3OS0A

Pfv strand transfer complex (stc) at 2.81 a resolution
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
365
structure length
365
Chain Sequence
AELDQLLQGHYIKGYPKQYTYFLEDGKVKVSRPEGVKIIPPQSDRQKIVLQAHNLAHTGREATLLKIANLYWWPNMRKDVVKQLGRCQQCLITNASNKASGPILRPDRPQKPFDKFFIDYIGPLPPSQGYLYVLVVVDGMTGFTWLYPTKAPSTSATVKSLNVLTSIAIPKVIHSDQGAAFTSSTFAEWAKERGIHLEFSTPYHPQSSGKVERKNSDIKRLLTKLLVGRPTKWYDLLPVVQLALNNTYSPVLKYTPHQLLFGIDSNTPFANQDTLDLTREEELSLLQEIRTSLYHPSTPPASSRSWSPVVGQLVQERVARPASLRPRWHKPSTVLKVLNPRTVVILDHLGNNRTVSIDNLKPTSH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The mechanism of retroviral integration from X-ray structures of its key intermediates
pubmed doi rcsb
source organism Human spumaretrovirus
molecule tags Recombination/dna
molecule keywords Integrase
total genus 103
structure length 365
sequence length 365
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2010-09-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
A PF17921 Integrase_H2C2 Integrase zinc binding domain
A PF18103 SH3_11 Retroviral integrase C-terminal SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2300 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3os0A04
1.10.340.70 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Endonuclease III; domain 1 3os0A01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3os0A02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3os0A03
2HNYA 2GBZA 4FZXC 4FJ7A 1WGSA 1JXEA 4OLAA 1C1CA 3PX6A 3MEVA 1KLNA 4CJTA 1S1WA 2E6NA 2A1SA 1ZBUA 2LSNA 4OVLA 2BDPA 1HYZA 5KCHA 3M8QA 4PA1A 3PMIA 4CIEA 2X4WA 1BI4B 1JLFA 4E3SA 4AILC 1VSEA 1SL1A 2HHSA 3UIQA 3OA6A 2DFEA 4KB1A 4DTPA 4J2DA 3E01A 3DRPA 4E89A 2XHBA 1G5VA 4DS5A 3OYGA 1RT1A 4FK2A 2D9TA 3OYDA 1YVUA 1SL0A 3E9FA 2KTQA 3T1AA 3DLGA 3VQ6A 2O4XB 2HQXA 2RHXA 2ITGA 2EHGA 4X34A 1NK0A 4Z0UA 5FDLA 1T8EA 3DB4A 1YTUA 3VA0A 1YTAA 2G8UA 3KUFA 4DF4A 5K14A 1XI1A 5D6WA 5CZ1A 2RPIA 1VSIA 1A5WA 3K2PA 4N4GA 3LP3A 3OS2A 1VRTA 5SZTA 1HQUA 2RI5A 3TANA 3VQCA 2G8KA 4NCBA 3JYTA 3KJVA 1NKBA 4BE0A 1RTIA 4NCGA 1D9FA 1ASVA 1BHLA 3AA4A 5CY4A 4Z4IA 4MQ3A 3THVA 2BKDN 2KQ2A 5SWMA 3QKJA 4DMNA 2DY4A 2IDOA 3AVAA 3K5LA 4W5QA 4RG2A 4CHOA 4E7IA 5IAYA 1HQEA 2YNGA 2Y1IA 3LX7A 3PNWC 3VQ7A 4NZGA 4PQUA 3V6DA 3MXIA 4K8XA 3MAQA 1VSMA 2L3RA 3DB3A 2DFFA 4DSIA 3OYHA 3CM5A 3HSTB 5I3UA 4KV8A 5CZ2A 3MECA 4DTUA 2R5MA 4IBNA 1UAXA 5T7BA 1B92A 4CJWA 4KHWA 2WOMA 3DOLA 2RJCA 4N41A 2QQRA 1RTHA 4CGDA 3O3FA 4I2QA 4I2PA 4DTXA 4Z4HA 4IUPA 1HYSA 4IG0A 3AA5X 3KIOA 3VQBA 1Q9XA 4UQGA 1SV5A 3TWHA 3RMAA 4FLYA 3AO1A 4KFBA 1U4BA 1Z26A 2GFUA 1C0MA 3HXMA 4C8LA 1HRHA 1RBRA 4C5HA 3ISNC 2Z1GA 4CJEA 2EKOA 2X35A 4C5EA 1KVCA 1LAVA 1QE1A 3SV3A 2G8HA 4F8RA 5FRMA 2BUDA 5KH6A 3EYZA 2KFZA 3HT3A 1MU2A 4E7HA 5C0MA 3SUOA 2D0CA 1C1AA 2WONA 3V9ZA 3TARA 3QINA 3L2WA 3NGIA 4CF0A 2R5AA 4H4OA 3L2RA 2YNFA 3RMDA 4FJMA 3I0SA 4MFBA 2QKBA 2FBYA 2RJFA 2F96A 4CJQA 4FXDA 2LTOA 4DLGA 4ELVA 4ZTJA 1RBTA 3CYMA 4F3OA 2X6SA 1U45A 3RRHA 3MEGA 2B4JA 2LCCA 1HNVA 4YFUA 4FLWA 4CJ4A 3TAEA 2E6MA 2X4YA 4ICLA 4YNQA 3ZEHA 3IS9A 1T03A 4OLBA 3LH0A 4BDZA 1JKHA 1K6YA 3TAGA 1ZBHA 4CEFA 2YHBA 4DU3A 1Q8IA 4RW6A 1XHZA 1NK7A 1NKEA 1XHXA 5C24A 4B8CA 1XNIA 2IG0A 3IAYA 2HHVA 3RTVA 4FJLA 1RDBA 2F5KA 4OKJA 4OKEA 4CHPA 3SCXA 3ZSZA 3SQ1A 4B9MA 4Q0BA 5KGWA 3QEVA 1FKPA 3OB9A 4CFAA 1NK4A 1WAJA 4B9NA 5KCOA 4C8NA 3B6PA 1SKWA 4HCCA 2L8DA 3QIIA 3LGLA 4CIFA 3VQ4A 4FJ8A 1MHNA 2CKKA 1BQMA 1RBSA 2FBVA 4E1MA 4PY5A 2M16A 3AVKA 2BIVA 1UA0A 1SKSA 4K8ZA 4Z02A 2ATQA 1J53A 2Z1IA 3L8BA 4DTSA 2B5JA 2KW4A 3DLEA 4CK3A 4CFCA 1L3SA 1BCMA 4BDPA 3MO8A 3RRGA 4CCHA 1L3VA 2DAQA 1KHCA 3K5OA 3ALYA 3G0ZA 4DSEA 3DLRA 3AVGA 2BGGA 2IAJA 1W0HA 1HMVA 3WNHA 3K5NA 3KK1A 3SUPA 2YNHA 1Z25A 3UWNA 4HHTA 3AVBA 5HP1A 3OYKA 1LW2A 4DS4A 3U3YA 3V1RA 1EKEA 3RR8A 4HCBA 2D5RA 2PQWA 1EXQA 4CEBA 4FZYA 1F21A 4FJ5A 2VG7A 4QVZA 5HBMA 4AHSA 3V1QA 4KPYA 3MXJA 4PL6A 4CEQA 4FZZA 4H8KA 1NJZA 3AV9A 4B9WA 3L42A 3AA3A 1UOCA 1VSLA 3DLHA 4BE2A 4EDUA 2ZQBA 1JLQA 5J2MA 1CXQA 5D3GA 4ELUA 2HHUA 3NBPA 1VSKA 3NH2A 1SKRA 5KI6A 1KCFA 4RW7A 3OS1A 3LLRA 2VG6A 2P51A 3CM6A 3NH0A 1JL1A 3RWUA 4Y1DA 3SQ4A 2EQUA 1D9DA 2KFNA 1J54A 2AJQA 3DLMA 1S9EA 4M3XA 3BDPA 3ZT3A 1I3AA 3NF8A 4DTOA 2G8VA 2EQJA 3Q1JA 1TK0A 4N76A 4QW2A 1JLGA 1RT5A 2P5OA 2XY5A 4FJHA 3LPTA 4KI4A 3FEOA 1S1UA 4O4GA 2VWJA 3SUNA 1BISA 4RW4A 3PY8A 1SL2A 2JGUA 5DK5A 2RI3A 2XRIA 5C6SA 2DIGA 3V9UA 3LWLA 1XWLA 3S9HA 3CQ8A 3HJFA 1CLQA 3VQ5A 1H3ZA 2IC3A 1GOBA 2EQKA 3MP6A 4IURA 4DFJA 1TL1A 3D45A 1RNHA 4O0IA 1RBUA 1TKZA 3MEAA 3PUFA 4AH9A 2Q3SA 1HYVA 4DF8A 1IKVA 4M3ZA 1VSJA 1D8YA 4KREA 3OQ5A 3QLHA 2B8AA 4ID5A 1JL2A 4HVJA 2E5QA 5C42A 2WACA 3ITHA 1LWEA 3T19A 2G8FA 1WSEA 4JLHA 2X74A 4CJPA 2RHYA 3VQEA 3F73A 1U47A 4Q5WA 1DTQA 3O3GA 1RT6A 4CHZA 4FJNA 5FROA 4BWJA 3QERA 2B6AA 1B9FA 3OJSA 4DQPA 3OYMA 4OGEA 3TR8A 1VSDA 4NYNA 2X78A 4CJFA 3V81A 5HRNA 3PX0A 1TVRA 4J2AA 4BDYA 3LZJA 4KRFA 3UT1A 1WSJA 3P83D 1RT7A 4FLXA 4GVMA 2LVMA 3SUQA 3AVHA 1U49A 1NJWA 3M9QA 2RHUA 1RT4A 1DLOA 3AO3A 4C8KA 4B3OA 3LANA 1BIZA 3QO9A 2LRQA 2MWPA 1S6PA 5J2QA 3QNNA 1X9MA 3HP6A 1OI1A 4PLLA 3F70A 3S6WA 3AVFA 2GV9A 3OYNA 3C4SA 3KD1E 3QNOA 2F8SA 1FK9A 3LGFA 4N4HA 4B9XA 4FK4A 4GMJB 2KZMA 3OYCA 3LP0A 3KTQA 2R57A 4QQDA 3NDKA 3SQ2A 2OZSA 4F4KA 3LAMA 4FLVA 2A1RA 4B9SA 1OYXA 2RN2A 3OYAA 3CEYA 2MWOA 3VN5A 2HHWA 4IFVA 3D0PA 3VQQA 2FBXA 3HO1A 4RG8A 5KTQA 2PY5A 1TKTA 1WJSA 4ZTFA 3MP8A 3ASMA 4F2RA 4LD0A 4JRQA 3MXMA 4OVAA 3NTKA 4CJLA 3VQAA 5M9OA 2XY8A 4CJKA 1KVBA 2QXFA 5KRSA 4B9UA 4Z4GA 2DTUA 4LD6A 1N27A 3OYJA 1HJRA 2YV0X 3DRRA 4R5PA 3OJUA 1QSSA 3A2FA 4FJXA 4QAGA 3NTHA 1GOCA 1REVA 3QEXA 1EETA 2DIQA 1TAUA 4KHUA 2YRVA 4J2BA 1OZ3A 1QHTA 4NS5A 1HNIA 1BI4A 3OS0A 2HNDA 3QJ6A 3HVTA 4LH4A 4GY5A 3QEIA 2RJEA 1EP4A 4H4MA 4DSKA 3NCIA 3HK2A 2HNZA 1VSFA 4IG3A 2BE2A 1KVAA 4NYFA 3VQ8A 1TKXA 1KFDA 4B9VA 4DSLA 1RILA 3O3HA 1QQCA 1N6QA 4DTRA 2OA8A 3P8DA 1C0UA 2O4XA 2GUIA 2YKNA 4O5BA 4CJ3A 4HUEA 3OYIA 1Q9YA 1I39A 2PZSA 4ID1A 3L3UA 2ZE2A 3AVLA 4IDKA 3C95A 2OYQA 4N5SA 3FC3A 4OPJA 3SYZA 3SV4A 4DFPA 2P5GA 1BCOA 1LV5A 2PYLA 4EZ9A 3NF7A 3TI0A 4DWIA 1B9DA 2E6LA 4FVMA 4CHNA 2NLUA 4PWDA 5J2PA 3FLGA 3ZT2A 3CFOA 5DMRA 3PO5A 4G1QA 4UC4A 4W5NA 1JLEA 4C8OA 1RBVA 2R7YA 4J2EA 4FLTA 4CERA 4N56A 4CGGA 2K3XA 3NGZA 3PX4A 3SPYA 4KHSA 4Z4FA 4CJ5A 4DG1A 4KHNA 2GF7A 1BQNA 4F3TA 4FYDA 2EQMA 3OMGA 4IUQA 4PUOA 1XC9A 4CJRA 2YHAA 4F2SA 2JTFA 2RHIA 1LAWA 4W5TA 3QBYA 3O4NA 4CIGA 4XIUA 3NAEA 2Y1JA 4ELTA 4HCZA 4KAZA 4GW6A 1D5AA 2VWKA 1UA1A 2ZD1A 3V9XA 1S1XA 4EP4A 3LDSA 3TABA 3QIOA 2QK9A 5HROA 3ASKA 4LY7A 4KO0A 1NOYA 3TAPA 3ZSVA 2BANA 4O55A 3RMCA 1ZYQA 3OY9A 3ME9A 2HB5A 3L2UA 2OPQA 4FM1A 1KSPA 3LP2A 3SNNA 2L89A 4E7KA 1S6QA 5C25A 3HPOA 4C5GA 1X1PA 2YKMA 4CJUA 3AO2A 4DTMA 1ZBLA 3L3VA 3ZT4A 1U48A 4FJ9A 3MEUA 3DI6A 4HUFA 3MEWA 3OYEA 3OMCA 4M3TA 1BGXT 1CXUA 5IN1A 1JXBA 4CECA 3KK3A 4LSNA 2IS3A 4N47A 4L59A 3ZT1A 4FLZA 5HRRA 4DSFA 3SJJA 4L8RB 1S1VA 1T05A 2D0BA 4ZHRA 1ASUA 3QEWA 4AHRA 4CFDA 3H8ZA 1JLAA 3H6ZA 1LWFA 2OPRA 3IG1A 2O4IA 2K3YA 2D0AA 3I8DA 4IKFA 1IG9A 1RT2A 4BWMA 4DLEA 4DQIA 3FDRA 3U3GA 1BIUA 3CFPA 3L2QA 5JS2A 1TK8A 5J39A 4NCAA 3DRSA 4FU6A 3KLEA 3KKRA 1UWBA 3HPGA 4CF2A 1SSFA 4FW2A 3TAFA 4JRPA 1X9WA 3M8RA 4HUGA 4CGJA 3SPZA 3AVMA 1WSFA 4KTZA 1OZ2A 2FBTA 1VSHA 1S1TA 1ITGA 3LAKA 4M3YA 1RTJA 3AVJA 4M45A 5KE2A 4AHTA 4CEEA 3HVRA 1TAQA 1C1BA 4B8AB 3G10A 1WJQA 3LALA 1IKYA 3QETA 1RTDA 1WSGA 4CE9A 4FLUA 1J5OA 1KTQA 3K58A 4OPKA 3RMBA 4E0DA 3JSMA 3KLFA 2G8WA 1A5XA 4O0JA 3KKSA 4CGHA 3VQPA 4E1NA 4I9LA 2FHDA 3AO4A 3DYAA 3BGRA 3S3NA 1BL3A 3MEDA 5D6XA 4DQRA 4AHCA 4FJIA 4A4HA 3ZCMA 3O4QA 2OPPA 4M42A 1TGOA 3H08A 3BDLA 4TSXA 1FXXA 3P5JA 3C6UA 4KTQA 2F8TA 5J26A 4B9LA 2RI2A 4IUVA 1WAFA 1Y97A 1N5YA 3NTIA 1RI0A 4FK0A 4CHYA 1TV6A 2XY7A 1KRPA 4RW9A 3NFAA 2VYTA 4CK1A 1S5JA 4CF9A 3ZT0A 4HTUA 1QTMA 4Z4EA 4OKKA 3NE6A 3ZSXA 1GOAA 5I42A 3C94A 1KLMA 2E4LA 4RW8A 3META 4IFYA 2LDMA 3B6OA 3WNFA 3OYBA 4CEOA 3AO5A 4W5OA 3TAQA 2HMIA 3V4IA 1EX4A 1G15A 3AA2A 1IO2A 4BD3A 3NGYA 3RR7A 2M0OA 2IGIA 3I0RA 2O4GA 5J2NA 2P0KA 2OPSA 4CK2A 4DQQA 1ZBIA 1NKCA 5CYQA 4A4EA 4DQSA 3SQ0A 1L3TA 1CZBA 3PFSA 1RDDA 3SI6A 1QSLA 3S3OA 3DMJA 3QEPA 1T7PA 4CEAA 4PLIA 3LWMA 3KLHA 4E19A 4II1A 4IUTA 4LSLA 3DLBA 1VRUA 1NK6A 3EY1A 4FJGA 1L5UA 2RHZA 3HPHA 4E7LA 1S9GA 3O8VA 1RCHA 4M3UA 2HW3A 2XDPA 4LH5A 2RJDA 4Z4CA 4CRIA 3P8HA 4KB0A 1WLJA 3ZSOA 3SD4A 3ULDA 1QSYA 1IKXA 3VQDA 2X6NA 5CYMA 3CFRA 3M8SA 4FM2A 3V9SA 3K5MA 2DFHA 2EFIA 2NUBA 2G8IA 1A5VA 5FRNA 3V1OA 3PMTA 3K57A 1NK5A 1L3UA 3PO4A 4KI6A 1WSHA 3HP9A 3NHGA 3F9KA 3E9GA 4CJSA 1LWCA 2ETJA 4DU1A 5J1EA 3K59A 3VQ9A 3T3FA 2QKKA 3L2VA 3FFIA 4I9QA 1WN7A 4Y1CA 3M8PA 2X4XA 3KLIA 3MEEA 3LYIA 4CF8A 3SZ2A 1NOZA 3DOKA 4FJJA 5EU7A 3EAEA 3OVNA 3QESA 5JS1A 4CF1A 3EZ5A 2HVHA 4FW1A 3KK2A 4C5IA 2RF2A 1JLBA 1WSIA 1W9HA 2JLEA 3TAMA 1KFSA 2HHQA 1FKOA 4QQGA 4Q5VA 4DTNA 5KRTA 1TKDA 3HL8A 2VG5A 4M3RA 1C6VA 4W5RA 1RT3A 3OYLA 1TL3A 3LPUA 3ZSRA 4CJVA 3KLGA 2XO7A 4QOZB 2HHTA 3S3MA 2XK0A 4B08A 2I5JA 2JZ2A 4C8MA 1IKWA 3KD5E 2HVIA 4QCLA 2YNIA 3NF6A 4FJKA 4AHUA 4EZ6A 2G3RA 2FC0A 3CG7A 3HM9A 4CEZA 1NJYA 4A4FA 2HQEA 4CESA 4DSJA 1RDCA 1WNSA 3IRXA 3HYFA 4FL6A 1IH7A 4JS5A 3GOXA 3ZSYA 4DTJA 4B9TA 4KHQA 4N4IA 3ZSWA 2QQSA 4FM0A 3DM2A 3NF9A 4DFMA 2Z1JA 5E41A 1ZBFA 1NK9A 2IOCA 4KTWA 1TK5A 5HRPA 2RO0A 4M3WA 4OGCA 5KE3A 1C0TA 4OJRA 5HLFA 4EP5A 3LZIA 2OZMA 3AVCA 2KZZA 3NH1A 2M1HA 1HPZA 1CZ9A 1YT3A 5HRSA 1JLCA 1SUQA 1J9AA 4O44A 4JS4A 4BACA 2HHXA 4IUUA 1QS4A 3WNGA 3WNEA 2R58A 5KGXA 3LP1A 2GFAA 1R0AA 3C6TA 3PV8A 3ZSQA 4A4GA 4I7FA 2Z1HA 1X9SA 4CEDA 3P1GA 4DFKA 4AHVA 2PYJA 2W42A 4KKOA 1LW0A 3V9WA 3U6FA 3AVNA 4CHQA 5D6YA 4QQ6A 3OYFA 2XY6A 3AVIA 4E7JA 1O1WA 1RDAA 4FCYA 4CGFA 3QIPA 4DU4A 1DTTA 4CFBA 4CGIA 1ASWA 4KHYA 1VK0A 4WE1A 1NJXA 4BE1A 3VA3A 3MP1A 5CIUA 1U04A 2P1JA 1WJRA 2EX3A 3DLKA 2RKIA 4M41A 1NK8A 3NNQA
chains in the Genus database with same CATH superfamily
1WGSA 3OS5A 1FP1D 4OVLA 4B47A 2GEMA 1YVUA 4BC5A 1SL0A 2F5FA 3E9FA 2E34A 4HRIA 1YTAA 1M90C 4B43A 5ECAA 3H3OB 1IDYA 4E70A 2VBWA 3LSPA 2R7XA 3JS6A 3LP3A 3PIOL 2JRTA 3TANA 4JKCA 4WXDA 2YXYA 1WA7A 3JAMZ 1UHMA 3SWNA 3I33A 4W5QA 4LXCA 3NWSA 1S29A 4G7OF 5IHIA 2G7HA 4YOUA 2EWNA 5HVQC 2NOBA 3CM5A 1NH3A 5CZ2A 3K0SA 1KONA 5T7BA 5KQDA 4I2QA 3H0GJ 4DTXA 4KN7X 1HYSA 3CJCA 3M0RA 4BVOA 1ZQ1A 3RMAA 1XGOA 4EHUA 2GFUA 1VQNT 4M7DF 3CCUN 5GAMg 1WQ7A 4J5YA 3LCNA 4IHYA 1XTDA 1VQMI 2RAEA 5LY3A 5J47A 4ZTJA 2C0IA 2LG4A 4BDZA 3H36A 4HLXA 4C92C 4B8CA 2HHVA 2IG0A 4BNCA 2LVSA 4BC3A 4FJLA 4OKJA 3FHZA 5AQMA 5FKOA 3OB9A 3PO3J 3F5TA 4HCCA 3AG2H 1Y7XA 4J8OA 1YHQN 4XLAA 2MMPA 1CKAA 4I6MA 1KYWA 3UB5A 4JUVA 5ADXA 2V4JC 1L3VA 3K5OA 4HSBA 2QDYB 3LSTA 1T56A 3TEDA 2I0NA 1NGIA 2H6CA 4CZZA 3B02A 3G6ET 1MBKA 2P4RA 3FXKA 4H0VB 1HF0A 1JXOA 3L42A 2LKSA 1PCXA 3NBPA 1RI7A 1XX5A 2NNWA 4QTRA 4FT4A 3HJEA 3NAUA 1AKHB 2AJQA 4N76A 3PQKA 2P5OA 3BR6A 1Y0UA 2JUFA 3VRZA 3LA7A 4HQMA 3CXCS 4EA5A 2RI3A 4EM2A 1CLQA 2DIGA 3VQ5A 2VB6A 3FXLA 1GOBA 3DF8A 3HUGA 2KPMA 1R00A 3MEAA 2RNGA 4CD1A 1H0MA 4HVJA 1HLVA 5GAGP 2QYOA 2XICA 3VOVA 4FJNA 3CCQA 2E2PA 3CC4T 1USSA 1O57A 3KP3A 4F7ZA 4FSVA 1FOKA 4DV7K 1ZUUA 1LPQA 3LANA 3HSRA 1X9MA 3HP6A 2FEZA 1HC8A 5BNGA 1M8VA 3N05A 3OH9A 3OYCA 3VDXA 2R7QA 5L3FA 5F64A 4DOZA 4F4KA 4QIWN 4C8QE 2AKLA 1VYUA 5J6XA 1D4XA 4B1XB 2I10A 3F22A 1FTTA 4CJLA 2CUBA 5KRSA 2PBIA 3T8RA 3I53A 4Z4GA 2GXGA 4ZYHA 1TAUA 4J2BA 2CP6A 3CJ9A 3HM8A 1A5JA 2ZMEA 1T44A 3G71T 4F92B 4E1JA 5FLXK 1YHQQ 1QQNA 1K0SA 1U9OA 4RDUA 4OMQA 1YI2I 1FBUA 5I11A 2KRMA 2HDAA 1WJBA 2Y48A 2E1YA 4OPJA 2P5GA 3FHFA 2QZ8A 1FLIA 2PYLA 4EZ9A 1BR2A 1XMAA 2AQEA 1NGFA 1FW6A 3ZT2A 5BPLA 4C8OA 1OYYA 3VODA 3IAM2 4XH4A 3NGZA 4DG1A 3CMEQ 4CBUA 1WJAA 3E6MA 2ECBA 1TTYA 4ANJA 3A5NC 5EOYA 4ELTA 4PSWA 1HNXK 2VWKA 1H1VA 3TABA 1Y64A 3ASKA 4P96A 1LFPA 2YG8A 3TDUC 2M51A 2D5VA 2H8RA 3M8FA 2L3QA 2R92J 3SNNA 4M6VA 3C0BA 4M7AE 4JEPA 1QKXA 4MFEA 2Q36A 4CECA 4DSFA 3D5SC 3BROA 4JK9A 3M6GA 1M2VA 4CC3A 2KLAA 3GIBA 3FDRA 2DTOA 3V7SA 4J9CA 1X9WA 2EJFA 2P81A 4C0FA 2MH9A 3ULEB 4S0HB 2JN0A 1ITGA 1VSHA 2D6FA 4M3YA 4R55A 4J6YA 4B8AB 2IW5A 1MBHA 4E9HA 2KEAA 9ATCB 2BE9B 3MWTA 2YUSA 2CFXA 3KLFA 5A2QO 2Z2SB 3REBB 1NG6A 2DERA 3DYAA 2H09A 4A4HA 1NGNA 5KNLA 2EFQA 2LLKA 4MMKA 5EG0B 3UA7A 1WAFA 1Q81O 1B8IB 4CHYA 3HBLA 4BJ5C 3JREA 2DODA 1UGPB 4M7DC 3TSPA 4OKKA 3NE6A 2A6TA 2ZSIB 5H2FC 4XBFA 2IGIA 4DQQA 1U5TA 5CYQA 2WTUA 1N32K 3PFSA 3HFNA 1QRYA 2LY2A 5CQXA 3BDUA 4HF2A 1AWOA 1HKSA 2QEXA 1CF7B 2V6EA 3ZQQA 4E7LA 3NRVA 3ULDA 4P9UA 1HNZK 1A5VA 5FRNA 1ETVA 2XB0X 3HP9A 1DEJA 3TOBA 1PHTA 2F6CA 4Y1CA 3JB9G 1ACIA 3LYIA 3CMEA 1FOXA 5D8KB 1KK7A 1ZX6A 3BEXA 1CQTA 2DXBA 2EIFA 2OTJI 1UG1A 5JMVA 1RADB 2E1HA 3GLXA 3VYGA 2LK2A 2VKNA 3OBWA 1QCNA 4K0KK 4EJOA 1IH7A 3KZIC 1N77A 2K57A 3M58A 3HEFA 4M3WA 5HLFA 3K69A 1LE8A 1VQ9N 1CZ9A 1YT3A 1P6RA 5ILVA 4M4ZA 5CVRA 3WNEA 1OQKA 3P38A 5IPAA 4AHVA 1NZ9A 2JA5J 4KKOA 4CVNE 1Z1DA 4A2UA 1ETYA 2DZCA 2F1LA 2YLBA 2KZGA 4BE1A 1U04A 1BK2A 1TT0A 1QZZA 3PX6A 2QWMA 3F3XA 4W97A 1LDDA 3I4PA 1WJDA 1SEUA 4B3AA 2UXXA 3JSOA 3CCMQ 4IQJA 3UKUB 2FJ1A 3MZ8A 2G8UA 1WSUA 3J7AY 1JQQA 1TSFA 3OIQA 2Y9YA 1NKBA 3QPSA 3HRMA 2M30A 4EM1A 2P7CB 2GOXB 3KCCA 3K7AJ 4JZ3A 3QP5A 1QHAA 5IAYA 1HQEA 2GWJA 4MMLA 2GBQA 3HSTB 1MBJA 2X6XA 4L5EA 1VQ8I 3F21A 1O3RA 2NVXJ 4DGWB 3DLLA 3RKWA 4DEXA 3CLQA 5C10A 2MGQA 3HC7A 4ENJA 3DKWA 3G1OA 1C0MA 1RUOA 3KPHA 4YFKF 4F3QA 1L0OC 1IREB 2OTLQ 4FE4A 1GLDG 2J4RA 1LWWA 1C1AA 2P9LB 1YJWQ 1IJWC 3ERED 1IG8A 4FJMA 2FBYA 1E2XA 1SVMA 2LSOA 3MKDA 3VEPA 4OLBA 2D1HA 2VXDA 5C24A 1MNEA 2DXTA 3MFKA 3VSLA 3JCMX 1UB9A 4D7MA 1EZZB 2FPDA 4EEFG 4M71A 3CCLQ 3Q0WA 1QZEA 4A61A 1UA0A 2LD5A 5BPMA 4OMOA 2DL8A 4CK3A 2L7MP 3QPHA 2VQFK 4F7UB 3T0YA 3TSWA 1KD1C 2E1ZA 1T08B 3GZ5A 1PRMC 4MLOA 4C1NI 2PQWA 4FJ5A 3T1HK 3M4YA 4NOYA 1Y96A 4KPYA 5GANe 3AV9A 3RI4A 4OU0A 4B9WA 3AA3A 2IS1A 3FX3A 3THWB 3H9JA 3TP0A 2L0AA 1YBYA 1J54A 3NF8A 4M7DA 4FYWB 1JLGA 3VMFB 1QVGP 2XY5A 1ZQ3P 4RW4A 3CMAT 1JKRC 1RLQC 1HYVA 4BGDA 3OH6A 5EG2A 1FX7A 5GANj 4PJMA 1SPKA 3F73A 5F1JA 3HTRA 5FROA 3JCUC 4M7XA 2AS5F 4FE7A 3P83D 3CC7I 4M7AB 2Y9ZA 3QYBA 1Z9QA 4ZC3A 5AQPA 3BOQA 2SRCA 2P6SA 1BIBA 5GINA 4IFVA 5KPTA 3VTIA 2F2XA 3VYTB 2FZCB 4RG8A 5KTQA 2ESNA 2HHHK 4F2RA 2XDDA 3MXMA 5M9OA 1D1AA 2JA8J 1VQKA 3KZBA 3G4SI 3DRRA 3W6KB 3CUQA 4XTXA 1ZXOA 2OQGA 1FY7A 1FJLA 1KD1O 4LF4K 3CZ6A 2DD4A 2L9VA 2QGGA 2QWLA 1K61A 2Y30A 1VQ5T 4A3FJ 4HUEA 2KI7A 3C95A 2CGHA 4F7UE 5I21A 3LL7A 1HW1A 2PVOB 2XG8D 4M7AC 5EF6A 5J2PA 2MBFA 1WI3A 5M3MJ 2E2IJ 1QP2A 2BZYA 3H5NA 2DU9A 3COAC 3NAEA 2NRAC 3V9XA 3EG3A 2ISYA 3QP6A 4F17A 3FHNA 2FRYA 3J7YJ 3RMCA 4G6QA 1MJAA 2L7FP 3HKSA 2R7VA 4DBRA 3OMCA 2ICWG 4LF5K 5JLWA 4P5OA 4LOCA 1IF1A 5HLHA 4LUDA 4LDXA 2HKOA 1OLTA 3FHGA 3O9SA 3DPTA 2DMUA 5LJ3j 2FSNA 4CDGA 2NOLA 1M90R 1M90O 2K2VA 4E4HA 4E7ZA 2VKDA 1MA9B 4PFZA 1KC8U 5BOXA 4FJIA 5JI6A 1W1FA 4AWXB 1VYVA 5L3GA 3KYLA 4IUVA 4FK0A 2E2JJ 3HL2A 1QTMA 3RR6A 2HOEA 2XRLA 1KLMA 3CO6C 3FBNB 2W6KA 1T0FA 3TAQA 1WRJA 4C3IJ 1Z9ZA 5LRSA 2COYA 3EYIA 3FXMA 2HMPA 1FEXA 4DJAA 2FL7A 1Z05A 5TGTA 1O4XA 3KLHA 3FXUA 2O8BB 3FKIJ 2P9UA 4KFCA 1NK6A 3DLBA 2COZA 1K73O 3FJPA 1QQOA 2K5CA 5AQIA 1VQ9Q 1HOMA 1JJ2P 4EIAA 3K4LA 4PJOF 4WXCA 1HW5A 2F4MB 3CFRA 3M8SA 1IUFA 3NVKA 3ABKH 1STZA 3CCLT 4A3LJ 1WSHA 3T69A 2MLGA 2CGLA 2ETJA 4J9BA 3ZEUA 2YT6A 2AQFA 3FM3A 3BE3A 4IHXA 4FW1A 2QM3A 1MDMB 3S41A 1VQ9I 1VQ9T 1OOTA 2I5JA 4G9ZA 3ZETB 4I01A 5IP6A 2CH6A 2HQEA 1BUPA 1SRLA 2FD5A 1QGPA 5M1FA 4N4IA 3KWGA 2GA2A 1ZYRF 1NGBA 2NOJB 2LZ6B 1I3QJ 1RAEB 2YX4A 1ACMB 2VQEK 5HY6A 1BKBA 3MAJA 1EWRA 4UVAA 4UUVA 2FRWA 1VQOQ 1I8FA 4D8KA 4RA2A 2EJGA 3RBBB 1VQ4T 2Z9OA 1NJXA 3IC7A 1WJRA 2EX3A 1KG7A 3J7AP 4B3RK 1BL0A 1XTAA 2QWRA 5CKBA 1ZBUA 2OPTA 4H4KC 4AILC 1KA8A 2XPWA 2D1KA 5LBQA 4JN4A 2LJ3A 3S2HJ 2X0LA 2D9TA 4ME7A 3O5BA 3JRGA 3OW2A 3FLCO 3CP8A 4EGZA 2YUPA 2FNPA 3VA0A 1JCFA 5EDNA 3U1KA 1DP7P 1TZLA 1XSXA 2RI5A 3CPWM 5LL6Z 4BBSJ 2KQ2A 1MV0B 5LGNA 3K5LA 4IOCL 4D8DA 2CH4A 4GCVA 4B23A 3ESWB 2PUKB 1I1SA 1KQ2A 2V1QA 1RTHA 1OVQA 1OH6A 2QG9B 3KIOA 3DXJF 4DOVA 1L3LA 3JSPA 4C8LA 5AZIA 4CJEA 1LAVA 1QE1A 1VQLQ 2EZIA 2XF7A 2K5FA 4BHPA 1MU2A 2BV6A 3OV8A 3LSMA 1N78A 2R7FA 4H4OA 1KG5A 4AM6A 3TVTA 2LTOA 2DYSH 1M1KU 3RRHA 1R23A 2LQNA 3EDPA 1IN6A 3H1QA 3SWNB 1VQ8T 3VUZA 4M78D 4RW6A 5F1XA 3BTLA 3CMMA 3E19A 3SQ1A 1QHGA 2ABLA 2CQ7A 2NRXA 4ZN3A 1U2VB 1H8AC 3H41A 4PY5A 2RQPA 1LCUA 3CCSQ 4M75E 3OBYA 1U2WA 4M72A 5IT3A 2XAUA 4XTUA 2A3SA 2EPFA 3UWNA 4X9DA 2HVRA 4HCBA 1ZG5A 1U5TB 1U78A 3CC7Q 3CC2N 1A6QA 1WIEA 2W1OA 2V9PA 4YIIA 4C3HJ 4MDWA 1YW8A 2GOMA 2VG6A 2PLYA 4PL7A 2D0QB 3RWUA 4ABZA 1ZSGA 5CKHA 1HBXG 1I3AA 4M9XA 4JKGA 5LJ5f 5IP9J 4XKCA 3G4SN 2DA9A 4RTTA 3LWLA 1OPCA 3MP6A 4XL9A 5HODA 1RNHA 2HXIA 3FK7A 5HNHA 5TKYA 2L4AA 3OQ5A 4B3XA 1KD1U 2RQQA 5HLGA 2LF8A 3HGGA 5E18F 3OYMA 4OGEA 2RK1A 2O9VA 3JCMh 3WEEB 4BR7A 3BQYA 1Q86O 1OI1A 3F70A 3C4SA 4PKIA 3X20B 2DLLA 4QQDA 5BREA 3CEYA 3I5SA 3E0JB 1R1VA 1KAYA 2DRMA 1UE9A 5D5WB 2XIGA 1GOCA 1B4AA 1CGPA 2E2HJ 3QDFA 3CBPA 1U4BA 4H0OA 4GY5A 3RPUD 4DSKA 2DK8A 3RJPA 2VXEA 1UELB 4IG3A 2FOKA 5JFRA 3AHUA 3MMYB 4RTVA 3ZXSA 2BE5F 1VFCA 4O5BA 2M7BA 1JXMA 2ZGZA 2ZE2A 3AVLA 4LDUA 3KTUA 2COMA 2XHKA 1OX9A 1OR7A 3BY5A 3CFOA 5L8RE 3CCVI 2XSJC 4CERA 3IH3A 3C6HA 3UNGC 4WTOB 2Z33A 2ID6A 3W6VA 1XC9A 2O6GE 4H0XB 4F7UF 2ENMA 5AFUH 3D2FB 2E88A 2BY1A 2HPIA 5H6QA 2ZBKA 2QWWA 4IO8A 3ZFJA 3RYPA 3KLNA 3OY9A 5LJWA 4CZEA 1JJ2S 1DGKN 3WE2A 1GV2A 3I54A 3AO2A 4JI8K 4N9IA 3HOVJ 3L09A 3VS4A 1YJNA 1SEMA 1WH7A 4GKJK 1IV0A 4X1EA 1SD6A 4J7IA 4PFOA 4IKFA 1S8NA 2QBYB 1G3SA 3HHHA 1P7IA 3I9V2 4MDXA 4KTZA 3EFOB 2P5KA 3NMUA 3LAJA 1NEGA 2UV1A 3P39A 3J80E 1Z21A 1VOMA 2JS2A 2UYTA 1A5XA 2OZUA 4CGHA 1N8RO 2FHDA 2NUTB 2WA0A 3PUBA 1NLPC 3O4QA 3WTZA 3ECHA 1NJIO 3MN9A 5BR8K 2RGVA 5IT9Z 2VYTA 2H3GX 3CO7C 3TBIA 5EYRA 2W84A 2IIMA 3GBQA 2RN7A 4C8KA 2HMIA 4JPBW 1IN5A 1YRNB 3CXCM 1NKCA 1HK9A 2NLXA 1N9SA 3O9QA 1DGWY 4PKHA 3N0UA 2LREA 2AT1B 1YI2A 2DRKA 3W6JB 1VQKI 4L18B 4TVRA 2XMFA 4RGRA 1E7OA 4JHDB 2A69F 2FMYA 1NM7A 3TREA 3VEVA 5CYMA 2DFHA 1HCRA 3ZLJA 4JKHA 2LJ1A 5FPDA 3VQ9A 1TT5B 3T3FA 1I5OB 2M4GA 4WQ5C 2PFBA 3KLIA 1X1DA 1B8IA 1NOZA 2ESHA 4XU0A 4H0TB 4C9YA 3EZ5A 5GAMd 3M5AA 4DTNA 1H3HA 1H8KA 2YNIA 2P6TA 1X1AA 4XONA 3CG7A 3HM9A 1QPIA 2O01E 3IRXA 2IGOA 2Z1JA 3TTDA 2XAJA 3LDPA 2JJ7A 1MBGA 2HHXA 2RH2A 4A0YA 3S14J 1D0XA 4R1HA 3QYEA 1R0CB 2IS4A 2K5IA 4CZMA 2LR8A 3AVNA 2NOGA 3D7EO 5DM7L 3QUIA 1U8RA 2A61A 4I0BA 3RDIA 1DTTA 4CFBA 4DZJA 1ASWA 3N97A 1UCRA 5GAN3 4WE1A 1WX6A 3FMQA 5CIUA 3DLKA 2IJLA 5F08A 1WJCA 4OLAA 4KGXB 1XSVA 3OSFA 1T0FC 3GTOJ 1LEAA 2A1SA 1ZH5A 2R7OA 3HSEA 2X4WA 1ETKA 2QM1A 3JSCA 1YG2A 4B3MK 3WQUA 3OOUA 3RMQA 4LITA 3DB4A 5GAOq 3CCRQ 4BI3A 2RPIA 4B4CA 5MLCQ 4YIFA 2KDSA 4IVNA 3P9IA 6AT1B 4DR7K 2HYJA 3GTKJ 3JCMc 2RREA 2HL3A 3AVAA 4G7ZF 2DK3A 2WY7Q 4WQ4C 4M75A 1QNTA 2BXZA 1NK2P 1HU0A 3LM2A 2V6CA 1S72A 4IRHA 3G3ZA 2JM8A 1H89C 4Z4HA 1NG2A 3H0HA 4CCKA 3K9KA 3N5NX 4IEEA 1X4PA 3ISNC 5GTHC 4GVEA 3UKUA 2X6WA 4KH0B 3DV8A 4LG3A 5C0MA 3SUOA 3FZHA 4FASD 1XSDA 2R5AA 4HYEA 3Q9SA 5D6EA 4DLGA 4F3OA 4U87A 3ZEHA 4NLCA 3MKWB 4XU3A 2EBIA 1NK4A 4WF9L 1WH5A 1ZRCA 2QGFB 4M78E 4CIFA 2WSEE 5EG0A 1MJBA 4LNPA 4DTSA 1BCMA 4LF7K 1KHCA 3CJ1A 2RV8A 1YHQA 3SUPA 4NO7A 3AVBA 5D5XB 3JRHA 1EKEA 3V7CA 2JWLA 3VRYA 1D1BA 1M27C 2VWBA 3M55A 4C0ZA 4DR2K 2L3DA 5D5UB 3SQNA 1K1ZA 3Q7CA 5FPNA 2A05A 4DTOA 3HSBA 1NLOC 1MMGA 4NXMK 1IRXA 3PY8A 2XDBA 3V9UA 2AIRB 1XWLA 2M3AA 3ABMH 2E71A 3B6CA 5A0GA 2GLOA 3R3LA 4M73A 4BAYA 1YXQA 4BI8B 2CS3A 2RC4A 4BBRJ 1FBQA 3ZGKA 2X74A 2DEQA 1RESA 1RT6A 2F4VK 2JJ9A 1FJGK 2VCPA 4DQPA 4CJFA 1VSDA 5AT1B 1LWVA 3ZETA 4I98B 3RUXA 1RT7A 3TDZC 1U49A 3C7NA 2NOHA 1WHMA 3QO9A 2JMAA 3LFUA 4JI4K 3S6WA 3CJAA 1FK9A 3C12A 2VJJA 5D5VB 2VV5A 3ZQCA 2V1RA 1VZ0A 1P7JA 1LVAA 4HX4A 3G71N 5M1PA 3BG6A 1APLC 1J6ZA 4V2FA 4CJKA 4LD6A 1N27A 3HRTA 3TMOA 1GT0C 4PNOA 4ESJA 3QJ6A 1NGEA 2R7DA 4ZNXA 3J7AO 2JPCA 3GWZA 2V26A 5HS7A 1VA7A 2OA8A 1C0UA 5KQ8A 2F5DA 4OMZA 4M7AA 3RIRA 1QVGS 2OYQA 4LLNA 3C7JA 4Q48A 2R0QC 1BR1A 3PX4A 4Z4FA 3K4KA 1BQNA 1ZARA 4FYDA 3ZQIA 4RB2C 4CJRA 3GF5A 1BI1A 3QRFF 2IAIA 2FYKA 3MWPA 4BR0A 5K5QA 1BDGA 2QKLB 1HKBA 4ELZC 2DPUA 3HPOA 1W6XA 1VQMA 2ASMA 5GAN2 1U48A 1B59A 4AMCA 3DI6A 1EF4A 5HRRA 2LKPA 3VEOA 1MDUB 2OPRA 2ZXIA 2MA3A 5JHFA 3WGHA 2K3YA 1R0BG 1QVGM 4DLEA 1UHCA 4FU6A 3TAFA 1TWCJ 3B73A 1SHFA 3S2WA 1OZ2A 1TWHJ 3LAKA 2IS2A 4L6V5 2KL4A 3AL0B 2RNAA 2LQKA 2VQCA 1J5OA 3S16J 2DT6A 3JSMA 2QA4Q 1QZ6A 3DKYA 1PWTA 1ETOA 4XQ3A 4FHTA 3ZYYX 2W48A 2YJFA 3FMRA 4DCHA 1IV8A 1N5ZA 3GTLJ 1VQOT 3DAWA 4HTUA 3M9AA 3ONQA 1TWFJ 3EETA 3MPUB 4JK8A 1M2OA 2M0OA 3R60A 4YTLA 3SI6A 3HFOA 1W5CC 1T7PA 3CMAQ 1SD5A 1VRUA 3ZQGA 1UHSA 4M3UA 5M1QA 2DYIA 1SFXA 4KB0A 4H03B 3WUHA 1NNEA 4YPHA 6PAXA 1BC7C 1YI2N 4LF6K 4AU7A 4MDBA 4OMMA 1YW9A 1BB9A 1W2BM 1DPUA 5CLSA 2DPNA 2X85A 3MEEA 4QVDA 1PNJA 4B1RA 3CC2Q 2QWOA 1X58A 5GAHJ 1IAWA 1OULA 2PVGB 3IRRA 4W5RA 2UXNA 2XO7A 3ISPA 1QVTA 2QA4T 2A6EF 1MWMA 4DSJA 5AQKA 2LF7A 4B9TA 5LFAA 4A0ZA 1QLYA 3IV5A 2R93J 2ZPGB 5EEAA 4JS4A 4PZJA 2QAZA 5FLMJ 1R49A 3IP4B 1T98A 3FWEA 4QT7A 3M4OJ 2W42A 4LN2A 2XY6A 4M77C 4IRIA 1IHVA 3I56I 2IPOB 1VK0A 5FLVA 3CC7A 1OX8A 3MP1A 3MECA 3GTGJ 1LB2A 2WSFE 4B1YB 4JI7K 3INZA 3M8QA 4BQZA 4RGSA 2CSOA 3DRPA 4LLLA 1RT1A 4FO0A 2M9HA 3OA9A 1XMQK 4XOTA 2GQIA 1GBQA 3K10A 1T33A 3GYHX 3K2PA 3HOSA 1XOVA 1RLPC 2KBTA 4GYIA 4OP0A 2BY3A 4C92B 1D9FA 1FPQA 3H92A 4A63B 4U0WA 4E7IA 4J9GA 3PNWC 4RGUA 3WXMB 3MXIA 4K8XA 3MAQA 2A07F 2JPBA 2KQWA 3QWYA 3P8BB 2FSKA 3OL4A 2R5MA 2JRMA 2MSYA 5TISC 2WOMA 3ATUA 1REPC 2CV1A 1F5TA 2QQRA 4E6KG 2KGTA 4IUPA 1F1ZA 3E2UA 1YIJT 4J9HA 1WHJA 1VQNI 4WFNL 5FB2A 3GZNB 2JTEA 4HKEA 3QBWA 4A54A 2QTXA 5FRMA 3EYZA 5J3BA 2DPDA 1ZA1B 2D0CA 2JK3A 1Y8RB 2WONA 1W36D 3IQLA 4B6MA 9ANTA 2QKBA 4BU2A 3T7ZA 5LHIA 5LJ5j 3OW2M 2E1MB 3K4JA 1VQ6I 3TAEA 3RKXA 4CJ4A 3EFOA 3LH0A 2VKHA 1NKEA 3JV3A 4OMNA 3L4QA 4CHPA 4GXOA 2JWKA 2H3EB 4B1VA 2EB7A 1OKJA 5GIOA 4BHBA 4CJ7A 2OTJT 4DBQA 4HX8A 4F7UG 4DSEA 2ZKZA 2NVUB 1HSTA 3NWTA 4O8KA 3CCUQ 1YYVA 2LQ8A 2RQVA 2DA3A 4M78F 3CMEI 5IT9E 1YRNA 2QA4N 3OYYA 2VG7A 4IHWA 1AWXA 5ED4A 1UOCA 4ZGDB 4GV3A 2PAVA 1K73R 1AZEA 2P51A 1EV7A 3E6CC 2ED0A 2EQUA 2RQTA 1XNRK 1TK0A 4OIRF 1X01A 2LOOA 2CUZA 3ZEUB 3FEOA 5M1NA 2ZNZA 1SL2A 2JVVA 1XQOA 2W24A 4KREA 4LLGF 4M3GA 2QQ8A 4DKWA 1I5ZA 2LDUA 2W00A 4Q5WA 5AR0A 4I76A 1ARKA 1X6OA 2CW0F 2DL7A 3RDVA 3BDDA 3CJNA 4X62K 3AVHA 1UGQB 1JXSA 1X3NA 3I0TA 1S6PA 2CW7A 2RK2A 3QNOA 1AA7A 2OJED 1U5TC 3PFYA 3V7RA 2JW4A 1AWWA 4DBFA 1A04A 5ICCA 2FBXA 2F69A 4IF4A 4JRQA 1XGNA 3NTKA 1ZAOA 1E17A 5AQRA 4JYAK 2Z3YA 3DXKA 4MLEA 4DV4K 2YRVA 2V1XA 4WCIA 1MKMA 2W10A 1KU2A 3BFMA 4H5TA 4MO7A 4Y13A 3NCIA 4FT2A 5LEKA 1IHWA 1KFDA 4B9VA 3ZPLA 2FXUA 2QK0A 4OB2B 1T6SA 3M1EA 3VETA 3TI0A 5HDGA 4FVMA 2KIQA 2Q97A 3CD6T 1ABOA 3PO5A 2KIMA 3BLYA 4N4NB 5IHNA 3CCJA 4N56A 2WV0A 4Z88A 3CCMI 3ZMTA 3S8PA 2JTFA 4OMLA 2QEXI 1TNTA 1PJRA 4KAZA 3M0SA 1D5AA 1QU3A 1KIKA 3MN7A 1NOYA 1M8MA 4D6WA 4V19S 3CCRN 2C0OA 1AHDP 3PVQA 3CCQI 2HB5A 5C25A 4C5GA 2ZPHB 4GDFA 2OTJN 2PJRA 3BPVA 3VS0A 2CP2A 1SAUA 2Q1ZB 1T05A 1ASUA 4JRKA 3J7YP 1MH3A 5J1YA 2KRFA 2K9SA 2MF2A 4WCEL 4NCAA 4AIKA 1SSFA 5ICGA 3KVGA 1SG5A 3J81Z 4C92F 4J19A 3G2BA 1VQ5A 4XTWA 2YI1A 3L6QA 2LT1A 3RMBA 2KY9A 3GDQA 3HTSB 3K5NA 2J6FA 3EHRA 1HPMA 2HBMA 4M42A 4ZGJB 3IDHA 4B9LA 3RZOJ 4Z6YA 5JLFA 3SFZA 2HBWA 4I02A 3CC2T 2ZXWH 1K78B 4JLIA 3VPRA 4OB1B 1GOAA 1BOBA 5KAFC 4ZH4F 2P9PA 1EX4A 5CKEA 2ZWHA 2A7YA 1CZBA 4OPHA 3URGA 5BN9A 1D0ZA 4F52A 1M1KO 4PGHA 2G6FX 4HZFA 3VGLA 3QPLA 2PTKA 1ZUKA 1XQPA 4JKAA 2E7XA 3TO6A 4BC4A 3EE8A 4ILHA 3QBXA 3K4NA 2G8IA 2FMLA 2QYZA 2OANA 4W1UA 4OX9K 2R7ZJ 1LWCA 4DU1A 1S1NA 4N9HA 4NHJA 3EG2A 1UAAA 3OVNA 1RRSA 3SFIA 2RQWA 3A98A 1GVJA 2HVHA 2NYXA 1X2KA 2DMOA 3ZCOA 5GAN5 2CWEA 4MZPA 2EILH 4A59A 3U8XA 4JS5A 3GOXA 3LOCA 4G6TB 4M77F 5HRPA 2DXIA 4JHDA 5HRSA 3PIOA 1P90A 2E10A 3WNGA 2MD0A 3CWTA 4BQQA 4CZGA 4J7FA 3G6EA 5DCFA 5FLXZ 4I7HA 5KYWB 1E3PA 5AQLA 3CCQQ 4L9NA 3NNQA 4V2GA 1VQNN 1RFQA 1BG3A 3QFPA 1K9MO 3QQAA 4HNVA 3PMIA 2HHSA 4J2DA 4PJOD 1ZLJA 3FZLA 1RACB 5KYXA 2YHTA 2QTDA 4YIRX 2RHXA 2ITGA 3KZZA 3CCJI 5FDLA 4CZKA 3CCEI 5IOZA 4IIOA 1JGGA 2RF0A 1U6GA 4YEJA 2ROTA 5HDKA 2OAZA 4F16A 4N4GA 4U7DA 1WJ5A 4NCGA 4R0KA 1ASVA 1BHLA 1HJOA 1D09B 2OTLT 3THVA 4RG2A 5AQXA 2YNGA 1RPWA 5C4JJ 3QXEB 4U7BA 4JKEA 3ID6A 2V8JA 5EC7A 1D8KA 2GWKA 1FYNA 2GQVA 1O3QA 4M77D 4YFNF 4A57A 1KQ8A 2NNYA 4IG0A 2M45A 4UQGA 2X6OA 3K70D 2FBIA 4V19K 2VN2A 1RBRA 2QA4I 2G8HA 4LIUA 1KC8C 2HBJA 1YITA 5KH6A 3OIPA 3DLLL 1XNQK 1LKXA 3L2WA 2GELA 2GQQA 5GMKi 1GBRA 3CYMA 1YITN 3MEGA 5KHDA 4A4KA 3BPXA 3RQ4A 2EFOA 3D2EB 4D1QA 1K9MR 4BRNA 2KIFA 1AU7A 3QB0A 4EM0B 3KBGA 4EJVA 4M75B 5KGWA 5CKFA 1I6HJ 2E5ZA 2YJEA 2GBYA 1Z7LA 4Y4RA 5IHKA 3PE0A 2QF7A 4FJ8A 4IX7A 3SHFA 3TO9A 2ZPFB 3CBOA 1UFFA 5FD6A 4CFCA 4BRDA 3MO8A 3CPWP 1KC8O 3ALYA 3AVGA 3E5QA 4EJUA 3M57A 3WNHA 5GAGJ 1VTNC 2KJCA 4Y92A 4MTEA 4RKUE 3I59B 5D3GA 3E97A 2HHUA 2LX9A 5F0XA 1JKOC 2E3IA 3HTUA 3CIPA 2KFNA 3DJCA 5AQYA 1EIFA 3EG0A 3J7ZO 5KYUA 2E6ZA 1ZELA 3QDKA 3F0CA 2DT7B 5JLXA 4FTHA 2BBYA 4UVCA 2L3SA 2XRIA 1IXRC 3VESA 2ELKA 2K3FA 3ERMA 1U3OA 2BHYA 3GVAA 1OH8A 3SMPA 1WUAA 1NG7A 2JWTA 4PDKA 4GV9A 5C42A 3ITHA 1LWEA 1KQSS 1U3EM 2Y0SN 1MSFC 1W5SA 4KRFA 4Y0WA 2V79A 5KK1A 1YQMA 1PUFB 4KITB 5CQYA 3GXOA 2E12A 4BQNA 2RHUA 4OO1J 4XKVA 5K7ZA 2ZFUA 3OYNA 1ZA2B 1VQ6T 2DEUA 3SQ2A 2HKQB 2A1RA 3CCSI 2ECZA 4ESBA 3F8MA 1XDUA 4OVAA 4BXXJ 5LLQA 4G8XA 4A3JJ 2C0TA 2NOFA 1JJ2M 1RR8C 4RTUA 2NS8A 2HNDA 3O9TA 3SAHA 1ERDA 1AOJA 4XKBA 2QWNA 2OJ2A 3KEQA 3O3HA 4FVUA 3JCMg 2ZO4A 3CCMN 1F43A 1T95A 2EZKA 4AM3A 1X69A 4PGGA 1VQLI 3GG4A 5DMRA 5GAMe 1LPLA 3VGMA 2K3XA 1DJ7B 3N4QA 2B0LA 2ZMEC 2STWA 4G12A 1GXPA 4CIGA 2ZJPF 5JLHA 3UKRB 1UA1A 4JDSA 1KG1A 3RZDJ 3HOUJ 2HXOA 2W04A 2Q0RA 2X9HA 3JTHA 3G73A 2L89A 4E7KA 4H5WA 1K7AA 3MEUA 2V7FA 3KK3A 4YRVA 4I6ZA 1BR4A 3VYSB 1ZBSA 3M4GA 4E2FB 1BIUA 5KCMA 2DMNA 3HPGA 2HBLA 4PJOG 2BW3B 4HUGA 4KIGA 5A0LA 3I55Q 4C23A 1V4TA 2HQNA 2DXUA 4Y28E 3ULRB 3H3ZA 5LJ3f 1X3UA 4FLUA 4BY9C 3TO7A 3K58A 1YS6A 5J8CA 2G8WA 2XD0A 1NGHA 5D6XA 3O1BA 3ZCMA 3BDLA 3CTAA 3ZX0A 1O3SA 3CBMA 2ME6A 1RI0A 4Q5SF 2HZTA 5C2FA 1SANA 2C06A 1KRPA 4CUGA 4Z4EA 4XU1A 3C94A 5I42A 3B6OA 2VQGA 5DUKA 3AA2A 2FF3B 2E2NA 4HF1A 4A4EA 2DTZA 4X66K 4M7AG 1ATRA 5H1SQ 3ROUA 5HL7L 4FJGA 2VBZA 3FKJA 3DU6A 3HPHA 5FLXO 4A12A 2XDPA 3HGYA 1WLJA 4M75C 3PGGA 2TCTA 1DT9A 2CZ7B 3E5UA 1DU6A 3JRAA 1ZGWA 5D4SA 4OINF 5DLOA 1SVOA 2RF2A 3N4PA 1OKRA 3PVLA 2HHQA 3LPUA 2QWQA 1TL3A 2ZNYA 1HDDC 1M3CA 3LM9A 4CJVA 1Y1WJ 4X64K 1WXUA 5FWCA 4B08A 1V4RA 2V8KA 3M7GA 1E3MA 1EH6A 4EVVA 3JRZA 3F8CA 1UUEA 3TOAA 1S72I 1VQ5N 2FU4A 3MHXA 1E6GA 4R79A 3LZIA 3K4CA 1UECA 4BGBA 4M78G 5DM6L 3QU3A 4KUDK 4ENNA 4RCCA 2GFAA 3ZSQA 4A4GA 2OUMA 2Z1HA 3GTPJ 2VODA 3HZ6A 2HI3A 5D6YA 5D6FA 2MOXA 1RDAA 5ADXH 1QO0D 2J6KA 3R6SA 5HDNA 3I3LA 1TQMA 3WVEB 3OOPA 3VS1A 1YJWT 1Y0NA 2W7NA 3DXKB 2LC2A 2FB7A 4M75D 4KDPA 2KIUA 5I2MA 1VSEA 4ISFA 2OAUA 3ENBA 2EFPA 2DO3A 3BR1A 3O8MA 3VQ6A 3FFKB 4UXNA 4CBWA 1MGQA 3F6VA 3KUFA 3UR3C 1RGIA 4CZJA 1LOTB 1KAXA 2BH1A 5AQQA 5CY4A 4CI6A 2MCNA 5SWMA 2IDOA 3DBRB 1ZN2A 3EUAA 4PQUA 5C0YA 3IHOA 4LD5A 3AAFA 1YJ9Q 3A1PA 3QSUA 3FJ5A 2V1NA 5FU6C 2ME0A 1M1KR 2ZCFB 4N41A 3HOTA 2KR3A 3ATVA 1PU8A 1T3SA 1VQ5I 1S72N 2M4KA 5BPNA 2DMTA 1K8AC 4ESFA 2KFZA 1HJDA 2E1CA 2YSQA 3V9ZA 5D4RA 3LWHA 1Z9CA 3BG5A 4DYQA 4DV6K 3CCEA 4ISGA 2HTSA 4FXDA 1RBTA 1FSHA 1U45A 1T03A 3CLOA 1NEBA 2F2WA 3KETA 3JCMJ 2JM9A 3U9ZA 2RMOA 4A3MJ 1WAJA 3D0SA 1CKBA 2HNHA 3M8EA 3R61A 3AVKA 3WXLA 4K8ZA 3CCSA 2KW4A 5L23A 5GAEJ 3DLRA 4YHHK 2QQAA 3OYKA 3D4VA 3WXIA 2P9PB 3RR8A 1IZ6A 2WBMA 3BTJA 1W2BS 2XAQA 2YUNA 3NGPA 1KO9A 2FQ4A 1LMZA 3CCVQ 1Q7YC 1OFCX 5J4YA 1LJ9A 1EH8A 1D9DA 3IKTA 4GV6A 4CXFA 2ZF5O 4AVPA 1D1CA 5AQUA 1OPKA 4M78B 5FFXA 3CWSA 2IC3A 3ABLH 4JI2K 3PUFA 4KT0E 1WJEA 2KT0A 4AQYK 2E5NA 1ONVA 4YOWA 5FJ8J 1EBMA 1GHCA 4J2AA 1J3TA 4DYCA 1BOAA 1HSJA 1W0TA 4DR3K 3LSJA 3PNVA 1YQRA 2KHOA 5CYVA 2ZFWA 1MNDA 1AKHA 5HCKA 2XB5A 4NDLA 1TTHB 3CC4Q 4LFCK 1I6XA 3BZ6A 3MP8A 2RHKA 5BR9A 4LD0A 3P31A 4B9UA 5KYWA 5LMUK 2DYBA 1BOTO 3OYJA 4DYRA 1REVA 3WHCA 4YORA 3KFWX 3BT9A 1EP4A 4ENKA 2VUMJ 2YU3A 4L9JA 3EGDA 2MK5A 3P8DA 4WQ5A 1IG7A 2K3PA 3DFGA 3O5ZA 1XN7A 3CCJN 3IFRA 2VE9A 3FLGA 4G1QA 4N0BA 1MIJA 5CPRB 3X2QH 5IH2A 2VT2A 3CCVA 4I0AA 3OMGA 2PFUA 1KG3A 2YHAA 2W03A 2ZD1A 2RM4A 1A35A 2LTPA 4A3GJ 2Q0UA 1MPGA 3C1DA 2DE0X 1KU3A 2ZGWA 1KSPA 3FB9A 1X1PA 3VB2A 4B3TK 5LGTA 3H9GA 3MEWA 1JXBA 4FLZA 2BZTA 3QWXX 3RKYA 3T1BA 1R36A 2ZGYA 2CDTA 3I8DA 1VQMN 4AFUC 1LWYA 3U3GA 3N5BB 4DV2K 4CF2A 4XLNF 3M8RA 1S1TA 4AYBA 3FE1A 2B63J 3KZYA 3HVRA 1RAGB 3O8HA 2LP5A 1NJIU 3SMSA 1RTDA 2FX0A 1ZREA 4AT1B 2L54A 1G2BA 4O0JA 2EFNA 1VQ5Q 1V3FA 2F8TA 1RRQA 4E9FA 1RI9A 4MIMA 1U06A 5FGMA 1N5YA 1ZSZB 4CK1A 1KG2A 1M1KC 1YJ9N 1JE8A 5C44J 2E4LA 4B1WB 1YWPA 5GAN8 3ZBDA 5TKWA 3VPZA 4NC6A 5EZGA 1D8JA 4DQSA 5CQGA 4A3EJ 1M3HA 4OIOF 3DKXA 4E19A 5IOYA 4A5AA 3G71Q 3I59A 5IT9O 2I5UA 4M3DA 5AZJA 4X0GA 5JVTA 4ZDLA 1R8OB 4BEHB 3ZSOA 3C2HA 2HSEB 4FM2A 3V9SA 3K5MA 4JD2A 3AG3H 2DQLA 1ZGJA 1OCTC 2CZ6B 2O7OA 3IHUA 2X1DA 2ITMA 2DOAA 3R6OA 1ETQA 5F2RA 2OQRA 5A2QE 3VS3A 3UDCA 3GX4X 4BY6B 3CJRB 4BRIA 1TKDA 3CDLA 3H35A 2RA2A 4ZJZA 2E7WA 4WYBA 3S3MA 3LWFA 4M6YA 4LUEA 2RD1A 4EZ6A 1WNSA 5GAHP 1SFKA 4FL6A 2LT4A 3ZSYA 1U8BA 5C2DA 4DFMA 3M8JA 2X1EA 4KTWA 3EYYA 4OJRA 2OZMA 3HBTA 3NH1A 4GBQA 3VS6A 4BUPA 4I7FA 2EQIA 1W7PA 3H0IA 4DR4K 2ZZDA 2X51A 2CQQA 5TJJA 3V4GA 2JTMA 1H9GA 1IN8A 1QQJA 4CGIA 3A0BC 2XRNA 3LDLA 2L02A 4MNUA 1WZ2A 4A2BA 4IRGA 1YQLA 2M0MA 4KIFA 2F5TX 1NM1A 4DZPA 4ELYC 4C2TA 3I55T 3E5XA 2DFEA 2LYCA 2VIXA 4YDUA 4KB1A 4CHUA 2QTVA 4XH1A 1AT1B 1BIAA 4E9EA 2PG4A 4IJAA 4HXJA 2F9TA 2XSDC 4FIBA 4XRMA 3WU0A 1OMIA 3FZMA 1A5WA 1LFUP 2FEIA 1H88C 2BUPA 4IXCA 1PVEA 1QVGA 1Y39A 2O8XA 1WHUA 2K27A 1KD1R 1Z6RA 4KN4X 4UVBA 3CMEN 1VIEA 2KRCA 3V6DA 1JI8A 2A3LA 4JX5A 4H5RA 3OYHA 2CV0A 2BGCA 3UKRA 5AQJA 2E36A 2NXNB 4A2AA 3G1MA 1S3XA 3OW2P 1Z7UA 5ILUA 3VWBA 1IRGA 3AO1A 1V76A 3BTIA 4HG2A 3E9PA 4YOQA 1OPLA 2YNFA 2F96A 4CJQA 1DKGD 1S7EA 5GJVB 2DW4A 5I9EB 2BW3A 2L5QA 5FLXE 2HAXA 4B8XA 2M87A 1RUNA 4DR1K 1NK7A 4EJZA 3F23A 1C0FA 4XORA 1RDBA 1B34A 4FWQA 4ZYAA 1FKPA 2YG9A 4KT6A 2WAFA 1P7MA 1NLVA 3L0QA 1IRFA 1X75C 5ELZA 3R1XA 1EA3A 3SAFA 3CCLI 2E4HA 4R8HA 2UUCK 1IGNA 4KBOA 4BRCA 3K4MA 3KK1A 1K0XA 2CZ1B 3U3YA 3V1RA 2NVTJ 2CS7A 4FZYA 1YX5A 5HBMA 4AHSA 2IVOA 4FZZA 1YIJA 3W2VA 1R77A 3W2WA 1BO5O 3QWLA 1MUYA 3D2EA 1UG0A 3E7LA 3OS1A 3TEEA 1SKUB 2EJRA 1N3CA 4RM2A 3MEXA 5AQWA 1E4FT 2EQJA 4M7AF 4PJOB 3BWGA 2WB1A 2DLPA 5F0FA 2HKNA 3P9CA 3LL3A 3QLHA 2BY2A 1SAXA 2FBKA 1X43A 2E5QA 1KU9A 3T19A 4F7UA 4BG9A 2DBBA 3TU5A 2ZJQL 4AFSC 1G3YA 3OJSA 3QYGB 2HTJA 2HZYA 2K02A 3CUOA 3CPFA 3VS7A 4GVMA 2LVMA 3A8YA 2DDBA 3CCJQ 3THWA 3OR2C 5J2QA 2LRQA 1YCSB 3BR2A 5HS8A 1R5ID 3E66A 4YFXF 3LGFA 5DLQE 3LDNA 3A1YA 1VQPI 4CCJA 1UJ0A 1XMKA 3GNFB 3OYAA 4FL9A 5KYUB 3VN5A 4ZDOA 3ZQHA 1T3LA 4RMOA 2Z5UA 2XY8A 3A2FA 1V55H 4CSWA 4CW7B 2ATCB 2E60A 3QEIA 3PIPL 5CJ9A 3JCMb 3KP5A 4DUYK 1ZHFA 3DTKA 1Q9YA 4OFHA 2XPVA 5FPEA 1DQUA 1P4AA 2XDVA 5IYDJ 3SV4A 1NK3P 2NRVA 3NF7A 4YG2F 4XM3A 4LB5A 1KGSA 4OFAA 4OPAA 1TYQB 4NXNK 3SJHA 4F3TA 1OVYA 3CC4A 3X28B 4IUQA 4CGZA 3CF2A 1ETXA 1F4KA 4LDYA 4XIUA 3A01A 4GW6A 4IJNA 3CUQB 3ZSVA 2F4OB 2HMAA 3ME9A 1ATNA 2F9WA 1WWXA 4E47A 2DVEA 2J6OA 5IT9K 1BU6O 4PJLA 3H8ZA 3IG1A 2Y2ZA 2YCHA 2UWMA 3SZGA 1RT2A 3IKVA 2RQRA 1TLHB 1TK8A 4G94A 3Q3SA 3DRSA 3KKRA 4F55A 3G71A 1GVDA 3F8FA 2WADA 1WSFA 4D7NA 2FBTA 1TQIA 1N6AA 1W0UA 4J9IA 3LALA 1KTQA 2KYMA 4E0DA 4PKCC 4BVPA 3J80O 2K7AA 1VQ9A 2VLAA 5J8FA 3MEDA 3GEZA 4DQRA 3PSFA 2DJNA 3NTIA 1KQ9A 3DBHB 2XY7A 4AD9A 1Q1HA 4QSHA 2A6HF 3META 2Y75A 3G25A 2IRFG 3GE1A 3H0FA 3I4MJ 2XHCA 4A5BA 1UDLA 1FN7A 5CAIA 4FISA 4HWIA 4PLIA 1WXBA 2P9SA 4IUTA 4BR2A 3DXMB 3TSQA 5AFUA 2HW3A 2ZJ2A 4LH5A 1RRJA 1J2XA 1WZOA 3DWLE 5GANd 2EFIA 3KHYA 1WEGA 1GFCA 3PMTA 3PNYA 4Z94A 3PO4A 3DPUA 2R7SA 3AKZA 4CJSA 1Q7YO 3ENOA 1BW6A 2EYYA 1IRZA 3A5MC 3DOKA 3QESA 3OSSC 2XGXA 3L1PA 2JLEA 3RVCA 4QLCU 4A3CJ 1QVPA 3ZSRA 1GXIE 2HVIA 1JU5C 1YJ9T 5JHUA 4QCLA 2FC0A 4CC4B 4QVCA 1YLFA 2CP7A 2JXBA 3I55I 1WFXA 5LJ5e 1OU8A 1X6GA 1NTCA 4KNYA 2QVOA 1Q86R 2K3BA 1YHQT 4O44A 1N75A 1YHQI 4FWLA 4LG0B 3VGKA 1WOQA 1KEAA 4IOXA 4FX0A 3K2ZA 1N9RA 1HDPA 1Q7YR 1FIAA 4NL3A 4KHYA 1U0JA 2OTJQ 4S05A 5ERIA 2W40A 4KA4A 3HOYJ 1NK8A 2HNYA 4FJ7A 3CMAN 1LCKA 1MDMA 4M7DG 3RMSA 3HYIA 5KCHA 2D0OA 2JT4A 1BI4B 4E3SA 1I81A 3PTAA 3OA6A 3L2ZA 1G5VA 4YOVA 3BY7A 4FK2A 3EZWA 3DLGA 1NK0A 4CZIA 5JVGF 3AG4H 1YTUA 3MVPA 1VSIA 3QO3A 1P2FA 1HQUA 2MG4A 1AVZC 3VS2A 1S6LA 2DBMA 5EVZA 4KH6A 4LFBK 2Y1IA 2X3XD 4CZCA 3H6EA 3VOEA 1JJ8C 4JJBA 5JVHL 1B07A 2Y4XA 3IH4A 3F8BA 1WB9A 4YY3K 1SF9A 4I2PA 4M9SA 1DIZA 2IBDA 1FYMA 4M78C 4F8RA 2HGCA 2BUDA 5GAMf 4Z2YA 3V8JA 2NWMA 3WTSC 4CF0A 5CK9A 3J7AF 1AWJA 2IPQX 3CCUA 2W57A 1BI2A 2DA7A 3PFIA 2LCCA 1HNVA 1K6YA 3I56A 4CEFA 3RTVA 1OH7A 1ZC6A 3FDYA 3CMYA 4HVWA 2MIOA 4HNTA 3I56N 3QIIA 1FNNA 3IL2A 4J01A 3U2RA 1BQMA 2I5WA 3DP7A 4QS7A 5AYFA 3O2PE 3RRGA 4E7SA 1YP5A 2W25A 3G0ZA 2Q0OA 2GXAA 2O3FA 4OF1A 3WE3A 1GUUA 2YNHA 2YRCA 2O9LA 2KRHA 1M30A 3TQ7P 2O31A 2BVMA 3MXJA 2LFBA 2Y31A 3CD6Q 4ELUA 5KI6A 4RW7A 1ON1A 3NH0A 3BJOA 1MZBA 3QJYA 1SZ2A 2A5WA 4JD2B 1W4SA 4RTFD 3GO5A 3DEEA 3U9DA 2JGUA 4FSSA 3CQ8A 1JO8A 2B7EA 2JSPA 1RBUA 3WODF 4FWRA 2G8FA 1O7LA 2WAQA 5DM6F 3QERA 2B6AA 2VONA 2X78A 3V81A 3PX0A 1QWEA 1G6NA 3U23A 2AXTC 1HYOA 4G7HF 5LL6S 3QNNA 3KP6A 1P4XA 3DEWA 5LHHA 2BZXA 3CPEA 3H9QA 3NFCA 2CGKA 1YJWI 3QU6A 4L0YB 2A3ZA 1B7TA 1W7PB 4FWNA 1TKTA 4ZTFA 4DQ2A 2OCCH 4X1VA 3GF2A 4NB4A 4FJXA 5J4VA 3FIWA 3B6AA 5IYCJ 3RYRA 2M02A 1WKMA 5J40A 3C6AA 1VQ8Q 3K2AA 3HVTA 3BQZA 1U6ZA 1JTYA 2L7KA 2DJIA 3HDDA 4B09A 1RILA 4HV6A 1W36C 2JA2A 1ORPA 3WEEA 3CXCP 4EV0A 4HTLA 2D8HA 1K83J 1A36A 4UUSB 3J8AA 2CZ0B 3AFHA 1KU7A 1Y0MA 5HLTA 2ROLA 3VEWA 4CHNA 3CD6I 2RN8A 2DQRA 1GLJO 2IXSA 2H8HA 3CCMT 1FSEA 2MFZA 3A5LC 4BHCA 1TG0A 5FKMA 1G3WA 3VYHB 4UY8O 5ICEA 3AAQA 2XF6A 2YR2A 3SHWA 2P0PA 4RAGA 5GTIC 2KRSA 5AQHA 2X1CA 1LOJA 3CXCA 2GNCA 4K41A 1T3VA 1WHKA 1CXUA 3JTGA 3UIQA 4RMNA 4XN3A 2IS3A 4LSNA 1KG4A 3QEWA 2JA6J 3KEOA 2O03A 4U88A 4BKXA 2EYWA 3CFPA 4FW2A 4JRPA 4M7AD 2NOZA 1Q81U 1TU0B 1YS7A 1EH7A 1VQMQ 4CEEA 1I50J 1TAQA 1VQKN 2D1VA 3D2FA 4XK4A 5B8HA 5F0HA 4MQ9F 3CCRT 4TV7A 3H08A 3HB9A 3C6UA 1YIJQ 3HPWA 2KFDA 2QSHX 4LFUA 3KE2A 1I5LA 1SD7A 4RW9A 5M1KA 3NFAA 3BJ6A 2C6YA 4KMFA 2A28A 3NGYA 3RR7A 3I0RA 3HIFA 4UUTA 5E3LA 3BG3A 2VT3A 5DV5A 1ZK8A 1L3TA 5DD4A 3ECOA 3F6OA 3S3OA 2QBYA 3DMJA 1M3QA 5C12A 1GCQA 2P9NA 3A8LB 4CEAA 2XKPA 5E8GA 3EY1A 1VQKT 2E65A 2RJDA 4Z4CA 3P8HA 1M1EB 4XH5A 3S1QJ 5GAEP 5EJCA 4XNFA 2NUTA 1MMDA 4DEYA 3K59A 4IWVA 5IY5H 1ZBXA 2VL8A 5GMKh 4FJJA 1O75A 4N4OB 2DCEA 2RQUA 1WSIA 5HOOA 1HW2A 5KRTA 2IVWA 3HL8A 3HOZJ 4M3RA 1FIPA 5DM7R 3KLGA 3H3VK 2A68F 3E6BA 4R56A 5FW9A 2G3RA 4HT9A 2IA1A 2F2VA 1TUGB 4FM0A 1NK9A 4CCMA 1BWFO 3LAPA 1PYVA 1VQ7A 1J9AA 2HDDA 4NL2A 1KZHA 2HQHA 3FXOA 3PV8A 1IN7A 1K8AR 3EUHC 3CF5L 1TP4A 4PJNA 3O9RA 2HL5C 2XI9A 4B9QA 2IVMA 5K5RA 4AI5A 4KJZA 4QWQA 1XMOK 4BXUA 4FZXC 4XKWA 4WK8F 3MEVA 4QPQA 4UOBA 2GIZA 4CIEA 2K9LA 1T39A 1NBEB 2LC4A 2QEXQ 4DTPA 3OYGA 2OCEA 3CMAA 3G6EI 2FF6A 1UB4A 2ZPIB 3LA3A 5DTDA 2OAWA 1FOWA 5D6WA 3S1RJ 4C2UA 4C3JJ 2G8KA 1VRTA 5SZTA 3EKUA 3R9PA 4NCBA 3JYTA 1HKCA 4MHGA 1DDNA 4DMNA 4FOIA 2R4GA 1EQYA 2M5WA 2COWA 1JJ2A 4KUMA 3VSKA 1QVFS 2FVUA 5H20A 2EV0A 1N39A 4DTUA 5LRRA 2LX7A 1B92A 3CERA 4Y3OA 4FQGA 2EFWA 4BH9A 2D1XA 3AA5X 3VQBA 1YIOA 3CDHA 4QS9A 1QZ5A 2FF4A 4C5HA 2Z1GA 2EKOA 3J81K 2G9WA 1V4SA 1NMDA 3JAMK 2NYSA 3L2RA 3VW4A 3D5LA 1YUWA 4RM3A 4OOIA 3CMET 2QLZA 4RUGA 1NGCA 2D4WA 4DU3A 2YHBA 2HDWA 3K1MA 5K7FA 4OKEA 2CUFA 2HQRA 4EFHA 3MCZA 4J8FA 4B9NA 4C8NA 5J3LA 2QENA 1YQAA 3A8MB 1FZPB 2L8DA 1D5VA 2CKKA 3CCQT 4BR9A 3QPTA 4C8QG 1J53A 2R7RA 1L3SA 3GUDA 5CR2A 2M8GX 3K4BA 2DA6A 2EH3A 2P5VA 2YPRA 1Z25A 5HP1A 2NRWA 1X9JA 4YOYA 1PSFA 1PP8F 4DV0K 4GKKK 3MMVA 5F1RA 4FWMA 3CESA 1FTZA 5AONA 1KQSP 4H8KA 2YS9A 1JLQA 1UGVA 5AZJB 3SWNC 1VSKA 3NH2A 1SKRA 4BEHA 3ZN0A 3DXMA 1M3AA 3T9NA 3R0AA 3J80Z 4J00A 2V75A 4K25A 4XTYA 2H27A 4DOWA 2HEOA 2WSCE 1XGMA 2H1LA 4ZZLA 2M8EA 3FXJA 2CH0A 4ZDPA 3I0WA 3GL1A 2VWJA 2N8GA 2BE7D 2I8DA 4MEYF 4MLHA 1IN4A 1WBDA 2HZDA 2BZ8A 2E2QA 4M77G 1VQ8A 2R7UA 1DP3A 3UKGA 4H0PA 1D8YA 5C4XJ 2WFBA 5EEHA 3EGXA 4G9YA 2ED1A 2RHYA 5I22A 5E3MA 3WXKA 3C2BA 3HI0A 2E2OA 5GAN4 4NYNA 3UT1A 4ORZA 3RCOA 1S3JA 1RT4A 3KK7A 4Y15A 4PKGA 1VQ6Q 1BIZA 3GFIA 3ZL7C 5E79C 3KD1E 4B9XA 1U1TA 4NC7A 2D0PA 2WC2A 2JN6A 3CP2A 3H5AA 5KPZA 3QFUA 4FLVA 4GNIA 4RAZA 1J59A 4D5FA 4P1WA 1IBLK 2L4MA 3EQLF 3FM5A 3WTWC 1YITT 3CJ7A 2P9IA 2DTUA 3A03A 1VQ7Q 1U84A 5AQVA 2ECCA 5AQGA 2UU9K 1EETA 1TXQA 1NGAA 1KYZA 3RERA 2V7ZA 4UNOA 3ABTA 1KAZA 2K2MA 4AIJA 3L3UA 3KYDB 4HVUA 2NRRA 1YX3A 4KH1B 2OA4A 2IA0A 1CZAN 2E6LA 1RBVA 3BG9A 2UXDK 1GLEG 1VQOA 2RHIA 3M56A 5GJWB 1QVFP 1S1XA 5HROA 5F04A 1FP2A 2F4IA 4WWCA 2NS0A 1XG7A 1WHGA 2VKVA 1NBWA 3FK6A 2ETHA 2L7ZA 4FJ9A 2TDXA 3QG1A 4HUFA 3H0DA 1O7FA 5FKNA 2JHJA 2JOYA 1X4OA 3M0UA 4ISEA 1LWFA 3CUQC 2K9NA 1BW5A 2GTJA 3VV0A 2NZTA 3KLEA 2WTEA 3L2CA 1HUXA 3I35A 2QKMB 1ZBJA 3O6BB 2QWPA 1TYQA 3AVJA 1K9AA 4M45A 4AHTA 5GMKj 4B1ZA 2MD5A 5A0DA 2VC1A 3WG9A 2Z99A 2HSTA 4LF8K 3AO4A 1K8KA 1I94K 4BRQA 1TGOA 3QZ9B 3OGDA 1JHFA 4KTQA 1H9TA 1P59A 1R71A 2E1NA 3GOIA 5BQTA 2GZWA 1VQOI 4B44A 2MC4A 4A6DA 2KQRA 1WYXA 1VQLA 3WQTA 3SXYA 3QOEA 2P0KA 2IIRA 1U5SA 2KVQG 2FNAA 4NC8A 2AZSA 1POGA 1QSLA 2Z16A 1WHHA 2L9NA 1VQLN 1MNMC 3CMAI 4HV5A 2KXCA 3CCRI 2OI3A 3O8VA 1KHIA 2O5RA 2EVRA 2E20A 4AIDA 3SD4A 4GY2B 3I58A 1HQCA 3HKZA 2YUQA 4PJOA 3V1OA 1MMNA 4XR6A 4I9QA 1UZCA 2X4XA 2BY0A 5M1OA 5B5EC 3HKZN 4BQOA 1E6HA 2KLOA 3KK2A 3TAMA 2K9QA 4CICA 4Q4ZF 1K73C 2JZ2A 1J0RA 1QKWA 1DUXC 4CEZA 4BRLA 4P5NA 3THYA 1ZGAA 2RO0A 1DPRA 1C0TA 1I27A 5LMNK 5AQTA 2ELHA 4DR5K 3ABUA 4IUUA 4XRSG 3LP1A 1R0AA 1HX1A 4CHQA 1VQNA 4KISA 3N4MA 5FU7B 2KP6A 1QVUA 1O1WA 2M7AA 3PIPF 4JLGA 4DUZK 3ZQLA 4LK1F 4L9VA 3BR0A 4IQ4A 4AFQC 3M0QA 1JXEA 4MEXF 1KLNA 4B48A 1HYZA 1QHHD 2KZMA 1J5YA 2OTLN 2BVLA 2CG4A 5GAOp 3SBTA 2HQXA 4XRSA 4NNJA 4GRIA 1T8EA 5DYMA 4BY1J 1V5FA 1GL5A 4UUSA 4A5MA 2P9KA 5JR3A 3KJVA 3VF4A 3A5OC 3O1WA 5GPCA 4A5NA 1OCRH 2V9KA 3EEQA 3K9JA 1Z67A 2CJJA 5I3UA 5KN9A 4JI3K 1AZGB 3FISA 2L9SA 1K4SA 2YHYA 2HPMA 3TWHA 1MW7A 2DL3A 4FLYA 2X48A 3BP8A 3HT3A 1WHLA 5E26A 2MABA 2EGCA 4B22A 3CCLA 4MFBA 4EMKC 4C0GA 1RC9A 2E35A 3I55A 1FWZA 4C92A 3CCQN 1V1CA 3OL3A 2ADUA 1TUYA 5HK3A 4EMGA 5KAIC 1K6OA 4JI5K 3TL4X 2F5KA 2DA5A 4Q0BA 4XRFA 3QEVA 1IGUA 1HNWK 5B1BH 3U4LA 1KSWA 1NWKA 2EYQA 3VQ4A 4E1MA 1R1TA 4CA0A 5LJ3d 3SZPA 2KSSA 2VBYA 2IT0A 1FYKA 2Z1IA 4BDPA 2LCSA 2JS0A 3HUGB 4ETSA 4GFBA 3L1AA 1XQSC 2PNIA 1W0HA 1HMVA 1T2KA 1YJNQ 1XPXA 5DUIA 4DS4A 4CYCB 2DPPB 2ELJA 2V8IA 3V1QA 2ZPEB 3GZ6A 1Q95G 3BUZB 1K9MC 3DLHA 4BE2A 4EDUA 1N3AA 3VEXA 3G4SA 1LUJB 1Z6TA 2E1MC 4IOAL 2EA2A 3SEZA 2ZAEA 1R5HA 3LA2A 3DLMA 1B3QA 2G8VA 2TRTA 2G7UA 4WF2A 2LRDA 5CQEA 1ODDA 4A3DJ 2DILA 1AOYA 4O4GA 5DK5A 3S9HA 2XKOC 3BC8A 3QZ5B 3EH2A 2Z0WA 1IXDA 2QCOA 2EQKA 4XLPF 4RTWA 4BQLA 1ZR2A 2ZMEB 4JI1K 2K9GA 1BM9A 3ASNH 1IXCA 4CHZA 1VQ6N 5I2SA 4BWJA 2FG0A 1NHAA 3DQVC 3CC4I 4C0DC 5A2QZ 3AG1H 4OIPF 2L01A 1P8ZA 3S15J 3BTCA 1XS9A 4HEA2 2HEQA 5LJ3h 5FKKA 1GFDA 2EPDA 4IZ9A 1OYXA 3E9OA 1PKTA 3BR5A 4KRTA 2DTRA 3I4NJ 1GLLO 4JKFA 4KIBA 4JYKA 3WGGA 4HLYA 3K1NA 1QSSA 1HJRA 3DTIA 2DIQA 5H6RA 3TPQA 3K6GA 1OZ3A 2EV6A 2VGNA 1BI4A 2NVQJ 3HK2A 2O8KA 2UUZA 5FKLA 2BE2A 1KVAA 4NYFA 4F04B 1SVLA 5GANh 2O4XA 4CJ3A 3B8AX 4IEIA 1AD5A 4B24A 2H56A 3L7WA 3SYZA 2HFHA 4DNCA 4FYYB 3UF4A 4RLQA 2XAGA 2R7WA 4FLTA 1HR0K 2LMJA 1WJFA 4CGGA 2ZCWA 3A02A 4M63C 2EQMA 2Q2EA 3R2XC 3DEUA 3AT1B 1VQ4I 1OYIA 1VQON 5E8IA 4O55A 1NKUA 1ZUYA 4ZGEB 3L3VA 5LHGA 1G99A 4XN0A 3MN5A 4ILJA 5M5YJ 4ENMA 2LY9A 3SJJA 1MD0A 2D0NA 2KROA 4AHRA 1M1GA 1JLAA 2ZJRF 2HKXA 3LQQA 2R3SA 1C0WA 2FZKB 4XIDA 3M3YJ 4JX6A 2A40A 1PKSA 1YF5L 3VYRB 2L3PA 1ZLKA 2FA5A 2LY1A 4XK8E 3QETA 5GMKm 3QDRB 1QCOA 3LQRA 1P92A 2NS7A 3D7SB 3VQPA 4AHCA 1FXXA 4O5FA 3KX2A 3JRBA 1RABB 2J7IA 2QASA 1FOYA 1WGXA 3IWFA 1RUWA 2PJRB 1QW1A 4S04A 3ZSXA 1YN8A 2LDMA 2VJIA 4RTYA 3QAHA 2FSJA 3LSKA 1HD3A 1RDDA 1X19A 3GFJA 2W4SA 1BBYA 3G71I 2A41A 1Q1VA 4LSLA 3AL0C 1FC3A 1FMWA 2ZXHA 1LE8B 3LSIA 2KT8A 1WPYA 2VC8A 2R5ZB 3M1CA 2O8CB 2KJBA 4N0AA 3K57A 1TWGJ 4PJOE 3NHGA 1G2HA 3T8TA 4O6JA 2O8DA 4CZLA 1SSHA 5JS1A 5M3FJ 4C5IA 2F7TA 3DLAA 3WG7H 1WFWA 1IKWA 3MK6A 4KH4A 3HOWJ 1W2BA 4A4FA 4RWTA 5BRFA 2P0QA 2H1KA 2QQSA 4WQ4A 2QQBA 5EX5A 3AVCA 2GM4A 1YCYA 2B9SA 1SFOJ 1N33K 1JLCA 4XU2A 4BACA 5KGXA 4KGVB 2VWFA 2HVSA 3C6TA 2ZJRL 3K70C 3U6FA 3FIFA 5CHZA 3GTJJ 3OYFA 4ASNA 1GCQC 1RDUA 1G83A 2P9IB 3H3NO 2P1JA 2ASOA 1YW7A 3JXUA 1OV3A 1X2NA 1KQ1A 2BOLA 1IUYA 2A42A 2JVHA 4PA1A 1SL1A 1KQSM 1RL2A 1YITI 3QYHB 4AIHA 4DBHA 3SJMA 4AUXA 4LF9K 4CC7A 1KQ0A 2GA1A 4C8QD 4HA8A 1N36K 2YU9J 4Z4IA 4PJOC 3QKJA 2DY4A 1YIJN 4L0ZB 2K40A 1GXQA 3LX7A 3TSUA 1MMSA 4DSIA 4NLBA 2X3WD 1PRLC 1UAXA 3CVTA 5EGOA 4H0EA 3PNTA 1G59A 1ZR4A 3CWAA 3CF5F 4E9GA 1OISA 2YWWA 2X4HA 3KP2A 3RESA 1Z26A 2O61A 2H8WA 1OR7C 3EE9A 4W5TA 5KYXB 4ZYEA 4LK0F 2X9DA 2JMCA 2MI6A 4LFAK 1UGRB 2KRNA 1XGSA 4LC9B 1S7OA 1YI2Q 1WPKA 2RNJA 4JKDA 3TAGA 4O8UA 2LNBA 1QBJA 3P7NA 3THXB 4LIVA 4H5NA 3OSGA 3RNJA 4CFAA 1V29B 1VF9A 3J7ZI 1CSKA 1Z0XA 3KP7A 2Q8KA 3DPLC 4G6DA 3REOA 2FBVA 2V9VA 2OTLA 2PN6A 3LW5E 4I09A 4GLMA 3WTTC 4UV9A 4BROA 2JQ7A 4FYXB 2IAJA 4IHVA 1J9IA 1NJIC 4UB6C 3G7ZA 4F9OA 3MX5A 3RPUA 1BU1A 3T5XA 2P9NB 1XC3A 4HCKA 3MCAB 3E1YA 4UNFA 2A0FB 5LGUA 3LLRA 1MMAA 1X3ZB 4MQVA 5DY9A 4C92D 2IA2A 4HNUA 1YJNI 3X25B 1SS6A 5AQOA 1PG5B 2DX1A 2VPLA 3M5RA 2Q1NA 3JB9I 1B9NA 3VTHA 4RAYA 3ZMSA 4O0IA 4QKUA 1VSJA 2GIVA 2DJZA