3OREA

Crystal structure of ttha0988 in space group p6522
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
492
structure length
481
Chain Sequence
b'VRGFYLRFGEGVSEEANRRALALAEALLRAPPPGLLDAVPAYGVLYLEYDPRRLSRGRLLRLLKGLRVVEIPVRYDGEDLPEVASRLGLSLEAVKALHQKPLYRVYALGFTPGFPFLAEVEPALRLPRKPHPRPRVPAHAVAVAGVQTGIYPLPSPGGWNLLGTSLVAVYDPHRETPFLLRPGDRVRFLEAEGPTPPEPRPLELLPEEPRLPALLVEEPGLMDLVVDGGRFLGGHLGLARSGPLDAPSARLANRLVGNGAGAPLLEFAYKGPVLTALRDLVAAFAGYGFVALLEGEEIPPGQSFLWPRGKTLRFRPRGPGVRGYLAVAGGLEVRPFLGSASPDLRGRIGRPLWAGDVLGLEALRPVRPGRAFPQRPLPEAFRLRLLPGPQEAFRALCSGPFRVARADRVGVELLGPEVPGGEGLSEPTPLGGVQVPPSGRPLVLLADKGSLGGYAKPALVDPRDLWLLGQARPGVEIHFTS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative uncharacterized protein TTHA0988
publication title The structure of TTHA0988 from Thermus thermophilus, a KipI-KipA homologue incorrectly annotated as an allophanate hydrolase
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Structural genomics, unknown function
total genus 119
structure length 481
sequence length 492
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-09-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02626 CT_A_B Carboxyltransferase domain, subdomain A and B
A PF02682 CT_C_D Carboxyltransferase domain, subdomain C and D
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.100.10 Mainly Beta Beta Barrel Cyclophilin Cyclophilin-like 3oreA02
2.40.100.10 Mainly Beta Beta Barrel Cyclophilin Cyclophilin-like 3oreA04
3.30.1360.40 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 3oreA01
2PHCB 4YUGA 3S6MA 2WFJA 5JVOA 3RCIX 1E8KA 2RS4A 1XQ7A 1XXBA 1IIPA 1QOIA 4J59A 4HY7A 3RFYA 2XGYB 4S1EA 5CBWA 5LUDA 1FGLA 3K0MA 3QX3A 2HE9A 1CWMA 4YUJA 4J5EX 2X25B 2RMCA 2PLUA 3RDAX 3R4GA 1QNHA 1YNDA 2CK1A 3L4KA 4G0UA 3JB9d 2X7KA 5KV5A 3ICHA 5KV1A 4CYHA 4YULA 4YUKA 2XCOA 1CWBA 2P5MA 1LOPA 1BJTA 2X2DB 1AWTA 4O8IA 2IGVA 1WIHA 2OSEA 2K7NA 3V4GA 4DGCA 3OEPA 3R57A 1BGWA 3BKPA 4N1SA 1XXAA 1IS1A 5CBUA 2CYHA 2WFIA 1AWQA 3FOEA 2ZFZA 1CWLA 3R59A 2ESLA 1M9DA 2Z6WA 1MIKA 4ZSCA 1CWAA 4N1QA 1CWFA 2POEA 5KUWA 3K0RA 1RMHA 4KDDA 3FOFA 3K0PA 3NUHA 3CYHA 5CCRA 1CWHA 4I9YA 2OK3A 4JCPA 1H0PA 4DDQA 3BUEA 1M9EA 1GE9A 1ISEA 1AWSA 4G0WA 4N1RA 1AWUA 3OREA 2MVZA 3RCFA 4YUOA 4N1NA 1E3BA 4R3FA 3FHZA 2KWAA 1W8VA 5KV3A 1CWJA 1ZMFA 4J5DX 5KUNA 1X7FA 4TOTA 1WQGA 5KV4A 1MF8C 3CYSA 1Z81A 4G0VA 4KC6A 5CYHA 1EH1A 1ZVUA 1C5FA 1AK4A 1AWRA 4J3NA 5KUUA 1F9NA 3LAPA 2BIUX 1A33A 4DGBA 2C3BA 3RDCA 3EOVA 2WLWA 2R99A 4YUNA 4IPZA 2HQ6A 4KB4A 2B71A 1VBTA 4XNCA 5KUQA 3K2CA 1XWNA 3T1UA 3R56A 5CCSX 4YUPA 4FM9A 1W8LA 1AB4A 1XO7A 1CLHA 2GW2A 1CWCA 2MS4A 4N1PA 1M9YA 3BT8A 1W74A 4GFQA 1W8MA 5CBTA 1A58A 3UCHA 2ALFA 3LAJA 1ISTA 1ZKFA 3ODLA 1J2AA 3K0OA 3OPFA 4DGAA 1WQHA 3BO7A 2ZP2A 2X2CK 1XYHA 5CBVA 5KUZA 4FRUA 3R49A 3QYUA 4YUMA 3ODIA 3L4JA 1DD5A 1EK8A 4ZSDA 4E1QA 4R3EA 5KV2A 2Y3PA 3O7TA 1VDNA 5KULA 1AWVA 3RCGA 3ERED 1OCAA 4J5AX 4N1OA 3K0NA 2CMTA 5KUVA 2NULA 4O8HA 5CCNA 5KUSA 2P0OA 2MZUA 2XCQA 1XXCA 1V9TA 2RMAA 5KUOA 3RDDA 4EYVA 5DUDA 3ICIA 5CCQA 1VBSA 2QERA 1WQFA 1M63C 4DGEA 1M9FA 3RCKX 1CWOA 3RDBA 3CAGA 2XCRB 4N1MA 2X2AA 4KB2A 2OJUA 1DYWA 2HQJA 4YUHA 2A2NA 3RD9X 1B4AA 1B4BA 5JHEA 1QNGA 3MMLA 4KAWX 1BCKA 2BITX 4J58A 3R54A 1CYNA 1CWIA 2MC9A 2RMBA 4J5CX 4FRVA 5F66A 5KV0A 3RCLA 4J5BA 2FU0A 3VA7A 4S1JA 2N0TA 3PMPA 1M9CA 5A0EA 1M9XA 1NMKA 3MMLB 2CPLA 1ZKCA 5KURA 4YUIA 1CWKA 4DGDA 1VAIA 2RGRA 2X83B 3K0QA 3LPXA 2HAQA 4LQWA 4JJMA 2CFEA 1IHGA 1MZWA 2POYA 5KV7A 5KV6A 2IGWA 5CJ9A
chains in the Genus database with same CATH superfamily
1XZQB 2PHCB 4YUGA 1YNNA 3S6MA 4KMUA 3RZDK 4KMHA 4GTDA 2WFJA 1O2FB 1O25A 5JVOA 1IQ0A 1K83A 4OIRA 3RCIX 4MEXA 3G4CA 2NVXK 1JQWA 5EGEA 5FJ8K 1E8KA 1ZX8A 1SFOA 2RS4A 3PO2K 5E68A 1XQ7A 1XXBA 1Y1WK 3I4NK 2CW0A 1IIPA 1K83C 1QOIA 4J59A 4HY7A 1J6WA 3RFYA 2XGYB 4KM9A 3S15C 2R92K 1C0AA 1VGXA 4S1EA 5CBWA 1SFOC 4LR2A 3T02A 5LUDA 1ZQ1C 1FGLA 5CHPA 3K0MA 3QX3A 2HE9A 3S1NC 1CWMA 4KN4A 1I3QA 4RMFA 4YUJA 4J5EX 4Y52C 5C4JC 2X25B 4A3FC 2RMCA 5IYDC 2PLUA 3RDAX 2V6SA 3R4GA 4YFXA 4XCHA 3HOYC 1QNHA 1YNDA 1I3QC 3GTPK 2CK1A 3L4KA 4G0UA 3I4MK 3CQZA 3JB9d 2X7KA 2PMZL 5KV5A 2JA8K 3ICHA 5KV1A 5TMCA 4CYHA 3GTLA 4YULA 5C4XK 4YUKA 2XCOA 4BXXC 1CWBA 3FKIA 2GAHC 3A8KA 3CQZC 1VJEA 4GTFA 2CFAA 2P5MA 3S2HK 4GZYA 5M5XK 1LOPA 4A3IC 1BJTA 3S1QK 2JA5A 2X2DB 4C2MK 4XSXA 3FKIC 1AWTA 3HOZC 4O8IA 2IGVA 2VUMA 1WIHA 1IW7A 1X31C 4BY1K 2OSEA 2K7NA 4O2DA 3V4GA 4DGCA 4C3IC 4G7HA 2JA5C 3OEPA 2WAQD 4OINA 1IL2A 3R57A 4C3JK 1L0WA 3S16C 1BGWA 2VUMC 4YFNA 3BKPA 3S0XA 4N1SA 1XXAA 4A3BC 4M1XA 1KQ4A 1VH2A 4MQ9A 1IS1A 5CBUA 2CYHA 2WFIA 2PA8L 5TMFA 4C3HC 4A3CK 3M3YC 1AWQA 3FOEA 3GEHA 4Y7NC 2ZFZA 5C3EK 1I6VA 1CWLA 3R59A 4A3EK 3GTJK 3HOUC 2ESLA 1M9DA 2Z6WA 2P8TA 3GTOA 3GTMA 2JA6A 1MIKA 3GTGA 2A68A 4ZSCA 3TFHA 1CWAA 4N1QA 2E2IA 1CWFA 2POEA 3H3VL 5KUWA 3SZYA 3K0RA 4A3GC 1RMHA 4KDDA 3FOFA 2JA6C 5M3FK 3GTOC 3GTMC 1WOPA 3GTGC 1SFOK 3K0PA 2NVYA 3K7AC 3NUHA 3CYHA 2E2IC 1TWAA 2ZUFA 5CCRA 1CWHA 4I9YA 2OK3A 1J6XA 4BY7C 2E2HA 4X6AC 4JCPA 1H0PA 4DDQA 3DXJA 4Y52K 5FLMK 2NVYC 4KN7A 5C4JK 4A3FK 4BBRK 3BUEA 1TWAC 5IYDK 1M9EA 1GE9A 1ISEA 1TWCA 3HOYK 2E2HC 2PA8D 1AWSA 2B63A 1TWGC 4KATA 1EQRA 1I3QK 4G0WA 4N1RA 1AWUA 2GSOA 3OREA 3S14C 2MVZA 3RCFA 3S2DC 1J6VA 4A93K 4YUOA 5C44C 5JFEA 1TWCC 2B63C 1F93A 4N1NA 1E3BA 4BXXK 4R3FA 4JK1A 3FHZA 4LQYA 5IP7C 2KWAA 1W8VA 3CQZK 3GTQA 5KV3A 1Y1VA 1CWJA 1ZMFA 2A6EA 2Y0SD 1HQMA 3H3VD 4A3LC 3FKIK 4J5DX 2FQOA 2EBBA 3HOZK 5IYBC 1V5VA 3AQPA 4KARA 2JA7K 1XPPA 5KUNA 1X7FA 1Y1VC 4C3IK 4TOTA 3KOPA 1WQGA 5KV4A 1WORA 4AH6A 4BLAA 4A3JC 3S16K 1MF8C 2WAQL 2VUMK 3HXAA 4YG2A 3AD7C 3H0GA 3CYSA 1PJ7A 4A3MC 4A3BK 3N0BA 2A69A 1Z81A 4G0VA 4KC6A 2R93K 1O24A 4XLNA 5CYHA 4ZH4A 1EH1A 3ADAC 3H0GC 1ZVUA 4GTBA 3M3YK 1C5FA 4Y7NK 1EFWA 4FZBA 4GTEA 1R9TA 1WCMA 4XLPA 1AK4A 4A3KC 4J3NA 2E2JC 5KUUA 1F9NA 3S1MK 3S1RC 3HOUK 3WODA 3GEEA 5IORA 3LAPA 4BBSC 1O27A 2BIUX 1A33A 1ZXOA 1WCMC 1R9TC 4DGBA 3GTKA 2C3BA 3GTLC 3RDCA 4BKWA 3EOVA 4A3GK 2WLWA 2R99A 4YUNA 4IPZA 3T00A 3GTGK 4LK0A 2HQ6A 3K7AK 4KB4A 5M3MK 5IYCC 2NVQC 1WSRA 2E2IK 3HOXK 4KM8A 2B71A 4GT9A 1VBTA 4XNCA 3G4AA 4AYBD 3RZDC 5KUQA 3K2CA 1I50A 1XWNA 1Y1WA 2NVYK 2O5IA 3T1UA 3R56A 5CCSX 1TWAK 4YUPA 2R92A 4FM9A 1TWFK 3PO3K 1W8LA 4MEYA 1AB4A 1XO7A 2E2HK 4XSZA 1CLHA 1I50C 1TWGK 4KMDA 1Y1WC 2D6FC 3IPJA 3PO2C 2GW2A 1CWCA 2MS4A 2CFAB 4WJ3M 4N1PA 3S14K 1M9YA 4Q5SA 3BT8A 2O5JA 2R92C 3S2DK 2BE5A 1W74A 4GFQA 5C44K 1W8MA 5CBTA 1TWCK 1A58A 3UCHA 2ALFA 3TFJA 3GSIA 2WB1D 4ILDA 4LK1A 5IP7K 2NVTC 3LAJA 1ISTA 3M4OC 1ZKFA 3GTPA 3ODLA 3HOVC 1J2AA 3K0OA 3OPFA 5IOSA 3HOWC 4P5BA 1K83K 5IYBK 2Y0SL 4DGAA 3S15K 1WOOA 4QJVA 5L46A 2YU9A 1Y1VK 3GTPC 3AH5A 5D4DA 3I4MC 1O28A 1WQHA 3S17C 4A3JK 3BO7A 1PJ6A 3S1NK 3RZOC 2JA8C 2ZP2A 4PAAA 5C4XC 2YU9C 4A3MK 1YNJA 4KMAA 5EGHA 2X2CK 1XYHA 5CBVA 1DCHA 3S2HC 1XZQA 3A8IA 5KUZA 4YFKA 4FRUA 3EQLA 4C45A 4A3KK 3R49A 3S1RK 3QYUA 4NOIA 4YUMA 2JH3A 3ODIA 3L4JA 1F7VA 1USMA 1WCMK 1DD5A 1EK8A 4A3IK 3GTLK 1O29A 5HL8A 4ZSDA 4E1QA 4OIQA 4R3EA 5KV2A 4PABA 2Y3PA 3GTQC 5IOTA 3O7TA 1VDNA 5IYCK 3GTJA 3AD8C 5KULA 2JA5K 4LLGA 1JOEA 1DCPA 1O26A 5C3EC 1AWVA 1HI9A 3RCGA 2RH6A 3ERED 1OCAA 4QIWD 4AYBL 2A6HA 4J5AX 4A3EC 2PPBA 3GTJC 4N1OA 1RU0A 1I50K 3K0NA 3T01A 4A3DC 4C3HK 2CMTA 5KUVA 3TFIA 1UV7A 2NULA 4O8HA 4GTLA 5IP9C 3HKZD 5CCNA 5KUSA 1J98A 2P0OA 2NVTK 2MZUA 2XCQA 3M4OK 1XXCA 1V9TA 2RMAA 5KUOA 2WB1L 3RDDA 4EYVA 4OIOA 3HOVK 2R7ZA 5FLMC 5DUDA 3ICIA 3AQOA 3A8JA 4BBRC 1TWHA 3HOWK 3AD9C 1G51A 5CCQA 5M5WK 1VBSA 2QERA 2JA6K 3GTOK 3GTMK 2R7ZC 1WQFA 1M63C 4DGEA 3GTKC 3S17K 1YCLA 1ZYRA 1TWHC 2NNZA 1I6HC 4A93C 2ZUEA 1M9FA 2NVXA 3RCKX 1CWOA 3RZOK 1WSVA 4BY7K 5CJ9A 2YU9K 4WILA 4X6AK 3RDBA 3CAGA 2XCRB 4G7ZA 4N1MA 2X2AA 2JA7A 1XZPA 4KB2A 4P9SA 2NVXC 2OJUA 1F7UA 3JSTA 1DYWA 2HQJA 4YUHA 2GSUA 2A2NA 3RD9X 1VLOA 4OIPA 1B4AA 3I4NC 1IBAA 3SZZA 5IOQA 4WJ4A 2JA7C 4G7OA 1B4BA 2GSNA 2B63K 4BLBA 5JHEA 1QNGA 3MMLA 5M5YK 4KAWX 3GDZA 1BCKA 2R93A 1O2AA 3N3YA 4P5AA 2BITX 4J58A 1ZBSA 1WOSA 3R54A 1O2BA 4A3LK 2GAGC 2W7VA 1CYNA 4KASA 1CWIA 2MC9A 4LOWA 2R93C 4LJZA 1EI6A 2V6UA 2RMBA 3GTQK 1BDFA 1XZPB 1PJ5A 4J5CX 4FRVA 5F66A 5KV0A 1SMYA 3X27A 2PMZD 5TJ3A 3RCLA 4J5BA 1JVIA 1VRQC 2FU0A 3VA7A 4S1JA 3BP8C 4GTAA 3S1MC 2N0TA 3PMPA 1M9CA 5A0EA 4QIWL 1M9XA 1YX2A 3GIRA 1NMKA 3MMLB 2V6TA 2CPLA 3S1QC 3BP3A 4A3DK 1INNA 3H0GK 4C2MC 4Q4ZA 1ZKCA 2KA0A 5KURA 4YUIA 5IP9K 4BY1C 1CWKA 3Q3QA 2E2JK 4DGDA 1DCOA 3HOXC 1VAIA 4QJVB 1TWFA 3HKZL 4C3JC 1IE0A 1BS2A 2RGRA 2X83B 4BBSK 3K0QA 1TWGA 3LPXA 3GEIA 1R9TK 2HAQA 3TTGA 4LQWA 1TWFC 4JJMA 3PO3C 2CFEA 1IHGA 2FQTA 4GTCA 1MZWA 2POYA 5KV7A 1USOA 2R7ZK 4A3CC 3GTKK 3N0CA 5KV6A 2NVQK 2IGWA 1TWHK 1AWRA 1I6HK
chains in the Genus database with same CATH topology
2PHCB 4YUGA 3S6MA 4KMHA 4GTDA 2WFJA 1O25A 5JVOA 1K83A 3RCIX 3G4CA 5EGEA 1E8KA 1SFOA 2RS4A 1XQ7A 1XXBA 1IIPA 1QOIA 4J59A 4HY7A 3RFYA 2XGYB 4KM9A 4S1EA 5CBWA 4LR2A 5LUDA 5CHPA 1FGLA 3K0MA 3QX3A 2HE9A 1CWMA 1I3QA 4YUJA 4J5EX 2X25B 2RMCA 2PLUA 3RDAX 3R4GA 1QNHA 1YNDA 2CK1A 3L4KA 4G0UA 3CQZA 3JB9d 2X7KA 5KV5A 3ICHA 5KV1A 4CYHA 3GTLA 4YULA 4YUKA 2XCOA 1CWBA 3FKIA 4GTFA 2CFAA 2P5MA 1LOPA 1BJTA 2JA5A 2X2DB 1AWTA 4O8IA 2IGVA 2VUMA 1WIHA 2OSEA 2K7NA 3V4GA 4DGCA 4C3IC 3OEPA 3R57A 1BGWA 3BKPA 3S0XA 4N1SA 1XXAA 4M1XA 1KQ4A 1IS1A 5CBUA 2CYHA 2WFIA 4C3HC 1AWQA 3FOEA 2ZFZA 1CWLA 3R59A 2ESLA 1M9DA 2Z6WA 3GTMA 3GTOA 2JA6A 1MIKA 3GTGA 4ZSCA 1CWAA 4N1QA 2E2IA 1CWFA 2POEA 5KUWA 3K0RA 1RMHA 4KDDA 3FOFA 3K0PA 2NVYA 3NUHA 3CYHA 1TWAA 5CCRA 1CWHA 4I9YA 2OK3A 2E2HA 4JCPA 1H0PA 4DDQA 3BUEA 1M9EA 1GE9A 1ISEA 1TWCA 2B63A 1AWSA 4KATA 4G0WA 4N1RA 1AWUA 2GSOA 3OREA 2MVZA 3RCFA 4YUOA 5JFEA 4N1NA 1E3BA 4R3FA 3FHZA 4LQYA 2KWAA 1W8VA 3GTQA 5KV3A 1Y1VA 1CWJA 1ZMFA 4J5DX 3AQPA 4KARA 5KUNA 1X7FA 4TOTA 1WQGA 5KV4A 4BLAA 1MF8C 3H0GA 3CYSA 3N0BA 1Z81A 4G0VA 4KC6A 1O24A 5CYHA 1EH1A 4GTBA 1ZVUA 1C5FA 4FZBA 4GTEA 1R9TA 1WCMA 1AK4A 4J3NA 5KUUA 1F9NA 3LAPA 5IORA 1O27A 2BIUX 1A33A 1ZXOA 4DGBA 3GTKA 2C3BA 3RDCA 4BKWA 3EOVA 2WLWA 2R99A 4YUNA 4IPZA 2HQ6A 4KB4A 4KM8A 2B71A 4GT9A 1VBTA 4XNCA 3G4AA 5KUQA 3K2CA 1I50A 1XWNA 1Y1WA 3T1UA 3R56A 5CCSX 4YUPA 2R92A 4FM9A 1W8LA 1AB4A 1XO7A 1CLHA 4KMDA 2GW2A 1CWCA 2MS4A 2CFAB 4N1PA 1M9YA 3BT8A 1W74A 4GFQA 1W8MA 5CBTA 1A58A 3UCHA 2ALFA 4ILDA 3LAJA 1ISTA 1ZKFA 3GTPA 3ODLA 1J2AA 3K0OA 3OPFA 5IOSA 4P5BA 4DGAA 2YU9A 3AH5A 1O28A 1WQHA 3BO7A 2ZP2A 4KMAA 5EGHA 2X2CK 1XYHA 5CBVA 5KUZA 4FRUA 3R49A 3QYUA 4YUMA 2JH3A 3ODIA 3L4JA 1DD5A 1EK8A 1O29A 4ZSDA 4E1QA 4R3EA 5KV2A 2Y3PA 5IOTA 3O7TA 1VDNA 3GTJA 5KULA 1O26A 1AWVA 3RCGA 2RH6A 3ERED 1OCAA 4J5AX 4N1OA 3K0NA 2CMTA 5KUVA 2NULA 4O8HA 4GTLA 5CCNA 5KUSA 2P0OA 2MZUA 2XCQA 1XXCA 1V9TA 2RMAA 5KUOA 3RDDA 4EYVA 2R7ZA 5DUDA 3ICIA 3AQOA 1TWHA 5CCQA 1VBSA 2QERA 1WQFA 1M63C 4DGEA 2NVXA 1M9FA 3RCKX 1CWOA 5CJ9A 3RDBA 3CAGA 2XCRB 4N1MA 2X2AA 2JA7A 4KB2A 2OJUA 1DYWA 2HQJA 4YUHA 2GSUA 2A2NA 3RD9X 1B4AA 5IOQA 1B4BA 2GSNA 4BLBA 5JHEA 1QNGA 3MMLA 4KAWX 1BCKA 2R93A 1O2AA 3N3YA 4P5AA 2BITX 4J58A 1ZBSA 3R54A 1O2BA 1CYNA 4KASA 1CWIA 2MC9A 2RMBA 4J5CX 4FRVA 5F66A 5KV0A 5TJ3A 3RCLA 4J5BA 2FU0A 3VA7A 4S1JA 4GTAA 2N0TA 3PMPA 1M9CA 5A0EA 1M9XA 1NMKA 3MMLB 2CPLA 4C2MC 1ZKCA 5KURA 4YUIA 1CWKA 3Q3QA 4DGDA 1VAIA 1TWFA 4C3JC 2RGRA 2X83B 3K0QA 1TWGA 3LPXA 2HAQA 4LQWA 4JJMA 2CFEA 1IHGA 4GTCA 1MZWA 2POYA 5KV7A 3N0CA 5KV6A 2IGWA 1AWRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PHC B;  4YUG A;  3S6M A;  2WFJ A;  5JVO A;  3RCI X;  1E8K A;  2RS4 A;  1XQ7 A;  1XXB A;  1IIP A;  1QOI A;  4J59 A;  4HY7 A;  3RFY A;  2XGY B;  4S1E A;  5CBW A;  5LUD A;  1FGL A;  3K0M A;  3QX3 A;  2HE9 A;  1CWM A;  4YUJ A;  4J5E X;  2X25 B;  2RMC A;  2PLU A;  3RDA X;  3R4G A;  1QNH A;  1YND A;  2CK1 A;  3L4K A;  4G0U A;  3JB9 d;  2X7K A;  5KV5 A;  3ICH A;  5KV1 A;  4CYH A;  4YUL A;  4YUK A;  2XCO A;  1CWB A;  2P5M A;  1LOP A;  1BJT A;  2X2D B;  1AWT A;  4O8I A;  2IGV A;  1WIH A;  2OSE A;  2K7N A;  3V4G A;  4DGC A;  3OEP A;  3R57 A;  1BGW A;  3BKP A;  4N1S A;  1XXA A;  1IS1 A;  5CBU A;  2CYH A;  2WFI A;  1AWQ A;  3FOE A;  2ZFZ A;  1CWL A;  3R59 A;  2ESL A;  1M9D A;  2Z6W A;  1MIK A;  4ZSC A;  1CWA A;  4N1Q A;  1CWF A;  2POE A;  5KUW A;  3K0R A;  1RMH A;  4KDD A;  3FOF A;  3K0P A;  3NUH A;  3CYH A;  5CCR A;  1CWH A;  4I9Y A;  2OK3 A;  4JCP A;  1H0P A;  4DDQ A;  3BUE A;  1M9E A;  1GE9 A;  1ISE A;  1AWS A;  4G0W A;  4N1R A;  1AWU A;  3ORE A;  2MVZ A;  3RCF A;  4YUO A;  4N1N A;  1E3B A;  4R3F A;  3FHZ A;  2KWA A;  1W8V A;  5KV3 A;  1CWJ A;  1ZMF A;  4J5D X;  5KUN A;  1X7F A;  4TOT A;  1WQG A;  5KV4 A;  1MF8 C;  3CYS A;  1Z81 A;  4G0V A;  4KC6 A;  5CYH A;  1EH1 A;  1ZVU A;  1C5F A;  1AK4 A;  1AWR A;  4J3N A;  5KUU A;  1F9N A;  3LAP A;  2BIU X;  1A33 A;  4DGB A;  2C3B A;  3RDC A;  3EOV A;  2WLW A;  2R99 A;  4YUN A;  4IPZ A;  2HQ6 A;  4KB4 A;  2B71 A;  1VBT A;  4XNC A;  5KUQ A;  3K2C A;  1XWN A;  3T1U A;  3R56 A;  5CCS X;  4YUP A;  4FM9 A;  1W8L A;  1AB4 A;  1XO7 A;  1CLH A;  2GW2 A;  1CWC A;  2MS4 A;  4N1P A;  1M9Y A;  3BT8 A;  1W74 A;  4GFQ A;  1W8M A;  5CBT A;  1A58 A;  3UCH A;  2ALF A;  3LAJ A;  1IST A;  1ZKF A;  3ODL A;  1J2A A;  3K0O A;  3OPF A;  4DGA A;  1WQH A;  3BO7 A;  2ZP2 A;  2X2C K;  1XYH A;  5CBV A;  5KUZ A;  4FRU A;  3R49 A;  3QYU A;  4YUM A;  3ODI A;  3L4J A;  1DD5 A;  1EK8 A;  4ZSD A;  4E1Q A;  4R3E A;  5KV2 A;  2Y3P A;  3O7T A;  1VDN A;  5KUL A;  1AWV A;  3RCG A;  3ERE D;  1OCA A;  4J5A X;  4N1O A;  3K0N A;  2CMT A;  5KUV A;  2NUL A;  4O8H A;  5CCN A;  5KUS A;  2P0O A;  2MZU A;  2XCQ A;  1XXC A;  1V9T A;  2RMA A;  5KUO A;  3RDD A;  4EYV A;  5DUD A;  3ICI A;  5CCQ A;  1VBS A;  2QER A;  1WQF A;  1M63 C;  4DGE A;  1M9F A;  3RCK X;  1CWO A;  3RDB A;  3CAG A;  2XCR B;  4N1M A;  2X2A A;  4KB2 A;  2OJU A;  1DYW A;  2HQJ A;  4YUH A;  2A2N A;  3RD9 X;  1B4A A;  1B4B A;  5JHE A;  1QNG A;  3MML A;  4KAW X;  1BCK A;  2BIT X;  4J58 A;  3R54 A;  1CYN A;  1CWI A;  2MC9 A;  2RMB A;  4J5C X;  4FRV A;  5F66 A;  5KV0 A;  3RCL A;  4J5B A;  2FU0 A;  3VA7 A;  4S1J A;  2N0T A;  3PMP A;  1M9C A;  5A0E A;  1M9X A;  1NMK A;  3MML B;  2CPL A;  1ZKC A;  5KUR A;  4YUI A;  1CWK A;  4DGD A;  1VAI A;  2RGR A;  2X83 B;  3K0Q A;  3LPX A;  2HAQ A;  4LQW A;  4JJM A;  2CFE A;  1IHG A;  1MZW A;  2POY A;  5KV7 A;  5KV6 A;  2IGW A;  5CJ9 A; 
#chains in the Genus database with same CATH topology
 1XZQ B;  2PHC B;  4YUG A;  1YNN A;  3S6M A;  4KMU A;  3RZD K;  4KMH A;  4GTD A;  2WFJ A;  1O2F B;  1O25 A;  5JVO A;  1IQ0 A;  1K83 A;  4OIR A;  3RCI X;  4MEX A;  3G4C A;  2NVX K;  1JQW A;  5EGE A;  5FJ8 K;  1E8K A;  1ZX8 A;  1SFO A;  2RS4 A;  3PO2 K;  5E68 A;  1XQ7 A;  1XXB A;  1Y1W K;  3I4N K;  2CW0 A;  1IIP A;  1K83 C;  1QOI A;  4J59 A;  4HY7 A;  1J6W A;  3RFY A;  2XGY B;  4KM9 A;  3S15 C;  2R92 K;  1C0A A;  1VGX A;  4S1E A;  5CBW A;  1SFO C;  4LR2 A;  3T02 A;  5LUD A;  1ZQ1 C;  1FGL A;  5CHP A;  3K0M A;  3QX3 A;  2HE9 A;  3S1N C;  1CWM A;  4KN4 A;  1I3Q A;  4RMF A;  4YUJ A;  4J5E X;  4Y52 C;  5C4J C;  2X25 B;  4A3F C;  2RMC A;  5IYD C;  2PLU A;  3RDA X;  2V6S A;  3R4G A;  4YFX A;  4XCH A;  3HOY C;  1QNH A;  1YND A;  1I3Q C;  3GTP K;  2CK1 A;  3L4K A;  4G0U A;  3I4M K;  3CQZ A;  3JB9 d;  2X7K A;  2PMZ L;  5KV5 A;  2JA8 K;  3ICH A;  5KV1 A;  5TMC A;  4CYH A;  3GTL A;  4YUL A;  5C4X K;  4YUK A;  2XCO A;  4BXX C;  1CWB A;  3FKI A;  2GAH C;  3A8K A;  3CQZ C;  1VJE A;  4GTF A;  2CFA A;  2P5M A;  3S2H K;  4GZY A;  5M5X K;  1LOP A;  4A3I C;  1BJT A;  3S1Q K;  2JA5 A;  2X2D B;  4C2M K;  4XSX A;  3FKI C;  1AWT A;  3HOZ C;  4O8I A;  2IGV A;  2VUM A;  1WIH A;  1IW7 A;  1X31 C;  4BY1 K;  2OSE A;  2K7N A;  4O2D A;  3V4G A;  4DGC A;  4C3I C;  4G7H A;  2JA5 C;  3OEP A;  2WAQ D;  4OIN A;  1IL2 A;  3R57 A;  4C3J K;  1L0W A;  3S16 C;  1BGW A;  2VUM C;  4YFN A;  3BKP A;  3S0X A;  4N1S A;  1XXA A;  4A3B C;  4M1X A;  1KQ4 A;  1VH2 A;  4MQ9 A;  1IS1 A;  5CBU A;  2CYH A;  2WFI A;  2PA8 L;  5TMF A;  4C3H C;  4A3C K;  3M3Y C;  1AWQ A;  3FOE A;  3GEH A;  4Y7N C;  2ZFZ A;  5C3E K;  1I6V A;  1CWL A;  3R59 A;  4A3E K;  3GTJ K;  3HOU C;  2ESL A;  1M9D A;  2Z6W A;  2P8T A;  3GTO A;  3GTM A;  2JA6 A;  1MIK A;  3GTG A;  2A68 A;  4ZSC A;  3TFH A;  1CWA A;  4N1Q A;  2E2I A;  1CWF A;  2POE A;  3H3V L;  5KUW A;  3SZY A;  3K0R A;  4A3G C;  1RMH A;  4KDD A;  3FOF A;  2JA6 C;  5M3F K;  3GTO C;  3GTM C;  1WOP A;  3GTG C;  1SFO K;  3K0P A;  2NVY A;  3K7A C;  3NUH A;  3CYH A;  2E2I C;  1TWA A;  2ZUF A;  5CCR A;  1CWH A;  4I9Y A;  2OK3 A;  1J6X A;  4BY7 C;  2E2H A;  4X6A C;  4JCP A;  1H0P A;  4DDQ A;  3DXJ A;  4Y52 K;  5FLM K;  2NVY C;  4KN7 A;  5C4J K;  4A3F K;  4BBR K;  3BUE A;  1TWA C;  5IYD K;  1M9E A;  1GE9 A;  1ISE A;  1TWC A;  3HOY K;  2E2H C;  2PA8 D;  1AWS A;  2B63 A;  1TWG C;  4KAT A;  1EQR A;  1I3Q K;  4G0W A;  4N1R A;  1AWU A;  2GSO A;  3ORE A;  3S14 C;  2MVZ A;  3RCF A;  3S2D C;  1J6V A;  4A93 K;  4YUO A;  5C44 C;  5JFE A;  1TWC C;  2B63 C;  1F93 A;  4N1N A;  1E3B A;  4BXX K;  4R3F A;  4JK1 A;  3FHZ A;  4LQY A;  5IP7 C;  2KWA A;  1W8V A;  3CQZ K;  3GTQ A;  5KV3 A;  1Y1V A;  1CWJ A;  1ZMF A;  2A6E A;  2Y0S D;  1HQM A;  3H3V D;  4A3L C;  3FKI K;  4J5D X;  2FQO A;  2EBB A;  3HOZ K;  5IYB C;  1V5V A;  3AQP A;  4KAR A;  2JA7 K;  1XPP A;  5KUN A;  1X7F A;  1Y1V C;  4C3I K;  4TOT A;  3KOP A;  1WQG A;  5KV4 A;  1WOR A;  4AH6 A;  4BLA A;  4A3J C;  3S16 K;  1MF8 C;  2WAQ L;  2VUM K;  3HXA A;  4YG2 A;  3AD7 C;  3H0G A;  3CYS A;  1PJ7 A;  4A3M C;  4A3B K;  3N0B A;  2A69 A;  1Z81 A;  4G0V A;  4KC6 A;  2R93 K;  1O24 A;  4XLN A;  5CYH A;  4ZH4 A;  1EH1 A;  3ADA C;  3H0G C;  1ZVU A;  4GTB A;  3M3Y K;  1C5F A;  4Y7N K;  1EFW A;  4FZB A;  4GTE A;  1R9T A;  1WCM A;  4XLP A;  1AK4 A;  4A3K C;  4J3N A;  2E2J C;  5KUU A;  1F9N A;  3S1M K;  3S1R C;  3HOU K;  3WOD A;  3GEE A;  5IOR A;  3LAP A;  4BBS C;  1O27 A;  2BIU X;  1A33 A;  1ZXO A;  1WCM C;  1R9T C;  4DGB A;  3GTK A;  2C3B A;  3GTL C;  3RDC A;  4BKW A;  3EOV A;  4A3G K;  2WLW A;  2R99 A;  4YUN A;  4IPZ A;  3T00 A;  3GTG K;  4LK0 A;  2HQ6 A;  3K7A K;  4KB4 A;  5M3M K;  5IYC C;  2NVQ C;  1WSR A;  2E2I K;  3HOX K;  4KM8 A;  2B71 A;  4GT9 A;  1VBT A;  4XNC A;  3G4A A;  4AYB D;  3RZD C;  5KUQ A;  3K2C A;  1I50 A;  1XWN A;  1Y1W A;  2NVY K;  2O5I A;  3T1U A;  3R56 A;  5CCS X;  1TWA K;  4YUP A;  2R92 A;  4FM9 A;  1TWF K;  3PO3 K;  1W8L A;  4MEY A;  1AB4 A;  1XO7 A;  2E2H K;  4XSZ A;  1CLH A;  1I50 C;  1TWG K;  4KMD A;  1Y1W C;  2D6F C;  3IPJ A;  3PO2 C;  2GW2 A;  1CWC A;  2MS4 A;  2CFA B;  4WJ3 M;  4N1P A;  3S14 K;  1M9Y A;  4Q5S A;  3BT8 A;  2O5J A;  2R92 C;  3S2D K;  2BE5 A;  1W74 A;  4GFQ A;  5C44 K;  1W8M A;  5CBT A;  1TWC K;  1A58 A;  3UCH A;  2ALF A;  3TFJ A;  3GSI A;  2WB1 D;  4ILD A;  4LK1 A;  5IP7 K;  2NVT C;  3LAJ A;  1IST A;  3M4O C;  1ZKF A;  3GTP A;  3ODL A;  3HOV C;  1J2A A;  3K0O A;  3OPF A;  5IOS A;  3HOW C;  4P5B A;  1K83 K;  5IYB K;  2Y0S L;  4DGA A;  3S15 K;  1WOO A;  4QJV A;  5L46 A;  2YU9 A;  1Y1V K;  3GTP C;  3AH5 A;  5D4D A;  3I4M C;  1O28 A;  1WQH A;  3S17 C;  4A3J K;  3BO7 A;  1PJ6 A;  3S1N K;  3RZO C;  2JA8 C;  2ZP2 A;  4PAA A;  5C4X C;  2YU9 C;  4A3M K;  1YNJ A;  4KMA A;  5EGH A;  2X2C K;  1XYH A;  5CBV A;  1DCH A;  3S2H C;  1XZQ A;  3A8I A;  5KUZ A;  4YFK A;  4FRU A;  3EQL A;  4C45 A;  4A3K K;  3R49 A;  3S1R K;  3QYU A;  4NOI A;  4YUM A;  2JH3 A;  3ODI A;  3L4J A;  1F7V A;  1USM A;  1WCM K;  1DD5 A;  1EK8 A;  4A3I K;  3GTL K;  1O29 A;  5HL8 A;  4ZSD A;  4E1Q A;  4OIQ A;  4R3E A;  5KV2 A;  4PAB A;  2Y3P A;  3GTQ C;  5IOT A;  3O7T A;  1VDN A;  5IYC K;  3GTJ A;  3AD8 C;  5KUL A;  2JA5 K;  4LLG A;  1JOE A;  1DCP A;  1O26 A;  5C3E C;  1AWV A;  1HI9 A;  3RCG A;  2RH6 A;  3ERE D;  1OCA A;  4QIW D;  4AYB L;  2A6H A;  4J5A X;  4A3E C;  2PPB A;  3GTJ C;  4N1O A;  1RU0 A;  1I50 K;  3K0N A;  3T01 A;  4A3D C;  4C3H K;  2CMT A;  5KUV A;  3TFI A;  1UV7 A;  2NUL A;  4O8H A;  4GTL A;  5IP9 C;  3HKZ D;  5CCN A;  5KUS A;  1J98 A;  2P0O A;  2NVT K;  2MZU A;  2XCQ A;  3M4O K;  1XXC A;  1V9T A;  2RMA A;  5KUO A;  2WB1 L;  3RDD A;  4EYV A;  4OIO A;  3HOV K;  2R7Z A;  5FLM C;  5DUD A;  3ICI A;  3AQO A;  3A8J A;  4BBR C;  1TWH A;  3HOW K;  3AD9 C;  1G51 A;  5CCQ A;  5M5W K;  1VBS A;  2QER A;  2JA6 K;  3GTO K;  3GTM K;  2R7Z C;  1WQF A;  1M63 C;  4DGE A;  3GTK C;  3S17 K;  1YCL A;  1ZYR A;  1TWH C;  2NNZ A;  1I6H C;  4A93 C;  2ZUE A;  1M9F A;  2NVX A;  3RCK X;  1CWO A;  3RZO K;  1WSV A;  4BY7 K;  5CJ9 A;  2YU9 K;  4WIL A;  4X6A K;  3RDB A;  3CAG A;  2XCR B;  4G7Z A;  4N1M A;  2X2A A;  2JA7 A;  1XZP A;  4KB2 A;  4P9S A;  2NVX C;  2OJU A;  1F7U A;  3JST A;  1DYW A;  2HQJ A;  4YUH A;  2GSU A;  2A2N A;  3RD9 X;  1VLO A;  4OIP A;  1B4A A;  3I4N C;  1IBA A;  3SZZ A;  5IOQ A;  4WJ4 A;  2JA7 C;  4G7O A;  1B4B A;  2GSN A;  2B63 K;  4BLB A;  5JHE A;  1QNG A;  3MML A;  5M5Y K;  4KAW X;  3GDZ A;  1BCK A;  2R93 A;  1O2A A;  3N3Y A;  4P5A A;  2BIT X;  4J58 A;  1ZBS A;  1WOS A;  3R54 A;  1O2B A;  4A3L K;  2GAG C;  2W7V A;  1CYN A;  4KAS A;  1CWI A;  2MC9 A;  4LOW A;  2R93 C;  4LJZ A;  1EI6 A;  2V6U A;  2RMB A;  3GTQ K;  1BDF A;  1XZP B;  1PJ5 A;  4J5C X;  4FRV A;  5F66 A;  5KV0 A;  1SMY A;  3X27 A;  2PMZ D;  5TJ3 A;  3RCL A;  4J5B A;  1JVI A;  1VRQ C;  2FU0 A;  3VA7 A;  4S1J A;  3BP8 C;  4GTA A;  3S1M C;  2N0T A;  3PMP A;  1M9C A;  5A0E A;  4QIW L;  1M9X A;  1YX2 A;  3GIR A;  1NMK A;  3MML B;  2V6T A;  2CPL A;  3S1Q C;  3BP3 A;  4A3D K;  1INN A;  3H0G K;  4C2M C;  4Q4Z A;  1ZKC A;  2KA0 A;  5KUR A;  4YUI A;  5IP9 K;  4BY1 C;  1CWK A;  3Q3Q A;  2E2J K;  4DGD A;  1DCO A;  3HOX C;  1VAI A;  4QJV B;  1TWF A;  3HKZ L;  4C3J C;  1IE0 A;  1BS2 A;  2RGR A;  2X83 B;  4BBS K;  3K0Q A;  1TWG A;  3LPX A;  3GEI A;  1R9T K;  2HAQ A;  3TTG A;  4LQW A;  1TWF C;  4JJM A;  3PO3 C;  2CFE A;  1IHG A;  2FQT A;  4GTC A;  1MZW A;  2POY A;  5KV7 A;  1USO A;  2R7Z K;  4A3C C;  3GTK K;  3N0C A;  5KV6 A;  2NVQ K;  2IGW A;  1TWH K;  1AWR A;  1I6H K; 
#chains in the Genus database with same CATH homology
 2PHC B;  4YUG A;  3S6M A;  4KMH A;  4GTD A;  2WFJ A;  1O25 A;  5JVO A;  1K83 A;  3RCI X;  3G4C A;  5EGE A;  1E8K A;  1SFO A;  2RS4 A;  1XQ7 A;  1XXB A;  1IIP A;  1QOI A;  4J59 A;  4HY7 A;  3RFY A;  2XGY B;  4KM9 A;  4S1E A;  5CBW A;  4LR2 A;  5LUD A;  5CHP A;  1FGL A;  3K0M A;  3QX3 A;  2HE9 A;  1CWM A;  1I3Q A;  4YUJ A;  4J5E X;  2X25 B;  2RMC A;  2PLU A;  3RDA X;  3R4G A;  1QNH A;  1YND A;  2CK1 A;  3L4K A;  4G0U A;  3CQZ A;  3JB9 d;  2X7K A;  5KV5 A;  3ICH A;  5KV1 A;  4CYH A;  3GTL A;  4YUL A;  4YUK A;  2XCO A;  1CWB A;  3FKI A;  4GTF A;  2CFA A;  2P5M A;  1LOP A;  1BJT A;  2JA5 A;  2X2D B;  1AWT A;  4O8I A;  2IGV A;  2VUM A;  1WIH A;  2OSE A;  2K7N A;  3V4G A;  4DGC A;  4C3I C;  3OEP A;  3R57 A;  1BGW A;  3BKP A;  3S0X A;  4N1S A;  1XXA A;  4M1X A;  1KQ4 A;  1IS1 A;  5CBU A;  2CYH A;  2WFI A;  4C3H C;  1AWQ A;  3FOE A;  2ZFZ A;  1CWL A;  3R59 A;  2ESL A;  1M9D A;  2Z6W A;  3GTM A;  3GTO A;  2JA6 A;  1MIK A;  3GTG A;  4ZSC A;  1CWA A;  4N1Q A;  2E2I A;  1CWF A;  2POE A;  5KUW A;  3K0R A;  1RMH A;  4KDD A;  3FOF A;  3K0P A;  2NVY A;  3NUH A;  3CYH A;  1TWA A;  5CCR A;  1CWH A;  4I9Y A;  2OK3 A;  2E2H A;  4JCP A;  1H0P A;  4DDQ A;  3BUE A;  1M9E A;  1GE9 A;  1ISE A;  1TWC A;  2B63 A;  1AWS A;  4KAT A;  4G0W A;  4N1R A;  1AWU A;  2GSO A;  3ORE A;  2MVZ A;  3RCF A;  4YUO A;  5JFE A;  4N1N A;  1E3B A;  4R3F A;  3FHZ A;  4LQY A;  2KWA A;  1W8V A;  3GTQ A;  5KV3 A;  1Y1V A;  1CWJ A;  1ZMF A;  4J5D X;  3AQP A;  4KAR A;  5KUN A;  1X7F A;  4TOT A;  1WQG A;  5KV4 A;  4BLA A;  1MF8 C;  3H0G A;  3CYS A;  3N0B A;  1Z81 A;  4G0V A;  4KC6 A;  1O24 A;  5CYH A;  1EH1 A;  4GTB A;  1ZVU A;  1C5F A;  4FZB A;  4GTE A;  1R9T A;  1WCM A;  1AK4 A;  4J3N A;  5KUU A;  1F9N A;  3LAP A;  5IOR A;  1O27 A;  2BIU X;  1A33 A;  1ZXO A;  4DGB A;  3GTK A;  2C3B A;  3RDC A;  4BKW A;  3EOV A;  2WLW A;  2R99 A;  4YUN A;  4IPZ A;  2HQ6 A;  4KB4 A;  4KM8 A;  2B71 A;  4GT9 A;  1VBT A;  4XNC A;  3G4A A;  5KUQ A;  3K2C A;  1I50 A;  1XWN A;  1Y1W A;  3T1U A;  3R56 A;  5CCS X;  4YUP A;  2R92 A;  4FM9 A;  1W8L A;  1AB4 A;  1XO7 A;  1CLH A;  4KMD A;  2GW2 A;  1CWC A;  2MS4 A;  2CFA B;  4N1P A;  1M9Y A;  3BT8 A;  1W74 A;  4GFQ A;  1W8M A;  5CBT A;  1A58 A;  3UCH A;  2ALF A;  4ILD A;  3LAJ A;  1IST A;  1ZKF A;  3GTP A;  3ODL A;  1J2A A;  3K0O A;  3OPF A;  5IOS A;  4P5B A;  4DGA A;  2YU9 A;  3AH5 A;  1O28 A;  1WQH A;  3BO7 A;  2ZP2 A;  4KMA A;  5EGH A;  2X2C K;  1XYH A;  5CBV A;  5KUZ A;  4FRU A;  3R49 A;  3QYU A;  4YUM A;  2JH3 A;  3ODI A;  3L4J A;  1DD5 A;  1EK8 A;  1O29 A;  4ZSD A;  4E1Q A;  4R3E A;  5KV2 A;  2Y3P A;  5IOT A;  3O7T A;  1VDN A;  3GTJ A;  5KUL A;  1O26 A;  1AWV A;  3RCG A;  2RH6 A;  3ERE D;  1OCA A;  4J5A X;  4N1O A;  3K0N A;  2CMT A;  5KUV A;  2NUL A;  4O8H A;  4GTL A;  5CCN A;  5KUS A;  2P0O A;  2MZU A;  2XCQ A;  1XXC A;  1V9T A;  2RMA A;  5KUO A;  3RDD A;  4EYV A;  2R7Z A;  5DUD A;  3ICI A;  3AQO A;  1TWH A;  5CCQ A;  1VBS A;  2QER A;  1WQF A;  1M63 C;  4DGE A;  2NVX A;  1M9F A;  3RCK X;  1CWO A;  5CJ9 A;  3RDB A;  3CAG A;  2XCR B;  4N1M A;  2X2A A;  2JA7 A;  4KB2 A;  2OJU A;  1DYW A;  2HQJ A;  4YUH A;  2GSU A;  2A2N A;  3RD9 X;  1B4A A;  5IOQ A;  1B4B A;  2GSN A;  4BLB A;  5JHE A;  1QNG A;  3MML A;  4KAW X;  1BCK A;  2R93 A;  1O2A A;  3N3Y A;  4P5A A;  2BIT X;  4J58 A;  1ZBS A;  3R54 A;  1O2B A;  1CYN A;  4KAS A;  1CWI A;  2MC9 A;  2RMB A;  4J5C X;  4FRV A;  5F66 A;  5KV0 A;  5TJ3 A;  3RCL A;  4J5B A;  2FU0 A;  3VA7 A;  4S1J A;  4GTA A;  2N0T A;  3PMP A;  1M9C A;  5A0E A;  1M9X A;  1NMK A;  3MML B;  2CPL A;  4C2M C;  1ZKC A;  5KUR A;  4YUI A;  1CWK A;  3Q3Q A;  4DGD A;  1VAI A;  1TWF A;  4C3J C;  2RGR A;  2X83 B;  3K0Q A;  1TWG A;  3LPX A;  2HAQ A;  4LQW A;  4JJM A;  2CFE A;  1IHG A;  4GTC A;  1MZW A;  2POY A;  5KV7 A;  3N0C A;  5KV6 A;  2IGW A;  1AWR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...