3OS0A

Pfv strand transfer complex (stc) at 2.81 a resolution
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
365
structure length
365
Chain Sequence
AELDQLLQGHYIKGYPKQYTYFLEDGKVKVSRPEGVKIIPPQSDRQKIVLQAHNLAHTGREATLLKIANLYWWPNMRKDVVKQLGRCQQCLITNASNKASGPILRPDRPQKPFDKFFIDYIGPLPPSQGYLYVLVVVDGMTGFTWLYPTKAPSTSATVKSLNVLTSIAIPKVIHSDQGAAFTSSTFAEWAKERGIHLEFSTPYHPQSSGKVERKNSDIKRLLTKLLVGRPTKWYDLLPVVQLALNNTYSPVLKYTPHQLLFGIDSNTPFANQDTLDLTREEELSLLQEIRTSLYHPSTPPASSRSWSPVVGQLVQERVARPASLRPRWHKPSTVLKVLNPRTVVILDHLGNNRTVSIDNLKPTSH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Integrase
publication title The mechanism of retroviral integration from X-ray structures of its key intermediates
pubmed doi rcsb
source organism Human spumaretrovirus
molecule tags Recombination/dna
total genus 103
structure length 365
sequence length 365
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2010-09-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
A PF17921 Integrase_H2C2 Integrase zinc binding domain
A PF18103 SH3_11 Retroviral integrase C-terminal SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2300 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3os0A04
1.10.340.70 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Endonuclease III; domain 1 3os0A01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3os0A02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3os0A03
2WONA 2GF7A 1NK4A 4L59A 4DQQA 4ZHRA 1VSEA 1C6VA 2RHIA 3ZEHA 2QXFA 1CXUA 4FL6A 2YKNA 3SV4A 4E7KA 3HL8A 1IKWA 1KSPA 3L2RA 1SSFA 1JL1A 1VSHA 1NK0A 3LPUA 5D6XA 1TL3A 1RDDA 1QSSA 1T03A 3V9WA 4K8XA 4DU3A 3VN5A 4IBNA 5EU7A 4B3OA 4CFBA 2LDMA 3VQ6A 4CEDA 3PMIA 3TAFA 3KD5E 3NF7A 2E4LA 3PO5A 4O5BA 2RJDA 4C8OA 5KCHA 4DU1A 1RT5A 4CJ3A 4GVMA 3P1GA 4BDYA 4B9WA 1OZ2A 3SQ1A 3SD4A 3OY9A 3TARA 1SL0A 4KV8A 1NOZA 3AVKA 4B9SA 3MP6A 2HHSA 2L8DA 2JTFA 2D5RA 1WAFA 4ELVA 4RW7A 3HXMA 2O4XB 1S1TA 2HNZA 2RN2A 4B9XA 3KJVA 1RT4A 1H3ZA 3RMCA 4PLIA 4OGEA 4OLBA 4RW9A 3OYDA 1UOCA 3O3GA 3UT1A 3AVBA 2PY5A 1ZBIA 4NZGA 3HO1A 3OYFA 2P1JA 4LD0A 1EKEA 4RG8A 2BGGA 3TANA 4OVLA 3DM2A 3H8ZA 4DSEA 4CIFA 3TAEA 4J2EA 4DQIA 2LSNA 1RTJA 1TK0A 4LSNA 3LP2A 3WNHA 3OVNA 4IFVA 5CY4A 1RNHA 4FM0A 2R57A 4CGIA 5D6YA 1RCHA 1T05A 1FKOA 3DB3A 1G5VA 4OJRA 4FJJA 1KVAA 2QKBA 4FJ5A 2PQWA 3QBYA 5J1EA 1KFDA 4W5NA 4CF8A 4J2AA 1XNIA 1QS4A 2HB5A 1XWLA 2D9TA 3IS9A 1WAJA 5D3GA 4CJFA 2KQ2A 3O3FA 2I5JA 3MEGA 3L2WA 1TKXA 3SQ4A 5KRSA 4FK4A 1VSKA 3NNQA 1EETA 5I42A 3VQQA 2X6NA 4EP4A 3OYAA 5J39A 3KLIA 2X4XA 4CJLA 4M45A 1TKDA 4NCBA 1D8YA 4FM2A 4Z4CA 1R0AA 3OS1A 1XHZA 1FKPA 4PQUA 1VSIA 3U3YA 5CYMA 4E7JA 1QTMA 1IKVA 5J26A 2LCCA 3EY1A 3QEXA 3KLFA 2B5JA 1UWBA 4CIEA 3KIOA 3FEOA 4RG2A 4FVMA 3ZSOA 1RBVA 3L3UA 3AVGA 4FZZA 2G8UA 5M9OA 2W42A 4CF0A 3AVMA 3D45A 4DQSA 1DTQA 4O55A 1IG9A 2JZ2A 3K5LA 4E0DA 4Z02A 4FJMA 3ZSYA 2RPIA 4FLVA 4FLUA 3BDLA 3QERA 3MO8A 4IUPA 1LWEA 3TAGA 3ZSRA 2YRVA 3DOKA 4FCYA 4H4MA 4HUEA 3AO4A 3QEPA 1EXQA 1YTUA 1D5AA 2RI2A 1JXEA 2YNHA 4E7IA 1UAXA 4N76A 3LP0A 1QSYA 2NLUA 3SJJA 2OYQA 3LLRA 4CK3A 1JLBA 4KREA 4BDPA 1S1XA 3QKJA 3K59A 3V4IA 4I9QA 3SUQA 4O44A 1CXQA 2OPSA 2P0KA 1TK8A 1IKYA 1W9HA 1U45A 1X9SA 4F2SA 4F8RA 4HVJA 1JLCA 1KVBA 1WSFA 3MEUA 3ZSVA 4OKJA 3T1AA 3QINA 2OZSA 2G8FA 4CESA 1NJYA 1GOCA 1RILA 3NH2A 4RW6A 4BD3A 4A4FA 1WJSA 4GY5A 3P83D 2XDPA 3E9GA 3NF6A 3CFOA 3AVCA 3TI0A 1U49A 5DK5A 3NTHA 4KI4A 4EZ9A 3MAQA 4DS5A 4DSLA 1HYSA 5K14A 1I39A 1K6YA 3DYAA 4KKOA 4E3SA 2VWJA 4HTUA 2RI3A 1SL1A 3HVTA 5KRTA 3LWLA 2IOCA 2M16A 1ZBHA 3HPGA 3VQ8A 1CLQA 1HQEA 3P8HA 2PYLA 2RKIA 4WE1A 2RJFA 3AVAA 2R5AA 5KGXA 3NH0A 3HT3A 1EP4A 1HNVA 2D0CA 4HHTA 4EDUA 2O4GA 3VQDA 4BE0A 2GUIA 4GMJB 3LX7A 4PA1A 5J2MA 4KHYA 3L42A 1NKBA 4QQ6A 2DY4A 4H8KA 4M3UA 4N4IA 2RJCA 4DFMA 1SKWA 3ZSWA 2F5KA 4DTSA 3KLEA 3C4SA 3BGRA 4C5EA 4CJQA 3VQ4A 4FLZA 4CECA 4QCLA 3AO2A 3SQ0A 1NKCA 3CQ8A 1KHCA 4CIGA 1C0TA 1KLNA 3S3MA 4EP5A 2G8HA 2KFNA 4FW2A 3PX4A 4DTNA 4IUTA 4A4GA 4CFAA 4YNQA 2RHUA 2QQSA 2ETJA 3OMGA 1GOBA 4MFBA 2A1SA 3DMJA 3SYZA 3RRHA 1LAWA 3NTIA 5D6WA 2IDOA 4F4KA 1BL3A 4AHRA 2ZQBA 4O0JA 2OA8A 3KKSA 4GW6A 4CF2A 4NCGA 1MHNA 2LTOA 1L3SA 4OLAA 3S6WA 3AA3A 1U04A 2HHWA 4C8MA 2O4IA 3KK3A 3NBPA 4DG1A 4KTZA 3HP6A 1HMVA 3CG7A 3KK1A 2IG0A 4DFKA 3MXMA 4Z4EA 1HRHA 5KE3A 1U4BA 4CF1A 3OYCA 3DLKA 2HW3A 4PL6A 2IGIA 4KRFA 4Q5VA 4LSLA 3OJSA 1B9FA 5HRRA 3RTVA 3DLEA 2P5OA 1JLGA 1WSIA 4CK2A 4ZTFA 4FZXC 2ZD1A 3OA6A 4ICLA 4AHUA 3QESA 2Z1GA 2HHTA 4CK1A 2LRQA 4AHTA 4CHQA 3OYIA 1RDBA 5DMRA 2DTUA 4W5RA 1O1WA 4N4HA 4QAGA 2F8TA 4ELUA 3MXIA 3VQEA 3V9SA 2OPQA 3QEIA 2PZSA 1NOYA 2RHYA 3L2UA 4CGJA 1BCOA 1YVUA 3ZT0A 1RT3A 3KKRA 2OPRA 4FJIA 1KLMA 3T19A 4M3WA 3C6UA 4LH5A 4EZ6A 1ZBUA 2QK9A 4FJ9A 3QIOA 3NGZA 1ZYQA 3V1OA 3LWMA 3RMAA 5E41A 4W5QA 1NK5A 1LW0A 1TKZA 3TR8A 3MP1A 4CJTA 4ID1A 4B9TA 2MWPA 5CZ2A 3IG1A 4FJXA 4OPJA 3H08A 4BDZA 1N6QA 2HVHA 1IH7A 2XK0A 4CJVA 4O4GA 2YNFA 1C1AA 3TAQA 1ASUA 2KZMA 3V9ZA 2X4YA 3AVIA 1S6PA 4B08A 4F2RA 2HNDA 3M9QA 1HNIA 3PX0A 1EX4A 2E6NA 4HUGA 4QQDA 2HQEA 2BE2A 1VSMA 2JLEA 1NKEA 4JRPA 3PX6A 4CF9A 3M8SA 3AO1A 2R58A 3QETA 3CEYA 2FBTA 3QEWA 3TAMA 2FBYA 4CJ5A 4KHUA 4BE1A 4PUOA 3HSTB 1SKSA 3DB4A 3V6DA 4CGFA 3HYFA 3DLHA 1CZBA 2BIVA 1MU2A 3M8QA 4FJNA 4E1NA 1D9FA 3DLMA 3KUFA 3JYTA 5KGWA 4QOZB 3CYMA 3AO5A 3G0ZA 4CJSA 3MEWA 2YKMA 1HYVA 1XHXA 3MEAA 3C94A 3THVA 1S5JA 2L89A 2EFIA 2XY7A 3QNNA 1BI4A 1UA1A 1RT2A 1JLQA 2Z1HA 2XHBA 4FJHA 3RRGA 3EAEA 3K5MA 2B8AA 4DTJA 4CEQA 4NCAA 3LZIA 3SCXA 3DRSA 2YNIA 4CJWA 1RTDA 4IUQA 2FBXA 4Y1DA 1NJZA 3OB9A 2RF2A 4CHYA 4FJ8A 1S9GA 1VSFA 1OI1A 4CERA 3HK2A 4FYDA 3LP1A 3SUPA 3F9KA 2WOMA 4DU4A 2DFEA 3LAMA 4E19A 5C0MA 3AVNA 4CGGA 4DTOA 1FK9A 3S3NA 3VQBA 2BKDN 4CFDA 2DIGA 2QKKA 3B6PA 2HVIA 4B9VA 4KHQA 3H6ZA 2RHZA 1KTQA 2RO0A 1JXBA 2K3YA 4IFYA 3NGYA 4OKEA 3CFPA 1DLOA 1T8EA 2P51A 1NK8A 3MEEA 3I0SA 1C0UA 1UA0A 3E9FA 4F3TA 4HCBA 1BQNA 1SKRA 5JS2A 2CKKA 1A5VA 4CGDA 3C95A 2FHDA 2VG6A 3PMTA 3EYZA 5C25A 3VQ9A 4DMNA 4JRQA 1RTHA 4C5HA 3K57A 3ULDA 2O4XA 1BGXT 3B6OA 3L3VA 4K8ZA 3P8DA 2OPPA 2JGUA 5J2NA 3QJ6A 3LYIA 3LP3A 3Q1JA 1J9AA 3AVFA 1Q9XA 1NK7A 4PWDA 3HPHA 1WSHA 4CEFA 4X34A 4DQPA 3DOLA 4OGCA 3LH0A 4CJEA 2OZMA 3OYMA 3ZSXA 4Z4GA 4FU6A 1WSJA 1WSEA 3NAEA 3SZ2A 4FK2A 4AH9A 4M3TA 3TAPA 2HHXA 4QW2A 4LY7A 1HJRA 2XY8A 3D0PA 3QIPA 1A5XA 3SV3A 1KRPA 3MECA 1NK9A 3L2VA 3LDSA 5HRSA 3MEDA 2X78A 2GFUA 4FLXA 3M8PA 4IDKA 3NH1A 4DS4A 1Q8IA 3OYLA 4N47A 2HMIA 1ASVA 4C8LA 4CJPA 3WNGA 3ZT3A 4O0IA 3LGLA 1YTAA 3M8RA 4PY5A 3OYEA 4Q5WA 1C0MA 4LH4A 4Z4IA 3PFSA 2D0BA 3OS2A 2EQKA 3OS0A 2DFHA 2YHAA 4B9UA 1OYXA 3F70A 3PUFA 4E89A 3RWUA 4BACA 3O3HA 5SWMA 3OYGA 3AVLA 4Z4FA 3FFIA 2DFFA 4FJKA 2EQMA 1RBUA 1S1WA 2E6MA 4FLWA 5HRNA 3NF8A 3FC3A 1LAVA 4N5SA 3RR7A 2YNGA 1CZ9A 4BWJA 2F8SA 3ISNC 2GV9A 4M41A 3CM5A 1TVRA 1RBTA 2G8WA 3E01A 1J53A 4HCCA 4KHSA 1J54A 3OYBA 4ID5A 4IG3A 1FXXA 3OMCA 4I2PA 1KCFA 4CHPA 4E7LA 1NJXA 1JLEA 1BISA 4N4GA 3QEVA 2KFZA 4Y1CA 1RT1A 1TAQA 1S9EA 3LGFA 4IUVA 4DFJA 2EHGA 4DLGA 5T7BA 3MEVA 4YFUA 5KE2A 1RBSA 3HP9A 3LANA 4C8KA 1VRTA 4DSIA 4KPYA 2HNYA 3AV9A 1WGSA 2VG5A 3NCIA 3OYJA 2D0AA 3S3OA 4M3XA 3LAKA 1RT7A 4KTQA 4FM1A 5J2QA 1VK0A 3V9XA 4DQRA 5FROA 3ZT1A 3HM9A 3V9UA 4Q0BA 4F3OA 4IURA 1TV6A 3ZSZA 2ATQA 3SI6A 3ZCMA 4BE2A 3OJUA 1BIZA 3QIIA 1BQMA 4DTUA 1VSDA 1RTIA 1BIUA 3META 4CJKA 1XI1A 5IN1A 2A1RA 4KAZA 3AO3A 1B92A 2FBVA 3PV8A 4RW8A 2Y1JA 1C1CA 1DTTA 2MWOA 1L3TA 4FLYA 1WJRA 4NYFA 1VRUA 2G8IA 4I7FA 5CYQA 1JLAA 3ASKA 3TWHA 1HYZA 1L5UA 3DRRA 2KZZA 4W5OA 1SL2A 3K2PA 3ZT2A 3VA0A 3OYKA 2BANA 4DTXA 4IKFA 3DRPA 5C6SA 4NS5A 4CJ4A 4QVZA 4KB1A 1BHLA 1N27A 3KLGA 4R5PA 4CRIA 4E7HA 3NF9A 4FW1A 4B8AB 2ZE2A 4DTPA 3NGIA 3NTKA 1HPZA 2P5GA 4DLEA 3SPZA 1IO2A 2R5MA 5C24A 1F21A 2X74A 4CE9A 4LD6A 1U48A 4KI6A 2E5QA 3WNEA 4DTRA 1WSGA 2E6LA 4M42A 1Y97A 1SUQA 3ZSQA 4I9LA 1TGOA 3K58A 1TAUA 4KFBA 2Q3SA 3QLHA 2IS3A 2DIQA 4M3RA 2XY5A 3SNNA 2XRIA 5JS1A 1A5WA 4L8RB 2HHVA 1QSLA 4M3ZA 3VQAA 3KK2A 4CEAA 4C5GA 1L3UA 4TSXA 2DAQA 4HCZA 3C6TA 2AJQA 2ITGA 4Z0UA 1JKHA 3VQ5A 4B9MA 1WJQA 3NFAA 3T3FA 5J2PA 3VQ7A 1W0HA 1J5OA 4DF8A 3OYHA 2RJEA 1IKXA 3PNWC 1WN7A 3IRXA 4CFCA 4DFPA 3FDRA 2K3XA 2LVMA 3HJFA 3SQ2A 2G8KA 2WACA 4CEBA 2HQXA 4N56A 4DF4A 5HLFA 4CHZA 4FK0A 4CHOA 2XO7A 1KVCA 4QQGA 4AHSA 4CEZA 2XY6A 2KW4A 3KLHA 3DLGA 1XC9A 1Z26A 2Y1IA 4CJUA 4ZTJA 1SV5A 4CJRA 4JS4A 3PO4A 3IAYA 5HRPA 3P5JA 3FLGA 2EKOA 3PY8A 3I8DA 3RMBA 4II1A 3VA3A 2EQJA 4OPKA 4FXDA 3NHGA 3NDKA 2X35A 3V1RA 1RI0A 4FZYA 4OKKA 4OVAA 2VYTA 1RDCA 4KHNA 3HPOA 1TL1A 3WNFA 2NUBA 1RDAA 1X1PA 3K5NA 3S9HA 1VSJA 4AHVA 3AVHA 4CGHA 1S1VA 5HP1A 4JLHA 2X6SA 3GOXA 5HROA 4IUUA 1BCMA 2RHXA 4PLLA 3O4QA 2IAJA 3V81A 4HUFA 3V1QA 3A2FA 3UIQA 3LPTA 5SZTA 1LV5A 1VSLA 3BDPA 1NJWA 3G10A 4IG0A 3HVRA 1LWCA 4DWIA 1REVA 4FLTA 4J2DA 5IAYA 1LW2A 3MP8A 2GFAA 3KD1E 3UWNA 2PYJA 1U47A 3LALA 1HQUA 4CEEA 3JSMA 2R7YA 2F96A 3ITHA 4E1MA 3VQCA 3QO9A 2VG7A 3SUOA 5C42A 1Z25A 4XIUA 4BWMA 4B8CA 4CHNA 3CM6A 4Z4HA 1JL2A 1X9WA 1T7PA 4DSJA 2YHBA 5KH6A 1QQCA 4AHCA 1WNSA 1QE1A 4UQGA 1ZBFA 2HHUA 4N41A 3AA5X 2HHQA 2RI5A 1D9DA 2BDPA 3DLBA 1OZ3A 5HBMA 4FJLA 4RW4A 4MQ3A 4ELTA 1C1BA 4KO0A 1S6QA 3AVJA 1I3AA 3QNOA 3RR8A 1YT3A 2QQRA 4DSKA 3ME9A 1KFSA 3U6FA 2X4WA 2M0OA 1ASWA 4J2BA 3DLRA 2M1HA 2L3RA 1JLFA 4C8NA 1LWFA 3F73A 4C5IA 1QHTA 3I0RA 4UC4A 4B9NA 4KHWA 3EZ5A 1RT6A 1Q9YA 3AA2A 4G1QA 1X9MA 1WLJA 4CEOA 2FC0A 3MXJA 2GBZA 1TKTA 3L8BA 3KTQA 3O4NA 1ZBLA 4A4EA 3O8VA 3NE6A 2G3RA 3ALYA 5I3UA 3DI6A 2EQUA 4W5TA 1GOAA 2Z1IA 4NYNA 3SUNA 3K5OA 1S1UA 4DSFA 3OQ5A 1NK6A 5FRMA 2B6AA 1ITGA 2BUDA 2YV0X 4H4OA 1B9DA 4FJ7A 3CFRA 3L2QA 5KCOA 4M3YA 2G8VA 4CCHA 3LZJA 1RBRA 3U3GA 2B4JA 1G15A 1N5YA 5KI6A 1TK5A 5CIUA 4JS5A 3TABA 4FJGA 3SPYA 4I2QA 3ASMA 4DTMA 2EX3A 5KTQA 4KB0A 3ZT4A 4AILC 2IC3A 5CZ1A 2KTQA 5FRNA 2Z1JA 1BI4B 3OYNA 1L3VA 3AA4A 5FDLA 4A4HA 4KTWA 3VQPA 3RMDA 4B9LA 2VWKA
chains in the Genus database with same CATH superfamily
3I56Q 1UHWA 2FZGB 1NK4A 4DQQA 2E1HA 5JVHL 4G9YA 1RETA 3GCMA 3C7NB 3AAQA 2AHQA 2ZPGB 1CXUA 4LF6K 5CKTA 5JI6A 4GYGA 4BI3A 4FWMA 1GVDA 3SV4A 4E7KA 1ZRCA 3HL8A 1M1EB 3HKZN 2JXBA 4A53A 5FU7C 2IVWA 1NTCA 2EQIA 1YJ9N 3JCMW 4WX9A 2KAFA 4YOUA 3TEDA 1NK0A 3S1NJ 4FASD 1M2VB 1ZUUA 5FW9A 2BZYA 3U9DA 2E12A 1T03A 1X6OA 3VRZA 3C18A 4DU3A 3HHTB 1KU7A 3O8GA 4CFBA 4XOTA 1WBBA 5E20A 1FMWA 2XGEA 1EH8A 2XPVA 2E4LA 1ZSZB 2E70A 1OJLA 1IZ1A 1KFZA 2P9NA 1MMDA 4XM3A 4GVMA 1VQLI 4IHXA 2LNVA 4B9WA 1E3PA 3SQ1A 3SD4A 2YLCA 1SL0A 2FNAA 4D7MA 4DGWB 5C3EJ 1TUUA 5I21A 4KV8A 4HXJA 2JJ7A 1JJ8C 5I2MA 3M59A 4RTTA 2JTFA 1U5TB 3HZJA 1R5GA 3D2FA 3FWEA 3HXMA 1GVJA 3M4GA 5AQLA 2UXBK 2HNZA 3CCJN 4B9XA 4M6YA 2H1KA 3CCRI 1P59A 4FSSA 2JPBA 4PLIA 4LMYA 4RW9A 1Z6RA 3QDFA 2PY5A 2DRMA 4BS9A 1ZBIA 2EJ9A 2EZLA 4IO9F 5B3SH 4F93B 1YI2I 1M8MA 4LD0A 4RG8A 1NJIC 4FQGA 3CQYA 3H8ZA 2Y90A 1D8KA 2HEOA 1LNWA 1B6AA 1RTJA 2CUJA 4LSNA 3LP2A 3OVNA 2JRMA 3GDQA 3O1BA 3TTDA 3FM3A 3QHSA 2QSGX 1VQOT 2R57A 5D6YA 1X3WB 1RCHA 1XSDA 1UJ0A 4XN0A 3I4NJ 3DB3A 2K5FA 1G5VA 3H3NO 5M1KA 2VONA 1OCTC 2QGUA 1AOYA 1UDLA 3RPQA 1XJWB 1QVFS 5GAMh 4WQ5C 4CF8A 4L9TA 4BAYA 2MCNA 4JZ4A 1QS4A 3W0LA 4NC7A 2Q0OA 3DAWA 4J7IA 2DQLA 4AT1B 5GANd 5K5OA 4ILJA 1PD0A 1Q81U 1R59O 3O3FA 3A2KA 3L2WA 5BR8K 1FP2A 5KRSA 4QTRA 3NNQA 2HBMA 1YITN 1Q7YU 4L5GA 4OP0A 5H2FC 2EFQA 4IX7A 2DK8A 1VQ5A 3KLIA 1IZ6A 3O9TA 2K4JA 5M5XJ 5J1UA 3GLXA 1TKDA 3NVKA 2LC4A 2KDZA 1WHMA 3BG9A 5KQ8A 3ECOA 3HEFA 3BDUA 2KYMA 4XLCA 4PQUA 2O61A 3MN5A 1XGNA 1AA7A 3U3YA 1UECA 1QTMA 3BR0A 3EY1A 1WNLA 3CJTB 2V9KA 2B5JA 3M58A 5JLXA 2Q8KA 3CJ7A 3O3KA 3WTXC 1XQOA 5GMKm 1D0XA 3D0SA 1HW5A 3VEYA 3A1PA 1M27C 4C92F 4FZZA 3R4KA 3CF2A 1SQKA 3WHBA 2W42A 4WFNL 2QI2A 4R1HA 3D45A 4C8QD 1JJ6C 3WG9A 1DTQA 1IG9A 5F0XA 4Z02A 2FU4A 2F6CA 1X1DA 2CSIA 2R92J 1AU7A 2JMAA 3ZSYA 1AEYA 3CO6C 2RPIA 4FLVA 1VQMN 2M34A 1VQNA 2XKOC 4EJVA 5BPNA 3QYHB 1IV8A 3QP5A 1Z9QA 5HCKA 4BRPA 3DOKA 5HLGA 1HKQA 2A42A 2ZGYA 4BR7A 1N9SA 1EXQA 2DMQA 2P7VB 4S04A 2NUPB 2OTJN 1MMGA 1RZ4A 2YNHA 4JI4K 3ZFJA 3BT9A 1VHXA 4XSXF 3LP0A 3VEOA 2DMOA 3H5RA 1R1UA 3AY9A 4IHSA 4CK3A 1JLBA 1OCRH 4KREA 1S1XA 5K1YA 1PUEE 4I9QA 3LSPA 2D1VA 2MABA 3H9GA 2FZCB 2OPSA 1OPLA 2P0KA 3T1BA 3SFZA 2E60A 1LMZA 1X9SA 4XLFA 2EZIA 1KU9A 2XF5A 5EG0B 2MG4A 4CZJA 4B9QA 1ETVA 4C92E 3CCVA 4LK0F 3THYA 2MA3A 3KP3A 4ZDOA 1IN8A 2YUQA 1BR4A 3M6GA 3G6EA 1NJYA 3NH2A 1RILA 2A28A 1U2VA 4A4FA 4OIOF 2XC7A 3CWUA 5AFUH 3TEEA 1RUOA 4LUDA 1X43A 2DI3A 2PTKA 1Y1VJ 4J8FA 1U49A 3FHGA 3NTHA 4KNYA 2WY8Q 4QT7A 1N33K 2E2PA 1QQMA 3SAFA 3KP4A 3MAQA 4DS5A 1HU0A 4AUXA 3I35A 4EJWA 4W97A 3RZOJ 1KG7A 4JK7A 5AZIB 4Z94A 3D4VA 1HYSA 1MMSA 4YDUC 1IRFA 3K4JA 1K6YA 3IKVA 1GL5A 5C2FA 4M77F 2JMWA 3DYAA 2DXIA 3HG9A 1X6BA 5AQSA 4PJOA 3WODF 3VGKA 4HTUA 2RI3A 4L5JA 1P7IA 3VYTB 3ZYYX 2WV0A 2I0NA 2XU8A 5KRTA 3CC2T 1NHAA 3LWLA 4DZPA 1EZZB 1W36D 3MN6A 1HQEA 4YRVA 1VQ8N 4AI5A 5HLHA 2JM9A 1OOTA 1A6QA 3NH0A 1VAZA 3MN2A 1LB2A 1USTA 5JHUA 3DWLA 4I6MA 4HWIA 4B43A 1SANA 4BH9A 3VQDA 2GUIA 1WJCA 4EMKA 2QAZA 2EYQA 4KHYA 2R93J 9ANTA 2VCPA 2RQVA 1AZEA 5F27A 4XRSA 2KZVA 1T0FA 5H6RA 3CCSA 4LLNA 3JRGA 2FRYA 4C5EA 3MWMA 2CSOA 4CJQA 4HQEA 1Y96B 4H0PA 3WXIA 1ABOA 4C0DC 4C0FA 3IAS2 4YOXA 4M77E 4EJYA 1HKGA 3CQTA 4AMCA 3AO2A 2KGTA 3CQ8A 3F2KA 2CUBA 3BTJA 4AIAA 2G8HA 4JUVA 2NUZA 4A3CJ 2LKPA 1E4FT 1TW3A 2X4HA 2DT7B 4JP0A 3U1KA 4RTUA 3DXKB 2Z2SB 1L3LA 4WTOB 2CGLA 3IHUA 3CMAT 2LX9A 3CCMQ 2YX6A 4HT8A 1GOBA 4FE7A 4MFBA 2A1SA 1Z91A 3EETA 3O8MA 3BE3A 4FHTA 3RRHA 1IN7A 2ZJ2A 3ID6A 3BPVA 1BL3A 2VKVA 3G73A 1XG1A 5AQMA 2OQGA 4I2OA 3CZ6A 4MQVA 3T8TA 3HC7A 3KKSA 3ROUA 5A2QZ 2VOOA 3CTAA 1BDGA 4AFSC 2DOFA 5BMZA 3S6IA 1JCFA 3OBWA 3EUKL 4M72A 4BRMA 4OLAA 5BNGA 1AVZC 1K0XA 4J5YA 3QODA 2R7FA 3ZR8X 4MDBA 2P9LB 4FWNA 1K8AC 4CSWA 3KK3A 1QVUA 3FJ5A 2C0OA 2HOAA 2GBYA 3NBPA 4UVAA 4KTZA 3X25B 2OX7A 3QRFF 1KQSP 3U9ZA 3GZNB 2F2XA 1HRHA 1IXCA 3F8MA 3MKDA 1VQ4Q 1P7JA 2NOLA 4CF1A 2HW3A 1KD1O 1UGQB 1R23A 3CCLN 2A68F 4KRFA 3ZETB 4JV5K 3E5UA 1WSUA 4Q5VA 4ZDPA 1WH5A 3FB9A 3OJSA 1BOAA 1K8KA 4CC3A 3LA2A 3TOAA 2UXXA 2E2NA 5IHNA 1KYWA 4BJ6C 3BQYA 1VQ9I 1O57A 2QSFX 3OA6A 1B07A 2HOSA 1SF9A 3HB9A 3KZZA 3KE2A 4XTWA 3QESA 5LGNA 4JOMA 2LRQA 5A0LA 5GAMj 4CHQA 4NHJA 2XAFA 3MAJA 2HMPA 4QVDA 3M4YA 1XMXA 4BHCA 3KFWX 2DMPA 2NRXA 1VQON 2EB7A 1Q86R 3A0BC 1NOYA 2RHYA 3KBGA 2HWVA 4CGZA 1JEGA 3OIQA 4EJUA 3ZT0A 1TT5B 4BY9C 3GIBA 3KKRA 2BUPA 2R5ZB 4R79A 3MJXA 1NLPC 4FJIA 2E2OA 1KLMA 3NWSA 2FBKA 1I94K 4GGGA 4EZ6A 1QVFP 5FKNA 4FJ9A 3QIOA 1QVGM 1UJYA 2K3PA 3M55A 4I0BA 3V1OA 1A31A 1E0EA 3RMAA 5E41A 2J5PA 2XIDA 4F91B 4W5QA 2DEUA 1P2FA 3H46O 3I71A 1YQMA 2XKPA 3PO3J 1LE8A 1WHHA 2YDLA 3MWTA 4XORA 1DQUA 1NEBA 1T56A 2I8DA 2KQRA 3IG1A 2PUOB 3BJ6A 3VJPA 3G71T 4FJXA 4OPJA 4RCBA 2LOOA 3E6BA 4G7OF 2HVHA 5LJ5d 4CJVA 1ZRFA 2PFUA 2YNFA 3RYRA 1TS9A 3TAQA 2H6CA 2YU3A 4KJZA 2CS7A 1U78A 4IDHA 2PNIA 1MBFA 3BR6A 2GA2A 4ATOA 1V54H 4MTEA 1W4MA 1LNXA 2RQRA 3OSVA 2QWQA 1GLBG 1J0RA 2NWMA 4WQ5A 3ZRGA 2HR3A 1WYXA 4HUGA 1Z0XA 2YXYA 1NKEA 1VSMA 4JJCA 4M75A 3JB9I 1T2KA 3TQ7P 3EGDA 2XASA 4CF9A 3UKRA 3JAMZ 4Q5SF 2R58A 3JCMg 1XPXA 3CC7T 2V1UA 3LAJA 2E7XA 3Q5FA 2Y69H 1IDYA 3H0GJ 3TSPA 5DS9A 4PUOA 1ERDA 3DB4A 2O8CA 1MJ9A 1AKHA 3V6DA 1QGPA 3TU4K 1HLVA 1G3SA 2EK5A 1CZBA 2RDPA 2EFNA 3JRZA 4B8XA 2DILA 4FJNA 1NLOC 1VOMA 1SVMA 1M90U 5LMUK 4XRSG 1NJIR 1XG7A 2RHKA 4QOZB 4RMNA 3G0ZA 2AXLA 3I9QA 3MEWA 2CUEA 2V1RA 4XKVA 3E2UA 2YKMA 3CPWM 3S2DJ 1IV6A 3M3YJ 3H45C 2JW4A 2W41A 3I55A 3SAHA 2IS6A 4LDYA 3R6OA 3AG3H 2L89A 4Z6YA 2XY7A 1UA1A 5FO5A 4AFZC 5FPMA 4UVCA 3RRGA 3EAEA 2B8AA 1PHTA 1HR0K 2EKHA 4CEQA 4UY8O 2YPRA 2QQ9A 4BR4A 2E1MC 2YNIA 2JA2A 4E6RA 3CD6A 5FLXE 1RTDA 3VS5A 2QW9A 4FYYB 4EPCA 3CCEA 2FBXA 4Y1DA 5GJWB 1GLLO 4CCNA 3CUQB 3GEZA 2BXZA 2GAUA 3H35A 3OB9A 2XRLA 1TWFJ 3HXLA 1DDNA 1OI1A 1WEGA 4DKWA 3TO6A 4AVPA 1EF4A 1XUPO 3J81K 4NBQA 3F9KA 4IPAA 4J01A 1RAIB 2GX9A 4E19A 3I0XA 5C0MA 3PFIA 3H41A 4CYCB 3S3NA 3E1SA 5HY6A 2HU9A 5E1XA 5L3GA 1WXBA 1GBQA 2DK3A 3MWPA 1H641 2HDWA 3K9JA 5E8GA 5HKCA 2QK0A 4DR6K 4B9VA 2XGXA 3J81O 5F1XA 1JXBA 3KHYA 3FKJA 1ZHIA 5FU7B 2K7LA 5FKMA 2BTFA 3JRFA 3NWTA 3CC2N 1NGDA 1DLOA 5BS6A 1EQYA 2XB5A 3I0SA 4B6MA 1C0UA 2MYSA 4F3TA 1R6RA 1BQNA 3HSRA 4IOAF 2BBYA 5JS2A 4I02A 1NYGA 1A5VA 4CGDA 2VG6A 3EYZA 2XV4S 3BJAA 3M0QA 1ULYA 5LHGA 3LOCA 4IVNA 1S1NA 1YRNA 2Y0MA 1KG3A 4AC0A 1TNSA 1LWVA 3MCPA 1TW2A 1WOQA 2HXIA 2O4XA 1SG5A 3VGMA 1RR8C 4MO4A 4J6WA 1VA7A 3L3VA 2BXYA 3FZLA 3N5NX 3BF1A 1NGIA 4Y15A 4M9XA 1UGSB 3QJ6A 1MBKA 2QKMB 3VEPA 4GKKK 2E1YA 1B8IB 2HOEA 4JKEA 2CGPA 1C6VX 1WB9A 2VT2A 5GAN6 2X9HA 4S0HB 3DOLA 1I4K1 2GWKA 1VQ6Q 1AWJA 1X4PA 5GAOp 5E3NA 2X85A 3BR3A 3EFRA 2ZJPF 1NYFA 1WIEA 1HSJA 1X1AA 2P81A 1JE8A 3OOPA 1VQ7Q 1W7PD 4OB1B 1VQPA 3PIOL 4JEPA 1VQ5N 3NAEA 2OTLQ 3K4CA 2WB1A 1BIBA 4JD2A 4M3TA 5C2DA 1S5LC 2PAVA 3QBWA 4LY7A 3CMAN 4U0YA 3VEVA 5FLMJ 4PL8A 2HQRA 1Y64A 3SV3A 1KRPA 3MECA 1NK9A 4BGAA 4B3TK 3CC4Q 3HRSA 3MEDA 2X78A 2GFUA 3M8PA 5K5QA 3EN9A 3M7GA 5DM7L 4N47A 3E9OA 4LF7K 2HBPA 1Z1DA 1MBEA 4CJPA 3ZT3A 5IT9K 2A3ZA 4J9DA 2DXUA 4O0IA 1ZR2A 5GAN3 3I8BA 1NG6A 1N78A 1TUYA 3MD2A 1K78A 1U5SA 3CMEQ 1C0MA 2VKHA 4LFAK 5LEJA 2MAMA 2V8KA 1IGNA 1EIFA 2VKEA 4JI1K 5IT9O 4B9UA 3HFOA 2QEXN 1OYXA 4EM0B 4IEJA 4A4KA 2QUFA 2WC9A 4J9CA 4X9CA 5SWMA 3OYGA 2Z5UA 2EIJH 3FFIA 1TG0A 2COZA 1XS9A 3K4NA 2DL7A 2RM4A 4M7AC 1RBUA 4UNFA 1VQLA 2KYBA 3M54A 1F1ZA 2CQQA 5BPMA 3UR3C 1W5CC 3NF8A 3W6VA 2D5VA 2EA2A 1VYVA 3DKMA 1PVEA 1ETXA 2YNGA 3BC8A 2P5VA 3CBOA 3CM5A 1TVRA 3CCQT 4HNTA 1FW6A 2A3LA 1J54A 3OYBA 1PKSA 2EYXA 3CCRA 4IG3A 4PUSA 3OMCA 2UZKA 4CHPA 2FOWA 4A54A 4M7DA 4C92D 1JLEA 4O5FA 2LC2A 2DA7A 4FYXB 5L3BA 2E65A 5I11A 3FXJA 1YI2A 2M0MA 1TAQA 4RLFA 4C3JJ 1RI7A 5T7BA 2LH9A 2YRDA 3HP9A 1RBSA 4B21A 4C8KA 4DSIA 4KPYA 2W82A 5GINA 1ZTRA 4RTWA 4U87A 3OYJA 3CCJI 3GBTA 2CV2A 2EIKH 3GP8A 2ASMA 3ZMTA 3UKGA 3VMFB 3J7ZI 4CZFA 4PSWA 4FM1A 3V9XA 3ZT1A 4WCGA 2CGHA 2ATQA 5ADXA 1SVLA 3OR2C 3FXMA 2DZ9A 3ZCMA 4BE2A 1BI0A 2H09A 1BIZA 1MUDA 4EGZA 1VSDA 1RTIA 5LHHA 3META 5IN1A 3AO3A 4EA4A 4J8OA 4G12A 3GTMJ 3ZGKA 1B92A 2QXLA 3G71N 1DKGD 3MZ8A 3LDOA 1TYQA 3A5NC 4RW8A 1TC3C 1QZZA 3DKYA 1JKPC 1KQ1A 4L9VA 1EA3A 4FLYA 1ZR4A 4H0VB 3JSCA 3NHNA 3F10A 1FOYA 3QAHA 4H4KC 1HPMA 3A03A 2NRVA 4O8UA 4I7FA 1E3OC 1YJNQ 3VENA 2XGDA 5CPRB 2KZZA 1NKUA 3TU5A 2HQHA 4GY2B 2LDUA 4P5OA 1SL2A 2NS8A 3HOVJ 1YFHA 3H5NA 2BANA 5KN9A 2NNYA 4CJ4A 2D1HA 2L4AA 1K8AR 4KB1A 2ESNA 4OMZA 3H0DA 1N27A 1S72Q 3IWZA 4DB3A 5EDNA 5JVGL 1XSVA 3CCSN 2P4TA 4KFCA 3HM8A 2KQWA 1VRLA 1G2BA 1OVQA 4Y7NJ 2DJZA 2M87A 3CC7N 4B1UB 1HPZA 2QTVA 4N0BA 1YITI 1T08B 4M77D 5KPTA 1IO2A 4HF1A 2R5MA 2KLAA 5AR0A 5KAFC 1WQ2A 3EFOA 1G4DA 4XK8E 5LRSA 4EQQA 3K1NA 3K4BA 4NNJA 4X1EA 4CBWA 5GAN5 5LMNK 4L0ZB 4PJOF 4M42A 4M78A 2D45A 2P5LC 1WEFA 1EJ9A 4OB2B 2RQTA 2DOAA 4I9LA 1YJWT 2STTA 1N8RR 3OSGA 4K43A 1QZ5A 2L3QA 2DLLA 5TKWA 4P55A 2DAOA 2VN2A 1B34A 1YW9A 3P7NA 2P9PB 5AIPA 3FMSA 2A36A 2ECBA 1B3QA 2HKQB 4M3RA 2XY5A 3ERMA 1FYMA 2IIMA 2EYZA 4JK8A 1U3EM 3WGIA 2EFWA 2RAEA 4C5GA 2A7YA 1LCKA 2L9SA 3RYPA 2AQFA 1NGJA 4XOPA 1JKHA 2QM3A 1VQMI 3LQRA 3VS6A 4GV6A 3MVPA 4DYCA 1T44A 1ZBJA 1TOVA 4ESRA 3BF3A 2NNNA 1W0HA 1BA0A 4AM3A 3RSEA 4CZGA 1IKXA 2RJEA 3OL4A 4CFCA 2VQFK 4DFPA 3Q7BA 2OTJI 2E7WA 4PJOE 1D09B 2G8KA 2WACA 2VQLA 2HQXA 1XQPA 2ELJA 1O4XA 5FKKA 1HA8A 2NZTA 5CK9A 1OCPA 5HLFA 4EW0A 2E4HA 2UXCK 4FK0A 4CHOA 4EVIA 4CEZA 4ABZA 3G25A 3OA9A 2FPDA 2FLOA 3DLGA 1N36K 2QASA 5ERIA 1XC9A 1NM7A 4CJUA 5DCFA 2ECCA 2HEQA 3WTTC 4J9IA 3IRQA 1NK2P 3PO4A 3DWLE 1OU8A 1SHGA 2RNAA 4B1VA 1X4OA 1PVSA 1SMYF 2K2VA 1X1CA 2MW8A 2X6XA 4FXDA 1BB9A 1UTIA 4AI4A 2EYYA 2GQIA 4PJJA 1F43A 1NG9A 3ZXSA 2MK5A 1POGA 4GVEA 2XAUA 4OVAA 3WXLA 1NPRA 2PMZA 3QJYA 1RDCA 2CW0F 5I9EB 2YLBA 3BR5A 1LCUA 3FIWA 2OCCH 1N5ZA 3MN9A 5EG2A 2LT4A 3E5XA 2DX1A 2COBA 2NUBA 3A8GB 4L3QA 5H6QA 4JKCA 1X1PA 3H0FA 3LDNA 4M6VA 3K5NA 1OISA 2K7AA 1VSJA 5F1JA 3H6EA 3PO2J 2ZJQL 5GAHJ 4JLHA 2X6SA 2R3SA 1NZ9A 3GOXA 2HF4A 5KCMA 4B3RK 2E3IA 1JUMA 2KY9A 1U84A 3O4QA 2ESWA 1U6GA 4HUFA 2VOPA 5SZTA 1VSLA 1HC8A 3G10A 1VQ8I 5AQYA 2BE5F 4DWIA 2P9SB 1WQWA 4FLTA 1V55H 1YXQA 3NAUA 1LW2A 3SLCA 4RGXA 4DQ2A 2PYJA 2LYCA 1U47A 3LALA 1GLNA 4M73A 3ZCOA 4E1MA 1V1CA 2ZFUA 2YHWA 3QDRB 3GWZA 2XMFA 5GAOr 1JL2A 2DFUA 1Q81O 5DD8A 3X26B 4AU7A 5KH6A 4AHCA 1WNSA 3REBB 2ZJRL 4GLMA 3UF4A 2DXCA 2W84A 4UQGA 5CKDA 1HW1A 3HGGA 4AM7A 2VPLA 1Q7YO 2RI5A 1GHCA 5FGMA 4L5EA 5TKYA 3Q9VA 3CXCS 5DM6L 2ZF5O 5E84A 4A6EA 5EZHA 5EC7A 3FMRA 1C1BA 4UVBA 1I3AA 5K5RA 2QSHX 1ZG5A 2F5DA 3SWNC 4FISA 1N75A 3U6FA 5BPLA 3BW1A 2TDXA 1ASWA 5LRRA 3RPUA 3PE0A 2HQAA 3KTUA 1KU2A 2ABLA 1QHTA 4XRFA 4XONA 3RQIA 3DJCA 3PIPL 2NOFA 5L23A 1CSKA 2L02A 1ZA1B 5F2RA 1WLJA 1TP4A 1NG7A 1YIJQ 3CCQN 1M3AA 4WFAL 2GBZA 2ZGZA 1Q82U 4ZGEB 2HXOA 5KYYB 3I55N 3KTQA 1IBKK 4B1WB 2PQ8A 3VYGA 5AQJA 2LT1A 3TDZC 4KUIA 1DGKN 5KYNA 1OR7C 1GOAA 2Z1IA 2E5ZA 5IYBJ 2DL3A 3O5BA 4II3A 4RBOA 4BRKA 1S1UA 4HOBA 3DXMB 3K70D 2X9DA 1I8FA 3OQ5A 2L0KA 5FRMA 3BY5A 1VQ9A 2COWA 3K2ZA 2OAWA 1YS6A 2LNBA 4M75F 4GYIA 2CH0A 5F08A 1B9DA 3CFRA 4EIKA 3L2QA 3L2CA 4CI0C 1HYOA 3EEQA 4M3YA 1JGGA 4FSVA 1GFDA 2G8VA 2ZMEC 4XMYA 3FBNB 3LZJA 2EV0A 2XIGA 1RBRA 3CCLI 1S7OA 2JJ9A 4LGWA 1LPQA 1V4TA 4M7AA 3K6GA 1PSEA 3R0JA 3TABA 2JA5J 4KH4A 3OIOA 4LG0B 2YS9A 1TH7A 2DT6A 2LJ1A 3QOPA 3EDPA 4MDWA 4CICA 4KB0A 2WA0A 3H1CA 1IJWC 4A59A 3ZMSA 4L5IA 1MSEC 4BL0B 2RC4A 2Z1JA 4CCLA 1IRXA 3CCYA 3RMDA 5GANh 2K3BA 1XMAA 1VQOI 1UMQA 3BZCA 1VNDA 3A0IX 1WJFA 1VSEA 3A4CA 1G83A 3NGPA 2LBFB 3GE1A 3QU6A 2K5LA 3PQJA 1DU0A 2E1MB 2GM4A 3BZKA 2CQXA 3KFVA 3JCMV 1OH7A 5FPDA 1W70A 1IKWA 2P7CB 5E1WA 4JZ3A 1SSFA 3JCMd 1TTYA 3JTHA 1E6GA 3LPUA 2DVEA 3KNTA 2HZYA 2K27A 2PVGB 3A5OC 4UUSA 1OMIA 3GTKJ 3DXJF 1S9HA 5I22A 2VIXA 5CQGA 2I2LA 5EU7A 3FHNA 2LY1A 1RL2A 3I5RA 5AQGA 4CEDA 2HQ5A 3PMIA 3S16J 3GO5A 1I5ZA 5KHDA 3ID8A 3KD5E 1B4AA 3NF7A 3KEQA 2DN0A 2Q36A 1CQTA 4ZH4F 2DTIA 4C8OA 1P8ZA 3M8EA 4BRHA 1ZBSA 4OAYA 2FSJA 4IEIA 4DR3K 1QVFM 2QA4T 4XKWA 4RM2A 2FNPA 5GP9A 1VQPN 1WHJA 4A5BA 2R7ZJ 1HBXG 4IXAA 3TARA 1YJWN 3FJPA 2RVCA 1NOZA 3WGHA 3MP6A 4FWLA 1ZHFA 2Y0SN 4A3EJ 5DCMB 1WAFA 2LFBA 3IFRA 2XDBA 1JT0A 1N8RO 1K7AA 1EWQA 4RW7A 3P9IA 1IBMK 2RN2A 3KJVA 4BXUA 1E4GT 1RT4A 2V7YA 1K79A 1L0OC 1CF7A 1VZ0A 1Y07A 5GTIC 2W6KA 1AHJB 3OYDA 1UOCA 3O3GA 3AVBA 7AT1B 3ZX2A 3TP0A 2MFZA 2KKOA 2L2OA 1IUYA 4NZGA 5EEHA 4HNUA 4Q4ZF 2P1JA 2JPCA 5HS8A 3HL2A 1VTNC 4OVLA 4BRCA 1ON2A 4UNOA 3SEZA 3F72A 3QZ5B 1HKTA 4DSEA 4CIFA 3ZQFA 3KPHA 3TAEA 2A5YB 2LSNA 2P9IA 2CQNA 2IA2A 2OBPA 1H1VA 3WNHA 3KYLA 4D8KA 3FZHA 3BTCA 1RUNA 3O9UA 3OMYA 4PIIA 4BXXJ 1KAXA 4JI7K 2YHXA 3FLCO 3PVLA 2V52B 3D1NI 3KYDB 5AQRA 4W5NA 5GAEJ 4LFCK 1UEBA 1ACIA 3FZKA 3CDIA 2HB5A 2G7HA 2PJRA 1XWLA 1Z3YA 2D9TA 1HW2A 2QENA 3GBGA 1MZBA 2OFKA 1KHIA 2CFOA 2DTRA 1XC3A 4CZEA 1BA1A 3BROA 1VQKT 4CJFA 3J80K 2K9MA 2JTMA 5DY9A 3U1DA 4L18B 4M9ZA 2DW4A 3X24B 2I5JA 1ETKA 2W10A 3FR0A 1JJ2P 2LQ8A 3SQ4A 4FK4A 4HVWA 3T69A 1UG2A 2E36A 5FPNA 3VS7A 3IL2A 3VQQA 2X6NA 5AZJA 2VV5A 1YHQQ 4PZJA 3TO7A 2ASOA 3J80O 2X4XA 1QVGS 3G4ST 3I4PA 5JLWA 4M45A 4NCBA 4FM2A 3RKWA 4NL3A 4A2BA 1ZN2A 4JYAK 2L3DA 3UB5A 1E3MA 5CHZA 1FKPA 3IWFA 4C8QC 1UHSA 4FIBA 1OH8A 3TKYA 4M3GA 4DA4A 4B3MK 1IKVA 4H0YB 2LCCA 2DA1A 4Q48A 4BRNA 5IXFA 2PBIA 1UWBA 3KIOA 4WXCA 1RDWX 3FEOA 4RG2A 3CC2I 5D5VB 2A40A 4XL9A 1K73R 3L3UA 3CBMA 2HCKA 1D3BA 3VU3C 5ECAA 5M9OA 3H1VX 3MMVA 4J19A 1WGXA 1MNEA 4CF0A 3DLLL 3QYBA 4O55A 4DK9A 2JZ2A 1LEBA 3VYRB 1KK7A 3O5ZA 3TSWA 2W48A 4M7AG 2JRTA 1NGFA 3JRAA 3ENOA 2VUBA 3NPFA 4BR9A 4M7DF 5GAN4 1XCVA 2PVOB 2HBJA 4FCYA 2FRWA 4WQ4C 2GUPA 4HUEA 1Z9CA 3BOQA 4G7ZF 1YTUA 2LREA 2LJ3A 2NLUA 2MPXC 4ZN3A 3J81Z 1VFCA 1K8KB 4Z89A 1N6AA 2DETA 2CWEA 1W97L 1GUUA 3SUQA 4D6WA 4O44A 2K85A 2NS7A 4LC9B 3VERA 1BJAA 3QPLA 1GV2A 3BG7A 4JRIA 4IFEA 4F2SA 1OFCX 2LP5A 3SQNA 2ID3A 4U67L 5EGOB 4HVJA 4J9HA 1VQ5I 2HVSA 2A3SA 1R0CB 2QGFB 3CXCP 1KVBA 3CJ9A 2P9UB 1WI9A 5FWCA 1T98A 3CPWS 3T1AA 4HF0A 3CMAI 2OZSA 1MA9B 1UJ8A 4L0YB 4L9JA 1QHGA 4CBUA 3AT1B 5J3BA 1W5TA 1KYZA 2R4GA 3CQZJ 4BI4A 2XD0A 2L54A 4GY5A 2DTZA 1TWCJ 5EEAA 3E9GA 3NF6A 4M71A 1W36C 3AVCA 3TI0A 3HKZA 3V7SA 5HLIA 1PRMC 1U3OA 4CCOA 3AGKA 4KI4A 4EZ9A 1GCQC 5M1FA 2P0PA 3RERA 2HAXA 3GNGA 5AQWA 2F5TX 3WQUA 1KQJA 4PKIA 4YIRX 3L4IA 1WHUA 1R00A 1KD1U 3LFKA 1WJBA 1TQMA 3H3UA 3CCUT 3DTKA 4D0PA 5ADXH 2QEXI 2K9SA 3SDGA 5GPAA 3QWYA 1NMNA 5GIPA 4YOQA 4ZYAA 2M16A 2QWNA 4MHGA 3HPGA 4KGZB 3RMQA 1FZPB 4A3BJ 1M90O 1SAZA 4QLCU 4XRMA 2FMLA 2CJJA 2K5IA 4F7UG 2RKIA 3ZBDA 4WE1A 4PJOD 2R5AA 4K25A 4KUMA 1ZQ3P 4G94A 3N5BB 5CHIA 3BWGA 1EP4A 2L2PA 3KZIC 2IPQX 3LSRA 2XAJA 5F04A 5F6FA 3AG4H 4CH7A 5GANj 4BE0A 3G1MA 1GT0C 1GBRA 3D7EO 4MGRA 4C0ZA 2M3AA 1RABB 2CSQA 5HVQC 4M78F 2HKXA 3HTVA 4H8KA 3CCJA 2HBKA 1ZXOA 4RTXA 4MZPA 4KULA 2UU9K 2F5KA 4DTSA 1YAGA 3C4SA 5EOYA 1HJDA 2DLPA 4BBRJ 5C10A 3QMLA 4B22A 3VQ4A 4FLZA 3PQKA 4CECA 4AIDA 5IT9Z 3HSCA 4MMLA 5LJ3d 5F64A 3DPLC 2V1XA 2WTUA 2E1CA 3RUXA 1AOJA 4CIGA 4LITA 1ZLMA 5D8LB 4EP5A 2W04A 4FW2A 2KFNA 2ZPIB 4DTNA 4A4GA 3N4QA 4FT2A 4A69C 2RHUA 3PIOA 1DT9A 2QQSA 2GOMA 2ETJA 3ZQ7A 3FK7A 5CLSA 2PI0A 5M1NA 5JVTA 2O3FA 4BROA 2V8JA 3VB2A 3SYZA 5D6WA 3JSPA 3FDYA 2IDOA 4F4KA 3E66A 5KVRA 1RADB 1M3QA 1IREB 4KH0B 4ZN1A 4F17A 4M78E 4AVZA 4GW6A 4CF2A 3W6KB 2XPWA 3G71I 3KXTA 3ABMH 5GJVB 3LSIA 2M45A 3LWFA 3S6WA 2E6ZA 1LQ1A 2QA4N 1P7MA 1N3CA 4NDLA 2I10A 3CLOA 2HHWA 3I56T 4C8MA 3JW4A 1YITA 2EV5A 1HOMA 2EVRA 3CG7A 2FYKA 3GPLA 2IG0A 3M56A 4DW6A 1VQNQ 4FWOA 2HF3A 1Q95G 3CMYA 2E88A 1V5EA 1QU3A 4IHVA 3K9TA 1W2BS 3OYCA 3JTGA 3QU3A 2A69F 3NMUA 3ESWB 5E18F 2JSPA 2HNHA 3HRGA 3LM2A 5HRRA 3RTVA 1FJLA 3ZX0A 3CC7I 1E2XA 4JKHA 4MIMA 5GAGJ 1ITYA 3Q9SA 4KIGA 1WA7A 1MBJA 2L9VA 1IV0A 2DPPB 3G1LA 2SEMA 2Z0WA 4CK1A 2DOEA 5KYXA 3CCVQ 5KYUB 1ZBXA 4HDUA 4BHPA 4NUBA 3EGXB 2F8TA 2IPOB 2YX4A 3QEIA 3ZEUA 1MWKA 2X6WA 4LD5A 2R5YA 5BRFA 1PRLC 3G6EQ 3UKUA 3M1CA 2NUTB 2BY0A 1VQMA 2AXTC 2M4KA 4FOEA 1F4KA 2IAIA 1KG4A 2DD5A 1Z7LA 4I7HA 2H94A 2FF4A 1Q1VA 5FU6C 4DJAA 1PKTA 1D5YA 3E6DA 3I0WA 4KHPK 2NOHA 2OTJA 2O8DA 1KEAA 4BHBA 3C6UA 4LH5A 3HPWA 2QK9A 2O8FB 1X2NA 3VTIA 1ZYQA 2M9UA 3TSUA 1MIJA 4NO7A 1TZLA 1VYUA 3MP1A 3HI0A 4CJTA 2UUCK 2KVQG 2NNWA 4GNIA 1JKRC 1YWOA 4B9TA 3S14J 1SHFA 3G4SN 2CDTA 3T1YK 5LHIA 4NB4A 4BDZA 2BHZA 1KAZA 2PMUA 2XVCA 3BTLA 5HLTA 4O4GA 2GWRA 2HI3A 1ASUA 4II2A 2KZMA 1CZAN 2JPSA 3W2WA 3C2HA 1S3XA 1QVFA 3SWNB 3AVIA 1YW7A 1MMNA 3CJNA 3VDXA 3I33A 2DVJA 4F2RA 1A6IA 2F5CA 1A04A 3JAMK 1QZYA 1RPWA 5AQVA 4HYEA 1TUGB 3KP6A 3OS5A 2BE2A 4R8HA 4JRPA 3U23A 3CPFA 3H3ZA 1VQKQ 3HZ6A 3QETA 5GAN7 3GMEA 2YUSA 1K73O 4CO8A 2FBTA 2OD5A 5ICGA 4HBLA 3C2GA 5M1OA 2RE2A 3NQOA 3TAMA 1PUFB 4KHUA 4BE1A 1FTZA 5KNLA 2ZXHA 4M75D 2VLAA 2BIVA 1OULA 1VQ8A 1TNTA 1D9FA 3QDKA 1KSWA 2K40A 1R36A 5KGWA 3HOTA 3DV8A 3CHWA 4BY7J 4BQNA 1C0WA 3CYMA 3AO5A 1KAYA 2JTVA 2V26A 3VEZA 2KT0A 3RJPA 2ESHA 4IHWA 2E19A 1MUNA 1XHXA 5J3LA 1M3BA 2O8BB 2ZMEB 2V6EA 1TBXA 1RUWA 1UHFA 4JQFA 1JB0E 2JHNA 2R7UA 4NCAA 1W5SA 3RQ4A 4XLPF 2ZWHA 4HLYA 2A6HF 5GAGP 2QYZA 2LF8A 1MV0B 3UE5A 3LL3A 3C7NA 2FE3A 2WY7Q 1O3RA 2X48A 5L8RE 2VC8A 4U7BA 2RF2A 4CHYA 1S9GA 1RLPC 4WF9L 1YLFA 4FYDA 3LP1A 2GNCA 2KRFA 4XICA 4H03B 2WADA 2BW3B 4DU4A 2DPDA 2DFEA 4Y33A 5CAIA 5CKFA 4WXHA 1M2VA 2CV1A 2GQVA 4PKCC 2YT6A 3UA7A 2DIGA 3LSMA 3B6PA 1UGPB 4C1NI 3UNGC 5LJWA 3D5RC 4JYKA 4KHQA 3H6ZA 1KTQA 4OMQA 4UB6C 1MNMC 1OX8A 3NGYA 4OKEA 3C7JA 1ZSZA 3MQ0A 1T8EA 1N39A 3K1PA 4M7AE 2P51A 1NK8A 3ER0A 3MEEA 1KA8A 1WUAA 1DP7P 3E9FA 4HZFA 3GFLA 2CKKA 4HDVA 2VQHA 5BRHA 4ZYGA 2X1EA 3V8JA 2M1BA 2K86A 1M3CA 3WQTA 4DMNA 1U5TA 4FT4A 3U9GA 5M5WJ 2D0QB 5C15A 2GTOA 3H1QA 3JB9F 1IDZA 3K57A 4JKGB 1UUEA 3CCQI 3B6OA 2YHTA 2VJIA 3P8DA 2OPPA 1D8JA 1IG8A 1Q86U 5J2NA 1HSTA 2XHIA 3CCLA 3ELKA 1RNLA 1BC7C 4JX5A 3Q1JA 1J9AA 2KT1A 1GCQA 5BN8A 4RUGA 2QWLA 4PWDA 1VF9A 4ZC3A 1Y6IA 3HPHA 1WSHA 3E97A 1OH6A 1T8IA 2VBYA 1UB4A 2R7XA 1UFMA 3ZSXA 5LJ5j 3MEXA 3CCUQ 1SFEA 2F1LA 1LEAA 2M4GA 2YR2A 1WSJA 2LMDA 2QLZA 2OUMA 1WLPB 5E17F 4AH9A 3JB9H 3ATVA 1VQOA 4H5TA 3TAPA 2LY2A 2W25A 4BNCA 2Q0RA 3QIPA 1MBHA 4XLEA 3K0SA 3L2VA 5HRSA 3OYYA 5J40A 5J4YA 4FSXA 3EG9B 2ICWG 3NH1A 2HPIA 1DEJA 2KRCA 2HMIA 1SFXA 2E1OA 4XAXB 3JRHA 1NGGA 1CKBA 1VYTA 1QVPA 5BRDA 3LSJA 4NQWB 2P9KB 1YTAA 3IMXA 1WZ2A 1AZGB 2UUZA 3FE1A 4Q5WA 2DL4A 4LH4A 2VUMJ 3I56N 3PM1A 3ZOBA 4JNEA 2ELKA 1KG6A 1K9MC 3OS2A 4MNUA 1WPKA 4F7UE 4UUTA 4DR1K 3F70A 4E89A 4N4OB 1IF1A 4CCJA 4FT8A 2Y30A 1SFUA 1Z7UA 2O03A 4BACA 2AP1A 3AVLA 4Z4FA 1ZX6A 2VQCA 4C92C 4FJKA 2MBFA 2E2JJ 1OYYA 5AJ3K 3SBTA 3CCMT 1LDDA 3A8OB 1S1WA 4FLWA 3FC3A 3F3XA 1D5VA 2CV0A 2M30A 3KX2A 4E9GA 4EVVA 4CZHA 2F5EA 1W2BP 2KT8A 2K9LA 2O7OA 2QVOA 3CWSA 4N5SA 2JA6J 1CZ9A 1TSFA 3QYEA 1O13A 3ABUA 1G59A 3TOBA 1RBTA 4AIJA 3PIPA 4C8QB 1NJIU 2J5OA 4ZYHA 4ENNA 4LUEA 3E01A 1VI0A 3WE2A 3CUQC 3I4MJ 1B72B 2M5WA 3CD6Q 3K10A 3CCEQ 3BJOA 4Y1CA 5AQPA 4BR0A 1YJWI 1S9EA 3LGFA 4IUVA 4DFJA 2I5WA 4C8QG 4XTXA 3LNQA 3A01B 5GIOA 5TGTA 5L3EA 3QWXX 1J3TA 2HNYA 4M7DD 3AV9A 1VQ4T 2NUPA 2DA9A 2K5CA 2D0AA 1UCRA 1X6GA 2IJLA 3O6BB 4M3XA 2QYOA 3ZQGA 5C4JJ 2L9RA 3I3LA 2XSDC 2RA2A 4KTQA 3KVGA 1APLC 5IYDJ 2LKXA 5J2QA 4DQRA 2MC3A 4Q0BA 1BU1A 2Q2EB 3OJUA 4MFEA 3CVSA 5EG0A 3QIIA 1BQMA 2GLOA 3J7AO 1BIUA 1XI1A 2A1RA 4KAZA 2DEQA 4JKFA 2FBVA 2KXCA 3K4MA 3LMMA 4L6V5 2Y1JA 1T6CA 3B02A 3L9FA 4RS8A 2YJFA 3DCFA 4N9IA 2CZ6B 1KQSS 5E1ZB 2UXDK 4QS7A 4BBSJ 1Y71A 2EFPA 2HGCA 2IS1A 5CYQA 3TWHA 3ASKA 2VBZA 5FKLA 4J9FA 1L5UA 5IT3A 4XLAA 2NOIA 2E2QA 4YOWA 2XSJC 2VJ5A 5EYRA 5BR9A 1N3AA 5GANe 2MH9A 3K2PA 2BVLA 1Q82O 1XMKA 4YOYA 3OYKA 1BBYA 4NS5A 3D2EB 5AZIA 3THWB 4J6XA 4QVZA 4WCEL 1BHLA 2EZHA 3KLGA 2ZC2A 4PGHA 1H92A 4CRIA 4FW1A 4B8AB 2VE8A 2BV6A 1T6SA 2NYXA 3NGIA 2P5GA 1PSFA 4DLEA 3V4GA 5B1BH 2FPFA 3S32A 1OVYA 4H5VA 4DHYA 3DLAA 5C24A 3CC2A 1F21A 2D2WA 2PFBA 2EWNA 3BFMA 4LD6A 1U48A 1WCMJ 4KI6A 5J6XA 3GTJJ 2O9SA 5DLOA 3P9CA 1BI3A 2FF6A 4BRQA 3WNEA 2H6BA 1H88C 1Z3XA 4FWQA 2H27A 1ZYRF 1OPCA 2KP6A 1KXPA 2QF7A 1IGUA 1LFBA 1TGOA 4JKAA 4AYBN 2MLKA 1BC8C 2IXSA 1NGCA 1YCYA 2L7FP 3O08A 4ZGJB 3IKMA 3VODA 3R60A 4LG3A 2WFBA 2NVYJ 5LEKA 1P6RA 5CCAA 2V79A 2K2MA 2D1XA 2E8AA 3EZWA 4M78D 4HCKA 3AHUA 3QLHA 4UOBA 2Q0UA 2DIQA 1HD3A 1J5YA 4Q47A 1Y96A 1LOTB 1F9NA 1NWKA 1A5WA 3ZLJA 4M3ZA 2H8HA 1RKWA 1KQ0A 4XU0A 1W0TA 3KK2A 4CEAA 2DAQA 3UPUA 5LJVA 3C6TA 1RACB 2ITGA 5AN4A 2B9SA 2UWMA 5HK0A 3F8FA 4HTLA 4B9MA 3J80Z 1PJRA 2AS5F 2IW5A 3WU1B 3R8EA 3DXKA 1FBSA 2KJCA 3JRBA 4ZGDB 4DF8A 3OYHA 3IRXA 5DPKA 2K3XA 2LVMA 1U9NA 3HJFA 3UDCA 2J6OA 1DU6A 3CMAA 1NGBA 2LK2A 4N56A 4JI0K 1VQLQ 3BG3A 1C0GA 4HQMA 2XHCA 2PLYA 3DEUA 3SDBA 4QQGA 5CYVA 3KLHA 2F48A 5KN8A 2LRDA 4KIBA 1RRQA 2WC2A 4MLHA 2LG4A 2JT4A 2LVSA 3PUBA 4HA8A 3RKQA 2Y1IA 3PIOF 2I5UA 4I6ZA 4ZTJA 4PL7A 1X3ZB 1SV5A 1QWFA 4TV7A 2JS0A 1H3HA 3CCRQ 3P5JA 3FLGA 1A5JA 2EKOA 1HUXA 1V4SA 2P9LA 3RMBA 2CMPA 3VYHB 3VA3A 3ZMUA 4OPKA 3RI4A 1XGSA 1YI2Q 2CZ7B 2ADUA 5DM7F 4KGXB 3MDQA 1SD4A 2X35A 1RI0A 2QEXA 4A2UA 5HK3A 4FPAA 3JCMJ 4OKKA 4F9OA 1WXUA 3EH1A 3N0UA 1ZQ1A 2DD4A 1KG1A 1XCBA 4A5AA 3HPOA 1DJ7B 3MCZA 1JBMA 3ZETA 1IJJA 1N34K 3PTAA 4WK8F 3JCMQ 2A08A 3CXCM 1X01A 1GLFO 4RTVA 3I59B 5IY5H 2Q31A 4AHVA 3AVHA 4CGHA 3INZA 2IGMA 2GIZA 3J7AF 2X1CA 5HP1A 1X2MA 4BY1J 3HSEA 1M1GA 4AWXB 1BCMA 2KI7A 4AD9A 1AHDP 2IAJA 4BUPA 1U1SA 3ZN0A 3J8AA 3V1QA 3M3ZA 2IS4A 4CUGA 4OF1A 4IG0A 2G0EA 4E9EA 4UY8I 4DYQA 3HVRA 2A6TA 1MW7A 1LWCA 4AIHA 2NVUB 3BUZB 2PBDA 3LSKA 2YG9A 1REVA 4ENJA 3C0CA 5HODA 2C06A 3F9MA 4DR2K 2JG6A 3DLLA 3RTRA 2A07F 2GFAA 5IP6A 2X6YA 2R5ZA 1ODDA 2R7YA 3LA7A 4FWPA 3KK7A 2E2HJ 2VG7A 3AG2H 1J2XA 3WXKA 4M74A 4CHNA 3CM6A 4Z4HA 1S7EA 1T7PA 1RR7A 4BI8B 3MFKA 2KE9A 3EHQA 4F3QA 4XN3A 1QQCA 1WKMA 5I2SA 2L3PA 2OA4A 4KBOA 1ZBFA 1XGMA 2HHUA 1X1BA 5FU6B 1PNJA 1H8AC 1KC8R 3WEEB 4ENKA 2EJGA 2NOGA 1VQ6T 2B86A 4MQ3A 4CZMA 1LFPA 1NEGA 3QUIA 4XQ3A 2AIRB 1QWEA 2Q1NA 1K8AU 1IHVA 3P38A 3JV3A 2H1LA 4KO0A 2JS2A 2VQGA 1ZAOA 4PFOA 4IL6C 3G71A 3LSHA 1VQ7T 3QNOA 4JK1X 3RR8A 1ATSA 4DSKA 2OTLT 1R4MB 3VEXA 2KK4A 1P4AA 3HYIA 1IRGA 3ZL7C 4FYWB 3CCMN 2X4WA 2M1HA 3K70C 1JLFA 1M1FA 4C8NA 3F73A 3CC4T 2UYTA 4RB1A 4A3FJ 3OW2S 1UGRB 2Y48A 2VE9A 1JO8A 1S22A 2YSQA 4CEOA 3ERED 1J6ZA 3CP2A 2LNHB 3O4NA 4A4EA 3T8RA 3RPUD 2IGOA 3O8VA 5J47A 3GTPJ 2G3RA 1N8RU 3DI6A 2ZPHB 2QA4I 3EG2A 4CC2A 3CMET 3CO7C 3CC7A 1NMDA 3S1RJ 4Z88A 2M0YA 4ZNXA 2IVPA 1YQRA 3AFHA 1XTDA 2L7MP 1M30A 1BYMA 1ITGA 5D6FA 2KRSA 5FLXO 4CA0A 3OR1C 4A0ZA 4RCCA 3KEYA 1VQ4N 5JVGF 5KCOA 4LNPA 3Q0UA 1R0BG 2V75A 1G15A 4XH1A 5HNHA 5KI6A 1TK5A 1BA5A 5CIUA 3JCMP 2VXDA 4FJGA 3ML6A 4I2QA 4I98B 1W1FA 2V1DA 3EFSA 2F5FA 4IRHA 5F0FA 2AKKA 3FXQA 1BKBA 1KD1C 1BI2A 1R7JA 1WFWA 4AILC 1XNRK 1MH3A 5E79C 1IW7F 1ZLJA 2IC3A 1EH7A 2Y9YA 2XHKA 1BI4B 1RESA 1QZ6A 3L4QA 2JUGA 2V4JC 3BQZA 4KH6A 4B9LA 1IBLK 4PJNA 3CUQA 2DO3A 5CVRA 4BRIA 1GDTA 1F36A 2GF7A 2HL5C 4L59A 4ZZLA 2VI6A 2FMYA 4OWRB 1BW5A 2QXFA 1SRLA 2YKNA 5GMKl 2V7ZA 1FBQA 4CYCA 2HHHK 3E3VA 1KSPA 2CQ7A 2CT4A 5EXWA 2HZTA 2LQWA 2MF2A 1VQKI 1K9MR 3R1XA 1VSHA 1YNZA 3JS6A 1XSXA 2W6LA 2YX7A 1TL3A 4LXCA 3K7AJ 1RDDA 3HOSA 3CDHA 3V9WA 1WI7A 2ZAEA 5JR3A 2YJEA 1E17A 4LF5K 2KIFA 3MN7A 2ITMA 3TAFA 4LFUA 4G8XA 3G4SI 5LJ5e 3CJ1A 3PO5A 4O5BA 2RJDA 3QICA 1VIEA 4C8QE 4IOXA 4B09A 2CS3A 2D0NA 2CUDA 5KCHA 4DU1A 2HSPA 3DTIA 3F0ZA 1RT5A 5M3FJ 3G2BA 4CJ3A 2DNUA 4DBHA 1YX3A 1OZ2A 4JAXA 1T3LA 2DJNA 2VGNA 2WSCE 1YW8A 3S17J 2CREA 3OSFA 1YJNT 2HHSA 2L8DA 1SPKA 2COMA 3QSUA 3JB9D 2P6SA 3M5AA 4XSZF 2D5RA 2RN7A 1YJ9T 3BLYA 1E6HA 4E9HA 1K6OA 1PP7U 3CDLA 1EV7A 2Z9OA 1G3YA 3VPZA 1B8IA 2HMAA 3HSBA 3CBPA 1M1KR 1VIFA 2IS2A 1S72T 3LDLA 4OGEA 2PJPA 1WQ7A 4OMMA 4E7SA 4FETA 4EMHA 4DUZK 4ZYEA 2M02A 1XMOK 2O8KA 1ZLKA 1EKEA 2NOEA 1W7PB 2BGGA 3R61A 2PG4A 2M7BA 1I27A 2I7NA 1T3SA 2Q2RA 2OFIA 4QS8A 3DKXA 2ZNYA 4X6AJ 1FMVA 4JI5K 1H8KA 3R6SA 2P0WA 1TK0A 5F1RA 3A0HC 1VUBA 3WUHA 4IFVA 1SFKA 1YF5L 4FM0A 1ETOA 1B59A 2ENMA 1XMQK 2D4WA 2ZJQF 4C2MJ 4CGIA 1T05A 2VJ4A 2OAUA 4AF1A 4OJRA 4FJJA 2RH2A 5GMKi 2QKBA 4FJ5A 2PQWA 2GOXB 1BBZA 3BP8A 2E5LK 1XNIA 3TCJA 2MI6A 3HRTA 3EUHC 4ILHA 3EE8A 4BEHB 2B0LA 4I01A 3IS9A 1WAJA 1KQ2A 5D3GA 1I81A 1V76A 5B8HA 3P4IA 2KQ2A 3KP7A 1R22A 1J5EK 3MEGA 3A8HB 2W57A 1TKXA 3L00A 5HS9A 4B1RA 3T5XA 3K69A 4IRIA 1VSKA 1IO6A 1EETA 4BRFA 5C44J 3HRMA 4HRIA 2O9LA 1VQ9Q 5KYWB 3OYAA 3IQLA 1U9OA 5IYCJ 1MWMA 4Y52J 4CJLA 1D8YA 1JUSA 4O8KA 2ZJRF 4V2FA 4Z4CA 3T9NA 4E1JA 1R0AA 3AAPA 4XH4A 4KGVB 3GL1A 3OS1A 1XHZA 1TQIA 1VSIA 2RKHA 5CYMA 2XAGA 1DIZA 3SHWA 5J26A 5DM6F 2KLOA 4N9HA 5CO7A 4AM6A 3CCUI 1WWXA 3TSZA 4C92B 2GXBA 2VT3A 4D7NA 3GTQJ 1FIPA 3CCQA 4CIEA 1RKTA 4FVMA 1PCXA 2AT1B 2DYRH 3ENBA 3M8JA 3AVGA 1NK3P 2G8UA 1T0JA 2LKSA 2HSTA 1FTTA 3RBBB 2KIUA 2GWJA 3QBXA 5E8IA 1YITT 5M5YJ 3TVTA 1MV3A 4FOIA 3PIPF 4C92G 4E0DA 2R7WA 4UXNA 1K4TA 2KHOA 2QQAA 4FPBA 4FLUA 1YP5A 2HYJA 1DGRM 4IUPA 1LWEA 3TAGA 2FL7A 3ZSRA 4NOYA 4OMFB 3AO4A 3QEPA 2WAQN 1MDUB 1DPRA 4M9SA 4HNVA 2JA8J 2M0CA 2XKOA 1JXEA 4E7IA 1UAXA 4N76A 4RAZA 3RR6A 5BREA 3U21A 3HUGA 3LLRA 3S2WA 4ISFA 3MKWB 5BN9A 4HF2A 2LSOA 1ETYA 1ZG1A 3K59A 2HBWA 4BQAA 1RLQC 5A2QE 1Y0MA 1VQ6N 3JB9J 1TK8A 2DRKA 4FO0A 4J7FA 4EM2A 1U45A 2O5RA 3SFMA 3A8LB 2BGCA 1HKCA 4J9EA 1PYVA 1VQ7N 4B1ZA 1T39A 2OTLN 2X0LA 1JLCA 3MEUA 3ZSVA 1I1GA 4LF8K 4OKJA 3QINA 2OU2A 3ZQQA 2G8FA 1O3TA 3GTOJ 1J59A 4BD3A 4YTLA 3CC4N 2F4MB 3UKUB 1WJSA 2DBBA 3O9RA 3P83D 2CP7A 2Q1ZB 2AO9A 1QVTA 3CFOA 5CQEA 5DK5A 2HVQA 3SEQA 4CYDA 3K4KA 2EGEA 3OW2P 2CQKA 3QO3A 4M77B 4MEXF 4PJOC 3BG5A 3BTIA 3LCNA 3HTUA 2G7UA 4GRIA 3TMOA 2JA7J 3U4LA 1QQNA 5K14A 3CMEN 4A57A 2HNIA 2LZ6B 3I56I 4KKOA 4E3SA 4V19K 2VXZA 1QNTA 4XU3A 5J4VA 1D1AA 4YDUA 4EA5A 2IOCA 3JCMX 8AT1B 5DUIA 2J7IA 8ATCB 3HOWJ 1ETWA 4NXNK 1NNEA 3P8HA 2FPEA 4BG8A 1RC9A 3RSNA 1H89C 1OKJA 2EPFA 3HT3A 4RTZA 2A5XA 1YJWA 1HNVA 2M2EA 1ESVA 1S3JA 1FMKA 2F4OB 2GEMA 1ZRDA 5FKOA 3CJAA 2AZVA 2P9PA 4HHTA 1TU0B 2Y0SA 1TTHB 1SZ2A 4PJLA 3O1WA 1T0FC 4GMJB 2KDSA 3M9AA 4DOWA 2SRCA 5J2MA 3M57A 2XICA 3L42A 1YIJT 3E1YA 1MDMB 2DY4A 3O6WA 1QLYA 2RJCA 3DU5A 5A0GA 3D6RA 2JTEA 2Y4YA 1OCZH 4HPQA 4C23A 3BGRA 1FC3A 5DDGA 3A02A 1PG5B 2DYBA 2RD1A 3THXB 1S6LA 2V9PA 2RNGA 4QCLA 3C3WA 1W2BM 3MX2A 2QKLB 2K9GA 3SQ0A 3SB2A 1NKCA 2MOXA 4GDFA 2DJQA 1C0TA 1X75C 1OLTA 2FEZA 1USSA 2X4JA 5CE3A 4D9JA 2F4VK 1U06A 1YN8A 4IUTA 4YNQA 1LWWA 3A98A 5AYFA 2FB7A 3A1YA 5JFRA 4BC2A 4Y4RA 1K0SA 2P84A 3A5ZB 3DMJA 1B1BA 5H20A 3SJHA 3NTIA 3IH2A 2HD0A 2BHYA 3O8HA 2RPNA 3RMSA 4BGBA 5AQZA 1WI3A 2V1QA 3QFUA 2NRRA 5B1AH 3KWGA 3DEWA 4B47A 1XB4A 2JWLA 3S93A 1MSFC 4NCGA 1MHNA 1L3SA 4JDSA 3BDDA 1NGAA 4DV2K 2ACJA 3F5TA 4CVNE 1U04A 3OGDA 2LX7A 4M3BA 2W03A 5M1QA 2O4IA 3C65A 3I0TA 1XQHA 4PFZA 3TP3A 1YJNN 3KK1A 2KRNA 4IO8A 1K73U 1I5LA 4IRGA 3MXMA 5KE3A 1Z77A 3WTZA 3B73A 1Q86O 4EFHA 4X1VA 1T6DA 3CVTA 3DLKA 5CR2A 3URGA 1S72N 4QPOA 3NMZC 2XF6A 1B9FA 2OZUA 2P5OA 4RGRA 1M2OA 1JLGA 3VF6A 4RM3A 1IAWA 2NRZA 5GANf 1M1KO 2W40A 4ZTFA 3CJQB 4FZXC 4HSBA 5LD2C 4ICLA 1UE9A 4AHUA 2ATCB 4C30A 2HHTA 2CP2A 4AHTA 1P9QC 1N32K 4HX4A 2DQRA 2A0FB 2P9SA 2DTUA 5DEQA 4NC8A 4N4HA 2O8EA 4ELUA 3RDVA 1LJOA 2PZSA 2HOTA 2UUBK 4KRTA 1FY7A 1WJDA 4CGJA 1KD1R 1YVUA 3E9LA 4MEYF 3WU2C 2RV8A 3ULEB 3C6HA 3C12A 1RT3A 2ZPEB 4GO1A 2ZPFB 1PU6A 2ZBKA 1Y1WJ 2VODA 5LJ3g 1ORPA 3CCLT 3D5SC 4M3WA 1YJ9Q 1UB9A 3B6CA 3DLLF 1ZBUA 4FX0A 4J9GA 1IXSB 1GLDG 4HEA2 3NGZA 1Y0NA 1WJAA 3LWMA 4JI8K 5D8KB 3VKIA 1KGSA 4JJBA 4BC5A 2K3FA 1V4RA 3SMPA 4OB0B 3EUAA 5AIQA 4DYRA 4IOCL 3G7ZA 4Y13A 3SAGA 2HYGD 2N8GA 4ELZC 1FWZA 3DP7A 2PUKB 3FSPA 4XK4A 4YG2F 2DA3A 2V1NA 3X20B 3H08A 4JI2K 1MGQA 1R58A 2B7EA 1MUZA 5BPIA 3M0PA 3ZMZA 1C1AA 2CZ0B 1J7KA 4PGGA 5GMKe 1M5Q1 2GXAA 2QBYB 2X4YA 5GAN8 2D0PA 1FN7A 2AA4A 5CQXA 1WHGA 5KYYA 4M75C 4CCMA 1S6PA 3CI5A 1RAHB 1NJIO 4XKCA 1W6XA 1AWOA 2HNDA 2L0AA 3M9QA 1EX4A 1B9NA 1IC8A 1LKXA 3CCJQ 5LJ3j 2FO0A 3EUHA 4MO5A 1FOXA 2CH4W 4F52A 3M8SA 1GCPA 3DXMA 4CD1A 3GG4A 3ULRB 1O3SA 3VRYA 1D0YA 2J05A 3AO1A 4JJDA 3CEYA 3X28B 4C1NK 3QEWA 2J06A 3ZX3A 4D1QA 5EZGA 1X69A 1BUPA 2FBYA 1YHQT 4CJ5A 4JBAA 3PVQA 3HSTB 1SKSA 3H36A 1G3TA 1QVGA 2BE7D 1WHLA 4CGFA 3HYFA 3DLHA 1WBDA 2NOZA 3DLMA 2ME6A 2DMTA 5FFZA 2RF0A 4LG0A 4EHUA 5L3CA 1HYVA 5KAIC 4E6KG 3JRDA 4BG9A 4JHDB 3QG1A 1PU8A 1M4ZA 2EFIA 4HSRA 3QNNA 4IIMA 3ZMDA 1R8OB 4RB3C 2XHBA 4FJHA 3K5MA 1JJ2S 4DTJA 1HCRA 2JUCA 1ZC6A 3LZIA 3SCXA 2VC0A 1YCSB 3DRSA 4CJWA 1W7AA 1QPMA 3T0YA 3SFIA 4IUQA 4RB2C 4B3SK 4HLXA 1RI9A 2F7TA 1EBMA 4BGDA 3S15J 3LA3A 4EMGA 2LBFA 1YITQ 1PP8F 1KG5A 4FJ8A 1VSFA 5EEGA 4CERA 2Y4XA 3HK2A 1X27A 4QSHA 3RNJA 2MD0A 3VYUB 3G0QA 3SUPA 2WOMA 1A0NB 4N4NB 4V2GA 5B5EC 3AVNA 4CGGA 3HTSB 1FK9A 1EH6A 2JOYA 1WZOA 1O3QA 4MQ9F 4OX9K 4MFDA 2V9VA 2RHZA 1UG1A 1U6ZA 1ETQA 4UV8A 2MSYA 3ZMVA 4DR7K 4IFYA 4P9FA 2R7RA 2Z33A 2P8TA 3KLNA 2BE9B 4XEIA 1Q81C 1JKOC 2E35A 3E6CC 5AQIA 1OQKA 4G9ZA 1B9MA 2IT0A 1UA0A 2NS0A 3VSLA 4HCBA 1NGNA 1SKRA 2P6TA 3VOEA 3O80A 4EHTA 3OH9A 5FLVA 1W4SA 3CPWA 2QA4A 2CYYA 2FHDA 1R1TA 4A3LJ 1IG7A 1Q7YC 1MJAA 3CCMI 5C25A 1MKMA 3EYIA 2P9NB 4JRQA 2Q97A 2JVVA 1RTHA 4BJ5C 2NYSA 5DCMA 6AT1B 1VQMQ 4X62K 4R55A 4KIFA 3ZQCA 3BY7A 4V2SA 1ILYA 2EINH 3N97A 1X2KA 3M0RA 1YIJN 1BGXT 3VEWA 4K8ZA 2JGUA 3PFYA 3I9V2 2OTJQ 3D2FB 3TDUC 1TL8A 3LP3A 3QQAA 1G8XA 5LBQA 1W0UA 1G6NA 2QG9B 4BC4A 1IN5A 1KO9A 2HSEB 4H5WA 3RIRA 3GYHX 3VW4A 4X34A 4DQPA 4HSTA 3U2RA 1MGTA 4DR4K 2W1OA 4B3AA 1LJ9A 2Z3YA 1ON1A 4Z4GA 1X9JA 3AG1H 2E64A 1FIAA 5DUKA 1VQ4I 1I1SA 1WSEA 1XDUA 3GOIA 2K57A 3SZ2A 4FK2A 2ZO4A 2RGVA 2DZCA 2YU9J 4QW2A 1HJRA 3D0PA 1QO0D 1A5XA 4A6DA 1D1BA 4BJTA 1TLHB 2LJ0A 1XGOA 4RA2A 5LY3A 4DS4A 1Q8IA 1CKAA 2E41A 4RTYA 1KG2A 2Z16A 2QTDA 1ASVA 4C8LA 3H92A 1RDUA 5BOXA 1VQKA 2KRHA 2DTOA 3LGLA 1AWCA 5JMVA 3M8RA 4CZIA 2KBTA 3CIPA 2JM8A 1EFNA 1PD1A 3OYEA 2HDDA 2KFDA 3M53A 3KEOA 3R3LA 4BR2A 3PFSA 5D6EA 1NG2A 3LFUA 5FLXZ 5C4XJ 4O5VA 2EQKA 2NRTA 4RTFD 2DFHA 3OS0A 5D5UB 1GLJO 2FX0A 2V51B 3PUFA 3RWUA 2OANA 4KH5A 3PNTA 4I99C 2EWSA 1VQ5T 3G4SA 3JCMe 3O3HA 3C6AA 2QGGA 2X1DA 4DZJA 1A36A 4Y0WA 4OFAA 1VQ8Q 2WWYA 4M3FA 2GA1A 2RREA 4F04B 1R77A 2J4RA 2FA5A 3J7AP 2E6MA 3MPUB 1SD6A 2F9WA 1XX5A 1JHHA 4HVUA 2IP2A 4BY6C 4OINF 4G7HF 5EY4A 1ZKGA 3K2AA 4KN7X 3RR7A 3KP5A 1BG3A 4BWJA 2F8SA 4A62A 5GAMg 4M7DC 1D3YA 2G8WA 1F1BB 4HV5A 2OJED 2P0QA 1KQSM 1J53A 3QWLA 2BH1A 3VV0A 4ID5A 1FXXA 1KCFA 3MZHA 1BISA 1Z67A 1ENHA 1N9RA 2Y75A 1PWTA 2KFZA 3PGGA 4BB7A 2DA5A 2NRHA 1RT1A 4MDXA 2FSNA 2QEXT 1P92A 2EHGA 3MEVA 4YFUA 1OCCH 4FL9A 5KE2A 3IDHA 3VYSB 4PKHA 5LJ5f 2DL8A 1VQNT 2O8XA 2L7KA 3Q3SA 1W2BA 1YE9A 3OOUA 3DPTA 3S3OA 2UUAK 4QVCA 4NC6A 2EA4A 1VK0A 3HM9A 1SMTA 4F3OA 4IURA 1HNXK 3TPQA 2Z1DA 3S1QJ 4FTHA 3CERA 1N8RC 1K8AO 3HBTA 5EGOA 4R0KA 4D8DA 4B1XB 2BOLA 4E7ZA 4DNCA 1S29A 2P9UA 1GLAG 3KWIA 1KZHA 3CQXA 2YWWA 3CCVT 2VBXA 1DTTA 4XTZA 2KZGA 2MWOA 2IA1A 1HKBA 3EE9A 5EF6A 3THYB 1KONA 4NYFA 3WXMB 1JQQA 2CP3A 1VRUA 3G6ET 2FF3B 5BQTA 2XB0X 3DRRA 4ETSA 4EJOA 1U2VB 4W5OA 5HDNA 1QCFA 1Z9ZA 3ZT2A 3VA0A 3TW6A 1B7TA 1GRIA 5C6SA 4DV7K 5A0DA 1FYNA 2HQNA 4F55A 1OQYA 4E47A 3CCLQ 3AL0C 3M0TA 4R5PA 4F7UA 4CZKA 4HX8A 4LLGF 4WYBA 1AWXA 4DTPA 1M9SA 3EPZA 3NTKA 3CCUA 1OCOH 3FRNA 5AQUA 1T95A 4JN4A 1RGIA 5GADJ 2GGRA 1YHQN 4PJOB 2X74A 4M78C 4BQOA 5JHFA 4EEFG 2JWTA 4NL2A 1GLEG 2E5QA 3FK6A 1XDSA 1U8BA 4U7DA 4A3IJ 1X3MA 2E6LA 2E5KA 3L1AA 3L1PA 4YIFA 1VQOQ 2KNBB 5MLCQ 1Y97A 1SUQA 4Y17A 3K58A 4PJOG 2FXUA 4OMOA 4ESJA 2KIMA 4I6MB 3KLOA 2LTPA 4LDUA 4KFBA 4F7ZA 2Q3SA 2K9NA 4EMKB 2FXAA 2IGNA 1KU3A 2IS3A 4MZTA 3SNNA 3CCST 4L8RB 2ISYA 4RLQA 4DV1K 3LQQA 1QSLA 3VQAA 3RKYA 1BJZA 3THKA 4LJZF 3EYYA 1JI8A 2XDDA 5AQKA 3WVEB 4Z0UA 4A5NA 3ISPA 3LSTA 5K7FA 2LR8A 4A12A 3VQ5A 3IC7A 1UZCA 3NFAA 3GVAA 3T3FA 3VQ7A 2HPMA 3AAFA 3PNWC 3FDRA 1K9AA 3PSFA 1NGEA 3DU6A 3SQ2A 3HM5A 1YWPA 1QHAA 2KSSA 4DBRA 3MKYB 2IIRA 2CZ1B 2ZCFB 5CVVA 2ZSHB 4KISA 2DXBA 3DTEA 4AHSA 3MX5A 2DXTA 2RB6A 2E71A 3DBLB 5DTDA 1VQ6I 3WTUC 3PJRA 1OYIA