3ORPA

Mycobacterium tuberculosis pknb kinase domain l33d mutant (crystal form 5)
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
290
structure length
274
Chain Sequence
MTTPSHLSDRYELGEILGFGGMSEVHLARDLRDHRDVAVKVLRADLARDPSFYLRFRREAQNAAALNHPAIVAVYDTGEAETPAGPLPYIVMEYVDGVTLRDIVHTEGPMTPKRAIEVIADACQALNFSHQNGIIHRDVKPANIMISATNAVKVMDFGIAIGTAQYLSPEQARGDSVDARSDVYSLGCVLYEVLTGEPPFTGDSPVSVAYQHVREDPIPPSARHEGLSADLDAVVLKALAKNPENRYQTAAEMRADLVRVHNGEPPEAPKVLTD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Serine/threonine protein kinase
publication title Allosteric activation mechanism of the Mycobacterium tuberculosis receptor Ser/Thr kinase, PknB
rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
total genus 88
structure length 274
sequence length 290
ec nomenclature
pdb deposition date 2010-09-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3orpA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3orpA01
3WZUA 3EZRA 4M69A 5I4NA 4GIIA 4WG5A 4FL2A 5AA9A 3NVKI 4N70A 4DH1A 2C5YA 4GUEA 3EN7A 1PW2A 3LQ5A 2GPHA 2OXDA 2BRGA 2WGJA 5I9YA 3EN9A 1REKA 3C7QA 4JIKA 5EK7A 2BRNA 5LCJA 1YXSA 5ICPA 1PXMA 2X7GA 3EQBA 4DFUA 1OKZA 3L9NA 4YBKA 3I7BA 3ZRLA 3GCSA 1OIRA 4A4OA 4V0GA 4X2FA 2QHNA 5JH6A 3VBVA 3OY3A 1OL1A 3IDCA 4C38A 3KRXA 2OGVA 2QG5A 3TV4A 1H26A 2CKPA 1RW8A 3E8DA 4XG8A 4EC8A 1NVQA 2CCIA 3S95A 4O2ZA 5KMKA 5LWMA 2BFXA 4YTCA 3C9WA 3R30A 1IA8A 5CT0A 3E3PA 2R0IA 3HRFA 4TYEA 4A9UA 3GFWA 4HCUA 4YURA 5KBRA 2VTTA 4II5A 2W5BA 3PJ8A 2W1GA 4KKGA 3NUPA 4CFVA 4NM5A 5AEPA 4MXYA 3FI4A 3W2PA 3ZO3A 1H1SA 3A99A 1KUTA 5FEDA 2OK1A 2UW6A 3F5UA 4U0IA 3RAKA 2JDTA 5AR5A 2GS7A 2W0JA 4X3FC 4ZEGA 1ZMWA 3VS5A 3I0QA 1JOWB 3VUMA 4JBOA 3UMXA 4K77A 5AP7A 4D0WA 4L53A 4LM5A 5G6VA 3RNIA 4RMZA 4W4XA 3KREA 5DYJA 5IA4A 4QQJA 1G8AA 1OPKA 4KKEA 2GQRA 2YJSA 4X6QC 4RZVA 4OT5A 2W99B 3DTCA 4L43A 3LKMA 4A4XA 5LVNA 4JG7A 4OLIA 5JEBA 5IQCA 3ZC6A 3PIZA 4QNAA 4OTDA 3SLSA 3RVGA 4C62A 2BZKB 4RX8A 5KMMA 3NSZA 3PY1A 4AFEA 4AE9A 5HVKA 2O0UA 3I1AA 3IOKA 3VHEA 3F9NA 5ANOA 4FTJA 4FKTA 3WF9A 4FSNA 3D0EA 4G3DA 3QTZA 4BBFA 4ZTMA 3F2NA 1PKDA 2GTNA 4XRJA 3ZMMA 2Z7SA 1OVEA 4W9WA 2O8YA 1WBPA 3QUPA 3Q4CA 5JK3A 1OL5A 3DBCA 5A6NA 4YLJA 4EJNA 4IANA 1M52A 2H96A 2IVUA 3OWLA 1H0VA 1ZMVA 4HGSA 4YNEA 5HIBA 1FINA 3VBWA 2CKOA 4KKHA 4G3CA 5I5ZA 3FSKA 4UZDA 3OCGA 2BRMA 5A4EA 1OBGA 5BMMA 3U9CA 2XIXA 4YPSA 2QKRA 4PF4A 3C0IA 4PDOA 5EHOA 1REJA 4KIKA 3MWUA 4HVIA 3R1NA 2VWYA 4DITA 3UO4A 5DVRA 2I0HA 1Z57A 5M09A 4E1ZA 3ERKA 2G2HA 1PXJA 4NFMA 5D7AA 4IB5A 3W33A 4GRBA 4U42A 1RDQE 5F4NA 1WFCA 4F9CA 3QZGA 4FA2A 3CQWA 4QPAA 2XKFA 2EU9A 3DLZA 2JBOA 4EHEA 3W18A 4CKJA 2HWOA 3QGWA 4RQVA 3VS4A 2LAVA 1FMOE 4O0XA 3BYVA 3HECA 4C2VA 1ZYLA 4PTGA 4FV8A 5HIEA 2FSMX 4S30A 5EDPA 4FZ6A 3BLQA 4IQ6A 1U54B 5ETIA 3FLNC 5EQYA 4DFYA 2IN6A 5AP0A 4BZNA 2B9HA 2IW8A 4GYIA 2HXQA 2G1TA 4WSYA 3VVHA 4RA5A 4FG9A 3OXZA 3HV6A 4YLKA 4EZ7A 2XCKA 1E9HA 4GK3A 3ODYX 4FF8A 5FXQA 4DEDA 3QYZA 4KINA 3ETAA 3G6HA 3QFVA 3KK8A 4AZSA 3AT4A 3DOGA 2QG7A 5JFXA 5KKRC 5CXZA 1NVSA 2EUFB 2WIHA 2J0KA 3D7TB 4UB7A 3MPMA 1M2RA 3QTSA 5DEYA 3NNUA 2R5TA 4MXCA 5CU2A 5JRQA 3GU4A 4YJRA 3BI6A 2JBPA 2B53A 4FKWA 3JY9A 4YSMA 5AV0A 4DFNA 3ORPA 4C3RA 1H1QA 4IHPA 2CPKE 4CQEA 3DXPA 2W9ZB 3QQJA 3LXLA 4AN3A 3FAAA 4XYFA 2Z7RA 4NTTA 4CFFA 5JKGA 3NVMB 1GY3A 4UN0C 5C8NA 3GOPA 4I5PA 5I9UA 1R0EA 3GENA 4YO6A 3FZSA 2QU5A 5FM3A 5FWKK 3D5WA 1PXIA 1BLXA 4O7RA 4DC2A 3EL8A 2HY81 4OUCA 2RGPA 2YCFA 2P0CA 3HUCA 2VWWA 3KKVA 4QYHA 3DZQA 3FC2A 2V5QA 4XG4A 3TTJA 4YO4A 1Q8UA 4O86A 3HVCA 3POZA 1Q3WA 1NW1A 1GOLA 4ONAA 5CWZA 3OW4A 5CT7A 4O96A 4IWDA 3MJ2A 4ACHA 1OUYA 3MGYA 4JS8A 4I93A 4CYJA 3PXFA 4HNFA 2ITPA 3P08A 4AZEA 3DLSA 4M67A 3I7CA 1A9UA 3NUNA 4FZAB 4JBPA 4OAUC 4JX7A 3HP5A 1G5SA 3BQCA 5IH5A 5JFVA 4TL0A 1APME 4ANMA 5CQWA 4QTCA 2CCHA 2JDOA 4CFWA 4DGLC 5IH4A 3FZ1A 2B52A 3FZPA 4R5SA 4BKZA 5FG8A 2VWUA 1TQPA 4DEAA 1FVTA 2PVNA 2BHEA 2BZIB 2WMTA 3O50A 3CKWA 3FHRA 3R71A 4EH3A 2NP8A 5AP3A 4U9AA 5LQFA 1ZWSA 1AGWA 5K4JA 3BIZA 2IW9A 1ZOEA 4BZOA 3KA0A 1IASA 1UU3A 5L8LA 2E9VA 4GCJA 2BDFA 2OW3A 4JOAA 3OVVA 4LGGA 3IW4A 5CAPA 4O0TA 4FKGA 3IW6A 3KK9A 2VD5A 2X4ZA 4E4LA 1UU7A 5A4TA 3Q2JA 1I44A 1ZY5A 1BL6A 1Z9XA 4LOQA 1OIYA 1OKYA 4R1YA 1H08A 2PZRA 5D12A 4EOLA 3MH1A 5CALA 3ORNA 4TZRA 3NNVA 5DOSA 2FB8A 1U5RA 4Y8DA 2IW6A 3UG2A 3LJ1A 2VWVA 3HMOA 2BROA 3AC2A 2J5FA 3HLLA 3GEQA 3Q9XA 3MFRA 3THBA 5KMIA 4NKAA 5BMSA 4NIFA 1RQQA 3UOJA 2ZM3A 2W7XA 3F2RA 4FL3A 4AWIA 4DG3E 2EVAA 4IJPA 4FNZA 2PVRA 4IDVA 2CN5A 3CEKA 1J7UA 1ZYSA 3UODA 4KS7A 3CC6A 5FDPA 3UE4A 4ANLA 4L00A 3SD0A 4D9UA 3WF5A 3R9DA 2GQSA 4KSQA 4DFBA 1Q5KA 2X7FA 2QOFA 4RC3A 1XH7A 4YZ9A 5DPVA 4JXFA 4RC4A 2W1EA 3RNYA 2OBJA 4BCKA 1XQZA 4TTHB 2GCDA 3MSSA 3H9FA 4I6QA 4A4LA 2OICA 5A4LA 4EOQA 3DKCA 3KGAA 4RVTA 3O0GA 3TZ8A 4YU2A 3C4WA 3OOMA 1IR3A 3EN5A 5CVGA 2G01A 3FZRA 1ATPE 1JKLA 2X7OA 4H39A 4ZTSA 2ONLC 4RC2A 5GNKA 3R7YA 2J5EA 4FTLA 4X3FA 3SW4A 3VUTA 4C02A 5JMSA 2X6DA 3PRFA 4O6LA 4XOYA 5BPYA 5JGDA 5JQ8A 2XNPA 3ULIA 4IAZA 4QYYA 3QQHA 4RWIA 4XG6A 3IO7A 5K0XA 3RZFA 4YGAA 5HE1A 4BCOA 4E8AA 5DR2A 3MS9A 3KVWA 3VBQA 3RPVA 3KN6A 5J1WA 4YJQA 3FE3A 4GEOA 2A27A 2GSFA 4M13A 4XOZA 5FXSA 2ACXA 2X8EA 4R5YA 4RWKA 3RHXA 3VULA 5EYKA 2XIRA 1LUFA 3EYGA 3W8QA 3WF8A 4ZJVA 2OIBA 3U6HA 3PVBA 3ZO1A 1YQJA 3SW7A 4M14A 3UQCA 1BMKA 3R8ZA 5HORA 4QO9A 3FC1X 3RZBA 4TYGA 1GZOA 1KE9A 2F49A 4FKPA 4DEIA 5C8KA 1OECA 4AFJA 3KRJA 4FIGA 2XA4A 2GNHA 4HYHA 3G9NA 5AWMA 3DQWA 3QX2A 5EI6A 1ZAOA 4ACDA 4QMSA 3QALE 1Q8ZA 3BYOA 3ID6C 2WELA 3BWFA 3CQUA 2DYLA 3RPSA 3VS6A 4P7EA 3GCVA 3VJOA 2ETKA 4FGRA 3EN4A 2UZOA 3CD3A 4GJ2A 2GNJA 3BHYA 2B4SB 5LJJA 3ZRKA 1SYKA 2VNWA 4G2FA 3QLFA 1P2AA 2F4JA 3HYHA 4OAVB 2QOIA 3Q04A 4C33A 5L2QA 3R7GA 4RFMA 4RLKA 4W8EA 1YDRE 4OTQA 1CTPE 3V6SA 4BRXA 3OWPA 3Q32A 5C03A 3T8OA 1PYEA 2B55A 3KY2A 3MVJA 4MX9A 4I6FA 4AZTA 4ZMEA 5K3YA 2XRUA 4QTAA 5E8YA 4BCGA 3QQLA 4EI4A 4Z55A 1RE8A 2QOKA 2X2LA 2X2MA 3H0ZA 4XRLA 3TTIA 4IVBA 5HX8A 1YDSE 2XEYA 2PE0A 3DKGA 2R7BA 4UWCA 5AUXA 5I9VA 1P14A 2YIQA 3GCQA 2IZUA 1XH6A 4NSTA 1IRKA 3C50A 2H6DA 2OZOA 2HY0A 3G5DA 1WVWA 3MV5A 3HAMA 3OP5A 3OY1A 3BE2A 4PPCA 4LG4A 1SZMA 3OCSA 2CKEA 4WNKA 3BU6A 1XH4A 2ITVA 3IW8A 4BCMA 4DBXA 3Q52A 1CMKE 3R01A 4LUDA 4QNYA 4CLIA 5DR9A 5BVDA 3UIBA 3POOA 2UW0A 3LFSA 4NFNA 3VNTA 4DGGA 3PWYA 4YHTA 3UMWA 1XWSA 4QMWA 3UZPA 3RBWA 4D5HA 4Q9SA 2C3LA 4XV1A 2J0MB 4GYGA 4WNMA 1YOMA 3VWAA 3BE9A 2P55A 3Q53A 4QT1A 5L6OA 4D2VA 2PVJA 5GZAA 2C6DA 2QR8A 4G6OA 4ZSGA 3W2CA 3NW6A 5BYYA 3L8XA 2JIUA 5CF8A 1GZKA 4ZSAA 1Q8TA 3LCTA 4O7TA 3DK3A 3TT0A 5A14A 5H8EA 2PVFA 2B9JA 2YCSA 3HMIA 3DS6A 3KCKA 4FEXA 1Y8GA 4JI9A 5DBXA 2OFVA 4HPTE 3PTGA 4C4GA 5L8JA 4C61A 1CKJA 2XNNA 5IEXA 4BDJA 4GIHA 4UMQA 1YOLA 2V7OA 3OZ6A 4WSQA 5E8VA 3VUKA 5I9ZA 4XV3A 3OW3A 4M7IA 5AUZA 3QCSA 3C4ZA 2OJFE 3DGKA 3IDBA 4MD8E 1JWHA 3QUDA 5F95A 4DLIA 2IZSA 5DH3A 4BI1A 1ZARA 1B38A 2XNMA 3BYMA 5CEIA 4EK8A 4PNKA 4ASZA 1VYWA 5EQPA 2V22A 3KXHA 2YIWA 5ACKA 4CMOA 3OF0A 3LCKA 2A1AB 3ACKA 1XO2B 4EORA 5DA3A 1PYXA 4RVMA 2YABA 1W82A 4ANNA 2X8IA 5CU4A 3PPKA 4LL5A 5CENA 3PPZA 2PMNX 4DBNA 3V5PA 3QBNA 3IECA 4PDSA 3MESA 5C9CA 5L6WL 4V05A 3DKFA 5CF4A 3F88A 4RIOA 2ZB0A 1PHKA 3Q2MA 4QP1A 1O6YA 4DFZE 2XIZA 5M56A 4X3FB 3GU6A 1Q8WA 1OPJA 5ANIA 3W32A 4WHZA 4BFMA 2JDRA 2VX1A 1F5QA 4QP8A 4FSYA 5KBQA 5G1XA 1Y6BA 4I4FA 5HI2A 5AUTA 4PRJA 5IA1A 3A60A 3FDNA 3MPTA 2WAJA 1XBCA 3MIAA 4FTAA 4ZS0A 2UZBA 3Q5ZA 4MHAA 4DLJA 4ZOGA 3ITZA 4EBVA 3DAJA 5CVFA 4JJRA 4U40A 5CSXA 4AZWA 4CFMA 3QZIA 2VO6A 3OCTA 4IBMA 4JR3A 4V04A 3O71A 3SKCA 2YERA 5E8TA 5T68A 3U4WA 4MQ1A 5CU3A 5M57A 1R78A 3BEAA 2UW7A 1R39A 4IACA 2Y6MA 3ZDUA 3FHIA 3AQVA 4FT3A 2QLQA 5EYDA 4WT6A 2GQGA 2BPMA 4J7BA 4D9TA 4DFXE 3RWPA 4C4IA 5HO8A 5DE2A 1OIQA 1J3HA 1KWPA 4FKVA 4I20A 2OLCA 3C5IA 4I0SA 3R8VA 4RLLA 3QQUA 3A7GA 2AUHA 2XK7A 2HYYA 4TPTA 5T6KA 2HW7A 5AV3A 5L2TA 4MWHA 4Y5HA 5HIDA 1CKPA 4F63A 3DTWA 3BRBA 3FJQE 1STCE 3A4PA 5CZIA 5FP5A 5HG9A 5ACBC 1E1XA 4I94A 4ZJIA 1OPLA 5DEWA 2WQBA 5KO1A 5CEQA 4DFLA 3UIUA 2YDIA 1BYGA 4I23A 4UZHA 2X2KA 3TI1A 3UGCA 2BFYA 1QPEA 2W1CA 3PG1A 4MBLA 5H8BA 1OMWA 4JDJA 2EWAA 2Z7LA 2VTOA 4O6EA 2J90A 4EH7A 3VW8A 4CFXA 5A46A 5IKWA 1JKSA 2AC3A 5D11A 1JLUE 4E4XA 1M7QA 5GHVA 2F2UA 3JR1A 4TWPA 3TG1A 5JFSA 2YIRA 2O5KA 2HK5A 3FLSA 3I4BA 4AF3A 4F6UA 2VTAA 3ZC5A 2PSQA 3R22A 4NJ3A 2W06A 4E5WA 4BKJA 4RGJA 4G6NA 1ZYDA 2XK9A 4EWQA 5BX0A 2PK9A 2PL0A 4YC8A 4AGUA 5LVMA 5LVPA 2R3OA 4XG7A 4PQNA 5JN2A 3R9NA 2RF9A 1ZOGA 2UZVA 2UW5A 2WTIA 4OTGA 4FT9A 4RWJA 2I0EA 1VEBA 4OW8A 4MXZA 3UDBA 1A06A 4H1JA 4APCA 2C6MA 3QQGA 4FX3A 2WTVA 3ATSA 5HVYA 4KUJA 3R2BA 3NUXA 5FUTA 5EOBA 5AP2A 3O8PA 4AA4A 4NZWB 4FV9A 3C4FA 4ERKA 2CNQA 2W05A 1P4FA 3O7LD 5D41A 4I5CA 5JZNA 5KKRB 3EJ1A 2YA9A 1S9IA 4EK3A 4ZJJA 3EB0A 4D58A 4RJ3A 2JAMA 3FMMA 3LFQA 4TT7A 3VN9A 2OJGA 4LFIA 2ITXA 3DZOA 4FYOA 3QZHA 4BTKA 3KRLA 2J51A 4H3PA 2G2FA 3ALOA 4FVPA 4MNFA 5HBHA 2R3HA 1YHWA 2VWZA 2ZDUA 3MI9A 5TR6A 5LCKA 3OC1A 5CAVA 3DA6A 4ANBA 3TM0A 2CDZA 4O84A 2R3KA 3FXXA 5BVNA 3COKA 3FPMA 4YJPA 5DRBA 1VZOA 4JAJA 3C1XA 5AAGA 2WTKB 2CGXA 4AAAA 4A9RA 3OBGA 4ID7A 3R00A 4TKSA 1ND4A 3PZEA 3WOWA 3PA3A 5DWRA 2PVKA 5JFWA 1BI8A 2YM8A 3PIXA 4BDEA 5IQHA 1K9AA 1Y91A 2VO3A 2UVYA 4B9DA 5IF1A 4AZVA 5IMXA 4DTAA 4RVLA 4D2SA 3G2FA 4FE2A 4C4FA 3U4UA 3K5UA 4YJVA 1LEWA 4MH7A 2J50A 2VTMA 3EOCA 3NDMA 3OCBA 3PXZA 2VTSA 3SA0A 4F0IA 5FTGA 3HEGA 3FL5A 4F7JA 2OJJA 5EG3A 4K18A 3V5TA 1T45A 2YZAA 4QP4A 4FTUA 3RM7A 4EOOA 3QD2B 3R63A 4FKQA 2NRUA 5JSMA 2R3LA 3BYSA 2CNVA 3COMA 3DFAA 3D7TA 3F2AA 5E8ZA 5TO8A 2JAVA 5LMKC 4WG3A 5GZ8A 3ZH8A 3BKBA 3LLAA 4HYIA 5HTIA 3QD0A 2B1PA 4F0GA 1FMKA 4MNEA 4GW8A 3TNQB 2ZJWA 1U59A 1WBVA 2BVAA 3ZHPC 2XVDA 3FI8A 1ZZ2A 4J1RA 5A3XA 3QTWA 2UZTA 4O22A 5AIKA 5IEYA 3UO6A 2X39A 3L1SA 1KOAA 4DYMA 3LFDA 3KXMA 3GQLA 2QOBA 3MDYA 4JVGA 5EW8A 3RK7A 5M51A 3OXIA 4LRMA 4LOOA 2QOQA 2QU6A 4YC6A 4Y83A 4ZSEA 4IB1A 5BUJA 2WTWA 5E91A 3BV2A 5EQEA 1YI3A 3FMHA 5AAEA 5EM7A 4G1WA 4CG8A 3FBVA 2QKWB 5F94A 2O2UA 2I1MA 3F82A 3BCEA 2IVVA 2JLDA 3FMJA 2Z60A 3D7ZA 4Z7HA 2H9VA 3CGFA 5GIPE 4S2ZA 3VUDA 4CG9A 1LP4A 2ERKA 3LE6A 3NW7A 2C1AA 4AT4A 3IW7A 4CLJA 2XNOA 2W5HA 3G9LX 4Q9ZA 4ERWA 4AN2A 1YI4A 3IG7A 3R02A 2P3GX 4D28A 4TNBA 2OXXA 4TW9A 3MYGA 3JXWA 3H0YA 4CZUA 2JDSA 3QTXA 4YUQA 4YPDA 4PL3A 3PJ3A 3CQEA 3ET7A 4G9RA 3ZSHA 4RBLA 4K8AA 4KBAA 4MCVA 4F7LA 3CBLA 3MW1A 4FI1A 5IUIA 5CSPA 3UVQA 3C4CA 4L46A 3ZFXA 4IC7A 4QP2A 2VN9A 4N4SA 2YDJA 4M97A 4FZDB 4S31A 1Q99A 5CU6A 4BVUA 3ENMA 3DK6A 5KZ0A 5BQ0A 3MA6A 4C7TA 3SV0A 2O65A 3WILA 4O0YA 1VR2A 1PY5A 3KQ7A 4QD6A 3QHWA 4O82A 2QHMA 5FLFA 5CS6A 2KULA 1PXKA 3V5QA 3QAME 4BL1A 3HDNA 2R3RA 4ENXA 4QYEA 3WYXA 1SNUA 4G3EA 4KWPA 4M12A 4E26A 4D55A 5LXMA 3A7IA 4YJOA 4ACMA 2XK3A 4A07A 3RKBA 2NRYA 2R4BA 4JT3A 4YJTA 5CU0A 3ZONA 4AS0A 3A7FA 4C57A 2OWBA 2XJ2A 4G34A 5LVLA 4WA9A 2OH4A 1PRYA 3ORTA 4UXQA 3CSVA 1H24A 2C1BA 5EYMA 2JFMA 2XH5A 3TJCA 2FSOX 3M11A 4JBQA 1Q97A 1OZ1A 5DMZA 4KSPA 2QOHA 4TWOA 5ETCA 3K3IA 4D2TA 3ZO4A 1WZYA 3P86A 1CKIA 4O7VA 4BI0A 2ERZE 3EQIA 4XP3A 4JRVA 5HD7A 3TKIA 3LFBA 4G9CA 4LI5A 3SOCA 3WF6A 4DG2E 5BUEA 5LVOA 3UQFA 2B54A 3GUBA 3HMMA 5EM8A 4GVAA 3E5AA 3KXXA 3CTJA 2ZOQA 3O96A 3ZFYA 4ZTHA 3QD3A 3TJDA 4BYIA 4HCVA 3A62A 2X4FA 4WOVA 2XBJA 3L8VA 4V01A 5AUVA 2OF4A 2PZ5A 4FKOA 3RK9A 5IDPA 4ASXA 5HX6A 4B8LA 4ACCA 3FMEA 4B4LA 4NH1A 4AOTA 2J9MA 3CD8A 5K0KA 5CVHA 4KIQA 4FTIA 2WQOA 3Q6UA 5CNOA 5GZ9A 4D2WA 2XM9A 3LQ8A 3QC9A 1PKGA 1YOJA 2ZAZA 4L3PA 3LJ2A 4Q5HA 1H0WA 3WBLA 1J91A 1HCLA 2FO0A 4EQCA 5B2LA 3SVVA 3A4OX 4NM7A 4UY9A 1X8BA 2VWIA 5AV1A 2V55A 3EIDA 5HE2A 2NO3A 5CI6A 1VYZA 1TKIA 2IVTA 2XMYA 4R3RA 5DI1A 3E3BX 2VRXA 3DCVA 1MUOA 3MFUA 4IH8A 3NYNA 4FUXA 2YIXA 2CKQA 1SMHA 4S34A 4ZLOA 2ZV7A 3KMUA 2ITZA 3U9NA 3RCDA 5C01A 1Q8YA 4ARKA 5IEVA 2DUVA 3AC5A 4EJ7A 3C0GA 1BUHA 3B2WA 2E9PA 4WUAA 5FQDC 3PJ1A 5HE3A 1V0PA 3P7CA 2PHKA 4LGDA 2WKMA 3CCNA 5KMLA 3H9OA 4E7WA 3TV7A 4BN1A 1H01A 4YZNA 5HQ0A 4F7NA 1WMKA 2VTQA 5D9HA 5IUGA 3C4XA 5ANEA 5GJDA 4MNEB 5IA0A 3BHHA 1KV2A 1ZYCA 4TNDA 4FG8A 4CQGA 3DY7A 3CJGA 4KRCA 3IPHA 5KCVA 2WMVA 3BYUA 4FIHA 3KB7A 4UWYA 5F20A 4FIFA 1XH8A 4O0WA 2Y4IC 3IKAA 4HNIA 4F1OA 2VTIA 2IVSA 3PA4A 4IB3A 5CX9A 3PSBA 2WTKC 3V8SA 4FT0A 3V01A 3V04A 2WPAA 5FDXA 2PUPA 1KE5A 4IE9A 5H3QA 2IO6A 3G6GA 4MWIA 5D1JA 3NAXA 5CAUA 4BWPA 2YM4A 3AOXA 3KN5A 4BDGA 2R9SA 1U5QA 3CLYA 2IG7A 4D2PA 2VUWA 4L3JA 4ZY5A 3PLAE 4BWXA 2C3KA 2C68A 3UG1A 4FV1A 2UZNA 4LQMA 3R1SA 4ANSA 5IA2A 5DNRA 4CTBA 3ZSGA 2Z7QA 2CNUA 5M4IA 3AC4A 4LGHA 2W1DA 2C69A 2YAKA 3RPYA 4DH5A 3FMNA 3UBDA 2WQEA 3KXNA 2C5VA 3VIDA 1YWRA 2C5OA 2WEVA 4DCAA 1BX6A 1AD5A 3ZLYA 4TYIA 2HOGA 2QC6A 4Y73A 2XK4A 5L2SA 5HLWA 5L4QA 2CGUA 1EH4A 2BR1A 5CY3A 3RI1A 4A9SA 4YJSA 3SHEA 1JSTA 3NIZA 4UWBA 5AFVA 5J9LA 3DBQA 3K2LA 2PE2A 5EHLA 1KSWA 3A8WA 4O83A 4O38A 3I79A 4GG7A 4QMLA 5LMKA 5TF9A 1WBSA 5B2KA 2VTPA 2VO7A 4CCBA 4PY1A 3C13A 3QU0A 4D1ZA 2QQ7A 1KE7A 3CJFA 5ETFA 5HD4A 3N51A 4F65A 1H27A 2I6LA 4O0RA 1L8TA 4E3CA 2C3JA 2P2HA 3ZLSA 4AACA 3KRWA 4GKHA 3DPKA 2ITUA 1UU8A 1W0XC 1YWNA 5EOLA 4I24A 5ETAA 3AC3A 4CTCA 5E8UA 3ALNA 4XLVA 2DWBA 2PY3A 3BLHA 1O6KA 3CKXA 3VHKA 5L6PA 3OXTA 4AU8A 4XG9A 4GFOA 1SVEA 3RAIA 4L67A 4J8MA 3NCZA 1GIHA 4QYGA 2IZRA 4FIEA 1LR4A 2JFLA 4I0RA 2QOOA 4O7ZA 4ZTQA 4MTAA 3L9MA 4YZDA 3R9HA 2BZHB 4X2NA 4YTHA 2XNEA 1Y6AA 2BUJA 5LARA 3SRVB 3GOKA 3DDPA 1IG1A 3R2YA 4FGBA 3RK5A 3LVPA 2J0JA 3HNGA 2JD5A 4JLCA 5EI8A 2BRHA 3PY3A 5BVWA 4DT9A 2R0UA 2YITA 2FVDA 3NWWA 3OHTA 4QMUA 4NT4A 3OEFX 1IEPA 5DFPA 4IZ5A 2XEZA 1A48A 3NYOA 4NEUA 4GS6A 4P2KA 3S00A 4EL9A 5M07A 4FSMA 3KRRA 2CLXA 3VBXA 4FKLA 4L7SA 2GNLA 5HEZA 2ITOA 5IQDA 4X6RA 4CFUA 2J2IB 2WMRA 4CZTA 4YTFA 1NVRA 4C4HA 3CE3A 4BCFA 2HZNA 5AX3A 4DH7A 5BNJA 3A8XA 4DHFA 4BCPA 4DEHA 4EH8A 3P23A 4O0UA 5HTBA 5IQEA 1L3RE 4XP0A 3F3VA 3F3UA 4BB4A 4K0YA 3Q4TA 1CDKA 1W83A 3MN3A 2PU8A 1R0PA 3TZMA 4EBWA 5BUIA 3NRMA 4L45A 2XNBA 2C6OA 2BKKA 2J7TA 3OUKA 4I5HA 2W4JA 4FKUA 4K1BA 2QODA 4TRLA 4XP2A 3R9OA 3D83A 4CRSA 2HIWA 5AR3A 3EFJA 2XM8A 3PDTA 3E63A 5AM7A 4I3ZA 3FWQA 1ZRZA 3VF9A 4F09A 4U5JA 1QPCA 2WFYA 3A7HA 4TWCA 5FTOA 5HO6A 2O63A 1NY3A 2GNFA 4FC0A 4JQ7A 3HMNA 3R21A 3ZFMA 5LWNA 1NT2A 4ZSJA 2BKZA 2C5XA 3FQHA 4EOIA 1URWA 3RINA 4DTBA 3TEIA 4DINA 2QO9A 4LRKA 5EI2A 3VUGA 4UV0A 1KOBA 3PXQA 2O64A 4G31A 2C5NA 3RTPA 2OJIA 4ZXTA 3TIYA 2J0IA 3DKOA 3F66A 1SVGA 2Z02A 4FSRA 1OL6A 5A6OA 2QO7A 3PFQA 4AW1A 5CF5A 5IPJA 2C3IB 1MP8A 5DLSA 5FEQA 4QP3A 4EWHA 3PSCA 4C37A 2WEIA 2P2IA 4F0FA 2RKUA 3E8EA 2ESMA 3LCOA 4IAFA 5T3QA 3H10A 3JUHA 3EYHA 1H1RA 4KAOA 4EUUA 2QVSE 1M17A 2PVYA 4QTBA 4EOJA 3LQ3A 3BHUA 5B0XA 2YWVA 4ZZOA 4BR3A 3LMGA 4HGTA 4DGNA 3NUYA 3R7EA 3ORKA 4IAKA 1YDTE 3DAKA 2HZ0A 4IWPA 5JGAA 4JDIA 4E5AX 5M53A 3PY0A 4CV9A 3EQGA 4M66A 3TNWA 4EYMA 3U6JA 4UXLA 4ZTRA 5HHWA 4O7NA 4GH2A 4I0TA 4J53A 3FY0A 5FRIA 4HVSA 3QTUA 4ITIA 4IWQA 2OF2A 4RQKA 2GFCA 1B39A 4FICA 5FP6A 2Q0BA 3QXPA 4N6YA 3T3VA 4KIOA 4L3LA 4BIBA 2EB3A 4Z16A 1HOWA 4R7IA 3PA5A 2OXYA 1GIJA 4XV2A 5J7BA 3HAVA 1OB3A 2Y0AA 2VX0A 2ZDTA 3AGMA 3F69A 2ZM4A 3MH3A 2XB7A 4PUZA 5HGIA 2GS6A 4L8MA 4OTRA 3ROYA 4L9IA 3UVPA 4EH9A 2B0QA 3GXLA 3G0FA 4YMJA 4Y95A 2CSNA 3LXPA 3TDVA 3D2IA 5AP5A 3VQUA 4NWMA 1B6CB 5M08A 2FA2A 4LL0A 5CAOA 2VGOA 5FBOA 4RIXA 2WQNA 3ZS5A 4YZBA 3KF7A 2BDWA 2H34A 4F70A 4OT6A 3PXKA 3ELJA 3VS1A 2JDVA 5KZIA 5B7VA 3COHA 5AUUA 3VQHA 4E5BA 4CXAA 1DS5A 3RMFA 2FSLX 3R7OA 4LOPA 3FSFA 3IGGA 3LCSA 5M44A 3B8RA 4TY1A 3PG3A 3EHAA 3EZVA 2W5AA 2WMXA 3C4EA 4O81A 3PWDA 5DR6A 5HNBA 3I81A 2A19B 3QCXA 5IA3A 2XP2A 4OBOA 4UALA 4XNEA 2JEDA 5J5SA 5CEPA 4O7YA 4FEWA 4IVCA 5FBNC 5CAQA 3EQFA 1QPDA 5HESA 5HZNA 3GCPA 2PE1A 4EKLA 1XH5A 3DV3A 1SVHA 3PLSA 3ZEPA 2OI4X 3FXWA 4GFGA 2BILB 3M2WA 3GGFA 5DGZA 3KFAA 2VTRA 4D4RA 4FVQA 4JBVA 1PXNA 2J0LA 5KHXA 3TDWA 3ROCA 1E1VA 2PMOX 4EYJA 3R9RA 2GS2A 5IU2A 3GI3A 3Q5IA 5AP4A 4PMTA 3RALA 4WRGA 1TQIA 4GMYA 3AT2A 4IM0A 4UYAA 5HG8A 4C2WA 4AOIA 4RRVA 4IVDA 4N6ZA 4RA4A 4FNWA 5AV2A 2C6KA 4M3QA 3D15A 3ZUUA 2R3FA 5J87A 5K9IA 4FK6A 4FV4A 4EOSA 5J79A 3FYJX 2W1IA 1W98A 4GK2A 4TYHB 5KX8A 4E73A 4IDTA 4L01A 4M0ZA 4HJOA 4IADA 5DHJA 3N4VA 2BTRA 4IB0A 4WBOA 1BL7A 5HBJA 4XBUA 3G90X 3WE8A 4IZYA 4DCEA 4RVKA 5CNNA 1ZYJA 2V7AA 4FTMA 4HGLA 3IOPA 5EYCA 2BRBA 1QMZA 4I6BA 4MBJA 3WZJA 1IAJA 4FTKA 2VTLA 1UKHA 2I0VA 2XBAA 4MKCA 3GC9A 4EHZA 3P9JA 3D2KA 2I7QA 5IQIA 2AYPA 4J98A 3QX4A 5HCZA 4AUAA 3D14A 3LFFA 4WRSA 4XH6A 3OFMA 4ALUA 1HCKA 3BGPA 1JPAA 3D5VA 3W2SA 4CYIA 4DH3A 2X6EA 3E88A 5ANGA 4U3ZA 5C26A 4QMTA 4GT3A 3FQEA 4E6AA 4CVAA 5L2IA 1IAHA 2WHBA 4HVHA 4NYEA 5GINE 3RAHA 4EOKA 3K3JA 1XR1A 3CY2A 3TXOA 3DJ6A 4RT7A 3PUPA 4LYNA 3R8PA 3WF7A 4QYFA 1GJOA 5HO7A 4F1TA 1ZOHA 3QWJA 1QL6A 3AG9A 2ZB1A 5BVKA 4ZZNA 3GC0A 3BGQA 4QMXA 5AM6A 2XYNA 5D7VA 5IQFA 4EH2A 4FYNA 4J71A 4K6ZA 5A4QA 1OIUA 4QPMA 4HZRA 2P4IA 3NGAA 2UUEA 3P79A 3U87A 4QOXA 4ZLZA 4U44A 4FZFB 4MK0A 4BDFA 2PUUA 5HLPA 3FZTA 3MFSA 4PP9A 2R3GA 4U41A 2YISA 1WBWA 2CGVA 4X2GA 3F6XA 4MQ2A 4K11A 4NW6A 3BV3A 1YRPA 5ITAA 4H1MA 3UPZA 1TQMA 5CSHA 4GFMA 2RFNA 1H07A 4D0XA 4CCUA 4PDYA 2VNYA 2REIA 3AT3A 2Y9QA 1JKKA 3DJ7A 3MBLA 4FUYA 3R8MA 3ORZA 4RIYA 4QMMA 2WOUA 3Q60A 4P5QA 3GB2A 4EK6A 1F3MC 3LCDA 3CTHA 4K9YA 4J95A 4R8QA 4Z9LA 1M2QA 4BBMA 5A4CA 5HU9A 4H05A 4E6DA 4BCHA 3R73A 3UVRA 4MD9E 3FMLA 3ODZX 4JDKA 4NM0A 4AGDA 3GNIB 4BDDA 4Z3VA 5IQGA 2I0YA 5CZHA 1J7IA 1R3CA 4QTDA 3FI3A 2FYSA 2C6EA 2I40A 3V51A 4FIJA 4C3PA 4ZTNA 4RJ5A 5I3RA 3PIYA 2VX3A 5AV4A 3VW6A 1P5EA 1O6LA 4J99A 5AAFA 2Y6OA 5JZJA 2GHLA 2CLQA 5HVJA 4QMOA 1CSNA 2UW8A 2ZV2A 5H8GA 3VC4A 2IWIA 4I92A 3VBTA 4C35A 3UPXA 3E92A 1XBAA 2HZ4A 4EQUA 3ORLA 2CGWA 4RIXB 3S0OA 4PP7A 3EWHA 2YM6A 3GU7A 4RX9A 5I9XA 4PMMA 4BDIA 4IW0A 3QWKA 2FUMA 2ZYBA 4F1MA 2BHHA 3F5PA 4FNYA 4IX5A 5K5XA 2P33A 5HCYA 3EFKA 2VV9A 5ANJA 3I0OA 2WMSA 2QCSA 3F61A 3VF8A 2IZTA 4NUSA 5E8XA 3B8QA 3QD4A 5EM6A 4RSSA 2HELA 4BHNA 4ZAUA 4IZ7A 4FK3A 2XKCA 2C30A 2HENA 1MRVA 4S33A 3ORIA 3COIA 5E90A 4AT3A 2Y4IB 4C4EA 4FSUA 2JKKA 2WTCA 3FKNA 3HZTA 4MXAA 4W4YA 3PE2A 4XCUA 4C34A 4DG0E 4N0SA 4H3BA 3ZUVA 3VAPA 5B2MA 4JRNA 1RJBA 3Q4UA 3VUHA 2OIDA 3VS7A 2R3PA 4OTHA 3UTOA 2QI8A 3FMKA 3NIEA 3MB7A 3FQSA 4FV5A 4GK4A 4A06A 4Y5QA 2E9UA 2VWXA 3KF4A 3QF9A 5FEEA 4YP8A 4HW7A 3KCFA 3Q96A 3GCUA 4XV9A 4ZSLA 5A54A 3MTLA 2XK6A 3GQIA 3HUBA 3P7AA 4ZMFA 3KL8A 4YNOA 4IJ9A 5C4KA 2G15A 2WMAA 4ZTLA 3QKLA 4O1OA 2YEXA 5CSVA 3FL4A 1G3NA 4AW5A 3S1HA 4Y72A 3FUPA 3PZHA 1JSVA 2ZMDA 4R6VA 1Q41A 3QZFA 3ZZWA 4D2RA 2R7IA 3LOKA 4B99A 5TE0A 2GTMA 3UC3A 4BF2A 4XLIA 1Y8YA 2ETRA 2WQMA 3AC1A 3QYWA 3E64A 4D4YA 2WB8A 1LPUA 2RG6A 3LM0A 4WO5A 5M4FA 3K54A 3ZXZA 3CTQA 4TN6A 3ZCLA 5CSWA 4FV3A 2FSTX 4L68A 4M0YA 4FL1A 4M15A 4FV0A 1FQ1B 2ITNA 4EH4A 4S32A 2BTSA 5CEKA 4UMTA 5KNJA 3BU3A 3E62A 5L8KA 4IAAA 3DJ5A 3E87A 2WNTA 3QL8A 4QQCA 4HZSA 4ALWA 4BDHA 4YZMA 4ENYA 3EFWA 3HL7A 3OG7A 3C5UA 3I6UA 1OBDA 3O7LB 4NCTC 3ZM4A 4Q5EA 4DN5A 4QMYA 2JIIA 3DBFA 4IFGA 4JAIA 4PDPA 1UV5A 4F9BA 1Q24A 5E1SA 1UNHA 2EXMA 2WOTA 1OL2A 3F7ZA 3I60A 4FV2A 4HGEA 4C36A 3R1YA 4IX3A 5HTCA 2WU6A 4QMNA 5HOAA 2OO8X 3EMGA 4NTSA 3WI6A 3PXRA 5J9YA 4KNBA 4FEUA 3AMBA 2BAQA 4UBAA 4ZIMA 4EC9A 2VU3A 3QQFA 3MTFA 5HE0A 4DGOA 1XHAA 1KV1A 5ANKA 3R6XA 3NPCA 4QMPA 2SRCA 4BY9E 2WIPA 2B9FA 1WBOA 4P4CA 1UKIA 2J6MA 1Z5MA 3DFCB 4FZ7A 2PZYA 3KU2A 3O2MA 5AUYA 4JX3A 4G3FA 3SAYA 3QA8A 4DTKA 1R1WA 5KMOA 1P4OA 5JQ5A 4KIPA 3OBJA 3TNIA 4MYGA 4AOJA 2YJRA 1YWVA 1YVJA 5E8SA 4AA0A 3BBWA 1H4LA 1FVVA 3KMMA 5TKDA 2XIYA 2YZLA 5C4LA 1UNLA 3PSDA 3F3WA 4CV8A 4BTFA 2RSVA 4DH8A 4RIYB 2JGZA 1DI8A 3CXWA 4KRDA 5AA8A 1J1CA 3WZEA 4CRLA 2WD1A 4PX6A 4H3QA 2C6LA 4AXAA 4FT5A 4JDHA 3DXQA 4M84A 4YSJA 5CANA 2X9FA 3QTRA 1JSUA 3FYKX 4B0GA 3OUNB 4UYNA 3FLQA 4FV6A 4GU6A 2X0GA 5F1ZA 3RAWA 3AMYA 4EHVA 2PPQA 2R2PA 3L8SA 3ENHA 3Q9YA 5E1EA 1WVXA 4E6CA 4RIWB 3QTQA 5IQAA 1OITA 4CMTA 2PZPA 4NK9A 4FODA 4JIAA 5J8IA 3GP0A 3Q3BA 4L7FA 1JNKA 3OTUA 5AADA 2OSCA 2YIYA 4Y46A 2XZSA 4RPVA 2QR7A 3AMAA 1V0OA 2BMCA 2B7AA 2B9IA 2XK8A 3CGOA 1SNXA 3F3ZA 2EXEA 3NX8A 3PJCA 4MEDA 3ZZEA 3F3TA 2UVZA 5HCXA 3R8LA 3MVLA 3ZLXA 4DEEA 3LAUA 3IQ7A 5GIOE 3E8CA 4RX7A 1UA2A 3ACJA 4IX4A 2Z2WA 4G6LA 1Q62A 4IXPA 4W4WA 2JIVA 2F57A 3FKOA 3ZM9A 2YDKA 3T9TA 3NCGA 3BWJA 4Q2AA 4R7HA 3QKMA 2F9GA 2E9OA 3SRVA 5F9EA 5CI7A 3SOAA 4E6QA 3BZ3A 3FLYA 4FIIA 3MH0A 4CNHA 2VO0A 4FSTA 2HXLA 3UYSA 4BDCA 2WO6A 4JQEA 3BEGA 4EZ5A 2C6TA 3IW5A 2EB2A 4F9YA 4BZDA 4PV0A 5HU3A 3KVXA 2RL5A 4APPA 1ZLTA 4X3JA 3P7BA 1J1BA 3V5WA 3ZBXA 2GNGA 2F7ZE 2PWLA 3W1FA 4BDKA 3TZ7A 2XJ0A 3W2OA 1ZZLA 5IG1A 2ZMCA 4EQMA 5CQUA 3Q4ZA 3HA8A 3U6IA 2PULA 5C8MA 2BAKA 3DBEA 4FTNA 4BWKA 2XUUA 5IUHA 4O7WA 5HICA 2YM5A 5HNIX 2W1FA 1YXVA 3EQPA 3NW5A 4YZCA 2GU8A 2WMQA 5TOZA 3E8NA 1H25A 2UZEA 4IM2A 2H8HA 4XS2A 4FTCA 3VS3A 1FGKA 4ANOA 3ANQA 3CIKA 3QXOA 4E93A 3KEXA 4BICA 2DS1A 3VRYA 4E4MA 4O0VA 4O0SA 4X2KA 3DBDA 4AQCA 4FTTA 4AX8A 4B7TA 4YC3A 4R77A 1XJDA 3KULA 4W9XA 5IH6A 4GV1A 2F2CB 3WARA 1YXUA 1GZNA 3EQRA 3K5VA 4G5PA 5C27A 3U8WA 4F6SA 3FPQA 4KBKA 5EW3A 2KTYA 3QRTA 2WMWA 4JG8A 3VUIA 5C1QB 4IVAA 4R3CA 5DRDA 2XYUA 5DT0A 4DAWA 4G3GA 4RWLA 5CXHA 1PXLA 3QKKA 3V6RA 1PXPA 3D5UA 4MAOA 1U4DA 1O9UA 4WNPA 3E7OA 4AZFA 2W4OA 4XMOA 1PXOA 4H36A 1GNGA 4M69B 1AQ1A 1I09A 3TWJA 4NW5A 3W2RA 3SC1A 2VGPA 3C0HA 2CN8A 5E7RA 3VBYA 3QCYA 3MH2A 4XJ0A 2UW4A 3P78A 3RWQA 2RFEA 4P90A 4MBIA 5KMJA 4OGRA 4KD1A 5L3AA 4QMZA 2CMWA 4H58A 4EH5A 4WIHA 3M42A 3E7VA 4M8TA 3EQCA 4OTPA 3BELA 4U81A 4CD0A 4D4VA 3Q6WA 4EZ3A 3ZYAA 2OIQA 4NU1A 1M2PA 4L6QA 4X0MA 5E92A 4V0GB 5EHYA 1LEZA 4F99A 4YBJA 2HZIA 4Y85A 3MA3A 3IK3A 4NL0A 2CHLA 2UW9A 2ZV9A 4L44A 4CMUA 4UMRA 3PPJA 3F5GA 3AD4A 1FGIA 3PE1A 2BALA 3UOHA 2GHMA 3F5XA 3GFEA 4XHKB 4X21A 5BYLA 4PPAA 4RFZA 1ZXEA 3R7UA 4QQTA 2WZJA 3JY0A 2PUNA 3LMHA 4BGGA 3TKUA 3VS0A 4F9WA 3SX9A 4IZAA 2YM3A 4AG8A 1PMUA 1OL7A 3A2CA 4RX5A 3NNXA 3G33A 5DG5A 4OBPA 4USDA 4FOBA 4OTWA 2JKMA 3RCJA 3RHKA 3LXKA 3VS2A 3JVRA 2R3QA 3UOLA 5J1VA 3A7JA 4ZP5A 1Q3DA 4BGHA 2A4LA 3SXFA 3WZDA 4TYJA 4C4JA 4NM3A 1KE6A 2OZAA 2XIKA 1H1PA 3ATTA 3R7VA 2X9EA 4EH6A 5CLPA 4I1ZA 5EW9A 4JQ8A 2Z8CA 3CPBA 4CZYB 3OD6X 4MXOA 4I6HA 4P5ZA 3WZKA 2C47A 5M55A 3FLWA 3IGOA 4IX6A 3LHJA 3G51A 4PMPA 4RZWA 3ZO2A 5ANDA 4LRJA 4UMPA 4CKRA 4K33A 3O17A 3PVWA 4NCTA 3ZDIA 1K2PA 3DDQA 4BHZA 3G15A 1VJYA 3EL7A 3IONA 4HCTA 3ZOSA 4BKYA 4W4VA 3HV7A 2V62A 4BC6A 4ZS4A 4XUFA 3TUDA 2IJMA 2NNWB 4C59A 5EKOA 4O91A 2W1HA 5JGBA 2VAGA 3PVUA 4ZY4A 4U45A 4CKIA 4N57A 2PTKA 4ORKA 3KC3A 5CYIA 4DEBA 4KABA 4JG6A 4LMUA 4HVGA 2NPQA 4U43A 5J95A 3V5JA 4QMQA 5HLNA 2QLUA 2OJ9A 3GBZA 3LFNA 3QHRA 3R7IA 3U51A 2W17A 3D5XA 3QRUA 3BHTA 3BHVA 1JBPE 4TYHA 4IWOA 4RJ4A 2FH9A 4KB8A 3W10A 2X1NA 1OUKA 1UVRA 2BDJA 2OKRA 3KXZA 5HBEA 5TT7A 4AGWA 4BTJA 3NLBA 4KIKB 4AGCA 3RJCA 3OTVA 4B6LA 4QRCA 2JKQA 5GJGA 4FKSA 2WU7A 2O3PA 1FVRA 1XKKA 3QC4A 3LFCA 1M7NA 5H2UA 2FGIA 4FSWA 1MQ4A 3V8TA 1S9JA 1V0BA 5HNGA 3BLRA 3SGCA 4U97A 5LMAA 1Q61A 2YWPA 3TUBA 1DAWA 3REPA 3UQGA 3R04A 3LW0A 4NJDA 1YW2A 2YLFA 4EEVA 4WG4A 5HKMA 3NUUA 3QGYA 1YHSA 4MD7E 2XRWA 2Q83A 4XEYA 1OKWA 1OM1A 4IAYA 1GZ8A 3M1SA 2YM7A 3HDMA 3AD6A 3HGKA 2GMXA 3E93A 5BYZA 4A7CA 3TNPC 3SG8A 5EM5A 4GG5A 4FR4A 4YLLA 3KULB 1PMNA 3BU5A 3EKNA 5FTQA 3JYAA 5AR2A 4A9YA 4BIDA 3QRJA 4FEQA 2GHGA 1YXXA 4CFNA 3QCQA 3LJ0A 4HVDA 2QD9A 4LUEA 1UU9A 3QTIA 1WCCA 5FXRA 4OBQA 5AP6A 5EKNA 2HW6A 2YLEA 3L9PA 4U79A 2ETMA 4J97A 2V0DA 4HOKA 4PNIA 4USEA 1WVYA 2VTNA 3LZBA 5KUPA 3WIGA 4O21A 2ZVAA 3HRBA 3NUSA 4FBXA 5AUWA 4USFA 4BCIA 4DE4A 2XCHA 4GT5A 2Q0NA 2OU7A 5DT3A 4ZZMA 5M4UA 4FKRA 4J8NA 2UZLA 3ORXA 4WBBB 3SQQA 1ZY4A 2PVLA 4PTCA 3N4TA 4FMQA 3ANRA 2ITWA 2GFSA 4EK4A 2WMBA 2UZDA 3FZOA 1FBNA 2PZIA 3HA6A 4FTOA 4F9AA 4L52A 4FNXA 1JAMA 4G17A 4D5KA 1QPJA 3L9LA 3SXSA 4FTRA 2C0IA 3DQXA 4GSBA 5KMNA 3NUAA 3H4JA 1T46A 4FVRA 2ITYA 3MPAA 2LGCA 3UOKA 3O8TA 4BCJA 5EDQA 4FOCA 1GIIA 1TVOA 3NR9A 3SDJA 3V8WA 3UNZA 5J5TA 4F4PA 2C4GA 4C58A 1MRUA 2RFDA 2HWPA 3TV6A 3EQHA 3LFAA 2YN8A 4A9TA 3HX4A 3ZEWA 5I3OA 4BYJA 2IPXA 3UIMA 4I21A 2J4ZA 3D94A 2UZWE 1JVPP 3VJNA 3EKKA 2QO2A 4YJNA 5BVFA 4YHJA 4YJUA 4BI2A 3BBTB 1ZMUA 5EDRA 3OROA 4U3YA 4LV5A 4UMUA 5I0BA 4PMSA 5JT2A 3B2TA 3TCPA 4BTMA 3GC7A 1M14A 1UWJA 3QRKA 3L8PA 5AJQA 4KA3A 3S2PA 2C0OA 4IEBA 4Z7GA 2VZ6A 2YHVA 3CP9A 5DN3A 2A2AA 3LIJA 2R3NA 4HYSA 2XKEA 4DF3A 3WIKA 3CR0A 2OZAB 3O51A 4OTFA 2A0CX 3I5NA 4DGMA 2YAAA 3MJ1A 3NNWA 4R3PA 2OG8A 5FD2A 4FG7A 4RJ7A 2BIYA 2G2IA 3DB6A 3RGFA 3WE4A 5AIRA 4EUTA 1NA7A 5AR4A 1BI7A 2UW3A 4GL9A 3LPBA 3MVHA 4PWNA 4ASEA 4BGQA 2Y7JA 1U46A 4ACGA 5E4HA 3BPRA 2JITA 4RFYA 3DNDA 3UIXA 4AA5A 3MY5A 3HRCA 5J9ZA 3PP1A 2ZM1A 3T3UA 4EKKA 4F7SA 3OMVA 3Q9ZA 3LMIA 2PMLX 2R3MA 3TNHA 4IMYA 1CM8A 4D4SA 4MF1A 5EH0A 1PMEA 4ZK5A 5DIAA 3R83A 5K4IA 1J7LA 5CASA 3P4KA 4NIFB 4GUBA 3W2QA 2GDOA 5CEMA 2C6IA 2HAKA 1FPUA 5AR7A 3D4QA 3V5LA 3TKHA 4R1VA 3GC8A 3ZBFA 5I9WA 2UZUE 1MQBA 1KE8A 3CY3A 1MRYA 4XX9A 3FY2A 3KMWA 3DB8A 5CF6A 3NMUF 5EFQA 4FKIA 4C0TA 4E20A 3RP9A 3MY1A 1FOTA 3NYVA 4G5JA 2JC6A 3GVUA 4DT8A 4AW2A 4CT1A 2F7EE 1OI9A 3HP2A 5DT4A 4AN9A 3HMPA 3MIYA 3JVSA 3ZSIA 3LM5A 3F7WA 4FTQA 4U8ZA 3V3VA 2G9XA 5E9EA 1YKRA 3DT1A 3OWJA 2ZV8A 2WTJA 4BDBA 3EN6A 4RJ8A 2HCKA 4CT2A 1WBTA 1QCFA 1YI6A 4I4EA 3II5A 2X8DA 3HV5A 5FM2A 3AGLA 1ERKA 3U54A 2WXVA 4KBCA 2YCQA 4YR8A 2VTJA 4GJ3A 5HG7A 2Y8OA 3C51A 1YXTA 4F08A 4RG0A 3A61A 3OWKA 4AP7A 4O7SA 3PVGA 3BQRA 1XH9A 4RJ6A 3HKOA 3SXRA 4ITJA 1DAYA 1NXKA 2WMUA 2WTDA 2XS0A 4EK5A 3H9RA 3O8UA 3N4UA 1XBBA 3FEGA 1JKTA 2QOCA 3OEZA 4W8DA 1IA9A 3R1QA 4B8MA 3DAEA 1UWHA 3FI2A 4GKIA 2F7XE 3AD5A 3U55A 5AX9A 5IA5A 4C3FA 4LV8A 4FSZA 3PJ2A 4MXXA 3UJGA 4EHGA 4IAIA 3SG9A 2W1ZA 4CGAA 3NS9A 3ZRMA 4FT7A 3ULZA 3BX5A 4IM3A 2W4KA 2BIKB 3AXWA 3OT8A 4FV7A 4GVJA 2AC5A 4OTIA 4ZY6A 5BVEA 1YHVA 3QLGA 3FV8A 3P5KA 3LFEA 3ZLWA 2R3JA 3LXNA 4WD5A 1URCA 4J96A 2X81A 3PRIA 2ITTA 1H1WA 4O27B 4XBRA 3UO5A 4R78A 2OH0E 2PMIA 3TL8A 1WBNA 4PPBA 1K3AA 3JS2A 3D9VA 4JL9A 2BZJA 5A9UA 2QURA 3MVMA 1PF8A 3TIZA 2YACA 3GT8A 4QPSA 3TZ9A 4ALVA 4I41A 3UZTA 3UYTA 2W96B 5BVOA 3T9IA 2VTHA 3PP0A 4FKJA 4FSQA 3HV4A 3ZU7A 4JNWA 4PL4A 3G0EA 3EFLA 5IDNA 3UNKA 1DM2A 4O1PA 4IC8A 4YHFA 4PTEA 3QRIA 3OS3A 3ORMA 4RIWA 3IDPA 2PVMA 2EXCX 3GU5A 4GT4A 1W84A 5E8WA 4KS8A 3OT3A 4J52A 3RM6A 2JKOA 3GU8A 4PL5A 3PYYA 3DK7A 2ONLA 4K2RA 1W7HA 4IIRA 1Q4LA 3W16A 3ZXTA 4AW0A 3S3IA 4QP6A 3VRZA 2XF0A 3DU8A 4EOMA 4LMNA 3NAYA 3S4QA 3I6WA 4L42A 3QA0A 1H00A 3W8LA 1F0QA 4D1XA 4DA5A 4AT5A 2UVXA 4ITHA 1H28A 3NYXA 4MVFA 3P1AA 3UZRA 3DXNA 2Y4PA 2YCRA 2ITQA 5LMBA 4O7LA 3EH9A 4TWNA 3LLTA 3IS5A 4UEUA 4F64A 1G8SA 3TUCA 5KE0A 2PYWA 5JRSA 4X2JA 1OKVA 4D1SA 2GNIA 4EONA 5K5NA 2BCJA 4IFCA 1OGUA 3MY0A 4WNOA 2E9NA 4YTIA 4GU9A 3WYYA 5CEOA 3H30A 5LOHA 4CSVA 3Q9WA 2VWBA 3FLZA 5KHWA 4BCNA 3UC4A 1WAKA 5AMNA 3P0MA 3W55A 3UP2A 4BCQA 5IQBA 2QNJA 3H3CA 3O23A 1DI9A 2PVHA 3UP7A 3BGZA 4DEGA 1PJKA 4NKSA 3NZ0A 4XG2A 3ZUTA 5AP1A 4BBEA 4QQ5A 5IISA 2R64A 3HV3A 1H8FA 5M4CA 4BDAA 1Y57A 4F6WA 5CTPA 1UNGA 5L2WA 4UX9A 3FKLA 2E2BA 2XKDA 5FGKA 4R7BA 4WKQA 4WUNA 4U80A 4OR5A 3NEWA 3CPCA 2XJ1A 3DNEA 3QQKA 4BIEA 4QP7A 3RPOA 2RIOA 5AR8A 4U7ZA 1V1KA 2CJMA 4FEVA 3MFTA 5M06A 3PXYA 2OFUA 2RG5A 3EQDA 4C8BA 3AC8A 3CS9A 4TXCA 5D10A 5HG5A 5J7HA 4QMVA 3RPRA 4O2PA 1PMVA 4MF0A 1U54A 4JR7A 1JQHA 3KXGA 1GAGA 4XG3A 4ASDA 4QTEA 3QUEA 3N9XA 4HYUA 4G16A 2PUIA 5H9BA 3ZTXA 5GJFA 4CEGA 3R8UA 2UV2A 1BKXA 4QP9A 2RFSA 3FXZA 1W8CA 2DQ7X 2R3IA 3TACA 3UNJA 5IMEA 2BAJA 3R28A 2QOLA 4ANQA 2W9FB 2XNGA 3JPVA 4X7QA 2C0TA 4I5MA 4EOPA 3FMDA 4I22A 4E4NA 5IZFA 3VO3A 3TN8A 4ZLYA 2YFXA 4HPUE 4M68A 3OOGA 4U6RA 3MB6A 1SM2A 3R0TA 2QONA 4AE6A 3I5ZA
chains in the Genus database with same CATH superfamily
3WZUA 3EZRA 4M69A 5I4NA 4GIIA 4WG5A 4FL2A 5AA9A 3NVKI 4N70A 4DH1A 2C5YA 4GUEA 3EN7A 1PW2A 3LQ5A 2GPHA 2OXDA 2BRGA 2WGJA 5I9YA 3EN9A 1REKA 3C7QA 4JIKA 5EK7A 2BRNA 5LCJA 1YXSA 5ICPA 1PXMA 2X7GA 3EQBA 4DFUA 1OKZA 3L9NA 3PFYA 4YBKA 3I7BA 3ZRLA 3GCSA 1OIRA 4A4OA 4V0GA 4X2FA 2QHNA 5JH6A 3VBVA 3OY3A 1OL1A 3IDCA 4C38A 3KRXA 2OGVA 2QG5A 3TV4A 1H26A 2CKPA 1RW8A 3E8DA 4XG8A 4EC8A 1NVQA 2CCIA 3S95A 4O2ZA 5KMKA 5LWMA 2BFXA 4YTCA 3C9WA 3R30A 1IA8A 5CT0A 3E3PA 2R0IA 3HRFA 4TYEA 4A9UA 3GFWA 4HCUA 4YURA 5KBRA 2VTTA 4II5A 2W5BA 3PJ8A 2W1GA 4KKGA 3NUPA 4CFVA 4NM5A 5AEPA 4MXYA 3FI4A 3W2PA 3ZO3A 1H1SA 3A99A 1KUTA 5FEDA 2OK1A 2UW6A 3F5UA 4U0IA 3RAKA 2JDTA 5AR5A 4BJJA 2GS7A 2W0JA 4X3FC 4ZEGA 1ZMWA 3VS5A 3I0QA 1JOWB 3VUMA 4JBOA 3UMXA 4K77A 5AP7A 4D0WA 4L53A 4LM5A 5G6VA 3RNIA 4RMZA 4W4XA 3KREA 5DYJA 5IA4A 4QQJA 1G8AA 1OPKA 4KKEA 2GQRA 2YJSA 4X6QC 4RZVA 4OT5A 2W99B 3DTCA 4L43A 3LKMA 4A4XA 5LVNA 4JG7A 4OLIA 5JEBA 5IQCA 3ZC6A 3PIZA 4QNAA 4OTDA 3SLSA 3RVGA 4C62A 2BZKB 4RX8A 5KMMA 3NSZA 3PY1A 4AFEA 4AE9A 5HVKA 2O0UA 3I1AA 3IOKA 3VHEA 3F9NA 5ANOA 4FTJA 4FKTA 3WF9A 4FSNA 3D0EA 4G3DA 3QTZA 4BBFA 4ZTMA 3F2NA 1PKDA 2GTNA 4XRJA 3ZMMA 2Z7SA 1OVEA 4W9WA 2O8YA 1WBPA 3QUPA 3Q4CA 5JK3A 1OL5A 3DBCA 5A6NA 4YLJA 4EJNA 4IANA 1M52A 2H96A 2IVUA 3OWLA 1H0VA 1ZMVA 4HGSA 4YNEA 5HIBA 1FINA 3VBWA 2CKOA 4KKHA 4G3CA 5I5ZA 3FSKA 4UZDA 3OCGA 2BRMA 5A4EA 1OBGA 5BMMA 3U9CA 2XIXA 4YPSA 2QKRA 4PF4A 3C0IA 4PDOA 5EHOA 1REJA 4KIKA 3MWUA 4HVIA 3R1NA 2VWYA 4DITA 3UO4A 5DVRA 2I0HA 1Z57A 5M09A 4E1ZA 3ERKA 2G2HA 1PXJA 4NFMA 5D7AA 4IB5A 3W33A 4GRBA 4U42A 1RDQE 5F4NA 1WFCA 4F9CA 3QZGA 4FA2A 3CQWA 4QPAA 2XKFA 2EU9A 3DLZA 2JBOA 4EHEA 3W18A 4CKJA 4DHJA 2HWOA 3QGWA 4RQVA 3VS4A 2LAVA 1FMOE 4O0XA 3BYVA 3HECA 4C2VA 1ZYLA 4PTGA 4FV8A 5HIEA 2FSMX 4S30A 5EDPA 4FZ6A 3BLQA 4IQ6A 1U54B 5ETIA 3FLNC 5EQYA 4DFYA 2IN6A 5AP0A 4AXFA 4BZNA 2B9HA 2IW8A 4GYIA 2HXQA 2G1TA 4WSYA 3VVHA 4RA5A 4FG9A 3OXZA 3HV6A 4YLKA 4EZ7A 2IEWA 2XCKA 1E9HA 4GK3A 3ODYX 4FF8A 5FXQA 4DEDA 3QYZA 4KINA 3ETAA 3G6HA 3QFVA 3KK8A 4AZSA 3AT4A 3DOGA 2QG7A 5JFXA 5KKRC 5CXZA 1NVSA 2EUFB 2WIHA 2J0KA 3D7TB 4UB7A 3MPMA 1M2RA 3QTSA 5DEYA 3NNUA 2R5TA 4MXCA 5CU2A 5JRQA 3GU4A 4YJRA 3BI6A 2JBPA 2B53A 4FKWA 3JY9A 4YSMA 5AV0A 4DFNA 3ORPA 4C3RA 1H1QA 3W0RA 4IHPA 2CPKE 4CQEA 3DXPA 2W9ZB 3QQJA 3LXLA 4AN3A 3FAAA 4XYFA 3NFFB 2Z7RA 4FRFA 4NTTA 4CFFA 5JKGA 3NVMB 1GY3A 4UN0C 5C8NA 3GOPA 1XMLA 4I5PA 5I9UA 1R0EA 3GENA 4YO6A 3FZSA 2QU5A 5FM3A 5FWKK 3D5WA 1PXIA 1BLXA 4O7RA 4DC2A 3EL8A 2HY81 4OUCA 2RGPA 2YCFA 2P0CA 3HUCA 2VWWA 3KKVA 4QYHA 3DZQA 3FC2A 2V5QA 4XG4A 3TTJA 4YO4A 1Q8UA 4O86A 3HVCA 3POZA 1Q3WA 1NW1A 1GOLA 4ONAA 5CWZA 3OW4A 5CT7A 4O96A 4IWDA 3MJ2A 4ACHA 1OUYA 3MGYA 4JS8A 4I93A 4CYJA 3PXFA 4HNFA 2ITPA 3P08A 4AZEA 3DLSA 4M67A 3I7CA 1A9UA 3NUNA 4FZAB 4JBPA 4OAUC 4JX7A 3HP5A 1G5SA 3BQCA 5IH5A 5JFVA 4TL0A 1APME 4ANMA 5CQWA 4QTCA 2CCHA 2JDOA 4CFWA 4DGLC 5IH4A 3FZ1A 2B52A 3FZPA 4R5SA 4BKZA 5FG8A 2VWUA 1TQPA 4DEAA 1FVTA 2PVNA 2BHEA 2BZIB 2WMTA 3O50A 3CKWA 3FHRA 3R71A 4EH3A 2NP8A 5AP3A 4U9AA 5LQFA 1ZWSA 1AGWA 5K4JA 3BIZA 2IW9A 1ZOEA 4BZOA 3KA0A 1IASA 1UU3A 5L8LA 2E9VA 4GCJA 2BDFA 2OW3A 4JOAA 3OVVA 4LGGA 1TFFA 3IW4A 5CAPA 4O0TA 4FKGA 3IW6A 3KK9A 2VD5A 2X4ZA 4AXDA 4AQKA 4E4LA 1UU7A 5A4TA 3Q2JA 1I44A 1ZY5A 1BL6A 1Z9XA 4LOQA 1OIYA 1OKYA 4R1YA 1H08A 2PZRA 5D12A 4EOLA 3MH1A 5CALA 3ORNA 4TZRA 3NNVA 5DOSA 2FB8A 1U5RA 4Y8DA 2IW6A 3UG2A 3LJ1A 2VWVA 3HMOA 2BROA 3AC2A 2J5FA 3HLLA 3GEQA 3Q9XA 3MFRA 3THBA 5KMIA 4NKAA 5BMSA 4NIFA 1RQQA 3UOJA 2ZM3A 2W7XA 3F2RA 4FL3A 4AWIA 4DG3E 2EVAA 4IJPA 4FNZA 2PVRA 4IDVA 2CN5A 3CEKA 1J7UA 1ZYSA 3UODA 4KS7A 3BL7A 3CC6A 5FDPA 3UE4A 4ANLA 3UDZA 4L00A 3SD0A 4D9UA 3WF5A 3R9DA 2GQSA 4KSQA 4DFBA 1Q5KA 2X7FA 2QOFA 4RC3A 1XH7A 4YZ9A 5DPVA 4JXFA 4RC4A 2W1EA 3RNYA 2OBJA 4BCKA 4LDTA 1XQZA 4TTHB 2GCDA 3MSSA 3H9FA 4I6QA 4A4LA 2OICA 5A4LA 4EOQA 3DKCA 3KGAA 4RVTA 3O0GA 3TZ8A 4YU2A 3C4WA 3OOMA 1IR3A 3EN5A 5CVGA 2G01A 3FZRA 1ATPE 1JKLA 2X7OA 4H39A 4ZTSA 2ONLC 4RC2A 5GNKA 3R7YA 2J5EA 4FTLA 4X3FA 3SW4A 3VUTA 4C02A 5JMSA 2X6DA 3PRFA 4O6LA 4XOYA 5BPYA 5JGDA 5JQ8A 2XNPA 3ULIA 4IAZA 4QYYA 3QQHA 4RWIA 4XG6A 3IO7A 5K0XA 3RZFA 4YGAA 5HE1A 4BCOA 4E8AA 5DR2A 3MS9A 3KVWA 3VBQA 3RPVA 3KN6A 5J1WA 4YJQA 3FE3A 4GEOA 2A27A 2GSFA 4M13A 4XOZA 5FXSA 2ACXA 2X8EA 4R5YA 4RWKA 3RHXA 3VULA 5EYKA 2XIRA 1LUFA 3EYGA 3W8QA 3WF8A 4ZJVA 2OIBA 3U6HA 3PVBA 2XARA 3ZO1A 1YQJA 3SW7A 4M14A 3UQCA 1BMKA 3R8ZA 5HORA 4QO9A 3FC1X 3RZBA 4TYGA 1GZOA 1KE9A 2F49A 3AKKA 1XMMA 4FKPA 4DEIA 5C8KA 1OECA 4AFJA 3KRJA 4FIGA 2XA4A 2GNHA 4HYHA 3G9NA 5AWMA 3DQWA 3QX2A 5EI6A 1ZAOA 4ACDA 4QMSA 3QALE 1Q8ZA 3BYOA 3ID6C 2WELA 3BWFA 3CQUA 2DYLA 3RPSA 3VS6A 4P7EA 3GCVA 3VJOA 2ETKA 4FGRA 3EN4A 2UZOA 3CD3A 4GJ2A 2GNJA 3BHYA 2B4SB 5LJJA 3ZRKA 1SYKA 2VNWA 4G2FA 3QLFA 1P2AA 2F4JA 3HYHA 4OAVB 2QOIA 3Q04A 4C33A 5L2QA 3R7GA 4RFMA 4RLKA 4W8EA 1YDRE 2AQXA 1CTPE 4OTQA 3V6SA 4BRXA 3OWPA 3Q32A 5C03A 3T8OA 1PYEA 2B55A 3KY2A 3MVJA 4MX9A 4I6FA 4AZTA 4ZMEA 5K3YA 2XRUA 4QTAA 5E8YA 4BCGA 3QQLA 4EI4A 4Z55A 1RE8A 2QOKA 2X2LA 2X2MA 3H0ZA 4XRLA 3TTIA 4IVBA 5HX8A 1YDSE 2XEYA 2PE0A 3DKGA 2R7BA 4UWCA 5AUXA 5I9VA 1P14A 2YIQA 3GCQA 2IZUA 1XH6A 4NSTA 2XALA 1IRKA 3C50A 2H6DA 2OZOA 2HY0A 3G5DA 1WVWA 3MV5A 3HAMA 3OP5A 3OY1A 3BE2A 4PPCA 4LG4A 1SZMA 3OCSA 2CKEA 4WNKA 3BU6A 1XH4A 2ITVA 3IW8A 4BCMA 4DBXA 3Q52A 1CMKE 3R01A 4LUDA 4QNYA 4CLIA 5DR9A 5BVDA 3UIBA 3POOA 2UW0A 3LFSA 4NFNA 3VNTA 4DGGA 3TMOA 3PWYA 4YHTA 3UMWA 1XWSA 4QMWA 3UZPA 3RBWA 4D5HA 4Q9SA 2C3LA 4XV1A 2J0MB 4GYGA 4WNMA 1YOMA 3VWAA 3BE9A 2P55A 3Q53A 4QT1A 5L6OA 4D2VA 2PVJA 5GZAA 1VLRA 3W0PA 2C6DA 2QR8A 4G6OA 4ZSGA 3W2CA 3NW6A 5BYYA 3L8XA 2JIUA 5CF8A 1GZKA 4ZSAA 1Q8TA 3LCTA 4O7TA 3DK3A 3TT0A 5A14A 5H8EA 2PVFA 2B9JA 2YCSA 3HMIA 3DS6A 3KCKA 4FEXA 1Y8GA 4JI9A 5DBXA 2OFVA 4HPTE 3PTGA 4C4GA 5L8JA 4C61A 1CKJA 2XNNA 5IEXA 4BDJA 4GIHA 4UMQA 1YOLA 2V7OA 3OZ6A 4WSQA 5E8VA 3VUKA 5I9ZA 4XV3A 3OW3A 4M7IA 5AUZA 3QCSA 3C4ZA 2OJFE 3DGKA 3IDBA 4MD8E 1JWHA 3QUDA 5F95A 4DLIA 2IZSA 5DH3A 4BI1A 1ZARA 1B38A 2XNMA 3BYMA 5CEIA 4EK8A 4PNKA 4ASZA 1VYWA 5EQPA 2V22A 3KXHA 2YIWA 5ACKA 4CMOA 3OF0A 3LCKA 2A1AB 3ACKA 1XO2B 4EORA 5DA3A 1PYXA 4RVMA 2YABA 1W82A 4ANNA 2X8IA 5CU4A 3PPKA 4LL5A 5CENA 3PPZA 2PMNX 4DBNA 3V5PA 3QBNA 3IECA 4PDSA 3MESA 5C9CA 5L6WL 4V05A 3DKFA 5CF4A 3F88A 4RIOA 2ZB0A 1PHKA 3Q2MA 4QP1A 1O6YA 1ST0A 4DHIB 4DFZE 2XIZA 5M56A 4X3FB 3GU6A 1Q8WA 1OPJA 5ANIA 3W32A 4WHZA 4BFMA 2JDRA 2VX1A 1F5QA 4QP8A 4FSYA 5KBQA 5G1XA 1Y6BA 4I4FA 5HI2A 5AUTA 4PRJA 5IA1A 3A60A 3FDNA 3MPTA 2WAJA 1XBCA 3MIAA 4FTAA 4ZS0A 2UZBA 3Q5ZA 4MHAA 4DLJA 4ZOGA 3ITZA 4EBVA 3DAJA 5CVFA 4JJRA 4U40A 5CSXA 4AZWA 4CFMA 3QZIA 2VO6A 3OCTA 4IBMA 4JR3A 4V04A 3O71A 3SKCA 2YERA 5E8TA 5T68A 3U4WA 4MQ1A 5CU3A 5M57A 1R78A 3BEAA 2UW7A 1R39A 4IACA 2Y6MA 3ZDUA 3FHIA 3AQVA 4FT3A 2QLQA 5EYDA 4WT6A 2GQGA 2BPMA 4J7BA 4D9TA 4DFXE 3RWPA 4C4IA 5HO8A 5DE2A 1OIQA 1J3HA 1KWPA 4FKVA 4I20A 2OLCA 3C5IA 4I0SA 3R8VA 4RLLA 3QQUA 3A7GA 2AUHA 2XK7A 2HYYA 4TPTA 5T6KA 2HW7A 5AV3A 5L2TA 4MWHA 4Y5HA 5HIDA 1CKPA 4F63A 3DTWA 3BRBA 3FJQE 1STCE 3A4PA 5CZIA 5FP5A 5HG9A 5ACBC 4QDEA 1E1XA 4I94A 4ZJIA 1OPLA 5DEWA 2WQBA 5KO1A 5CEQA 4DFLA 3UIUA 2YDIA 1BYGA 4I23A 4UZHA 2X2KA 3TI1A 3UGCA 2BFYA 1QPEA 2W1CA 3PG1A 4MBLA 5H8BA 1OMWA 4JDJA 2EWAA 2Z7LA 2VTOA 4O6EA 2J90A 4EH7A 3VW8A 4CFXA 5A46A 5IKWA 1JKSA 2AC3A 5D11A 1JLUE 4E4XA 1M7QA 5GHVA 2F2UA 2XAMA 3JR1A 4TWPA 3TG1A 5JFSA 2YIRA 2O5KA 2HK5A 3FLSA 3I4BA 4AF3A 4F6UA 2VTAA 3ZC5A 2PSQA 3R22A 4NJ3A 2W06A 4E5WA 4BKJA 4RGJA 4G6NA 1ZYDA 2XK9A 1W2FA 4EWQA 5BX0A 2PK9A 2PL0A 4YC8A 4AGUA 5LVMA 5LVPA 2AEGA 2R3OA 4XG7A 4PQNA 5JN2A 3R9NA 2RF9A 1ZOGA 2UZVA 2UW5A 2WTIA 4OTGA 4FT9A 4RWJA 2I0EA 1VEBA 4OW8A 4MXZA 3UDBA 1A06A 4H1JA 4APCA 2C6MA 3QQGA 4FX3A 2WTVA 3ATSA 5HVYA 4KUJA 3R2BA 3NUXA 5FUTA 5EOBA 5AP2A 3O8PA 4AA4A 4NZWB 4FV9A 3C4FA 4ERKA 2CNQA 2W05A 1P4FA 3O7LD 5D41A 4I5CA 5JZNA 5KKRB 3EJ1A 2YA9A 1S9IA 4EK3A 4ZJJA 3EB0A 4D58A 4RJ3A 2JAMA 3FMMA 3LFQA 4TT7A 3VN9A 2OJGA 4LFIA 2ITXA 3DZOA 4FYOA 3QZHA 4BTKA 3KRLA 2J51A 4H3PA 2G2FA 3ALOA 4FVPA 4MNFA 5HBHA 2R3HA 1YHWA 2VWZA 2ZDUA 3MI9A 5TR6A 5LCKA 3OC1A 5CAVA 3DA6A 4ANBA 3TM0A 2CDZA 4O84A 2R3KA 3FXXA 5BVNA 3KIOC 3COKA 3FPMA 4YJPA 5DRBA 1VZOA 4JAJA 3C1XA 5AAGA 2WTKB 2CGXA 4AAAA 4A9RA 3OBGA 4ID7A 3R00A 4TKSA 1ND4A 3PZEA 3WOWA 3PA3A 5DWRA 2PVKA 5JFWA 1BI8A 2YM8A 3PIXA 4BDEA 5IQHA 1K9AA 1Y91A 2VO3A 2UVYA 4B9DA 3VONA 5IF1A 4AZVA 5IMXA 4DTAA 4RVLA 4FJVA 4D2SA 3G2FA 4FE2A 4C4FA 3U4UA 3K5UA 4YJVA 1LEWA 4MH7A 2J50A 2VTMA 3EOCA 3NDMA 3OCBA 3PXZA 2VTSA 4O4DA 4F0IA 3SA0A 3HEGA 3FL5A 5FTGA 4F7JA 2OJJA 5EG3A 4K18A 3V5TA 1T45A 2YZAA 4QP4A 4FTUA 3RM7A 4EOOA 3QD2B 3R63A 4FKQA 2NRUA 5JSMA 2R3LA 3BYSA 2CNVA 3UDTA 3COMA 3DFAA 3D7TA 3F2AA 5E8ZA 5TO8A 2JAVA 5LMKC 4WG3A 5GZ8A 3ZH8A 3BKBA 3LLAA 4HYIA 5HTIA 3QD0A 2B1PA 4F0GA 1FMKA 4MNEA 4GW8A 3TNQB 2ZJWA 1U59A 1WBVA 2BVAA 3ZHPC 2XVDA 3FI8A 1ZZ2A 4J1RA 5A3XA 3QTWA 2UZTA 4O22A 5AIKA 5IEYA 3W0QA 3UO6A 2X39A 3L1SA 1KOAA 4DYMA 3LFDA 3KXMA 3GQLA 2QOBA 3MDYA 4JVGA 5EW8A 3RK7A 5M51A 3OXIA 4LRMA 4LOOA 2QOQA 2QU6A 4YC6A 4Y83A 4ZSEA 4IB1A 5BUJA 2WTWA 5E91A 3BV2A 5EQEA 1YI3A 3FMHA 5AAEA 5EM7A 4G1WA 4CG8A 3FBVA 2QKWB 5F94A 2O2UA 2I1MA 3F82A 3BCEA 2IVVA 2JLDA 3FMJA 2Z60A 3D7ZA 4Z7HA 2H9VA 3CGFA 5GIPE 4S2ZA 3VUDA 4CG9A 1LP4A 2ERKA 3LE6A 3NW7A 2C1AA 4AT4A 3IW7A 4CLJA 2XNOA 2W5HA 3G9LX 4Q9ZA 4ERWA 4AN2A 1YI4A 3IG7A 3R02A 2P3GX 4D28A 4TNBA 2OXXA 4TW9A 3MYGA 3JXWA 3H0YA 4CZUA 2JDSA 3QTXA 4YUQA 4YPDA 4PL3A 3PUFC 3PJ3A 3CQEA 3ET7A 4G9RA 3ZSHA 4RBLA 4K8AA 4KBAA 4MCVA 4F7LA 3CBLA 3MW1A 4FI1A 5IUIA 5CSPA 3UVQA 3C4CA 4L46A 3ZFXA 4IC7A 4QP2A 2VN9A 4N4SA 2YDJA 4M97A 4FZDB 4DHZA 4S31A 1Q99A 5CU6A 4BVUA 3ENMA 3DK6A 5KZ0A 5BQ0A 3MA6A 4C7TA 3SV0A 2O65A 3WILA 4O0YA 1VR2A 1PY5A 3KQ7A 4QD6A 3QHWA 4O82A 2QHMA 5FLFA 5CS6A 2KULA 1PXKA 3V5QA 3QAME 4BL1A 3HDNA 2R3RA 4ENXA 4QYEA 3WYXA 1SNUA 4G3EA 4KWPA 4M12A 4E26A 4D55A 5LXMA 4MUQA 3A7IA 4O4BB 4YJOA 2XK3A 4A07A 3RKBA 2NRYA 2R4BA 4JT3A 4YJTA 4ACMA 5CU0A 3ZONA 4AS0A 3A7FA 4C57A 2OWBA 2XJ2A 4G34A 5LVLA 4WA9A 2OH4A 1PRYA 3ORTA 4UXQA 3CSVA 1H24A 2C1BA 5EYMA 2JFMA 2XH5A 3TJCA 2FSOX 3M11A 4JBQA 1Q97A 1OZ1A 5DMZA 4KSPA 2QOHA 4TWOA 5ETCA 3K3IA 4D2TA 3ZO4A 1WZYA 3P86A 1CKIA 4O7VA 4BI0A 2ERZE 3EQIA 4XP3A 4JRVA 5HD7A 3TKIA 3LFBA 4G9CA 4LI5A 3SOCA 3WF6A 4DG2E 5BUEA 5LVOA 3UQFA 2B54A 3GUBA 3HMMA 5EM8A 4GVAA 3TYKA 3E5AA 3KXXA 3CTJA 2IF8A 2ZOQA 3O96A 3ZFYA 4ZTHA 3QD3A 3TJDA 4BYIA 4HCVA 3A62A 2X4FA 4WOVA 2XBJA 3L8VA 4V01A 5AUVA 2OF4A 2PZ5A 4FKOA 3RK9A 5IDPA 4ASXA 3P5JC 5HX6A 4B8LA 4ACCA 3FMEA 4B4LA 4NH1A 4AOTA 2J9MA 3CD8A 5K0KA 5CVHA 4KIQA 4FTIA 2WQOA 4AAYA 3Q6UA 5CNOA 5GZ9A 4D2WA 2XM9A 3LQ8A 3QC9A 1PKGA 1YOJA 2ZAZA 4L3PA 3LJ2A 4Q5HA 1H0WA 3WBLA 1J91A 1HCLA 2FO0A 4EQCA 5B2LA 3SVVA 3A4OX 4NM7A 4UY9A 1X8BA 2VWIA 5AV1A 2V55A 3EIDA 5HE2A 2NO3A 5CI6A 1VYZA 1TKIA 2IVTA 2XMYA 4R3RA 5DI1A 3E3BX 2VRXA 3DCVA 1MUOA 3MFUA 4IH8A 3NYNA 4FUXA 2YIXA 2CKQA 1SMHA 4S34A 4ZLOA 2ZV7A 3KMUA 2ITZA 3U9NA 3RCDA 5C01A 1Q8YA 4ARKA 5IEVA 2DUVA 3AC5A 4EJ7A 3C0GA 1BUHA 3B2WA 2E9PA 4WUAA 5FQDC 3PJ1A 5HE3A 1V0PA 3P7CA 2PHKA 4LGDA 2WKMA 3CCNA 5KMLA 3H9OA 4E7WA 3TV7A 4BN1A 1H01A 4YZNA 5HQ0A 4F7NA 1WMKA 2VTQA 5D9HA 5IUGA 3C4XA 5ANEA 5GJDA 4MNEB 5IA0A 3BHHA 1KV2A 1ZYCA 4TNDA 4FG8A 4CQGA 3DY7A 3CJGA 4KRCA 3IPHA 5KCVA 2WMVA 3BYUA 4FIHA 3KB7A 4UWYA 5F20A 4FIFA 1XH8A 4O0WA 2Y4IC 3IKAA 4HNIA 4F1OA 2VTIA 2IVSA 3PA4A 4IB3A 5CX9A 3PSBA 2WTKC 3V8SA 4FT0A 3V01A 3V04A 2WPAA 5FDXA 2PUPA 1KE5A 4IE9A 5H3QA 2IO6A 3G6GA 4MWIA 5D1JA 3NAXA 5CAUA 4BWPA 2YM4A 3AOXA 4DDGA 3KN5A 4BDGA 2R9SA 1U5QA 3CLYA 2IG7A 4D2PA 2VUWA 4L3JA 4ZY5A 3PLAE 4BWXA 2C3KA 2C68A 3UG1A 4FV1A 2UZNA 4LQMA 3R1SA 4ANSA 5IA2A 5DNRA 4CTBA 3ZSGA 2Z7QA 2CNUA 5M4IA 4O4CA 3AC4A 4LGHA 2W1DA 2C69A 2YAKA 3RPYA 4DH5A 3FMNA 3UBDA 2WQEA 3KXNA 2C5VA 3VIDA 1YWRA 2C5OA 2WEVA 4DCAA 1BX6A 1AD5A 3ZLYA 4TYIA 2HOGA 2QC6A 4Y73A 2XK4A 5L2SA 5HLWA 5L4QA 2CGUA 1EH4A 2BR1A 5CY3A 3RI1A 4A9SA 4YJSA 3SHEA 1JSTA 3NIZA 4UWBA 5AFVA 5J9LA 3DBQA 3K2LA 2PE2A 5EHLA 1KSWA 3A8WA 4O83A 4O38A 3I79A 4GG7A 4QMLA 5LMKA 5TF9A 1WBSA 5B2KA 2VTPA 2VO7A 4CCBA 4PY1A 3C13A 3QU0A 4D1ZA 2QQ7A 1KE7A 3CJFA 5ETFA 5HD4A 3N51A 4F65A 1H27A 2I6LA 4O0RA 1L8TA 4E3CA 2C3JA 2P2HA 3ZLSA 4AACA 3KRWA 4GKHA 3DPKA 2ITUA 1UU8A 1W0XC 1YWNA 5EOLA 4I24A 5ETAA 3AC3A 4CTCA 5E8UA 3ALNA 4XLVA 2DWBA 2PY3A 3BLHA 1O6KA 3CKXA 4O4EA 3VHKA 3OXTA 5L6PA 4AU8A 4XG9A 4GFOA 1SVEA 3RAIA 4L67A 4J8MA 3NCZA 1GIHA 4QYGA 2IZRA 4FIEA 1LR4A 2JFLA 4I0RA 2QOOA 4O7ZA 4ZTQA 4MTAA 4QDVA 3L9MA 4YZDA 3R9HA 2BZHB 4X2NA 4YTHA 2XNEA 1Y6AA 2BUJA 5LARA 3SRVB 3GOKA 3DDPA 1IG1A 3R2YA 4FGBA 3RK5A 3LVPA 2J0JA 3HNGA 2JD5A 4JLCA 5EI8A 2BRHA 3PY3A 5BVWA 4DT9A 2R0UA 2YITA 2FVDA 3NWWA 3OHTA 4QMUA 4NT4A 3OEFX 1IEPA 5DFPA 4IZ5A 2XEZA 1A48A 3NYOA 4NEUA 4GS6A 4P2KA 3S00A 2NYAA 4EL9A 5M07A 4FSMA 3KRRA 2CLXA 3VBXA 4FKLA 4L7SA 2GNLA 5HEZA 2ITOA 5IQDA 4X6RA 4CFUA 2J2IB 2WMRA 4CZTA 4YTFA 1NVRA 4C4HA 3CE3A 4BCFA 2HZNA 5AX3A 4DH7A 4I6LA 5BNJA 3A8XA 4DHFA 4BCPA 4DEHA 4EH8A 3P23A 4O0UA 5HTBA 5IQEA 1L3RE 4XP0A 3F3VA 3F3UA 4BB4A 4K0YA 3Q4TA 1CDKA 1W83A 3MN3A 2PU8A 1R0PA 3TZMA 4EBWA 5BUIA 3NRMA 4L45A 2X0QA 2C6OA 2XNBA 2BKKA 2J7TA 3OUKA 4I5HA 2W4JA 4FKUA 4K1BA 2QODA 4TRLA 4XP2A 3R9OA 3D83A 4CRSA 2HIWA 5AR3A 3EFJA 2XM8A 3PDTA 3E63A 5AM7A 4I3ZA 3FWQA 3BL9A 1ZRZA 3VF9A 4F09A 4U5JA 1QPCA 2WFYA 3A7HA 4TWCA 5FTOA 5HO6A 2O63A 1NY3A 2GNFA 4FC0A 4JQ7A 3HMNA 3R21A 3ZFMA 5LWNA 1NT2A 4ZSJA 2BKZA 2C5XA 3FQHA 4EOIA 1URWA 3RINA 4DTBA 3TEIA 4DINA 2QO9A 4LRKA 5EI2A 3VUGA 4UV0A 1KOBA 3PXQA 2O64A 4G31A 2C5NA 3RTPA 2OJIA 4ZXTA 3TIYA 2J0IA 3DKOA 3F66A 1SVGA 2Z02A 4FSRA 1OL6A 5A6OA 2QO7A 3PFQA 4AW1A 5CF5A 5IPJA 2C3IB 1MP8A 5DLSA 5FEQA 4QP3A 4EWHA 3PSCA 4C37A