3OS0A

Pfv strand transfer complex (stc) at 2.81 a resolution
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
365
structure length
365
Chain Sequence
b'AELDQLLQGHYIKGYPKQYTYFLEDGKVKVSRPEGVKIIPPQSDRQKIVLQAHNLAHTGREATLLKIANLYWWPNMRKDVVKQLGRCQQCLITNASNKASGPILRPDRPQKPFDKFFIDYIGPLPPSQGYLYVLVVVDGMTGFTWLYPTKAPSTSATVKSLNVLTSIAIPKVIHSDQGAAFTSSTFAEWAKERGIHLEFSTPYHPQSSGKVERKNSDIKRLLTKLLVGRPTKWYDLLPVVQLALNNTYSPVLKYTPHQLLFGIDSNTPFANQDTLDLTREEELSLLQEIRTSLYHPSTPPASSRSWSPVVGQLVQERVARPASLRPRWHKPSTVLKVLNPRTVVILDHLGNNRTVSIDNLKPTSH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Integrase
publication title The mechanism of retroviral integration from X-ray structures of its key intermediates
pubmed doi rcsb
source organism Human spumaretrovirus
molecule tags Recombination/dna
total genus 103
structure length 365
sequence length 365
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2010-09-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
A PF17921 Integrase_H2C2 Integrase zinc binding domain
A PF18103 SH3_11 Retroviral integrase C-terminal SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2300 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3os0A04
1.10.340.70 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Endonuclease III; domain 1 3os0A01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3os0A02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3os0A03
3AVCA 4CF1A 2X4WA 2EFIA 2HHXA 4B08A 1F21A 3OS2A 3DLRA 4M3TA 2RI5A 4EP4A 4CGGA 1S5JA 1R0AA 1WJQA 5HLFA 4Z02A 5D6XA 4MFBA 4CJ3A 4Y1CA 3VQ5A 4L59A 4CGHA 4E0DA 3Q1JA 1C1BA 2B6AA 3KK2A 4FJNA 5FRNA 3TAFA 3WNEA 2ETJA 4AHCA 4BWJA 2NLUA 3C4SA 2LDMA 3VQAA 3RMAA 5HRNA 1TK0A 3S6WA 4DLGA 1NK9A 3L2UA 3AVIA 4F3OA 2XY8A 4QAGA 4A4GA 3UT1A 2I5JA 2YNIA 3V9SA 3OYEA 3QEIA 2KFZA 2G8UA 3P5JA 4CEZA 4CGJA 2HNZA 3MXMA 3AA3A 3SUNA 3KK3A 2G3RA 1TKTA 2JLEA 3ULDA 1Q8IA 4LY7A 2HVIA 2P0KA 1RBUA 1XWLA 2BIVA 3NF6A 4I2PA 3AVNA 2RJCA 1RDAA 4KB0A 3BDLA 1J9AA 4Z4FA 3LGLA 2WONA 5IAYA 1A5XA 3FLGA 2R58A 5KI6A 2XRIA 2OPPA 2HW3A 1K6YA 2B5JA 3TAMA 4FJLA 1HQEA 4AILC 2HB5A 4JS4A 1O1WA 4CF0A 2F96A 3SQ0A 2E6LA 3ALYA 1VK0A 3G10A 1QSYA 3C94A 1XI1A 4O4GA 4DFJA 3QNOA 3MP1A 4IFVA 3FEOA 4CJSA 1CLQA 1SV5A 5M9OA 4N76A 3E01A 4IUVA 1WLJA 2L89A 2HHQA 4RW8A 4W5RA 3OMCA 4BE1A 4OGCA 4JLHA 3I0SA 3OS1A 1LW0A 1SKWA 4C5EA 3HK2A 4O44A 4CEQA 3KLGA 3AVLA 3VQCA 3V1OA 4FZZA 2HHSA 1NJZA 4BWMA 4HUEA 1S6QA 1WGSA 4DS4A 3NF9A 2E6NA 3CYMA 1MHNA 4G1QA 5KH6A 3KLIA 2RJEA 2NUBA 5FRMA 4RG2A 2PZSA 1IKXA 1HPZA 4DQPA 1BQNA 4O0JA 1XC9A 3SI6A 1N27A 4CEDA 4FJ7A 3OYHA 2B8AA 4DTUA 1RI0A 4KHWA 1NOYA 3OB9A 2FHDA 1C6VA 4DQSA 3RTVA 1BHLA 3HJFA 4BACA 3KIOA 2Z1JA 5J2NA 4CJKA 3OYGA 1RDBA 1QQCA 3RMDA 3QERA 3SV3A 4CECA 1TKXA 1RT6A 1SL0A 4KFBA 4FM2A 3EYZA 4BDPA 3LWMA 1NKEA 1N6QA 2IOCA 4I2QA 1NJXA 2BE2A 4OVLA 1X9MA 1SL2A 1KVBA 3UIQA 1S1XA 3MP8A 2QKKA 1RILA 4FLYA 2YNGA 4NS5A 4CFCA 1TAQA 3AA5X 3DOKA 4CJ4A 4DF8A 1FK9A 4FJ9A 2P5OA 2QQSA 3SQ4A 4DQRA 3K59A 1RT4A 3F73A 4FU6A 3AVJA 1L3UA 3MEWA 4A4FA 4KREA 1LWFA 4KHNA 3AVHA 2HHVA 3SZ2A 1HRHA 4QOZB 3KKSA 1GOCA 1RTDA 4KTWA 4DU4A 4IUUA 1LWEA 5SWMA 4F3TA 1VSLA 4Z4IA 3L8BA 2WOMA 1ZBLA 2EHGA 1KVAA 4DTJA 5HROA 1U47A 4O0IA 1FXXA 1JKHA 4JS5A 2ITGA 1SSFA 3META 2IS3A 1BI4B 4M41A 2O4XB 1C0MA 3F70A 3HVRA 2YNHA 4ELUA 1ITGA 4IKFA 4OVAA 4FK4A 4J2BA 3ASMA 4W5TA 1QSLA 4RG8A 2OZMA 4DLEA 3RWUA 4KAZA 3HYFA 1SKSA 3SQ2A 2EX3A 1NK8A 2GF7A 4ID5A 4FYDA 3PV8A 2D9TA 1RBRA 2RI3A 4B9UA 2KZZA 2XY7A 3AV9A 2B4JA 5HRPA 4ZTJA 3MO8A 4CJ5A 3OYMA 1VSIA 4F2SA 5CZ1A 1CZBA 1RBTA 3I0RA 2VG7A 4M3ZA 1TK5A 4EZ9A 3SUQA 1VRTA 1WSGA 3QO9A 2BDPA 4KI4A 1ASVA 4AHRA 5KE2A 2A1SA 4IBNA 3MXJA 3KK1A 3NH2A 3NTHA 1UA1A 4PLLA 3QJ6A 1BIUA 4GVMA 1UAXA 4FCYA 4FJ8A 4XIUA 3TAEA 3DLHA 1OYXA 4E89A 3LLRA 4HUGA 3OYCA 3OYLA 4IG3A 3MXIA 3PO5A 4DMNA 2DIGA 4GY5A 3BDPA 3LZIA 1VSHA 4KHSA 3QETA 3ZSWA 4LD6A 4J2EA 3IS9A 2HVHA 1IG9A 2RJFA 2EKOA 3PX4A 1W9HA 4FZYA 4NYNA 2G8VA 3PX6A 3V6DA 3HPHA 3WNHA 1TL3A 3SV4A 4QQGA 4F2RA 4WE1A 3S3NA 4CJEA 4DFKA 4KHQA 5J2PA 2BUDA 3NBPA 4CJUA 4YNQA 4CEFA 4W5NA 1TAUA 2HQEA 4AHVA 4Q0BA 3OYDA 1Z26A 1I3AA 3MAQA 2M0OA 3JSMA 1FKOA 3OS0A 4QVZA 1B9DA 3VQ7A 3OYIA 4NCAA 4N4HA 1JLCA 2R5AA 4B9SA 3VN5A 4FVMA 3NF8A 3IRXA 1VSJA 5CY4A 3HVTA 1CZ9A 2R57A 5KCHA 5JS1A 1TL1A 4B9LA 2X6SA 3O3GA 2G8IA 2F5KA 4RW4A 3K5LA 3T19A 3LGFA 3DLEA 3D45A 3KLHA 3CFRA 3V9XA 3HPOA 4FJXA 4OPKA 2EQMA 2PYLA 5HBMA 2JZ2A 3AVGA 1Y97A 3DI6A 5KGXA 4NYFA 1HNVA 3LYIA 5DK5A 2IC3A 1ASUA 3NH1A 3ZSOA 3NF7A 1WSJA 1U04A 3FFIA 3QIIA 3P1GA 2ATQA 2HHUA 3L3UA 3NHGA 1RNHA 1ZBFA 1SL1A 2P51A 3QLHA 3RRGA 4OKEA 4CJPA 4J2DA 1RT7A 3WNGA 4CRIA 1U48A 2DAQA 1HYZA 5CZ2A 3C6TA 3LALA 3QINA 2FBYA 4C8NA 1BIZA 3LPTA 4M3RA 2RHUA 3SD4A 2BANA 1T8EA 4PLIA 3TAPA 1IH7A 1YTAA 2DFFA 4AHTA 3DB3A 3LAKA 2Z1IA 1L3TA 4M3XA 4E7LA 2FC0A 3T3FA 4HTUA 5CYQA 1S1UA 5J2QA 5C6SA 3PUFA 4DTMA 3ZT0A 5I3UA 2RHIA 5CIUA 5J2MA 1KLNA 3PO4A 2OPQA 3VQPA 1T03A 1KCFA 1RT2A 4EDUA 4QCLA 1VSDA 4HVJA 3OY9A 4CIEA 2Z1GA 1NK5A 3LAMA 4KV8A 3LANA 3AA4A 4CF8A 1VSEA 3NTKA 1KLMA 4R5PA 3HXMA 1JLFA 1RTHA 4IUTA 1QE1A 3CG7A 4GMJB 4PY5A 4FL6A 4N47A 3THVA 1REVA 2YHBA 3OYBA 4DSJA 3K5OA 4C5GA 4LH5A 1S1TA 4NZGA 3V9WA 2D0BA 3P83D 4CCHA 2OZSA 2E6MA 4AHUA 3V4IA 4OKJA 4QQ6A 3KD1E 4TSXA 4Z0UA 4ELVA 1FKPA 2HMIA 4DF4A 1RDDA 1VSFA 2BKDN 1WNSA 3TR8A 3AO2A 3IG1A 3ASKA 1RTJA 2XY6A 2O4GA 1YTUA 2A1RA 4FJHA 3O4QA 3QBYA 3NNQA 2VYTA 1TK8A 4HCBA 2GUIA 3SQ1A 3S3OA 3V81A 3QEVA 1RT5A 1D9DA 5KCOA 2L8DA 2D0AA 4DQIA 4FM1A 2HQXA 4M3YA 4I9QA 1BQMA 2EQUA 2LRQA 1H3ZA 2DFHA 2K3XA 3AVFA 4N5SA 1NK6A 4DS5A 2VWJA 5SZTA 4CJVA 2RPIA 1KHCA 3VQ4A 3AVAA 1UA0A 4DTOA 4ZTFA 2EQKA 4CGDA 3MP6A 4RW6A 4FW1A 2R7YA 1BCMA 4H8KA 3AO3A 1BL3A 3HT3A 1HYSA 1TKDA 3LP3A 3V1QA 1QSSA 3QKJA 2W42A 4DSFA 2RHXA 4CFDA 4Q5WA 4Z4HA 4DTPA 3DRPA 4B9XA 3A2FA 5D6WA 4CHZA 4FJJA 3QIOA 3TWHA 1GOBA 4KB1A 4KKOA 2GBZA 4B9NA 4IDKA 4PWDA 4EZ6A 5I42A 4FK0A 3P8HA 4CHPA 2YNFA 4KPYA 2X74A 4QW2A 1MU2A 1DTQA 4FLWA 3OYNA 3M9QA 3DLBA 3DM2A 3KTQA 1S9EA 4CF2A 3QIPA 4M3WA 4FM0A 1DLOA 3H6ZA 2P1JA 3DOLA 4HHTA 1WJSA 4Y1DA 4BDYA 1W0HA 3MEUA 3NAEA 1LAWA 4C8MA 1U4BA 4ICLA 3TARA 5C24A 3MECA 1BGXT 1UWBA 4M45A 2IAJA 4IFYA 3DRSA 4I7FA 4CGIA 4OLAA 5KRTA 4DTNA 1JLQA 1L3SA 3DLGA 2QKBA 2Q3SA 5KGWA 4NCGA 4C8OA 1WSFA 3I8DA 2HNYA 2RHZA 2X4YA 3U6FA 3V9UA 3S3MA 3K58A 4E7KA 5KRSA 1EP4A 1SKRA 3RMCA 4CJQA 1D9FA 3LP2A 3MEAA 4F8RA 1RCHA 2G8KA 5J26A 1JLBA 4L8RB 3L2QA 4OJRA 1Q9XA 2G8FA 1B92A 1HNIA 3EAEA 3OA6A 1VRUA 3M8QA 2KFNA 3L2RA 3C6UA 2OPRA 1IKVA 3HPGA 1A5WA 1JLEA 3KLFA 2JTFA 3NGZA 1UOCA 1TVRA 1S1WA 4W5OA 3DB4A 3AVBA 4CHNA 3CEYA 1OZ3A 2YKMA 3H08A 1L3VA 4CJLA 1C1CA 4BE2A 4FW2A 3RR7A 3NGYA 3B6PA 4RW9A 3C95A 4KRFA 1EETA 5FROA 4FZXC 5C25A 3SPZA 2ZE2A 1WAJA 1KVCA 4DTRA 3D0PA 1QTMA 3HP9A 4OLBA 4DSEA 3NGIA 4QQDA 2X78A 4LD0A 4ID1A 2MWPA 4LSNA 2PQWA 1NK4A 3ZEHA 1CXQA 2PYJA 3DLKA 3LP1A 4CHOA 4BD3A 5D3GA 3ZT3A 3TAQA 4J2AA 4UC4A 4C5HA 3S9HA 4DQQA 5HRRA 2MWOA 3AO4A 1WSHA 1EX4A 3L2WA 2M1HA 4KI6A 2IDOA 3CM5A 3LX7A 2G8WA 4E7HA 3BGRA 2R5MA 4EP5A 1WSIA 4CFAA 4CJRA 1X1PA 3GOXA 2K3YA 1Q9YA 4B9VA 3U3YA 1Z25A 1G5VA 2LSNA 1G15A 4CK1A 1LV5A 5C42A 2O4IA 4DSLA 3ISNC 1A5VA 4DFPA 4PA1A 4YFUA 4B3OA 2E5QA 2LCCA 3O3HA 4N4GA 3VQ8A 3OQ5A 1RTIA 1NJYA 3ZSVA 4I9LA 1RT3A 1S6PA 3AVMA 3OMGA 2RJDA 4C5IA 3VQQA 2HHWA 4X34A 4DWIA 3DLMA 4DSKA 3HM9A 1RBSA 4FJIA 3MEDA 4FLTA 4FJGA 3ME9A 4CEOA 2RKIA 3PNWC 1XHZA 1KRPA 4FLXA 3B6OA 3O3FA 3K57A 2OA8A 4Z4EA 3F9KA 3M8SA 3MEEA 4FJMA 1KTQA 4KO0A 4PUOA 2BGGA 2YRVA 4CEEA 3LPUA 3MEGA 4N56A 3K5MA 3AO1A 5C0MA 1B9FA 1X9WA 4FK2A 2RN2A 4CHYA 4ZHRA 1WAFA 4Z4GA 1NOZA 4FXDA 4BE0A 4CIFA 1WSEA 1NK7A 4CIGA 4A4EA 4F4KA 3TI0A 4FJ5A 1JXEA 2JGUA 2D0CA 3LWLA 3ZSXA 4B9TA 3WNFA 3OJSA 5E41A 2XHBA 1C0TA 3ZSYA 3QNNA 4CESA 4K8XA 3QEPA 4IURA 1JL2A 2PY5A 1LAVA 4B8CA 4A4HA 3VQDA 1J5OA 3TABA 4C8KA 3ZT4A 5J39A 1QHTA 1SUQA 3SCXA 3UWNA 3CM6A 3ZT1A 3OYKA 1TV6A 1NK0A 2KTQA 4RW7A 1RDCA 2F8TA 3KD5E 3VQ6A 3VA3A 4OPJA 1YVUA 4PL6A 3OVNA 3QEXA 4FLVA 3OYAA 4E7JA 4E1MA 2X4XA 2GV9A 1BISA 5KE3A 3CFOA 5CYMA 3QESA 4O55A 5T7BA 1ZBIA 1RBVA 4CF9A 4E1NA 4CEBA 3O4NA 4H4OA 3AVKA 4IUPA 1KFSA 3EY1A 3KKRA 1WJRA 3VQ9A 2Y1IA 3T1AA 4GW6A 1VSMA 1CXUA 5DMRA 2XDPA 2KW4A 1WN7A 1ZBUA 3VQBA 2AJQA 2LVMA 1JLGA 4PQUA 2M16A 4MQ3A 4DSIA 3ZT2A 5EU7A 3ZCMA 2QK9A 3HP6A 4OGEA 3P8DA 4C8LA 3AO5A 2E4LA 4II1A 2KZMA 1L5UA 1ASWA 1HYVA 3DMJA 3FDRA 4FLUA 2YKNA 4CFBA 1U45A 4E3SA 4IUQA 2XK0A 3DRRA 2QQRA 4W5QA 3VQEA 3LZJA 1IKYA 4LH4A 3L42A 3HL8A 1U49A 2RHYA 4NCBA 4CGFA 2L3RA 4KTZA 1XHXA 3K5NA 1QS4A 1HQUA 1KSPA 2X35A 3L2VA 1C1AA 4ELTA 1XNIA 3SUOA 5HRSA 2EQJA 3TAGA 1YT3A 4DG1A 3LP0A 4AH9A 2VG6A 3PY8A 1LW2A 4B8AB 1D8YA 1KFDA 3NH0A 3CQ8A 1HMVA 4E19A 5K14A 3IAYA 1GOAA 4LSLA 3H8ZA 1IO2A 1BCOA 2HHTA 1JL1A 1RT1A 3RMBA 1EKEA 4DU3A 5IN1A 2XO7A 4CJTA 3SJJA 3KLEA 4O5BA 4CEAA 3SNNA 2VG5A 2FBVA 4M42A 3PMTA 5J1EA 2KQ2A 3ZSRA 2VWKA 2DFEA 3O8VA 4K8ZA 4OKKA 1S1VA 3V1RA 4HCCA 3AA2A 3NDKA 1TGOA 2LTOA 4DFMA 1BI4A 3M8PA 2YV0X 2O4XA 1EXQA 4DU1A 3SUPA 3OYFA 4M3UA 1C0UA 4CK3A 4CK2A 3PX0A 4KHUA 3LDSA 2P5GA 1J54A 3OYJA 2RF2A 4B9WA 3NFAA 4KTQA 2DTUA 4CJFA 2FBTA 2ZQBA 1NJWA 4IG0A 4Z4CA 4DTSA 4N4IA 1NKBA 5D6YA 1T7PA 3JYTA 3FC3A 5JS2A 4CE9A 2CKKA 2IG0A 2ZD1A 4B9MA 4JRPA 5HP1A 2F8SA 3SPYA 1ZYQA 4HUFA 4HCZA 4Q5VA 2GFAA 2RI2A 3V9ZA 1OZ2A 3EZ5A 2WACA 3NTIA 4UQGA 4H4MA 1JLAA 3RRHA 3QEWA 3TANA 2HNDA 2RO0A 4DTXA 2XY5A 2D5RA 1N5YA 3LH0A 4FJKA 3K2PA 3L3VA 1D5AA 3OJUA 3ITHA 4CJWA 1HJRA 1JXBA 4JRQA 3DYAA 3MEVA 1S9GA 1I39A 4BDZA 5KTQA 4FLZA 3PMIA 3E9FA 3HSTB 1NKCA 2Z1HA 4AHSA 2GFUA 3KJVA 3ZSZA 1T05A 4CERA 1VSKA 2G8HA 2IGIA 1TKZA 3VA0A 3CFPA 2Y1JA 2DY4A 3RR8A 1J53A 2DIQA 3ZSQA 3HO1A 2QXFA 1LWCA 4N41A 3G0ZA 3NCIA 3PFSA 3E9GA 2OYQA 2X6NA 1IKWA 1DTTA 2OPSA 4E7IA 1OI1A 3KUFA 4KHYA 1X9SA 1ZBHA 2FBXA 3U3GA 2YHAA 3NE6A 3SYZA 5FDLA 3M8RA 4CHQA
chains in the Genus database with same CATH superfamily
2DCEA 3RSEA 2K4BA 2AZSA 5KNLA 4CF1A 2X4WA 2EFIA 3O9UA 2HHXA 2HDCA 2CZ7B 2HCKA 4M3TA 4EP4A 2NS7A 3D5RC 1R0AA 4V2SA 2R92J 5HLFA 4A3MJ 1BG3A 2M7AA 4ZYAA 3SDZA 4Y1CA 1GXPA 4KN4X 1U06A 3QDKA 3VQ5A 3CDHA 1ZUKA 2V7FA 3J80Z 1ZBJA 2ZFUA 2ZXWH 2IPOB 4M7AE 2LT1A 3Q1JA 5A0DA 2B6AA 4FJNA 5FRNA 3TAFA 3WNEA 4C92A 1PSFA 4KH5A 3CJTB 3VQAA 1TZLA 3EG3A 3EN9A 1TK0A 1QQOA 3CETA 4GVEA 3CO7C 2NRAC 4F3OA 2FA5A 3MN5A 3QEIA 4XLHA 2JN6A 1LOJA 4DV0K 1ETVA 5ELZA 3W2AA 3G3ZA 3LSHA 3CCVQ 1BW5A 5LJ3j 1Y7XA 5CVUA 3OBWA 2F4IA 3QMLA 4J19A 2JLEA 3QYHB 2QUFA 3RIRA 1IV0A 1TW3A 2I8DA 2DE0X 2BIVA 4X0GA 2RJCA 1RDAA 3OMYA 4KB0A 3BDLA 3MN2A 5HY6A 5LLQA 2IA1A 1A5XA 3TSZA 1R5HA 4Q48A 2R7XA 3WG7H 1HUXA 4JBAA 1EH6A 3D5SC 3RMQA 4YELA 3HKZN 5BREA 1WHJA 3EHRA 2TCTA 1HQEA 3G6EI 1XGMA 1PU8A 2CH5A 3E3VA 4DGWB 4JS4A 2MGQA 4XRSA 1SFEA 1O1WA 4MO4A 3CMAN 4DK9A 2LX9A 2CJJA 3A8YA 2O8FB 1G2BA 3GFMA 2XDBA 3V8JA 4LB5A 4DFJA 3QNOA 2H1LA 1MW7A 4JQFA 4IFVA 4CJSA 2J5OA 1GLNA 1SV5A 1BI2A 1Z67A 2QTDA 4GLKA 3UKGA 3E01A 3R6NA 2HHQA 3OR1C 1N33K 1ZK8A 3HC7A 5L3BA 2JT4A 4W5RA 2FF4A 4DOWA 2DQRA 3EZWA 3LSIA 1SKWA 3HPWA 4O44A 2WAFA 3IAS2 3E9LA 3DEUA 4JNEA 4P96A 3KLGA 1IBLK 3V1OA 4FZZA 3HIFA 2WB1N 4FSXA 3LFKA 1Z05A 3L9FA 1S6QA 5E20A 4DS4A 2E6NA 2XDVA 2DTOA 4XN0A 3VFZA 1BU6O 4G1QA 1OH6A 3PJRA 1FMKA 2F5TX 1QZZA 2IVWA 1OR7A 4A6EA 2KHMA 1RNLA 3CMET 2JWKA 3CMEN 2NUBA 5FRMA 4ESRA 4A3CJ 3I8BA 4ESJA 3QOEA 3VOEA 1MDMB 5KYUB 3HKZA 1G83A 1YJWI 1HPZA 4JRIA 3RKQA 2Z5UA 3OOPA 4AFUC 1XC9A 2FRHA 2WBNA 1OQYA 2UYTA 2VKEA 3QBXA 1V55H 4FL9A 1I1GA 1MJAA 4FJ7A 2AHQA 2M9UA 3CC2A 2L2PA 2O9LA 2HKXA 2ZPFB 3EFOA 3PVLA 5LHGA 1RI0A 3A0IX 4KHWA 1YJ9T 3ZEUB 4Z2YA 3AHUA 3OB9A 2JA8J 1YJNT 1YJ9N 2HOTA 1YJNN 2QKLB 4YTLA 2K9NA 2XAJA 1ZG5A 2O8KA 1C6VA 3PO2J 5EJCA 1D0XA 4DQSA 4Y92A 4UV8A 4A4KA 2MLKA 3IMXA 3WTYC 3HJFA 4WYBA 2Z1JA 1VQ8I 2OAUA 5J2NA 3LQQA 2BYVE 3CPWP 4PJJA 3QERA 4FYWB 3V8KA 3IRQA 1VQ6T 4AG2C 1VQ5T 1VQ6N 1VQ5N 1TKXA 2VJIA 1W97L 3WXLA 3CWAA 5DEQA 4ELYC 1ACMB 3X24B 4FM2A 1HLUA 1CSKA 1M3CA 2VUBA 4XMYA 2K9LA 1T56A 4HVVA 3ZQHA 1SSHA 1PVSA 2EQRA 5AJ3K 3OSSC 2QA4I 2R7UA 4CHUA 1UJYA 1SL2A 1KVBA 1W1FA 2E1OA 5FU7B 3V7SA 1FSHA 2F5FA 2ZNYA 2QKKA 4FLYA 2WY7Q 1BO5O 3PIPL 3FX3A 2V6EA 1VQ9A 1S3XA 1TAQA 3AA5X 4CJ4A 2CS3A 3CCUN 5IT9E 3RBBB 2Q2EA 3PFIA 4DB3A 3EQLF 3MEWA 5LHHA 3C6AA 1HD3A 4A4FA 3H5RA 2V79A 2RQPA 2VVKA 2E2PA 3DQVC 1AEYA 3CXCP 3SZ2A 5FD5A 5D8KB 4BYYA 3N97A 1UFMA 3AAPA 3AL0C 1YJNA 2P5VA 3P9CA 2JWTA 2HMPA 3BY7A 5SWMA 4HVUA 5JICA 2DQLA 1E0EA 2COWA 3L8BA 3M5AA 5J8CA 2L7FP 4HDVA 2HDAA 2F4MB 4DTJA 1J6ZA 5AQLA 1YXQA 4JEPA 1VQ6A 1VQ5A 2GXBA 4E6KG 1X4PA 1Z91A 5AQMA 2XB5A 1LCUA 2YG9A 1FXXA 3FJ5A 1JKHA 2COMA 1K79A 1GVJA 2QBYB 2ITGA 1SSFA 3META 1IBKK 1X3ZB 1K83J 1VHXA 4M41A 3DLLF 2FZKB 1C0MA 3F70A 3WU2C 2FSKA 1TLHB 1ITGA 5HS7A 2IIRA 4J7IA 4K0KK 4IKFA 2EBIA 3VS3A 4AG1C 3VTHA 4LG3A 3HI0A 3RWUA 3REOA 1SKSA 4D7MA 5D5XB 2MSYA 1MMSA 4DR3K 3Q5FA 1MJBA 1KJWA 2J05A 2O8CA 3UKUA 1RBRA 4B9UA 3F8BA 2XY7A 1NBEB 1Q81U 2CU7A 1W70A 5HRPA 5IHKA 3OYMA 1EZZB 1VSIA 4F2SA 4MFEA 5CZ1A 4M7AA 3BG7A 1RBTA 3KYDB 4HTLA 5IH2A 1WPKA 2A61A 4M3ZA 4KFCA 3FZLA 1TK5A 4EZ9A 5KYYA 1VRTA 1YNZA 5AQUA 2CYYA 4M7DE 3H5AA 3HUGB 3ZBDA 3J7AP 3MXJA 1UA1A 4XLNF 2XU8A 1LWVA 3HFNA 3TGNA 4YOWA 4WFNL 1I0CA 1UAXA 3OIOA 3TU4K 4CYDA 1NJIR 2KLAA 4IOAL 1KAZA 1ATSA 4XORA 3DLHA 2VJJA 5M1NA 3T7ZA 3FXKA 4BBSJ 4YDUA 1ONVA 2P9KA 3RUXA 4HUGA 5E3MA 3CCEN 1LE8B 2V1DA 3OYCA 3OYLA 3MXIA 2ATCB 2JS0A 2OCCH 2D0NA 1K4US 4XTYA 2GOXB 1GLEG 3IS9A 1KGSA 1QVGS 1FMWA 1IG9A 1V1CA 5HLTA 3MDQA 1NM1A 3V6DA 3VRYA 3ERMA 2ZMEA 5H2FC 4QTRA 2XPWA 3SV4A 1S1NA 5IT9O 2EZHA 4U0YA 2PMZN 2GTJA 1MUZA 4QKUA 1CF7B 4CJEA 1XC3A 4DFKA 1X3UA 1O7FA 1R59O 5J2PA 1O75A 2NS0A 2BUDA 2LNVA 5GAOq 1PUFB 4BRCA 1RRJA 1K9MO 2DX1A 3M7GA 2WFBA 3EL2A 1IG8A 1D5VA 2K85A 2DT5A 3L7WA 1BI0A 4A69C 4Q0BA 2QAZA 4FQGA 1ABQA 3JSMA 4HQEA 5LJ5f 4AMCA 2KJBA 4XOPA 1B9DA 4AVZA 2ASMA 2M30A 3MHXA 3IRXA 2D6FA 4C92D 3TSPA 1VSJA 4RGUA 2R57A 3PVQA 1ORPA 3ZRGA 1JO8A 2VB6A 1LDDA 1WHUA 5JVGF 1VQPN 1WJDA 3WU1B 3PE0A 4AI4A 4M75G 1OU9A 4MEYF 3JCMV 4IL6C 3M0RA 5L3EA 2F5KA 1R00A 2KEAA 5HVQC 2DETA 5IXFA 2D0OA 3T19A 1TU0B 3DLEA 4A62A 5KYXB 3KLHA 2RQWA 2K86A 1NKUA 3HPOA 4FJXA 3L09A 2EQMA 5HBMA 2SEMA 3DI6A 1UCRA 1S7AA 1HNVA 2Q0RA 1YIOA 3CCLN 2W85A 3DTIA 2DL5A 2LJ3A 2MBFA 2CP6A 2YRCA 3NF7A 2RQVA 1WSJA 1VQLQ 2N8GA 2BV6A 4C92C 2OA4A 3WTSC 2HHUA 4BB7A 4LLLA 5I11A 4JLGA 2LRDA 2YPRA 3FK7A 2QWNA 1V5FA 1FEXA 4N0AA 4O5FA 4OKEA 4CJPA 2XPUA 2CUJA 1BM9A 3N4QA 4DKWA 1WHHA 2VPLA 2ESNA 1BI3A 2LZ6B 2ZBKA 4M4ZA 4KIFA 2E1MB 2QEXI 4BGBA 5GMKj 2FBYA 3CCQI 1BIZA 5GADJ 5FFZA 4XU2A 1HJOA 4EFHA 1IH7A 1E17A 2DFFA 4DR7K 3KXTA 2FZCB 2EIMH 4M3XA 2VV5A 2V51B 3CCVT 2W4SA 1K7AA 2J5PA 4JD2B 1N6AA 3S1MJ 5CIUA 5J2MA 1KLNA 3PO4A 2OPQA 2JPCA 1ZRCA 1T03A 2P6SA 6PAXA 4PGGA 1Q81C 4N4NB 5HNFA 4HVJA 5HCKA 1BJZA 2P9SA 1HNXK 1NK5A 4KV8A 3LANA 1VSEA 1XOVA 3PT9A 3M0TA 1I07A 3R9PA 4A3IJ 3HXMA 3TSWA 1JLFA 3VRZA 4I2OA 1J3TA 1RTHA 4M9XA 4IUTA 3JB9D 3CG7A 2CP0A 3D7EO 3UR3C 4IEEA 2E1ZA 2VJ5A 4BRHA 3CUOA 4C2TA 3BDDA 3LDOA 2ELJA 1REVA 2YHBA 1SS6A 1BWFO 4GCVA 4IZZA 3FXJA 3IH7A 1D3BA 2H3JA 1U1SA 2PNIA 4M3DA 1N8RR 2ZJRF 2F2VA 3QUIA 4CCHA 3FM5A 4Q4ZF 2OZSA 2E6MA 2ELHA 3VEPA 4P9FA 4Z0UA 1FKPA 1Y0MA 4F7UF 4DF4A 3CCVA 5ADXH 4IHTA 3TREA 4HYEA 3SFZA 2FNPA 2CZ1B 3P9KA 3P38A 4PIIA 1R5GA 2VQCA 3F8MA 1I27A 4FJHA 2QDYB 1G3WA 1KONA 3F8CA 4LDVA 3BR2A 3BY5A 2K2MA 2HKQB 2QQAA 5I9EB 2AA4A 3V81A 1K73R 2EZLA 3K1PA 3VDXA 4M7DA 4BROA 4F93B 3Q9VA 5GAN2 3EFSA 1JJ2A 4RWTA 4FM1A 4KJZA 5ILUA 2LD5A 2I2LA 4M6YA 5EZHA 1A5JA 2EQUA 3LQRA 1YO5C 2DFIA 4ENKA 5EXWA 3V7CA 4CJVA 1QCNA 1C0WA 1KHCA 2FBHA 1YW9A 4NLBA 2ROTA 3MQ0A 4VUBA 1YQRA 1KG5A 3MWMA 2F9WA 3WXJA 1WZ2A 1KQSS 4CZIA 2GCXA 2I7NA 3T8RA 3A03A 4H8KA 3AO3A 4UUSB 3HT3A 1HYSA 3VEYA 5ICGA 2ISZA 4EM1A 3LP3A 3ID8A 4M3GA 4G6TB 2HF4A 1GLDG 4DJAA 3FZFA 4Z4HA 3OW2M 4DTPA 2KDSA 1QHGA 1E6HA 2W25A 1QRYA 5JR3A 2HYGD 1RACB 4FJJA 3EYIA 2JW4A 1SC7A 1WEGA 2K9GA 4L5GA 4KB1A 5ED4A 1O3RA 3ZFJA 1NEBA 3CF5F 1U5TC 3VPZA 3VYHB 5I42A 3P8HA 4RTWA 2Y0SN 3DTEA 1XX5A 4KPYA 2E5ZA 1DTQA 3GFIA 4FLWA 3OYNA 1RRSA 3M9QA 3ABUA 1XMQK 4HX4A 3DLBA 3VW4A 5F1JA 1KQ8A 1UTIA 3Q7BA 2NAZA 1SEUA 2P1JA 1JKQC 5B8HA 3DOLA 4JHDB 4X66K 1IXCA 2PQ8A 3LWFA 1W0HA 5LEKA 5AQSA 1LAWA 3WQUA 5FGMA 4M7AD 4C8MA 2RN8A 2HEOA 4CC3A 1UWBA 1EV7A 4M45A 1T0FC 1VQNQ 3TPQA 1XJWB 2XHCA 1SZ2A 1BK2A 1NGGA 4O8KA 4J9GA 4A3BJ 2HBKA 4QSHA 2ZO4A 4DV2K 1N78A 3O3KA 2QKBA 2Q3SA 1WNLA 4NCGA 2IS1A 3HHTB 4X64K 4IIMA 1Z9CA 4BXUA 2EQIA 1KAXA 3L1AA 1E4FT 2X4YA 4UNFA 3S3MA 2W10A 3K58A 1OVYA 4E7KA 1NZ9A 5KRSA 1Q86O 1FY7A 1SKRA 3PIOA 2JMWA 4CJQA 1W2BA 1D9FA 1STZA 3BTJA 5AZIB 3TTDA 4ZDPA 4BJ5C 1OCCH 2RA2A 2VGNA 4M75A 2G8KA 2KXDA 2P7VB 2XC7A 4Y0WA 4L8RB 4ORZA 3GUDA 1TTYA 1XMKA 3VGMA 4OJRA 1X2MA 3PQKA 2DODA 1HNIA 2DBMA 3EAEA 3VF2A 4LN2A 4BXXJ 2KFNA 4FASD 1D8KA 1A5WA 3ERED 2EILH 3HOYJ 2MAMA 2QWOA 3CMEI 1JLEA 3NGZA 1UOCA 2CFOA 1TVRA 1KA8A 3MK6A 2UXDK 4D8KA 2VLAA 3CEYA 2V1XA 3ATVA 5FD6A 4B47A 4CJLA 1ZYRF 4FW2A 5LMUK 3B6PA 1ZLKA 2WSCE 5LJVA 5GAEP 1TOVA 4KRFA 1EETA 2B9SA 1VQMQ 4XEIA 1YJ9I 1YJNI 3ZMUA 2A36A 5GANd 3SPZA 2Z9OA 2K4JA 1U8RA 1QTMA 3HP9A 4OLBA 2YLBA 1BW6A 1YFHA 4IXAA 3DPTA 4OB2B 1FSEA 2X78A 4ILJA 2DVEA 3EYYA 4ID1A 4BY1J 2PYJA 3THYB 3I56Q 3GF2A 3DLKA 3CCMQ 1VQOQ 4BD3A 2KL4A 4BI4A 5D3GA 4J8FA 3SHWA 1VQ6I 3R1XA 1VQ5I 4J2AA 5AQXA 4BR5A 1ZA2B 2KMUA 3HRMA 4HSBA 3F6OA 4OPAA 3BW1A 1B59A 2JVVA 1R1VA 3GLXA 4EJZA 3L2WA 4LUDA 3QPHA 4WXCA 5H6RA 4KI6A 2XGEA 2BH1A 4JKEA 2WC2A 1WHMA 2G8WA 1AZEA 1SG5A 4E7HA 2GLOA 3VS1A 2LP5A 3O08A 3GDQA 1ULYA 4EP5A 4CFAA 4UY8O 3I5UA 2K9MA 3S1RJ 3BZCA 3GOXA 5CE3A 2LOOA 3DPLC 4AF1A 4HT8A 1OVQA 5FU6B 4B3XA 3IFRA 3GVAA 4WTOB 1OKRA 3ISNC 2DYRH 5D6EA 3HG9A 4B3OA 1YQLA 4A93J 1P4XA 3VQ8A 4DV1K 1NJYA 3ZSVA 3ULQB 4I9LA 3AVMA 4OIRF 2AIRB 3K6GA 2V52B 3VQQA 1O3TA 3I64A 4NO7A 2UXBK 1F1BB 4DWIA 5HNHA 1MKMA 2WBMA 2OTLQ 3BG5A 1RBSA 1Q7YO 3ME9A 4DQ2A 1JKOC 3KP5A 1X6OA 2E12A 1LNXA 1OH8A 4M6XA 3K1MA 4FLXA 3I9QA 4XU1A 3VUBA 4Z4EA 4M7AF 2OA8A 2V1NA 2NUPA 4OIOF 2VQLA 2C6YA 4PUOA 4LF9K 1JXOA 2BTTA 4BR0A 2R4GA 4B8XA 3E6MA 3LCNA 4EJUA 4XLCA 3DP7A 5B1AH 2FOWA 4E9EA 3MEGA 1FP2A 3K5MA 4Y91A 2FYKA 5CYVA 2L54A 4DYQA 1VQLT 1VQLN 2DL7A 2FO0A 2RN2A 1OH5A 1WB9A 1ODDA 2IIMA 2OI3A 2DERA 4DBFA 2LJ1A 4DV7K 1O57A 3DKWA 1NOZA 4FXDA 4LG0B 5TRDA 4F9OA 3M0SA 1KQ1A 1NGNA 1FTZA 3U4LA 4WCEL 4AM7A 1BU1A 2HPIA 4NLCA 1JXEA 2UZKA 1IAWA 3X26B 3KEYA 2DA4A 3VEWA 2JGUA 3LWLA 3QDFA 4F91B 4AFZC 4FT8A 4OMPA 3S14J 1M9SA 1MA9B 5AQRA 1X2QA 3VS0A 3FXQA 3HJEA 2M0MA 2K40A 1XG1A 4B3RK 2XHBA 3ZSYA 2P6TA 4K8XA 2PY5A 3TBIA 4PKIA 1J2XA 2DYBA 4UB8C 5C15A 1YWOA 1K9MC 2H8HA 1QVFP 3J7YP 1FYMA 1WI7A 3K4JA 2O8FA 5J39A 4JI8K 5F6FA 1NGDA 3OYKA 2F8TA 3BR1A 2DMQA 4NQWA 5E17F 1UGPB 4EVIA 4B1YB 3K9TA 1VQLA 4I6MB 1ORNA 4CZFA 2E35A 4CZLA 2KRMA 4KULA 5KPRA 3BC8A 4M7DD 5GMKm 5CVJA 4O55A 2JJ7A 1RBVA 1JJ2S 3I4NJ 3IHOA 4I02A 1Q82R 4LC9B 1SKUB 2PBIA 4ATOA 3G71N 3H35A 4H4OA 4BR2A 2HSTA 3CUQC 1KAYA 3KKRA 1WJRA 4M77G 2FX0A 3CPWS 3DPUA 4RAYA 5ERIA 5BOXA 1R71A 4WX9A 3T1AA 2EA4A 5C2DA 4QWQA 5CO7A 5KYUA 1PC0A 4GW6A 1N5ZA 2L3PA 2OANA 3ABTA 3W2VA 4M78G 2OJED 4IO9F 2R7VA 1JLGA 3S93A 3ZCMA 1R49A 1TWGJ 1FBQA 2FOKA 3SAHA 4UXNA 4A5BA 3P8DA 3ZEUA 3FHZA 2E4LA 1XCVA 1V76A 2X51A 2R5YB 2WAEA 3DMJA 4B24A 1QPIA 2PVDB 2LMDA 4EPCA 4IUQA 2KT1A 1ZH5A 4PJOE 4BC3A 1TH7A 3BJ6A 1VQKQ 2A37A 4W5QA 3VJPA 1EIFA 3LZJA 9ATCB 4RS8A 5A0LA 4ZH4F 2LC4A 3KWIA 3HL8A 4ETSA 1X1DA 2CDTA 5GAN8 2JTMA 2F7TA 1NJIO 3CXCS 2L3RA 2NVYJ 2JN0A 3QB0A 2P0QA 2KHOA 1HQUA 2X35A 5EF6A 5L3GA 1JJ6C 1Q86U 3LSRA 2KIUA 5JHUA 5HLHA 2I0NA 5GANj 4BR7A 2E41A 2WY8Q 3OIPA 4V2FA 3L2CA 2E1HA 4CZEA 2X6XA 4AH9A 3LA3A 2R3SA 2M02A 2DPUA 2CP3A 1LW2A 4MMLA 1GRIA 3NH0A 4HVWA 4BC2A 3SFIA 3KZBA 4IDHA 2CSOA 4IHXA 2V8IA 1ZARA 4J9HA 5K14A 1QVGM 1FBSA 1MWMA 1RABB 4XTXA 3L00A 1GVDA 3R60A 1GOAA 4LSLA 4FETA 1T0JA 4PK4A 4YRVA 4LJZF 5LD2C 4QIWN 1F9NA 1FLIA 2IJLA 4BVOA 3JRZA 2O8BA 1IREB 2YT6A 2F2WA 3GBQA 4FISA 4ZDOA 3CCVI 2F4VK 1LUJB 3I9V2 2VQHA 4AYBA 3KLEA 4O5BA 2IA2A 4AFQC 3SNNA 1R77A 4MHGA 2PVOB 4M75D 1QVUA 1HNZK 2ZCWA 3BF3A 3B6AA 2DJZA 1BOAA 2BE9B 3ZSRA 2ZJPL 4OB0B 4K8ZA 4OKKA 4I6ZA 4HX8A 5JLXA 3NDKA 4ZN3A 2QQ8A 1T08B 4G8XA 4DFMA 2YV0X 2QGGA 5BPDA 3SUPA 3IV5A 1BBZA 1HF0A 1JQQA 3LDSA 3JCMJ 3KFWX 2A5WA 2HXIA 3E6DA 1J54A 2BXZA 3OYJA 2VWBA 4BQNA 4LK0F 4CI0C 3NFAA 1W36D 1VQNT 1VQNN 2XV4S 2ZQBA 1NJWA 2ZGWA 4IG0A 2MH2A 4Z4CA 4DTSA 5BS6A 1PRLC 5HKCA 1NKBA 4JKBA 1SVLA 3KP2A 3CCJN 1T7PA 1T95A 4M7DF 3FISA 3HM8A 5JS2A 3GZNB 2CKKA 2ZD1A 1YUWA 4I98B 1H8AC 1RIOH 5JVHL 3SPYA 1YP5A 2LG4A 4Q5VA 3CTAA 4IOAF 2Y48A 1J59A 4DV4K 5BN9A 3EZ5A 5EVZA 4UQGA 4B3TK 2V1RA 2W48A 4PKCC 4MIMA 3MCPA 2J06A 3Q0WA 2GA1A 4RCCA 5DCFA 2CV0A 1R58A 2EYQA 5LJ3e 1O13A 3M9AA 1SHGA 1KU3A 4AD9A 2D45A 1BBYA 2XHIA 1QW1A 3LH0A 3K2PA 2HD0A 4W1UA 3S15J 1D5AA 1I94K 4XH4A 5AYFA 4DA4A 2I5UA 3THKA 4JRQA 1Q7YU 1JXBA 3MEVA 1ON1A 1I39A 1HLVA 2CUEA 1CZAN 5FO5A 4B3AA 4FLZA 4LDXA 1VQNA 3JCMP 3DXJF 2A7YA 2RH2A 1TKZA 4H0TB 3A2KA 4AT1B 1VQ8Q 1UGSB 3O9RA 2HS5A 2CWEA 3FZHA 1VQMT 3ZSQA 3GZ6A 1VUBA 4JKAA 3EUAA 1S9HA 4YIIA 3VSLA 1LWCA 2Q97A 2R7TA 3G0ZA 4F7UB 1CF7A 1N9SA 1TBXA 2K57A 2W41A 2OYQA 1NM7A 4JYKA 2Q1ZB 1PJRA 1FOYA 3L6QA 1ZR4A 4ISEA 3I56T 3CCMT 1PUFA 1VQOT 4KHYA 2VONA 4DCHA 1YRNA 3G2BA 2HR3A 4G6DA 1ZBHA 2FBXA 3U3GA 3H9QA 4C3JJ 3SYZA 2NNNA 3ENBA 2NRXA 5AIPA 4EEFG 1XMXA 4LDWA 2RE2A 1AWCA 1F21A 3FF5A 3LA7A 4ZDLA 5E79C 2RI5A 3CWTA 1GLLO 3ZETA 2D1KA 3C7NA 1S5JA 2DVJA 1X58A 4HG2A 5D6XA 2H8RA 1N8RO 3ZN0A 1Q86C 2YX6A 2FMYA 2EFPA 2KBTA 4ELZC 1C1BA 5GPAA 5AQZA 2XPVA 2NLUA 2LDMA 3S6WA 1DGWY 5M1OA 4DLGA 3HHGA 1NK9A 2V9KA 2PG4A 3TEEA 2XIGA 3AVIA 1VQMA 3PIOF 2I5JA 3KP3A 2YNIA 5EYRA 1KG7A 4M75F 3VKIA 4M77A 2Q36A 4Y17A 4CCKA 2HNZA 3FBIB 3LA2A 2NVTJ 5C0YA 1L3LA 2NOZA 3ULDA 3I56A 3CCMA 1VQOA 1WXBA 5CHIA 2R0QC 5LBQA 1KSWA 2PMHA 3NF6A 3I59B 1UAAA 4I2PA 3JRHA 3AVNA 3DXMA 1WHLA 1QQMA 1NLPC 3R0AA 3DBHB 2O6GE 2NOIA 2GEMA 4Z4FA 4B48A 2M51A 2K9SA 3WGHA 1WJFA 4ENMA 2B5JA 4XTZA 4PJNA 3K69A 1VI0A 4DZJA 1HCRA 1FYKA 4MO7A 2KRSA 1E3OC 4NB4A 2HEQA 1R1TA 4EGYA 4CF0A 2L9RA 2F96A 2E6LA 1VK0A 3BCBA 1S5LC 4O4GA 1YI2Q 1IJJA 2DJIA 1BDGA 1M27C 4I01A 4JD2A 2JPBA 4X9CA 4M71A 4NL3A 4X9DA 2C06A 2IVOA 4OGCA 1HPMA 3UA7A 4M7YA 4C5EA 2CQ7A 1ZGWA 4ZYHA 4H5RA 4CEQA 4XK4A 2P9IB 5ILVA 5HODA 1OPKA 4KH1B 5GANg 4IF4A 2BY2A 2OTLA 2HHSA 4BWMA 2EH3A 2K7AA 4B1WB 3CYMA 4LF8K 1MHNA 4CZZA 4DR1K 4ON0A 1BR4A 5GAMd 3GTMJ 4XU3A 4CI6A 2LR8A 1K78A 4ITVA 2CO5A 4I0BA 2PZSA 3OH6A 1QO0D 1MUYA 2IRFG 2MYSA 3QRFF 3H3NO 4CEDA 2QCOA 3INZA 4ZZLA 3JRFA 3JAME 2RNGA 2A08A 4DTUA 2G7HA 1Q7YC 1VFCA 2V8JA 2ZXHA 2QWMA 3CQXA 2E4HA 2QGFB 4HLXA 3CBPA 2ZWHA 1NK3P 4B9QA 3RTVA 4EAHD 4JI1K 2QWLA 4BREA 4EATA 1YTYA 4CJKA 3CPFA 3WE2A 1H89C 5AQTA 2ESWA 3SV3A 4CECA 3SWNB 3CD6Q 3KZZA 5LFAA 2ZPHB 2CGJA 3X20B 4Z8AA 4KFBA 1SF9A 4C8QB 4BDPA 4WK8F 4XLAA 1NKEA 4EJWA 4MQ9F 1IHVA 3LH5A 4FX0A 3JCMb 2PU9B 4I2QA 4HX7A 3K0SA 2HBLA 1B9NA 1W0TA 1WVRA 2ISYA 1GBQA 3UIQA 3R6OA 2CV1A 2Q2EB 4F17A 3R61A 1OCRH 1AD5A 3GO5A 4FYVB 4KBOA 3MZHA 3M55A 4QS8A 4NS5A 1R22A 4IQ4A 1RI9A 5AQJA 3HXLA 3AAFA 3RI4A 3U1DA 3DOKA 4DUZK 4AM6A 1A6IA 5I2MA 2QQSA 2AXTC 2L9NA 4DQRA 3SQ4A 4FE7A 3K59A 1U0JA 3EHQA 4FU6A 3JAMZ 2EV6A 3TU5A 4KREA 2RDPA 4PSXA 1VQKT 1HRHA 1ESVA 2K5FA 3CCSQ 5ICEA 2E5KA 3SAGA 4DU4A 1X2NA 4BY7J 3F0CA 1RADB 1VSLA 3P31A 2YHWA 2YUPA 5LJ3h 1ZBLA 2K3FA 1VQLI 1MUDA 1KVAA 5HROA 3AGKA 1E7OA 1KC8O 5DLQE 3QQAA 2AS5F 1EFNA 4F7ZA 1D5YA 3CCQQ 1ACIA 1IGUA 4KISA 3JCMW 4JS5A 3OSFA 1HJDA 4JKCA 2JWLA 2ZFWA 3M0PA 4G7ZF 2V4JC 3E5XA 1R5ID 2JNGA 2OTJN 4K2EA 2O31A 4ELUA 3ZX3A 3VEVA 1G99A 3LNQA 4OVAA 4JHDA 2H56A 5A2QE 4FK4A 1HU0A 4MTEA 4W5TA 1WQ2A 4MTDA 1HQCA 3HYFA 2JA7J 4MZMA 2EIJH 1N9RA 2JQ7A 1NMDA 1NU0A 4BG9A 2DILA 2RI3A 1S72N 4FT2A 2H94A 4ZTJA 2ACJA 3KEOA 3MO8A 4ZJZA 3V42A 1U9OA 1VQKA 4MGRA 3OWTA 3I0RA 2VG7A 4DW6A 2KKZA 2A68F 3IAM2 4J6YA 4LF6K 2NOJB 1OCPA 2CQQA 3F0ZA 4IRGA 1V4RA 3JCMX 4A63B 3NH2A 1H9TA 2JS2A 3I58A 4Z94A 1W5SA 4BRMA 4GVMA 2EZKA 1MSEC 5AZIA 2E1YA 5IT9K 4KGXB 1Y0NA 1H0MA 2BOLA 1OFCX 2MF2A 1NPRA 1OYXA 1E3HA 4RTUA 2NZTA 3CCRQ 3LLRA 3CJBA 1RLPC 1LWWA 3R4KA 2MOXA 2HBWA 1UJ8A 4IG3A 5FLXE 3PO5A 4FO0A 4G94A 4LE9A 4DMNA 4GY5A 2LFBA 3FB9A 1GUUA 1NJIC 2DMNA 1R8OB 3DEWA 4PJMA 2QF7A 1VSHA 1ETQA 2ZMEB 5CJ9A 2VKNA 1SAUA 5A2QZ 1IBMK 4J2EA 1ZBXA 3FWEA 3FRNA 2QASA 1AKHA 3TMOA 1X1AA 2YX7A 3VS4A 5H20A 5M1KA 3HSFA 1VTNC 3PX4A 2UUZA 5CVVA 2CGKA 5GMKe 5EG2A 1UHWA 2G8VA 3AG4H 1LEBA 2VKHA 4BRGA 3WNHA 3NARA 3SAFA 1N39A 4JDSA 1R23A 4QQGA 2EV5A 2NS8A 2PBDA 2ZM6K 2EIFA 2CUZA 5EX5A 1QZ6A 2L0AA 2HBMA 3CJQB 3VYSB 3QBWA 4UUVA 1X1CA 1TL8A 2M8EA 1RDWX 3NBPA 2KT8A 4GV6A 1I50J 1OMIA 4HF2A 2LJ0A 2Z1DA 2XUBA 2HQEA 4M3FA 4AHVA 3THYA 3MAQA 3LAPA 4FIBA 3SZPA 2V7YA 5M1QA 2M0OA 1NLOC 3TCJA 1FKOA 3LDPA 4XM3A 3PUBA 5CAIA 4QVZA 3M3YJ 4KT0E 4N4HA 4A3KJ 4RB1A 2R5AA 1IRGA 1AWXA 5FLXZ 4O3MA 1G3YA 1KO9A 1Y1WJ 1CZ9A 1HA8A 4B3MK 1RPWA 3FZKA 2W57A 1TL1A 5DM7L 3URGA 5GAMj 3O3GA 1MBHA 4M6VA 3HGGA 3CQTA 1ERDA 3TQNA 1P9QC 5A2QO 3K5LA 3LGFA 3CFRA 4FX4A 3GWZA 3P4IA 4CGZA 2JZ2A 5GIPA 2BHZA 4JK8A 5DK5A 2JA2A 3EUHC 5GAHP 5BPLA 4P1WA 3NH1A 4QT7A 1UHMA 3VS5A 3A02A 1JJ2M 2NYSA 1Q82O 2DTZA 1F5TA 3VOVA 4Y28E 5GAOm 3FFIA 4BC4A 3P1GA 3I33A 1WRJA 1Y8RB 1EH7A 1K76A 2OC6A 2XF5A 2COBA 2PEXA 1UHCA 1HW5A 3QLHA 1UZCA 4J7FA 4B1UB 3SB2A 5ILSA 2J4RA 4Y3OA 5FW9A 3ZMDA 2EK5A 2H1KA 4B1RA 1HYZA 2K6DA 4BC5A 1M1GA 1OV3A 3QINA 3ZQFA 1XSDA 4EIKA 1V4TA 4M3RA 3SD4A 2NYXA 2BANA 1VQ8A 4PJLA 3CMAQ 4PJOC 4S0HB 5F27A 2Z33A 3WUHA 3TAPA 4JOMA 2Z1IA 1L3TA 4E7LA 2FC0A 2O3FA 2KJCA 1DJ7B 3P8BB 4WFAL 2A69F 3NWSA 2YUNA 2A5YB 2E1MC 4CYCB 5B66C 3D2FB 2NRHA 5TKYA 2VCPA 1VQNI 3ZT0A 5EEAA 2ZJQF 1QWEA 2IS2A 2RHIA 3HTSB 4FHTA 3BG3A 3Q0UA 3HOSA 2X1DA 5CVRA 4LG0A 1OH7A 2BEOA 4AI5A 3U9ZA 2NXNB 1VSDA 3OY9A 2O2OA 3LAMA 1TQIA 3AA4A 2KRFA 4OPHA 5AN4A 4JX5A 4OP0A 2LQ8A 3NTKA 1KG3A 4H4KC 3S2HJ 1D3BB 1WBBA 1EWQA 2BBYA 1X75C 1QE1A 3CMEQ 3GF5A 4PY5A 2E3HA 2RNAA 4N47A 2B0LA 3S41A 3DKYA 1YI2T 1Q1HA 1TTHB 1IN4A 4DSJA 4C5GA 4OO1J 4NZGA 3V9WA 4E7SA 3G7ZA 3JCMd 4HF1A 3G4SN 2OV7A 5GAOp 2IVPA 4A57A 4X65K 1V5GA 1C0FA 4CCMA 1B9MA 1R4NB 5D5VB 4D5CA 4F7UE 1SFKA 3VODA 2HMIA 1XG7A 5M1FA 4OMQA 1YJ9Q 1RDDA 4I6MA 3F6VA 5DPKA 4YOVA 5CKFA 1N8RC 1KU7A 2O4GA 1YTUA 4KGVB 1F43A 4JJBA 2TDXA 2QSGX 2HVQA 1KD1O 4HCBA 1VQMI 4PJOG 1W2BM 2QWRA 3S2WA 4IPAA 5M3FJ 3SQ1A 1OCZH 2R7RA 1WX6A 4PCQA 1RR8C 3PTAA 2WAQN 1MV0B 1KG4A 1M1KR 4DQIA 1KC8U 3I56I 4NC7A 3CCMI 1YAGA 4M3YA 1VQOI 1PUEE 3LM9A 3LSGA 3MKDA 5C12A 4IEJA 3AVFA 4RAGA 1NK6A 1NK2P 5LGNA 3BOQA 1ZR2A 1WA7A 1DUXC 2R7SA 2QZ8A 1K73C 3FMSA 4J01A 3BTLA 1YI2A 2FRYA 2P9PB 2CH6A 2EQKA 4M77F 4JYAK 3CCUQ 1IRZA 2R7YA 1BCMA 3WTVC 4HSRA 1HNWK 1RGIA 2LK2A 2P81A 3VYRB 3M3ZA 3ABLH 4M78F 2MC3A 2V26A 2VUMJ 2W42A 3D1NI 2B7EA 3CD6T 3VEZA 3CD6N 4L5IA 1BOBA 4CFDA 2JUGA 2PI0A 4Q5WA 1XD7A 2P4WA 1I8FA 4AIAA 1FJGK 3H1VX 3X2QH 2E1NA 4B9XA 2HF3A 3A2FA 2BXYA 4IVNA 4L9TA 2HBPA 4CHZA 4X1VA 5CKDA 1TQPA 2X85A 2HQRA 3QIOA 1ZLJA 4EJYA 1EQYA 2VE8A 2ZXJA 3FSPA 1OYWA 2GBZA 1RR7A 2P8TA 4HWIA 4IDKA 1LWYA 4PWDA 4LB6B 4FK0A 4CHPA 2L01A 2QVOA 4YORA 2M8GX 2X74A 2VXZA 1MGTA 4QW2A 1EWRA 1VOMA 3FFKB 1S9EA 4CF2A 4EMKC 4ZZDA 1GLCG 1NBWA 1B34A 2K02A 3UNGC 3RCOA 4M3WA 1R9TJ 1TWHJ 4FM0A 3CC4N 2XKOA 1DLOA 5GMKh 3H6ZA 4BU2A 2MD0A 4RB2C 2JVGA 4HHTA 4OIPF 3RKWA 3CVTA 1O9SA 3S2DJ 1X9JA 2L5QA 2CSIA 3CCST 3CCSN 1X3WB 3SEZA 3MEUA 3NAEA 3E1SA 3IQLA 1DP3A 2O61A 2CZ0B 4ICLA 4XBFA 3TARA 2LP0A 1I6HJ 2HNIA 2XDDA 1BGXT 2YI1A 4C9YA 2JSPA 2V9PA 1U3OA 3VGLA 2EZIA 4EJVA 3GOIA 4EMSA 3M4OJ 2DA7A 2MI6A 2VBYA 2FQ3A 1DGKN 4K11A 5KRTA 4DTNA 3CD6A 2ZF5O 4HBLA 1JLQA 4A2AA 3TO9A 4FOEA 2M1BA 2ZJPF 1HDPA 1WSFA 1BA1A 5FWCA 2ZAEA 1QBJA 2JM8A 3IWZA 3C1DA 4M75B 4JJNK 3T9NA 3V9UA 2EA2A 2ESHA 1LPLA 3GNFB 1VZ0A 4HRIA 3RMCA 5AQVA 3MZYA 2ZNZA 3VF6A 1X1BA 1PVEA 2Q31A 3R6SA 3GX4X 4IEIA 3KZIC 1HBXG 1OULA 4D5FA 5M3MJ 2HFHA 5J26A 1JLBA 2JHJA 4LDYA 4N9HA 3CCEQ 1B92A 1TC3C 4RCBA 4FWQA 3M8QA 5FB2A 4XRFA 5DV5A 3C6UA 4QS7A 2OPRA 2VOPA 1MSFC 1MJ9A 1W7PB 4M73A 3J8AA 2J6OA 4KITB 4L0ZB 5I2SA 4U7DA 1YX3A 3BQZA 3RR6A 2UU9K 3KLFA 2JTFA 3CCSA 2M45A 3DEEA 3QZ5B 2FBIA 3I4PA 2O7OA 4W5OA 4GGGA 3AVBA 3DKXA 3AG3H 4CHNA 3M1EA 3H6EA 4NXMK 3H9GA 1IO6A 2DL3A 1XQHA 2DEQA 3LDQA 3OW2P 4BE2A 1P7MA 3NGYA 2A3SA 3C12A 3FM3A 1IJWC 3MX2A 4RW9A 3C95A 3KYLA 4EA5A 4C8QE 3GNGA 2FXUA 3ZCOA 3CCQA 1T39A 3KVGA 3CCRT 1WAJA 1KVCA 4DTRA 3D0PA 3GLLA 3AGRA 2CH4W 4DSEA 1Q82U 2G6FX 2FJ1A 2Z0WA 2QK0A 1EO1A 4HZFA 1RAEB 3VTIA 3I55N 2PQWA 3ZEHA 5TJJA 2QG9B 1DP7P 1P59A 1IN8A 5GAN5 3WTXC 3ZT3A 3J80E 4UV9A 3GL1A 4UC4A 4C5HA 4C23A 1P2FA 4J9IA 2LY2A 4O8UA 3K70D 4DQQA 3AO4A 4IO8A 1A0NB 2FEIA 2FQ4A 1Y0UA 3IC7A 4PDKA 1KC8C 3CM5A 3LX7A 2M3AA 4KH0B 1QP3A 1VQPQ 4M3EA 2R5MA 1CQTA 1WSIA 3TO7A 4AIKA 1HKTA 5IY5H 4B4CA 3LL3A 1Q9YA 2GZWA 2PUOB 3DWLE 2X6OA 3X25B 5F1XA 3CC7Q 4RB0A 2LSNA 4BY6B 4CK1A 1LV5A 5J40A 4FVUA 3CCLQ 4KUDK 1UUEA 3WT0A 1MNEA 3KE2A 3FKIJ 4DSLA 2LKXA 4PA1A 4CZMA 4YFUA 4J9BA 1ENHA 1Y64A 1VQKI 2E5QA 3VUZA 5GAN4 1K8AR 4CZJA 4BRQA 3OQ5A 2L02A 2W6KA 3CCRA 2F1LA 1V29B 3BR0A 5FPEA 3KZYA 3CF2A 2JMAA 4RTXA 2K5IA 5FU6C 1WH5A 4X34A 2O9SA 2NUPB 3THXB 3DLMA 1TT0A 3HM5A 3K10A 3VS2A 2ASPA 4CEOA 3SBGA 1VNDA 2P84A 4K43A 1XHZA 1Y8QB 4RGSA 1XGNA 4IHWA 3K57A 2A42A 4C2MJ 2CGLA 4EJOA 2HDDA 1P90A 3M8SA 3MEEA 4FJMA 1KTQA 3HSBA 4KO0A 2PFBA 2DAOA 3MFKA 4PUSA 1MMNA 2YRVA 3CZ6A 2D0PA 2NVXJ 3I0XA 5F0HA 3VYUB 4DOVA 2V1QA 4B1VA 3PO3J 2VC1A 4FK2A 4CHYA 4GNIA 5JLWA 4QPOA 3ZMSA 1YHQQ 1WAFA 3HFOA 1ON2A 2DI3A 2H8WA 5JVTA 2BUPA 1JCFA 3EG0A 4CIFA 1WSEA 1KG1A 1Q81R 4CIGA 2DRMA 4A4EA 1GBRA 4P5OA 5FKMA 5HK3A 3S16J 2BZTA 4LF5K 1KD1U 3I3LA 3I59A 1TUGB 2D0CA 1YWPA 5GAN3 1TUCA 2M2EA 1M8MA 1P92A 3QPTA 4QLCU 3CMAT 2IGKA 4FWRA 2DYIA 3SMSA 3X28B 4HCKA 3QEPA 4BXFA 4IURA 3U23A 1M3BA 1LAVA 1UECA 3J80O 3M1FA 2BY1A 4NQWB 3DXKB 3M59A 1M90O 4KGZB 2E64A 4W97A 5GANe 4HF0A 2UV1A 3WTZA 3ZT4A 2IS6A 2PX9A 1UG2A 4E2FB 3ZT1A 4NDLA 3G73A 3H92A 1NK0A 1NMNA 4RW7A 1X6BA 2L7KA 2A28A 3VQ6A 3ZQGA 3GTLJ 4PL6A 1KQ9A 2D4WA 4FWPA 2BGCA 3QEXA 1X69A 1QVTA 3TKYA 3DKMA 3WG9A 3ABKH 3OYAA 4E7JA 3M07A 4GDFA 3G1LA 5AFUH 4XICA 3KPHA 1XUPO 3A5MC 2XG8D 4UVAA 1BISA 5KE3A 3CFOA 5CYMA 1Y56A 4CC7A 2P9IA 5T7BA 2EWNA 4A3JJ 3GBTA 3A01A 4H0PA 3A5LC 1Y71A 2YX4A 4F3QA 4RTFD 3T69A 2FL7A 4A5NA 4CEBA 3NEUA 3O4NA 4FM4B 5KQDA 4LIUA 2F48A 2L3QA 1USTA 3EY1A 2JG6A 4WCIA 2GOMA 3C7JA 1NGBA 4CC4B 2BHYA 2W0ZA 3FXOA 3CMAA 1TNSA 2GWJA 5CCAA 2DK8A 3C2HA 4CD1A 1Q82C 1VSMA 2XDPA 3KP6A 4PQUA 1RUWA 3ZQCA 2M16A 1SAXA 1UGVA 3ZT2A 5EU7A 2M7BA 3TW6A 3O6BB 1WH7A 3AO5A 2GQVA 1SHFA 5BPNA 1MUNA 1HX1A 1ASWA 3FXUA 1YITQ 2RKHA 3EKSA 3BDUA 2YKNA 2X9DA 4E3SA 1UGRB 2WB1A 1LB2A 1KU2A 2Q0OA 1D0YA 4BUGA 1C0GA 3SWNA 4KH6A 1W6XA 1U5TB 1U78A 2EYXA 3KCCA 1HC8A 3M4GA 2H6CA 4CGFA 2VQEK 2QSFX 3A5ZB 3CMEA 3JRGA 2JOYA 3QPLA 4BQAA 2FG0A 1RUNA 4C8QA 3S1QJ 4I09A 1KSPA 2YJFA 4O6JA 2DPPB 5LJ5d 4ELTA 1XNIA 4H0YB 1WQWA 2BY3A 1TW2A 1YT3A 3B6CA 2X1CA 2LNHB 4DG1A 1PWTA 3CCUT 4PJ0C 1M3AA 5DLOA 5AT1B 5DUIA 1P7IA 3PY8A 3FZMA 1KFDA 2MIOA 1KQSA 2ZB9A 5E3OA 2P5LC 5IOZA 1R0BG 4B6MA 1T2KA 1YJ9A 3FMRA 4N0BA 2O8BB 4WXHA 1GLFO 1N25A 4OU0A 2FEZA 4JV5K 3CBOA 4EIAA 3K1NA 2PJRA 3CQYA 5B1BH 1BCOA 3TTFA 2E3IA 4D6WA 2P9NB 2K3PA 3RPUA 4E9HA 1RFQA 3H0GJ 4XKBA 2CUFA 4OMYA 1RT1A 1USSA 5KYWB 3ASOH 4CSWA 5IP6A 2L3SA 4DR4K 4GFBA 4DU3A 2L2OA 3DWLA 4CJTA 2XO7A 2ABKA 2FBVA 1FN7A 1PU6A 5J1EA 3FKJA 1UEBA 4CXFA 3HZ6A 2DBBA 4KRTA 2YS9A 4BUPA 1QZYA 4OFAA 2A5XA 2NOBA 4HCCA 4XN3A 2KDZA 1MPGA 3U21A 2EGCA 4N4OB 2NRRA 3JSPA 2H6BA 4M74A 4UUTA 4CCJA 4DU1A 3GPLA 3OYFA 1SRMA 1KD1C 3PNVA 2GM4A 4CK3A 1MBGA 4CK2A 3PX0A 3CCUA 2P5GA 4C0DC 2RF2A 3G6EN 2LSOA 3F9MA 4RMNA 5GAOl 3BCAA 5K1YA 2DTUA 3ABMH 3JCMg 3WHCA 1W5CC 3TEDA 2HTJA 1UG0A 3RERA 3E0JB 3M1CA 1YI2I 4N4IA 3N4PA 3JYTA 3CVSA 3FC3A 1WJBA 1CKBA 3DU5A 1JB0E 4B9MA 1PG5B 2EJGA 3TO6A 1Z21A 1W5TA 4OMLA 1AOYA 4L5EA 1ZKGA 1B6AA 3I0TA 4JPBW 4HCZA 4Z6YA 1WDXA 4A6DA 4QS9A 1J09A 1B07A 1UGQB 3GTKJ 2WTUA 3K4BA 1ILYA 3DCFA 4ISFA 1G3TA 1YVNA 1MBFA 1ZGJA 3A5NC 1H92A 1ZSZB 3CCET 3BR6A 2HU9A 4JI2K 3I71A 3TANA 2E7XA 1I5ZA 1PD1A 3E5UA 3O9QA 1IN5A 1OOTA 5HLIA 1DDNA 2ZPGB 1DT9A 2FF3B 1Z7LA 4J83A 4JKFA 2KISA 2EGEA 3L3VA 3TL4X 3A0HC 3WTTC 1Y96B 1I5LA 3OJUA 3ITHA 3J81E 1WUAA 3R0JA 1S9GA 5LJ3g 4BDZA 3NAUA 1QVGP 2KRCA 3GTQJ 4YOUA 3HSCA 3ZSZA 1T05A 2HI3A 4BI8B 2Y31A 3VA0A 3CFPA 2ITMA 3CMYA 3GEZA 2XRNA 1F36A 2PMUA 2NVUB 1J53A 2DIQA 4YPRA 4AM3A 3CP2A 4RDUA 1SMYF 4N41A 4CCOA 4D9JA 1YRNB 2Y4XA 3MCZA 1QLYA 3PFSA 1O3SA 3H3VK 3AAQA 1IKWA 1DTTA 1GCPA 3R2XC 1OI1A 1JGGA 3KUFA 3CD6I 3O9SA 2NOEA 1X9SA 3E5QA 2DU9A 2KIQA 3SDGA 1T8IA 5HK0A 3ZETB 3HDDA 3HTUA 3C7NB 3MKZA 3CCEA 2EFWA 5FDLA 2AXLA 4PKHA 3OS2A 1U1TA 5GANh 1MBEA 2XICA 2QA4N 2ZPBB 1VQPT 2CQXA 4BGDA 3RKXA 3NMUA 5DM7F 5F2RA 3J81Z 1ARKA 4Z02A 5E26A 2HYFA 1PD0A 5IYDJ 2M4KA 4CJ3A 4WQ4A 5KPTA 2GBQA 2Y0MA 3CC7T 4L59A 2Q8KA 3WVEB 3CC7N 4CW7B 1HKQA 2UUBK 2WV1A 1I3QJ 3CJ1A 3FBNB 1M90U 3CCLT 4XH5A 4LGWA 4LUEA 3VETA 3KK2A 2CRGA 4XOTA 2PMZA 2YU3A 3KLOA 2ETJA 3B8AX 4BWJA 4AHCA 3C4SA 4M77B 3N05A 5HRNA 2HNHA 1BL0A 2RQRA 2J7IA 1E4GT 2E2IJ 3L2UA 2XY8A 4M75E 3CCSI 3UT1A 3OGDA 3MD2A 2KFZA 3S32A 1QU3A 4M78B 3P5JA 4CEZA 4L18B 3H1CA 4CGJA 3DXMB 2H3EB 2W40A 3MXMA 3AA3A 3SUNA 2LCLA 2KT0A 3KK3A 1TKTA 1Q8IA 5DCMA 5GPCA 3ER0A 2LTPA 3JB9J 1I1JA 4K41A 2P0KA 4KNYA 2EFNA 1RBUA 1M1KO 1XWLA 1FNNA 1JHHA 5CKBA 2FVUA 2ZCFB 4A61A 2VKDA 1BC8C 3MMYB 1J9AA 3A8LB 5GAN7 2OJ2A 1N32K 1UB9A 3LGLA 3FLGA 1I81A 1SFXA 1K6YA 4HEA2 4WWCA 1VQPA 3MEXA 5IOYA 2XIDA 1YIJQ 3PIPA 2FPFA 3TAMA 2EYWA 5FPDA 4CJ7A 3W3DA 1MZBA 5LJ5j 3ELKA 2YR2A 3OBYA 2VYPA 5L23A 3REAB 4C1NK 3SJMA 3RZOJ 2KQRA 3J81O 1S29A 5L3CA 3G10A 3CC7A 1YHQT 4MDAA 3C94A 1YHQN 1ZN2A 1WXTA 2VBZA 3CCLA 3HOUJ 2XASA 1U2VB 4CYCA 3FEOA 1B7TA 3D2FA 4EJTA 2KIMA 2OAZA 1CLQA 1PKTA 4FOIA 5M9OA 1OISA 2QWQA 2AZVA 3ZXSA 4IUVA 2L89A 4YOQA 5KPZA 3A4CA 1T0HA 4JZ3A 4II2A 3OMCA 4BE1A 4HA8A 4JLHA 2KAFA 3I0SA 3OS1A 1DPUA 2ZC2A 1Z77A 1GV2A 3OSGA 3N4MA 1KIKA 4XIDA 4L9NA 2F69A 3HK2A 4BQZA 2DDBA 5D5WB 1GCQA 2PN6A 4BRPA 3AVLA 4PGHA 1G8XA 4GBQA 4IFEA 3VQCA 2ED0A 2JHNA 4ANJA 3G71Q 2E34A 3NF9A 3O8MA 1K78B 1OU8A 2GIZA 2F5CA 1BOTO 1EBMA 2MC4A 3PSIA 5KH6A 4C92G 5C2FA 3CCRI 5DTDA 4BRFA 3VWBA 2RJEA 4RG2A 3JRBA 2K79A 1OR7C 2J6FA 1IKXA 1G3SA 1M2OA 2E36A 3RDIA 5BPIA 1ZQ3P 5AQIA 3GFLA 2DXBA 1SANA 3SI6A 2Y30A 3ZMZA 4X6AJ 5F1RA 1SEMA 3E7LA 3Q3SA 1JUMA 4IOXA 1YHQA 4ISGA 1ETXA 2OPTA 1NOYA 4K25A 1ZTRA 2FHDA 1HSJA 3I54A 1FOXA 2D1XA 1AOJA 4BJTA 1M2VB 3CJRB 2X6WA 2BZ8A 2L4MA 2WV0A 3MPUB 1YG2A 1T98A 3AG1H 1RDBA 1UHFA 2DLPA 4C8QD 4NUBA 2E5LK 2H27A 5HDKA 3ZX0A 2MCNA 3VS6A 1RT6A 1XQOA 1SL0A 3KETA 1WIEA 2LY1A 4XRSG 2FSWA 2NOFA 4OMFB 3MAJA 3CPWA 3LWMA 4DOZA 2KSSA 2IOCA 3TP3A 3GW2A 5GAGP 1NJXA 1HSTA 2BE2A 4OVLA 4IIOA 3SWNC 5J4YA 4BVPA 3T8TA 3NWTA 3W6KB 2JSCA 1RILA 2GXAA 1WI3A 1I6XA 2P9PA 1BJAA 5KAIC 2YNGA 3QODA 4CFCA 2ECCA 1YITT 5JHFA 1YITN 1NG7A 4FJ9A 5ICFA 2P5OA 3RPUD 4ZC3A 4E1JA 3H45C 1YX5A 3F73A 2VJ4A 2BE5F 1L3UA 3CWUA 1QHAA 3OTOK 3GTJJ 1SQKA 3AT1B 1H88C 2HHVA 2CGHA 1V4SA 3TTCA 4QOZB 3KKSA 3TDUC 4C3IJ 1T3LA 1RTDA 1M90C 3BEXA 1LWEA 3BF1A 3M8EA 3GE1A 2LQKA 4A0ZA 4Z4IA 1S3JA 3CXCA 3CIPA 2R7FA 2ENMA 1LOTB 4EQQA 3JB9G 1JJ8C 5LL6S 2W24A 4O0IA 2JT1A 1Q95G 3HL2A 1S6LA 1TWAJ 1B72B 3OSVA 2IS3A 1WJEA 1VYUA 3K0LA 1W4MA 3RQ4A 2QEXT 3HVRA 4MNUA 2QEXN 2HGCA 1QPMA 2MA3A 1MH4A 1VQ4T 2R7OA 2DJNA 1VQ4N 1E3MA 4A0YA 2LNBA 4LFBK 4EVVA 5GAEJ 2E10A 2XVCA 3CMAI 4B23A 4BAYA 9ANTA 4DR2K 3RSNA 2OZMA 4RG8A 2EW3A 4KAZA 1SPKA 1YITA 5GP9A 4A2UA 2EX3A 3LMMA 2OU2A 4ID5A 3N0UA 4FYDA 2D9TA 1YS7A 2VC8A 3CCJQ 3VMFB 2KGTA 3AV9A 2Z2SB 1FIPA 2VPRA 5CR4A 1CZBA 3O2PE 2D1VA 2IA0A 3ZQLA 5BRHA 4H5VA 2X9HA 5GAMe 4JJDA 3G1OA 2W84A 2NUTA 5CVIA 2QWWA 4M7AC 2BDPA 1K9MU 4KI4A 1K8AO 4Y15A 2Y0SA 3BY6A 3SK3A 5AZJA 5KE2A 4GKJK 2DEUA 4PLLA 3QJ6A 1BIUA 2DXUA 3M0QA 4C3HJ 3OH9A 4JKGB 2JRTA 1BIBA 1YBYA 3QZ9B 4XIUA 3OW2S 3TAEA 5LGTA 2P0PA 3O1BA 1KQJA 3M5RA 3RDVA 2RHKA 1N77A 1M1EB 3DV8A 1JBMA 1Y57A 1WEIA 5BMZA 2AT1B 1AKHB 3F2KA 5AQQA 3PLAA 3SZTA 3HTVA 4YDUC 2DOFA 4HOBA 4BJ6C 4R79A 2RK1A 1QP2A 5D4SA 1W7PA 1RC9A 3BDPA 3LZIA 1GLJO 4F52A 1SRLA 4KHSA 3QETA 4HXJA 4OAZA 1U6ZA 4F04B 2RJFA 2EKOA 3WU0A 1W9HA 4FZYA 4NYNA 3UF4A 3PX6A 4J6WA 5FKLA 4XNFA 2W6LA 4ILHA 5LJ3f 2K2VA 1HYOA 4B09A 2OD5A 2ZZDA 1TL3A 2XAQA 2UWMA 2IGOA 4E4HA 4C8QF 4YIRX 2ZMEC 4DNCA 4H0XB 3S3NA 2EJFA 2GQQA 4IXCA 1YLFA 1D4XA 2RQQA 3ROUA 1H3HA 1NG9A 1U8BA 4BHBA 5A2QK 3IP4B 1N3AA 2VC0A 5EEHA 2JRMA 3EPZA 5BR8K 1H8KA 4W5NA 4D7NA 3G1JA 2P7CB 4DV5K 2R5ZB 3OYDA 1JXMA 1Z26A 5AONA 5ECAA 3OS0A 5HLGA 3VQ7A 3D6RA 3OYIA 2XGCA 2QYOA 1MWKA 4IZ9A 4B9SA 1Q1VA 4BL0B 1IDZA 2ZSHB 4M7AG 4FVMA 2RNJA 3NF8A 2E70A 4O5VA 3HHHA 3NQOA 4C0GA 2HXOA 4LNPA 4PFZA 3CCUI 4CH7A 2X6SA 1RAIB 4XSXF 4BRAA 4IOCL 4A12A 3BWGA 4RW4A 1VF9A 1VQ7Q 3D45A 3V9XA 2EJRA 2PYLA 3TOAA 5LRSA 1Y97A 3A98A 5GAN6 3LYIA 4WQ4C 3HZJA 5E1XA 2KR3A 2LREA 2IC3A 1ASUA 3ZSOA 4OAYA 5FLXK 5C4XJ 1U04A 2XF6A 4CBXA 4LFUA 2XAHA 1WQ7A 4LITA 3J7YJ 4H03B 2ATQA 4FWLA 2KDOA 2LC2A 2XAGA 3L3UA 3NHGA 4HDUA 1BKBA 1QGPA 1SL1A 1BA5A 2P51A 3QOPA 4N9IA 4JX4A 3RRGA 3THXA 1RT7A 1IRFA 1R36A 4L9VA 4N0AC 2P4RA 2DAQA 4RGXA 5CZ2A 3C6TA 3LALA 2EYYA 2DL8A 3O4WA 5EDNA 2ELKA 3FXLA 3K4CA 4WF2A 1T8EA 4J5YA 2VOOA 4ZGEB 3O6WA 4FWNA 3DB3A 2E1CA 3H3OB 3EE9A 1HSQA 1H1VA 4M9ZA 4HTUA 1MIJA 4BH9A 1YQKA 5BQTA 1S1UA 5J2QA 3OL4A 3MZ8A 3NMZC 5J1RA 5EC7A 1IW7F 5I3UA 1UG1A 2FRWA 3CC2T 3CC2N 3CDLA 3VQPA 4LOCA 4G6QA 5C3EJ 1RT2A 4EDUA 2CP7A 3MN6A 1RL2A 3H3ZA 4V19K 1HXDA 1C6VX 1TWFJ 1LMZA 1MBJA 3CMMA 2DKGA 4D8DA 4CIEA 4A54A 1XNRK 2Z1GA 1GXQA 5KVRA 5FWBA 3QHSA 1YIJT 1YIJN 2RGVA 4R5PA 1XS9A 2P5KA 2BVLA 3IRRA 1NWKA 3UB5A 2OUMA 2E20A 5LRRA 2CP2A 1HKGA 2FXAA 1OX9A 4J00A 1IXSB 1QZ5A 2V7ZA 5D8LB 3ZP5A 5KQ8A 3CCEI 2F2XA 3THVA 3AY9A 3NRVA 1GCQC 4CCNA 1JTYA 5CK9A 3SBTA 4U67L 5D7UA 2KZGA 3VGKA 3OYBA 3DXKA 5BRFA 1G6NA 4LH5A 3HRUA 4PFOA 2HVSA 2AQEA 5DDGA 3QICA 2GQIA 3I5RA 1IV6A 3PFYA 1AVZC 2WADA 2OZ6A 4JI6K 1YN8A 3E2UA 1Q7YR 3BPVA 2EIKH 4QQ6A 4GV9A 4TSXA 2PJPA 1VQ9T 1VQ9N 1LVKA 1VSFA 2VN2A 1WYXA 4FPAA 4H5WA 3AO2A 2A05A 2BVMA 5IHIA 3ASKA 1GV5A 1AA7A 3VS7A 2DT6A 1A31A 3G71T 3HRGA 4CDGA 2X4JA 2A1RA 1SVOA 2XB0X 2AP1A 4IO9L 4M7XA 3QBYA 3NNQA 1JJ2P 1TK8A 4EA4A 2GUIA 3KBGA 2FBKA 3WEEB 2PTKA 2LF8A 3FHNA 3JCMc 4DYRA 3S3OA 3EGUA 2DO3A 4BGAA 3QEVA 1YF5L 1D9DA 5KCOA 5I21A 3IKVA 2YUSA 3HSEA 4MQVA 5IP9J 1G4DA 1YIJA 2KQWA 4DQ8A 3WGGA 2HQXA 4M7DC 2AK5A 1YQAA 2DJQA 4I9QA 2ZKZA 4MMKA 4DS5A 3OL3A 2VWJA 2WSFE 3HRSA 4HPQA 5LGUA 2RPIA 4UVCA 1XDUA 5KYNA 1NGEA 3VQ4A 3A8MB 1OEBA 1W1WE 4ZYDA 4M77E 1UA0A 1LPQA 2CGPA 4DTOA 1M1KC 4HSTA 4CGDA 3SMPA 1X4OA 1VQPI 4RW6A 1VAZA 1RRQA 2HKOA 5GAMh 1OQKA 4M78E 1X3NA 4MLHA 2W7NA 1JCEA 4WQ5A 3V1QA 2VXFA 3CHWA 3UATA 4DSFA 4IWVA 3GZ5A 4RAZA 1LJOA 3CC7I 2E2QA 1WKMA 3CCLI 4F14A 2PLYA 3ULRB 3E9OA 3G71A 1YFNA 5D6WA 5E3NA 4C0ZA 4V19S 1U5TA 4G9YA 5M5XJ 4FWMA 2O8XA 3TWHA 1GOBA 3PIPF 1K8AU 2VL8A 2XAUA 1IC8A 4KKOA 1DQUA 4B9NA 2DMPA 1B34B 2CQKA 4YFNF 4C0FA 4EZ6A 5DY9A 2YRDA 4U0WA 2FPDA 3C18A 2LQWA 1O7LA 2NRVA 2CP5A 3KTQA 2OTJQ 2CW0F 3DU6A 2DO7A 1Z9QA 5E1WA 1POGA 4LK1F 3OYYA 4PNOA 4ZGDB 4A53A 3RYRA 2GAUA 4A3FJ 4U88A 1WJAA 3QG1A 2V6CA 4M3BA 1WJSA 5AQHA 1B8IB 3WVDB 2MMPA 5E8GA 4Y1DA 1VYTA 4BDYA 4D1QA 5DM7R 2LCSA 2DBKA 1T0FA 3CJNA 3JSOA 2YCHA 3MECA 3ASNH 1EF4A 1S72Q 2ECBA 1PP8F 2P9NA 3EDPA 1MGQA 2E65A 4M7DG 4IFYA 3LFUA 4I7FA 4CGIA 5KYWA 2IGNA 1YE9A 3SEQA 1XQSC 3KLNA 1YHQI 3VENA 4J6XA 4P9UA 5IT9Z 1ZX6A 4BQOA 5KGWA 2PAVA 1W2BP 4XAXB 4EM0B 3I8DA 3JCMQ 1M30A 1SD6A 3UKRB 2K4YA 2RHZA 4NBQA 3EE8A 3JCMe 2QSHX 2L4AA 4BHPA 3JREA 4LXCA 2F5EA 2RQTA 3FIFA 3KP4A 1GT0C 1J5YA 1AHDP 3SJHA 3LP2A 5JFRA 5IPAA 5FPNA 2HBJA 1RCHA 4F8RA 1W7PD 4A59A 4IHVA 2G8FA 4M75C 3OA6A 3JTHA 1VRUA 3L2RA 2O88A 3CCJT 1ATNA 2FZGB 2IAIA 3C0CA 3EFRA 3TW7A 4DBRA 2X4HA 4PKGA 1ZGAA 2LKSA 3CQZJ 3HOTA 4RBOA 2DTHA 3TSQA 2XSDC 2QTVA 2CW7A 2QQ9A 4UHTA 4ZYGA 4MFDA 5FPMA 1E6GA 2RD1A 3D4VA 1JU5C 2OFIA 2ZXIA 4R56A 1OZ3A 4CVNE 1PU7A 3BROA 3MMVA 1L3VA 1HKSA 1W36C 3P7NA 5CPRB 1D3YA 3IKMA 1QCOA 1C1CA 2CT3A 5F0XA 1UMQA 3HOZJ 2MW8A 1I4K1 1UJ0A 5FROA 4FZXC 3ISPA 1M3HA 5C25A 2PVGB 3BR3A 4IX7A 2QKMB 3FE1A 3W0LA 2HZTA 1U9NA 1ZSZA 1K8KA 3NGIA 2IVNA 3K2AA 3PL8A 2QM1A 5K5RA 2Y9ZA 1CXQA 2UXCK 2A41A 1QHHD 2YSRA 2C0OA 3EGXA 3TAQA 5E3LA 4CZGA 4IQJA 1IUYA 1Y96A 4HQMA 1FYLA 3WTUC 3H5NA 2MWOA 1EX4A 2KIFA 2DA1A 1AHJB 4M63C 3BJAA 2VBWA 3GP8A 3CCJA 3O5BA 1U84A 7AT1B 3BGRA 3ZR8X 2CW8A 1LEAA 1RZ4A 1OLTA 4WFBL 2DXTA 4J9EA 3LOCA 5J4VA 2JPSA 1G5VA 1YITI 2JXBA 2RK2A 4LF4K 4KBMB 2DOAA 3VF4A 4FT4A 1A5VA 4DFPA 2HYJA 3FHGA 2LCCA 3J7ZO 5IYCJ 3UA6A 3QJYA 4H0VB 1RTIA 5E18F 3CP8A 1S6PA 4EM2A 2RJDA 4BY6C 4C5IA 1EH8A 1HOMA 1Y07A 2HHWA 3PIOL 4DSKA 4BR4A 3HM9A 2GIVA 3CPEA 4EW0A 1JXSA 4BQQA 4FLTA 4JI7K 2NLXA 1Z0XA 1K8AC 3H41A 4JI3K 4V2GA 1KRPA 1NH3A 2DA5A 3K4KA 4PJOB 3LL7A 2L7ZA 3J7AY 3O3FA 5D5UB 3F9KA 3N5NX 1VQ7T 1VQ7N 2O8DB 4HAMA 1WFWA 5E1ZB 3PNYA 2E2OA 3I53A 1AT1B 4CEEA 3F8FA 3LWIA 4N56A 1VQ4I 4M9SA 3AO1A 3W6JB 1NG6A 2GNCA 2FUG2 1Z7UA 1X9WA 1TUUA 3AKZA 1ZLMA 2CSQA 1K73O 2D8HA 2QTXA 3BE3A 1XN7A 3J80K 4M78A 3G25A 3J7AF 2KKOA 2G9WA 4RA2A 3THWA 2A3ZA 2R7WA 4BE0A 4JJCA 3CCVN 1ABOA 5J8FA 2RN7A 4F4KA 3TI0A 5FKOA 2B63J 4HV6A 5AQWA 2WUSA 5GAOr 4XK8E 3QXEB 3MWTA 2VWFA 4RUGA 3FHFA 2MPXC 2YHXA 1KQSM 5E41A 4HKEA 1C0TA 4CESA 3FLCO 1WFXA 2ED1A 1ZHFA 3HB9A 1G59A 3GTPJ 3ZYYX 1PP7U 3G1MA 4B8CA 1KU9A 3O8HA 3G4SQ 1VQ7A 1J5OA 3DBLB 1L0OC 4AWXB 3TABA 1SUQA 3SCXA 1DIZA 1G2HA 5L3FA 4OIQF 1ZHIA 1TV6A 2KTQA 1U2VA 1OYIA 1RDCA 1QVFA 3KD5E 4EMHA 4OPJA 4A2BA 1YVUA 4K42A 2QGUA 4Y7NJ 3A01B 2EYZA 2Q0UA 3RYPA 1ZSGA 5GADP 2W1OA 3SQNA 2GV9A