The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
15
|
sequence length |
65
|
structure length |
65
|
Chain Sequence |
EQRITLKDYAMRFGQTKTAKDLGVYQSAINKAIHAGRKIFLTINADGSVYAEEVKDGEVKPFPSN
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
molecule tags |
Gene regulation/dna
|
molecule keywords |
DNA (5'-D(*TP*AP*TP*CP*GP*AP*TP*A)-3')
|
publication title |
Crystal structure of an engineered Cro monomer bound nonspecifically to DNA: possible implications for nonspecific binding by the wild-type protein.
pubmed rcsb |
source organism |
Enterobacteria phage lambda
|
total genus |
15
|
structure length |
65
|
sequence length |
65
|
ec nomenclature | |
pdb deposition date | 1998-04-23 |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Alpha Beta | 2-Layer Sandwich | CRO Repressor | CRO Repressor |
#chains in the Genus database with same CATH superfamily 2OVG A; 1D1M A; 3ORC A; 1D1L A; 2ECS A; 1ORC A; 6CRO A; 2CW1 A; 5CRO A; 2A63 A; 2ORC A; 1COP D; #chains in the Genus database with same CATH topology 5CRO A; 2LJX A; 1ORC A; 2M3L A; 2A63 A; 3ORC A; 1WU7 A; 4XR8 F; 3C6F A; 2ECS A; 2OVG A; 1D1M A; 1D1L A; 2FK4 A; 2LJZ A; 6CRO A; 4GIZ C; 2CW1 A; 2LJY A; 2ORC A; 1COP D; #chains in the Genus database with same CATH homology 5CRO A; 2LJX A; 1ORC A; 2M3L A; 2A63 A; 3ORC A; 1WU7 A; 4XR8 F; 2ECS A; 2OVG A; 1D1M A; 1D1L A; 2FK4 A; 2LJZ A; 6CRO A; 4GIZ C; 2CW1 A; 2LJY A; 2ORC A; 1COP D;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...