3ORPA

Mycobacterium tuberculosis pknb kinase domain l33d mutant (crystal form 5)
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
290
structure length
274
Chain Sequence
MTTPSHLSDRYELGEILGFGGMSEVHLARDLRDHRDVAVKVLRADLARDPSFYLRFRREAQNAAALNHPAIVAVYDTGEAETPAGPLPYIVMEYVDGVTLRDIVHTEGPMTPKRAIEVIADACQALNFSHQNGIIHRDVKPANIMISATNAVKVMDFGIAIGTAQYLSPEQARGDSVDARSDVYSLGCVLYEVLTGEPPFTGDSPVSVAYQHVREDPIPPSARHEGLSADLDAVVLKALAKNPENRYQTAAEMRADLVRVHNGEPPEAPKVLTD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Serine/threonine protein kinase
publication title Allosteric activation mechanism of the Mycobacterium tuberculosis receptor Ser/Thr kinase, PknB
rcsb
source organism Mycobacterium tuberculosis
total genus 88
structure length 274
sequence length 290
ec nomenclature
pdb deposition date 2010-09-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3orpA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3orpA01
3PWDA 2PYWA 3CKXA 4BKZA 2X81A 4ZZMA 1J1BA 1NT2A 1YWNA 2VTRA 3OBJA 5LWMA 5L8LA 2C5VA 4N57A 3GU8A 3R8LA 4DGNA 4OTWA 1FMKA 2I0VA 2OK1A 4JG6A 1WBOA 2O5KA 5HLPA 5IA5A 2R3IA 3KXGA 4RZVA 2HXQA 4GT5A 5DPVA 4J98A 3QYWA 5AR5A 4O7RA 3RNIA 3CBLA 3L9NA 4FKTA 5KHXA 3TACA 3FYKX 1H08A 4RG0A 5A3XA 3D4QA 4W9XA 5FTOA 4FEQA 3GU7A 2B9JA 4OBOA 3ZM4A 3DGKA 4O83A 3DV3A 4C34A 4FOBA 2YIQA 3LFSA 1QPDA 1M14A 5HNGA 3ZO2A 1M52A 3ZUVA 4L00A 4JIAA 5EOLA 3HMIA 1OL7A 3C9WA 3PA4A 4BI1A 2HZ4A 4WIHA 2BR1A 2UW3A 3ORKA 4GJ2A 5BYZA 4TZRA 4O38A 4GH2A 3F6XA 5ICPA 2ZDTA 4GRBA 1DS5A 2ITUA 3F2AA 3PFQA 1ZAOA 3ZEWA 2CLQA 3O0GA 3KCKA 4FNWA 4HOKA 4PNIA 1Q8YA 4XG2A 5BX0A 3S00A 3LJ0A 3LW0A 4KAOA 4FZDB 2WO6A 4I5CA 4PDPA 3C50A 2OLCA 3QRIA 4FTLA 3ZBFA 4E3CA 2PUUA 5CAOA 3DY7A 4OAUC 2QG5A 4D9TA 4HZSA 4IJ9A 5TOZA 4OTGA 1UU9A 4F6UA 3QWJA 4R3RA 3UIBA 2VTQA 2OXDA 5DR9A 4GFOA 4B9DA 3FXWA 2AC5A 3LQ5A 3BHUA 3ZRLA 2J0LA 3ZMMA 1ERKA 4ZOGA 1V0OA 1ZRZA 2X6EA 1KE6A 4EH4A 3EB0A 3JS2A 2YCSA 2W9ZB 5M4FA 5EQPA 4K9YA 3ZC6A 5HNBA 3Q5ZA 2W4KA 5I9YA 4EOQA 5J9YA 4TPTA 5EW9A 5CU2A 4V04A 3GC8A 3C4FA 4FTOA 4GK3A 4U6RA 4Y5QA 3BWFA 5BYLA 3QTIA 1B38A 4BCIA 3PPJA 1KE5A 4B6LA 4ZJIA 1PW2A 4HVSA 5L6OA 2R3LA 3AGLA 4KIKA 4RIXB 1BKXA 1KOAA 2E9VA 3DKCA 3ELJA 4PTGA 3Q52A 4U0IA 1O6YA 2JKOA 4CLJA 3KREA 4W4XA 3H30A 3ZLWA 2YDJA 4MQ1A 3TIYA 4IM0A 5HO7A 5HE3A 3WZJA 2ITOA 3PXQA 3G6HA 5E8UA 2VUWA 3AC2A 2YFXA 3KCFA 2QHNA 3ZZWA 5LWNA 5DMZA 3NMUF 3H9FA 1UU8A 4YJPA 5CWZA 3CSVA 3QQJA 5I4NA 4RBLA 3ATTA 3ALNA 3NR9A 5AV3A 3A61A 2YDIA 3A7HA 2VAGA 2PVMA 4C4IA 3GNIB 2XK8A 4FSZA 1A48A 3ZTXA 2DWBA 2JFLA 2GPHA 2CKQA 4D4VA 3P7BA 4YZDA 3P0MA 4N6YA 2VNYA 2EWAA 5E8ZA 4EK6A 3CTHA 2ZJWA 1KOBA 3RVGA 2OICA 4TWOA 3V5LA 1PYXA 4O0SA 2IZSA 2RFDA 3GC0A 4TT7A 3PXZA 5JK3A 3DKOA 1H0VA 4ANSA 5AP6A 2BZHB 3RWQA 4XOYA 3G90X 3R9OA 3ZU7A 3DK6A 1IRKA 3T3VA 5CYIA 3D5WA 3BX5A 3M11A 3PUPA 3SDJA 5LARA 2UZTA 1KE9A 4O7TA 2I0HA 4QYHA 4XLVA 3R7IA 3DPKA 2C1AA 4EOMA 3I0QA 3C4ZA 5CSXA 5IQGA 4JVGA 5G6VA 2XUUA 1FVVA 4RSSA 2O0UA 2HZNA 5D10A 5LVPA 3QQLA 3M2WA 5KZIA 5EKOA 2P0CA 5HU3A 2CPKE 3FMNA 3MPTA 3MVHA 2JDSA 2WPAA 3EN5A 3QX4A 5M4UA 4JQEA 3H9OA 3FYJX 4E6CA 2Z60A 1Q8TA 4E4NA 2CNQA 4DFYA 1RDQE 3CJFA 4FV6A 4G6LA 1IAHA 1XBBA 4KSPA 4F1OA 2WU7A 3IGGA 4RZWA 1OIQA 2W1FA 5CENA 4IX6A 4NJ3A 1GY3A 2B4SB 1OKZA 2F7ZE 2ITWA 4U79A 1XH9A 4IW0A 3RGFA 1APME 2PVHA 4L44A 3EQIA 3RMFA 3A7IA 4JRNA 4Q5EA 2QI8A 1VYZA 3Q60A 1MRVA 4FV7A 3ZSIA 1NA7A 4GIIA 3O7LD 4C62A 4KNBA 4ASZA 4DH8A 2ITQA 3H0ZA 3ZLXA 2ZMDA 4R7IA 4UV0A 5CVFA 3ZS5A 4D1ZA 3F82A 1OKWA 4DH7A 4BDEA 4X3FA 3NW6A 3FXXA 5IA0A 2QOKA 3GCPA 4GVAA 1CM8A 2JKMA 3I0OA 5JH6A 4O0TA 1H28A 4NKAA 4BVUA 1BX6A 4NM7A 1OUKA 4HYIA 1R3CA 2F4JA 2VTHA 2YAKA 3CTJA 3BWJA 3F66A 4DEHA 4FE2A 2XYNA 4G16A 2UVZA 5AV1A 3RI1A 3ZZEA 3QTXA 5F9EA 4LGDA 4QMOA 2XK6A 3IONA 3W2CA 2PUNA 3Q9WA 4ANQA 4F6WA 4TYEA 4BDCA 3AT2A 5H9BA 4OAVB 2FUMA 5FXSA 4R78A 2BKZA 4ONAA 3HL7A 3KKVA 1UWJA 2XKCA 5KMIA 2X2MA 4I0TA 4RLLA 2CLXA 2IZTA 4HZRA 3KA0A 1OL5A 3C4EA 4E5WA 3VQUA 3OXZA 2VO0A 3MA6A 3EL8A 3LJ2A 3QD4A 5H2UA 3F2NA 2XIXA 3EQGA 3AT3A 4CD0A 5HBJA 2J0IA 2A2AA 3GT8A 3D2IA 4BBMA 3VF8A 5L3AA 2R3JA 2C6OA 3C51A 5BVKA 2IZRA 3TCPA 3NSZA 2FB8A 3KL8A 4QMMA 4NU1A 1FPUA 5I5ZA 3DTCA 1Y6BA 2JDVA 4L42A 3DXPA 3LFCA 4DTKA 4A4XA 5AR3A 5DEYA 3EHAA 5CI6A 1JSTA 5JZNA 5KE0A 4NM5A 3UG1A 4FKWA 4D4SA 5CF5A 5L4QA 4L9IA 2BZJA 3QRTA 4Z16A 4PMTA 2VWBA 3U87A 4FKOA 5I9VA 2IO6A 3FQHA 4EJ7A 1UVRA 3AGMA 1GZOA 4RC4A 3BPRA 2E9UA 2V22A 5AR7A 3D5VA 3HP2A 1J91A 4XG7A 2VTAA 4DBNA 4FZ6A 1BL7A 4QMWA 4YJNA 3UO5A 2RFNA 3UVRA 5K4JA 4B8MA 5K3YA 3EWHA 4HYSA 1FINA 4H3QA 4I6QA 4ASEA 4GJ3A 1PMUA 5FGKA 4CNHA 2BALA 4K6ZA 2VWWA 2GS2A 3LXPA 4O21A 2BAKA 1ZZLA 4DCAA 2X2KA 2UZVA 3R7EA 2BPMA 2XCKA 3GENA 3NPCA 4QQTA 1QPEA 2CDZA 2YZLA 2WMWA 3EKKA 3I6UA 5CVHA 4NWMA 4O2PA 2XNMA 5L8JA 1PYEA 4CZYB 4YZBA 5JKGA 1OBDA 3G5DA 3KF4A 1JKSA 4IC7A 2WIHA 2WHBA 3FDNA 4D2SA 2JDRA 3OOGA 1W98A 2O63A 5LQFA 4O82A 1YOJA 3PXKA 4D4RA 3R63A 4M84A 4QYEA 4CYIA 4O7VA 3O2MA 5CEMA 3NUXA 3PRIA 5GZ9A 3CQUA 4J8NA 2YM5A 5CF4A 3UPZA 3FZSA 5E8XA 4MF0A 5M53A 4KRDA 4ZZNA 4NTSA 5IEXA 1U54B 3VHKA 3Q5IA 4M69B 4ZLZA 4YTIA 3MPAA 4FYOA 4F08A 4FSMA 4ANMA 5J87A 3TN8A 4ZMFA 3FI3A 4W4YA 4C37A 4FV3A 3ZSGA 3EH9A 1P5EA 4PMMA 4DAWA 5FP6A 4F0FA 3DOGA 4NZWB 5A4TA 2OH0E 4RWLA 4CFFA 2NO3A 4DITA 3KXMA 3TT0A 3R6XA 1KSWA 3CQEA 3GCSA 1PMEA 2C1BA 5EYDA 4AZVA 2IW6A 4QP4A 1B39A 4PL5A 2JD5A 2F7XE 2WMVA 4F65A 5F95A 1SVEA 3SXSA 5EHLA 4NM0A 4QP1A 3VS0A 3P7AA 1PRYA 4CMTA 2E9NA 4KKEA 3BU5A 3ZC5A 5BPYA 1U59A 4F9YA 5AV2A 3UYSA 3QRJA 2YJRA 5EW3A 3KVWA 4FOCA 3QRKA 4ZMEA 4G6NA 4MNEB 5EFQA 1OL6A 3OWKA 4NFNA 3FLNC 4YTFA 2ZB0A 3HAMA 2A27A 4R3PA 2XK9A 4GU9A 4XBUA 3HECA 4RFZA 4F9WA 5BVDA 3PG3A 3QKMA 3KXZA 5LVLA 2W1IA 4D0XA 4ENXA 5IU2A 1KWPA 5CLPA 4K77A 4P90A 3V5PA 4NM3A 2QU5A 4D58A 1BYGA 2I6LA 2QOQA 2R5TA 3L8VA 2Z02A 3MYGA 1M7QA 3FMMA 3MGYA 3QAME 4FSRA 3UIMA 4DLIA 4Z55A 3AMBA 4DT8A 1RQQA 2ZV7A 3SRVA 2FSTX 4FKJA 5HI2A 3VBQA 5HCYA 2XRWA 2OWBA 4IM3A 1SYKA 2R7BA 4KBAA 3U51A 4MYGA 4FK6A 4F1MA 2CN5A 1JQHA 5F1ZA 3DCVA 3S3IA 4C35A 2FVDA 3GFWA 4QYGA 3RK5A 4FR4A 3CY2A 5TE0A 3Q32A 5KMJA 2BDFA 2XVDA 3NGAA 3SOAA 3BE2A 3A4PA 5H8GA 4E5BA 4CTCA 3MFUA 3FHIA 3PTGA 3QF9A 4IJPA 4QMZA 1EH4A 4XHKB 2CKPA 1URCA 2ZDUA 2B1PA 5ANGA 4XV1A 4GL9A 5EI8A 4I92A 4C4JA 4TYHB 3QZIA 4YU2A 2OO8X 4YC8A 1TQMA 4U41A 4QMVA 4S30A 5BVWA 3FZPA 2VTIA 3E7OA 2YIWA 4M12A 4AOTA 5JZJA 5KMMA 3QD0A 4TW9A 3LKMA 3R9RA 2C6TA 3LXKA 1OIYA 2ITXA 2X6DA 1UWHA 2YIRA 3I4BA 3NCZA 4V0GA 5IKWA 4X7QA 3ZUTA 4EHVA 5ETAA 5CZIA 3TUCA 2WKMA 3L1SA 2XA4A 4XBRA 3QZGA 4JBOA 2PMLX 2BHEA 2GTNA 2OZAA 4IB0A 1GIHA 4NW6A 4MBJA 4ZXTA 3D14A 3VO3A 4YZNA 4G3EA 4LGGA 5D7VA 1YHSA 2Z7QA 2VWYA 2IW9A 4IIRA 3H4JA 2R3NA 3R01A 2WQNA 4OT6A 1H1WA 5EYCA 4R5YA 3TJDA 1V0PA 5IH5A 2XYUA 5IA1A 4C0TA 1Q41A 1URWA 4EHZA 3MSSA 3PY1A 1HCLA 2C69A 3QQHA 4JDHA 5FBOA 4DC2A 4RC3A 2XH5A 3NVMB 1WVYA 2QNJA 1UKIA 3HRCA 3WYYA 5EM6A 2XEZA 5IA4A 2ZMCA 2P2HA 5DR6A 3F3WA 3BE9A 4HPUE 3LMIA 4P5QA 1YI6A 4RJ7A 3EQPA 3UOKA 2O8YA 2X8EA 4DH5A 3Q04A 4GG5A 5DI1A 1U5QA 1XH7A 5AUXA 3VW8A 2CKOA 4KABA 3SLSA 2UZEA 3F7WA 3G51A 1KE8A 4FV8A 4DH1A 4EONA 3TDVA 4L53A 2BRGA 2R3PA 3ET7A 5HEZA 1YWRA 3K5UA 3OXTA 3FI8A 5JFXA 3A2CA 4I1ZA 3SX9A 2GHLA 5KNJA 4EH5A 3W2OA 4QP2A 4BDBA 2RSVA 4FV4A 5AX9A 4CMUA 3LJ1A 4GVJA 4L8MA 4WA9A 3KXXA 2RG5A 2Y4PA 5M08A 4M67A 4F7SA 3QCXA 2W05A 3IOPA 3VIDA 5JGBA 5IQEA 4WSQA 3CEKA 2BCJA 1M2QA 2I0YA 4FVRA 2WTWA 3U4UA 2GNLA 5JMSA 4I5MA 1J7UA 3ALOA 1YDTE 4ERWA 3L9PA 2JDTA 3DS6A 3W8QA 3MH0A 3BCEA 3DJ5A 4GK2A 4IX4A 4BIEA 5CALA 5EHOA 1PJKA 3V8WA 5CU3A 2VTNA 3ANRA 1QPJA 4D2RA 4AX8A 2R9SA 5ANEA 3K54A 3AD4A 3OWJA 2QC6A 5JQ5A 3ORLA 2JGZA 4BTKA 4ANOA 2PSQA 2C4GA 3MY1A 4XH6A 4C4EA 4AGCA 5L2TA 2BMCA 3EKNA 3FAAA 3EQRA 3FSFA 4GIHA 2V7OA 3PSBA 4FT9A 3E62A 3FZ1A 5CF8A 5AAFA 1NXKA 1PKGA 3MBLA 4TWNA 1JPAA 4XJ0A 2QQ7A 4BBEA 2PUIA 1JSUA 4RVTA 4XS2A 4TYGA 5I3RA 3N4UA 2ZOQA 2XP2A 4DT9A 3WF5A 4I22A 5M44A 4Q9SA 2VTOA 4MK0A 4AF3A 2O2UA 1Q8UA 5JRSA 2XJ1A 4Z9LA 4U40A 3F61A 4CRLA 4IVDA 3RK7A 4HGTA 3ZO1A 3R7UA 2J9MA 4M66A 4EZ7A 4UX9A 1KV2A 3SKCA 3W2SA 3TUDA 1MQ4A 3DB8A 5AUYA 1DAYA 3EFKA 4JX7A 2W5AA 4I0SA 5AJQA 3UVPA 4FIIA 4A4LA 3ROYA 4ACHA 1VJYA 4CFWA 4YPDA 1ZYJA 4JDJA 1Z57A 2YM3A 4IZYA 5T68A 5FG8A 1IA9A 5AP4A 2BZIB 5J8IA 4U80A 3MFSA 5HE2A 4AU8A 4HVIA 1L8TA 4IFCA 4GS6A 4BL1A 2IZUA 4EK5A 1OIUA 4BDAA 3LCDA 5LMKA 1LR4A 2PVKA 4CT2A 4ANNA 5J79A 4L7SA 3GEQA 4QMTA 3T8OA 3FJQE 3NDMA 3V01A 2QOCA 4M15A 2R3OA 5EQYA 1DM2A 3DFCB 3E63A 3SW4A 2B53A 3MVJA 4TKSA 1ZMWA 3G9NA 4KWPA 3L8SA 1ZZ2A 2XKFA 2WMAA 4M14A 1AGWA 3BGPA 3CY3A 3MTLA 4GK4A 4JDIA 1ATPE 3AC4A 3ZDUA 3TZ8A 4AN3A 3MFTA 5M4IA 5HIEA 5AUWA 5AA8A 2VNWA 5JEBA 1HOWA 3EN4A 3FMDA 1R0EA 3UPXA 4WBOA 4MBIA 4O7WA 4AW1A 4MHAA 4PDOA 2BFYA 3VHEA 3UP7A 2EXEA 4YJTA 4XNEA 5HVYA 3VS7A 4EYMA 3IW4A 4FTAA 1KV1A 5FD2A 3EJ1A 3S1HA 4B7TA 4M13A 4S33A 4XV9A 3MFRA 1NVQA 3HV5A 2BRNA 2JLDA 5FUTA 3FXZA 2P3GX 4DFZE 4BDDA 3ORIA 2BHHA 4QP3A 2I7QA 4Q5HA 3IG7A 1UU3A 3AMAA 4XMOA 3OBGA 5J95A 4J99A 4XRJA 2XZSA 3EFJA 4LI5A 4O1PA 3RPVA 4BDJA 4Z7HA 2R3MA 2ERKA 4FSUA 4JBQA 3ORMA 2X2LA 4I5HA 2O65A 4LRJA 4IDTA 5K9IA 3THBA 2QOBA 3JYAA 1W0XC 4MBLA 2A19B 3HVCA 3ZRMA 2DUVA 2GHMA 3GU4A 2QODA 4JI9A 5ANOA 2C6LA 4RIYB 2H8HA 5EM7A 4HYUA 3U9NA 4D28A 1B6CB 3W1FA 3WI6A 4DGMA 3I6WA 4QPAA 4RVMA 3TDWA 4FT5A 4BCKA 4MXOA 3O23A 1CTPE 4PY1A 3BHYA 4BKYA 4XRLA 3HMPA 3V8TA 3EQDA 3PY0A 3HUBA 1E9HA 3VS1A 3C4WA 4DG0E 1OKVA 2FSLX 3QLGA 4XUFA 5EDQA 2G2IA 3AXWA 2YAAA 2FSOX 3P86A 4EBWA 5FDPA 3U55A 3D5XA 2V7AA 3LZBA 3V3VA 1Q61A 3P08A 2C6IA 5A6OA 4BRXA 3FEGA 2QR8A 4NH1A 3BV3A 4F1TA 4FGBA 5HE0A 2WZJA 2YM7A 4BCPA 3ZRKA 3W10A 2QO9A 3TNPC 2PZRA 2HZ0A 2NP8A 3MN3A 3KN6A 2X1NA 4JT3A 3MJ2A 3ZBXA 2V62A 3GFEA 2OJJA 2V0DA 4DFBA 4RVKA 4AZWA 2UZUE 4MX9A 2X7GA 4X2KA 3KN5A 4II5A 3ZCLA 3ZLYA 3CGFA 5M51A 2YLEA 3W2PA 1G8SA 2F2CB 3R1NA 5BVOA 4FODA 4ZTHA 1Q97A 4AGDA 3FC2A 5K5NA 1Y8YA 3U8WA 4GYIA 3UQCA 4RJ5A 2W7XA 2CCIA 1XBCA 4CEGA 2WFYA 3M1SA 3HV3A 2WTJA 3GP0A 4JG7A 3JY9A 1PXOA 4FV2A 5AUVA 4U3YA 5FLFA 3D9VA 4HGEA 3VWAA 2UZLA 3HV6A 3C1XA 4EHEA 3BZ3A 4USFA 1OBGA 2WQMA 1I44A 3QX2A 1ZOGA 4DFLA 4QMUA 1M2RA 2W96B 5IQHA 3UO6A 3KRLA 4O96A 4PX6A 4ACMA 3UOJA 4O7NA 2WNTA 1H1PA 4UXLA 3AC3A 3C4XA 4QT1A 5HE1A 3CD3A 4YJUA 3OUKA 4WHZA 4WNKA 3GCQA 1R1WA 1VEBA 4FTUA 4IAAA 3TJCA 5E8VA 3U6HA 4EH7A 1W7HA 3B2TA 2UVYA 4ALVA 2EUFB 2X7FA 3CJGA 3O8PA 3BIZA 2F7EE 4KS8A 4FC0A 1WZYA 5E8SA 3V5QA 4FUYA 4FICA 4IMYA 4C38A 5J5SA 4C36A 3R71A 4I0RA 4QMQA 2C5YA 3CPBA 3UDBA 4AQCA 4EQUA 4PL3A 1S9IA 5DG5A 2GHGA 2VO7A 2Z7SA 1YW2A 3POZA 2PPQA 2G2FA 2C3KA 4GV1A 4H36A 4Y85A 2XNEA 1GAGA 4BI2A 3BBTB 4AGWA 4J7BA 1SVHA 3ZXTA 2X9FA 3KRXA 2YJSA 3HDMA 1OITA 3ZHPC 1JWHA 2OF4A 2VWUA 3R21A 4U97A 1P4OA 3R9NA 3ZONA 4FUXA 1M2PA 5TKDA 3SVVA 2EXMA 3R00A 3IK3A 2OU7A 3BBWA 3R73A 3D0EA 4LUEA 3EFLA 3KQ7A 4A9YA 4EUTA 5HTIA 3C7QA 1K3AA 4LV8A 3NWWA 3RWPA 4AZFA 4EWHA 2PULA 2Z7RA 2RKUA 4DGLC 3HRFA 5IEVA 4EKKA 4JOAA 4YZ9A 5IEYA 4PP9A 4RIWB 4M8TA 4YZCA 4C3RA 5HORA 1FBNA 2Y9QA 2YERA 1XBAA 2P2IA 3C0IA 5M4CA 5HBHA 4FEXA 1Q4LA 4MTAA 3W32A 1NY3A 4BB4A 3AC8A 3LE6A 3KMUA 2UZBA 3QHRA 4QYYA 3LQ3A 2HY0A 2C5OA 5CEKA 2HY81 4BCFA 5CAVA 5BMMA 3P9JA 1U46A 2X8IA 4QP7A 2J0JA 4PPBA 4FTNA 3O51A 2XCHA 3HNGA 4F0IA 2A0CX 5IG1A 3KFAA 2JIIA 4W8DA 1PXIA 5C9CA 3HDNA 2QD9A 5I9ZA 3QTQA 5L2WA 4JXFA 4CXAA 3ZH8A 4FKQA 1ZYCA 2BRHA 2OJGA 3QC4A 3JR1A 5C4LA 2KTYA 1GIIA 4EI4A 2WTCA 4MXAA 4EUUA 1ZWSA 2WEVA 3W55A 4IDVA 5TF9A 4U43A 5DE2A 4CKJA 4BFMA 4BCNA 3JUHA 1JLUE 4R7HA 5AP7A 5L2QA 4JJRA 4WNMA 1YDRE 4YTHA 3R7YA 4YTCA 3DAKA 4BCJA 5I0BA 3KK9A 1WBWA 3N9XA 4IZ7A 1F0QA 1MUOA 5FDXA 4WO5A 2BFXA 4I23A 5GJGA 5CU6A 3LVPA 2QLUA 1Y8GA 4FBXA 4HW7A 5HX6A 3R8VA 4V01A 3T3UA 4DBXA 5HCXA 3F88A 5CEIA 3FY2A 3LIJA 3KF7A 2YLFA 4W4WA 5DBXA 5B2MA 4BY9E 4WRGA 4F64A 5IQCA 4BWKA 3AMYA 3DBFA 3KMWA 3UG2A 4EOJA 4J97A 3GCVA 4IWOA 4RIXA 4TL0A 5CAQA 2UW8A 2BKKA 2PZYA 2OGVA 3NUSA 3BI6A 4DTBA 4BWPA 4O1OA 1V0BA 3I79A 2QURA 2GNFA 3GOKA 4X21A 5AWMA 5HESA 3VUHA 3EZRA 3KRWA 2Q83A 5BNJA 5M57A 3GXLA 4MQ2A 5EKNA 4AACA 4XG3A 1PXLA 2PY3A 1NVSA 4PDSA 5LCJA 3UNKA 1YOMA 2OIBA 3Q3BA 4QQCA 3R9DA 4BDIA 4RGJA 3MTFA 2G2HA 2J0MB 4Y8DA 4AUAA 3A7GA 1JOWB 4XLIA 4JG8A 3WZDA 4QMNA 3TKHA 3V8SA 4F9AA 4S34A 1BLXA 2QOLA 1W82A 3FE3A 3MI9A 2XK7A 2O64A 3G6GA 3Q4CA 2ERZE 3O8UA 4F7LA 3NAXA 2CJMA 2QLQA 3HRBA 3EMGA 3G33A 4CCBA 4I41A 1GNGA 3CTQA 3O7LB 5HQ0A 4APCA 4AA4A 4IWPA 4K2RA 4EQMA 5E92A 3LAUA 3ORNA 3P4KA 4L7FA 4RA5A 1LEZA 4ENYA 5CSWA 1S9JA 3A62A 4IADA 5K5XA 3UZRA 3RAIA 3BEGA 3BU3A 1VR2A 4YBJA 2W5BA 2EVAA 2WMUA 5AA9A 4HCUA 2HENA 3P78A 3KU2A 2Y6MA 4QMPA 4JQ8A 5CTPA 4G5PA 5E1SA 3HV7A 4YGAA 4PTCA 5E9EA 3LMGA 3CLYA 4ANBA 3PZHA 4E73A 3F2RA 2EU9A 5C4KA 2X7OA 1YRPA 1LEWA 1STCE 3GBZA 2XKEA 2C6MA 3D15A 4RQKA 5DLSA 2GU8A 3TKIA 4FTMA 4CZTA 2GDOA 4RT7A 5AM6A 3JVSA 5AP0A 5EDPA 3E87A 4FKIA 3WBLA 4DGGA 2RFEA 4AFJA 5EI6A 5C8MA 3RHKA 4MXZA 3CP9A 3VBWA 4AP7A 4U7ZA 1REJA 3FI2A 5FEEA 3PIZA 4D1XA 2LAVA 5IA3A 2WTDA 5ANIA 1OKYA 2OIQA 3R7OA 4Y46A 4HPTE 3R0TA 5LVNA 2YABA 2ITPA 5D12A 3RKBA 3WIGA 3NZ0A 2PMOX 4X2GA 1XH8A 4GFGA 4UXQA 5E90A 4IQ6A 4EC9A 4YHFA 4CT1A 3D83A 4LRKA 2C3IB 2UZNA 2CCHA 3GQIA 4L68A 3Q2JA 5J7BA 2PMNX 4C4HA 3DNDA 3II5A 4BIDA 4XEYA 4KBKA 3MJ1A 3VBXA 2YZAA 3QD3A 3DLSA 4XV2A 2B55A 4I4FA 3OWLA 3A8XA 4J1RA 4QPMA 4C61A 5M07A 2OXYA 4G9CA 4IC8A 4FX3A 1XQZA 4I6HA 5BVEA 2HWPA 3F5PA 4JR7A 3KXHA 4ZEGA 3RZFA 1GZKA 3ZFXA 4YNOA 4HNFA 5AR4A 5BVFA 4I93A 5EM5A 2ONLC 3EN6A 2C30A 1ZOHA 4I94A 4IHPA 3F5XA 3F9NA 4KRCA 3QRUA 4U42A 2XKDA 2ZM4A 4PMSA 5DT4A 4HNIA 3SRVB 3G9LX 4YSJA 3UQFA 2G9XA 5A4LA 3B8RA 2JKKA 2CSNA 4UY9A 3UBDA 5ETFA 4BIBA 1GOLA 4YR8A 2IVVA 5HG9A 1ZYDA 4FNYA 2QO2A 2VU3A 4FMQA 4LFIA 1OMWA 2YDKA 3UOLA 2W1DA 2BIYA 2F49A 1YXUA 2FH9A 4C33A 4CFUA 1REKA 2NNWB 4F7JA 4L6QA 3R9HA 3B8QA 4ZJVA 5L2IA 1Q24A 4FV0A 2DQ7X 1RJBA 4HVDA 4NIFB 3BGQA 4YLKA 2XJ0A 4Y5HA 5CNNA 3UC3A 3WZUA 3A7JA 1CDKA 2XIKA 2CNUA 3HEGA 3BLRA 4O91A 3PY3A 4QP8A 5DEWA 4EH6A 4N4SA 3HZTA 5J1VA 4ERKA 2G01A 2UV2A 5CX9A 1M17A 4P4CA 1ZLTA 2VX1A 2GCDA 3VUDA 5CSHA 4YUQA 4FTIA 4BHNA 1O9UA 5C8KA 3CS9A 4IAYA 1Q8ZA 3QUPA 2NRUA 1FGKA 3VRZA 4G3FA 3OWPA 2W1EA 5D11A 3TNQB 3REPA 2OZAB 5GHVA 3O17A 4R7BA 2YACA 4AAAA 4ZTNA 1M7NA 3VS2A 4D0WA 4HGLA 4NUSA 2BTRA 4D5KA 3P5KA 3FLQA 3FQEA 3RM6A 3PP0A 3IW7A 1Q62A 1ZYLA 2GTMA 3F5GA 3QZFA 4I24A 4MVFA 4G3CA 3V5TA 2W4JA 4X3JA 4A9SA 5CSPA 3PJ1A 4WSYA 4RWJA 3TZ9A 1Q3WA 4DINA 4CFXA 4GCJA 5JT2A 3FMHA 2WD1A 3OC1A 4GMYA 2X39A 4BWXA 3KGAA 1IEPA 1JSVA 3JPVA 2GSFA 5ACKA 4XP3A 1OVEA 4IXPA 1QL6A 4CFNA 2WMQA 4GW8A 3IW8A 4TN6A 2YCRA 3HGKA 2BTSA 1E1VA 3Q96A 3PLSA 3TG1A 4XG4A 3OCBA 3GI3A 3CR0A 5IH4A 2H96A 3E8DA 3QWKA 3VUTA 5ACBC 4OTFA 5JRQA 3OTUA 2ETMA 3MIYA 4YLJA 3E64A 3RCJA 4NL0A 3DBCA 4UWCA 4QTDA 4WG3A 1MQBA 3PZEA 4XG8A 4XP2A 3UYTA 2G15A 2J4ZA 3G0FA 1U54A 5CT7A 2KULA 3K5VA 4JQ7A 2C5XA 5DNRA 5CF6A 4IZ5A 3NUAA 3LQ8A 3NEWA 5DR2A 2OG8A 3RP9A 2PL0A 3LFDA 4QP6A 3TTIA 2RF9A 3IDBA 3ODZX 4L43A 4EHGA 4C59A 4YNEA 1OIRA 2QOFA 1J1CA 3KMMA 3UNJA 4QD6A 3RBWA 4LMNA 2W06A 4L3JA 3NUUA 3VVHA 2VTTA 3R22A 3D7TB 4OTQA 4UEUA 2PMIA 4ITJA 5HBEA 2C6DA 4EZ5A 4AOIA 4CLIA 3QCQA 3NIZA 3E8CA 4YJSA 2R3FA 5LVMA 1OPKA 2WOTA 4L67A 1W8CA 4Z3VA 2OI4X 2QKWB 4UZHA 5HLNA 2V5QA 3P1AA 3Q4UA 2GFSA 4FKRA 5LJJA 2GQSA 2E9OA 5CU4A 1KUTA 4DF3A 4FSTA 2PVJA 5CVGA 3RJCA 1Y6AA 2P33A 2ZM3A 4GSBA 3QU0A 1DAWA 3DU8A 3JVRA 5H8EA 2J7TA 2NRYA 4CRSA 4EZ3A 3FHRA 2GMXA 4ZAUA 3FV8A 1Q99A 2WEIA 3ENHA 2IVSA 5E8YA 3ORXA 5JGAA 3UO4A 3T9TA 2QOOA 4LL5A 5IQFA 5CI7A 1IR3A 5LCKA 3SXFA 3RK9A 3SGCA 3SQQA 4CSVA 4DFNA 2XJ2A 3C5UA 5CT0A 2YA9A 4H1MA 5CY3A 2YHVA 4O7LA 3VN9A 5FM3A 1IG1A 4BF2A 4LOQA 4C7TA 4ORKA 2CGVA 3TKUA 2YM6A 1T45A 3QQKA 4JBPA 4K8AA 3TUBA 1WBTA 3QYZA 4MD8E 2YITA 3Q53A 3CCNA 2C0TA 4TNDA 4WT6A 1DI8A 3C13A 5HD7A 2PHKA 2IVUA 3QD2B 5CU0A 1XH4A 1P4FA 3Q9XA 4KB8A 5HHWA 3W2RA 3DXNA 3TZMA 1OGUA 2GNIA 3GOPA 4AG8A 4F09A 1YI3A 2QHMA 3FL5A 5J7HA 5HIBA 5AP1A 2JITA 3UJGA 4DEEA 1YHVA 3DKFA 2P4IA 4YO6A 4TYHA 5ANKA 1YXVA 1ZOEA 5IUIA 4C3FA 5H3QA 5IH6A 4BCMA 3PJCA 1SZMA 3FC1X 3VUIA 4BCGA 5E1EA 2OW3A 2OKRA 4ZK5A 5CXZA 2Q0BA 4J8MA 4FIEA 5AR8A 2QKRA 5ANJA 4PPCA 4QO9A 4A9UA 4E6DA 4F70A 4WNPA 4JBVA 4UMTA 5KX8A 4O7SA 4O0WA 2WTKB 4UYAA 5A14A 2W4OA 4RLKA 4BCQA 4RRVA 2XF0A 3AC1A 3R30A 4KKHA 2BVAA 3OHTA 3E92A 4OTRA 4CQGA 1OI9A 1XH6A 4CFMA 4ARKA 4FL3A 4CYJA 2CNVA 4MWIA 4NYEA 5IQBA 4A07A 3FSKA 3MY5A 4QQJA 3AC5A 4FIJA 1XKKA 4BGGA 3V5WA 4EC8A 4TXCA 4GT3A 3FKOA 3QFVA 3W16A 3WARA 5HZNA 3DK3A 3F3VA 2OSCA 2XIRA 4QTAA 5AP2A 3WF7A 4EJNA 2GS7A 1YKRA 2PZPA 2W1CA 3NUYA 5J1WA 4K1BA 3WZEA 2GNHA 3VS3A 5LMKC 3GVUA 1H07A 4AT5A 4CQEA 2YWVA 4D2VA 4D2PA 3VRYA 2CHLA 2WTKC 4O7YA 4LOOA 4L45A 5TR6A 2JC6A 3ATSA 2FO0A 4NTTA 3MH1A 5EH0A 2UW5A 4C2VA 2WQOA 3D5UA 4IAIA 2R0UA 2XIYA 4UMPA 4LMUA 4Y73A 5D41A 2CKEA 3E3PA 4C3PA 3IO7A 3PE1A 4E4LA 1LPUA 1G8AA 2R0IA 3MESA 5EM8A 5HLWA 1FMOE 3E88A 4O0RA 3SOCA 5HOAA 2IPXA 1OPLA 5D7AA 4QQ5A 2QO7A 1H8FA 3RNYA 2PVLA 3LCSA 3NW5A 4IB1A 1WVXA 3LXNA 2CGUA 4S31A 4MD7E 2F2UA 4Q2AA 3QXOA 4CCUA 5K4IA 4EK4A 2RL5A 3ANQA 2VWXA 2YEXA 3R8PA 1KE7A 4IX5A 2VTSA 4FSYA 4E4XA 5BVNA 4ZTSA 3WF6A 3VBVA 3QUDA 4OTIA 4C58A 3ORPA 4RC2A 2HK5A 4UB7A 4ZTMA 4FV5A 5J9LA 4OUCA 3RAWA 3Q6WA 4CKRA 5IPJA 4JRVA 5KZ0A 3S95A 3COIA 3QQGA 3OS3A 1WAKA 1AQ1A 3AT4A 4EBVA 1W83A 4PTEA 3OMVA 3W33A 2Y6OA 1YXXA 4CTBA 3VJOA 3R1SA 3RPRA 4UMQA 4O27B 4C8BA 3A8WA 4N70A 1ZMVA 1JNKA 3LFQA 2EB3A 1JAMA 4FKGA 5FP5A 3BYOA 5HTCA 4FTKA 4CG9A 4GUEA 2IN6A 4UWBA 3TV6A 5AX3A 2ZV8A 5IISA 1OL2A 2WU6A 5HKMA 4IBMA 1JVPP 3FZRA 4S32A 3C0GA 5DFPA 1Q5KA 4EOLA 3UE4A 4NCTC 3UGCA 4PUZA 3DJ7A 2PVNA 3BHTA 3F69A 1PMVA 2J50A 3VUMA 4WRSA 4YJOA 5AUZA 3FWQA 2JIUA 2R3QA 3UTOA 1PKDA 3QKKA 3UMXA 3GU6A 4H58A 2F57A 2PK9A 5CQUA 1R78A 2YWPA 5HGIA 3B2WA 1CKIA 4QNYA 4YJRA 5E4HA 5IQAA 4GKHA 2OBJA 2WTVA 3LOKA 3BEAA 4CVAA 1WMKA 4EK3A 4FNXA 2UZOA 4ZTRA 4ACCA 5AUTA 3Q9YA 4FKLA 5CXHA 5HO8A 4TRLA 4D2TA 3BKBA 4PWNA 4F6SA 2ESMA 2QVSE 3PJ8A 4FTTA 2WOUA 3ZUUA 2ETRA 3AQVA 3ULZA 1WCCA 5HG7A 4MH7A 4ZY4A 3K3JA 5LMAA 4WNOA 4JR3A 3K2LA 4E5AX 5KBQA 3SHEA 3HMNA 3NUNA 2R3GA 2WXVA 2G1TA 3WE8A 3FMEA 4AZSA 4IVCA 4MWHA 5D9HA 4MAOA 2HZIA 5CNOA 5FM2A 4L3PA 2JDOA 4EOOA 4RJ6A 3F3ZA 1RE8A 4DG2E 4F7NA 4OTHA 3CC6A 5CSVA 2OF2A 2WMRA 4IWDA 2WTIA 5GZAA 3ERKA 3DDQA 3Q4TA 4JLCA 4MXCA 5KKRB 2W1HA 2VX0A 4BDGA 4A9RA 2GQRA 3UZTA 1JKTA 2Z2WA 2QOHA 3KULA 3QXPA 4YBKA 5AADA 3U6JA 4J53A 4O0XA 4WKQA 4AW2A 3PVBA 5M56A 2B9HA 2VRXA 4Y83A 2PVYA 4KIKB 2GS6A 5CZHA 3LM0A 3ZLSA 3FZOA 3R1QA 4MD9E 4G1WA 4WG5A 3S2PA 3VC4A 4FTQA 3LFEA 3COHA 3C4CA 5ETIA 1ZARA 2WMBA 2X8DA 3PJ2A 4FT7A 3ZFYA 4FG8A 5GZ8A 4O0UA 2UW9A 1U4DA 3R1YA 4YPSA 2OFUA 4UWYA 4DEDA 1H01A 4CZUA 1ZMUA 4USDA 2X4FA 3QALE 3I7CA 4RJ8A 2ITVA 3WILA 4GT4A 4YHTA 1RW8A 3QL8A 4AA5A 5KKRC 3V04A 4NEUA 3BQCA 1IAJA 3C5IA 4IFGA 2XRUA 4ZTQA 2BRMA 3FBVA 2PUPA 3IW5A 3MPMA 5I3OA 3RALA 3MS9A 2VTLA 4FK3A 1P14A 2QR7A 3CKWA 3ORZA 5GINE 4H1JA 3IS5A 3NLBA 5AM7A 2YN8A 4RIYA 1UNHA 3EN7A 3LLTA 1UKHA 3DLZA 2PE1A 3GC7A 2XNGA 3R2YA 4FKUA 4PDYA 1ZY4A 2VGPA 3TNWA 3HX4A 4BZOA 5A6NA 2OIDA 4D2WA 4I20A 2WMTA 2BILB 3M42A 3SG9A 1UNGA 4FKVA 4FIHA 4BCHA 1ZY5A 3ZOSA 4BCOA 2WELA 4WG4A 4ZSGA 1VZOA 4G3GA 5JFVA 2B9IA 4APPA 3EQFA 4HYHA 4O7ZA 3QCYA 4RPVA 4PNKA 1CSNA 3LPBA 3VNTA 3OXIA 5JSMA 1IA8A 4YLLA 1H27A 3WYXA 4ZSLA 3VF9A 2R7IA 3U54A 3BELA 2SRCA 5GIPE 1SM2A 2OJIA 2VWZA 3NNUA 2GQGA 3R04A 3I60A 2PWLA 2WGJA 4EH8A 3F3UA 2FSMX 3TNHA 5IQDA 1H1QA 3QKLA 3VS6A 4HVHA 2A1AB 3QQUA 2REIA 3DNEA 3PP1A 5F94A 3RAKA 4BZDA 3QTWA 4DEIA 3RTPA 4HCVA 1FVTA 4IZAA 4G17A 3WF8A 4JDKA 3O71A 5A4QA 4D5HA 2XB7A 4FZ7A 4AS0A 4QTEA 2VTPA 3KVXA 4F99A 4YSMA 2NPQA 3SV0A 3VUKA 3OROA 2BZKB 3VJNA 5AMNA 4FG9A 5FRIA 3HMMA 5DVRA 5IA2A 1BL6A 4H3PA 3T9IA 4TY1A 4ALWA 3N4TA 4X3FB 2XNNA 1PXPA 3DBQA 3KRRA 1XR1A 5E91A 3R8ZA 3PLAE 3CE3A 5FEDA 4AXAA 3DKGA 2FYSA 4FL1A 4DHFA 3PG1A 4ITHA 4HGSA 4H3BA 4KBCA 3FQSA 3TEIA 5FBNC 4MNFA 1TQPA 4AW0A 3PJ3A 3GB2A 4AOJA 5B7VA 5CAUA 5B0XA 1AD5A 4BHZA 3DFAA 3OD6X 3KB7A 4FT3A 2H9VA 4WUAA 4UN0C 2JIVA 3TV4A 4FG7A 5AV4A 3DK7A 4A7CA 3U6IA 3EZVA 3HYHA 4EWQA 5KMLA 4O84A 1FQ1B 3NNXA 2R4BA 1YHWA 3A4OX 2BAQA 4QPSA 4ID7A 4USEA 3UP2A 3P7CA 4U9AA 5EI2A 2PZIA 4BYIA 4M0YA 5EDRA 4O0YA 1WFCA 4Y95A 1O6KA 4AE9A 5AIKA 3OEZA 4YURA 4Z7GA 3L9LA 4X3FC 5EYKA 2PE2A 2EXCX 5AFVA 2JAMA 2R3RA 4BBFA 1JKKA 4R8QA 2J2IB 4LM5A 4TYIA 5EG3A 4FTRA 3ZO3A 2F9GA 3FKNA 3I5NA 4OLIA 3FPQA 3R8UA 2C3JA 2H6DA 2ACXA 3WF9A 2ZM1A 4PP7A 2C0IA 2R3KA 3Q6UA 3MH2A 5C1QB 5IZFA 4IH8A 3ODYX 4JAJA 1E1XA 4I6BA 4B4LA 3SW7A 3G0EA 3PVUA 2XS0A 3LCKA 5JFWA 3E3BX 5C03A 1JBPE 4RMZA 3AD6A 2W9FB 3ZDIA 4QMLA 3DT1A 4LUDA 4OR5A 3RPOA 3F7ZA 3I81A 4FYNA 2Y4IB 3OCGA 4PRJA 4QTBA 4EORA 2CMWA 5C8NA 3A60A 3OW3A 1IASA 1XWSA 4GU6A 2VTJA 5CEQA 3ZO4A 4BDFA 4WBBB 3FLYA 4I21A 1ZXEA 2YCQA 5FTGA 4K0YA 4G34A 3ZSHA 4E93A 4LV5A 2EB2A 2XMYA 3QC9A 4KIPA 3W2QA 5HX8A 1XH5A 3SC1A 4MKCA 4MCVA 1J3HA 2HOGA 4RIWA 4FVPA 3MH3A 4FZAB 3OFMA 2QCSA 5BUEA 4J95A 2OJ9A 5I9UA 2ZYBA 3AD5A 4C02A 2VV9A 3ENMA 5AEPA 1OB3A 4M68A 4OTPA 3LFFA 5HVJA 3WZKA 3DQXA 4X2FA 1JKLA 2JBPA 1PXNA 3HUCA 4CFVA 4BR3A 1F5QA 2Y4IC 3L8XA 4IANA 5JQ8A 1FVRA 1BUHA 2CN8A 2W0JA 3OY3A 4F9BA 5CAPA 4OTDA 5EQEA 4JIKA 3VQHA 4E8AA 2C6KA 2FGIA 4IAFA 4Q9ZA 3E5AA 4MXXA 2B52A 3PWYA 4ACDA 4EYJA 1OL1A 4BGHA 4D9UA 5CASA 2C3LA 2ITYA 4JS8A 4U3ZA 1CKJA 2HXLA 3QHWA 4ZIMA 5LOHA 2VGOA 3QBNA 4YJQA 3TM0A 3FMJA 1Q8WA 3Q9ZA 1YWVA 4YZMA 5HD4A 5LVOA 4O86A 4PL4A 4O0VA 3EFWA 3QTSA 4FEVA 4A06A 4DYMA 5L6PA 3NYNA 3HV4A 5HNIX 4J71A 5ETCA 3LXLA 3OF0A 5DHJA 4DFXE 4FKSA 5DOSA 3FLWA 3RCDA 4DEBA 4EQCA 4AFEA 4O22A 4YO4A 2UW7A 4F4PA 5LXMA 4RJ3A 2XM8A 2PE0A 2YM8A 1FOTA 1TVOA 2YIYA 4CV9A 4RX5A 3QTRA 1TQIA 2ETKA 1YOLA 5AAGA 3V6RA 4P2KA 1O6LA 3EOCA 5E8WA 3IECA 2R2PA 4KIOA 4ZY5A 2Z8CA 5EK7A 3OUNB 1G5SA 4FV9A 3MV5A 3BYVA 5C01A 2X4ZA 3IW6A 5BUJA 4RQVA 3GC9A 3LFBA 3NRMA 3FL4A 5IDNA 2XK3A 3RPSA 4DG3E 5FEQA 2CGWA 3FZTA 1BMKA 4ZSEA 2W1ZA 3DJ6A 3H3CA 2XNBA 3QCSA 5L6WL 4EH2A 5F20A 2V55A 4IVBA 4RWIA 4UYNA 1YQJA 4YMJA 3H10A 3IKAA 3SXRA 4ZLOA 2C47A 1YVJA 4C4GA 3KXNA 1PXKA 3KC3A 4IM2A 4FZFB 5DT3A 4I6FA 4CGAA 4IE9A 1MRYA 3DXQA 2IWIA 4NK9A 1OECA 3VS4A 4IAKA 3WE4A 2GFCA 4UALA 5DYJA 3COKA 2XBAA 4M97A 5FQDC 2JFMA 3SA0A 5HVKA 1QPCA 1V1KA 2BIKB 3BV2A 3PPKA 1UA2A 3A7FA 4I5PA 4IAZA 3OT8A 4OW8A 4RFMA 3UQGA 3MB6A 4XV3A 2PVFA 3FI4A 3BHVA 3FKLA 3HA8A 3L9MA 2XBJA 4J96A 4K33A 4N0SA 4Y72A 5E7RA 4O81A 2ITTA 5AV0A 5BYYA 3EL7A 4XG9A 4OGRA 2B9FA 1K2PA 2BROA 3DBEA 2OZOA 4JL9A 4R3CA 4FSWA 1GZNA 2J90A 3NNVA 4YJVA 1YXSA 4BZNA 4DTAA 5IUHA 2UVXA 4M0ZA 4QMXA 2VD5A 3ZM9A 3E8EA 4P7EA 3CQWA 5HG8A 4TNBA 1VYWA 2HWOA 3R2BA 4LOPA 4E1ZA 4HCTA 5H8BA 4W4VA 4RFYA 5TO8A 4JAIA 3LFNA 2UZDA 4FIFA 5GJDA 4LQMA 4E26A 4OT5A 4AN2A 1WBPA 1U5RA 1PY5A 4KKGA 4RIOA 4DGOA 3BYMA 3OZ6A 2RFSA 2YISA 5I9WA 4KUJA 3OCSA 5CQWA 3R7GA 3UVQA 2XNOA 3BLHA 4HJOA 2J0KA 3BGZA 3ITZA 4V0GB 4CV8A 2HAKA 2JKQA 2UW6A 2Y0AA 3OCTA 4BC6A 3LMHA 4G5JA 5DA3A 3EN9A 2WIPA 2AYPA 3PIYA 1A9UA 2WQEA 4OBPA 4A9TA 3N4VA 3HA6A 4FTJA 3PYYA 1Y91A 4IVAA 5A4EA 2ONLA 3A99A 3NNWA 1J7LA 4C4FA 4AT3A 1BI8A 1LP4A 2BDJA 3IQ7A 2VTMA 4AGUA 3SAYA 3RZBA 4A4OA 5KO1A 3I1AA 4L52A 4ZJJA 3NX8A 5FXRA 1NW1A 3PDTA 3UIXA 4N6ZA 4FEWA 2PVRA 3LLAA 1BI7A 2HIWA 3PRFA 4AWIA 3PA3A 5JFSA 1SNUA 1UU7A 3QGYA 3DB6A 3VUGA 2C68A 1MP8A 4LYNA 3W8LA 3GUBA 5M55A 4AT4A 4BGQA 3UIUA 3GU5A 2HW7A 4LG4A 4IX3A 1PHKA 4H39A 3ZXZA 3BQRA 4G2FA 4W8EA 2P55A 3MVMA 4BN1A 4U5JA 4EOPA 2C5NA 3FMKA 5DT0A 4ZTLA 3NIEA 1H24A 3DDPA 1I09A 1XJDA 1QMZA 3NCGA 3DZOA 1PF8A 3RAHA 4IWQA 5FWKK 4EEVA 4DCEA 3OEFX 3D2KA 5G1XA 4EL9A 5DGZA 3OOMA 1H26A 4BDKA 4I4EA 3SG8A 4EH3A 5CS6A 3O50A 2X0GA 4FSNA 4KSQA 4G31A 4R6VA 5KCVA 4GKIA 5KUPA 5KHWA 5T3QA 3VAPA 2B7AA 2WAJA 3MIAA 3TNIA 3DBDA 4EOIA 4FV1A 4M69A 3D7ZA 5A4CA 2GNGA 3QTUA 3WIKA 2Z7LA 4PPAA 4TTHB 4DA5A 2DYLA 4QP9A 1WVWA 3QGWA 2OFVA 3S4QA 2AUHA 3EQHA 1YI4A 1PMNA 4XX9A 3H9RA 5EW8A 4DH3A 5AR2A 2Q0NA 5IDPA 4NIFA 4G3DA 5KMKA 4EKLA 3UZPA 4NW5A 3OVVA 4RVLA 3IPHA 3AG9A 2UUEA 2IW8A 3QA0A 4E4MA 2R3HA 5DN3A 2FA2A 4UZDA 1SNXA 4PF4A 1UNLA 4M3QA 5DH3A 3EQBA 3VBYA 3TL8A 2ZV2A 3V51A 4E20A 4MNEA 5IMEA 5ANDA 4FIGA 2H34A 3KRJA 3MVLA 1HCKA 4UMUA 1X8BA 3SD0A 3TXOA 2VO3A 3PIXA 3PVWA 4XYFA 3IDPA 2HW6A 4MXYA 4FKPA 3TI1A 4R1YA 4EOSA 3PSCA 3E8NA 2QONA 4QNAA 5CEOA 4FGRA 1YXTA 4U45A 3GQLA 4DE4A 4RA4A 3PPZA 1W84A 4U81A 4C2WA 5B2LA 3LHJA 3ULIA 3NUPA 3AOXA 3FUPA 2JBOA 5AP3A 3O96A 4BI0A 2J5EA 1GZ8A 4ALUA 4X6RA 4AZTA 3POOA 3PE2A 3ZEPA 2UW4A 2C0OA 3HKOA 4B0GA 1Z5MA 5CANA 1XHAA 2Y8OA 3DA6A 5BUIA 5IF1A 3VW6A 2PTKA 4B8LA 5DRBA 4O6EA 4XCUA 4IEBA 4P5ZA 5EOBA 5FTQA 5I9XA 4G9RA 2OXXA 2W17A 3O8TA 4F9CA 3FY0A 3UOHA 3CXWA 4I3ZA 2JEDA 3PVGA 1R39A 3ORTA 4ANLA 4NJDA 3IGOA 3D94A 3VS5A 3GGFA 4ZLYA 4BYJA 1LUFA 2QU6A 4X2JA 4FL2A 3PA5A 3CPCA 4GYGA 3W18A 2VWVA 2VN9A 2XIZA 2JAVA 2IJMA 3QUEA 4GFMA 3NAYA 2QG7A 4O6LA 1A06A 4R77A 1CKPA 1WBNA 2VZ6A 2XM9A 3NW7A 4L01A 2PZ5A 2UW0A 5HICA 3HP5A 5LMBA 3H0YA 3DAEA 4ITIA 4R5SA 2E9PA 3DZQA 3C0HA 5DRDA 4RWKA 3BLQA 5L2SA 3OG7A 3ZFMA 5HTBA 5DIAA 3OY1A 3D7TA 3R8MA 3ACJA 2BRBA 4CG8A 3PSDA 4ACGA 1PXMA 4DN5A 3PXYA 4UMRA 2UZWE 4FSQA 4FNZA 4LL0A 4K18A 3RINA 3OW4A 2Y7JA 4WD5A 3RPYA 4MF1A 4CMOA 1T46A 4QYFA 4ZS4A 4IB5A 3MA3A 3NYVA 3FMLA 4L46A 4QRCA 1G3NA 3RM7A 4EH9A 2BAJA 1K9AA 2DS1A 2HELA 5E8TA 4BTFA 3MW1A 4EOKA 3G15A 3EYGA 1H00A 5K0KA 1OZ1A 4ZP5A 4NSTA 1R0PA 3ROCA 4DLJA 2ITNA 2WQBA 4LRMA 2J6MA 3ZYAA 4PMPA 3DTWA 4IACA 4FA2A 5A54A 1MRUA 3LFAA 3G2FA 3BHHA 1SMHA 4M7IA 4PV0A 2HYYA 4U44A 5FXQA 3RHXA 4YP8A 3UC4A 1H0WA 4RX8A 3QLFA 4LGHA 4D55A 4KINA 5B2KA 4S2ZA 3V6SA 4AN9A 3F3TA 4DEAA 5F4NA 4X2NA 4QMSA 3FPMA 2W1GA 3MB7A 4AZEA 3LCTA 5A46A 3Q4ZA 2XNPA 2W5HA 4FI1A 1DI9A 3IOKA 2ZVAA 3MY0A 2I1MA 1H1SA 5L8KA 4MEDA 3BYUA 2WMSA 4ZY6A 2E2BA 4JNWA 4UBAA 2LGCA 4WOVA 3COMA 5AAEA 4KS7A 5AIRA 4D1SA 3CGOA 3FLZA 3KK8A 5KBRA 3NYXA 4FVQA 1H25A 2ITZA 4HVGA 1QCFA 4TYJA 5ITAA 5C26A 3E93A 4E6AA 4TWPA 4NT4A 3LM5A 4RX7A 4QOXA 5EYMA 1ZYSA 1GJOA 4FF8A 5TT7A 3I7BA 3NS9A 5GJFA 1GIJA 1WBSA 5C27A 4DFUA 5M06A 3JY0A 4CKIA 3L8PA 3ID6C 3BU6A 2I40A 1J7IA 3V5JA 1L3RE 3LCOA 3TTJA 2VWIA 4FEUA 1WBVA 3K3IA 3Q2MA 3PXFA 4L3LA 5CEPA 3N51A 2OJFE 2YIXA 4J52A 3CD8A 2W99B 2ZAZA 4U8ZA 4E7WA 5IQIA 4ASXA 4X0MA 5JN2A 3ETAA 4NFMA 2IG7A 3EIDA 5K0XA 2ZB1A 3CIKA 2I0EA 4KA3A 1SVGA 2AC3A 3QQFA 3BYSA 1XO2B 3UMWA 3KULB 2RG6A 2J51A 3OTVA 3HMOA 4ZS0A 4ZSJA 4OBQA 1OPJA 2CGXA 5IUGA 3R7VA 4FT0A 4ASDA 5HU9A 5GIOE 2YCFA 3F5UA 3EYHA 5M09A 2XK4A 3QA8A 4W9WA 2B0QA 4RX9A 1OM1A 3P79A 1Z9XA 4RJ4A 3TZ7A 2A4LA 3MDYA 4AE6A 4AW5A 1FGIA 4B99A 4YHJA 4C57A 4F0GA 3VULA 3U9CA 1ND4A 4GEOA 4XG6A 1F3MC 5HCZA 3TV7A 1UV5A 4QTCA 3NVKI 4YC6A 4BDHA 5A9UA 4H05A 4IB3A 5GNKA 3S0OA 4R1VA 3UODA 3GCUA 5JGDA 4GUBA 3EQCA 4KD1A 4O2ZA 2X9EA 3JXWA 5AUUA 2WMXA 4G6OA 4QMYA 4PQNA 2O3PA 3QTZA 1CMKE 2GNJA 2RGPA 4FTCA 3R83A 3MWUA 3IDCA 3TIZA 2BDWA 3OP5A 2J5FA 4DEGA 2XEYA 1P2AA 1Y57A 4AA0A 4YC3A 5DWRA 3DAJA 4XP0A 3KY2A 3QZHA 3WOWA 5BQ0A 2OH4A 2WB8A 3UNZA 3OT3A 2IVTA 2VO6A 4EK8A 2B54A 5T6KA 5IMXA 4BTJA 5AP5A 4K11A 4NKSA 3U4WA 3DQWA 2R64A 4KIQA 1H4LA 4GG7A 2QOIA 2ZV9A 4BTMA 5J9ZA 2RIOA 3KEXA 3VBTA 4NCTA 5HIDA 3PXRA 3TWJA 2YM4A 5J5TA 3HAVA 4F63A 4ZSAA 5KMNA 2BUJA 1OUYA 2VX3A 4D4YA 3I5ZA 3R28A 1NVRA 4X6QC 3ACKA 5D1JA 4BKJA 2PU8A 3HLLA 4JX3A 3FLSA 4V05A 1Q3DA 1PXJA 3P23A 3NYOA 5HO6A 4BICA 5BMSA 4TWCA 3E7VA 3R02A 4E6QA 1H1RA 4ZZOA 5EHYA 4WUNA 3BRBA 5KMOA 2C6EA 4XOZA 1TKIA 1YDSE 5HG5A 2HCKA
chains in the Genus database with same CATH superfamily
3PWDA 2PYWA 3CKXA 4BKZA 2X81A 4ZZMA 1J1BA 1NT2A 1YWNA 2VTRA 3OBJA 5LWMA 5L8LA 2C5VA 4N57A 3GU8A 3R8LA 4DGNA 4OTWA 1FMKA 2I0VA 2OK1A 4JG6A 1WBOA 2O5KA 5HLPA 5IA5A 2R3IA 3KXGA 4RZVA 2HXQA 4GT5A 5DPVA 4J98A 3QYWA 5AR5A 4O7RA 3RNIA 3CBLA 3L9NA 4FKTA 5KHXA 3TACA 3FYKX 1H08A 4RG0A 5A3XA 3D4QA 4W9XA 5FTOA 4FEQA 3GU7A 2B9JA 4OBOA 3ZM4A 3DGKA 4O83A 3DV3A 4C34A 4FOBA 2YIQA 3LFSA 1QPDA 1M14A 5HNGA 3ZO2A 1M52A 3ZUVA 4L00A 4JIAA 5EOLA 3HMIA 1OL7A 3C9WA 3PA4A 4BI1A 2HZ4A 4WIHA 2BR1A 2UW3A 3ORKA 4GJ2A 5BYZA 2XAMA 4TZRA 4O38A 4GH2A 3F6XA 5ICPA 2ZDTA 4GRBA 1DS5A 2ITUA 3F2AA 3PFQA 1ZAOA 3ZEWA 2CLQA 3O0GA 3KCKA 4FNWA 4HOKA 4PNIA 1Q8YA 4XG2A 5BX0A 3S00A 3LJ0A 3LW0A 4KAOA 4FZDB 2WO6A 4I5CA 4PDPA 3C50A 2OLCA 1XMLA 3QRIA 4FTLA 3ZBFA 4E3CA 2PUUA 5CAOA 3DY7A 4OAUC 1TFFA 2QG5A 4D9TA 4HZSA 4IJ9A 5TOZA 4OTGA 4BJJB 1UU9A 4F6UA 3QWJA 4R3RA 3UIBA 2VTQA 2OXDA 5DR9A 4GFOA 4B9DA 3FXWA 2AC5A 3LQ5A 3BHUA 3ZRLA 2J0LA 3ZMMA 1ERKA 4ZOGA 1V0OA 1ZRZA 2X6EA 1KE6A 4EH4A 3EB0A 3JS2A 2YCSA 2W9ZB 5M4FA 5EQPA 4K9YA 3ZC6A 5HNBA 3Q5ZA 2W4KA 5I9YA 4EOQA 5J9YA 4TPTA 5EW9A 5CU2A 4V04A 3GC8A 3C4FA 4FTOA 4GK3A 4U6RA 4Y5QA 3BWFA 5BYLA 3QTIA 1B38A 4BCIA 3PPJA 1KE5A 4B6LA 4ZJIA 1PW2A 4HVSA 5L6OA 2R3LA 3AGLA 4KIKA 4RIXB 1BKXA 1KOAA 2E9VA 3DKCA 3ELJA 4PTGA 3Q52A 4U0IA 1O6YA 2JKOA 4CLJA 3KREA 4W4XA 3H30A 3ZLWA 2YDJA 4MQ1A 3TIYA 4IM0A 5HO7A 5HE3A 3WZJA 2ITOA 3PXQA 3G6HA 5E8UA 2VUWA 3AC2A 2YFXA 3KCFA 2QHNA 3ZZWA 5LWNA 5DMZA 1G8JA 3H9FA 3NMUF 1UU8A 4YJPA 5CWZA 3CSVA 3QQJA 5I4NA 4RBLA 3ATTA 3ALNA 3NR9A 5AV3A 3A61A 2YDIA 3A7HA 2VAGA 2PVMA 4C4IA 3GNIB 2XK8A 4FSZA 1A48A 3ZTXA 2DWBA 2JFLA 2GPHA 2CKQA 4D4VA 3P7BA 4YZDA 3P0MA 4N6YA 2VNYA 2EWAA 5E8ZA 4EK6A 3CTHA 2ZJWA 1KOBA 3RVGA 2OICA 4TWOA 3V5LA 3O5AA 1PYXA 4O0SA 2IZSA 2RFDA 3GC0A 4TT7A 3PXZA 5JK3A 3DKOA 1H0VA 4ANSA 5AP6A 2BZHB 3RWQA 4XOYA 4MUQA 3G90X 3R9OA 3ZU7A 3DK6A 1IRKA 3T3VA 5CYIA 3D5WA 3BX5A 3M11A 3PUPA 3SDJA 5LARA 2UZTA 1KE9A 4O7TA 2I0HA 4QYHA 4XLVA 3R7IA 3DPKA 2C1AA 4EOMA 3I0QA 3C4ZA 5CSXA 5IQGA 4JVGA 5G6VA 2XUUA 1FVVA 4RSSA 2O0UA 2HZNA 5D10A 5LVPA 3QQLA 3M2WA 5KZIA 5EKOA 2P0CA 5HU3A 2CPKE 3FMNA 3MPTA 3MVHA 2JDSA 2WPAA 3EN5A 3QX4A 5M4UA 4JQEA 3H9OA 3FYJX 4E6CA 2Z60A 1Q8TA 4E4NA 2CNQA 4DFYA 1RDQE 3CJFA 4FV6A 4G6LA 1IAHA 1XBBA 4KSPA 4F1OA 2WU7A 3IGGA 3PUFC 4RZWA 1OIQA 2W1FA 5CENA 4IX6A 4NJ3A 1GY3A 2B4SB 1OKZA 2F7ZE 2ITWA 4U79A 1XH9A 4IW0A 3RGFA 1APME 2PVHA 4L44A 3EQIA 3RMFA 3A7IA 4JRNA 4Q5EA 2QI8A 1VYZA 3Q60A 1MRVA 4FV7A 3ZSIA 1NA7A 4GIIA 3O7LD 4C62A 4KNBA 4ASZA 4DH8A 2ITQA 3H0ZA 3ZLXA 2ZMDA 4R7IA 4UV0A 5CVFA 3ZS5A 4D1ZA 3F82A 1OKWA 4DH7A 4BDEA 4X3FA 3NW6A 3FXXA 5IA0A 2QOKA 3GCPA 4GVAA 1CM8A 2JKMA 3I0OA 5JH6A 4O0TA 1H28A 4NKAA 4BVUA 1BX6A 4NM7A 1OUKA 4HYIA 1R3CA 2F4JA 2VTHA 2YAKA 3CTJA 3BWJA 3F66A 4DEHA 4FE2A 2XYNA 4G16A 2UVZA 5AV1A 3RI1A 3ZZEA 3QTXA 5F9EA 4LGDA 4QMOA 2XK6A 3IONA 3W2CA 2PUNA 3Q9WA 4ANQA 4F6WA 4TYEA 4BDCA 3AT2A 5H9BA 4OAVB 2FUMA 5FXSA 4R78A 2BKZA 4ONAA 3HL7A 3KKVA 1UWJA 2XKCA 5KMIA 2X2MA 4I0TA 4RLLA 2CLXA 2IZTA 4HZRA 3KA0A 1OL5A 3C4EA 4E5WA 3VQUA 3OXZA 2VO0A 3MA6A 3EL8A 3LJ2A 3QD4A 5H2UA 3F2NA 2XIXA 3EQGA 3AT3A 4CD0A 5HBJA 2J0IA 2A2AA 3GT8A 3D2IA 4BBMA 3VF8A 5L3AA 2R3JA 2C6OA 3C51A 5BVKA 2IZRA 3TCPA 3NSZA 2FB8A 3KL8A 4QMMA 4NU1A 1FPUA 5I5ZA 3DTCA 1Y6BA 2JDVA 4L42A 3DXPA 3LFCA 4DTKA 4A4XA 5AR3A 5DEYA 3EHAA 5CI6A 1JSTA 5JZNA 4DHZA 5KE0A 4NM5A 3UG1A 4FKWA 4D4SA 5CF5A 5L4QA 4L9IA 2BZJA 3QRTA 4Z16A 4PMTA 2VWBA 3U87A 4FKOA 5I9VA 2IO6A 3FQHA 4AXCA 4EJ7A 1UVRA 3AGMA 1GZOA 4RC4A 3BPRA 3W0OA 2E9UA 2V22A 5AR7A 3D5VA 3HP2A 1J91A 4XG7A 2VTAA 4DBNA 4FZ6A 1BL7A 4QMWA 4YJNA 3UO5A 2RFNA 3UVRA 5K4JA 4B8MA 5K3YA 3EWHA 4HYSA 1FINA 4H3QA 4I6QA 4ASEA 4GJ3A 1PMUA 5FGKA 4CNHA 2BALA 4K6ZA 2VWWA 2GS2A 3LXPA 4O21A 2BAKA 1ZZLA 4DCAA 2X2KA 2UZVA 3R7EA 2BPMA 2XCKA 3GENA 3NPCA 4QQTA 1QPEA 2CDZA 3BLAA 2YZLA 2WMWA 3EKKA 3I6UA 5CVHA 4NWMA 4O2PA 2XNMA 5L8JA 1PYEA 4CZYB 4YZBA 5JKGA 1OBDA 3G5DA 3KF4A 1JKSA 4IC7A 2WIHA 2WHBA 3FDNA 4D2SA 2JDRA 3OOGA 1W98A 2O63A 5LQFA 2XANA 1YOJA 4O82A 3PXKA 4D4RA 3R63A 4M84A 4QYEA 4CYIA 4O7VA 3O2MA 5CEMA 3NUXA 3PRIA 5GZ9A 3CQUA 4J8NA 2YM5A 5CF4A 3UPZA 3FZSA 5E8XA 4MF0A 5M53A 4KRDA 4ZZNA 4NTSA 5IEXA 1U54B 3VHKA 3Q5IA 4M69B 4ZLZA 4YTIA 3MPAA 4FYOA 4F08A 4FSMA 4ANMA 5J87A 3TN8A 4ZMFA 3FI3A 4W4YA 4C37A 4FV3A 3ZSGA 3EH9A 1P5EA 4PMMA 4DAWA 5FP6A 4F0FA 3DOGA 4NZWB 5A4TA 2OH0E 4RWLA 4CFFA 2NO3A 4DITA 3KXMA 3TT0A 3R6XA 1KSWA 3CQEA 3GCSA 1PMEA 2C1BA 5EYDA 4AZVA 2IW6A 4QP4A 1B39A 4PL5A 2JD5A 2F7XE 2WMVA 4F65A 5F95A 1SVEA 3SXSA 5EHLA 4NM0A 4QP1A 3VS0A 3P7AA 1PRYA 4CMTA 2E9NA 4KKEA 3BU5A 3ZC5A 5BPYA 1U59A 4F9YA 5AV2A 3UYSA 3QRJA 2YJRA 5EW3A 3KVWA 4FOCA 3QRKA 4ZMEA 4G6NA 4MNEB 5EFQA 1OL6A 3OWKA 4NFNA 3FLNC 4YTFA 2ZB0A 3HAMA 2A27A 4R3PA 2XK9A 4FJVA 4GU9A 4XBUA 3HECA 4RFZA 4F9WA 5BVDA 3PG3A 3QKMA 3KXZA 5LVLA 2W1IA 4D0XA 4ENXA 5IU2A 1KWPA 5CLPA 4K77A 4P90A 3V5PA 4NM3A 2QU5A 4D58A 1BYGA 2I6LA 2QOQA 2R5TA 3L8VA 2Z02A 3MYGA 1M7QA 3FMMA 3MGYA 3QAME 4FSRA 3UIMA 3ML1A 4DLIA 4Z55A 3AMBA 4DT8A 1RQQA 2ZV7A 3SRVA 2FSTX 4FKJA 5HI2A 3VBQA 5HCYA 2XRWA 2OWBA 4IM3A 1SYKA 2R7BA 4KBAA 3U51A 4MYGA 4FK6A 4F1MA 2CN5A 1JQHA 5F1ZA 3DCVA 3S3IA 4C35A 2FVDA 3GFWA 4QYGA 3RK5A 4FR4A 3CY2A 5TE0A 3Q32A 5KMJA 2BDFA 2XVDA 3NGAA 3SOAA 3BE2A 3A4PA 5H8GA 4E5BA 4CTCA 3MFUA 3FHIA 3PTGA 3QF9A 4IJPA 4QMZA 1EH4A 4XHKB 2CKPA 1URCA 2ZDUA 2B1PA 5ANGA 4XV1A 4GL9A 5EI8A 4I92A 4C4JA 4TYHB 3QZIA 4YU2A 2OO8X 4YC8A 1TQMA 4U41A 4QMVA 4S30A 5BVWA 3FZPA 2VTIA 3E7OA 2YIWA 4M12A 4AOTA 5JZJA 5KMMA 3QD0A 4TW9A 3LKMA 3R9RA 2C6TA 3LXKA 1OIYA 2ITXA 2X6DA 1UWHA 2YIRA 3I4BA 3NCZA 4V0GA 5IKWA 4X7QA 3ZUTA 4EHVA 5ETAA 5CZIA 3TUCA 2WKMA 3L1SA 2XA4A 4XBRA 3QZGA 4JBOA 2PMLX 2BHEA 2GTNA 2OZAA 4IB0A 1GIHA 4NW6A 4MBJA 4ZXTA 3D14A 3VO3A 4YZNA 4G3EA 4LGGA 5D7VA 1YHSA 2Z7QA 2VWYA 2IW9A 4IIRA 3H4JA 2R3NA 3R01A 2WQNA 4OT6A 1H1WA 5EYCA 4R5YA 3TJDA 1V0PA 5IH5A 2XYUA 5IA1A 4C0TA 1Q41A 1URWA 4EHZA 3MSSA 3PY1A 1HCLA 2C69A 3QQHA 4JDHA 5FBOA 3AKKA 4DC2A 4RC3A 2XH5A 3NVMB 1WVYA 2QNJA 1UKIA 3HRCA 3WYYA 5EM6A 2XEZA 5IA4A 2ZMCA 2P2HA 5DR6A 3F3WA 3BE9A 4HPUE 3LMIA 4P5QA 1YI6A 4RJ7A 3EQPA 3UOKA 2O8YA 2X8EA 4DH5A 3Q04A 4GG5A 5DI1A 1U5QA 1XH7A 5AUXA 3VW8A 2CKOA 4KABA 3SLSA 2UZEA 3F7WA 3G51A 1KE8A 4FV8A 4DH1A 4EONA 3TDVA 4L53A 2BRGA 2R3PA 3ET7A 5HEZA 1YWRA 3K5UA 3OXTA 3FI8A 5JFXA 3A2CA 4I1ZA 3SX9A 2GHLA 5KNJA 4O4FA 4EH5A 3W2OA 4QP2A 4BDBA 2RSVA 4FV4A 5AX9A 4CMUA 3LJ1A 4GVJA 4L8MA 4WA9A 3KXXA 2RG5A 2Y4PA 5M08A 4M67A 4F7SA 3QCXA 2W05A 3IOPA 3VIDA 5JGBA 5IQEA 4WSQA 3CEKA 2BCJA 1M2QA 2I0YA 4FVRA 2WTWA 3U4UA 2GNLA 5JMSA 4I5MA 1J7UA 3ALOA 1YDTE 4ERWA 3L9PA 2JDTA 3DS6A 3W8QA 3MH0A 3BCEA 3DJ5A 4GK2A 4IX4A 4BIEA 5CALA 5EHOA 1PJKA 3V8WA 2X0QA 2VTNA 3ANRA 1QPJA 5CU3A 4AX8A 4D2RA 2R9SA 5ANEA 3K54A 3AD4A 3OWJA 2QC6A 5JQ5A 3ORLA 2JGZA 4BTKA 4ANOA 2PSQA 2C4GA 3MY1A 4XH6A 4C4EA 4AGCA 5L2TA 2BMCA 3EKNA 3FAAA 3EQRA 3FSFA 4GIHA 2V7OA 3PSBA 4FT9A 3E62A 3FZ1A 5CF8A 5AAFA 1NXKA 1PKGA 3MBLA 4TWNA 1JPAA 4XJ0A 2QQ7A 4BBEA 2PUIA 1JSUA 4RVTA 4XS2A 4TYGA 5I3RA 4QDEA 3N4UA 2ZOQA 2XP2A 4DT9A 3WF5A 4I22A 5M44A 4Q9SA 2VTOA 4MK0A 4AF3A 2O2UA 1Q8UA 5JRSA 2XJ1A 4Z9LA 4U40A 3F61A 4CRLA 4IVDA 3RK7A 4HGTA 3ZO1A 3R7UA 2J9MA 4M66A 4LV7A 4EZ7A 4UX9A 1KV2A 3SKCA 3W2SA 3TUDA 1MQ4A 3DB8A 5AUYA 1DAYA 3EFKA 4JX7A 2W5AA 4I0SA 5AJQA 3UVPA 4FIIA 4A4LA 3ROYA 4ACHA 1VJYA 4CFWA 4YPDA 1ZYJA 4JDJA 1Z57A 2YM3A 4IZYA 5T68A 5FG8A 1IA9A 5AP4A 2BZIB 5J8IA 4U80A 3MFSA 5HE2A 4AU8A 4HVIA 1L8TA 4IFCA 4GS6A 4BL1A 2IZUA 4EK5A 1OIUA 4O4CA 4BDAA 3LCDA 5LMKA 1LR4A 2PVKA 4CT2A 4ANNA 5J79A 4L7SA 3GEQA 4QMTA 3T8OA 3FJQE 3NDMA 3V01A 2QOCA 2IEWA 4M15A 2R3OA 5EQYA 1DM2A 3DFCB 3E63A 3SW4A 2B53A 3MVJA 4TKSA 1ZMWA 3G9NA 4KWPA 3L8SA 1ZZ2A 2XKFA 2WMAA 4M14A 1AGWA 3BGPA 3CY3A 3MTLA 4GK4A 4JDIA 1ATPE 4O4BB 3AC4A 3ZDUA 3TZ8A 4AN3A 3MFTA 5M4IA 5HIEA 5AUWA 5AA8A 2VNWA 5JEBA 1HOWA 3EN4A 3FMDA 1R0EA 3UPXA 4WBOA 1ST4A 4MBIA 4O7WA 4AW1A 4MHAA 4PDOA 2BFYA 3VHEA 3UP7A 2EXEA 4YJTA 4XNEA 5HVYA 3VS7A 4EYMA 3IW4A 4FTAA 1KV1A 5FD2A 3EJ1A 3S1HA 4B7TA 4M13A 4S33A 4XV9A 3MFRA 1NVQA 3HV5A 2BRNA 2JLDA 5FUTA 3FXZA 2P3GX 4DFZE 4BDDA 3ORIA 2BHHA 4QP3A 2I7QA 4Q5HA 3IG7A 1UU3A 3AMAA 4XMOA 3OBGA 5J95A 4J99A 4XRJA 2XZSA 3EFJA 4LI5A 4O1PA 3RPVA 4BDJA 4Z7HA 2R3MA 2ERKA 4FSUA 4JBQA 3ORMA 2X2LA 4I5HA 2O65A 4LRJA 4IDTA 5K9IA 3THBA 2QOBA 3JYAA 1W0XC 4MBLA 2A19B 3HVCA 3ZRMA 2DUVA 2GHMA 3GU4A 2QODA 4JI9A 5ANOA 2C6LA 2A98A 4RIYB 2H8HA 5EM7A 4HYUA 3U9NA 4D28A 1B6CB 3W1FA 3WI6A 4DGMA 3I6WA 4QPAA 4RVMA 3TDWA 4FT5A 4BCKA 4MXOA 3O23A 1CTPE 4PY1A 3BHYA 4BKYA 4XRLA 3HMPA 3V8TA 3EQDA 3PY0A 3HUBA 1E9HA 3VS1A 3C4WA 4DG0E 1OKVA 2FSLX 3QLGA 4XUFA 5EDQA 2G2IA 3AXWA 2YAAA 2FSOX 3P86A 4EBWA 5FDPA 3NFFB 3U55A 3D5XA 2V7AA 3LZBA 3V3VA 1Q61A 3P08A 2C6IA 5A6OA 4BRXA 3FEGA 2QR8A 4NH1A 3BV3A 4F1TA 4FGBA 5HE0A 2WZJA 2YM7A 4BCPA 3ZRKA 3W10A 2QO9A 3TNPC 2PZRA 2HZ0A 2NP8A 3MN3A 3KN6A 2X1NA 4JT3A 3MJ2A 3ZBXA 2V62A 3GFEA 2OJJA 2V0DA 2XARA 4DFBA 4RVKA 4AZWA 2UZUE 4MX9A 2X7GA 4X2KA 3KN5A 4II5A 3ZCLA 3ZLYA 3CGFA 5M51A 2YLEA 3W2PA 1G8SA 2F2CB 3R1NA 5BVOA 4FODA 4ZTHA 1Q97A 4AGDA 3FC2A 5K5NA 1Y8YA 3U8WA 4GYIA 3UQCA 4RJ5A 2W7XA 2CCIA 1XBCA 4CEGA 2WFYA 3M1SA 3HV3A 2WTJA 3GP0A 4JG7A 3JY9A 1PXOA 4FV2A 5AUVA 4U3YA 5FLFA 3D9VA 4HGEA 3VWAA 2UZLA 3HV6A 3C1XA 4EHEA 3BZ3A 4USFA 1OBGA 2WQMA 1I44A 3QX2A 1ZOGA 4DFLA 4QMUA 1M2RA 2W96B 5IQHA 3UO6A 3KRLA 4O96A 4PX6A 4ACMA 3UOJA 4O7NA 2WNTA 1H1PA 4UXLA 3AC3A 3C4XA 4QT1A 5HE1A 3CD3A 4YJUA 3OUKA 4WHZA 4WNKA 3GCQA 1R1WA 1VEBA 4FTUA 4IAAA 3TJCA 5E8VA 3U6HA 4EH7A 1W7HA 3B2TA 2UVYA 4ALVA 2EUFB 2X7FA 3CJGA 3O8PA 3BIZA 2F7EE 4KS8A 4FC0A 1WZYA 5E8SA 3V5QA 4FUYA 4FICA 4IMYA 4C38A 5J5SA 4C36A 3R71A 4I0RA 4QMQA 2C5YA 3CPBA 3UDBA 4AQCA 4EQUA 4PL3A 1S9IA 5DG5A 2GHGA 2VO7A 2Z7SA 1YW2A 3POZA 2PPQA 2G2FA 2C3KA 4GV1A 4H36A 4Y85A 2XNEA 1GAGA 4BI2A 3BBTB 4AGWA 4J7BA 1SVHA 3ZXTA 2X9FA 3W0NA 3W0PA 3KRXA 2YJSA 3HDMA 1OITA 3ZHPC 1JWHA 2OF4A 2VWUA 3R21A 4U97A 1P4OA 3R9NA 3ZONA 4FUXA 1M2PA 5TKDA 3SVVA 2EXMA 3R00A 3IK3A 2OU7A 3BBWA 3R73A 3D0EA 4LUEA 3EFLA 3KQ7A 4A9YA 4EUTA 5HTIA 3C7QA 1K3AA 4LV8A 3NWWA 3RWPA 4AZFA 4EWHA 2PULA 2Z7RA 2RKUA 4DGLC 3HRFA 5IEVA 4EKKA 4JOAA 4YZ9A 5IEYA 4PP9A 4RIWB 4M8TA 4YZCA 4C3RA 5HORA 1FBNA 2Y9QA 2YERA 1XBAA 2P2IA 3C0IA 3BL7A 5M4CA 5HBHA 4FEXA 1Q4LA 4MTAA 3W32A 1NY3A 4BB4A 3AC8A 3LE6A 3KMUA 2UZBA 3QHRA 4QYYA 3LQ3A 2HY0A 2C5OA 5CEKA 2HY81 4BCFA 5CAVA 5BMMA 3P9JA 1U46A 2X8IA 4QP7A 2J0JA 4PPBA 4FTNA 3O51A 2XCHA 3HNGA 4F0IA 2A0CX 5IG1A 3KFAA 2JIIA 4W8DA 1PXIA 5C9CA 3HDNA 2QD9A 5I9ZA 3QTQA 5L2WA 4JXFA 4CXAA 3ZH8A 4FKQA 1ZYCA 2BRHA 2OJGA 3QC4A 3JR1A 5C4LA 2KTYA 1GIIA 4EI4A 2WTCA 4MXAA 4EUUA 1ZWSA 2WEVA 3W55A 4IDVA 5TF9A 4U43A 5DE2A 4CKJA 4BFMA 4BCNA 3JUHA 1JLUE 4R7HA 5AP7A 5L2QA 4JJRA 4WNMA 1YDRE 4YTHA 3R7YA 4YTCA 3DAKA 4BCJA 5I0BA 3KK9A 1WBWA 3N9XA 4IZ7A 1F0QA 1MUOA 5FDXA 4WO5A 2BFXA 4I23A 5GJGA 5CU6A 3LVPA 2QLUA 1Y8GA 4FBXA 4HW7A 5HX6A 3R8VA 4V01A 3T3UA 4DBXA 5HCXA 3F88A 5CEIA 3FY2A 3LIJA 3KF7A 2YLFA 4W4WA 5DBXA 5B2MA 4BY9E 4WRGA 4F64A 5IQCA 4BWKA 3AMYA 3DBFA 3KMWA 3UG2A 4EOJA 4J97A 3GCVA 4IWOA 4RIXA 4TL0A 5CAQA 2UW8A 2BKKA 2PZYA 2OGVA 3NUSA 3BI6A 4DTBA 4BWPA 4O1OA 1V0BA 3I79A 2QURA 2GNFA 3GOKA 4X21A 5AWMA 5HESA 3VUHA 3EZRA 3KRWA 2Q83A 5BNJA 5M57A 3GXLA 4MQ2A 1VLRA 5EKNA 4AACA 4XG3A 1PXLA 2PY3A 1NVSA 4PDSA 5LCJA 3UNKA 1YOMA 2OIBA 3Q3BA 4QQCA 3R9DA 4BDIA 3AKJA 4RGJA 3MTFA 2G2HA 2J0MB 4Y8DA 4AUAA 3A7GA 1JOWB 4XLIA 4JG8A 3WZDA 4QMNA 3TKHA 3V8SA 4AAYA 4F9AA 4S34A 1BLXA 2QOLA 1W82A 3FE3A 3MI9A 2XK7A 2O64A 3G6GA 3Q4CA 2ERZE 3O8UA 4F7LA 3NAXA 2CJMA 2QLQA 3HRBA 3EMGA 3G33A 4CCBA 4I41A 1GNGA 3CTQA 3O7LB 5HQ0A 4APCA 4AA4A 4IWPA 4K2RA 4EQMA 5E92A 3LAUA 3ORNA 3P4KA 4L7FA 4RA5A 1LEZA 4ENYA 5CSWA 1S9JA 3A62A 4IADA 5K5XA 3UZRA 3RAIA 3BEGA 3BU3A 1VR2A 4YBJA 2W5BA 2EVAA 2WMUA 5AA9A 4LDTA 4HCUA 2HENA 3P78A 3KU2A 2Y6MA 4QMPA 4JQ8A 5CTPA 4G5PA 5E1SA 3HV7A 4YGAA 4PTCA 5E9EA 3LMGA 3CLYA 4ANBA 3PZHA 4E73A 3F2RA 2EU9A 5C4KA 4AQKA 2X7OA 1YRPA 1LEWA 1STCE 3GBZA 2XKEA 2C6MA 3D15A 4RQKA 5DLSA 2GU8A 3TKIA 4FTMA 4CZTA 2GDOA 4RT7A 5AM6A 3JVSA 5AP0A 5EDPA 3E87A 4FKIA 3WBLA 4DGGA 2RFEA 4AFJA 5EI6A 5C8MA 3RHKA 4MXZA 3CP9A 3VBWA 4AP7A 4I6LA 4U7ZA 1REJA 3FI2A 5FEEA 3PIZA 4D1XA 2LAVA 5IA3A 2WTDA 5ANIA 1OKYA 2OIQA 3R7OA 4Y46A 4HPTE 3R0TA 5LVNA 2YABA 2ITPA 5D12A 3RKBA 3WIGA 3NZ0A 2PMOX 4X2GA 1XH8A 4GFGA 4UXQA 5E90A 4IQ6A 4EC9A 4YHFA 4CT1A 3D83A 4LRKA 2C3IB 2UZNA 2CCHA 3GQIA 4L68A 3Q2JA 4F78A 5J7BA 2PMNX 3AKLA 4C4HA 3DNDA 3II5A 4BIDA 4XEYA 4KBKA 3MJ1A 3VBXA 2YZAA 3QD3A 3DLSA 4DHJA 4XV2A 2B55A 4I4FA 3OWLA 3A8XA 4J1RA 4QPMA 4C61A 5M07A 2OXYA 4G9CA 4IC8A 4FX3A 1XQZA 4I6HA 5BVEA 2HWPA 3F5PA 4JR7A 3KXHA 4ZEGA 3RZFA 1GZKA 3ZFXA 4YNOA 4HNFA 5AR4A 5BVFA 4I93A 5EM5A 2ONLC 3EN6A 2C30A 1ZOHA 4I94A 4IHPA 3F5XA 3F9NA 4KRCA 3QRUA 4U42A 2XKDA 2ZM4A 4PMSA 5DT4A 4HNIA 3SRVB 3G9LX 4YSJA 3UQFA 2G9XA 5A4LA 3B8RA 2JKKA 2CSNA 4UY9A 3UBDA 5ETFA 4BIBA 1GOLA 4YR8A 2IVVA 5HG9A 1ZYDA 4FNYA 2QO2A 2VU3A 4FMQA 4LFIA 1OMWA 2YDKA 3UOLA 2W1DA 2BIYA 2F49A 1YXUA 2FH9A 4C33A 4CFUA 1REKA 2NNWB 3BL9A 4F7JA 4L6QA 3R9HA 3B8QA 4ZJVA 5L2IA 1Q24A 4FV0A 2DQ7X 1RJBA 4HVDA 4NIFB 3BGQA 4YLKA 2XJ0A 4Y5HA 5CNNA 3UC3A 3WZUA 3A7JA 1CDKA 2XIKA 2CNUA 3HEGA 3BLRA 4O91A 3PY3A 4QP8A 5DEWA 4EH6A 4N4SA 3HZTA 5J1VA 4ERKA 2G01A 2UV2A 5CX9A 1M17A 4P4CA 1ZLTA 2VX1A 4DHIB 2GCDA 3VUDA 5CSHA 4YUQA 4FTIA 4BHNA 1O9UA 5C8KA 3CS9A 4IAYA 1Q8ZA 3QUPA 2NRUA 2AQXA 1FGKA 3VRZA 4G3FA 3OWPA 2W1EA 5D11A 3TNQB 3REPA 2OZAB 5GHVA 3O17A 4R7BA 2YACA 4AAAA 4ZTNA 1M7NA 3VS2A 4D0WA 4HGLA 4NUSA 2BTRA 4D5KA 3P5KA 3FLQA 3FQEA 3RM6A 3PP0A 3IW7A 1Q62A 1ZYLA 2GTMA 3F5GA 3QZFA 4I24A 4MVFA 4G3CA 3V5TA 2W4JA 4X3JA 4A9SA 5CSPA 3PJ1A 4WSYA 2XAOA 4RWJA 3TZ9A 1Q3WA 4DINA 2XALA 4CFXA 4GCJA