3OREA

Crystal structure of ttha0988 in space group p6522
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
492
structure length
481
Chain Sequence
VRGFYLRFGEGVSEEANRRALALAEALLRAPPPGLLDAVPAYGVLYLEYDPRRLSRGRLLRLLKGLRVVEIPVRYDGEDLPEVASRLGLSLEAVKALHQKPLYRVYALGFTPGFPFLAEVEPALRLPRKPHPRPRVPAHAVAVAGVQTGIYPLPSPGGWNLLGTSLVAVYDPHRETPFLLRPGDRVRFLEAEGPTPPEPRPLELLPEEPRLPALLVEEPGLMDLVVDGGRFLGGHLGLARSGPLDAPSARLANRLVGNGAGAPLLEFAYKGPVLTALRDLVAAFAGYGFVALLEGEEIPPGQSFLWPRGKTLRFRPRGPGVRGYLAVAGGLEVRPFLGSASPDLRGRIGRPLWAGDVLGLEALRPVRPGRAFPQRPLPEAFRLRLLPGPQEAFRALCSGPFRVARADRVGVELLGPEVPGGEGLSEPTPLGGVQVPPSGRPLVLLADKGSLGGYAKPALVDPRDLWLLGQARPGVEIHFTS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure of TTHA0988 from Thermus thermophilus, a KipI-KipA homologue incorrectly annotated as an allophanate hydrolase
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Structural genomics, unknown function
molecule keywords Putative uncharacterized protein TTHA0988
total genus 119
structure length 481
sequence length 492
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-09-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02626 CT_A_B Carboxyltransferase domain, subdomain A and B
A PF02682 CT_C_D Carboxyltransferase domain, subdomain C and D
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.100.10 Mainly Beta Beta Barrel Cyclophilin Cyclophilin-like 3oreA02
2.40.100.10 Mainly Beta Beta Barrel Cyclophilin Cyclophilin-like 3oreA04
3.30.1360.40 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 3oreA01
5CBTA 2POEA 1CWBA 5KUQA 2ALFA 2PHCB 5DUDA 5CBWA 5CBUA 1QNGA 5KV3A 1EH1A 4DGEA 2N0TA 4TOTA 1A58A 1V9TA 1BCKA 4J5DX 3RCLA 5KV4A 5KUZA 1CWLA 5CJ9A 3FOFA 4YUKA 1M9FA 1YNDA 2X2DB 5JVOA 3R57A 4N1MA 1XYHA 3ICIA 2P0OA 4YULA 1MZWA 2HQ6A 2NULA 2RMAA 1AWUA 3K0RA 1AWQA 3OPFA 3RD9X 5JHEA 2HQJA 2QERA 2ZP2A 2ZFZA 3FOEA 2X2AA 4G0WA 1M63C 3R49A 5KUVA 1ISEA 2CFEA 2C3BA 1WQFA 3RCFA 2BITX 1IHGA 5LUDA 1ZKFA 4N1QA 5KUUA 3VA7A 1WIHA 3CAGA 4YUOA 4YUIA 3RDDA 5KV5A 3BT8A 1WQHA 4LQWA 1X7FA 2X7KA 4J5CX 4S1EA 4J59A 1ZVUA 1W8VA 2MVZA 1IIPA 3RFYA 4EYVA 2CYHA 5KV6A 3RCGA 2OSEA 3BO7A 3NUHA 4FM9A 3LAPA 1ZKCA 4R3EA 3PMPA 2RMBA 4N1PA 3ICHA 2CPLA 1XQ7A 3BUEA 5A0EA 4DGDA 1Z81A 2RMCA 2A2NA 2X83B 3RCIX 1XXAA 3L4JA 2R99A 1AWVA 4KC6A 2HAQA 4N1SA 3L4KA 3K0MA 2XCQA 2X2CK 4KB2A 1E8KA 4IPZA 4R3FA 4KB4A 2P5MA 3CYHA 2RGRA 1CWKA 4YUHA 1CWJA 4I9YA 3K0NA 5KV7A 3LPXA 4O8HA 4ZSCA 4CYHA 1AWRA 2MS4A 4YUJA 3K0PA 2MC9A 1MIKA 5KV2A 3FHZA 1ZMFA 1CYNA 4DGCA 2CMTA 2XGYB 1XXBA 2IGWA 4YUNA 4JJMA 3T1UA 3OREA 2OJUA 5KV0A 4XNCA 3O7TA 3LAJA 4N1NA 2WFJA 4E1QA 1ISTA 1M9EA 1F9NA 1W8LA 5KUWA 3K2CA 1VBSA 1OCAA 1RMHA 2Z6WA 3JB9d 1WQGA 4N1RA 3V4GA 1CWCA 1CWIA 1LOPA 1H0PA 3MMLA 4J3NA 1AK4A 1B4AA 2HE9A 3R56A 3RCKX 1QOIA 5CCNA 1A33A 3R54A 1BGWA 4J5AX 1J2AA 3BKPA 4G0UA 1EK8A 5F66A 5KURA 3UCHA 1E3BA 4YUGA 5CCRA 2IGVA 1C5FA 2RS4A 4J58A 2POYA 5KUSA 3MMLB 1B4BA 4GFQA 1M9YA 3ERED 2ESLA 3K0OA 1GE9A 1VBTA 3ODIA 1AWTA 1CWAA 4JCPA 1CWOA 5KV1A 1M9DA 1XWNA 2GW2A 1AB4A 2OK3A 5KUOA 1CWFA 3CYSA 2BIUX 5CBVA 2CK1A 1IS1A 4YUPA 4J5BA 3R4GA 3RDBA 4DGAA 4J5EX 3K0QA 4ZSDA 1M9CA 3RDCA 1QNHA 3RDAX 4FRVA 4HY7A 1BJTA 5KUNA 4YUMA 2KWAA 4O8IA 4DGBA 3R59A 4KDDA 4S1JA 5CCQA 1FGLA 1DYWA 1DD5A 4KAWX 2K7NA 4FRUA 1CWMA 2XCRB 1CWHA 3EOVA 3QX3A 4DDQA 5KULA 1VDNA 4N1OA 5CCSX 4G0VA 3OEPA 1MF8C 2MZUA 2WFIA 3QYUA 1XO7A 2PLUA 5CYHA 1CLHA 1XXCA 1W8MA 2WLWA 2XCOA 1AWSA 3S6MA 2FU0A 3ODLA 1VAIA 1M9XA 2B71A 1W74A 2Y3PA 1NMKA 2X25B
chains in the Genus database with same CATH superfamily
2GAGC 4GTFA 5KUQA 2A6HA 2ALFA 2PHCB 5DUDA 5CBWA 2CFAA 4RMFA 5KV3A 4GTCA 1EH1A 4TOTA 3GTMC 1V9TA 2A69A 2KA0A 1HQMA 3EQLA 4BKWA 3RCLA 5CJ9A 3BP3A 3FOFA 2EBBA 3HOVK 1YNDA 1Y1WK 4GTDA 3GTQA 5JVOA 3HOZC 2P0OA 3I4MK 1MZWA 2RMAA 3K0RA 4WILA 3HOWC 2NVXA 2QERA 2ZP2A 4M1XA 5M5XK 2B63K 2NVTK 1DCOA 2O5JA 4G0WA 3H3VL 1WOOA 1IHGA 4OIOA 1ZKFA 4A3CC 1TWCA 1WIHA 3K7AC 1Y1VA 1WQHA 3G4CA 4LQWA 1X7FA 2X7KA 4KM8A 3T02A 4J59A 4C3HK 4G7HA 4Y52K 3RFYA 2GAHC 1KQ4A 1O2AA 4YG2A 4GZYA 2WAQD 5C3EK 2JA6K 1ZKCA 2VUMK 2RMBA 1XQ7A 5A0EA 3L4JA 3RCIX 3Q3QA 5IP7K 2PPBA 2R92C 3N3YA 1IE0A 2WAQL 2D6FC 4A3FC 1E8KA 4LK0A 2YU9K 2Y0SD 3SZZA 1K83K 3AH5A 2P5MA 1I3QA 4A3MC 2JA6A 4YUHA 1CWJA 5EGHA 3I4NC 3LPXA 4O8HA 1J6VA 4CYHA 2PMZD 3GTJC 4YUJA 1MIKA 5KV2A 3GSIA 1ZMFA 4YFNA 1O26A 4DGCA 1O2FB 4A3FK 1XXBA 4KASA 4YUNA 4JJMA 4XNCA 4N1NA 4WJ4A 1I3QK 1BS2A 1W8LA 1VBSA 2Z6WA 3JB9d 3GTQK 5C4XK 3V4GA 1LOPA 3ADAC 1AK4A 3TTGA 2NVQC 4P5BA 5CCNA 3R54A 1BGWA 4C3JK 1E3BA 3GEIA 3FKIK 1TWGK 2RS4A 4A3DC 2POYA 4A3IK 3DXJA 1F7VA 1EFWA 4QIWL 3K0OA 3HOUK 3ODIA 2CW0A 1CWAA 1CWOA 2NVYC 4QJVA 3KOPA 2BIUX 3AQOA 3R4GA 4C2MK 1TWCC 4ZSDA 1Y1VC 3RDCA 2JA7K 3GTMK 4P5AA 1ZXOA 4YUMA 4DGBA 4A3IC 4KDDA 2E2JC 1FGLA 3HOZK 1O28A 1PJ7A 4FRUA 1R9TK 1L0WA 3EOVA 4DDQA 4BY1C 4PABA 5CYHA 1CLHA 2XCOA 3AD7C 2R92A 3S6MA 3GEHA 4BY7K 1SMYA 4G7ZA 4KN4A 2JA5C 3GTLA 1XPPA 3A8KA 1CWBA 4BXXC 1I3QC 5C3EC 2JA6C 1QNGA 3GTKK 2PA8L 4DGEA 1BCKA 4J5DX 1ZYRA 3TFIA 5KUZA 1CWLA 3HXAA 3GTOK 4YULA 3ICIA 2HQ6A 2NULA 5JHEA 2ZFZA 1TWAK 2PA8D 4A3EK 4A3EC 2HQJA 2E2IK 2W7VA 4Q4ZA 3WODA 2E2HK 3RZOK 3R49A 5KUVA 1ISEA 3H0GC 4AH6A 5IOSA 4LLGA 5M3FK 3RCFA 4BLAA 4P9SA 4C45A 4YUOA 1WORA 1JOEA 2MVZA 5KV6A 5M5YK 3S2HK 1USOA 2OSEA 4MQ9A 3NUHA 1YNJA 3LAPA 3S2DC 4KM9A 1V5VA 3BUEA 4DGDA 2PMZL 2X83B 2A2NA 1XXAA 2R99A 2NVXK 4MEXA 2NVQK 3K0MA 5E68A 2X2CK 2NVYA 5TMFA 3CYHA 1I50C 1SFOK 2RGRA 2JA8K 1O29A 4I9YA 1TWCK 5KV7A 3HOYC 5M3MK 1AWRA 2MC9A 2R93A 3I4MC 2CMTA 3HOUC 3M4OK 2VUMA 3OREA 1M9EA 1F9NA 4AYBL 3K2CA 3HKZL 4BBSK 4N1RA 1CWIA 3MMLA 1Y1VK 2JA5A 1B4AA 3GTLC 3RCKX 2RH6A 4G0UA 3RZOC 3BKPA 5C44K 5F66A 5KURA 1ZX8A 4YUGA 4KARA 5FLMC 4LR2A 1PJ6A 1INNA 1VGXA 4GFQA 2BE5A 1BDFA 3GEEA 1J98A 1GE9A 4C3HC 4Y52C 1AWTA 5JFEA 5KV1A 1M9DA 3GTLK 1AB4A 2E2HC 3TFJA 1O27A 1VLOA 1CWFA 3H0GA 4A3GK 2CK1A 4J5BA 3IPJA 3RDBA 4BLBA 4J5EX 1VH2A 3GTGC 3H3VD 5IOQA 3A8IA 3RDAX 5L46A 4HY7A 5C4XC 1I6HC 4O8IA 3GTOC 3RZDK 3R59A 4S1JA 3HOXK 1DD5A 4KAWX 1EQRA 4G7OA 5M5WK 3QX3A 1K83A 5CCSX 1XZQB 2V6SA 5IOTA 4G0VA 1MF8C 2MZUA 4YFXA 3PO3K 1TWHA 1XO7A 2PLUA 1XXCA 2WLWA 3T00A 1AWSA 2FU0A 3S1RK 1W74A 1NMKA 1DCPA 3S15C 3SZYA 1I50A 5CBUA 1SFOC 2N0TA 3K7AK 5KV4A 4KMAA 1XZPA 4YUKA 1IL2A 1WSVA 4PAAA 3R57A 4N1MA 4KATA 2R93C 1IW7A 3GTPC 3OPFA 4XCHA 3HOWK 2VUMC 3TFHA 4YFKA 4Y7NK 5C44C 4A3JC 1M63C 3S2HC 2CFEA 3VA7A 5LUDA 3CAGA 4N1QA 1YCLA 1ZVUA 1W8VA 1IIPA 2E2JK 1WCMA 4EYVA 3S16K 3H0GK 2ZUEA 4KN7A 2R93K 3BO7A 2NVTC 4FM9A 4R3EA 1WOSA 3PMPA 4OINA 5EGEA 4Y7NC 4WJ3M 4N1PA 3ICHA 3CQZC 4GT9A 5IYDK 4KMHA 1Z81A 4QIWD 2JA8C 3PO2C 3HOYK 1AWVA 5C4JK 2HAQA 2E2IA 4JK1A 1WCMK 2E2HA 4KB4A 4BXXK 4AYBD 3GTKA 2V6UA 1TWHK 3K0NA 3GTGA 3CQZK 5IYDC 2O5IA 3S1RC 2ZUFA 3GTOA 2MS4A 3GTJK 3HOXC 1CYNA 4MEYA 2IGWA 5KV0A 4GTLA 5C4JC 4Q5SA 2OJUA 3LAJA 3O7TA 2WFJA 1K83C 1ISTA 4A3MK 2NNZA 2YU9C 3GDZA 3N0CA 3S14C 1TWHC 5HL8A 1OCAA 1WQGA 3AD9C 1CWCA 1IBAA 4J3NA 3M4OC 4A93K 2NVYK 4A3JK 2HE9A 2B63A 3R56A 1QOIA 3RZDC 1SFOA 4J5AX 1J2AA 3M3YK 3M3YC 5IP9C 4A3KK 2P8TA 1JQWA 2GSUA 3S1QC 5CCRA 2IGVA 1C5FA 4J58A 3FKIC 3GIRA 3S14K 5KUSA 1ZBSA 1B4BA 1M9YA 3G4AA 3GTPA 5TJ3A 1VBTA 3JSTA 4C3IC 2A6EA 4JCPA 3S15K 5CHPA 1XWNA 1X31C 2OK3A 5KUOA 3CYSA 5CBVA 4YUPA 2Y0SL 3S2DK 1RU0A 1YNNA 2R7ZK 1BJTA 5KUNA 5D4DA 2KWAA 4NOIA 1WCMC 5CCQA 1DYWA 1YX2A 4LOWA 3S1NC 1R9TC 1CWMA 1PJ5A 3T01A 5KULA 3CQZA 1VDNA 4N1OA 4C2MC 3A8JA 1C0AA 2WB1D 4A3BC 4A3BK 3ODLA 2R7ZA 2E2IC 2B71A 1TWAC 3T1UA 2X25B 4ZH4A 5CBTA 2POEA 2GSNA 3GTKC 3S16C 4LJZA 1A58A 3GTGK 4LK1A 1TWFC 5IP7C 1M9FA 4XLPA 2R92K 2X2DB 4KC6A 1XYHA 4ILDA 3RD9X 1AWUA 2JA5K 1AWQA 3FOEA 3S1MK 4BY7C 4C3JC 4BBRK 4BBRC 1VRQC 1IQ0A 2X2AA 4GTBA 2YU9A 3AD8C 5IYBC 2C3BA 1WQFA 2BITX 5KUUA 4YUIA 1TWFK 3RDDA 5KV5A 3BT8A 4C3IK 4J5CX 4S1EA 4XLNA 2B63C 1J6XA 2CYHA 3RCGA 4QJVB 2JH3A 4OIQA 4A3CK 3S1MC 2CFAB 3S1QK 3FKIA 1J6WA 1TWGA 2JA7A 2CPLA 4KMDA 3PO3C 2RMCA 3HOVC 1Y1WC 4N1SA 1VJEA 3L4KA 2XCQA 4KB2A 1XZQA 4A93C 4IPZA 4R3FA 1CWKA 1ZQ1C 3GTMA 1O24A 4O2DA 4ZSCA 4X6AK 1WOPA 3K0PA 1UV7A 3GTQC 3FHZA 4OIPA 3GTPK 1F93A 2XGYB 1R9TA 2NVXC 2FQOA 1HI9A 4E1QA 1DCHA 5FLMK 5KUWA 4GTAA 1RMHA 5FJ8K 3PO2K 2WB1L 4GTEA 2R7ZC 1H0PA 1TWAA 4X6AC 4XSXA 1A33A 3S0XA 3BP8C 1EK8A 3S1NK 3HKZD 4A3LK 3UCHA 3I4NK 1TWFA 3MMLB 1JVIA 1I6HK 4BBSC 3ERED 2ESLA 5IYCC 5IYCK 4OIRA 4KMUA 5IP9K 5TMCA 4A3KC 2GW2A 4A3GC 4A3DK 1IS1A 3N0BA 3S17C 4A3LC 4DGAA 3K0QA 1O2BA 1M9CA 4BY1K 1QNHA 2A68A 4FRVA 2FQTA 2V6TA 1EI6A 3GTJA 3X27A 1I50K 2K7NA 1USMA 1WSRA 2XCRB 1CWHA 1TWGC 2JA7C 1G51A 5IORA 5IYBK 3OEPA 2WFIA 1F7UA 3S17K 3QYUA 4LQYA 2GSOA 1W8MA 1Y1WA 2Y3PA 4FZBA 1XZPB 1VAIA 1M9XA 3AQPA 4XSZA 1O25A 1I6VA
chains in the Genus database with same CATH topology
4GTFA 5KUQA 2CFAA 2ALFA 2PHCB 5DUDA 5CBWA 5KV3A 4GTCA 1EH1A 4TOTA 1V9TA 4BKWA 3RCLA 5CJ9A 3FOFA 1YNDA 4GTDA 3GTQA 5JVOA 2P0OA 1MZWA 2RMAA 3K0RA 2NVXA 2QERA 2ZP2A 4M1XA 4G0WA 1IHGA 1ZKFA 1TWCA 1WIHA 1Y1VA 1WQHA 3G4CA 4LQWA 1X7FA 2X7KA 4KM8A 4J59A 3RFYA 1KQ4A 1O2AA 1ZKCA 2RMBA 1XQ7A 5A0EA 3L4JA 3RCIX 3Q3QA 3N3YA 1E8KA 3AH5A 2P5MA 1I3QA 2JA6A 4YUHA 1CWJA 5EGHA 3LPXA 4O8HA 4CYHA 4YUJA 1MIKA 5KV2A 1ZMFA 1O26A 4DGCA 1XXBA 4KASA 4YUNA 4JJMA 4XNCA 4N1NA 1W8LA 1VBSA 2Z6WA 3JB9d 3V4GA 1LOPA 1AK4A 4P5BA 5CCNA 3R54A 1BGWA 1E3BA 2RS4A 2POYA 3K0OA 3ODIA 1CWAA 1CWOA 2BIUX 3AQOA 3R4GA 4ZSDA 3RDCA 4P5AA 1ZXOA 4YUMA 4DGBA 4KDDA 1FGLA 1O28A 4FRUA 3EOVA 4DDQA 5CYHA 1CLHA 2XCOA 2R92A 3S6MA 3GTLA 1CWBA 1QNGA 4DGEA 1BCKA 4J5DX 5KUZA 1CWLA 4YULA 3ICIA 2HQ6A 2NULA 5JHEA 2ZFZA 2HQJA 3R49A 5KUVA 1ISEA 5IOSA 3RCFA 4BLAA 4YUOA 2MVZA 5KV6A 2OSEA 3NUHA 3LAPA 4KM9A 3BUEA 4DGDA 2X83B 2A2NA 1XXAA 2R99A 3K0MA 2X2CK 2NVYA 3CYHA 2RGRA 1O29A 4I9YA 5KV7A 1AWRA 2MC9A 2R93A 2CMTA 2VUMA 3OREA 1M9EA 1F9NA 3K2CA 4N1RA 1CWIA 3MMLA 2JA5A 1B4AA 3RCKX 2RH6A 4G0UA 3BKPA 5F66A 5KURA 4YUGA 4KARA 4LR2A 4GFQA 1GE9A 4C3HC 5JFEA 1AWTA 5KV1A 1M9DA 1AB4A 1O27A 1CWFA 3H0GA 2CK1A 4J5BA 3RDBA 4BLBA 4J5EX 5IOQA 3RDAX 4HY7A 4O8IA 3R59A 4S1JA 1DD5A 4KAWX 3QX3A 1K83A 5CCSX 5IOTA 4G0VA 1MF8C 2MZUA 1TWHA 1XO7A 2PLUA 1XXCA 2WLWA 1AWSA 2FU0A 1W74A 1NMKA 1I50A 5CBUA 2N0TA 5KV4A 4KMAA 4YUKA 4KATA 3R57A 4N1MA 3OPFA 1M63C 2CFEA 3VA7A 5LUDA 3CAGA 4N1QA 1ZVUA 1W8VA 1IIPA 1WCMA 4EYVA 3BO7A 4FM9A 4R3EA 3PMPA 5EGEA 4N1PA 3ICHA 4GT9A 4KMHA 1Z81A 1AWVA 2HAQA 2E2IA 2E2HA 4KB4A 3GTKA 3K0NA 3GTGA 3GTOA 2MS4A 1CYNA 2IGWA 5KV0A 4GTLA 2OJUA 3LAJA 3O7TA 2WFJA 1ISTA 3N0CA 1OCAA 1WQGA 1CWCA 4J3NA 2HE9A 2B63A 3R56A 1QOIA 1SFOA 4J5AX 1J2AA 2GSUA 5CCRA 2IGVA 1C5FA 4J58A 5KUSA 1ZBSA 1B4BA 1M9YA 3G4AA 3GTPA 5TJ3A 1VBTA 4C3IC 4JCPA 5CHPA 1XWNA 2OK3A 5KUOA 3CYSA 5CBVA 4YUPA 1BJTA 5KUNA 2KWAA 5CCQA 1DYWA 1CWMA 5KULA 3CQZA 1VDNA 4N1OA 4C2MC 3ODLA 2R7ZA 2B71A 3T1UA 2X25B 5CBTA 2POEA 2GSNA 1A58A 1M9FA 2X2DB 4KC6A 1XYHA 4ILDA 3RD9X 1AWUA 1AWQA 3FOEA 4C3JC 2X2AA 4GTBA 2YU9A 2C3BA 1WQFA 2BITX 5KUUA 4YUIA 3RDDA 5KV5A 3BT8A 4J5CX 4S1EA 2CYHA 3RCGA 2JH3A 2CFAB 3FKIA 1TWGA 2JA7A 2CPLA 4KMDA 2RMCA 4N1SA 3L4KA 2XCQA 4KB2A 4IPZA 4R3FA 1CWKA 3GTMA 1O24A 4ZSCA 3K0PA 3FHZA 2XGYB 1R9TA 4E1QA 5KUWA 4GTAA 1RMHA 4GTEA 1H0PA 1TWAA 1A33A 3S0XA 1EK8A 3UCHA 1TWFA 3MMLB 3ERED 2ESLA 2GW2A 1IS1A 3N0BA 4DGAA 3K0QA 1O2BA 1M9CA 1QNHA 4FRVA 3GTJA 2K7NA 2XCRB 1CWHA 5IORA 3OEPA 2WFIA 3QYUA 4LQYA 1W8MA 1Y1WA 4FZBA 2Y3PA 1VAIA 1M9XA 3AQPA 1O25A 2GSOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CBT A;  2POE A;  1CWB A;  5KUQ A;  2ALF A;  2PHC B;  5DUD A;  5CBW A;  5CBU A;  1QNG A;  5KV3 A;  1EH1 A;  4DGE A;  2N0T A;  4TOT A;  1A58 A;  1V9T A;  1BCK A;  4J5D X;  3RCL A;  5KV4 A;  5KUZ A;  1CWL A;  5CJ9 A;  3FOF A;  4YUK A;  1M9F A;  1YND A;  2X2D B;  5JVO A;  3R57 A;  4N1M A;  1XYH A;  3ICI A;  2P0O A;  4YUL A;  1MZW A;  2HQ6 A;  2NUL A;  2RMA A;  1AWU A;  3K0R A;  1AWQ A;  3OPF A;  3RD9 X;  5JHE A;  2HQJ A;  2QER A;  2ZP2 A;  2ZFZ A;  3FOE A;  2X2A A;  4G0W A;  1M63 C;  3R49 A;  5KUV A;  1ISE A;  2CFE A;  2C3B A;  1WQF A;  3RCF A;  2BIT X;  1IHG A;  5LUD A;  1ZKF A;  4N1Q A;  5KUU A;  3VA7 A;  1WIH A;  3CAG A;  4YUO A;  4YUI A;  3RDD A;  5KV5 A;  3BT8 A;  1WQH A;  4LQW A;  1X7F A;  2X7K A;  4J5C X;  4S1E A;  4J59 A;  1ZVU A;  1W8V A;  2MVZ A;  1IIP A;  3RFY A;  4EYV A;  2CYH A;  5KV6 A;  3RCG A;  2OSE A;  3BO7 A;  3NUH A;  4FM9 A;  3LAP A;  1ZKC A;  4R3E A;  3PMP A;  2RMB A;  4N1P A;  3ICH A;  2CPL A;  1XQ7 A;  3BUE A;  5A0E A;  4DGD A;  1Z81 A;  2RMC A;  2A2N A;  2X83 B;  3RCI X;  1XXA A;  3L4J A;  2R99 A;  1AWV A;  4KC6 A;  2HAQ A;  4N1S A;  3L4K A;  3K0M A;  2XCQ A;  2X2C K;  4KB2 A;  1E8K A;  4IPZ A;  4R3F A;  4KB4 A;  2P5M A;  3CYH A;  2RGR A;  1CWK A;  4YUH A;  1CWJ A;  4I9Y A;  3K0N A;  5KV7 A;  3LPX A;  4O8H A;  4ZSC A;  4CYH A;  1AWR A;  2MS4 A;  4YUJ A;  3K0P A;  2MC9 A;  1MIK A;  5KV2 A;  3FHZ A;  1ZMF A;  1CYN A;  4DGC A;  2CMT A;  2XGY B;  1XXB A;  2IGW A;  4YUN A;  4JJM A;  3T1U A;  3ORE A;  2OJU A;  5KV0 A;  4XNC A;  3O7T A;  3LAJ A;  4N1N A;  2WFJ A;  4E1Q A;  1IST A;  1M9E A;  1F9N A;  1W8L A;  5KUW A;  3K2C A;  1VBS A;  1OCA A;  1RMH A;  2Z6W A;  3JB9 d;  1WQG A;  4N1R A;  3V4G A;  1CWC A;  1CWI A;  1LOP A;  1H0P A;  3MML A;  4J3N A;  1AK4 A;  1B4A A;  2HE9 A;  3R56 A;  3RCK X;  1QOI A;  5CCN A;  1A33 A;  3R54 A;  1BGW A;  4J5A X;  1J2A A;  3BKP A;  4G0U A;  1EK8 A;  5F66 A;  5KUR A;  3UCH A;  1E3B A;  4YUG A;  5CCR A;  2IGV A;  1C5F A;  2RS4 A;  4J58 A;  2POY A;  5KUS A;  3MML B;  1B4B A;  4GFQ A;  1M9Y A;  3ERE D;  2ESL A;  3K0O A;  1GE9 A;  1VBT A;  3ODI A;  1AWT A;  1CWA A;  4JCP A;  1CWO A;  5KV1 A;  1M9D A;  1XWN A;  2GW2 A;  1AB4 A;  2OK3 A;  5KUO A;  1CWF A;  3CYS A;  2BIU X;  5CBV A;  2CK1 A;  1IS1 A;  4YUP A;  4J5B A;  3R4G A;  3RDB A;  4DGA A;  4J5E X;  3K0Q A;  4ZSD A;  1M9C A;  3RDC A;  1QNH A;  3RDA X;  4FRV A;  4HY7 A;  1BJT A;  5KUN A;  4YUM A;  2KWA A;  4O8I A;  4DGB A;  3R59 A;  4KDD A;  4S1J A;  5CCQ A;  1FGL A;  1DYW A;  1DD5 A;  4KAW X;  2K7N A;  4FRU A;  1CWM A;  2XCR B;  1CWH A;  3EOV A;  3QX3 A;  4DDQ A;  5KUL A;  1VDN A;  4N1O A;  5CCS X;  4G0V A;  3OEP A;  1MF8 C;  2MZU A;  2WFI A;  3QYU A;  1XO7 A;  2PLU A;  5CYH A;  1CLH A;  1XXC A;  1W8M A;  2WLW A;  2XCO A;  1AWS A;  3S6M A;  2FU0 A;  3ODL A;  1VAI A;  1M9X A;  2B71 A;  1W74 A;  2Y3P A;  1NMK A;  2X25 B; 
#chains in the Genus database with same CATH topology
 2GAG C;  4GTF A;  5KUQ A;  2A6H A;  2ALF A;  2PHC B;  5DUD A;  5CBW A;  2CFA A;  4RMF A;  5KV3 A;  4GTC A;  1EH1 A;  4TOT A;  3GTM C;  1V9T A;  2A69 A;  2KA0 A;  1HQM A;  3EQL A;  4BKW A;  3RCL A;  5CJ9 A;  3BP3 A;  3FOF A;  2EBB A;  3HOV K;  1YND A;  1Y1W K;  4GTD A;  3GTQ A;  5JVO A;  3HOZ C;  2P0O A;  3I4M K;  1MZW A;  2RMA A;  3K0R A;  4WIL A;  3HOW C;  2NVX A;  2QER A;  2ZP2 A;  4M1X A;  5M5X K;  2B63 K;  2NVT K;  1DCO A;  2O5J A;  4G0W A;  3H3V L;  1WOO A;  1IHG A;  4OIO A;  1ZKF A;  4A3C C;  1TWC A;  1WIH A;  3K7A C;  1Y1V A;  1WQH A;  3G4C A;  4LQW A;  1X7F A;  2X7K A;  4KM8 A;  3T02 A;  4J59 A;  4C3H K;  4G7H A;  4Y52 K;  3RFY A;  2GAH C;  1KQ4 A;  1O2A A;  4YG2 A;  4GZY A;  2WAQ D;  5C3E K;  2JA6 K;  1ZKC A;  2VUM K;  2RMB A;  1XQ7 A;  5A0E A;  3L4J A;  3RCI X;  3Q3Q A;  5IP7 K;  2PPB A;  2R92 C;  3N3Y A;  1IE0 A;  2WAQ L;  2D6F C;  4A3F C;  1E8K A;  4LK0 A;  2YU9 K;  2Y0S D;  3SZZ A;  1K83 K;  3AH5 A;  2P5M A;  1I3Q A;  4A3M C;  2JA6 A;  4YUH A;  1CWJ A;  5EGH A;  3I4N C;  3LPX A;  4O8H A;  1J6V A;  4CYH A;  2PMZ D;  3GTJ C;  4YUJ A;  1MIK A;  5KV2 A;  3GSI A;  1ZMF A;  4YFN A;  1O26 A;  4DGC A;  1O2F B;  4A3F K;  1XXB A;  4KAS A;  4YUN A;  4JJM A;  4XNC A;  4N1N A;  4WJ4 A;  1I3Q K;  1BS2 A;  1W8L A;  1VBS A;  2Z6W A;  3JB9 d;  3GTQ K;  5C4X K;  3V4G A;  1LOP A;  3ADA C;  1AK4 A;  3TTG A;  2NVQ C;  4P5B A;  5CCN A;  3R54 A;  1BGW A;  4C3J K;  1E3B A;  3GEI A;  3FKI K;  1TWG K;  2RS4 A;  4A3D C;  2POY A;  4A3I K;  3DXJ A;  1F7V A;  1EFW A;  4QIW L;  3K0O A;  3HOU K;  3ODI A;  2CW0 A;  1CWA A;  1CWO A;  2NVY C;  4QJV A;  3KOP A;  2BIU X;  3AQO A;  3R4G A;  4C2M K;  1TWC C;  4ZSD A;  1Y1V C;  3RDC A;  2JA7 K;  3GTM K;  4P5A A;  1ZXO A;  4YUM A;  4DGB A;  4A3I C;  4KDD A;  2E2J C;  1FGL A;  3HOZ K;  1O28 A;  1PJ7 A;  4FRU A;  1R9T K;  1L0W A;  3EOV A;  4DDQ A;  4BY1 C;  4PAB A;  5CYH A;  1CLH A;  2XCO A;  3AD7 C;  2R92 A;  3S6M A;  3GEH A;  4BY7 K;  1SMY A;  4G7Z A;  4KN4 A;  2JA5 C;  3GTL A;  1XPP A;  3A8K A;  1CWB A;  4BXX C;  1I3Q C;  5C3E C;  2JA6 C;  1QNG A;  3GTK K;  2PA8 L;  4DGE A;  1BCK A;  4J5D X;  1ZYR A;  3TFI A;  5KUZ A;  1CWL A;  3HXA A;  3GTO K;  4YUL A;  3ICI A;  2HQ6 A;  2NUL A;  5JHE A;  2ZFZ A;  1TWA K;  2PA8 D;  4A3E K;  4A3E C;  2HQJ A;  2E2I K;  2W7V A;  4Q4Z A;  3WOD A;  2E2H K;  3RZO K;  3R49 A;  5KUV A;  1ISE A;  3H0G C;  4AH6 A;  5IOS A;  4LLG A;  5M3F K;  3RCF A;  4BLA A;  4P9S A;  4C45 A;  4YUO A;  1WOR A;  1JOE A;  2MVZ A;  5KV6 A;  5M5Y K;  3S2H K;  1USO A;  2OSE A;  4MQ9 A;  3NUH A;  1YNJ A;  3LAP A;  3S2D C;  4KM9 A;  1V5V A;  3BUE A;  4DGD A;  2PMZ L;  2X83 B;  2A2N A;  1XXA A;  2R99 A;  2NVX K;  4MEX A;  2NVQ K;  3K0M A;  5E68 A;  2X2C K;  2NVY A;  5TMF A;  3CYH A;  1I50 C;  1SFO K;  2RGR A;  2JA8 K;  1O29 A;  4I9Y A;  1TWC K;  5KV7 A;  3HOY C;  5M3M K;  1AWR A;  2MC9 A;  2R93 A;  3I4M C;  2CMT A;  3HOU C;  3M4O K;  2VUM A;  3ORE A;  1M9E A;  1F9N A;  4AYB L;  3K2C A;  3HKZ L;  4BBS K;  4N1R A;  1CWI A;  3MML A;  1Y1V K;  2JA5 A;  1B4A A;  3GTL C;  3RCK X;  2RH6 A;  4G0U A;  3RZO C;  3BKP A;  5C44 K;  5F66 A;  5KUR A;  1ZX8 A;  4YUG A;  4KAR A;  5FLM C;  4LR2 A;  1PJ6 A;  1INN A;  1VGX A;  4GFQ A;  2BE5 A;  1BDF A;  3GEE A;  1J98 A;  1GE9 A;  4C3H C;  4Y52 C;  1AWT A;  5JFE A;  5KV1 A;  1M9D A;  3GTL K;  1AB4 A;  2E2H C;  3TFJ A;  1O27 A;  1VLO A;  1CWF A;  3H0G A;  4A3G K;  2CK1 A;  4J5B A;  3IPJ A;  3RDB A;  4BLB A;  4J5E X;  1VH2 A;  3GTG C;  3H3V D;  5IOQ A;  3A8I A;  3RDA X;  5L46 A;  4HY7 A;  5C4X C;  1I6H C;  4O8I A;  3GTO C;  3RZD K;  3R59 A;  4S1J A;  3HOX K;  1DD5 A;  4KAW X;  1EQR A;  4G7O A;  5M5W K;  3QX3 A;  1K83 A;  5CCS X;  1XZQ B;  2V6S A;  5IOT A;  4G0V A;  1MF8 C;  2MZU A;  4YFX A;  3PO3 K;  1TWH A;  1XO7 A;  2PLU A;  1XXC A;  2WLW A;  3T00 A;  1AWS A;  2FU0 A;  3S1R K;  1W74 A;  1NMK A;  1DCP A;  3S15 C;  3SZY A;  1I50 A;  5CBU A;  1SFO C;  2N0T A;  3K7A K;  5KV4 A;  4KMA A;  1XZP A;  4YUK A;  1IL2 A;  1WSV A;  4PAA A;  3R57 A;  4N1M A;  4KAT A;  2R93 C;  1IW7 A;  3GTP C;  3OPF A;  4XCH A;  3HOW K;  2VUM C;  3TFH A;  4YFK A;  4Y7N K;  5C44 C;  4A3J C;  1M63 C;  3S2H C;  2CFE A;  3VA7 A;  5LUD A;  3CAG A;  4N1Q A;  1YCL A;  1ZVU A;  1W8V A;  1IIP A;  2E2J K;  1WCM A;  4EYV A;  3S16 K;  3H0G K;  2ZUE A;  4KN7 A;  2R93 K;  3BO7 A;  2NVT C;  4FM9 A;  4R3E A;  1WOS A;  3PMP A;  4OIN A;  5EGE A;  4Y7N C;  4WJ3 M;  4N1P A;  3ICH A;  3CQZ C;  4GT9 A;  5IYD K;  4KMH A;  1Z81 A;  4QIW D;  2JA8 C;  3PO2 C;  3HOY K;  1AWV A;  5C4J K;  2HAQ A;  2E2I A;  4JK1 A;  1WCM K;  2E2H A;  4KB4 A;  4BXX K;  4AYB D;  3GTK A;  2V6U A;  1TWH K;  3K0N A;  3GTG A;  3CQZ K;  5IYD C;  2O5I A;  3S1R C;  2ZUF A;  3GTO A;  2MS4 A;  3GTJ K;  3HOX C;  1CYN A;  4MEY A;  2IGW A;  5KV0 A;  4GTL A;  5C4J C;  4Q5S A;  2OJU A;  3LAJ A;  3O7T A;  2WFJ A;  1K83 C;  1IST A;  4A3M K;  2NNZ A;  2YU9 C;  3GDZ A;  3N0C A;  3S14 C;  1TWH C;  5HL8 A;  1OCA A;  1WQG A;  3AD9 C;  1CWC A;  1IBA A;  4J3N A;  3M4O C;  4A93 K;  2NVY K;  4A3J K;  2HE9 A;  2B63 A;  3R56 A;  1QOI A;  3RZD C;  1SFO A;  4J5A X;  1J2A A;  3M3Y K;  3M3Y C;  5IP9 C;  4A3K K;  2P8T A;  1JQW A;  2GSU A;  3S1Q C;  5CCR A;  2IGV A;  1C5F A;  4J58 A;  3FKI C;  3GIR A;  3S14 K;  5KUS A;  1ZBS A;  1B4B A;  1M9Y A;  3G4A A;  3GTP A;  5TJ3 A;  1VBT A;  3JST A;  4C3I C;  2A6E A;  4JCP A;  3S15 K;  5CHP A;  1XWN A;  1X31 C;  2OK3 A;  5KUO A;  3CYS A;  5CBV A;  4YUP A;  2Y0S L;  3S2D K;  1RU0 A;  1YNN A;  2R7Z K;  1BJT A;  5KUN A;  5D4D A;  2KWA A;  4NOI A;  1WCM C;  5CCQ A;  1DYW A;  1YX2 A;  4LOW A;  3S1N C;  1R9T C;  1CWM A;  1PJ5 A;  3T01 A;  5KUL A;  3CQZ A;  1VDN A;  4N1O A;  4C2M C;  3A8J A;  1C0A A;  2WB1 D;  4A3B C;  4A3B K;  3ODL A;  2R7Z A;  2E2I C;  2B71 A;  1TWA C;  3T1U A;  2X25 B;  4ZH4 A;  5CBT A;  2POE A;  2GSN A;  3GTK C;  3S16 C;  4LJZ A;  1A58 A;  3GTG K;  4LK1 A;  1TWF C;  5IP7 C;  1M9F A;  4XLP A;  2R92 K;  2X2D B;  4KC6 A;  1XYH A;  4ILD A;  3RD9 X;  1AWU A;  2JA5 K;  1AWQ A;  3FOE A;  3S1M K;  4BY7 C;  4C3J C;  4BBR K;  4BBR C;  1VRQ C;  1IQ0 A;  2X2A A;  4GTB A;  2YU9 A;  3AD8 C;  5IYB C;  2C3B A;  1WQF A;  2BIT X;  5KUU A;  4YUI A;  1TWF K;  3RDD A;  5KV5 A;  3BT8 A;  4C3I K;  4J5C X;  4S1E A;  4XLN A;  2B63 C;  1J6X A;  2CYH A;  3RCG A;  4QJV B;  2JH3 A;  4OIQ A;  4A3C K;  3S1M C;  2CFA B;  3S1Q K;  3FKI A;  1J6W A;  1TWG A;  2JA7 A;  2CPL A;  4KMD A;  3PO3 C;  2RMC A;  3HOV C;  1Y1W C;  4N1S A;  1VJE A;  3L4K A;  2XCQ A;  4KB2 A;  1XZQ A;  4A93 C;  4IPZ A;  4R3F A;  1CWK A;  1ZQ1 C;  3GTM A;  1O24 A;  4O2D A;  4ZSC A;  4X6A K;  1WOP A;  3K0P A;  1UV7 A;  3GTQ C;  3FHZ A;  4OIP A;  3GTP K;  1F93 A;  2XGY B;  1R9T A;  2NVX C;  2FQO A;  1HI9 A;  4E1Q A;  1DCH A;  5FLM K;  5KUW A;  4GTA A;  1RMH A;  5FJ8 K;  3PO2 K;  2WB1 L;  4GTE A;  2R7Z C;  1H0P A;  1TWA A;  4X6A C;  4XSX A;  1A33 A;  3S0X A;  3BP8 C;  1EK8 A;  3S1N K;  3HKZ D;  4A3L K;  3UCH A;  3I4N K;  1TWF A;  3MML B;  1JVI A;  1I6H K;  4BBS C;  3ERE D;  2ESL A;  5IYC C;  5IYC K;  4OIR A;  4KMU A;  5IP9 K;  5TMC A;  4A3K C;  2GW2 A;  4A3G C;  4A3D K;  1IS1 A;  3N0B A;  3S17 C;  4A3L C;  4DGA A;  3K0Q A;  1O2B A;  1M9C A;  4BY1 K;  1QNH A;  2A68 A;  4FRV A;  2FQT A;  2V6T A;  1EI6 A;  3GTJ A;  3X27 A;  1I50 K;  2K7N A;  1USM A;  1WSR A;  2XCR B;  1CWH A;  1TWG C;  2JA7 C;  1G51 A;  5IOR A;  5IYB K;  3OEP A;  2WFI A;  1F7U A;  3S17 K;  3QYU A;  4LQY A;  2GSO A;  1W8M A;  1Y1W A;  2Y3P A;  4FZB A;  1XZP B;  1VAI A;  1M9X A;  3AQP A;  4XSZ A;  1O25 A;  1I6V A; 
#chains in the Genus database with same CATH homology
 4GTF A;  5KUQ A;  2CFA A;  2ALF A;  2PHC B;  5DUD A;  5CBW A;  5KV3 A;  4GTC A;  1EH1 A;  4TOT A;  1V9T A;  4BKW A;  3RCL A;  5CJ9 A;  3FOF A;  1YND A;  4GTD A;  3GTQ A;  5JVO A;  2P0O A;  1MZW A;  2RMA A;  3K0R A;  2NVX A;  2QER A;  2ZP2 A;  4M1X A;  4G0W A;  1IHG A;  1ZKF A;  1TWC A;  1WIH A;  1Y1V A;  1WQH A;  3G4C A;  4LQW A;  1X7F A;  2X7K A;  4KM8 A;  4J59 A;  3RFY A;  1KQ4 A;  1O2A A;  1ZKC A;  2RMB A;  1XQ7 A;  5A0E A;  3L4J A;  3RCI X;  3Q3Q A;  3N3Y A;  1E8K A;  3AH5 A;  2P5M A;  1I3Q A;  2JA6 A;  4YUH A;  1CWJ A;  5EGH A;  3LPX A;  4O8H A;  4CYH A;  4YUJ A;  1MIK A;  5KV2 A;  1ZMF A;  1O26 A;  4DGC A;  1XXB A;  4KAS A;  4YUN A;  4JJM A;  4XNC A;  4N1N A;  1W8L A;  1VBS A;  2Z6W A;  3JB9 d;  3V4G A;  1LOP A;  1AK4 A;  4P5B A;  5CCN A;  3R54 A;  1BGW A;  1E3B A;  2RS4 A;  2POY A;  3K0O A;  3ODI A;  1CWA A;  1CWO A;  2BIU X;  3AQO A;  3R4G A;  4ZSD A;  3RDC A;  4P5A A;  1ZXO A;  4YUM A;  4DGB A;  4KDD A;  1FGL A;  1O28 A;  4FRU A;  3EOV A;  4DDQ A;  5CYH A;  1CLH A;  2XCO A;  2R92 A;  3S6M A;  3GTL A;  1CWB A;  1QNG A;  4DGE A;  1BCK A;  4J5D X;  5KUZ A;  1CWL A;  4YUL A;  3ICI A;  2HQ6 A;  2NUL A;  5JHE A;  2ZFZ A;  2HQJ A;  3R49 A;  5KUV A;  1ISE A;  5IOS A;  3RCF A;  4BLA A;  4YUO A;  2MVZ A;  5KV6 A;  2OSE A;  3NUH A;  3LAP A;  4KM9 A;  3BUE A;  4DGD A;  2X83 B;  2A2N A;  1XXA A;  2R99 A;  3K0M A;  2X2C K;  2NVY A;  3CYH A;  2RGR A;  1O29 A;  4I9Y A;  5KV7 A;  1AWR A;  2MC9 A;  2R93 A;  2CMT A;  2VUM A;  3ORE A;  1M9E A;  1F9N A;  3K2C A;  4N1R A;  1CWI A;  3MML A;  2JA5 A;  1B4A A;  3RCK X;  2RH6 A;  4G0U A;  3BKP A;  5F66 A;  5KUR A;  4YUG A;  4KAR A;  4LR2 A;  4GFQ A;  1GE9 A;  4C3H C;  5JFE A;  1AWT A;  5KV1 A;  1M9D A;  1AB4 A;  1O27 A;  1CWF A;  3H0G A;  2CK1 A;  4J5B A;  3RDB A;  4BLB A;  4J5E X;  5IOQ A;  3RDA X;  4HY7 A;  4O8I A;  3R59 A;  4S1J A;  1DD5 A;  4KAW X;  3QX3 A;  1K83 A;  5CCS X;  5IOT A;  4G0V A;  1MF8 C;  2MZU A;  1TWH A;  1XO7 A;  2PLU A;  1XXC A;  2WLW A;  1AWS A;  2FU0 A;  1W74 A;  1NMK A;  1I50 A;  5CBU A;  2N0T A;  5KV4 A;  4KMA A;  4YUK A;  4KAT A;  3R57 A;  4N1M A;  3OPF A;  1M63 C;  2CFE A;  3VA7 A;  5LUD A;  3CAG A;  4N1Q A;  1ZVU A;  1W8V A;  1IIP A;  1WCM A;  4EYV A;  3BO7 A;  4FM9 A;  4R3E A;  3PMP A;  5EGE A;  4N1P A;  3ICH A;  4GT9 A;  4KMH A;  1Z81 A;  1AWV A;  2HAQ A;  2E2I A;  2E2H A;  4KB4 A;  3GTK A;  3K0N A;  3GTG A;  3GTO A;  2MS4 A;  1CYN A;  2IGW A;  5KV0 A;  4GTL A;  2OJU A;  3LAJ A;  3O7T A;  2WFJ A;  1IST A;  3N0C A;  1OCA A;  1WQG A;  1CWC A;  4J3N A;  2HE9 A;  2B63 A;  3R56 A;  1QOI A;  1SFO A;  4J5A X;  1J2A A;  2GSU A;  5CCR A;  2IGV A;  1C5F A;  4J58 A;  5KUS A;  1ZBS A;  1B4B A;  1M9Y A;  3G4A A;  3GTP A;  5TJ3 A;  1VBT A;  4C3I C;  4JCP A;  5CHP A;  1XWN A;  2OK3 A;  5KUO A;  3CYS A;  5CBV A;  4YUP A;  1BJT A;  5KUN A;  2KWA A;  5CCQ A;  1DYW A;  1CWM A;  5KUL A;  3CQZ A;  1VDN A;  4N1O A;  4C2M C;  3ODL A;  2R7Z A;  2B71 A;  3T1U A;  2X25 B;  5CBT A;  2POE A;  2GSN A;  1A58 A;  1M9F A;  2X2D B;  4KC6 A;  1XYH A;  4ILD A;  3RD9 X;  1AWU A;  1AWQ A;  3FOE A;  4C3J C;  2X2A A;  4GTB A;  2YU9 A;  2C3B A;  1WQF A;  2BIT X;  5KUU A;  4YUI A;  3RDD A;  5KV5 A;  3BT8 A;  4J5C X;  4S1E A;  2CYH A;  3RCG A;  2JH3 A;  2CFA B;  3FKI A;  1TWG A;  2JA7 A;  2CPL A;  4KMD A;  2RMC A;  4N1S A;  3L4K A;  2XCQ A;  4KB2 A;  4IPZ A;  4R3F A;  1CWK A;  3GTM A;  1O24 A;  4ZSC A;  3K0P A;  3FHZ A;  2XGY B;  1R9T A;  4E1Q A;  5KUW A;  4GTA A;  1RMH A;  4GTE A;  1H0P A;  1TWA A;  1A33 A;  3S0X A;  1EK8 A;  3UCH A;  1TWF A;  3MML B;  3ERE D;  2ESL A;  2GW2 A;  1IS1 A;  3N0B A;  4DGA A;  3K0Q A;  1O2B A;  1M9C A;  1QNH A;  4FRV A;  3GTJ A;  2K7N A;  2XCR B;  1CWH A;  5IOR A;  3OEP A;  2WFI A;  3QYU A;  4LQY A;  1W8M A;  1Y1W A;  4FZB A;  2Y3P A;  1VAI A;  1M9X A;  3AQP A;  1O25 A;  2GSO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...