3OREA

Crystal structure of ttha0988 in space group p6522
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
492
structure length
481
Chain Sequence
VRGFYLRFGEGVSEEANRRALALAEALLRAPPPGLLDAVPAYGVLYLEYDPRRLSRGRLLRLLKGLRVVEIPVRYDGEDLPEVASRLGLSLEAVKALHQKPLYRVYALGFTPGFPFLAEVEPALRLPRKPHPRPRVPAHAVAVAGVQTGIYPLPSPGGWNLLGTSLVAVYDPHRETPFLLRPGDRVRFLEAEGPTPPEPRPLELLPEEPRLPALLVEEPGLMDLVVDGGRFLGGHLGLARSGPLDAPSARLANRLVGNGAGAPLLEFAYKGPVLTALRDLVAAFAGYGFVALLEGEEIPPGQSFLWPRGKTLRFRPRGPGVRGYLAVAGGLEVRPFLGSASPDLRGRIGRPLWAGDVLGLEALRPVRPGRAFPQRPLPEAFRLRLLPGPQEAFRALCSGPFRVARADRVGVELLGPEVPGGEGLSEPTPLGGVQVPPSGRPLVLLADKGSLGGYAKPALVDPRDLWLLGQARPGVEIHFTS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative uncharacterized protein TTHA0988
publication title The structure of TTHA0988 from Thermus thermophilus, a KipI-KipA homologue incorrectly annotated as an allophanate hydrolase
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Structural genomics, unknown function
total genus 119
structure length 481
sequence length 492
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-09-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02626 CT_A_B Carboxyltransferase domain, subdomain A and B
A PF02682 CT_C_D Carboxyltransferase domain, subdomain C and D
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.100.10 Mainly Beta Beta Barrel Cyclophilin Cyclophilin-like 3oreA02
2.40.100.10 Mainly Beta Beta Barrel Cyclophilin Cyclophilin-like 3oreA04
3.30.1360.40 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 3oreA01
5KURA 1QNHA 4J58A 3MMLA 1MZWA 1CWCA 3QYUA 1CWOA 2MVZA 5CBVA 4HY7A 1EK8A 5JVOA 1V9TA 4I9YA 1M9CA 3O7TA 1ZKFA 2MC9A 1XXAA 1ISTA 5CCNA 1W8LA 3VA7A 3CYSA 2PLUA 1AWQA 5KV7A 1IS1A 5KV6A 3K2CA 1B4BA 5CBWA 1M9DA 5LUDA 3FOEA 1WQHA 4N1RA 2RGRA 3ODIA 3JB9d 1NMKA 3NUHA 1CWIA 4TOTA 2QERA 1CWHA 2CMTA 2X25B 3ICIA 3RDCA 1ISEA 4GFQA 2POEA 3ERED 1AB4A 1AWRA 4S1EA 2OK3A 1X7FA 3LPXA 1CWJA 4ZSDA 2ZFZA 4YUMA 4N1SA 1XXBA 2OJUA 2NULA 1CWLA 1ZVUA 3K0MA 4FRVA 1WIHA 5KV3A 4ZSCA 4J5BA 1XWNA 2XCOA 1BGWA 3R54A 2N0TA 3FOFA 3RDAX 1M63C 4J5CX 2P5MA 4N1NA 5KUSA 3CAGA 1ZMFA 1E3BA 1YNDA 3RCGA 5KUUA 1BJTA 1B4AA 3K0PA 3K0RA 4CYHA 2HQJA 4YUOA 3LAJA 4J5EX 2BITX 2CYHA 1DYWA 1XQ7A 2HE9A 3QX3A 4DGEA 2Z6WA 5KV1A 1MIKA 5CBUA 3CYHA 3UCHA 1OCAA 1XYHA 5DUDA 1IHGA 1QOIA 4DGAA 2GW2A 3RCKX 4YUIA 1AK4A 3OPFA 3BKPA 1XXCA 2RMBA 2CK1A 1W8VA 5KUZA 5KV5A 4KB2A 3RCFA 2A2NA 1RMHA 1IIPA 3L4KA 4FRUA 3ICHA 4YUGA 1BCKA 5A0EA 3RDBA 2X7KA 1QNGA 3K0NA 3K0OA 2WLWA 1GE9A 2XCRB 3LAPA 4YUNA 5CJ9A 3FHZA 3EOVA 5KUOA 2ESLA 1WQFA 4N1MA 4DGBA 2IGVA 5KUQA 1VDNA 4DGCA 3RCIX 3OREA 1W8MA 2IGWA 4G0UA 3BO7A 4E1QA 1EH1A 5CCQA 1CWBA 2MS4A 3L4JA 2P0OA 3MMLB 3R49A 4O8HA 4DDQA 3BUEA 4FM9A 4YULA 4YUHA 2R99A 2ALFA 4J59A 2PHCB 2ZP2A 5KV2A 4YUPA 4N1PA 2Y3PA 4KDDA 2X2AA 1ZKCA 3RDDA 4N1OA 2WFJA 1CWMA 2RMAA 3RD9X 4G0WA 1F9NA 1XO7A 2POYA 1M9YA 4KAWX 1H0PA 2HQ6A 5CBTA 3BT8A 5KUWA 2RMCA 1AWTA 1FGLA 4EYVA 2HAQA 5KULA 1VBSA 1VBTA 2CFEA 2K7NA 5CCRA 1CLHA 3RFYA 1AWVA 4KB4A 2C3BA 4R3FA 1A58A 3S6MA 3K0QA 4YUJA 3R57A 2BIUX 4IPZA 4R3EA 2MZUA 3R59A 2X2CK 1WQGA 4JJMA 1CWAA 2X2DB 3V4GA 1MF8C 1AWUA 2WFIA 4J5AX 1J2AA 5JHEA 1AWSA 1M9XA 5KV0A 4LQWA 4N1QA 2FU0A 4DGDA 1E8KA 1CWFA 4KC6A 4S1JA 5F66A 3RCLA 2B71A 4J5DX 1Z81A 2X83B 3OEPA 4O8IA 1W74A 2CPLA 1CYNA 2OSEA 3T1UA 2RS4A 5KV4A 5KUNA 3R4GA 1DD5A 1C5FA 3R56A 4XNCA 1VAIA 1A33A 2XCQA 4JCPA 4YUKA 5KUVA 5CCSX 1M9FA 2XGYB 3ODLA 1LOPA 1M9EA 4G0VA 3PMPA 2KWAA 1CWKA 5CYHA 4J3NA
chains in the Genus database with same CATH superfamily
1I3QC 4WJ4A 2R92K 5KURA 5M3FK 1QNHA 4J58A 3T02A 4MEXA 1Y1WK 3TTGA 3MMLA 1MZWA 1TWCK 1CWCA 1WCMK 1SFOC 2A6EA 5C44K 2PA8L 3QYUA 4KATA 1CWOA 4QIWD 4C3HK 1IBAA 4Y7NK 2MVZA 4G7HA 5CBVA 4HY7A 3GTJK 3S1RC 1EK8A 3TFHA 5JVOA 5HL8A 1V9TA 2NVYK 4I9YA 4XLPA 3HOZK 3CQZA 1M9CA 3H0GK 3O7TA 1ZKFA 4A3JK 2MC9A 1XXAA 1ISTA 1TWCC 3GSIA 5C44C 5CCNA 3GIRA 4PAAA 3AD7C 1W8LA 3VA7A 3CYSA 2V6UA 2PLUA 1AWQA 3N3YA 4QJVB 5KV7A 4C3HC 1IS1A 5FLMK 2R92A 3EQLA 3S16C 4P5AA 4WILA 5KV6A 3K2CA 4OIOA 3N0BA 1Y1WA 1B4BA 5CBWA 5D4DA 1WCMA 1M9DA 5LUDA 3FOEA 1WQHA 1USOA 4N1RA 2RGRA 3ODIA 3JB9d 3M4OK 3S1QK 1NMKA 3NUHA 1L0WA 3GTJA 5FLMC 1CWIA 3RZOK 1JVIA 4TOTA 2QERA 1CWHA 2CMTA 2X25B 1R9TC 3ICIA 2NVYA 4P5BA 3RDCA 4JK1A 1ISEA 1WOPA 4C45A 3H0GA 5C3EC 1I6HK 4GT9A 4GFQA 2POEA 3ERED 1TWGK 2B63K 3S1QC 1AB4A 1INNA 1AWRA 1X31C 5IORA 4S1EA 2OK3A 3IPJA 1X7FA 3GTQK 1XPPA 3LPXA 3S14C 4A3DC 2WAQL 2JH3A 4A3CK 1J6XA 3TFJA 1TWFC 3GTOA 4BBRC 1CWJA 3HKZD 4ZSDA 1TWGC 1J6VA 3A8IA 2ZFZA 4YUMA 4N1SA 1TWAK 1JQWA 3GTKK 4A3GK 4C2MC 4BY1C 5L46A 1XXBA 1F7VA 2OJUA 1SMYA 2NULA 1PJ7A 2JA7K 4A3CC 4KM8A 2Y0SD 1HI9A 2B63A 1CWLA 1ZVUA 3HOXK 3GTLA 2PMZD 3K0MA 4FRVA 1WIHA 2JA8K 2R93C 5KV3A 5M5WK 3GTQA 4ZSCA 1EFWA 4OINA 2JA7C 4KMHA 2BE5A 2E2IK 3GEHA 2NVTK 4J5BA 4PABA 1XWNA 2XCOA 2CFAB 3HOXC 1BGWA 4OIQA 1IE0A 3R54A 2N0TA 4C3IK 1TWAA 3GTKA 3S0XA 3FOFA 3RDAX 2JA8C 1M63C 2O5IA 4BY7K 4J5CX 2P5MA 4KASA 3GTPC 3GTMA 4KMDA 2NNZA 2FQTA 4N1NA 5KUSA 3CAGA 1BDFA 2NVTC 2V6SA 2JA5K 1ZMFA 4KN7A 1E3BA 1YNDA 3RCGA 5KUUA 1I3QK 1BJTA 1B4AA 4C3IC 4A3FK 4BBSC 5C4XC 1XZPA 3GEIA 4AYBD 1ZYRA 2GSUA 4QIWL 3K0PA 5JFEA 3K0RA 4BY7C 2A6HA 4CYHA 2HQJA 4YUOA 3LAJA 1RU0A 2E2IA 4J5EX 2BITX 2A69A 1SFOK 2CYHA 5IOQA 2JA5C 2R7ZK 1DYWA 3G4AA 4LR2A 5IYDC 3S1MK 1XQ7A 2HE9A 3QX3A 4DGEA 4A3FC 3S1RK 2P8TA 1JOEA 2Z6WA 5C4JK 5KV1A 4KMAA 4NOIA 1MIKA 1J6WA 4XCHA 5CBUA 2JA5A 1VGXA 3CYHA 3UCHA 1OCAA 1XYHA 2R7ZC 5DUDA 1I3QA 1IHGA 1WSVA 3S1MC 4Q5SA 3FKIC 3S16K 1QOIA 2GAGC 3BP8C 4DGAA 3K7AC 2YU9K 5C4JC 1XZQA 1SFOA 5CHPA 1Y1VC 2GSNA 2GW2A 1ZXOA 3I4NK 3RCKX 2NVXC 4YUIA 3A8KA 2E2HC 3HOVC 1AK4A 3OPFA 3BKPA 1TWHC 3TFIA 1R9TK 4G7ZA 1XXCA 2YU9C 5C3EK 1TWCA 3AH5A 1IW7A 2WB1D 2RMBA 3I4NC 2CK1A 1W8VA 5KUZA 5KV5A 1KQ4A 5IYBC 4KB2A 4A3IC 1O29A 1WOOA 3RCFA 2A2NA 1RMHA 3JSTA 3SZZA 1IIPA 3HOWC 3L4KA 3HKZL 4FRUA 3ICHA 4WJ3M 1O28A 1VH2A 3S14K 4A3DK 3A8JA 4A3EK 1IQ0A 5IYCC 1TWFK 4BBRK 4YUGA 1BCKA 5A0EA 3RDBA 3S17C 2X7KA 1R9TA 1QNGA 3K0NA 2Y0SL 3K0OA 2WLWA 1G51A 1GE9A 2XCRB 3LAPA 4C2MK 4BY1K 4YUNA 5CJ9A 3FHZA 3EOVA 4A3EC 4A3BK 5KUOA 2ESLA 1ZX8A 1WQFA 4N1MA 4DGBA 3H3VL 2IGVA 5KUQA 3H3VD 3AQOA 2JA6K 1VDNA 2R93K 4DGCA 3RCIX 1VRQC 5M5XK 3OREA 1W8MA 4C3JC 1XZPB 1TWFA 3HOYK 2D6FC 2IGWA 4A3BC 1TWGA 3S2HC 4Y52K 3PO3K 4G0UA 3BO7A 1VLOA 4E1QA 4QJVA 2JA6C 1EH1A 4GTDA 5CCQA 4YFNA 3GTPK 1CWBA 2MS4A 3GTGC 2A68A 3L4JA 4AYBL 3HOYC 4X6AC 1HQMA 2CW0A 2P0OA 3MMLB 4Y52C 5IP9K 3PO3C 3N0CA 2R93A 3R49A 4O8HA 5E68A 4DDQA 3BUEA 4MEYA 4GTEA 5C4XK 5M5YK 3RZDC 4BBSK 4BXXC 2JA7A 4FM9A 4YULA 4YUHA 2ZUFA 4OIRA 2WAQD 1I50C 2R99A 1VJEA 3Q3QA 1ZBSA 4KM9A 5IOSA 4KN4A 5IP9C 5IYDK 4BKWA 2ALFA 4J59A 2PHCB 3GTPA 4GTAA 1PJ5A 3PO2C 2ZP2A 2NVQC 1O26A 3AD8C 2VUMC 3S2DK 4GZYA 5KV2A 4YUPA 2W7VA 4N1PA 5EGHA 3X27A 2Y3PA 4KDDA 2X2AA 4GTLA 1ZKCA 3RDDA 1K83C 3FKIK 4A3MC 4N1OA 3GTMC 3K7AK 2WFJA 5TJ3A 1CWMA 2RMAA 3BP3A 3S1NK 1BS2A 1YNNA 3RD9X 3ADAC 4ILDA 3S15C 4OIPA 1Y1VK 4G0WA 1F9NA 2NVXK 1XO7A 4YFXA 2EBBA 3S2DC 4A93K 2E2HK 3HOVK 2POYA 1ZQ1C 1TWHK 1YNJA 5FJ8K 4LK0A 1M9YA 3S1NC 4KAWX 3I4MC 5TMCA 1WORA 4LLGA 4LJZA 4Q4ZA 1H0PA 2O5JA 1C0AA 2HQ6A 5CBTA 2R7ZA 3BT8A 3G4CA 4RMFA 5IYBK 4A3IK 5KUWA 4A93C 2RMCA 1AWTA 3FKIA 3HOUK 3HOWK 2CFAA 2KA0A 3CQZC 1FGLA 4EYVA 2HAQA 1Y1VA 1O27A 5M3MK 5KULA 2NVXA 1VBSA 2GSOA 5IYCK 2R92C 1USMA 1VBTA 5IP7K 2E2HA 3S17K 2CFEA 1TWHA 1Y1WC 3HOUC 2K7NA 2YU9A 1WCMC 5CCRA 4BLBA 1CLHA 1EQRA 4Y7NC 4XSXA 3GTJC 1YX2A 4YG2A 3RFYA 3T01A 1AWVA 5IP7C 3DXJA 2NVYC 4KB4A 2PA8D 3HOZC 2C3BA 4R3FA 3H0GC 1A58A 4A3JC 4GTCA 4A3KK 4YFKA 3S6MA 1UV7A 3K0QA 2PMZL 4YUJA 3GTOK 4LK1A 4C3JK 3R57A 2BIUX 3M3YK 4IPZA 1IL2A 4R3EA 2MZUA 3S2HK 3R59A 4XSZA 2X2CK 1WQGA 4A3KC 4JJMA 3HXAA 3AQPA 3GTOC 3M4OC 3GTGK 1CWAA 2X2DB 2GAHC 3RZOC 3V4GA 3GTLK 1MF8C 1AWUA 3M3YC 4X6AK 2WFIA 3AD9C 4J5AX 1DCPA 1J2AA 3WODA 1I6HC 1WOSA 4M1XA 3RZDK 4BXXK 1O25A 5JHEA 1AWSA 1M9XA 1I6VA 4KARA 1F7UA 2B63C 4KMUA 4MQ9A 5KV0A 3GTLC 4LQWA 4N1QA 4FZBA 3KOPA 1I50K 4XLNA 2FU0A 1EI6A 1O2BA 4DGDA 3GTQC 2PPBA 1E8KA 1CWFA 1J98A 2JA6A 3SZYA 4KC6A 3T00A 3GTGA 4ZH4A 2ZUEA 3PO2K 2NVQK 4S1JA 5F66A 3RCLA 1DCHA 2B71A 1TWAC 3GDZA 3GTKC 1XZQB 2VUMK 4A3GC 4J5DX 1Z81A 1WSRA 4A3LK 4AH6A 1K83K 4GTBA 4A3MK 2E2JK 3GTMK 2X83B 3OEPA 4O8IA 1W74A 3GEEA 3S15K 2CPLA 4BLAA 1CYNA 2OSEA 3T1UA 1I50A 2RS4A 5KV4A 4GTFA 5KUNA 3R4GA 1DD5A 1C5FA 4A3LC 3R56A 4G0VA 4XNCA 1VAIA 2E2JC 1A33A 2E2IC 2XCQA 4JCPA 4YUKA 1V5VA 3I4MK 1F93A 5KUVA 2VUMA 5TMFA 5CCSX 5EGEA 1M9FA 2RH6A 2XGYB 1YCLA 2V6TA 3ODLA 1LOPA 1K83A 2WB1L 4LOWA 1M9EA 3PMPA 4O2DA 1DCOA 2KWAA 4P9SA 1CWKA 1O2FB 5CYHA 1O2AA 1O24A 3CQZK 4G7OA 4J3NA 1PJ6A 2FQOA 5IOTA 4LQYA
chains in the Genus database with same CATH topology
5KURA 1QNHA 4J58A 3MMLA 1MZWA 1CWCA 3QYUA 4KATA 1CWOA 2MVZA 5CBVA 4HY7A 1EK8A 5JVOA 1V9TA 4I9YA 3CQZA 1M9CA 3O7TA 1ZKFA 2MC9A 1XXAA 1ISTA 5CCNA 1W8LA 3VA7A 3CYSA 2PLUA 1AWQA 3N3YA 4C3HC 5KV7A 2R92A 1IS1A 4P5AA 5KV6A 3K2CA 3N0BA 1Y1WA 1B4BA 5CBWA 1WCMA 1M9DA 5LUDA 3FOEA 1WQHA 4N1RA 2RGRA 3ODIA 3JB9d 1NMKA 3NUHA 3GTJA 1CWIA 4TOTA 2QERA 1CWHA 2CMTA 2X25B 3ICIA 2NVYA 4P5BA 3RDCA 1ISEA 3H0GA 4GT9A 4GFQA 2POEA 3ERED 1AB4A 1AWRA 5IORA 4S1EA 2OK3A 1X7FA 3LPXA 2JH3A 3GTOA 1CWJA 4ZSDA 2ZFZA 4YUMA 4N1SA 4C2MC 1XXBA 2OJUA 2NULA 4KM8A 2B63A 1CWLA 1ZVUA 3GTLA 3K0MA 4FRVA 1WIHA 5KV3A 3GTQA 4ZSCA 4KMHA 4J5BA 1XWNA 2XCOA 2CFAB 1BGWA 3R54A 2N0TA 1TWAA 3GTKA 3S0XA 3FOFA 3RDAX 1M63C 4J5CX 2P5MA 4KASA 4KMDA 4N1NA 5KUSA 3CAGA 1ZMFA 1E3BA 1YNDA 3RCGA 5KUUA 4C3IC 1BJTA 1B4AA 2GSUA 3K0PA 5JFEA 3K0RA 4CYHA 2HQJA 4YUOA 3LAJA 2E2IA 4J5EX 2BITX 2CYHA 5IOQA 1DYWA 3G4AA 4LR2A 1XQ7A 2HE9A 3QX3A 4DGEA 2Z6WA 5KV1A 4KMAA 1MIKA 5CBUA 2JA5A 3CYHA 3UCHA 1OCAA 1XYHA 5DUDA 1I3QA 1IHGA 1QOIA 4DGAA 1SFOA 5CHPA 2GSNA 2GW2A 1ZXOA 3RCKX 4YUIA 1AK4A 3OPFA 3BKPA 1XXCA 1TWCA 3AH5A 2RMBA 2CK1A 1W8VA 5KUZA 5KV5A 1KQ4A 4KB2A 1O29A 3RCFA 2A2NA 1RMHA 1IIPA 3L4KA 4FRUA 3ICHA 1O28A 4YUGA 1BCKA 5A0EA 3RDBA 2X7KA 1R9TA 1QNGA 3K0NA 3K0OA 2WLWA 1GE9A 2XCRB 3LAPA 4YUNA 5CJ9A 3FHZA 3EOVA 5KUOA 2ESLA 1WQFA 4N1MA 4DGBA 2IGVA 5KUQA 3AQOA 1VDNA 4DGCA 3RCIX 3OREA 1W8MA 4C3JC 1TWFA 2IGWA 1TWGA 4G0UA 3BO7A 4E1QA 1EH1A 4GTDA 5CCQA 1CWBA 2MS4A 3L4JA 2P0OA 3MMLB 3N0CA 2R93A 3R49A 4O8HA 4DDQA 3BUEA 4GTEA 2JA7A 4FM9A 4YULA 4YUHA 2R99A 3Q3QA 1ZBSA 4KM9A 5IOSA 4BKWA 2ALFA 4J59A 2PHCB 3GTPA 4GTAA 2ZP2A 1O26A 5KV2A 4YUPA 4N1PA 5EGHA 2Y3PA 4KDDA 2X2AA 4GTLA 1ZKCA 3RDDA 4N1OA 2WFJA 5TJ3A 1CWMA 2RMAA 3RD9X 4ILDA 4G0WA 1F9NA 1XO7A 2POYA 1M9YA 4KAWX 1H0PA 2HQ6A 5CBTA 2R7ZA 3BT8A 3G4CA 5KUWA 2RMCA 1AWTA 3FKIA 2CFAA 1FGLA 4EYVA 2HAQA 1Y1VA 1O27A 5KULA 2NVXA 1VBSA 2GSOA 1VBTA 2E2HA 2CFEA 1TWHA 2K7NA 2YU9A 5CCRA 4BLBA 1CLHA 3RFYA 1AWVA 4KB4A 2C3BA 4R3FA 1A58A 4GTCA 3S6MA 3K0QA 4YUJA 3R57A 2BIUX 4IPZA 4R3EA 2MZUA 3R59A 2X2CK 1WQGA 4JJMA 3AQPA 1CWAA 2X2DB 3V4GA 1MF8C 1AWUA 2WFIA 4J5AX 1J2AA 4M1XA 1O25A 5JHEA 1AWSA 1M9XA 4KARA 5KV0A 4LQWA 4N1QA 4FZBA 2FU0A 1O2BA 4DGDA 1E8KA 1CWFA 2JA6A 4KC6A 3GTGA 4S1JA 5F66A 3RCLA 2B71A 4J5DX 1Z81A 4GTBA 2X83B 3OEPA 4O8IA 1W74A 2CPLA 4BLAA 1CYNA 2OSEA 3T1UA 1I50A 2RS4A 5KV4A 4GTFA 5KUNA 3R4GA 1DD5A 1C5FA 3R56A 4XNCA 1VAIA 1A33A 2XCQA 4JCPA 4YUKA 5KUVA 2VUMA 5CCSX 5EGEA 1M9FA 2RH6A 2XGYB 3ODLA 1LOPA 1K83A 1M9EA 3PMPA 4G0VA 3GTMA 2KWAA 1CWKA 1O2AA 5CYHA 1O24A 4J3NA 5IOTA 4LQYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5KUR A;  1QNH A;  4J58 A;  3MML A;  1MZW A;  1CWC A;  3QYU A;  1CWO A;  2MVZ A;  5CBV A;  4HY7 A;  1EK8 A;  5JVO A;  1V9T A;  4I9Y A;  1M9C A;  3O7T A;  1ZKF A;  2MC9 A;  1XXA A;  1IST A;  5CCN A;  1W8L A;  3VA7 A;  3CYS A;  2PLU A;  1AWQ A;  5KV7 A;  1IS1 A;  5KV6 A;  3K2C A;  1B4B A;  5CBW A;  1M9D A;  5LUD A;  3FOE A;  1WQH A;  4N1R A;  2RGR A;  3ODI A;  3JB9 d;  1NMK A;  3NUH A;  1CWI A;  4TOT A;  2QER A;  1CWH A;  2CMT A;  2X25 B;  3ICI A;  3RDC A;  1ISE A;  4GFQ A;  2POE A;  3ERE D;  1AB4 A;  1AWR A;  4S1E A;  2OK3 A;  1X7F A;  3LPX A;  1CWJ A;  4ZSD A;  2ZFZ A;  4YUM A;  4N1S A;  1XXB A;  2OJU A;  2NUL A;  1CWL A;  1ZVU A;  3K0M A;  4FRV A;  1WIH A;  5KV3 A;  4ZSC A;  4J5B A;  1XWN A;  2XCO A;  1BGW A;  3R54 A;  2N0T A;  3FOF A;  3RDA X;  1M63 C;  4J5C X;  2P5M A;  4N1N A;  5KUS A;  3CAG A;  1ZMF A;  1E3B A;  1YND A;  3RCG A;  5KUU A;  1BJT A;  1B4A A;  3K0P A;  3K0R A;  4CYH A;  2HQJ A;  4YUO A;  3LAJ A;  4J5E X;  2BIT X;  2CYH A;  1DYW A;  1XQ7 A;  2HE9 A;  3QX3 A;  4DGE A;  2Z6W A;  5KV1 A;  1MIK A;  5CBU A;  3CYH A;  3UCH A;  1OCA A;  1XYH A;  5DUD A;  1IHG A;  1QOI A;  4DGA A;  2GW2 A;  3RCK X;  4YUI A;  1AK4 A;  3OPF A;  3BKP A;  1XXC A;  2RMB A;  2CK1 A;  1W8V A;  5KUZ A;  5KV5 A;  4KB2 A;  3RCF A;  2A2N A;  1RMH A;  1IIP A;  3L4K A;  4FRU A;  3ICH A;  4YUG A;  1BCK A;  5A0E A;  3RDB A;  2X7K A;  1QNG A;  3K0N A;  3K0O A;  2WLW A;  1GE9 A;  2XCR B;  3LAP A;  4YUN A;  5CJ9 A;  3FHZ A;  3EOV A;  5KUO A;  2ESL A;  1WQF A;  4N1M A;  4DGB A;  2IGV A;  5KUQ A;  1VDN A;  4DGC A;  3RCI X;  3ORE A;  1W8M A;  2IGW A;  4G0U A;  3BO7 A;  4E1Q A;  1EH1 A;  5CCQ A;  1CWB A;  2MS4 A;  3L4J A;  2P0O A;  3MML B;  3R49 A;  4O8H A;  4DDQ A;  3BUE A;  4FM9 A;  4YUL A;  4YUH A;  2R99 A;  2ALF A;  4J59 A;  2PHC B;  2ZP2 A;  5KV2 A;  4YUP A;  4N1P A;  2Y3P A;  4KDD A;  2X2A A;  1ZKC A;  3RDD A;  4N1O A;  2WFJ A;  1CWM A;  2RMA A;  3RD9 X;  4G0W A;  1F9N A;  1XO7 A;  2POY A;  1M9Y A;  4KAW X;  1H0P A;  2HQ6 A;  5CBT A;  3BT8 A;  5KUW A;  2RMC A;  1AWT A;  1FGL A;  4EYV A;  2HAQ A;  5KUL A;  1VBS A;  1VBT A;  2CFE A;  2K7N A;  5CCR A;  1CLH A;  3RFY A;  1AWV A;  4KB4 A;  2C3B A;  4R3F A;  1A58 A;  3S6M A;  3K0Q A;  4YUJ A;  3R57 A;  2BIU X;  4IPZ A;  4R3E A;  2MZU A;  3R59 A;  2X2C K;  1WQG A;  4JJM A;  1CWA A;  2X2D B;  3V4G A;  1MF8 C;  1AWU A;  2WFI A;  4J5A X;  1J2A A;  5JHE A;  1AWS A;  1M9X A;  5KV0 A;  4LQW A;  4N1Q A;  2FU0 A;  4DGD A;  1E8K A;  1CWF A;  4KC6 A;  4S1J A;  5F66 A;  3RCL A;  2B71 A;  4J5D X;  1Z81 A;  2X83 B;  3OEP A;  4O8I A;  1W74 A;  2CPL A;  1CYN A;  2OSE A;  3T1U A;  2RS4 A;  5KV4 A;  5KUN A;  3R4G A;  1DD5 A;  1C5F A;  3R56 A;  4XNC A;  1VAI A;  1A33 A;  2XCQ A;  4JCP A;  4YUK A;  5KUV A;  5CCS X;  1M9F A;  2XGY B;  3ODL A;  1LOP A;  1M9E A;  4G0V A;  3PMP A;  2KWA A;  1CWK A;  5CYH A;  4J3N A; 
#chains in the Genus database with same CATH topology
 1I3Q C;  4WJ4 A;  2R92 K;  5KUR A;  5M3F K;  1QNH A;  4J58 A;  3T02 A;  4MEX A;  1Y1W K;  3TTG A;  3MML A;  1MZW A;  1TWC K;  1CWC A;  1WCM K;  1SFO C;  2A6E A;  5C44 K;  2PA8 L;  3QYU A;  4KAT A;  1CWO A;  4QIW D;  4C3H K;  1IBA A;  4Y7N K;  2MVZ A;  4G7H A;  5CBV A;  4HY7 A;  3GTJ K;  3S1R C;  1EK8 A;  3TFH A;  5JVO A;  5HL8 A;  1V9T A;  2NVY K;  4I9Y A;  4XLP A;  3HOZ K;  3CQZ A;  1M9C A;  3H0G K;  3O7T A;  1ZKF A;  4A3J K;  2MC9 A;  1XXA A;  1IST A;  1TWC C;  3GSI A;  5C44 C;  5CCN A;  3GIR A;  4PAA A;  3AD7 C;  1W8L A;  3VA7 A;  3CYS A;  2V6U A;  2PLU A;  1AWQ A;  3N3Y A;  4QJV B;  5KV7 A;  4C3H C;  1IS1 A;  5FLM K;  2R92 A;  3EQL A;  3S16 C;  4P5A A;  4WIL A;  5KV6 A;  3K2C A;  4OIO A;  3N0B A;  1Y1W A;  1B4B A;  5CBW A;  5D4D A;  1WCM A;  1M9D A;  5LUD A;  3FOE A;  1WQH A;  1USO A;  4N1R A;  2RGR A;  3ODI A;  3JB9 d;  3M4O K;  3S1Q K;  1NMK A;  3NUH A;  1L0W A;  3GTJ A;  5FLM C;  1CWI A;  3RZO K;  1JVI A;  4TOT A;  2QER A;  1CWH A;  2CMT A;  2X25 B;  1R9T C;  3ICI A;  2NVY A;  4P5B A;  3RDC A;  4JK1 A;  1ISE A;  1WOP A;  4C45 A;  3H0G A;  5C3E C;  1I6H K;  4GT9 A;  4GFQ A;  2POE A;  3ERE D;  1TWG K;  2B63 K;  3S1Q C;  1AB4 A;  1INN A;  1AWR A;  1X31 C;  5IOR A;  4S1E A;  2OK3 A;  3IPJ A;  1X7F A;  3GTQ K;  1XPP A;  3LPX A;  3S14 C;  4A3D C;  2WAQ L;  2JH3 A;  4A3C K;  1J6X A;  3TFJ A;  1TWF C;  3GTO A;  4BBR C;  1CWJ A;  3HKZ D;  4ZSD A;  1TWG C;  1J6V A;  3A8I A;  2ZFZ A;  4YUM A;  4N1S A;  1TWA K;  1JQW A;  3GTK K;  4A3G K;  4C2M C;  4BY1 C;  5L46 A;  1XXB A;  1F7V A;  2OJU A;  1SMY A;  2NUL A;  1PJ7 A;  2JA7 K;  4A3C C;  4KM8 A;  2Y0S D;  1HI9 A;  2B63 A;  1CWL A;  1ZVU A;  3HOX K;  3GTL A;  2PMZ D;  3K0M A;  4FRV A;  1WIH A;  2JA8 K;  2R93 C;  5KV3 A;  5M5W K;  3GTQ A;  4ZSC A;  1EFW A;  4OIN A;  2JA7 C;  4KMH A;  2BE5 A;  2E2I K;  3GEH A;  2NVT K;  4J5B A;  4PAB A;  1XWN A;  2XCO A;  2CFA B;  3HOX C;  1BGW A;  4OIQ A;  1IE0 A;  3R54 A;  2N0T A;  4C3I K;  1TWA A;  3GTK A;  3S0X A;  3FOF A;  3RDA X;  2JA8 C;  1M63 C;  2O5I A;  4BY7 K;  4J5C X;  2P5M A;  4KAS A;  3GTP C;  3GTM A;  4KMD A;  2NNZ A;  2FQT A;  4N1N A;  5KUS A;  3CAG A;  1BDF A;  2NVT C;  2V6S A;  2JA5 K;  1ZMF A;  4KN7 A;  1E3B A;  1YND A;  3RCG A;  5KUU A;  1I3Q K;  1BJT A;  1B4A A;  4C3I C;  4A3F K;  4BBS C;  5C4X C;  1XZP A;  3GEI A;  4AYB D;  1ZYR A;  2GSU A;  4QIW L;  3K0P A;  5JFE A;  3K0R A;  4BY7 C;  2A6H A;  4CYH A;  2HQJ A;  4YUO A;  3LAJ A;  1RU0 A;  2E2I A;  4J5E X;  2BIT X;  2A69 A;  1SFO K;  2CYH A;  5IOQ A;  2JA5 C;  2R7Z K;  1DYW A;  3G4A A;  4LR2 A;  5IYD C;  3S1M K;  1XQ7 A;  2HE9 A;  3QX3 A;  4DGE A;  4A3F C;  3S1R K;  2P8T A;  1JOE A;  2Z6W A;  5C4J K;  5KV1 A;  4KMA A;  4NOI A;  1MIK A;  1J6W A;  4XCH A;  5CBU A;  2JA5 A;  1VGX A;  3CYH A;  3UCH A;  1OCA A;  1XYH A;  2R7Z C;  5DUD A;  1I3Q A;  1IHG A;  1WSV A;  3S1M C;  4Q5S A;  3FKI C;  3S16 K;  1QOI A;  2GAG C;  3BP8 C;  4DGA A;  3K7A C;  2YU9 K;  5C4J C;  1XZQ A;  1SFO A;  5CHP A;  1Y1V C;  2GSN A;  2GW2 A;  1ZXO A;  3I4N K;  3RCK X;  2NVX C;  4YUI A;  3A8K A;  2E2H C;  3HOV C;  1AK4 A;  3OPF A;  3BKP A;  1TWH C;  3TFI A;  1R9T K;  4G7Z A;  1XXC A;  2YU9 C;  5C3E K;  1TWC A;  3AH5 A;  1IW7 A;  2WB1 D;  2RMB A;  3I4N C;  2CK1 A;  1W8V A;  5KUZ A;  5KV5 A;  1KQ4 A;  5IYB C;  4KB2 A;  4A3I C;  1O29 A;  1WOO A;  3RCF A;  2A2N A;  1RMH A;  3JST A;  3SZZ A;  1IIP A;  3HOW C;  3L4K A;  3HKZ L;  4FRU A;  3ICH A;  4WJ3 M;  1O28 A;  1VH2 A;  3S14 K;  4A3D K;  3A8J A;  4A3E K;  1IQ0 A;  5IYC C;  1TWF K;  4BBR K;  4YUG A;  1BCK A;  5A0E A;  3RDB A;  3S17 C;  2X7K A;  1R9T A;  1QNG A;  3K0N A;  2Y0S L;  3K0O A;  2WLW A;  1G51 A;  1GE9 A;  2XCR B;  3LAP A;  4C2M K;  4BY1 K;  4YUN A;  5CJ9 A;  3FHZ A;  3EOV A;  4A3E C;  4A3B K;  5KUO A;  2ESL A;  1ZX8 A;  1WQF A;  4N1M A;  4DGB A;  3H3V L;  2IGV A;  5KUQ A;  3H3V D;  3AQO A;  2JA6 K;  1VDN A;  2R93 K;  4DGC A;  3RCI X;  1VRQ C;  5M5X K;  3ORE A;  1W8M A;  4C3J C;  1XZP B;  1TWF A;  3HOY K;  2D6F C;  2IGW A;  4A3B C;  1TWG A;  3S2H C;  4Y52 K;  3PO3 K;  4G0U A;  3BO7 A;  1VLO A;  4E1Q A;  4QJV A;  2JA6 C;  1EH1 A;  4GTD A;  5CCQ A;  4YFN A;  3GTP K;  1CWB A;  2MS4 A;  3GTG C;  2A68 A;  3L4J A;  4AYB L;  3HOY C;  4X6A C;  1HQM A;  2CW0 A;  2P0O A;  3MML B;  4Y52 C;  5IP9 K;  3PO3 C;  3N0C A;  2R93 A;  3R49 A;  4O8H A;  5E68 A;  4DDQ A;  3BUE A;  4MEY A;  4GTE A;  5C4X K;  5M5Y K;  3RZD C;  4BBS K;  4BXX C;  2JA7 A;  4FM9 A;  4YUL A;  4YUH A;  2ZUF A;  4OIR A;  2WAQ D;  1I50 C;  2R99 A;  1VJE A;  3Q3Q A;  1ZBS A;  4KM9 A;  5IOS A;  4KN4 A;  5IP9 C;  5IYD K;  4BKW A;  2ALF A;  4J59 A;  2PHC B;  3GTP A;  4GTA A;  1PJ5 A;  3PO2 C;  2ZP2 A;  2NVQ C;  1O26 A;  3AD8 C;  2VUM C;  3S2D K;  4GZY A;  5KV2 A;  4YUP A;  2W7V A;  4N1P A;  5EGH A;  3X27 A;  2Y3P A;  4KDD A;  2X2A A;  4GTL A;  1ZKC A;  3RDD A;  1K83 C;  3FKI K;  4A3M C;  4N1O A;  3GTM C;  3K7A K;  2WFJ A;  5TJ3 A;  1CWM A;  2RMA A;  3BP3 A;  3S1N K;  1BS2 A;  1YNN A;  3RD9 X;  3ADA C;  4ILD A;  3S15 C;  4OIP A;  1Y1V K;  4G0W A;  1F9N A;  2NVX K;  1XO7 A;  4YFX A;  2EBB A;  3S2D C;  4A93 K;  2E2H K;  3HOV K;  2POY A;  1ZQ1 C;  1TWH K;  1YNJ A;  5FJ8 K;  4LK0 A;  1M9Y A;  3S1N C;  4KAW X;  3I4M C;  5TMC A;  1WOR A;  4LLG A;  4LJZ A;  4Q4Z A;  1H0P A;  2O5J A;  1C0A A;  2HQ6 A;  5CBT A;  2R7Z A;  3BT8 A;  3G4C A;  4RMF A;  5IYB K;  4A3I K;  5KUW A;  4A93 C;  2RMC A;  1AWT A;  3FKI A;  3HOU K;  3HOW K;  2CFA A;  2KA0 A;  3CQZ C;  1FGL A;  4EYV A;  2HAQ A;  1Y1V A;  1O27 A;  5M3M K;  5KUL A;  2NVX A;  1VBS A;  2GSO A;  5IYC K;  2R92 C;  1USM A;  1VBT A;  5IP7 K;  2E2H A;  3S17 K;  2CFE A;  1TWH A;  1Y1W C;  3HOU C;  2K7N A;  2YU9 A;  1WCM C;  5CCR A;  4BLB A;  1CLH A;  1EQR A;  4Y7N C;  4XSX A;  3GTJ C;  1YX2 A;  4YG2 A;  3RFY A;  3T01 A;  1AWV A;  5IP7 C;  3DXJ A;  2NVY C;  4KB4 A;  2PA8 D;  3HOZ C;  2C3B A;  4R3F A;  3H0G C;  1A58 A;  4A3J C;  4GTC A;  4A3K K;  4YFK A;  3S6M A;  1UV7 A;  3K0Q A;  2PMZ L;  4YUJ A;  3GTO K;  4LK1 A;  4C3J K;  3R57 A;  2BIU X;  3M3Y K;  4IPZ A;  1IL2 A;  4R3E A;  2MZU A;  3S2H K;  3R59 A;  4XSZ A;  2X2C K;  1WQG A;  4A3K C;  4JJM A;  3HXA A;  3AQP A;  3GTO C;  3M4O C;  3GTG K;  1CWA A;  2X2D B;  2GAH C;  3RZO C;  3V4G A;  3GTL K;  1MF8 C;  1AWU A;  3M3Y C;  4X6A K;  2WFI A;  3AD9 C;  4J5A X;  1DCP A;  1J2A A;  3WOD A;  1I6H C;  1WOS A;  4M1X A;  3RZD K;  4BXX K;  1O25 A;  5JHE A;  1AWS A;  1M9X A;  1I6V A;  4KAR A;  1F7U A;  2B63 C;  4KMU A;  4MQ9 A;  5KV0 A;  3GTL C;  4LQW A;  4N1Q A;  4FZB A;  3KOP A;  1I50 K;  4XLN A;  2FU0 A;  1EI6 A;  1O2B A;  4DGD A;  3GTQ C;  2PPB A;  1E8K A;  1CWF A;  1J98 A;  2JA6 A;  3SZY A;  4KC6 A;  3T00 A;  3GTG A;  4ZH4 A;  2ZUE A;  3PO2 K;  2NVQ K;  4S1J A;  5F66 A;  3RCL A;  1DCH A;  2B71 A;  1TWA C;  3GDZ A;  3GTK C;  1XZQ B;  2VUM K;  4A3G C;  4J5D X;  1Z81 A;  1WSR A;  4A3L K;  4AH6 A;  1K83 K;  4GTB A;  4A3M K;  2E2J K;  3GTM K;  2X83 B;  3OEP A;  4O8I A;  1W74 A;  3GEE A;  3S15 K;  2CPL A;  4BLA A;  1CYN A;  2OSE A;  3T1U A;  1I50 A;  2RS4 A;  5KV4 A;  4GTF A;  5KUN A;  3R4G A;  1DD5 A;  1C5F A;  4A3L C;  3R56 A;  4G0V A;  4XNC A;  1VAI A;  2E2J C;  1A33 A;  2E2I C;  2XCQ A;  4JCP A;  4YUK A;  1V5V A;  3I4M K;  1F93 A;  5KUV A;  2VUM A;  5TMF A;  5CCS X;  5EGE A;  1M9F A;  2RH6 A;  2XGY B;  1YCL A;  2V6T A;  3ODL A;  1LOP A;  1K83 A;  2WB1 L;  4LOW A;  1M9E A;  3PMP A;  4O2D A;  1DCO A;  2KWA A;  4P9S A;  1CWK A;  1O2F B;  5CYH A;  1O2A A;  1O24 A;  3CQZ K;  4G7O A;  4J3N A;  1PJ6 A;  2FQO A;  5IOT A;  4LQY A; 
#chains in the Genus database with same CATH homology
 5KUR A;  1QNH A;  4J58 A;  3MML A;  1MZW A;  1CWC A;  3QYU A;  4KAT A;  1CWO A;  2MVZ A;  5CBV A;  4HY7 A;  1EK8 A;  5JVO A;  1V9T A;  4I9Y A;  3CQZ A;  1M9C A;  3O7T A;  1ZKF A;  2MC9 A;  1XXA A;  1IST A;  5CCN A;  1W8L A;  3VA7 A;  3CYS A;  2PLU A;  1AWQ A;  3N3Y A;  4C3H C;  5KV7 A;  2R92 A;  1IS1 A;  4P5A A;  5KV6 A;  3K2C A;  3N0B A;  1Y1W A;  1B4B A;  5CBW A;  1WCM A;  1M9D A;  5LUD A;  3FOE A;  1WQH A;  4N1R A;  2RGR A;  3ODI A;  3JB9 d;  1NMK A;  3NUH A;  3GTJ A;  1CWI A;  4TOT A;  2QER A;  1CWH A;  2CMT A;  2X25 B;  3ICI A;  2NVY A;  4P5B A;  3RDC A;  1ISE A;  3H0G A;  4GT9 A;  4GFQ A;  2POE A;  3ERE D;  1AB4 A;  1AWR A;  5IOR A;  4S1E A;  2OK3 A;  1X7F A;  3LPX A;  2JH3 A;  3GTO A;  1CWJ A;  4ZSD A;  2ZFZ A;  4YUM A;  4N1S A;  4C2M C;  1XXB A;  2OJU A;  2NUL A;  4KM8 A;  2B63 A;  1CWL A;  1ZVU A;  3GTL A;  3K0M A;  4FRV A;  1WIH A;  5KV3 A;  3GTQ A;  4ZSC A;  4KMH A;  4J5B A;  1XWN A;  2XCO A;  2CFA B;  1BGW A;  3R54 A;  2N0T A;  1TWA A;  3GTK A;  3S0X A;  3FOF A;  3RDA X;  1M63 C;  4J5C X;  2P5M A;  4KAS A;  4KMD A;  4N1N A;  5KUS A;  3CAG A;  1ZMF A;  1E3B A;  1YND A;  3RCG A;  5KUU A;  4C3I C;  1BJT A;  1B4A A;  2GSU A;  3K0P A;  5JFE A;  3K0R A;  4CYH A;  2HQJ A;  4YUO A;  3LAJ A;  2E2I A;  4J5E X;  2BIT X;  2CYH A;  5IOQ A;  1DYW A;  3G4A A;  4LR2 A;  1XQ7 A;  2HE9 A;  3QX3 A;  4DGE A;  2Z6W A;  5KV1 A;  4KMA A;  1MIK A;  5CBU A;  2JA5 A;  3CYH A;  3UCH A;  1OCA A;  1XYH A;  5DUD A;  1I3Q A;  1IHG A;  1QOI A;  4DGA A;  1SFO A;  5CHP A;  2GSN A;  2GW2 A;  1ZXO A;  3RCK X;  4YUI A;  1AK4 A;  3OPF A;  3BKP A;  1XXC A;  1TWC A;  3AH5 A;  2RMB A;  2CK1 A;  1W8V A;  5KUZ A;  5KV5 A;  1KQ4 A;  4KB2 A;  1O29 A;  3RCF A;  2A2N A;  1RMH A;  1IIP A;  3L4K A;  4FRU A;  3ICH A;  1O28 A;  4YUG A;  1BCK A;  5A0E A;  3RDB A;  2X7K A;  1R9T A;  1QNG A;  3K0N A;  3K0O A;  2WLW A;  1GE9 A;  2XCR B;  3LAP A;  4YUN A;  5CJ9 A;  3FHZ A;  3EOV A;  5KUO A;  2ESL A;  1WQF A;  4N1M A;  4DGB A;  2IGV A;  5KUQ A;  3AQO A;  1VDN A;  4DGC A;  3RCI X;  3ORE A;  1W8M A;  4C3J C;  1TWF A;  2IGW A;  1TWG A;  4G0U A;  3BO7 A;  4E1Q A;  1EH1 A;  4GTD A;  5CCQ A;  1CWB A;  2MS4 A;  3L4J A;  2P0O A;  3MML B;  3N0C A;  2R93 A;  3R49 A;  4O8H A;  4DDQ A;  3BUE A;  4GTE A;  2JA7 A;  4FM9 A;  4YUL A;  4YUH A;  2R99 A;  3Q3Q A;  1ZBS A;  4KM9 A;  5IOS A;  4BKW A;  2ALF A;  4J59 A;  2PHC B;  3GTP A;  4GTA A;  2ZP2 A;  1O26 A;  5KV2 A;  4YUP A;  4N1P A;  5EGH A;  2Y3P A;  4KDD A;  2X2A A;  4GTL A;  1ZKC A;  3RDD A;  4N1O A;  2WFJ A;  5TJ3 A;  1CWM A;  2RMA A;  3RD9 X;  4ILD A;  4G0W A;  1F9N A;  1XO7 A;  2POY A;  1M9Y A;  4KAW X;  1H0P A;  2HQ6 A;  5CBT A;  2R7Z A;  3BT8 A;  3G4C A;  5KUW A;  2RMC A;  1AWT A;  3FKI A;  2CFA A;  1FGL A;  4EYV A;  2HAQ A;  1Y1V A;  1O27 A;  5KUL A;  2NVX A;  1VBS A;  2GSO A;  1VBT A;  2E2H A;  2CFE A;  1TWH A;  2K7N A;  2YU9 A;  5CCR A;  4BLB A;  1CLH A;  3RFY A;  1AWV A;  4KB4 A;  2C3B A;  4R3F A;  1A58 A;  4GTC A;  3S6M A;  3K0Q A;  4YUJ A;  3R57 A;  2BIU X;  4IPZ A;  4R3E A;  2MZU A;  3R59 A;  2X2C K;  1WQG A;  4JJM A;  3AQP A;  1CWA A;  2X2D B;  3V4G A;  1MF8 C;  1AWU A;  2WFI A;  4J5A X;  1J2A A;  4M1X A;  1O25 A;  5JHE A;  1AWS A;  1M9X A;  4KAR A;  5KV0 A;  4LQW A;  4N1Q A;  4FZB A;  2FU0 A;  1O2B A;  4DGD A;  1E8K A;  1CWF A;  2JA6 A;  4KC6 A;  3GTG A;  4S1J A;  5F66 A;  3RCL A;  2B71 A;  4J5D X;  1Z81 A;  4GTB A;  2X83 B;  3OEP A;  4O8I A;  1W74 A;  2CPL A;  4BLA A;  1CYN A;  2OSE A;  3T1U A;  1I50 A;  2RS4 A;  5KV4 A;  4GTF A;  5KUN A;  3R4G A;  1DD5 A;  1C5F A;  3R56 A;  4XNC A;  1VAI A;  1A33 A;  2XCQ A;  4JCP A;  4YUK A;  5KUV A;  2VUM A;  5CCS X;  5EGE A;  1M9F A;  2RH6 A;  2XGY B;  3ODL A;  1LOP A;  1K83 A;  1M9E A;  3PMP A;  4G0V A;  3GTM A;  2KWA A;  1CWK A;  1O2A A;  5CYH A;  1O24 A;  4J3N A;  5IOT A;  4LQY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...