3OS0A

Pfv strand transfer complex (stc) at 2.81 a resolution
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
365
structure length
365
Chain Sequence
AELDQLLQGHYIKGYPKQYTYFLEDGKVKVSRPEGVKIIPPQSDRQKIVLQAHNLAHTGREATLLKIANLYWWPNMRKDVVKQLGRCQQCLITNASNKASGPILRPDRPQKPFDKFFIDYIGPLPPSQGYLYVLVVVDGMTGFTWLYPTKAPSTSATVKSLNVLTSIAIPKVIHSDQGAAFTSSTFAEWAKERGIHLEFSTPYHPQSSGKVERKNSDIKRLLTKLLVGRPTKWYDLLPVVQLALNNTYSPVLKYTPHQLLFGIDSNTPFANQDTLDLTREEELSLLQEIRTSLYHPSTPPASSRSWSPVVGQLVQERVARPASLRPRWHKPSTVLKVLNPRTVVILDHLGNNRTVSIDNLKPTSH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The mechanism of retroviral integration from X-ray structures of its key intermediates
pubmed doi rcsb
source organism Human spumaretrovirus
molecule tags Recombination/dna
molecule keywords Integrase
total genus 103
structure length 365
sequence length 365
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2010-09-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
A PF17921 Integrase_H2C2 Integrase zinc binding domain
A PF18103 SH3_11 Retroviral integrase C-terminal SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2300 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3os0A04
1.10.340.70 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Endonuclease III; domain 1 3os0A01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3os0A02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3os0A03
1KLMA 3P5JA 3KKSA 3VQ4A 2XY7A 2YNGA 3C6UA 3O3FA 4LH5A 1W0HA 3VQAA 2RJFA 4E1NA 3CFRA 2QXFA 1Q9XA 4FU6A 5KGWA 2DFEA 5KI6A 3DOLA 4OVAA 4A4GA 4ZTJA 1DLOA 4GVMA 1KFDA 2R7YA 3TARA 1NJZA 2JTFA 4IURA 4DSKA 3DLHA 3DRSA 4RW9A 4E19A 3HM9A 1D5AA 4ELTA 4FW2A 3RR7A 3H8ZA 4CIGA 4CJ5A 2IG0A 1WJRA 1TAQA 3ZT1A 4IUQA 5DK5A 1U45A 4M3YA 5C0MA 2G8VA 2ZQBA 3M8PA 4C5HA 4IDKA 3VQDA 3V81A 3MEUA 4M41A 3VN5A 1VSHA 4FJIA 3WNFA 2LSNA 3CFOA 2RF2A 4CEOA 3OYHA 4O4GA 4JLHA 3OMCA 1BL3A 3AVAA 4OVLA 3ZSRA 1ITGA 4CGDA 4JS5A 1REVA 2HB5A 4CGGA 1A5WA 3PX0A 3H08A 1LWFA 1VSIA 5IN1A 3VQ5A 4Z4FA 5D6XA 1TKDA 3SD4A 3QBYA 3VQCA 2K3XA 1ZBFA 3IRXA 4C8NA 1C6VA 3VQPA 4IFYA 4KHQA 4QOZB 4DLEA 3PO5A 3LZIA 4M3ZA 3CYMA 2RPIA 1JKHA 2EHGA 1WSJA 2WACA 2BANA 4M3RA 3V9ZA 2XY6A 4CIFA 4PL6A 5M9OA 3TAGA 4J2DA 3VQBA 2BE2A 4N4GA 4DTPA 4KAZA 2DTUA 2IDOA 4XIUA 4IG3A 5I3UA 4HVJA 2F5KA 2F96A 3PNWC 4CRIA 1XI1A 5KRTA 2YNFA 4DSFA 3RR8A 1K6YA 1XC9A 3L2RA 4EDUA 2HHWA 2Z1IA 4AHUA 2PQWA 3VQ7A 1OYXA 3TABA 4LSNA 4CJLA 4KHUA 4OLAA 4O0IA 3BDPA 1SSFA 3ASKA 3C94A 1HQUA 2E6NA 3OYGA 1KVAA 1U04A 3I0SA 4PLLA 5C6SA 3EZ5A 4FLZA 4CJ3A 4EZ9A 4L8RB 3UWNA 5FRMA 1VRUA 1NKEA 1WJQA 1LW2A 1RBSA 4Z4IA 3P1GA 3D0PA 5KCHA 1O1WA 2E4LA 2EQUA 3KK2A 3SQ2A 3SUOA 1RI0A 4OKEA 3NH0A 4OPJA 3NNQA 1HQEA 4B08A 4KB0A 1SL2A 2OZMA 4CHPA 3MP8A 3V4IA 4QVZA 2OPPA 2B8AA 1I39A 2G3RA 3NTKA 2IOCA 3FC3A 2XHBA 1SKSA 4IBNA 3SUNA 1KRPA 4PLIA 2W42A 2IC3A 1YTUA 3OVNA 1JL1A 2XDPA 3PMTA 5C25A 1S1TA 2RHZA 3QEVA 3CFPA 1VRTA 4B9WA 3B6PA 3ZSOA 4CE9A 2HNZA 5FROA 4ID1A 1U4BA 3MEGA 3OB9A 1SUQA 2QKBA 4LD0A 3QEPA 1SL1A 4AHTA 4DFPA 4ELVA 3F70A 1WSIA 3RMBA 3DLRA 2HVIA 2GFUA 4CFDA 3OYIA 1VSMA 3SV4A 3PY8A 3OYFA 1TKZA 3HP9A 4AHRA 2VWJA 1KHCA 4N5SA 2M16A 1FK9A 1KFSA 3LLRA 1NKCA 2RN2A 3DLGA 4BD3A 2X78A 1WAJA 2JLEA 4O5BA 1TV6A 2YNIA 4OLBA 1BI4B 3I0RA 3RMAA 3RRGA 4O0JA 4FJXA 4RW4A 3WNGA 1RTHA 3AO4A 4DQSA 4BE2A 1BQMA 2Z1JA 2Z1HA 1GOBA 1JLAA 1KLNA 1RTIA 3OYDA 4J2BA 1FKPA 5JS2A 3TWHA 3LGLA 3G0ZA 1QE1A 4DU4A 4KPYA 3BDLA 3ZSZA 1NK9A 1DTTA 1BHLA 3OS2A 4FCYA 1A5VA 2RO0A 3TR8A 4F8RA 2WONA 3AVIA 4CK2A 4FZXC 1NK6A 3L2QA 4FZZA 1WAFA 3ZSVA 1RDBA 4KO0A 5HRRA 5HP1A 4OKJA 4JRPA 3L42A 1WNSA 3AO5A 1TKXA 1RT1A 4LY7A 2Y1JA 4Z4EA 1NK4A 1WGSA 3HK2A 1ZBUA 3RMDA 3S6WA 2D0CA 1DTQA 1IKXA 3KLHA 4FM0A 1C0TA 3HVTA 1C1AA 4IFVA 4WE1A 3QJ6A 3HPGA 4CJ4A 4CHQA 3NAEA 2G8HA 1IKVA 2Y1IA 4BACA 4CEDA 4CGJA 3K58A 4CEFA 4W5TA 4AH9A 4FM2A 2RHYA 3E9GA 3TI0A 1NOZA 4CHOA 2JGUA 3ISNC 1CZBA 5CZ1A 3AVJA 3OYLA 2ETJA 4IUUA 3HYFA 3SQ1A 4FJ8A 3MEAA 1B9FA 4CGIA 3PV8A 2F8SA 4Z4CA 3SCXA 1WSEA 3QEXA 4NYFA 2FHDA 4I2QA 4B8AB 4K8ZA 3VA3A 4DF4A 1KSPA 3NF7A 3AV9A 1YTAA 4C8OA 3KK1A 1NJYA 1D9DA 3SQ4A 4KTQA 2HHVA 2YV0X 1QHTA 1RT6A 4I9LA 1RT2A 2M0OA 3ZEHA 3FFIA 4K8XA 4BDZA 5DMRA 3ZSYA 3DLKA 4LH4A 4E0DA 4RG2A 3LGFA 4KHSA 4CK3A 4H4OA 3QIPA 2DIGA 3AO2A 3KLFA 3TAEA 4CCHA 3NFAA 1RDCA 1NOYA 4W5OA 4JRQA 2RI2A 1HYVA 2KW4A 3JSMA 4F3OA 1KVBA 4DU3A 2P5GA 1IO2A 4CF0A 3OY9A 1EKEA 4O55A 4DS4A 1TK0A 2P5OA 2G8IA 1UOCA 2O4XA 1KVCA 1L3VA 3U6FA 1G15A 3HVRA 2IAJA 3QIIA 2Q3SA 2RI5A 4G1QA 2ATQA 3ALYA 2RJEA 3V1QA 1JLGA 3E9FA 3AO1A 3CEYA 4CFAA 4OPKA 1GOCA 4CF2A 4PQUA 2D5RA 1B9DA 1BQNA 4FLTA 1NKBA 2IGIA 2PY5A 5KE3A 4FK4A 3AVNA 1RT5A 4ZHRA 1U49A 4DQPA 4CERA 4FJMA 3DLMA 1RT7A 1ZBHA 2X35A 4DTJA 4MFBA 4M42A 1RBVA 1BIUA 3QETA 4FJKA 3NTIA 3ITHA 3LP3A 3HT3A 3K5LA 1HYSA 1IKWA 2HHQA 3K2PA 2PYLA 2G8WA 3OJSA 4M3WA 1N5YA 1J54A 3NF6A 2MWPA 4N47A 2B4JA 4CK1A 3KLGA 3QESA 4ELUA 1UA1A 1WN7A 2YKMA 1RNHA 4A4HA 4CEZA 4DTSA 1TVRA 4DTNA 3QO9A 2QQRA 3LP1A 3E01A 3DLBA 4B3OA 3S9HA 2L8DA 2L89A 2I5JA 3WNHA 1NK0A 1RBUA 1EXQA 3ME9A 1S1WA 3HP6A 2RJDA 1CXUA 1XWLA 3PUFA 3KK3A 3EY1A 1X9MA 3C4SA 1Z26A 2EQKA 3META 4A4FA 3O3HA 4HCCA 4M3XA 4CHNA 3OQ5A 5D6WA 2QKKA 3PO4A 3M9QA 3MEWA 4LSLA 1IG9A 4NS5A 2Z1GA 3UIQA 2VG7A 3A2FA 3HJFA 3SYZA 5J2PA 3AVCA 1F21A 1OI1A 4DTMA 3LZJA 4E3SA 5SWMA 1L3SA 3DMJA 5HRNA 4B8CA 1EX4A 5CZ2A 4YNQA 2X4WA 2YHBA 4UQGA 4CHYA 5KTQA 3B6OA 3SPYA 1VSKA 1QTMA 3IAYA 2BGGA 4B9TA 2KFNA 4HUEA 4H4MA 4BE1A 3BGRA 4FLYA 2EKOA 4NZGA 2VG6A 4W5RA 3AA4A 3M8RA 4FJ9A 5D3GA 3AO3A 3TANA 2BDPA 3T19A 4E7IA 1H3ZA 1WSHA 1RCHA 5C42A 5SZTA 1CZ9A 1NK7A 2IS3A 2EQMA 3ULDA 1QS4A 3L3VA 3KLIA 5J2NA 2A1SA 4IG0A 4Q5WA 4R5PA 3AA5X 2X6NA 4RW6A 4B9LA 1WSFA 3PX6A 2E6MA 3K5OA 1X9SA 1W9HA 4EP4A 3LWLA 4CJTA 3RRHA 3C6TA 3HPHA 3C95A 3LAKA 3SJJA 3OYMA 1RBTA 4E7LA 4FVMA 1VSJA 1SKWA 4RW7A 4FLWA 1UAXA 1D8YA 1RT3A 3MEDA 1SL0A 1EP4A 2VWKA 3AVGA 3AVKA 1XNIA 2LRQA 4ID5A 1HNVA 4IUPA 4C5IA 3HL8A 2DFFA 4CF8A 4AILC 1J5OA 2DIQA 1QSYA 4UC4A 3DLEA 3MECA 1JLBA 4DG1A 4FJ5A 4HCBA 5J2MA 4N4HA 4DTXA 2DY4A 4BDPA 3KTQA 3MO8A 2OZSA 4CJEA 4DF8A 1Z25A 4FW1A 2P1JA 2BUDA 4KHNA 4A4EA 1VSEA 1NK5A 4QCLA 2RHUA 1CLQA 4Q0BA 4IUVA 4B9XA 3TAQA 5EU7A 5IAYA 1UWBA 5I42A 1I3AA 3RMCA 3V1RA 3WNEA 3AVLA 4DQIA 4F2SA 3OYAA 5C24A 3U3GA 4CFCA 3V6DA 1T03A 3H6ZA 3AVBA 4KTWA 4AHCA 2AJQA 3Q1JA 5FDLA 4CEAA 4CJWA 4CJVA 1S6PA 3SQ0A 3NF8A 2R5MA 4HHTA 4BDYA 1WLJA 2RHXA 3QEWA 3JYTA 1T7PA 4KB1A 1HJRA 1S9EA 2X6SA 3HPOA 2KQ2A 4RW8A 1NJXA 3LALA 4L59A 1VSLA 4I7FA 1RTDA 1RBRA 3O3GA 4JS4A 4X34A 3L2UA 1VSDA 3AA3A 1JLEA 3VQEA 1BI4A 1XHXA 4B9UA 2K3YA 3ZSQA 2OYQA 4FK0A 2HHUA 4DSLA 4KRFA 1N27A 4BWJA 4N56A 3NGIA 4J2AA 5CIUA 1YVUA 3LH0A 1KTQA 2YNHA 4RG8A 3ZSXA 2R58A 4KHWA 3LPUA 4M3TA 5HROA 3NBPA 4CECA 3M8SA 3LAMA 3LP0A 5CYMA 1OZ3A 3AVMA 3QNOA 3QEIA 1NK8A 1X9WA 2RI3A 1QSLA 4MQ3A 1JXBA 3OYJA 3DYAA 4ICLA 4QAGA 1ZBLA 3DM2A 4M45A 4CJRA 1WJSA 3V1OA 3D45A 2GV9A 4NCGA 1VK0A 3VQ8A 3SV3A 4FJJA 5J26A 4C5GA 2B6AA 4OGCA 3K59A 1BIZA 3KD1E 5D6YA 3O4NA 4CJQA 4W5QA 3LP2A 3LWMA 1N6QA 1YT3A 4FM1A 4Z0UA 1ASVA 1SV5A 3SUQA 3F9KA 3L2WA 4CGFA 4KI6A 3DI6A 4CJSA 2YRVA 2GFAA 1XHZA 2ZD1A 2GBZA 1FKOA 1NJWA 1S9GA 1X1PA 4CIEA 3RTVA 3SUPA 4LD6A 4BWMA 1ASUA 1JLQA 4H8KA 3S3MA 2RJCA 3OMGA 2L3RA 2P0KA 2XK0A 4DU1A 3V9XA 1HNIA 4IKFA 1LAVA 1S6QA 2RKIA 4GW6A 3ASMA 5CYQA 3NH1A 2PZSA 2OPRA 2G8UA 4CEBA 4ZTFA 2XRIA 4EP5A 3MXIA 4Q5VA 2M1HA 1MU2A 2X4XA 4OGEA 2EFIA 2HHSA 2F8TA 4PA1A 2A1RA 3ZSWA 2HQXA 1RTJA 4CF1A 3OYBA 3OJUA 4QQGA 2D9TA 2EQJA 3NGYA 4C8MA 3OYCA 1EETA 3AA2A 3KLEA 2X4YA 3SI6A 4M3UA 2XO7A 3K5NA 3K57A 5KRSA 1L5UA 3M8QA 4KFBA 2YKNA 4CESA 5HLFA 2FC0A 1C0MA 1JL2A 3G10A 3KJVA 5J2QA 3THVA 2NUBA 2ZE2A 4CF9A 2OA8A 2HVHA 3NCIA 1ZYQA 3KUFA 3MXJA 3K5MA 4PWDA 4DSEA 2D0AA 3KD5E 1RDDA 3LYIA 1S1UA 2OPSA 4HTUA 4C8KA 4F4KA 5HRSA 4AHVA 2HQEA 5CY4A 4C8LA 4CJUA 4FK2A 4B9SA 3HSTB 1GOAA 1LAWA 4CGHA 4E1MA 3UT1A 3OS1A 1LWEA 1IKYA 3O4QA 2FBTA 1VSFA 5KH6A 4DFMA 2HNYA 5FRNA 3NTHA 3T3FA 2XY5A 2G8KA 4B9VA 4C5EA 3EAEA 1S1XA 2LDMA 2OPQA 4Z02A 3DOKA 4CJFA 4FLXA 2WOMA 3DRRA 2R57A 3NF9A 1U47A 3VA0A 3ZT3A 3U3YA 4GMJB 1J9AA 3NGZA 3QERA 2KTQA 1HRHA 3AVHA 1RILA 3QLHA 4GY5A 1T8EA 2HHXA 2BIVA 3AVFA 4F2RA 4FZYA 4DS5A 3NH2A 2G8FA 1OZ2A 3MEVA 3CM6A 4PY5A 4QQ6A 3P8HA 4HCZA 4B9NA 4F3TA 4II1A 1LV5A 4E7KA 2ITGA 3CG7A 3FDRA 2LVMA 5K14A 4NCBA 4FJGA 1C1BA 2JZ2A 3VQQA 3F73A 5JS1A 3LX7A 2LCCA 4CJKA 2X74A 3DB4A 1A5XA 2BKDN 1JLFA 3LANA 1BGXT 3TAMA 3CQ8A 2YHAA 4E89A 3P8DA 1J53A 4FLUA 3RWUA 3SZ2A 3ZT0A 1Q8IA 1HYZA 3ZT2A 1D9FA 1IH7A 5HRPA 3TAFA 2DFHA 4DTOA 2O4GA 4OJRA 1L3UA 2HHTA 3ZCMA 4FLVA 4HUGA 1TGOA 3HXMA 4DWIA 4DSJA 1SKRA 4E7HA 1TL3A 4B9MA 4E7JA 4Y1DA 2VG5A 4AHSA 2P51A 1L3TA 5J39A 3LDSA 4DQRA 1TAUA 2E5QA 4DQQA 3V9WA 3MAQA 1T05A 4N76A 1JXEA 3P83D 3L8BA 1TK8A 4DSIA 5HBMA 4FYDA 3PMIA 3L3UA 4I9QA 3DRPA 3OS0A 1HPZA 5KGXA 4FJLA 4FXDA 3S3OA 1S5JA 3QINA 1RDAA 1CXQA 1TL1A 4CEQA 1MHNA 4YFUA 1RT4A 2FBYA 2R5AA 1BCMA 1TKTA 3NE6A 3KIOA 3MXMA 1TK5A 1QSSA 4KHYA 1JLCA 3FLGA 3OA6A 4CJPA 4FJNA 4KKOA 3VQ9A 1FXXA 1U48A 3IG1A 4CEEA 1UA0A 3MEEA 4DLGA 2KFZA 4DTUA 3QNNA 1R0AA 1WSGA 4IUTA 3GOXA 4KREA 5E41A 2KZMA 1Y97A 3HO1A 5J1EA 3OYNA 4DFKA 1KCFA 2E6LA 3OYEA 2XY8A 1BCOA 1S1VA 3CM5A 2MWOA 5KCOA 4N4IA 3NDKA 4CHZA 4Z4GA 4Y1CA 4NYNA 3QKJA 5KE2A 5T7BA 4W5NA 4QW2A 3IS9A 4CFBA 4DFJA 4BE0A 1Q9YA 4N41A 2RHIA 1C0UA 2QK9A 3V9UA 4KV8A 3MP6A 4HUFA 3OYKA 2NLUA 4EZ6A 4I2PA 4J2EA 3DB3A 1LW0A 4FJHA 1HMVA 3EYZA 4KI4A 2DAQA 2GF7A 2QQSA 1C1CA 2FBVA 2HNDA 4PUOA 3QIOA 3S3NA 4O44A 3PX4A 1G5VA 4Z4HA 2KZZA 2O4IA 1B92A 4DMNA 2HW3A 4FJ7A 3MP1A 2VYTA 3V9SA 2O4XB 2CKKA 3T1AA 4NCAA 1LWCA 4FL6A 4QQDA 4TSXA 3NHGA 3PFSA 2B5JA 3TAPA 2HMIA 3KKRA 2D0BA 1QQCA 2GUIA 3SPZA 3SNNA 3LPTA 1BISA 3L2VA 3VQ6A 3ZT4A 3I8DA 4DTRA 2PYJA 1ZBIA 2LTOA 2EX3A 4OKKA 3O8VA 1ASWA 4KTZA 2FBXA 3FEOA
chains in the Genus database with same CATH superfamily
2BZTA 3ULRB 1ZR2A 3DOLA 4FX0A 1R8OB 3EG9B 2QWLA 2Z2SB 4C23A 1OCPA 4ATOA 3MZYA 2VBXA 2Y1IA 2RF2A 4GKKK 4PJOA 3VQ5A 3M55A 5FLMJ 1YIJQ 3IRXA 4V19S 2OF7A 4CZGA 4JI3K 4OP0A 4DTPA 1JUSA 4LXCA 3VYHB 2ZJRF 4UY8O 1V5FA 2LT4A 3CMYA 2NOBA 4PZJA 1KVAA 4PLLA 2DOAA 2JTMA 1G4DA 1IBMK 1WJQA 3KP7A 2DBKA 1M5Q1 3JCMh 5JVHL 5HDKA 3R2XC 1QZYA 2JUFA 2G3RA 2J6OA 1YJWN 4KN4X 3VW4A 2A42A 1XDUA 3CPWM 3TREA 1S1TA 1VRTA 2E1CA 3TSUA 2YLBA 2R4GA 4XORA 4BRAA 2FF6A 2LP5A 4RTZA 2VWJA 4BI3A 1FK9A 3A4CA 4UVCA 2RN2A 2KNBB 1FPQA 1YITI 3DEEA 1BI4B 3IWZA 4WK8F 3I0RA 1YITN 4KITB 2L3QA 3LSPA 5GANg 4C92B 4BE2A 3VEWA 4KMFA 1WQWA 2GAUA 3O9SA 2X3WD 2F6CA 5BN9A 2M45A 1NK6A 1JGSA 2OZUA 2AHQA 1D3BA 3HK2A 1FX7A 3BZ6A 3KLHA 4M77B 4HXJA 4OU0A 1N9SA 3R61A 2F4VK 4G12A 1Z6TA 1R7JA 1AOJA 2LKSA 2WADA 1E3PA 2KVQG 1U06A 3S1MJ 1KQSA 1E17A 1VQKI 1LVKA 3ER0A 4M77G 2EB7A 2K9SA 2L9NA 3ZSYA 2DL7A 2HVRA 3AO2A 1R6RA 2DERA 3CMAI 2RI2A 1IO2A 1U8BA 3CWTA 1KD1R 4AIKA 3PVLA 1NGDA 2JS0A 1Q95G 3ALYA 3QPHA 1GOCA 4PQUA 2IAIA 4ZHRA 3CCSI 2GIZA 4KIBA 4M42A 3GTGJ 3QETA 3OW2A 2PBDA 4J9FA 2MWPA 4N47A 3HSFA 1TQIA 4MMKA 5LJ3e 2MW8A 4O5FA 4AIJA 1RBUA 1QBJA 1M1GA 1N77A 4Y52J 1M2VA 3GBQA 2EQKA 1UFMA 1Y0NA 1F4KA 4LFBK 4HV5A 4A5NA 2Z0WA 3ZN1A 3DTIA 4BKXA 2IPOB 1RLQC 3EFOA 2O5RA 3RVCA 2VUBA 1FYMA 3K9JA 4E3SA 4OOIA 3I35A 2QTVA 2D1VA 1JUMA 1BC8C 1XDSA 2CUEA 4XKBA 3QB0A 3LSIA 5AZIA 1EWRA 2FSJA 4YRVA 2NRRA 5LFAA 4FL9A 1PVSA 1E2XA 5CPRB 3K1MA 2RD1A 3HRUA 4A2UA 3EG0A 3GFJA 1DIZA 3I53A 1EP4A 4BAYA 3MKZA 3O8HA 1QMCA 4PL7A 4FJ5A 4D7MA 2GIVA 3QPLA 4FW1A 1BU6O 3LDNA 5AQUA 1OPCA 2EWSA 2D8HA 5EU7A 3SFIA 1TWBA 1RDUA 1GXPA 1PC0A 4G6DA 2AJQA 3SQ0A 4JKEA 2P0QA 1T7PA 1XB4A 2KZVA 4X34A 1NK3P 1BI4A 4J83A 2DAOA 1YWOA 4JI2K 3LPUA 3H41A 4MFDA 3LP0A 4Q5SF 5KYWA 2HOSA 2HSPA 3V1OA 1ZQ3P 5J26A 3VB2A 3LWMA 2I8DA 1YT3A 1R36A 3GTKJ 4FM1A 4XSXF 1TWAJ 4C8QF 3GL1A 3JB9F 1RAAB 2DLPA 4CIEA 1ODDA 2NOGA 1YYVA 4GYIA 3O4WA 1HF0A 5GAOn 3LWIA 2PLYA 3A8GB 2IVWA 4M3UA 5GANj 4PKIA 3GLXA 1XX5A 1YHQA 3RI4A 5IY5H 5AIQA 1W2BA 5JLXA 3LYIA 2BZYA 1OYWA 4F4KA 3C18A 5JR3A 3CF2A 2HL3A 5DM6F 2JMCA 2V79A 2HNYA 5E20A 5FU7C 3U9DA 4DUZK 1KQ9A 2CUDA 1S6LA 3IH7A 3U3YA 5C4XJ 3CLOA 5GAN5 1YX5A 3KFWX 3CBPA 1JRIA 4X9DA 2OC6A 2AZSA 1K78B 2LRDA 4QPQA 2L7ZA 2AKLA 2E5NA 2AS5F 5JS1A 4WXCA 3A02A 3SMSA 1NYFA 4J5YA 1SL2A 3CCEN 1BN5A 3SEZA 2M3AA 1Y7XA 4OJRA 1YVNA 4CW7B 3DCFA 4BC5A 4AYBN 2JSPA 3CMAA 3H6EA 1ZBJA 2DMPA 2RM4A 3GZ5A 4DR2K 1XG7A 1F43A 4HZFA 3UKGA 2LREA 3L0QA 1W0UA 2P9PA 1TK5A 4XH5A 4KKOA 2Z5UA 1VQ4Q 4IX7A 3LMMA 2EV5A 5E41A 1W2BP 3OYNA 1TUCA 2O8FA 2VXEA 3S6IA 3J7ZI 3VMFB 1BI0A 2JPCA 3F6VA 2QK9A 1FBUA 2V6CA 4KV8A 1G8XA 3OYKA 4LB5A 1I50J 2VKEA 4PUOA 2FBHA 2KI7A 4C92D 3RNJA 3PX4A 2HW3A 1W2BM 3T1AA 1YJNA 2BOLA 3JCMV 2HXOA 1TLHB 2KSSA 1D3YA 1HR0K 3QHSA 4D7NA 5LJ5d 1ASWA 4FYVB 4JV5K 3I56N 2GTJA 4JN4A 4JD2B 3RSEA 3VS2A 1X3ZB 2XG8D 1D5YA 1TH7A 3DU6A 5FWCA 1MBJA 4CJ5A 3NGPA 3MN9A 2ZQBA 4EHUA 4HAMA 2LJ1A 1M9SA 3ZSRA 2I7NA 1TWCJ 1T0FC 2DD5A 1A5WA 3PX0A 2ZJPL 2JHJA 1WEGA 1C6VA 1YI2T 2EHGA 1V4TA 3H1CA 3VDXA 4E9EA 2XU8A 4X66K 3ZMTA 5M9OA 3TAGA 2L0AA 3X2QH 3VS3A 3CCSA 2ZGYA 3I0XA 3THXA 3TABA 5LD2C 3TQ7P 3VYSB 4LDWA 3BY7A 4BL0B 1T56A 4KGXB 4HVUA 2J5OA 1JKOC 3P1GA 4BVPA 2E4LA 5JLFA 4DZJA 1KYWA 1LQ1A 1HQEA 3VUZA 1G3SA 2M8GX 4GV9A 3D2FB 3OBWA 1KO9A 5FPDA 2IOCA 1QRYA 3CCRA 5AQHA 4JLGA 1YW7A 1QVTA 1KD1C 2ZJQL 1JCFA 1ZG5A 3OWTA 1JJ2A 2LNVA 4QVCA 3QWLA 1JT6A 1NGBA 1NKCA 2GOXB 2GTDA 1WAJA 3FJ5A 4X6AJ 3RRGA 1Y96B 4A5MA 3BZCA 4JKGB 3DAWA 3WNGA 3CC4T 4A93J 1RTIA 3BCBA 4AFQC 1SMYF 2LF7A 3OS2A 1A5VA 1GLNA 1SANA 2H3JA 4CYDA 3I9QA 3E6CC 5DYMA 3VWBA 1SF9A 2ZSHB 1MH4A 1JJ6C 1SRLA 1WGSA 1V4SA 5KAIC 4IFVA 4CHQA 3HTVA 2V7FA 4CEFA 2I10A 3K9TA 1Y57A 5CKFA 2VT3A 1BIBA 3FKJA 5K7FA 3H0DA 3WVEB 3CCUN 4XRSA 4MO4A 2H6BA 4C8QA 2QGGA 2H27A 5EZHA 2QWMA 4F52A 3I54A 1PRMC 3GDQA 5KK1A 1D4XA 4EMKB 4CF0A 5IT9K 2FSNA 1YRNA 3SAHA 1L3VA 4A6DA 1SHFA 2BVLA 3EHRA 3MFKA 3E9FA 3G1LA 1KK7A 3CMEA 1EFNA 3MD2A 1BQNA 1KG3A 3BWGA 2HHQA 1OFCX 2J06A 2DA3A 2MH2A 1C0GA 1NM1A 3K0SA 1Q7YO 4QPOA 4DV0K 3BR2A 2HL5C 2YX7A 1FMVA 3FLCO 4P55A 1FYLA 1XWLA 3CJNA 3UPUA 3V7SA 4IJAA 1B59A 5D6WA 2PMZN 2KDOA 4TVRA 1ZSGA 3A2FA 4OFEA 3AVCA 1IGNA 1L3SA 1OR7C 4UQGA 2JPBA 5AN4A 2VG6A 2E2QA 4Z8AA 4E7IA 3E6MA 1QPIA 5HDNA 3ULDA 2BE7D 4CUGA 4B9LA 1ZSZA 2DI3A 3ZP5A 3P39A 1RBTA 2GBQA 3OH9A 3M0SA 1RT3A 2LRQA 4ID5A 1HOMA 4O5VA 4GRIA 3F5TA 4DF8A 2FF4A 4QCLA 1CLQA 4IUVA 2MF2A 4YHHK 1QKWA 2QGUA 4IOCF 5DM6L 3VEPA 1HJRA 5CK9A 4LG0A 1Q86O 3SAGA 3D5LA 3RESA 1RBRA 4EFHA 2YHTA 3L2UA 4EVVA 4PJOF 2KIFA 4HYEA 3CW7A 3NGIA 2P9LB 3VEZA 3NBPA 3QNOA 1RI7A 3BY6A 1L0OC 1YFNA 1NWKA 2RK1A 2XRNA 3PSFA 4I02A 2YRVA 1YXQA 5KPTA 3KZBA 1X1PA 3RTVA 2GTOA 3W2WA 4LD6A 1NG9A 4UVAA 3E1SA 3I0TA 5KPRA 3ASMA 1S3JA 2OJ2A 4XEIA 4JKBA 5KPZA 1GBQA 1AWWA 2KHMA 3IUCA 2E4HA 3KLEA 2QSGX 4CESA 2FC0A 1J6ZA 4FE4A 1QVPA 2FUG2 3KUFA 1OCCH 3SEMA 2YS9A 5KYXA 1SSHA 4AI4A 1VQPI 5CVRA 2CSQA 3H3UA 3I3LA 4PJOD 2HEOA 4Z02A 2GA2A 4JQFA 2A0FB 1W7PD 1XN7A 1T0JA 3FF5A 1HKGA 3DKXA 1RR8C 1OZ2A 1VQ4I 2E88A 1LV5A 2KEAA 1BGXT 1M1KO 3P8DA 1J53A 3B73A 2XKOC 4C92C 4A3KJ 4HDUA 1YJNN 2AO9A 2MA3A 2DM1A 2JA5J 1K73C 2QWQA 3F0ZA 2WFBA 4DSIA 3FDYA 1XOVA 4I9QA 1PG5B 5K5OA 1LKXA 3LDPA 1VQ7A 2E3HA 5KAFC 1B9NA 1BCMA 4BG9A 3KIOA 4F92B 2GQQA 2CGKA 4AU7A 4HF1A 1R0AA 3UKUA 2DT5A 4BRLA 2E10A 1LJ9A 3I8BA 2E2OA 1OR7A 1RETA 2DMTA 1P9QC 1WBBA 1AEYA 2LZ6B 3DLLA 2CSIA 3ATVA 4BRFA 3DPUA 4B1ZA 3MP1A 1VQMA 4CBWA 4EJWA 3PFSA 1Z7LA 3FHFA 1QQCA 1IRXA 3CJQB 3L2VA 4A3MJ 1ZBIA 4DTRA 3O8VA 3WVDB 4IOAL 2QXFA 3HM8A 3UKRB 2DXBA 4RB0A 1N25A 4IURA 3A2KA 1QVFS 2ME0A 4C1NK 2KRMA 5BPLA 1H92A 3CCEA 1Q81U 5C44J 4D8KA 3M1FA 3LM9A 3ZT1A 1VYUA 4M3YA 1BR1A 4MTDA 4E9GA 1U6ZA 2QEXI 3G1JA 4M3FA 2QA4Q 3HXMA 1XCVA 3D2EA 5IT9O 4FT8A 4M7DF 2W7NA 2OBPA 2FMYA 3P7NA 2C0OA 1ZBFA 4QS9A 4BQZA 4FWRA 2RPIA 5HLGA 2WC9A 4J2DA 2QWNA 3C7JA 3I5RA 1AWOA 2NS8A 4XIUA 1HBXG 5KRTA 5LLQA 2YNFA 3OW2M 3F8CA 2P9SA 3SBTA 2HXIA 2JA6J 1WI9A 3S15J 1HKCA 2M51A 4BC3A 1O1WA 5HY6A 2XIDA 3NNQA 3VS7A 2OZMA 1VYVA 1I39A 4W1UA 2FQ3A 2YLCA 2IC3A 2XAUA 1R77A 3OMYA 2K5IA 5GAN7 2YUSA 4OMYA 2DVJA 2DMNA 1M1KC 3LWFA 3CXCA 4FWOA 5D5VB 2IVNA 5JMVA 5HDGA 3O08A 3RDIA 3B8AX 1V55H 2VQLA 2HAXA 2EV6A 4J2BA 3ZETB 1QE1A 1KJWA 4BQLA 2LKXA 2K4YA 2M87A 2KT1A 4O8UA 5J4VA 4F7UB 3QQAA 4Z4EA 3IRRA 1NGAA 3JCMd 3S6WA 5H2FC 4RS8A 3CUQB 1NGIA 2K4BA 1NOZA 1YJ9I 1N3AA 2RQRA 4NNJA 3I55N 4C30A 2K9GA 4RCHA 2KROA 1N8RO 1SFEA 4M7AD 2LBFB 2E12A 4IFEA 4NXMK 5I2MA 4EHTA 4M78A 2ISZA 3EG9A 3KK1A 1UGSB 4PIIA 1BKBA 2OTJQ 1RT2A 3RKWA 3ZEHA 3L09A 4HSBA 1VIEA 3VYTB 3VESA 4L5JA 3WTUC 4UV8A 3NFAA 4QIWN 4JRQA 2QGFB 1J09A 2HSEB 4CZKA 5GAMh 4L0YB 2DKGA 4WFNL 4PJOB 5TKWA 3CCMQ 3MAJA 3JRBA 3ECOA 3DLMA 3ESWB 3OSVA 2STWA 3JB9J 1KU9A 1IG7A 3CCQQ 2OQGA 3VRZA 4L9TA 4LF9K 1TVRA 2I2LA 1YJNQ 2LY2A 4F04B 4O3MA 1TOVA 4CO8A 3R9PA 1GLBG 3EY1A 3OV8A 1KQJA 3UA6A 2YJEA 3LSKA 1ETXA 3C7NB 2ABLA 1RKWA 3HJFA 5J40A 2XGDA 2FD5A 2YHBA 4RWTA 2BGGA 3BGRA 1I3QJ 4J9HA 1RCHA 3BJOA 3EGXB 3AA5X 2O9SA 3LWLA 2K3FA 4BYYA 2QQAA 1VQLA 1XMXA 1J7KA 2JT4A 1VQ7Q 3AVGA 2HS5A 3E5UA 4MQVA 2XHCA 3SDGA 2R0QC 2HKNA 4BDPA 2ZJQF 4PCQA 1LDJA 2KRFA 1YUWA 3HHTB 3WNEA 5LJ5h 2P7CB 1W5SA 4CFCA 3CCMN 4MEYF 3NF8A 4R1HA 5AFUA 4BDYA 4XU1A 2QTDA 1S9EA 1R59O 5GPAA 1GLJO 3LALA 1OEBA 3GCMA 3ZMDA 3JB9H 3HOUJ 3N4MA 4BXXJ 2FOKA 3ZSXA 2W25A 1CKAA 2HOAA 1M90O 4ICLA 3PIPL 4RTXA 3DM2A 4BY9C 4FJJA 3CCET 2VC1A 3GE1A 1HSQA 3KLOA 3F9KA 4M74A 4IRHA 1NJWA 4BWMA 1AZEA 4A0ZA 3S3MA 2RJCA 1RUNA 1POGA 4B1UB 2L3RA 1UHSA 2XICA 3HOXJ 1RI9A 1D0YA 5FJ8J 2G8UA 3Q9VA 1U78A 1X3UA 3CP2A 4Y0WA 3CC4Q 3R1XA 4GCVA 3OYBA 2X4YA 5KRSA 3M8QA 4CCKA 1BU1A 3G10A 3I4NJ 1ABOA 5DM7R 3HTSB 3CCVI 2A36A 1MMNA 4EJTA 4CYCB 3OOPA 1T08B 2HQEA 2HQRA 1SHGA 4B23A 4KISA 1LWEA 3O4QA 3DXJF 3CDHA 3G71N 1KQ8A 1YI2A 3LQQA 2M1BA 3EAEA 1S1XA 4JI6K 2L4MA 4OWRB 3HJEA 5FLXZ 4GMJB 3QBXA 3JAMO 3QLHA 4PJNA 1N6AA 5C15A 1WEIA 2G8FA 3BR3A 4F3TA 4JK1X 1JTYA 3KNTA 5CJ9A 5FKNA 3DB4A 3UF4A 4FLUA 4E89A 4HEA2 1IH7A 2ROLA 3K4LA 4KT5C 1FWZA 2ASOA 5AQJA 2ELHA 3JRDA 2NZTA 4DQRA 3ZX2A 1TQPA 1HDDC 3NMUA 1EH6A 3VF4A 3S3OA 3QINA 1P6RA 1KQSP 1S72A 4B3SK 2HQHA 3FLGA 4CJPA 1JJ2M 1U48A 3IG1A 4AD9A 3CJTB 5A0GA 3FBIB 2E1MC 3U1DA 4HLXA 4LG0B 5F1RA 1YF5L 2SRCA 3CC2T 4X9CA 1DKGD 2R5YB 1DEJA 3N5BB 4Y13A 1LW0A 3G4SA 1BK2A 3S3NA 4MIMA 2DRKA 1IN4A 5KQ8A 2B5JA 2HDDA 3VQ6A 3U2RA 3J81O 1VQNA 4GXOA 4DOVA 2P4RA 2XY7A 1O7FA 4LH5A 1W0HA 1V76A 4CGZA 5KI6A 4DZPA 4A3EJ 1T38A 1YI2N 1WHGA 3A8OB 2HQAA 3LL7A 5DK5A 5C0MA 3R3LA 2DDBA 2F1LA 2JT1A 2COYA 3S41A 2EK5A 2NVTJ 2XDDA 1U49A 4C9YA 1XG1A 4C92A 4BBRJ 3VQCA 1MBEA 4ESJA 1WSJA 3V9ZA 1ORKA 2W40A 4XTWA 1LPLA 1WHKA 5AONA 2Z33A 4IXCA 4RAYA 1W1WE 4U0WA 3VS6A 3K9KA 3OGDA 2ZPIB 3RR8A 2ZZDA 2EFPA 1IREB 2B9SA 2ZPFB 3HBLA 2ACJA 3OYGA 1U04A 5B8HA 1LW2A 3TOAA 2DNUA 4HX7A 3JCMe 3LCNA 4OKEA 4LDYA 4B08A 3S14J 3VS1A 4QVZA 2D5VA 5HVQC 1OQKA 1WB9A 1SKSA 4DK9A 3HTRA 4WCIA 2MPXC 6PAXA 1JQQA 3PTAA 5HNHA 5EYRA 4Y28E 2W42A 3JCUC 5D5XB 3HOTA 4IHVA 3CD6N 4P9FA 2E2PA 1D8JA 4BR2A 3JCMg 5EVZA 3PNVA 1B8IB 1H88C 2CW0F 1KFSA 4IDHA 4LDUA 3G4SN 5EG0B 3GZ6A 4KNYA 4OLBA 3QU3A 1FKPA 2M5WA 1HLVA 5GAMd 4HV6A 2PUOB 2VPRA 1K4SA 2P9KB 2EVRA 2Y0SA 2EGEA 4FZZA 3K4KA 3J80Z 4ANJA 3O1WA 3CQXA 3DJCA 2M0CA 3SHWA 2JG6A 3SDZA 4BY6B 2YSRA 2W03A 2H3GX 1C0TA 1C1AA 2EBIA 3CXCP 1YHQN 2R7OA 1VQ9I 1OCRH 3O6WA 3HYFA 2WB1N 2XPVA 2NOEA 4IHSA 4FWSA 3GEZA 2MAMA 4JPBW 5K5QA 2QM1A 3SQ4A 1ARKA 3F8BA 4BDZA 1R4MB 2ASPA 3EPZA 2XAHA 4KHSA 2XGXA 3QIPA 1DJ7B 1TK0A 4B21A 3R8EA 3T0YA 3U6FA 3R0AA 1WOQA 4ISGA 1XNRK 4PJOG 2VQCA 4U7DA 1RT5A 1RT7A 3OOUA 3OR2C 5BRHA 3ZMUA 2Y0MA 1RFQA 3LL3A 2ECCA 4B8XA 3ZN0A 3H0IA 3NWSA 1T39A 2B4JA 2ZFWA 1UA1A 2VE9A 1RNHA 4M77C 4OB0B 4Z6YA 1LNXA 1X27A 1IG8A 1S1WA 3ME9A 1MMSA 3DEWA 1KG6A 4AYBA 3CMAN 1M1FA 2QKKA 1SC7A 1SQKA 1P7JA 2V9VA 1VQ5Q 4UUVA 3R0JA 3KHYA 2M9HA 1ZG3A 1QTMA 3BG7A 2W6LA 1HW2A 4B9TA 2AQFA 2VXZA 1G83A 2UXDK 3KXTA 2A6EF 1W9HA 2ZMEC 1F1ZA 3AVKA 1XNIA 3TSZA 2DZ9A 2YT6A 4CZEA 1OCZH 2QQ8A 3KEYA 1JXSA 3FZMA 4M72A 1M3AA 3I4MJ 3M5RA 2P1JA 1ERDA 3WTZA 2VQHA 2W04A 3GTPJ 1UELB 1H9TA 3TW6A 1A36A 1KG2A 2GGRA 3RMSA 1RRSA 1TL8A 2R7TA 2JW4A 3CPWP 1XSXA 1J5YA 3D6RA 5HROA 1NMDA 4BREA 1OZ3A 5C0YA 1QSLA 4PFOA 2V26A 2FNAA 1NG2A 3PE0A 5CR2A 4WQ4C 3SV3A 2B6AA 3K59A 3M4YA 1N6QA 5C2DA 2CS7A 2BY1A 2JWTA 2L01A 4UHTA 4MO7A 1TW2A 1AKHB 5GAOl 3D7EO 2DK3A 4IQJA 2WY7Q 1VQOT 4FQGA 2M1HA 4M3BA 4OGEA 1MU2A 3WG7H 1NYGA 1FLIA 2F8TA 2X9DA 1YJNI 4DNCA 5FO5A 2MLGA 1IV0A 3FKIJ 4HOBA 1BA0A 3FHNA 4J9GA 4Z88A 4JI4K 2OCEA 1ZYQA 2CH5A 2P4WA 1FBQA 4WCGA 3G6EA 4B9SA 1GOAA 3GNFB 4ELYC 1X3MA 4BRIA 5KH6A 1V4RA 4FX4A 5C12A 1Z1DA 3KLNA 1Z9QA 2QK0A 3CP8A 3ENHA 3AVHA 4OIRF 2PJPA 4HNVA 4II1A 2FPEA 5JLHA 3FDRA 2JK3A 1YHQT 3OBYA 4M75C 2JA2A 1GLEG 1JHFA 3EH1A 3LANA 4ELZC 5FFXA 1T0FA 4PFZA 4BS9A 2HHTA 4CZIA 3A03A 4ZYEA 3HRMA 2Z16A 3OH6A 2M8EA 2E5QA 3V9WA 4M3XA 3A8LB 3FXRA 3MN7A 3HKZA 1B8IA 3HB9A 4NHJA 1HJDA 3BZKA 1MDMB 2G7HA 4FJNA 1FXXA 2BHZA 4DLGA 4LN2A 1UDLA 2HKXA 4AVZA 2PJRB 3F2KA 1M4ZA 3HKZN 1FTTA 3ZEUB 4O8KA 2BE9B 3CD6T 4NYNA 1F36A 1QCNA 1GHCA 4M7DC 2JWLA 1MBHA 4M75F 3M54A 2GF7A 1KEAA 1PU6A 1ETYA 1B6AA 2CV2A 4EJOA 1YI2I 4BI4A 4N0BA 2ROTA 2SEMA 1QHGA 3LPTA 2JVGA 2DXIA 4IO9L 3FEOA 2ZXJA 2RJFA 3CFRA 3IL2A 1WGXA 4ZTJA 4L0ZB 1M8VA 3AKZA 3K4MA 2BTTA 4RW9A 2E1HA 5DDGA 2NOFA 1YJ9T 2F2VA 1U2VA 4BRMA 1NMNA 1A04A 1IW7F 2P8TA 4FWLA 4M41A 4HT8A 1UTIA 3HOWJ 1LWFA 4CI0C 1SMTA 1B4AA 4QOZB 2M34A 3VOEA 2P9NB 4ZZDA 4M7DD 4DUYK 2HHHK 4H03B 2UXNA 3I56I 4V2GA 1M1KU 3BFMA 2NVYJ 4E1JA 4I6ZA 2A69F 5JVTA 3R6OA 3VETA 3I0SA 5ICGA 2GUPA 1VRUA 1TUGB 2K02A 3B6CA 3RSNA 2JM9A 3KK2A 4ITVA 3NH0A 3GF5A 1K0SA 1T95A 2XHBA 3ABKH 1KRPA 2V1QA 2CP6A 3OVNA 2RHZA 1VQ5I 3IHOA 3ZSOA 2HNZA 1WVRA 4ELVA 1FW6A 1S8NA 2P84A 2FXUA 3DKWA 3HRGA 4X1VA 3BPXA 3SYTA 2L7FP 1TV6A 3TL4X 2CJJA 3HOSA 3QOPA 4DB3A 1RAFB 2Z1JA 1JLAA 3WXLA 1R58A 1AZGB 3JSPA 4CK2A 3PIOF 5EGOA 4J8FA 5J47A 2QA4A 1WNSA 4LY7A 2NOHA 1JU5C 3RMDA 1YOVB 1VQOI 4IRIA 3ZX3A 1D1BA 4J7IA 3U8XA 4WFBL 1MZBA 3O9TA 2L9VA 2HZDA 5CKDA 3M56A 3P9CA 3QOEA 1IRZA 2ID6A 5L3BA 2YV0X 1PWTA 3E9PA 2L0KA 1DQUA 1R00A 1HNZK 1FJLA 1X1CA 5M3FJ 3K0LA 1AD5A 2XC7A 3CUQC 1MUZA 1NGGA 1UJYA 2J05A 3AO1A 3ZYYX 1VQ8Q 3IRQA 5F04A 2DA2A 2WTUA 4XH4A 3G6EQ 4RGRA 2JUGA 2VBWA 1J54A 4XK4A 2QQRA 3S9HA 3WNHA 3AY9A 3EKUA 1YS6A 2DYSH 2O03A 3THYA 3L4QA 4BC4A 2VUMJ 2NXNB 3SZPA 2YUPA 3CESA 5J2PA 3IAM2 4EJZA 2EGAA 3LZJA 2R3SA 1EX4A 3CC7N 3Q0VA 5JVGF 1X19A 3GZNB 4PHTX 5IOYA 1IF1A 3VEXA 1H3ZA 5GMKl 1VQ4A 2IS3A 2V8KA 1QS4A 5H20A 1VQLI 4C0GA 2F4OB 3KVGA 4H0TB 1VRLA 1VSJA 2O8DA 4PDKA 1HNVA 2QCOA 4IUPA 4C5IA 1VQ4N 2HDCA 4UC4A 4CJEA 3TOBA 4UUSB 4F7UA 1VSEA 2CH4W 2O8EA 2VLAA 2XMFA 1T0HA 1MGQA 1I3AA 5I42A 1ZA1B 5C24A 2LF8A 1T03A 4K41A 3HKSA 4CJWA 3CERA 3QEWA 2NLXA 3AG1H 2X6SA 4BRNA 1WKMA 3VPZA 3AAFA 3LW5E 2ZGZA 1G2HA 2IVPA 2VT2A 4R79A 2OQRA 3WXKA 4YEJA 3CJ7A 3EL2A 2I5WA 1YVUA 4M3TA 3FXUA 3SQNA 2DXTA 1G99A 3QEIA 2RE2A 3CCJN 1X69A 2G9WA 4IEJA 4H0EA 4MQ3A 1D0ZA 2ESWA 3FK6A 2K5CA 3REAB 1XD7A 5BQTA 1B3QA 3TDUC 1RL2A 3GVAA 2GBZA 3WTYC 3Q7BA 4JI0K 3CCJA 4BEHB 5CQYA 1ASUA 2VL8A 4IHWA 3V9XA 5BNGA 3TBIA 1KAZA 2Q0OA 1IHWA 4FASD 2JMAA 1Y64A 4DIQA 4CEBA 5JLWA 2PNIA 4C0FA 4M77F 2NRVA 2HD0A 2JUCA 1PP8F 4CF1A 2KP6A 2VWFA 3AA2A 4E7ZA 3SB2A 2YKNA 2W00A 3THVA 3E9LA 2NAZA 1WJFA 2LQ8A 1S72T 1NKUA 2GWKA 3SMPA 1A35A 2M30A 2IS2A 1OKJA 3S2HJ 1NZ9A 4MMLA 2E1ZA 1VQ8A 3P8BB 4JJCA 3TEEA 3NF9A 1J9AA 2R7RA 3DBRB 3CC2N 3AHUA 2HDAA 1NE8A 4HX4A 3UDCA 3HHHA 1VAZA 4JX5A 4BR7A 2H8WA 2IJLA 2JZ2A 1WQ2A 2DILA 5BPIA 5E84A 3CQ8A 3ZX0A 3HBTA 1IHVA 2GXGA 1HYZA 1OYIA 3BTLA 3B6AA 1G59A 3EGDB 2O4GA 1YTYA 1TGOA 4RB1A 3FHZA 1WBDA 2P51A 5J39A 2BW3A 1VQ6A 3MAQA 1IAWA 1TK8A 4LF4K 3O3KA 1YI2Q 5IWAK 3H9QA 4FXDA 2GZWA 2YRCA 3MXMA 2R5AA 4HWIA 2Y4XA 2OZ6A 2TRTA 3JCMb 3GTJJ 3PLAA 2RNAA 4B3RK 3HO1A 5A2QO 3CCJI 1Y07A 1BCOA 3D5RC 3FB9A 4CHZA 3BG3A 2Q0RA 3RYPA 3UA7A 1V5GA 3SWNA 4YORA 3BR6A 1VQ5T 4J2EA 1UHMA 1TW3A 1HMVA 2A07F 3S2DJ 1JJ2P 3T9NA 4KT0E 2FPDA 2M7AA 2P9SB 4DMNA 3CCST 4KH6A 3CPWS 5GAN3 4M9ZA 4JJDA 1JCGA 2PYJA 2EWNA 1VQPT 3EGDA 2FBXA 2TDXA 2E1MB 2O6GE 3VQ4A 4I2OA 2P5KA 4CC2A 4FU6A 3M53A 4M7XA 4ENMA 4CZZA 2YX4A 4D9JA 4M78F 3A1YA 4IZZA 2FMLA 1D5AA 1QVFA 4IUQA 4YOWA 2COZA 4CBXA 5B3SH 2DMOA 3MWMA 1XMAA 4II3A 2KJCA 3F23A 4IWVA 1REVA 4C0ZA 4FE7A 4U87A 4NQWA 3FWEA 4M7DB 2WACA 3KPHA 3PFYA 1R1VA 1LWWA 1JJ2S 2VJ4A 4IJNA 2HYGD 1YE9A 3WU0A 3L2RA 4B47A 4I0AA 4EMGA 5GADP 3EZ5A 4HKEA 2LX7A 1MGTA 3LSRA 3C12A 4N4OB 3IP4B 1WNLA 3SUOA 3H3VK 3BE3A 2X48A 2IP2A 1C6VX 3MP8A 1M27C 5F2RA 1V1CA 3H3ZA 5FU7B 4IBNA 2L3SA 1R1UA 2LY9A 4B22A 3KYLA 3RERA 1V5EA 3QEVA 1OLTA 2D1XA 2TCTA 3MEGA 4LD0A 4YOUA 2IBDA 1W4SA 4O5BA 2KKZA 1IN5A 3CUQA 2EYYA 2XSJC 3K4BA 5EDNA 4XKCA 1KLNA 4XAXB 3EG2A 3IH3A 1VQMI 3AL0C 1FP1D 5EF6A 4BG8A 3L2QA 5LL6S 1GL5A 2NVQJ 2VKHA 3LSHA 2D0CA 1IKXA 3ISPA 1GXQA 1IKVA 3N0UA 3EH2A 1YN8A 5CZ1A 1ZLKA 1KU7A 2W1OA 1PUFB 2M4GA 3I9V2 3SCXA 3FXKA 3PO3J 3QXEB 3M0TA 1GT0C 3NEUA 3AV9A 4OAYA 5E3MA 1E6GA 2HBWA 3FFIA 5DMRA 4DV2K 1AKHA 4RG2A 3LGFA 1NOYA 1GUUA 2F5CA 1KVBA 3EN9A 2KXDA 3OY9A 4ESRA 2BE5F 4BEHA 1FP2A 3RUXA 4CJ7A 1MBFA 2DTRA 2E64A 4CFAA 5ICEA 3NAUA 4B1RA 2CP3A 4DTJA 3C7NA 1RBVA 4H0XB 4FYWB 3HT3A 1I5ZA 5GTIC 3K7AJ 2PYLA 4L9VA 3EE8A 4XTUA 4E9FA 1SD4A 1ONVA 4MLHA 3BJ6A 3B02A 3C4SA 1Z26A 3T69A 3WE3A 5F1JA 1FTZA 4YDUA 9ANTA 3H35A 1GVJA 2QKMB 1HSJA 2KFNA 4AF1A 4J7FA 2WSCE 4QSHA 4NBQA 2F4IA 3ZBDA 2DL3A 2NYSA 5SZTA 4C92F 3KP6A 4ENKA 2CYYA 4IG0A 2EJGA 3TW7A 4M73A 2WA0A 2A6TA 4RTUA 2CP2A 3C6TA 3LAKA 2X4HA 4FOEA 4HQMA 4Z2YA 1JKQC 5AQRA 2ZPEB 2MLKA 4B1VA 5E3OA 3G1MA 3RKQA 3THKA 4BQOA 2V1NA 2BUDA 3T1YK 4KHNA 3HDDA 2DYIA 3QU6A 4B9XA 3DKMA 1KAYA 3LDQA 4F2SA 4K25A 2EQIA 4IL6C 4MTEA 2R5MA 4BGDA 3JYTA 1TSFA 1K76A 5DD8A 4RW8A 1AVZC 2OAWA 4MGRA 2XGCA 1XHXA 2K3YA 4XOPA 4BUGA 1RDWX 4XTVA 4DSLA 4WF9L 2KDZA 2DQLA 3R60A 4XR6A 4YDUC 1VQLT 2R58A 2D2WA 3JCMP 3TO7A 1W7AA 5GAN2 1VQMT 2QWPA 4M45A 2NNNA 2R7DA 3CCUI 5D6YA 3W0LA 4CJQA 2LK2A 2XKPA 2XROA 3L2WA 5GMKm 2XF5A 3U23A 3A5ZB 2DA7A 2ZD1A 2ZB9A 1TUDA 4YFNF 1S9GA 3A8MB 3T1BA 1RGIA 1LAVA 1S6QA 3MXIA 1QU3A 2EFIA 2DOEA 1RTJA 4EMHA 1ZK8A 2EQJA 4C8MA 1VQLN 2DXCA 1HYOA 4HNUA 4KBMB 5KYYB 4GFBA 2ZE2A 2OA8A 5JVGL 2FA5A 4DSEA 2VQGA 1FJGK 3ZQIA 2DJQA 2E5ZA 3M4GA 4FK2A 2IIMA 3CCVA 5M3MJ 4CCJA 3NRVA 3AGKA 2FBTA 3CCLN 2G8KA 2WV1A 5E3NA 2JRMA 3CMAT 2MYSA 1ZARA 1O3RA 2V9PA 4XTZA 1IRFA 2FSWA 2ZF5O 2LVMA 5K14A 4FJGA 2MH9A 4I09A 4F91B 1JLFA 3CVSA 3QFUA 2LY1A 1Q8IA 3ZT2A 1SFUA 3TAFA 1TYQB 4CZMA 4XL9A 1LEAA 2QQBA 4JK7A 4DSJA 4B9MA 4E7JA 1BA1A 1K73U 4OMNA 1RPWA 4A3GJ 2HPMA 5LJ5j 5FKMA 3PMIA 3GYHX 5KGXA 4CEQA 1UCRA 1DDNA 1Q81O 2NVXJ 2VOOA 2NUTB 3MEEA 4DTUA 1WSGA 4RAGA 4PJJA 4IUTA 1YJ9A 3FISA 4QS8A 3D2FA 5IHKA 4RB3C 4BE0A 4OMQA 2RHIA 1J5EK 4PJLA 4KI4A 2QQSA 1MSEC 1A31A 2EYWA 1APLC 1YCYA 3V9SA 1KONA 3ID8A 2GUIA 3SPZA 4OPHA 3I8DA 2QEXQ 2L9SA 1YJWI 1F1BB 1ON1A 4XKWA 3DWLE 3NCIA 4FPAA 4OVAA 2GWJA 4EA5A 1DLOA 2R7YA 1PDNC 1BL0A 1XJWB 3IAS2 3H8ZA 3OSGA 2V1DA 1H9GA 4PUSA 4RCCA 3V81A 1OH8A 2KE9A 3CFOA 3PIOA 1MUYA 3AG2H 2HB5A 2ZMEA 1VI0A 2RQPA 3MWPA 2O0YA 1WXTA 1J9IA 4U67L 4NC7A 3J7AO 4LGWA 2XAGA 4ZN1A 5H6RA 1K6YA 2HHWA 2CFOA 2CGPA 1OYXA 1DGWY 4EVIA 4UNFA 3VEOA 1OMIA 4L8RB 1NPPA 1BW6A 2KRHA 4BY6C 4BY1J 2E41A 5GANd 4NL2A 1WIEA 1RABB 2VE8A 4A6EA 2ECZA 4G94A 4HLYA 4M7AF 3L2ZA 2LX9A 1OPLA 1AA7A 3KETA 4KUDK 3TPQA 3WXJA 1ZA2B 2WAFA 1K73O 3RBBB 1LWVA 1VQ4T 1WSIA 3EG1A 2HVIA 2CZ6B 3BG6A 2O8DB 1VYTA 4JX6A 3LLRA 1ZHIA 2OUMA 3O8GA 4CZLA 3AO4A 3VOVA 1XSDA 4JHDB 1QQMA 2BGCA 1UHFA 1UE9A 5DV5A 4XLNF 1J75A 1LFUP 3QP6A 1R22A 3CHWA 4FZXC 3HEFA 3SFZA 2X1EA 3P4IA 4KO0A 4OKJA 1V29B 2RDPA 2EZIA 3TTFA 5IT9Z 3M0RA 3QJ6A 4WQ4A 4CEDA 1BBYA 1XQOA 3GF2A 2BTFA 2DVEA 4Y33A 3A0BC 4EV0A 2DETA 1MMDA 2COBA 3M57A 1JHHA 3J7AP 4KULA 3QEXA 1LDKB 2EGCA 1ZRCA 3F9MA 1VQ7T 3L00A 4UUSA 2FRWA 1XGSA 1H8AC 4I9LA 1HKBA 4G8XA 4CK3A 2DIGA 4W5OA 5AQVA 4KH0B 2FBIA 4DU3A 2P5OA 2G8IA 2O4XA 1VQPN 2EZKA 5LJ3g 2QWWA 3E3VA 1B9DA 3AVNA 1X2QA 2LC2A 4BU2A 5E1ZB 4MFBA 2ZCFB 2M4KA 4KBOA 4A3LJ 1HK9A 3RKYA 3L4IA 1E0EA 4B3OA 4XM3A 2IT0A 4LIUA 1VQ8I 3CBOA 1CXUA 3PUFA 2K40A 1AWCA 4MQ9F 3CCSQ 3HGYA 2ED0A 3UIQA 1ZC6A 2QWOA 2CH6A 1VQPQ 1Q86C 3EFSA 4JBAA 2CREA 2GWRA 2VASA 2DX1A 1K78A 5D3GA 1X2MA 2DPDA 1S1NA 5L8RE 4M3GA 1NK7A 3TO6A 5J2NA 5AYFA 3HC7A 5FKKA 2E6MA 1HNWK 1FC3A 4M77A 3DF8A 4LF5K 1N78A 2IIRA 1T98A 3UB5A 1KD1U 3K1NA 4EM0B 2UUBK 2IRFG 2DFFA 4Y17A 2DIQA 4HCBA 2G0EA 3TSWA 2RQUA 2CWEA 3R4KA 2RHUA 4XTYA 4LFAK 2NS7A 3OYAA 2JN6A 4KB1A 4HHTA 4CZJA 3OIQA 3ZR8X 1K61A 2XKOA 4LC9B 3VQEA 1LFBA 1E7OA 4E6RA 3VERA 3IFRA 3ABUA 1RIOH 2CT4A 3F6OA 2Y2ZA 3I55I 3ZQGA 1DGRM 3X28B 1X9WA 1UHCA 1USTA 2W6KA 2FG0A 1B72B 2KLOA 5BR8K 4HBLA 3BG9A 4KI6A 1TU0B 4A59A 1XGNA 5D5UB 3VUBA 3OMGA 3BEXA 4PJOE 1P2FA 2RKIA 4GW6A 3D5SC 4Z94A 2XAJA 4ZTFA 2JPSA 2XRIA 3ECHA 3X26B 2Q2RA 4LD5A 3QPSA 3LWHA 5TJJA 3CC2Q 3K57A 3KJVA 3IH2A 1ETKA 3WE2A 1UUEA 2ZJRL 4MDXA 2E2HJ 2D0AA 2HKQB 3MEXA 3DWLA 5CY4A 3RMQA 5I9EB 5AZJB 1T33A 1VSFA 2WOMA 2EIKH 2L3PA 4CZHA 3CF5F 1E3HA 3CMEQ 1Y71A 5IHNA 1FNNA 4GGGA 3GIBA 3I59A 2EILH 4PY5A 4F7UE 4OMLA 4NCBA 1I0CA 1RUWA 2XPUA 2DTHA 4R0KA 2OI3A 4LDVA 1NJIR 1YWPA 4FWPA 1I1JA 1MDMA 1SAXA 5HRPA 1L3UA 3J81Z 4RTYA 1K9MC 3F8MA 4Y1DA 2WTEA 1ETWA 4DQQA 3SHFA 3PGGA 2FYKA 3L3UA 3WEEA 3AARA 3CC7T 1TL1A 4ZH4F 2VKDA 1TKTA 4B3AA 1NTCA 5EXWA 2D4WA 1WLPB 2EPDA 5JFRA 4CEEA 2NUPB 3FXMA 2RF0A 4PGHA 4JKGA 3M7GA 3O6BB 3Q0WA 4N0AA 2W0ZA 2LP0A 1Q9YA 4N41A 3JB9D 2IGMA 5CAIA 5GAN6 5HLHA 4I76A 5EZGA 3I59B 3DP7A 3EDPA 2QBYB 2O4IA 4YG2F 4XKVA 4A2BA 4L5GA 2HMIA 1IXRC 3UNGC 1KYZA 1EH8A 1LCUA 4EA4A 4LUEA 3P5JA 4A4GA 2EZLA 1YJ9Q 4B3XA 2JTFA 5LHHA 2ZKZA 1KG7A 4R56A 2IG0A 4FSXA 1U45A 1VQNI 4FPBA 1WDXA 4FETA 1CGPA 4CCLA 2L9RA 4FJIA 1ITGA 2HF3A 5TRDA 4KFCA 5IN1A 3VPRA 3PIPF 2QI2A 4EW0A 2K3XA 4KHQA 2BANA 2GQVA 1B9MA 2X6OA 4M3DA 4C8QC 4CRIA 2HFHA 3RPQA 5F0HA 4DSFA 3WHCA 3H9NA 3VQ7A 2IW5A 1VQMQ 1IGQA 3IHUA 4CJ3A 5IP7J 3FZLA 4ILHA 2E5KA 4M7DA 3ZEUA 9ATCB 3NTKA 3FC3A 3VSLA 2ZJPF 5LGTA 2W4SA 2BW3B 4EM1A 3BUZB 4CE9A 3RZOJ 1SL1A 1P4XA 1W97L 5C3EJ 3E5QA 3LDLA 3I56A 4XNFA 4AHRA 5M1QA 2ZPGB 3CCLA 3SFMA 1IXCA 3I58A 4ORZA 1GV2A 3ZSZA 3A01B 3FRNA 4F8RA 2RA2A 3L42A 3I5SA 2HQ5A 4M75A 2PVGB 3EEQA 1NK4A 1ZRDA 1FIPA 4CHOA 4CD1A 5AQYA 3VEYA 3HUGB 3GFMA 2IEKA 4B8AB 4K8ZA 2IA0A 3K10A 5F64A 2B63J 4MO5A 4J6XA 2CH4A 1NJYA 3LNQA 1TP4A 2ZXHA 4WF2A 1VNDA 3MX5A 5AQLA 1SVMA 3P9KA 3W3DA 2QA4T 1RNLA 3O9UA 4RLQA 5CHIA 4U0VA 5GAOq 5C4JJ 2FSKA 1U84A 1QZZA 1VQOA 3CC4A 2RJEA 4E4HA 4PKGA 3IKTA 3UE5A 5I21A 4D5FA 3S1NJ 1HKSA 4YOVA 4BVOA 3WODF 3SDBA 5IYCJ 5M1FA 5F27A 1P7MA 4KGZB 2EH3A 1WWXA 3BT9A 3K70C 3H3OB 4FJKA 3AG4H 2E1YA 4JDSA 1N5YA 1QGPA 4YIFA 2D0NA 4CEZA 4DTSA 4DTNA 2QDLA 1MUDA 2RJDA 2NOJB 3CJRB 3H5NA 2GLOA 3JTHA 4KGVB 3PO2J 2ESHA 2W85A 3HUGA 2MD0A 3E6BA 4L9JA 3CLQA 2XAQA 2L4AA 5CZ2A 1RUOA 5KTQA 3CCMI 4BE1A 2PI0A 5GAGP 2HU9A 3M8RA 2MG4A 2BDPA 5C42A 1RR7A 3CCQI 1TTHB 3T8TA 3WTWC 5J3LA 3H1QA 3SJJA 5TKYA 2LFBA 4FVMA 3MEDA 2VWKA 3PVQA 3CBMA 1IUFA 3HPWA 4KRTA 5GAN4 3BP8A 1ZELA 5B1AH 4A4EA 2AXLA 2Q2EA 5CVVA 2KMTA 1KZHA 5M1KA 5E8IA 3AVBA 4KTWA 2QENA 5FDLA 4CEAA 4BR0A 1TT5B 3LAJA 2HBLA 1NJXA 1O57A 4OIOF 1VSLA 1K8AO 2P0WA 2EAYA 5ILVA 5GAHP 4N56A 4G9YA 5LJ3f 3KX2A 4PKCC 1RC9A 4C1NI 1PVEA 4CJRA 3KD1E 1R5ID 3O4NA 1VQON 3QYBA 2BZ8A 2J6FA 4CGFA 3J80O 3VSKA 3Q0UA 2NUPA 2F4MB 4G7ZF 4BRPA 3ULEA 4BI8B 4IO8A 4JKCA 2EINH 2VQEK 2OPRA 2F7TA 2BV6A 1WFWA 1D5VA 1K79A 2HBKA 1QZ6A 3CJBA 1WX6A 4MDAA 3ZSWA 4BHPA 1R0BG 1WI3A 3OYCA 2NOZA 2Q2EB 1DGKN 2K7AA 1ZBHA 2CMPA 4CF9A 4IHYA 1ENHA 5D4RA 1JE8A 3JB9I 2QLZA 1MA9B 2DMUA 4CJUA 4XLPF 5KVRA 3CPFA 4BGBA 2RAEA 3NTHA 2YU9J 4JEPA 2OPQA 3G73A 1T2KA 1PSEA 1NJIO 3CJCA 3HSRA 4QQ6A 2CDTA 2FZCB 1I81A 4LLLA 5IYDJ 4E7KA 2OPTA 1Y0UA 1P4AA 1R0CB 1SG5A 5DTDA 2R7SA 4S04A 4QKUA 4DV3K 2KJBA 2CFXA 3FE1A 5EEHA 1T44A 4M7AG 1QCOA 3LDOA 4EW4A 3L9FA 1U5TA 1LMZA 4M7AE 1TAUA 5AQZA 1HJOA 1ZXOA 1X4PA 4XQ3A 3VU3C 1NK2P 3SWNB 3QUIA 3M0QA 3D0SA 1MHNA 3QSUA 5BPMA 2M7BA 4K43A 1AWJA 2LMDA 3CCLI 2KIQA 1S1VA 1X43A 2KIUA 5GANe 2IGKA 2WC2A 2DEQA 2DA4A 3MZ8A 2CQ7A 3MP6A 2X0LA 4JJBA 5DCMA 1XNQK 2DMQA 2HNDA 2MFZA 1B92A 1GLDG 1IBKK 4FJ7A 4C92G 5M5YJ 4NCAA 1KG5A 4B44A 2HYFA 3U1KA 1OULA 3GTOJ 1OYYA 2O8CB 4A57A 2OFIA 3F8FA 2LTOA 4KTZA 1XUPO 3TP3A 5J6XA 4BBSJ 3O3FA 2FEIA 2UXCK 3QAHA 3LOCA 1TS9A 3DLHA 2D1HA 1FMWA 4CIGA 4KDPA 4LNPA 2NWMA 1T6CA 3VEVA 1Q7YC 2XGEA 4WX9A 2QTXA 2DPUA 3I56Q 4DBRA 1QKXA 3KZIC 4FWQA 4A53A 3H08A 3DPTA 4MHGA 2CUJA 4PJMA 4YFKF 4C8NA 3VQPA 3MN2A 1R9TJ 2LC4A 3VQBA 5F0XA 4FIBA 1XGMA 3PJRA 3CWUA 2NS0A 2F96A 2R7VA 2HEQA 5DCMB 3X24B 4KUIA 1K8KB 2CU7A 2E6NA 3QZ9B 5TISC 3BLYA 4WYBA 3FMRA 2EQUA 1I1GA 3C2GA 2DFUA 5M5WJ 5AQQA 4RTWA 4CHPA 1X1AA 2MSYA 1PUEE 4PLIA 1WHUA 4RM3A 1K8AR 2V51B 2O8KA 2EJRA 3E1YA 1A6QA 4XLCA 1SUQA 4YY3K 3WT0A 1TNSA 4DFPA 3FR0A 2J7IA 4CFDA 4UB8C 3G6ET 1VSMA 2KYBA 4HF2A 2JLEA 3KYDB 1WHMA 2YNIA 5GAMe 1Z05A 2P0PA 3DQVC 2D1KA 4V2FA 1BQMA 3ZQFA 3ID6A 2EFNA 2F5TX 5D5WB 3A1PA 4FSSA 3OYDA 3E0JB 2ABKA 1RAGB 2UWMA 2VIXA 1IGUA 1WAFA 1QVGP 1VQKQ 3KP2A 4JRPA 5C2FA 3CMET 1XCBA 1P90A 1YQAA 3HPGA 1DP7P 3K58A 2GXAA 2O3FA 2VWBA 2ZWHA 2NRXA 3ISNC 1CZBA 4B24A 4PL8A 2P9IA 3QDFA 3EFOB 2KPMA 2F8SA 2VC0A 4NYFA 1KSPA 2LLKA 2DQRA 2DJIA 3S16J 4K8XA 1YS7A 1ATRA 3CQTA 3TAEA 4H5WA 4CCHA 1RDCA 3L2CA 3JCMX 1HYVA 1VIFA 1YQLA 1EKEA 5IH2A 1VOMA 4MNUA 4M7DE 4FM4B 3E7LA 2RI5A 4G1QA 3BOQA 4I98B 1JLGA 3JV3A 2RQWA 4KA4A 4A2AA 2DODA 5FPEA 2RNJA 1NLPC 4EGYA 3K5LA 3QESA 3KZZA 1PKSA 5LJ5e 2VJIA 1ILYA 1OQYA 1YQRA 2L89A 1IXSB 4CA0A 1K73R 2O8XA 2V4JC 4HA8A 2GA1A 4Q48A 5AQKA 4HCCA 4ENJA 1IG9A 1FSHA 3OR1C 2NNYA 4B8CA 4CHYA 3BQZA 4FSVA 1VSKA 4FLYA 2QVOA 1BJZA 3I55A 3T19A 1T3VA 1U6GA 4IIMA 4FYYB 3FXJA 2KL4A 1X9SA 5IYBJ 1YX3A 4ILGB 3QDKA 5LMUK 4RW7A 3BG5A 5M1PA 3M8FA 3MQ0A 2IA1A 4JHDA 1LOTB 1SAZA 1OV3A 1WCMJ 3OSFA 4BXFA 2FOWA 2FQ4A 4CC3A 3HSCA 3NARA 1MWMA 1O3SA 2KHOA 1JEGA 3P38A 5F0CA 4FK0A 2HHUA 2FU4A 3VGKA 3GOIA 4BQQA 3EHQA 4RG8A 2JM8A 4DA4A 5BRDA 3V8JA 5GAMf 1ZBLA 4FWKA 1BC7C 1VK0A 3VQ8A 2XI9A 2WY8Q 4R55A 3U4LA 1BIZA 1BIAA 2RV8A 1SRMA 4BHBA 4AG2C 5GP9A 2E20A 4H8KA 2VB6A 4LLNA 4DU1A 3J8AA 3FJPA 4A5BA 5D6EA 5BMZA 2Y4YA 4EMSA 1JBMA 2O01E 3CWAA 5GMKh 3K5NA 1O13A 2AKKA 3CDLA 3ROUA 3QRFF 2DK8A 3K5MA 3N5NX 2R7UA 1N34K 1NBWA 2ZFUA 2MC3A 2EZHA 4CGHA 1IKYA 1Z21A 2ZAEA 2PN6A 4DFMA 2I5UA 2W57A 1WZOA 1CZAN 3RR6A 3T3FA 3FMQA 4EJYA 4NC6A 1ZRFA 1A5JA 2GQIA 1NGCA 1QVUA 2E3IA 3C0BA 4YTLA 1BBZA 3CC7I 1EZZB 3P8HA 3FZVA 1MSFC 2ITGA 3A5MC 1QVGM 1IBLK 2K7LA 4HF0A 1Y96A 3TAMA 1KQSM 2QEXN 5DCFA 1D9FA 3F21A 2JA8J 4DTOA 3HSEA 2NOIA 4DHYA 2ED1A 2VG5A 5AIPA 4M9SA 4G6QA 3L8BA 4YOTA 3OS0A 5ILSA 3O80A 3NH1A 2JMWA 4KHYA 3QG1A 2OANA 3OA6A 4GLKA 5GAEJ 1UA0A 3O9RA 2RREA 3GOXA 1G3WA 2MI6A 1KCFA 5L3GA 3OYEA 1MNEA 1OH7A 5IT3A 4YPHA 1Y1WJ 3AG3H 4CFBA 2YI1A 2LH9A 3J81E 2WAQN 1O9SA 4QVDA 4HX8A 2ZNYA 3EYZA 1EQYA 3CQZJ 3QIOA 3SBGA 2PFUA 3O5BA 2A5YB 1LB2A 4QQDA 1ZH5A 2OTJA 1UAAA 1S5LC 1XTDA 2MC4A 5CKBA 3PFIA 5LJ3d 1YAGA 3KKSA 2DT7B 3S8PA 1NJZA 2DBBA 4E19A 4ELTA 3J7YP 3J7YJ 4LOCA 1K83J 4LB6B 4C5HA 4IDKA 3VQDA 3EG3A 3BW1A 3VN5A 3DBLB 4L5EA 3FM3A 2P4TA 1XC3A 2ATCB 4M3ZA 3OMCA 5GMKe 1YJWT 5CR4A 1TKDA 2PMHA 3QBYA 3PO5A 3LZIA 4C3JJ 1JB0E 1JKHA 1R5HA 1P7IA 4M3RA 2XY6A 4PL6A 2V7YA 1K9MU 2BE2A 4KAZA 3M07A 5JHFA 3ELKA 4AHUA 2PQWA 2X6XA 4O0IA 4FLZA 5FRMA 3A5LC 2HVSA 3V4IA 2COMA 3E9OA 4L9NA 1YTUA 3J81K 3A5OC 3NWTA 3M8JA 5I11A 3SV4A 2M16A 2B0LA 1OH5A 3TMOA 1I8FA 2H8RA 3RMAA 1IB8A 3TSQA 4BJTA 4DQSA 3F72A 3WTTC 4X1EA 3M0UA 1N8RU 3TWHA 3G0ZA 2DBMA 4KPYA 4FCYA 2LQNA 1MMAA 3CWSA 1UZCA 2HF4A 3KFVA 5GMKi 3QEPA 2Q97A 2Q0UA 3CUOA 3CCRT 3RQIA 1LPQA 2QWRA 3ZGKA 1KC8R 3TI0A 2FXAA 2KT8A 3OYLA 2CSOA 1VQNT 4CGIA 3THWB 5LEJA 1BWFO 2RQTA 2H94A 4ZNXA 3CCVT 5I2SA 3EYIA 2DL5A 2M0YA 1M2OA 3E2UA 1QHTA 1M3QA 3E66A 4ISFA 5AQNA 2VONA 4DS4A 4O55A 3REBB 3W6JB 3HVRA 2K3BA 3V1QA 3MJXA 1FEXA 2PVDB 4CF2A 3VTIA 1WH5A 2XV4S 2IGIA 5KE3A 2EA2A 5CVUA 2WSFE 1E3OC 1M3CA 1BIUA 3FXQA 1K4US 2DO3A 1QQJA 2FRYA 1BUPA 1VQLQ 1QVFM 2YKMA 1XC5A 1G3TA 3WXMB 5KYWB 4A4HA 4B6MA 2FZGB 3DLBA 1RRJA 3LP1A 2YUOA 1FIAA 2I5JA 1VQ7I 3HFOA 2CT3A 3IDHA 1NK0A 3NPFA 4C8QD 1X9MA 3GFLA 2HYJA 4MZTA 4C2TA 1JT0A 4DEYA 1EO1A 1SAUA 1X1BA 3OSSC 1NGEA 4DGWB 3VF2A 1SVOA 1HUXA 3FIFA 1G6NA 2X4JA 1Q86U 1VF9A 2L7MP 4AVPA 3JREA 3U9GA 2EYXA 2PTKA 1WSHA 3SJMA 1BG3A 3THYB 1MIJA 3OW2S 5DM7F 3CC7A 4XQFA 3C95A 1QPMA 4PJOC 2EIFA 1UAXA 3LSMA 3FGUA 2XRLA 4M7DG 4JI8K 1QSYA 3RTRA 5AQMA 6AT1B 5J2MA 2FO0A 2DL8A 1VQKN 2A28A 5FW9A 5KYUA 1NK5A 3TAQA 5IAYA 2K85A 5HNFA 3S1QJ 3OL4A 1ZSZC 2LDUA 3KEQA 5FU6C 2WUSA 2UUAK 1YQMA 2VXDA 4AHCA 1GCPA 3T1HK 4BGAA 1B72A 1RTDA 3AA3A 5A2QZ 4LITA 2O8FB 4KRFA 2MOXA 4BWJA 4QTRA 4XLAA 5CIUA 3LH0A 3M0PA 1Z6RA 3JXUA 1B34A 3LAMA 1YITT 2R5ZB 1JXBA 2CV1A 3JR9A 3WHBA 1WJCA 4JZ4A 4Z0UA 3QYEA 1ASVA 1SV5A 3FIWA 3SUQA 2XB5A 1MWKA 1AHDP 3V7RA 1VQ8T 5BS6A 4I01A 4ZYGA 1W7PA 1GV5A 4JYKA 3QYHB 1YW9A 2UZKA 5J1UA 3URGA 3QODA 5H1SQ 3BDDA 1BI2A 3COAC 2VGNA 2A1RA 2DW4A 2HQXA 1MNDA 5FD6A 2XO7A 1MJ9A 4DYRA 1C0MA 1JL2A 3F3XA 1JJ8C 2BYVE 4BB7A 2F5FA 3IUOA 2R7XA 4OFHA 4C8LA 1BR2A 2L2OA 5HS8A 1ZBXA 5FPNA 3OS1A 1R23A 1HW1A 4YIRX 2XY5A 3H36A 2QEXT 1U47A 2O8BA 2E71A 3VA0A 2AK5A 4KMUX 3NGZA 2QYOA 2CS3A 2HHXA 1N36K 1N9RA 4RDUA 2XIGA 2CQKA 3ZOBA 2A05A 1VQ8N 3F73A 3WEEB 2XSDC 1A5XA 2YHAA 3CC2A 1K4TA 1I5OB 3JAME 3CXCS 4M7AB 3G1OA 2DTZA 1NHAA 4O6JA 4HUGA 2BUPA 2HQNA 3EKSA 3QYGB 1TL3A 4E9HA 4AHSA 2K3PA 1ITYA 4H5RA 3P83D 3DRPA 4NXNK 1OISA 1KG4A 4B09A 1JLCA 1K8KA 1J0RA 1FYKA 3G7ZA 1Y97A 4C0DC 4BH9A 2HMAA 4DFKA 3VFZA 3QYFA 4RCBA 2FB7A 2RB6A 4EIAA 5EC7A 3KTUA 5IXFA 4YOYA 3V9UA 4HUFA 1UEBA 3A01A 2V7ZA 4OPAA 4FJHA 1OKRA 3JAMZ 3HRSA 5AQOA 4KIGA 2QZ8A 3HXLA 1WPKA 4OMZA 3ZQLA 2KZZA 1O7LA 1OPKA 1WA7A 5CCAA 2FEZA 3RCOA 3G4SI 2YR2A 1IO6A 5HLTA 2EX3A 1FOXA 5ECAA 4GY5A 1W36D 4I6MA 4KH5A 2YNGA 3C6UA 4EJUA 2JRTA 1YIOA 1CKBA 1BDGA 1HDPA 4GVMA 1U3OA 4XOTA 4AM3A 1H89C 1VQ5N 3CPWA 1TAQA 3T7ZA 1S72Q 3CCUT 4ASNA 2JQ7A 4JAXA 5ED4A 3GPLA 5BN8A 5BPDA 4GNIA 1ZHFA 4OVLA 4CGDA 5JICA 4H5TA 2CG4A 4PK4A 3SD4A 1VQPA 3DFGA 3Q3SA 4L18B 3CYMA 3G71T 4FWNA 2OTLA 3GW2A 4BC2A 2F5KA 1KC8O 2RQQA 3PNWC 2RQVA 2ASMA 1XI1A 2Y75A 1VQ9A 1XC9A 1P92A 2DJNA 3PUBA 1T3LA 4CI6A 3BDPA 4F17A 3KEOA 5CLSA 3HI0A 3UWNA 1IV6A 2V9KA 1UJ0A 2EIMH 1H8KA 1NGJA 1WZ2A 3VGMA 5KHDA 1JXOA 1WUAA 2VYPA 2B8AA 4FTHA 5EEGA 2V6EA 3TTCA 4BR4A 4XIDA 4JP0A 5GAOp 2MD5A 2XDVA 4JRKA 2FZKB 4YIIA 2DTOA 2M2EA 1TKZA 1YIJI 2HPIA 4BD3A 3TO9A 4IXAA 2P9PB 2D0OA 2KXCA 1Q82C 1S72N 3HFNA 3LGLA 4AG1C 1LJOA 4CC7A 1KQSS 1NK9A 2WWYA 2ME6A 2NOLA 1S9HA 1TKXA 1MDUB 1OH6A 3HVTA 5LRSA 4WE1A 2K9LA 4KUMA 1UHWA 3ZQQA 2RHYA 2YJFA 2V8JA 4FJ8A 4XONA 4DKWA 3MEAA 4LF6K 1X2NA 4Z4CA 2LKPA 5FGMA 1VQ5A 1SKUB 3WU2C 1D9DA 4KTQA 1EA3A 4ISEA 3C0CA 1WJEA 2M0OA 1BR4A 3DLKA 3SAFA 1QNTA 3CCJT 1TWHJ 2D0QB 2HTSA 3HIFA 1KVCA 1W7PB 1G15A 2KK4A 4CDGA 5GINA 4A3CJ 4FJMA 4CERA 1U5TC 1P8ZA 2HCKA 4B1WB 4M75E 3AAQA 2G8WA 2KQRA 1RAEB 1STZA 2QSHX 2XAFA 2QG9B 2CUZA 3MPUB 2LMJA 1TUUA 3BJAA 3M5AA 2Z3YA 2OTLQ 3O3HA 2C0IA 4CHNA 3OQ5A 3M9QA 2YRDA 4LSLA 4M6VA 2Z1GA 3TVTA 2PZ1A 4MZMA 4YNQA 4H0OA 1TXQA 4RTTA 4IOAF 4HUEA 4H4MA 4OMPA 4OMOA 3AA4A 3N4PA 5AQTA 2QKLB 3Q7CA 2EQMA 2BY0A 3GMEA 4RW6A 4V19K 2O7OA 2K5LA 3K5OA 3QMLA 2E70A 5CQGA 1QO0D 3HPHA 5TGTA 1AOYA 1UGQB 1NGNA 1SVLA 4G7HF 1HLUA 4ZGDB 1J5OA 4S0HB 2I7PA 4LFCK 4AC0A 4OB2B 1Y6IA 4A4KA 4DTXA 1F9NA 4XRFA 4QT7A 3AFHA 3ZQHA 1U1SA 5LJ3h 3OA9A 3V6DA 3H6ZA 3A98A 3Q1JA 1NNEA 4PFPA 1NEGA 2KQ2A 2O8CA 2A68F 2Y0SN 1TWFJ 2G7UA 1VSDA 2RHKA 3T5XA 4J2AA 3QP5A 4BQNA 2D0PA 1W4MA 2FJ1A 3HM5A 1REPC 1NK8A 5D7UA 3DYAA 4QAGA 1ZKGA 2M9UA 3CC4I 4OGCA 1X2KA 2EJ9A 5CQXA 4MDBA 4W5QA 4Q47A 4DR3K 3DEUA 2W82A 3DLLF 4H0VB 2E65A 3CC7Q 4WFAL 4YOQA 1ZUUA 3SUPA 5J8CA 1UG2A 2VQFK 2VN2A 2EKHA 4IKFA 2L02A 4UV9A 3ZPLA 5CYQA 4P9UA 5DM7L 2ECBA 1WFXA 2E6ZA 5J1YA 2EYQA 3OJUA 3OL3A 1TQMA 1YP5A 2KR3A 3CXCM 5GANf 2LCLA 1T6SA 2ZXIA 1RDDA 1S1UA 2OPSA 3M6GA 1HNXK 1V54H 5HRSA 4AUXA 5BRFA 4LJZF 3KWGA 2L5QA 3CCRQ 3DOKA 2C06A 3FBNB 3ZT3A 1ETQA 3ABMH 5AZIB 4FZYA 3CCVQ 3MEVA 3D7SB 4HCZA 3ZFJA 1BI1A 2W10A 1D1AA 1LUJB 3CCRN 3I33A 2A3LA 2LCCA 5GADJ 4CJKA 3DV8A 4RUGA 3PT9A 2CP7A 4RGUA 1PU8A 1NGFA 3ML6A 1O3TA 1W5TA 2E35A 5HS7A 1JUPA 2ESNA 4EM2A 2HTJA 1T05A 4DV5K 1JXEA 1ATNA 1VFCA 1WYXA 2JA7J 4D8DA 5FLXE 2A6HF 2QEXA 2DOFA 4WQ5C 1TG0A 3WXIA 1PYVA 1UGRB 4OIQF 5GAEP 2V1RA 3VODA 4DV4K 1BOBA 4RM2A 3QNNA 4DV6K 5E79C 3HOVJ 3HZ6A 8AT1B 2RK2A 3ULEB 3CM5A 2VOPA 2YX6A 1NEBA 1F5TA 2NLUA 5GAOr 1YJ9N 2F5DA 2PBIA 4F7UG 3DKYA 1OCOH 4GV6A 5L3EA 1RAHB 4RGSA 5L3CA 3TAPA 1S7AA 2HOTA 4M7AC 1Q1VA 3SNNA 1BISA 1WHLA 3ZT4A 5CHZA 2OTLN 3JRIA 4C2MJ 2LBFA 7AT1B 1H0MA 3P31A 3N4QA 3KCCA 5KGWA 1KHIA 5IT9E 1VQ9N 4CVNE 2KMUA 3DRSA 3H45C 4IQ4A 4FW2A 5D4SA 2HOEA 2JS2A 3EO3A 4ON0A 2NUZA 3M8PA 4H5NA 1VSHA 3OYHA 4CCMA 3FHGA 3CMAQ 2ETHA 3S32A 2WBMA 2K27A 2JTVA 3M4OJ 2YXYA 5CKHA 2R5YA 4N4GA 1OX9A 4B1XB 2Z1IA 3EUAA 4CSWA 3MVPA 3ASKA 2ZMEB 3BR1A 2CO5A 3SQ2A 3VYUB 4XICA 1U3EM 2OPPA 3JCMJ 3LM2A 4IVNA 1IZ6A 1GLCG 2X6YA 2PU9B 3LH5A 4CZCA 1ZSZB 4J8OA 3R6MA 3RMBA 2GFUA 1BB9A 3E19A 1QVGA 2JVHA 2O2OA 1O3QA 3NFCA 4E7SA 1D3BB 4LF8K 1VQ9T 2XF7A 4HCKA 2PUKB 3WQTA 3EETA 1HKTA 5JS2A 4E47A 3H46O 2WSEE 2RO0A 3TR8A 1G3YA 4AFUC 3ZSVA 4FHTA 5HRRA 5HP1A 3BTIA 3W2AA 3IC7A 1OVYA 4RA2A 4D0PA 4P5OA 3MCAB 3NAEA 1Z9ZA 2O9LA 3FFKB 3BROA 2EQRA 4KYWA 1W36C 2CQNA 3CD6A 4BHCA 1LFPA 2JGUA 4XU0A 3N05A 4EAHD 1BJAA 4N0AC 3M1CA 1Q82U 4XTXA 5LGNA 3FX3A 1N75A 5HLIA 4M78G 3K2ZA 3T8RA 3AL0B 2FBKA 2QYZA 4Q4ZF 1RZ4A 3H9GA 1SD6A 3ASOH 4ZC3A 2ITMA 1KQ0A 2XD0A 2JOYA 1EWQA 1S22A 1Q81C 2RMOA 4OO1J 2L7KA 1Q81R