3OREA

Crystal structure of ttha0988 in space group p6522
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
492
structure length
481
Chain Sequence
VRGFYLRFGEGVSEEANRRALALAEALLRAPPPGLLDAVPAYGVLYLEYDPRRLSRGRLLRLLKGLRVVEIPVRYDGEDLPEVASRLGLSLEAVKALHQKPLYRVYALGFTPGFPFLAEVEPALRLPRKPHPRPRVPAHAVAVAGVQTGIYPLPSPGGWNLLGTSLVAVYDPHRETPFLLRPGDRVRFLEAEGPTPPEPRPLELLPEEPRLPALLVEEPGLMDLVVDGGRFLGGHLGLARSGPLDAPSARLANRLVGNGAGAPLLEFAYKGPVLTALRDLVAAFAGYGFVALLEGEEIPPGQSFLWPRGKTLRFRPRGPGVRGYLAVAGGLEVRPFLGSASPDLRGRIGRPLWAGDVLGLEALRPVRPGRAFPQRPLPEAFRLRLLPGPQEAFRALCSGPFRVARADRVGVELLGPEVPGGEGLSEPTPLGGVQVPPSGRPLVLLADKGSLGGYAKPALVDPRDLWLLGQARPGVEIHFTS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure of TTHA0988 from Thermus thermophilus, a KipI-KipA homologue incorrectly annotated as an allophanate hydrolase
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Structural genomics, unknown function
molecule keywords Putative uncharacterized protein TTHA0988
total genus 119
structure length 481
sequence length 492
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-09-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02626 CT_A_B Carboxyltransferase domain, subdomain A and B
A PF02682 CT_C_D Carboxyltransferase domain, subdomain C and D
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.100.10 Mainly Beta Beta Barrel Cyclophilin Cyclophilin-like 3oreA02
2.40.100.10 Mainly Beta Beta Barrel Cyclophilin Cyclophilin-like 3oreA04
3.30.1360.40 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 3oreA01
1QOIA 1AK4A 3RD9X 5CYHA 3RCFA 3V4GA 1M9EA 1H0PA 2CPLA 4ZSCA 1B4AA 2POYA 3K0PA 5CBTA 3BT8A 4J5DX 1XXAA 4FM9A 2FU0A 1OCAA 5KULA 5CBVA 1A58A 1CWOA 4E1QA 1F9NA 3OREA 2XCOA 2ZFZA 1W74A 4YUIA 5KV7A 4I9YA 2RMBA 1VDNA 1XQ7A 4J59A 4YUKA 1BGWA 3ODIA 3ICHA 1IIPA 3O7TA 4HY7A 3RDBA 4YUNA 1XXCA 4LQWA 5KURA 5CCRA 1WQFA 3FOEA 1CWIA 2MS4A 1ZMFA 2BIUX 2R99A 4J5EX 1WQGA 2OJUA 3RDCA 3BUEA 2Z6WA 1M9DA 1CWBA 3T1UA 2WFJA 1E8KA 4O8IA 4S1EA 1BCKA 1LOPA 5JVOA 1M63C 3CYSA 3R4GA 2K7NA 4R3FA 3R49A 3JB9d 4J3NA 2MVZA 2A2NA 4CYHA 1ZVUA 3MMLA 2ESLA 3S6MA 5CCSX 2CYHA 3OEPA 5KUOA 1MZWA 5CJ9A 1MF8C 3R59A 1DD5A 3LAPA 5KV4A 3K0RA 3LPXA 2N0TA 3L4JA 1NMKA 1AWQA 2X7KA 4JJMA 2RMAA 3CYHA 5KV0A 4KAWX 5KV2A 2RGRA 3UCHA 2IGVA 1M9CA 4N1PA 2P0OA 5DUDA 2HAQA 1W8LA 2MC9A 4DGDA 4KB4A 2NULA 2X2CK 3ICIA 2BITX 2X2AA 2WLWA 4ZSDA 1M9FA 4R3EA 1GE9A 2CMTA 4JCPA 4YUMA 2Y3PA 3ODLA 2IGWA 4KC6A 4DDQA 3K0OA 1BJTA 3LAJA 3K2CA 1V9TA 4FRVA 2KWAA 1AWUA 4YULA 3RFYA 3K0MA 4KDDA 4YUJA 1MIKA 3NUHA 2ALFA 2OK3A 2XGYB 1EH1A 1XYHA 3RDDA 4DGEA 4YUOA 3FHZA 4G0UA 1QNGA 3R56A 5KV6A 3VA7A 2C3BA 3FOFA 1E3BA 1CWAA 2QERA 3R54A 1WIHA 1W8VA 4N1OA 5LUDA 2ZP2A 4DGBA 4GFQA 1AWRA 1A33A 1CWLA 4FRUA 2HQ6A 3BO7A 1AWTA 1M9XA 2MZUA 4XNCA 5KUNA 3RCIX 3R57A 3CAGA 1VAIA 1CWMA 1DYWA 1CWFA 2POEA 1ISTA 1AWSA 2X25B 4O8HA 4S1JA 4EYVA 1AWVA 2CFEA 5A0EA 5CCNA 4J5AX 5F66A 1X7FA 5JHEA 4G0WA 2XCQA 4N1MA 3PMPA 1ISEA 1RMHA 2P5MA 5KV3A 2OSEA 2B71A 5KUUA 1IS1A 4J5BA 5KUSA 4KB2A 5KV1A 3ERED 1QNHA 3K0NA 2RS4A 4N1NA 4N1QA 3RDAX 5CBWA 5KUQA 4N1RA 5KUVA 1YNDA 1XO7A 3OPFA 3L4KA 3EOVA 1CWHA 2CK1A 1CYNA 2HE9A 2RMCA 3RCGA 5CBUA 4YUHA 2X83B 1Z81A 5KUZA 1CWKA 2PHCB 5CCQA 1AB4A 4TOTA 4N1SA 4J5CX 1ZKCA 1W8MA 3K0QA 1XXBA 2XCRB 3RCKX 3QX3A 4DGAA 1CWJA 1WQHA 1C5FA 1FGLA 3MMLB 4DGCA 1IHGA 1XWNA 4YUGA 2HQJA 4G0VA 5KUWA 1ZKFA 3RCLA 2PLUA 1M9YA 2GW2A 1CLHA 1EK8A 1J2AA 1VBSA 2WFIA 2X2DB 4J58A 4IPZA 5KV5A 1VBTA 3BKPA 3QYUA 4YUPA 1CWCA 1B4BA
chains in the Genus database with same CATH superfamily
3T00A 2E2IK 1QOIA 2NVYA 2NVTC 5EGEA 3V4GA 1O24A 1H0PA 4ZSCA 1O28A 1JQWA 5CBVA 2ZFZA 1F9NA 3HOWC 2XCOA 1R9TC 1XZPB 4I9YA 1BGWA 1XQ7A 4J3NA 1K83C 4FM9A 1IIPA 1I50A 2RH6A 4XLNA 1XXCA 3TFHA 3GTLK 2R99A 2PMZL 3FKIC 1ZYRA 3N0CA 2YU9A 5IP9C 3HOYK 1G51A 4GTLA 1E8KA 4S1EA 3G4CA 3CQZK 4KN4A 1Y1VK 3AQOA 1WORA 1ZX8A 1ZVUA 3MMLA 4A3BK 1EI6A 3JSTA 5TMCA 4WILA 5KUOA 2CYHA 5CJ9A 2R93A 1MZWA 1MF8C 1DD5A 3L4JA 2BE5A 4GTBA 4BKWA 3CYHA 4KAWX 4BBRK 5IP7C 1JVIA 4C2MK 2RGRA 2IGVA 5JFEA 2VUMK 1IBAA 2GSOA 1J6XA 4A3EK 4WJ4A 3BP3A 2NULA 3HOXK 2E2JC 2NVQK 1TWFC 1GE9A 4DDQA 5FLMK 3PO3K 2IGWA 1WOPA 1K83A 3GSIA 4KMHA 4BXXK 3RFYA 4YUJA 1I6VA 3M3YC 2JA8K 4DGEA 4LQYA 2JA6C 3VA7A 3PO2C 1E3BA 3A8KA 1WIHA 3GIRA 2WB1D 1A33A 4FRUA 4BBSK 1AWTA 1F7VA 3CAGA 3S17K 2KA0A 1O29A 3GEHA 2POEA 3CQZC 4O8HA 4S1JA 4EYVA 4C3IC 4Y52K 5JHEA 5IYCK 4N1MA 3PMPA 1EQRA 5C3EK 2A6HA 1RMHA 5KV3A 2OSEA 5KUUA 1IS1A 5KUSA 1O2AA 4N1QA 3RDAX 4OIQA 4BBRC 1PJ5A 5IP7K 3EOVA 2PA8D 5D4DA 1Z81A 1TWCC 2PHCB 5CCQA 4MEYA 4TOTA 2R92C 3QX3A 1O25A 1Y1WA 4AYBD 2E2JK 2JA7K 3MMLB 2NVQC 2JA5C 1IHGA 1ZQ1C 4G0VA 2Y0SD 4YFKA 5FLMC 3HOUC 2PLUA 4QJVA 3PO3C 1IL2A 2WB1L 1CLHA 1EK8A 4A3CK 1VBSA 2JA6A 1VBTA 1XZPA 4LK1A 3AD7C 3SZZA 4A3LC 5CHPA 2JA6K 1F7UA 3RD9X 1TWCA 5CYHA 4A3IK 1YNJA 1TWFA 1B4AA 4J5DX 3GTMK 3RZOK 2FU0A 3ADAC 1CWOA 4GTCA 4E1QA 1O2FB 3OREA 2GAHC 3IPJA 4GTDA 3TFIA 1Y1WK 4KATA 3GTJC 4KM9A 3S17C 2VUMA 3GEIA 2RMBA 1VLOA 3ICHA 4A3GC 3HXAA 5CCRA 3H0GK 1ZMFA 2BIUX 4Y52C 4A3FC 2OJUA 3BUEA 4GTEA 1DCHA 1Y1VA 5IYCC 5C3EC 1O26A 3I4MK 3R4GA 2K7NA 4R3FA 2MVZA 4AYBL 2A2NA 3Q3QA 5IYBK 2ESLA 1ZBSA 2B63K 1J6WA 3K0RA 2N0TA 3N0BA 4KMDA 4AH6A 5KV2A 3T02A 4LLGA 3GTGC 5DUDA 2HAQA 4P9SA 1W8LA 4QJVB 2X2CK 3S16K 3GTPA 1VH2A 2BITX 2X2AA 2WLWA 4ZSDA 1M9FA 4FZBA 5E68A 4KC6A 3ODLA 1BS2A 4OIOA 4OIRA 2JA5A 3K2CA 2R7ZA 3BP8C 2R92A 1X31C 4YULA 3S15C 4KDDA 1MIKA 4G7OA 3NUHA 1EH1A 3RZDC 3M4OC 5IOSA 1USMA 1QNGA 5KV6A 2C3BA 4A3GK 1USOA 2B63A 3R54A 3H0GC 1W8VA 4Y7NK 4DGBA 1Y1VC 2CW0A 1AWRA 4LJZA 3BO7A 1M9XA 3GTPK 3GDZA 4KMAA 3R57A 4XSXA 4MQ9A 3S1RC 1TWHA 4A3JK 1ISTA 2X25B 1AWVA 2CFEA 5IYBC 4J5AX 1X7FA 4G0WA 1TWHC 1J6VA 4C2MC 3GTQK 4XSZA 4J5BA 1QNHA 2ZUFA 4N1NA 5KUQA 1DCOA 4N1RA 1YNDA 2NVXK 1XO7A 5M5XK 2HE9A 4KM8A 1CYNA 4YUHA 2NVXA 1CWKA 4J5CX 1ZKCA 3S16C 3RCKX 3M3YK 1CWJA 4MEXA 1XWNA 1V5VA 1WCMK 1ZKFA 1DCPA 1I6HK 2E2IA 5HL8A 2X2DB 2JH3A 4BBSC 3S15K 4A3DC 3GTMA 1BDFA 4WJ3M 1IE0A 4M1XA 3RCFA 4A3KC 5M3FK 1M9EA 3GTKK 3K0PA 3BT8A 5KULA 1OCAA 1A58A 3GTPC 3AD9C 5C4JC 2O5IA 5KV7A 3HOVK 4J59A 2R93C 4YUKA 3S1MC 3ODIA 5M3MK 2V6SA 4A3JC 4LQWA 5KURA 1WQFA 3A8IA 2MS4A 1WQGA 4J5EX 3K7AK 4JK1A 4O2DA 3RDCA 2Z6WA 1TWHK 1M9DA 3GTQC 1SFOA 1CWBA 3S1NK 1TWCK 1BCKA 2R92K 1LOPA 1I50C 4A93C 4CYHA 2WAQD 2JA7C 2NVXC 3S6MA 1TWGK 5CCSX 3HOUK 3X27A 3S14C 3LPXA 4JJMA 4Q5SA 2RMAA 4X6AK 4A3LK 2YU9K 4OIPA 1WCMC 3UCHA 3S2HK 2NVYC 2A68A 3S1QC 4A3IC 4N1PA 4GT9A 4C3JK 2PPBA 1C0AA 1I6HC 1VRQC 3GTMC 2MC9A 4DGDA 4KB4A 3RZOC 4PABA 3GTJK 4R3EA 1XPPA 2CMTA 4YUMA 2Y3PA 3LAJA 1WOOA 1BJTA 3GTKC 1V9TA 2KWAA 1AWUA 4A3MC 1PJ6A 1WSRA 2ALFA 2OK3A 2XGYB 5M5WK 2R7ZK 2CFAA 4YUOA 4LR2A 3FHZA 3HOVC 2E2HC 2R93K 3R56A 2W7VA 3AQPA 2QERA 3A8JA 4ILDA 1SFOC 2FQOA 3HKZD 3GEEA 1CWLA 1I3QA 4BY1K 3HOZC 4P5AA 3I4NK 2JA7A 2EBBA 1VAIA 4G7ZA 1CWMA 3S1NC 4C45A 2NVTK 1I3QC 2CFAB 1HQMA 5CCNA 3KOPA 1L0WA 4KN7A 2E2HA 3GTGK 1R9TK 3N3YA 1TWGC 2P5MA 2NNZA 2B71A 3S14K 4KB2A 5KV1A 2FQTA 3K0NA 2P8TA 5CBWA 1WOSA 3FKIK 2GSNA 4GTAA 2YU9C 4LK0A 3CQZA 5M5YK 3OPFA 2Y0SL 1SMYA 1CWHA 2NVYK 5IP9K 4LOWA 5CBUA 3RCGA 4C3JC 4OINA 3S1QK 5KUZA 4KMUA 1F93A 3GTOK 1AB4A 3K0QA 3RZDK 3M4OK 1FGLA 4DGCA 2HQJA 4KARA 1R9TA 3RCLA 3HKZL 2GW2A 4Y7NC 1J2AA 1WSVA 5IOQA 4A3MK 1PJ7A 5KV5A 4Q4ZA 5IORA 2V6UA 4YFNA 3SZYA 4PAAA 4YUPA 1B4BA 2E2HK 2O5JA 1AK4A 3S1RK 1SFOK 1YNNA 4A3EC 2CPLA 2POYA 5CBTA 1XXAA 5IYDK 1O2BA 1RU0A 1W74A 4XCHA 4BY1C 3HOZK 4YUIA 3I4NC 3GTLA 1VDNA 4HY7A 3O7TA 3RDBA 4YUNA 1I3QK 1XZQB 4GTFA 3FOEA 3ERED 4BLBA 2V6TA 1CWIA 3WODA 4BXXC 5FJ8K 2JA8C 1EFWA 3S2DK 1VJEA 3T1UA 2WFJA 3PO2K 5IOTA 4O8IA 5JVOA 1XZQA 1M63C 3CYSA 3JB9d 3GTGA 3R49A 3T01A 3GTJA 5C44K 3OEPA 3R59A 3GTOC 3LAPA 5KV4A 1NMKA 1AWQA 4A3DK 4P5BA 2X7KA 4C3IK 2A69A 3S0XA 5KV0A 4ZH4A 4BY7C 1M9CA 4A3KK 3H0GA 2P0OA 2WAQL 5EGHA 3ICIA 1TWAC 4C3HK 4GZYA 5C4XC 5C4JK 1O27A 3EQLA 1HI9A 3S1MK 4JCPA 4BLAA 3K0OA 1J98A 3H3VD 4FRVA 1WCMA 5IYDC 3K7AC 3K0MA 4QIWD 1XYHA 3RDDA 4G7HA 4G0UA 2JA5K 4NOIA 2E2IC 3FOFA 1CWAA 4N1OA 4GFQA 5LUDA 2ZP2A 4RMFA 4A3CC 1IW7A 2HQ6A 1I50K 4A93K 2MZUA 4XNCA 3HOWK 5KUNA 3RCIX 1YX2A 4KASA 3S2DC 3AH5A 1K83K 1ZXOA 1DYWA 1CWFA 2D6FC 3GTLC 1AWSA 2ZUEA 3GTOA 2PA8L 3AD8C 3DXJA 4X6AC 5A0EA 5F66A 1Y1WC 2XCQA 3S2HC 3FKIA 3HOYC 5C44C 4XLPA 1KQ4A 2RS4A 5TMFA 5KUVA 2PMZD 4A3FK 3GTQA 4A3BC 3L4KA 2GAGC 4BY7K 1ISEA 1VGXA 2CK1A 2RMCA 4YFXA 2X83B 1TWAA 3G4AA 1CWCA 3I4MC 4N1SA 1TWGA 1XXBA 1W8MA 2XCRB 3GTKA 1UV7A 1TWAK 4C3HC 5C4XK 3TFJA 2R7ZC 4DGAA 3H3VL 1WQHA 1C5FA 4YUGA 1IQ0A 5L46A 2VUMC 2B63C 5KUWA 3TTGA 4QIWL 1M9YA 1INNA 2GSUA 4YG2A 1YCLA 2WFIA 5TJ3A 4J58A 4IPZA 3HOXC 3BKPA 2A6EA 3QYUA 1TWFK 1JOEA
chains in the Genus database with same CATH topology
1QOIA 2NVYA 5EGEA 3V4GA 1O24A 1H0PA 4ZSCA 1O28A 5CBVA 2ZFZA 1F9NA 2XCOA 4I9YA 1BGWA 1XQ7A 4J3NA 4FM9A 1IIPA 1I50A 2RH6A 1XXCA 2R99A 3N0CA 2YU9A 4GTLA 1E8KA 4S1EA 3G4CA 3AQOA 1ZVUA 3MMLA 5KUOA 2CYHA 5CJ9A 2R93A 1MZWA 1MF8C 1DD5A 3L4JA 4GTBA 4BKWA 3CYHA 4KAWX 2RGRA 2IGVA 5JFEA 2GSOA 2NULA 1GE9A 4DDQA 2IGWA 1K83A 4KMHA 3RFYA 4YUJA 4DGEA 4LQYA 3VA7A 1E3BA 1WIHA 1A33A 4FRUA 1AWTA 3CAGA 1O29A 2POEA 4O8HA 4S1JA 4EYVA 4C3IC 5JHEA 4N1MA 3PMPA 1RMHA 5KV3A 2OSEA 5KUUA 1IS1A 5KUSA 1O2AA 4N1QA 3RDAX 3EOVA 1Z81A 2PHCB 5CCQA 4TOTA 3QX3A 1O25A 1Y1WA 3MMLB 1IHGA 4G0VA 2PLUA 1CLHA 1EK8A 1VBSA 2JA6A 1VBTA 5CHPA 3RD9X 1TWCA 5CYHA 1TWFA 1B4AA 4J5DX 2FU0A 1CWOA 4GTCA 4E1QA 4GTDA 3OREA 4KATA 4KM9A 2VUMA 2RMBA 3ICHA 5CCRA 1ZMFA 2BIUX 2OJUA 3BUEA 4GTEA 1Y1VA 1O26A 3R4GA 2K7NA 4R3FA 2MVZA 2A2NA 3Q3QA 2ESLA 1ZBSA 3K0RA 2N0TA 3N0BA 4KMDA 5KV2A 5DUDA 2HAQA 1W8LA 2X2CK 3GTPA 2BITX 2X2AA 2WLWA 4ZSDA 1M9FA 4FZBA 4KC6A 3ODLA 2JA5A 3K2CA 2R7ZA 2R92A 4YULA 4KDDA 1MIKA 3NUHA 1EH1A 5IOSA 1QNGA 5KV6A 2C3BA 2B63A 3R54A 1W8VA 4DGBA 1AWRA 3BO7A 1M9XA 4KMAA 3R57A 1TWHA 1ISTA 2X25B 1AWVA 2CFEA 4J5AX 1X7FA 4G0WA 4C2MC 4J5BA 1QNHA 4N1NA 5KUQA 4N1RA 1YNDA 1XO7A 4KM8A 2HE9A 1CYNA 4YUHA 2NVXA 1CWKA 4J5CX 1ZKCA 3RCKX 1CWJA 1XWNA 1ZKFA 2E2IA 2X2DB 2JH3A 3GTMA 4M1XA 3RCFA 1M9EA 3K0PA 3BT8A 5KULA 1OCAA 1A58A 5KV7A 4J59A 4YUKA 3ODIA 4LQWA 5KURA 1WQFA 2MS4A 1WQGA 4J5EX 3RDCA 2Z6WA 1M9DA 1SFOA 1CWBA 1BCKA 1LOPA 4CYHA 3S6MA 5CCSX 3LPXA 4JJMA 2RMAA 3UCHA 4N1PA 4GT9A 2MC9A 4DGDA 4KB4A 4R3EA 2CMTA 4YUMA 2Y3PA 3LAJA 1BJTA 1V9TA 2KWAA 1AWUA 2ALFA 2OK3A 2XGYB 2CFAA 4YUOA 4LR2A 3FHZA 3R56A 3AQPA 2QERA 4ILDA 1CWLA 1I3QA 4P5AA 2JA7A 1VAIA 1CWMA 2CFAB 5CCNA 2E2HA 3N3YA 2P5MA 2B71A 4KB2A 5KV1A 3K0NA 5CBWA 2GSNA 4GTAA 3CQZA 3OPFA 1CWHA 5CBUA 3RCGA 4C3JC 5KUZA 1AB4A 3K0QA 1FGLA 4DGCA 2HQJA 4KARA 1R9TA 3RCLA 2GW2A 1J2AA 5IOQA 5KV5A 5IORA 4YUPA 1B4BA 1AK4A 2CPLA 2POYA 5CBTA 1XXAA 1O2BA 1W74A 4YUIA 3GTLA 1VDNA 4HY7A 3O7TA 3RDBA 4YUNA 3FOEA 3ERED 4GTFA 4BLBA 1CWIA 3T1UA 2WFJA 5IOTA 4O8IA 5JVOA 1M63C 3CYSA 3JB9d 3GTGA 3R49A 3GTJA 3OEPA 3R59A 3LAPA 5KV4A 1NMKA 1AWQA 4P5BA 2X7KA 3S0XA 5KV0A 1M9CA 3H0GA 2P0OA 5EGHA 3ICIA 1O27A 4JCPA 4BLAA 3K0OA 4FRVA 1WCMA 3K0MA 1XYHA 3RDDA 4G0UA 3FOFA 1CWAA 4N1OA 4GFQA 5LUDA 2ZP2A 2HQ6A 2MZUA 4XNCA 5KUNA 3RCIX 4KASA 3AH5A 1ZXOA 1DYWA 1CWFA 1AWSA 3GTOA 5A0EA 5F66A 2XCQA 3FKIA 1KQ4A 2RS4A 5KUVA 3GTQA 3L4KA 1ISEA 2CK1A 2RMCA 2X83B 1TWAA 3G4AA 4N1SA 1TWGA 1XXBA 1W8MA 2XCRB 3GTKA 4C3HC 4DGAA 1WQHA 1C5FA 4YUGA 5KUWA 1M9YA 2GSUA 2WFIA 5TJ3A 4J58A 4IPZA 3BKPA 3QYUA 1CWCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QOI A;  1AK4 A;  3RD9 X;  5CYH A;  3RCF A;  3V4G A;  1M9E A;  1H0P A;  2CPL A;  4ZSC A;  1B4A A;  2POY A;  3K0P A;  5CBT A;  3BT8 A;  4J5D X;  1XXA A;  4FM9 A;  2FU0 A;  1OCA A;  5KUL A;  5CBV A;  1A58 A;  1CWO A;  4E1Q A;  1F9N A;  3ORE A;  2XCO A;  2ZFZ A;  1W74 A;  4YUI A;  5KV7 A;  4I9Y A;  2RMB A;  1VDN A;  1XQ7 A;  4J59 A;  4YUK A;  1BGW A;  3ODI A;  3ICH A;  1IIP A;  3O7T A;  4HY7 A;  3RDB A;  4YUN A;  1XXC A;  4LQW A;  5KUR A;  5CCR A;  1WQF A;  3FOE A;  1CWI A;  2MS4 A;  1ZMF A;  2BIU X;  2R99 A;  4J5E X;  1WQG A;  2OJU A;  3RDC A;  3BUE A;  2Z6W A;  1M9D A;  1CWB A;  3T1U A;  2WFJ A;  1E8K A;  4O8I A;  4S1E A;  1BCK A;  1LOP A;  5JVO A;  1M63 C;  3CYS A;  3R4G A;  2K7N A;  4R3F A;  3R49 A;  3JB9 d;  4J3N A;  2MVZ A;  2A2N A;  4CYH A;  1ZVU A;  3MML A;  2ESL A;  3S6M A;  5CCS X;  2CYH A;  3OEP A;  5KUO A;  1MZW A;  5CJ9 A;  1MF8 C;  3R59 A;  1DD5 A;  3LAP A;  5KV4 A;  3K0R A;  3LPX A;  2N0T A;  3L4J A;  1NMK A;  1AWQ A;  2X7K A;  4JJM A;  2RMA A;  3CYH A;  5KV0 A;  4KAW X;  5KV2 A;  2RGR A;  3UCH A;  2IGV A;  1M9C A;  4N1P A;  2P0O A;  5DUD A;  2HAQ A;  1W8L A;  2MC9 A;  4DGD A;  4KB4 A;  2NUL A;  2X2C K;  3ICI A;  2BIT X;  2X2A A;  2WLW A;  4ZSD A;  1M9F A;  4R3E A;  1GE9 A;  2CMT A;  4JCP A;  4YUM A;  2Y3P A;  3ODL A;  2IGW A;  4KC6 A;  4DDQ A;  3K0O A;  1BJT A;  3LAJ A;  3K2C A;  1V9T A;  4FRV A;  2KWA A;  1AWU A;  4YUL A;  3RFY A;  3K0M A;  4KDD A;  4YUJ A;  1MIK A;  3NUH A;  2ALF A;  2OK3 A;  2XGY B;  1EH1 A;  1XYH A;  3RDD A;  4DGE A;  4YUO A;  3FHZ A;  4G0U A;  1QNG A;  3R56 A;  5KV6 A;  3VA7 A;  2C3B A;  3FOF A;  1E3B A;  1CWA A;  2QER A;  3R54 A;  1WIH A;  1W8V A;  4N1O A;  5LUD A;  2ZP2 A;  4DGB A;  4GFQ A;  1AWR A;  1A33 A;  1CWL A;  4FRU A;  2HQ6 A;  3BO7 A;  1AWT A;  1M9X A;  2MZU A;  4XNC A;  5KUN A;  3RCI X;  3R57 A;  3CAG A;  1VAI A;  1CWM A;  1DYW A;  1CWF A;  2POE A;  1IST A;  1AWS A;  2X25 B;  4O8H A;  4S1J A;  4EYV A;  1AWV A;  2CFE A;  5A0E A;  5CCN A;  4J5A X;  5F66 A;  1X7F A;  5JHE A;  4G0W A;  2XCQ A;  4N1M A;  3PMP A;  1ISE A;  1RMH A;  2P5M A;  5KV3 A;  2OSE A;  2B71 A;  5KUU A;  1IS1 A;  4J5B A;  5KUS A;  4KB2 A;  5KV1 A;  3ERE D;  1QNH A;  3K0N A;  2RS4 A;  4N1N A;  4N1Q A;  3RDA X;  5CBW A;  5KUQ A;  4N1R A;  5KUV A;  1YND A;  1XO7 A;  3OPF A;  3L4K A;  3EOV A;  1CWH A;  2CK1 A;  1CYN A;  2HE9 A;  2RMC A;  3RCG A;  5CBU A;  4YUH A;  2X83 B;  1Z81 A;  5KUZ A;  1CWK A;  2PHC B;  5CCQ A;  1AB4 A;  4TOT A;  4N1S A;  4J5C X;  1ZKC A;  1W8M A;  3K0Q A;  1XXB A;  2XCR B;  3RCK X;  3QX3 A;  4DGA A;  1CWJ A;  1WQH A;  1C5F A;  1FGL A;  3MML B;  4DGC A;  1IHG A;  1XWN A;  4YUG A;  2HQJ A;  4G0V A;  5KUW A;  1ZKF A;  3RCL A;  2PLU A;  1M9Y A;  2GW2 A;  1CLH A;  1EK8 A;  1J2A A;  1VBS A;  2WFI A;  2X2D B;  4J58 A;  4IPZ A;  5KV5 A;  1VBT A;  3BKP A;  3QYU A;  4YUP A;  1CWC A;  1B4B A; 
#chains in the Genus database with same CATH topology
 3T00 A;  2E2I K;  1QOI A;  2NVY A;  2NVT C;  5EGE A;  3V4G A;  1O24 A;  1H0P A;  4ZSC A;  1O28 A;  1JQW A;  5CBV A;  2ZFZ A;  1F9N A;  3HOW C;  2XCO A;  1R9T C;  1XZP B;  4I9Y A;  1BGW A;  1XQ7 A;  4J3N A;  1K83 C;  4FM9 A;  1IIP A;  1I50 A;  2RH6 A;  4XLN A;  1XXC A;  3TFH A;  3GTL K;  2R99 A;  2PMZ L;  3FKI C;  1ZYR A;  3N0C A;  2YU9 A;  5IP9 C;  3HOY K;  1G51 A;  4GTL A;  1E8K A;  4S1E A;  3G4C A;  3CQZ K;  4KN4 A;  1Y1V K;  3AQO A;  1WOR A;  1ZX8 A;  1ZVU A;  3MML A;  4A3B K;  1EI6 A;  3JST A;  5TMC A;  4WIL A;  5KUO A;  2CYH A;  5CJ9 A;  2R93 A;  1MZW A;  1MF8 C;  1DD5 A;  3L4J A;  2BE5 A;  4GTB A;  4BKW A;  3CYH A;  4KAW X;  4BBR K;  5IP7 C;  1JVI A;  4C2M K;  2RGR A;  2IGV A;  5JFE A;  2VUM K;  1IBA A;  2GSO A;  1J6X A;  4A3E K;  4WJ4 A;  3BP3 A;  2NUL A;  3HOX K;  2E2J C;  2NVQ K;  1TWF C;  1GE9 A;  4DDQ A;  5FLM K;  3PO3 K;  2IGW A;  1WOP A;  1K83 A;  3GSI A;  4KMH A;  4BXX K;  3RFY A;  4YUJ A;  1I6V A;  3M3Y C;  2JA8 K;  4DGE A;  4LQY A;  2JA6 C;  3VA7 A;  3PO2 C;  1E3B A;  3A8K A;  1WIH A;  3GIR A;  2WB1 D;  1A33 A;  4FRU A;  4BBS K;  1AWT A;  1F7V A;  3CAG A;  3S17 K;  2KA0 A;  1O29 A;  3GEH A;  2POE A;  3CQZ C;  4O8H A;  4S1J A;  4EYV A;  4C3I C;  4Y52 K;  5JHE A;  5IYC K;  4N1M A;  3PMP A;  1EQR A;  5C3E K;  2A6H A;  1RMH A;  5KV3 A;  2OSE A;  5KUU A;  1IS1 A;  5KUS A;  1O2A A;  4N1Q A;  3RDA X;  4OIQ A;  4BBR C;  1PJ5 A;  5IP7 K;  3EOV A;  2PA8 D;  5D4D A;  1Z81 A;  1TWC C;  2PHC B;  5CCQ A;  4MEY A;  4TOT A;  2R92 C;  3QX3 A;  1O25 A;  1Y1W A;  4AYB D;  2E2J K;  2JA7 K;  3MML B;  2NVQ C;  2JA5 C;  1IHG A;  1ZQ1 C;  4G0V A;  2Y0S D;  4YFK A;  5FLM C;  3HOU C;  2PLU A;  4QJV A;  3PO3 C;  1IL2 A;  2WB1 L;  1CLH A;  1EK8 A;  4A3C K;  1VBS A;  2JA6 A;  1VBT A;  1XZP A;  4LK1 A;  3AD7 C;  3SZZ A;  4A3L C;  5CHP A;  2JA6 K;  1F7U A;  3RD9 X;  1TWC A;  5CYH A;  4A3I K;  1YNJ A;  1TWF A;  1B4A A;  4J5D X;  3GTM K;  3RZO K;  2FU0 A;  3ADA C;  1CWO A;  4GTC A;  4E1Q A;  1O2F B;  3ORE A;  2GAH C;  3IPJ A;  4GTD A;  3TFI A;  1Y1W K;  4KAT A;  3GTJ C;  4KM9 A;  3S17 C;  2VUM A;  3GEI A;  2RMB A;  1VLO A;  3ICH A;  4A3G C;  3HXA A;  5CCR A;  3H0G K;  1ZMF A;  2BIU X;  4Y52 C;  4A3F C;  2OJU A;  3BUE A;  4GTE A;  1DCH A;  1Y1V A;  5IYC C;  5C3E C;  1O26 A;  3I4M K;  3R4G A;  2K7N A;  4R3F A;  2MVZ A;  4AYB L;  2A2N A;  3Q3Q A;  5IYB K;  2ESL A;  1ZBS A;  2B63 K;  1J6W A;  3K0R A;  2N0T A;  3N0B A;  4KMD A;  4AH6 A;  5KV2 A;  3T02 A;  4LLG A;  3GTG C;  5DUD A;  2HAQ A;  4P9S A;  1W8L A;  4QJV B;  2X2C K;  3S16 K;  3GTP A;  1VH2 A;  2BIT X;  2X2A A;  2WLW A;  4ZSD A;  1M9F A;  4FZB A;  5E68 A;  4KC6 A;  3ODL A;  1BS2 A;  4OIO A;  4OIR A;  2JA5 A;  3K2C A;  2R7Z A;  3BP8 C;  2R92 A;  1X31 C;  4YUL A;  3S15 C;  4KDD A;  1MIK A;  4G7O A;  3NUH A;  1EH1 A;  3RZD C;  3M4O C;  5IOS A;  1USM A;  1QNG A;  5KV6 A;  2C3B A;  4A3G K;  1USO A;  2B63 A;  3R54 A;  3H0G C;  1W8V A;  4Y7N K;  4DGB A;  1Y1V C;  2CW0 A;  1AWR A;  4LJZ A;  3BO7 A;  1M9X A;  3GTP K;  3GDZ A;  4KMA A;  3R57 A;  4XSX A;  4MQ9 A;  3S1R C;  1TWH A;  4A3J K;  1IST A;  2X25 B;  1AWV A;  2CFE A;  5IYB C;  4J5A X;  1X7F A;  4G0W A;  1TWH C;  1J6V A;  4C2M C;  3GTQ K;  4XSZ A;  4J5B A;  1QNH A;  2ZUF A;  4N1N A;  5KUQ A;  1DCO A;  4N1R A;  1YND A;  2NVX K;  1XO7 A;  5M5X K;  2HE9 A;  4KM8 A;  1CYN A;  4YUH A;  2NVX A;  1CWK A;  4J5C X;  1ZKC A;  3S16 C;  3RCK X;  3M3Y K;  1CWJ A;  4MEX A;  1XWN A;  1V5V A;  1WCM K;  1ZKF A;  1DCP A;  1I6H K;  2E2I A;  5HL8 A;  2X2D B;  2JH3 A;  4BBS C;  3S15 K;  4A3D C;  3GTM A;  1BDF A;  4WJ3 M;  1IE0 A;  4M1X A;  3RCF A;  4A3K C;  5M3F K;  1M9E A;  3GTK K;  3K0P A;  3BT8 A;  5KUL A;  1OCA A;  1A58 A;  3GTP C;  3AD9 C;  5C4J C;  2O5I A;  5KV7 A;  3HOV K;  4J59 A;  2R93 C;  4YUK A;  3S1M C;  3ODI A;  5M3M K;  2V6S A;  4A3J C;  4LQW A;  5KUR A;  1WQF A;  3A8I A;  2MS4 A;  1WQG A;  4J5E X;  3K7A K;  4JK1 A;  4O2D A;  3RDC A;  2Z6W A;  1TWH K;  1M9D A;  3GTQ C;  1SFO A;  1CWB A;  3S1N K;  1TWC K;  1BCK A;  2R92 K;  1LOP A;  1I50 C;  4A93 C;  4CYH A;  2WAQ D;  2JA7 C;  2NVX C;  3S6M A;  1TWG K;  5CCS X;  3HOU K;  3X27 A;  3S14 C;  3LPX A;  4JJM A;  4Q5S A;  2RMA A;  4X6A K;  4A3L K;  2YU9 K;  4OIP A;  1WCM C;  3UCH A;  3S2H K;  2NVY C;  2A68 A;  3S1Q C;  4A3I C;  4N1P A;  4GT9 A;  4C3J K;  2PPB A;  1C0A A;  1I6H C;  1VRQ C;  3GTM C;  2MC9 A;  4DGD A;  4KB4 A;  3RZO C;  4PAB A;  3GTJ K;  4R3E A;  1XPP A;  2CMT A;  4YUM A;  2Y3P A;  3LAJ A;  1WOO A;  1BJT A;  3GTK C;  1V9T A;  2KWA A;  1AWU A;  4A3M C;  1PJ6 A;  1WSR A;  2ALF A;  2OK3 A;  2XGY B;  5M5W K;  2R7Z K;  2CFA A;  4YUO A;  4LR2 A;  3FHZ A;  3HOV C;  2E2H C;  2R93 K;  3R56 A;  2W7V A;  3AQP A;  2QER A;  3A8J A;  4ILD A;  1SFO C;  2FQO A;  3HKZ D;  3GEE A;  1CWL A;  1I3Q A;  4BY1 K;  3HOZ C;  4P5A A;  3I4N K;  2JA7 A;  2EBB A;  1VAI A;  4G7Z A;  1CWM A;  3S1N C;  4C45 A;  2NVT K;  1I3Q C;  2CFA B;  1HQM A;  5CCN A;  3KOP A;  1L0W A;  4KN7 A;  2E2H A;  3GTG K;  1R9T K;  3N3Y A;  1TWG C;  2P5M A;  2NNZ A;  2B71 A;  3S14 K;  4KB2 A;  5KV1 A;  2FQT A;  3K0N A;  2P8T A;  5CBW A;  1WOS A;  3FKI K;  2GSN A;  4GTA A;  2YU9 C;  4LK0 A;  3CQZ A;  5M5Y K;  3OPF A;  2Y0S L;  1SMY A;  1CWH A;  2NVY K;  5IP9 K;  4LOW A;  5CBU A;  3RCG A;  4C3J C;  4OIN A;  3S1Q K;  5KUZ A;  4KMU A;  1F93 A;  3GTO K;  1AB4 A;  3K0Q A;  3RZD K;  3M4O K;  1FGL A;  4DGC A;  2HQJ A;  4KAR A;  1R9T A;  3RCL A;  3HKZ L;  2GW2 A;  4Y7N C;  1J2A A;  1WSV A;  5IOQ A;  4A3M K;  1PJ7 A;  5KV5 A;  4Q4Z A;  5IOR A;  2V6U A;  4YFN A;  3SZY A;  4PAA A;  4YUP A;  1B4B A;  2E2H K;  2O5J A;  1AK4 A;  3S1R K;  1SFO K;  1YNN A;  4A3E C;  2CPL A;  2POY A;  5CBT A;  1XXA A;  5IYD K;  1O2B A;  1RU0 A;  1W74 A;  4XCH A;  4BY1 C;  3HOZ K;  4YUI A;  3I4N C;  3GTL A;  1VDN A;  4HY7 A;  3O7T A;  3RDB A;  4YUN A;  1I3Q K;  1XZQ B;  4GTF A;  3FOE A;  3ERE D;  4BLB A;  2V6T A;  1CWI A;  3WOD A;  4BXX C;  5FJ8 K;  2JA8 C;  1EFW A;  3S2D K;  1VJE A;  3T1U A;  2WFJ A;  3PO2 K;  5IOT A;  4O8I A;  5JVO A;  1XZQ A;  1M63 C;  3CYS A;  3JB9 d;  3GTG A;  3R49 A;  3T01 A;  3GTJ A;  5C44 K;  3OEP A;  3R59 A;  3GTO C;  3LAP A;  5KV4 A;  1NMK A;  1AWQ A;  4A3D K;  4P5B A;  2X7K A;  4C3I K;  2A69 A;  3S0X A;  5KV0 A;  4ZH4 A;  4BY7 C;  1M9C A;  4A3K K;  3H0G A;  2P0O A;  2WAQ L;  5EGH A;  3ICI A;  1TWA C;  4C3H K;  4GZY A;  5C4X C;  5C4J K;  1O27 A;  3EQL A;  1HI9 A;  3S1M K;  4JCP A;  4BLA A;  3K0O A;  1J98 A;  3H3V D;  4FRV A;  1WCM A;  5IYD C;  3K7A C;  3K0M A;  4QIW D;  1XYH A;  3RDD A;  4G7H A;  4G0U A;  2JA5 K;  4NOI A;  2E2I C;  3FOF A;  1CWA A;  4N1O A;  4GFQ A;  5LUD A;  2ZP2 A;  4RMF A;  4A3C C;  1IW7 A;  2HQ6 A;  1I50 K;  4A93 K;  2MZU A;  4XNC A;  3HOW K;  5KUN A;  3RCI X;  1YX2 A;  4KAS A;  3S2D C;  3AH5 A;  1K83 K;  1ZXO A;  1DYW A;  1CWF A;  2D6F C;  3GTL C;  1AWS A;  2ZUE A;  3GTO A;  2PA8 L;  3AD8 C;  3DXJ A;  4X6A C;  5A0E A;  5F66 A;  1Y1W C;  2XCQ A;  3S2H C;  3FKI A;  3HOY C;  5C44 C;  4XLP A;  1KQ4 A;  2RS4 A;  5TMF A;  5KUV A;  2PMZ D;  4A3F K;  3GTQ A;  4A3B C;  3L4K A;  2GAG C;  4BY7 K;  1ISE A;  1VGX A;  2CK1 A;  2RMC A;  4YFX A;  2X83 B;  1TWA A;  3G4A A;  1CWC A;  3I4M C;  4N1S A;  1TWG A;  1XXB A;  1W8M A;  2XCR B;  3GTK A;  1UV7 A;  1TWA K;  4C3H C;  5C4X K;  3TFJ A;  2R7Z C;  4DGA A;  3H3V L;  1WQH A;  1C5F A;  4YUG A;  1IQ0 A;  5L46 A;  2VUM C;  2B63 C;  5KUW A;  3TTG A;  4QIW L;  1M9Y A;  1INN A;  2GSU A;  4YG2 A;  1YCL A;  2WFI A;  5TJ3 A;  4J58 A;  4IPZ A;  3HOX C;  3BKP A;  2A6E A;  3QYU A;  1TWF K;  1JOE A; 
#chains in the Genus database with same CATH homology
 1QOI A;  2NVY A;  5EGE A;  3V4G A;  1O24 A;  1H0P A;  4ZSC A;  1O28 A;  5CBV A;  2ZFZ A;  1F9N A;  2XCO A;  4I9Y A;  1BGW A;  1XQ7 A;  4J3N A;  4FM9 A;  1IIP A;  1I50 A;  2RH6 A;  1XXC A;  2R99 A;  3N0C A;  2YU9 A;  4GTL A;  1E8K A;  4S1E A;  3G4C A;  3AQO A;  1ZVU A;  3MML A;  5KUO A;  2CYH A;  5CJ9 A;  2R93 A;  1MZW A;  1MF8 C;  1DD5 A;  3L4J A;  4GTB A;  4BKW A;  3CYH A;  4KAW X;  2RGR A;  2IGV A;  5JFE A;  2GSO A;  2NUL A;  1GE9 A;  4DDQ A;  2IGW A;  1K83 A;  4KMH A;  3RFY A;  4YUJ A;  4DGE A;  4LQY A;  3VA7 A;  1E3B A;  1WIH A;  1A33 A;  4FRU A;  1AWT A;  3CAG A;  1O29 A;  2POE A;  4O8H A;  4S1J A;  4EYV A;  4C3I C;  5JHE A;  4N1M A;  3PMP A;  1RMH A;  5KV3 A;  2OSE A;  5KUU A;  1IS1 A;  5KUS A;  1O2A A;  4N1Q A;  3RDA X;  3EOV A;  1Z81 A;  2PHC B;  5CCQ A;  4TOT A;  3QX3 A;  1O25 A;  1Y1W A;  3MML B;  1IHG A;  4G0V A;  2PLU A;  1CLH A;  1EK8 A;  1VBS A;  2JA6 A;  1VBT A;  5CHP A;  3RD9 X;  1TWC A;  5CYH A;  1TWF A;  1B4A A;  4J5D X;  2FU0 A;  1CWO A;  4GTC A;  4E1Q A;  4GTD A;  3ORE A;  4KAT A;  4KM9 A;  2VUM A;  2RMB A;  3ICH A;  5CCR A;  1ZMF A;  2BIU X;  2OJU A;  3BUE A;  4GTE A;  1Y1V A;  1O26 A;  3R4G A;  2K7N A;  4R3F A;  2MVZ A;  2A2N A;  3Q3Q A;  2ESL A;  1ZBS A;  3K0R A;  2N0T A;  3N0B A;  4KMD A;  5KV2 A;  5DUD A;  2HAQ A;  1W8L A;  2X2C K;  3GTP A;  2BIT X;  2X2A A;  2WLW A;  4ZSD A;  1M9F A;  4FZB A;  4KC6 A;  3ODL A;  2JA5 A;  3K2C A;  2R7Z A;  2R92 A;  4YUL A;  4KDD A;  1MIK A;  3NUH A;  1EH1 A;  5IOS A;  1QNG A;  5KV6 A;  2C3B A;  2B63 A;  3R54 A;  1W8V A;  4DGB A;  1AWR A;  3BO7 A;  1M9X A;  4KMA A;  3R57 A;  1TWH A;  1IST A;  2X25 B;  1AWV A;  2CFE A;  4J5A X;  1X7F A;  4G0W A;  4C2M C;  4J5B A;  1QNH A;  4N1N A;  5KUQ A;  4N1R A;  1YND A;  1XO7 A;  4KM8 A;  2HE9 A;  1CYN A;  4YUH A;  2NVX A;  1CWK A;  4J5C X;  1ZKC A;  3RCK X;  1CWJ A;  1XWN A;  1ZKF A;  2E2I A;  2X2D B;  2JH3 A;  3GTM A;  4M1X A;  3RCF A;  1M9E A;  3K0P A;  3BT8 A;  5KUL A;  1OCA A;  1A58 A;  5KV7 A;  4J59 A;  4YUK A;  3ODI A;  4LQW A;  5KUR A;  1WQF A;  2MS4 A;  1WQG A;  4J5E X;  3RDC A;  2Z6W A;  1M9D A;  1SFO A;  1CWB A;  1BCK A;  1LOP A;  4CYH A;  3S6M A;  5CCS X;  3LPX A;  4JJM A;  2RMA A;  3UCH A;  4N1P A;  4GT9 A;  2MC9 A;  4DGD A;  4KB4 A;  4R3E A;  2CMT A;  4YUM A;  2Y3P A;  3LAJ A;  1BJT A;  1V9T A;  2KWA A;  1AWU A;  2ALF A;  2OK3 A;  2XGY B;  2CFA A;  4YUO A;  4LR2 A;  3FHZ A;  3R56 A;  3AQP A;  2QER A;  4ILD A;  1CWL A;  1I3Q A;  4P5A A;  2JA7 A;  1VAI A;  1CWM A;  2CFA B;  5CCN A;  2E2H A;  3N3Y A;  2P5M A;  2B71 A;  4KB2 A;  5KV1 A;  3K0N A;  5CBW A;  2GSN A;  4GTA A;  3CQZ A;  3OPF A;  1CWH A;  5CBU A;  3RCG A;  4C3J C;  5KUZ A;  1AB4 A;  3K0Q A;  1FGL A;  4DGC A;  2HQJ A;  4KAR A;  1R9T A;  3RCL A;  2GW2 A;  1J2A A;  5IOQ A;  5KV5 A;  5IOR A;  4YUP A;  1B4B A;  1AK4 A;  2CPL A;  2POY A;  5CBT A;  1XXA A;  1O2B A;  1W74 A;  4YUI A;  3GTL A;  1VDN A;  4HY7 A;  3O7T A;  3RDB A;  4YUN A;  3FOE A;  3ERE D;  4GTF A;  4BLB A;  1CWI A;  3T1U A;  2WFJ A;  5IOT A;  4O8I A;  5JVO A;  1M63 C;  3CYS A;  3JB9 d;  3GTG A;  3R49 A;  3GTJ A;  3OEP A;  3R59 A;  3LAP A;  5KV4 A;  1NMK A;  1AWQ A;  4P5B A;  2X7K A;  3S0X A;  5KV0 A;  1M9C A;  3H0G A;  2P0O A;  5EGH A;  3ICI A;  1O27 A;  4JCP A;  4BLA A;  3K0O A;  4FRV A;  1WCM A;  3K0M A;  1XYH A;  3RDD A;  4G0U A;  3FOF A;  1CWA A;  4N1O A;  4GFQ A;  5LUD A;  2ZP2 A;  2HQ6 A;  2MZU A;  4XNC A;  5KUN A;  3RCI X;  4KAS A;  3AH5 A;  1ZXO A;  1DYW A;  1CWF A;  1AWS A;  3GTO A;  5A0E A;  5F66 A;  2XCQ A;  3FKI A;  1KQ4 A;  2RS4 A;  5KUV A;  3GTQ A;  3L4K A;  1ISE A;  2CK1 A;  2RMC A;  2X83 B;  1TWA A;  3G4A A;  4N1S A;  1TWG A;  1XXB A;  1W8M A;  2XCR B;  3GTK A;  4C3H C;  4DGA A;  1WQH A;  1C5F A;  4YUG A;  5KUW A;  1M9Y A;  2GSU A;  2WFI A;  5TJ3 A;  4J58 A;  4IPZ A;  3BKP A;  3QYU A;  1CWC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...