3OS0A

Pfv strand transfer complex (stc) at 2.81 a resolution
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
365
structure length
365
Chain Sequence
AELDQLLQGHYIKGYPKQYTYFLEDGKVKVSRPEGVKIIPPQSDRQKIVLQAHNLAHTGREATLLKIANLYWWPNMRKDVVKQLGRCQQCLITNASNKASGPILRPDRPQKPFDKFFIDYIGPLPPSQGYLYVLVVVDGMTGFTWLYPTKAPSTSATVKSLNVLTSIAIPKVIHSDQGAAFTSSTFAEWAKERGIHLEFSTPYHPQSSGKVERKNSDIKRLLTKLLVGRPTKWYDLLPVVQLALNNTYSPVLKYTPHQLLFGIDSNTPFANQDTLDLTREEELSLLQEIRTSLYHPSTPPASSRSWSPVVGQLVQERVARPASLRPRWHKPSTVLKVLNPRTVVILDHLGNNRTVSIDNLKPTSH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The mechanism of retroviral integration from X-ray structures of its key intermediates
pubmed doi rcsb
source organism Human spumaretrovirus
molecule tags Recombination/dna
molecule keywords Integrase
total genus 103
structure length 365
sequence length 365
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2010-09-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
A PF17921 Integrase_H2C2 Integrase zinc binding domain
A PF18103 SH3_11 Retroviral integrase C-terminal SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2300 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3os0A04
1.10.340.70 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Endonuclease III; domain 1 3os0A01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3os0A02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3os0A03
4C5GA 2RHZA 5D6YA 3DB3A 1JLCA 3KLGA 3M8PA 4DLGA 3NDKA 5J2MA 1U45A 4FZZA 1C0TA 2E6LA 4ID5A 4IG3A 2JTFA 3AVIA 3WNFA 2RI5A 4DU3A 4JS4A 3M9QA 4CCHA 3C6TA 5HRNA 4PLIA 4DSFA 2L3RA 4PWDA 1FK9A 1JLQA 2YKMA 4CGHA 3L3UA 3D0PA 4HCZA 1D9FA 3AV9A 3LWMA 2D0AA 4TSXA 4LD0A 2HVIA 1VK0A 1X1PA 3OA6A 4FW1A 3MXJA 3LP2A 4H4MA 2G8IA 1J9AA 3LAMA 3LZIA 4DFMA 2LRQA 4DTPA 3HYFA 2R5AA 1I3AA 1SUQA 4CF1A 4F3OA 4LH5A 3VQEA 4OGEA 1J53A 4F2SA 2ETJA 3VQ4A 4DMNA 1HQEA 2BUDA 2P0KA 1C1CA 3AO3A 2D5RA 3LP3A 4CGIA 3GOXA 4QW2A 3HM9A 4PQUA 3DYAA 3KLIA 3TAMA 1S6PA 2W42A 3QBYA 2OPSA 4DTXA 5CZ2A 3AVGA 3VQ9A 3VQDA 3PX6A 3DOLA 4DU1A 1BCOA 1NJXA 3OS2A 1HMVA 1S6QA 3CG7A 4W5QA 3SV4A 3PO4A 2BANA 4UC4A 4DQRA 4EDUA 3HO1A 1JL2A 5JS2A 2RHIA 2BGGA 1C0UA 3E01A 1NKCA 5KGXA 2M0OA 4DFJA 3THVA 4N47A 2XY6A 4DSLA 3MO8A 3VQ7A 5KRSA 2KFNA 3MEUA 2QQSA 3MEVA 4OJRA 2DAQA 3MEAA 3ULDA 4B9LA 2F8SA 4O0JA 4KTWA 3K5MA 3JYTA 1TK0A 3FEOA 4OVAA 1IKXA 4QQGA 1WSGA 4B9MA 4FL6A 5KRTA 4B9SA 2KFZA 4CJVA 4BE2A 3B6PA 4DQQA 2G8VA 2GFAA 1UAXA 3KLFA 4RW6A 3SQ1A 4CFBA 1LWFA 2WACA 1WNSA 1NKBA 1Z26A 2Q3SA 1L5UA 2BDPA 4KRFA 1RDDA 3TANA 2HHUA 4NCGA 3RMBA 5J2NA 1EX4A 3G10A 4W5NA 4GVMA 2XY7A 4CK1A 4DF8A 3L2QA 4CEBA 4E19A 3AO4A 2P1JA 4B9WA 4AHRA 4AHVA 4DFPA 1RT4A 4C8KA 3CQ8A 4FJ9A 3NF7A 4FCYA 3OS0A 4ELVA 2EKOA 2OPPA 1BQMA 4PA1A 2X4YA 5CY4A 3ZSZA 3SQ4A 2DFFA 4CFAA 4B9UA 4BDYA 4KI6A 4IUPA 4C5EA 4W5RA 4QQDA 5T7BA 3V9SA 1CLQA 2MWPA 3HVRA 1RBRA 2BE2A 3AVBA 4HUEA 1D5AA 3V9ZA 4FLVA 4CHQA 5C0MA 1VRUA 4C8LA 4IUQA 3ZSRA 3HXMA 3O4NA 1T05A 4J2EA 3PFSA 3TARA 2VYTA 3OB9A 1S1TA 3LP1A 4NYNA 2RPIA 4OKEA 4N56A 2R58A 4W5TA 1NOYA 4YFUA 2PYLA 4FJ8A 5SWMA 1VSHA 1HNIA 2RN2A 4IG0A 3PMIA 3PMTA 1RNHA 3ZCMA 1WJRA 3O3GA 2D9TA 3U6FA 1XI1A 3E9GA 2HB5A 3OYEA 2R5MA 1IO2A 3FLGA 4C5IA 3QKJA 3T3FA 1TKXA 4KTZA 2RJCA 1WGSA 3H6ZA 4EP5A 4DFKA 2Y1JA 1NK7A 4CJFA 5E41A 2FBXA 2P5GA 4M3YA 1RCHA 1BCMA 1NK9A 3OYBA 2OPQA 4CIGA 1U49A 1TK5A 3MEWA 4FLUA 3RR7A 2GF7A 2B6AA 4PUOA 1HJRA 1S9EA 1BQNA 3WNHA 4AILC 4FZXC 2O4IA 1RTJA 4FJIA 4I2QA 4M3RA 4ZHRA 2ITGA 1QE1A 1FXXA 3K5NA 4CEZA 1IKVA 1FKPA 4O0IA 4O55A 3AO1A 4DTRA 3QETA 1NK5A 4B3OA 1G15A 1YVUA 2B8AA 3NH0A 4Z4GA 1YT3A 4RG8A 4KHUA 3QEIA 2GV9A 2YRVA 4EZ9A 3E9FA 4CGFA 1KVBA 3CFOA 4DU4A 2PY5A 4BD3A 2ZD1A 4CGDA 3KK2A 1KFSA 1TL3A 5D6WA 1OI1A 2EFIA 3UT1A 1BI4A 4W5OA 2QKBA 3LP0A 3UIQA 3LANA 1JXBA 3L2RA 2M16A 4IURA 1CXQA 3CFRA 3QINA 4I7FA 3VQBA 2GFUA 3AA3A 3CEYA 2Z1JA 3NBPA 3DRSA 4GMJB 3SUQA 3H08A 1U48A 3ZT2A 4ELUA 3HVTA 2X6SA 2LVMA 3LH0A 5CYMA 4KO0A 1RDAA 2HMIA 4FXDA 2X78A 3NAEA 3ZT3A 4CEAA 3V1OA 1QSSA 2F96A 1HYVA 3KD5E 1SV5A 1S1UA 4FJHA 3AA5X 4FLXA 3NGZA 3L3VA 4FLYA 1LWCA 4CJ4A 1WSEA 1HPZA 2D0BA 4CRIA 4HCCA 2DTUA 1Q9YA 2RKIA 3AVMA 3SI6A 3ZSWA 2EQUA 3NTIA 2EX3A 3HPGA 1NJYA 4EP4A 2VG7A 1KVAA 2YKNA 3P83D 4C8MA 3PO5A 2GUIA 4O4GA 3MAQA 4DTJA 3OVNA 1TKTA 2X4XA 5J2PA 3SD4A 4DTUA 1H3ZA 1RBSA 1EXQA 5KCHA 1XHXA 3K5OA 1BI4B 4A4GA 5IAYA 4OKKA 2DFEA 4B08A 2RJDA 3QIPA 3VN5A 3OJSA 2F5KA 1BISA 1GOAA 3BGRA 4RG2A 3BDLA 2XY8A 3PUFA 2RJEA 3V1QA 3L2VA 2NUBA 2WOMA 4XIUA 1NJZA 4J2BA 4KI4A 4RW7A 4PL6A 1CZ9A 1HYSA 4CJSA 1XNIA 1LAVA 4FM1A 2VWKA 4ELTA 3QESA 2Z1GA 3DRPA 2YNGA 5HP1A 1MHNA 4CF9A 1TL1A 4KREA 5CIUA 3TABA 4E7JA 4ZTFA 3QNNA 2NLUA 4OGCA 1A5WA 4CK2A 3QIOA 1LW0A 4CHOA 4DF4A 4A4HA 1HQUA 1RDBA 4O44A 5IN1A 3IRXA 3RR8A 5J1EA 1VSFA 1WN7A 4IKFA 4QQ6A 2PYJA 5J39A 1LAWA 4BDZA 3ZT0A 4FJXA 1O1WA 3DRRA 3RRHA 3RMAA 3S9HA 4YNQA 1TAUA 4E89A 1X9WA 3TR8A 3K2PA 1SSFA 3LALA 5SZTA 3NH2A 2DIGA 2VG5A 5J2QA 4Q0BA 1WSIA 4DLEA 4CF2A 4K8ZA 1B92A 2I5JA 4QAGA 1RT6A 3S3MA 4GY5A 1TVRA 4HCBA 3AVAA 1KLMA 1KVCA 3KTQA 3OYAA 4CJWA 4B8CA 2XRIA 1KHCA 5C25A 4HTUA 1VSKA 2RHXA 3OYLA 3HL8A 3HJFA 3SUPA 3VQ5A 4QVZA 1TK8A 4N41A 3OYNA 3ZSQA 2G8WA 4ICLA 2RJFA 1TGOA 3HP9A 4CECA 4KPYA 2VG6A 3NF6A 2A1RA 4AHCA 3V6DA 3SPZA 2OPRA 4CJ5A 3EAEA 4M3UA 4G1QA 1F21A 1LV5A 3DLMA 4N76A 1RILA 4E1MA 1T03A 3P8HA 1RT5A 4CHNA 3MECA 1NK0A 4AHTA 3MEGA 1C6VA 5DMRA 1YTUA 4H4OA 1RBTA 3QIIA 2Z1HA 1IKYA 4FU6A 3TAGA 2EQKA 3DOKA 4CJRA 3L8BA 2XK0A 1NK4A 4M42A 2A1SA 1JL1A 4DQIA 2AJQA 2YNFA 3EZ5A 3T1AA 4IBNA 1BIUA 1HRHA 2FBTA 2LSNA 2IC3A 3VQQA 1WAJA 4CHYA 3NCIA 2OZMA 2ZE2A 1ZBIA 3O3FA 4CHZA 4Z02A 2B5JA 2QK9A 4OKJA 1R0AA 1X9MA 1IH7A 4B9VA 4E7KA 4KKOA 3NGIA 1IG9A 4Z4IA 4N4GA 3O4QA 3QNOA 3C95A 4I2PA 3P1GA 4FVMA 3SCXA 3LAKA 4E3SA 1L3VA 1HNVA 3B6OA 2G8KA 4Z4HA 2GBZA 3HP6A 1S1VA 2RF2A 1ITGA 4LH4A 1JLEA 2E4LA 3LDSA 4FLTA 1VSJA 4CK3A 5KI6A 4B9NA 3NNQA 2KQ2A 4F8RA 1SL2A 3K57A 4IUVA 2LCCA 4O5BA 3UWNA 5HRRA 4Q5WA 3HT3A 4A4FA 3C94A 3SV3A 2CKKA 2IAJA 3HK2A 5D6XA 2WONA 4FLWA 4JLHA 2XY5A 1UOCA 3KUFA 4RW9A 4IUTA 3KK3A 2L8DA 4IFVA 1VSLA 1KRPA 1ZBFA 3V9WA 1OYXA 4IFYA 2FBVA 2IGIA 5EU7A 3PX0A 4KV8A 3HSTB 3WNGA 1DTTA 1K6YA 2QQRA 4OPKA 1WAFA 3OYGA 3C4SA 4RW8A 4AHUA 2VWJA 1ZYQA 1SL1A 1QTMA 3DLRA 4Z4EA 3AVKA 2FBYA 4DSEA 1RDCA 4JRQA 3SJJA 2JGUA 2OYQA 4KHNA 3F70A 4Z0UA 4KFBA 1WSJA 3QEVA 3CM5A 3OYMA 5C6SA 3ZT1A 1L3SA 4E7HA 3NTKA 4GW6A 2LTOA 4N4HA 1TV6A 1ASUA 3MP6A 3CM6A 4CJPA 3HPOA 3I8DA 1J54A 4HUGA 1RI0A 1RT7A 1RT3A 3AVLA 3QLHA 3TAPA 2B4JA 4FJNA 3TAQA 3OYHA 2MWOA 3OYIA 4MFBA 4JRPA 1KSPA 2FHDA 2FC0A 4FW2A 4CE9A 3OYKA 1SL0A 3AVHA 4KTQA 1VSIA 3S3OA 1D8YA 1QSYA 1A5XA 2K3XA 1KTQA 2RI2A 1W9HA 1Y97A 2KW4A 4FM2A 4Z4FA 4NCAA 3M8RA 1RT2A 3QERA 1WSFA 3ALYA 3D45A 2HQXA 3H8ZA 1NK6A 5KH6A 1UWBA 4BDPA 1EP4A 4N5SA 5KGWA 4JS5A 1TKZA 2RHUA 4CJTA 4CFDA 1S1XA 4DS5A 3PV8A 2RO0A 1GOCA 2YNIA 4FM0A 1N5YA 2QKKA 3MXMA 1DTQA 4FK2A 1S9GA 5FRNA 3KD1E 2HVHA 4DSIA 1VRTA 1BIZA 4FJKA 1JXEA 4KB1A 5HROA 1N6QA 3TI0A 4I9QA 1QSLA 3CYMA 4J2AA 3K5LA 1SKSA 3DLEA 3KKSA 4BWMA 3V81A 3KIOA 1J5OA 3G0ZA 3C6UA 3K59A 3SYZA 3IG1A 2G8FA 1BGXT 3O3HA 5D3GA 4FK0A 3RRGA 4KHQA 2KZMA 3MP1A 4CEFA 5C42A 3SUNA 4CHPA 4KHYA 1Q8IA 3F9KA 3FFIA 1ASWA 3META 4K8XA 1ASVA 1KCFA 3F73A 3NFAA 3RMDA 1NK8A 2G8UA 3NHGA 4FLZA 2BKDN 2L89A 2YV0X 3LLRA 3NGYA 5CYQA 3SPYA 4NZGA 1B9FA 3IS9A 1XC9A 4LD6A 4KHSA 1RBVA 4AHSA 1SKWA 4BE0A 3MEDA 2HHXA 2G8HA 3SQ2A 4FJLA 3ZEHA 1LW2A 3ZT4A 4CJ3A 3V9XA 3VA3A 3SZ2A 1C0MA 4CJEA 2R7YA 1TKDA 1D9DA 3LYIA 4DWIA 2O4XA 4OLBA 4A4EA 4LY7A 1OZ2A 3PY8A 2X35A 2IS3A 3DMJA 3WNEA 3RTVA 4FYDA 2DIQA 2LDMA 3EYZA 3M8QA 1RBUA 4CERA 5KE3A 3ZSXA 3VQAA 3NE6A 3L42A 1T8EA 3SQ0A 3K58A 1B9DA 4EZ6A 3OMCA 1W0HA 1SKRA 3AVNA 1EKEA 4E0DA 1QHTA 4C5HA 4C8OA 1WJSA 2X6NA 5HRPA 5KE2A 1A5VA 3AA2A 3VQ6A 3ZSVA 5HRSA 2XHBA 4M3WA 4M3XA 4I9LA 3OYFA 2IDOA 3QJ6A 4ID1A 3SUOA 4KHWA 4M45A 2YHBA 3ASMA 2Z1IA 2HNYA 3S6WA 4N4IA 1VSDA 4CEEA 2HHTA 1NOZA 1S5JA 1BHLA 2RI3A 1ZBLA 1KLNA 4FJGA 4R5PA 4ZTJA 3DLBA 1C1AA 4CF0A 4F3TA 2HHQA 2M1HA 2P51A 3OS1A 3DB4A 1CXUA 3AVCA 1UA1A 3KLHA 3VQ8A 4BWJA 3VQPA 3V9UA 2IG0A 3AO5A 3NF8A 1FKOA 4H8KA 3U3GA 3M8SA 3DLHA 5J26A 2OZSA 4FZYA 3FC3A 1VSMA 2QXFA 2YHAA 4Z4CA 1IKWA 2IOCA 1GOBA 4DQSA 5CZ1A 3OYJA 4RW4A 2E5QA 4B9XA 2R57A 4PLLA 2D0CA 3LGLA 4CGGA 1WSHA 3OYCA 2BIVA 3OMGA 4IDKA 2JLEA 1VSEA 3EY1A 3AO2A 1TAQA 2Y1IA 4FJ5A 3LX7A 4CESA 4CIEA 1RT1A 3IAYA 1LWEA 3DI6A 3KLEA 1ZBHA 3KK1A 1XHZA 1U47A 1RTIA 3V1RA 4KAZA 3L2UA 3QEWA 3MEEA 4CJKA 4FJ7A 1REVA 2O4GA 4DTOA 2P5OA 5K14A 1L3UA 3AA4A 4BE1A 1U4BA 3O8VA 2EQMA 3Q1JA 3KJVA 4CIFA 3VA0A 2HHVA 4X34A 3MP8A 4CJUA 4F2RA 4DSJA 3LWLA 3OJUA 1L3TA 2HHWA 5JS1A 4E7IA 3TAEA 3P8DA 3V4IA 2HW3A 4MQ3A 4J2DA 1ZBUA 2E6MA 3LPTA 1QQCA 1G5VA 4LSNA 4DTMA 2G3RA 5KTQA 3PX4A 1NJWA 3DLKA 4L8RB 2RHYA 1YTAA 2E6NA 1KFDA 1QS4A 3DM2A 4CJQA 1U04A 3CFPA 3RWUA 5M9OA 3PNWC 1DLOA 3FDRA 4DQPA 1HYZA 4PY5A 1MU2A 3L2WA 4E1NA 4DS4A 4UQGA 2DFHA 1OZ3A 3BDPA 4F4KA 2ATQA 4KB0A 4CJLA 4NCBA 3I0SA 3NF9A 3VQCA 3JSMA 1JLFA 2KZZA 3DLGA 4OVLA 5DK5A 5FDLA 4E7LA 4M3TA 3QO9A 3LZJA 4LSLA 4AH9A 2ZQBA 4C8NA 3TAFA 2K3YA 4Y1CA 3ASKA 3ISNC 3SNNA 5HLFA 4B9TA 5FRMA 2X4WA 2KTQA 3RMCA 1XWLA 1S1WA 1BL3A 2F8TA 5I3UA 3MXIA 1Z25A 4QOZB 4II1A 1EETA 4IUUA 1WJQA 1RTHA 2XDPA 2YNHA 3A2FA 3KKRA 1X9SA 2OA8A 2PZSA 4FK4A 3I0RA 2DY4A 1C1BA 1JLGA 4L59A 1JLAA 3QEPA 2HNDA 2X74A 4Q5VA 2JZ2A 1RTDA 4CF8A 1NKEA 3ZSYA 4CEQA 2XO7A 2EHGA 4FJMA 4B8AB 4CEOA 4HHTA 5FROA 5C24A 3OYDA 1Q9XA 4CGJA 3OY9A 1I39A 2PQWA 4DSKA 4HUFA 3NH1A 3QEXA 5I42A 4CEDA 4OLAA 2HNZA 2O4XB 1JLBA 3ME9A 3OQ5A 4HVJA 1UA0A 5KCOA 3LPUA 3NTHA 4M3ZA 3TWHA 4FJJA 2HHSA 3HPHA 3ITHA 2HQEA 4CFCA 4BACA 1WLJA 4NYFA 3U3YA 3LGFA 3S3NA 3AVJA 5HBMA 4DTSA 4NS5A 1N27A 2EQJA 4OPJA 4DTNA 3P5JA 3AVFA 4DG1A 4Y1DA 3T19A 1T7PA 4QCLA 4WE1A 1JKHA 1CZBA 4M41A 3ZSOA
chains in the Genus database with same CATH superfamily
1K7AA 3V7CA 3NDKA 2K7LA 4J8FA 4ZZDA 4K25A 3K1NA 4IIMA 2VKDA 5IT9Z 3QYEA 2Q1NA 2EBIA 1AHJB 2M0YA 2NRVA 2ETJA 3ZMVA 1SEUA 4M3EA 2E2QA 1Q81C 3X24B 3OA9A 3SV4A 5K5OA 5EY4A 5DCFA 4BJTA 1IXDA 2JW4A 1QRYA 2VUMJ 4GKJK 1T39A 4I01A 4A53A 5KRTA 5K7ZA 4EMGA 1CQTA 3MKDA 1T6SA 1B07A 1UAXA 3THWA 4LIUA 3SQ1A 4LUDA 3LWIA 4A4KA 4PL8A 5M5YJ 1UECA 3SEQA 3CC7A 3BTJA 4O6JA 1HCRA 3CCUN 2BE2A 2UXNA 1PRLC 4JD2A 3HXMA 4LLGF 2DL3A 1Y96A 2HQ5A 3OYEA 1WXBA 1IO2A 2WB1N 1HKTA 1M5Q1 3QFUA 2KIUA 3HHHA 1F5TA 2ITGA 3QPLA 1POGA 5FLVA 1KVBA 1P8ZA 4LIVA 2Y75A 3BCBA 4IHXA 4D7MA 1Z05A 3SZPA 1JXBA 4DV4K 3I9V2 4GLMA 1YRNA 3HYIA 2RD1A 3H08A 4ILHA 1FYMA 4AFUC 1SG5A 1JTYA 1RDAA 4BY1J 4JN4A 4FXDA 1U8RA 1YJWQ 4E2FB 2QEXQ 1NMDA 4HW0A 4FLXA 4CJ4A 2P9NA 2D0NA 3CCQT 3ZSWA 1K0SA 4E4HA 4WQ4A 3PNYA 1H3ZA 6AT1B 1E4FT 2VOPA 5GAOn 1XD7A 2VL8A 5IAYA 4CZMA 2QCOA 3EG2A 2NRTA 4KN4X 2WWYA 4XKWA 1IUFA 4CJSA 1WWXA 3DRPA 1BA5A 4KIBA 1CF7B 4HV5A 4E7JA 3QNNA 4OGCA 4AI4A 1R9TJ 1RDBA 3CCRA 2HDAA 1R1VA 1RAFB 5FKOA 3LSRA 1HKQA 2Y0SN 2XMFA 4J9FA 1SSFA 2WSFE 1QQJA 4P5OA 4Q0BA 1PD0A 4DLEA 4M75D 4CF2A 5J47A 1SD5A 4FE7A 4GY5A 1W7PB 1KVCA 3JRBA 3F0ZA 3HL8A 3HIFA 2QWRA 1LFUP 1OX9A 2V75A 4CJ5A 2VJJA 5EJCA 4U0YA 1YTUA 3F10A 2IIMA 2MIOA 4XN3A 4CZZA 1BA1A 2VJIA 2NOGA 4W97A 1YJ9I 3T1AA 2H6BA 2RQUA 1ZBIA 2OTJA 4A0YA 2HYJA 2UWMA 4I2PA 3TU5A 1Z0XA 3BJOA 3B6OA 2JHJA 3BQZA 2EFPA 4O5BA 3RIRA 5TKWA 2BE9B 2A07F 1OCPA 3HK2A 2Q1ZB 1KYZA 4FLWA 1TUYA 3KWIA 2BZYA 4RW9A 3CCMN 3CCJT 1ZBFA 5EEAA 1KQSA 4KNYA 3EZWA 1BG3A 3AVKA 1UB9A 1WSJA 3OIOA 1Z67A 2CH6A 1QWEA 3TSQA 1XG1A 1ORKA 2F5TX 3FF5A 1FN7A 4ATOA 1TT0A 1SFEA 1RT2A 1T44A 1WSFA 5LEKA 5BPIA 4TV7A 3F8NA 3HHGA 2DBMA 4WX9A 3PV8A 2QKKA 2E2OA 5FPNA 2QAZA 1VYVA 2FMLA 3FM3A 1VQ4T 5AN4A 1XTAA 3GTMJ 4FJKA 3FLCO 5DCMB 2DN0A 1YW7A 4J83A 2KXCA 3QYFA 5F0FA 1KU9A 1H92A 2HKOA 3BZKA 4KHYA 1Q8IA 2JA8J 3CC2I 1TUDA 2F69A 3KYDB 2BKDN 3NGYA 5CYQA 5KVRA 1XDUA 3S2WA 1W7PD 3JCMb 1FOYA 2J7IA 1LDKB 3V9XA 1D9DA 1M4ZA 3MN5A 4C1NK 3DPUA 1EH7A 2D0QB 2IS2A 5AQSA 4PCQA 1TQPA 1JUMA 1MBEA 1PU6A 1Z21A 4M7DB 3CC4I 1FOWA 3G6EN 3RSEA 2GA2A 3OYFA 1BO5O 3AHUA 4H0EA 2QASA 3PVQA 2HMPA 2YJFA 4F3TA 4BH9A 4KFCA 2HQRA 4QIWN 5LGUA 2QXFA 4FYWB 3J7AY 1VSEA 1IV6A 4MDBA 3WGHA 4J01A 3JB9I 1S5LC 3VB2A 1ZX6A 3QP6A 4CJKA 4YELA 2XVCA 1D8JA 4G6DA 3FDYA 3GNFB 3P8DA 1D1AA 2W7NA 2QEXN 5ICGA 5FLXK 3W0LA 1B1BA 3CC4A 4OIRF 4JI1K 3JB9F 2P9KB 3VJPA 3GW2A 4RAGA 4NNJA 1SVOA 1B34B 5FDLA 3QO9A 3LZJA 1JHHA 4AH9A 5AJ3K 1W1WE 3AFHA 1VQ4I 1SZ2A 5IT3A 1EETA 4F9OA 5IOZA 1Z7LA 2VE8A 1YI2Q 1ZHIA 1DJ7B 4B1ZA 5L3BA 4OPAA 2OA4A 4CEQA 2OQGA 1V54H 1D5YA 4CZEA 1X27A 3EKSA 5I42A 2R0QC 3ME9A 1J5YA 2FJ1A 1N5ZA 4JV5K 4FJJA 5LJ5h 3QODA 3PE0A 4CFCA 3LGFA 4H0PA 4II3A 3DV8A 3SWNC 4IOXA 2KRNA 3LDPA 3G1JA 4J9BA 3VF2A 1LMZA 4GLKA 2JMWA 1K8AR 1WH7A 2RI5A 2OF7A 1UG1A 2QWNA 1K9MO 2ESHA 3CI5A 4C3HJ 3ZMDA 3IHUA 1TQIA 2CGHA 4ESFA 2EYYA 3HM9A 2KFDA 3H5NA 1LJOA 2W42A 2HVQA 4O3MA 5HVQC 1WBBA 3CG7A 1VRLA 2A5WA 3OR2C 3CCUA 2KPMA 5J4YA 4JI3K 4H0TB 4FISA 4MTDA 3E5XA 4M75C 2E7WA 2HQAA 2NUTA 1ZH5A 3A5LC 1P4WA 3CERA 2DK5A 2WACA 1FOKA 4D5CA 2BDPA 1GT0C 1R5GA 4KRFA 3OSVA 1N78A 2CZ7B 2LQNA 1YQMA 2HBPA 3SDBA 4C0GA 1RT4A 3VEWA 1NYGA 4DV0K 3CMEQ 5FKKA 4IUPA 3CCRN 3HVRA 4BRFA 1VQ8Q 4IUQA 3ZSRA 3CHWA 2ASMA 1EIFA 1NOYA 1B6AA 2O8DB 3M5AA 3T69A 3VYTB 2HNHA 4M77D 1HDDC 2VV5A 5LMNK 3A4CA 1W36D 4OMFB 2HXOA 2SRCA 2PAVA 3RYPA 2COMA 1O3QA 3VYGA 4DTRA 2O8FA 3U1DA 4WFBL 1U2WA 1W7PA 1HW2A 2WY7Q 2HL3A 4GGGA 5CHIA 1UB4A 5DD8A 1BI4A 3JXUA 2XAFA 1OVYA 4XH5A 2HBJA 3ZT2A 3HVTA 4YDUC 4XTZA 4YOTA 3ENHA 4I7HA 3CTAA 1Q7YR 3IL2A 2K79A 1V5FA 1HD3A 1H89C 5J8CA 3F8FA 2DTUA 1Q9YA 2RKIA 4AVZA 2FMYA 4BRKA 2DU9A 4DTUA 5AQIA 1RBSA 1EXQA 2LDUA 4B08A 1R0CB 4ELTA 1K4US 3DPLC 5AQPA 3KEQA 5CR4A 3F3XA 1MUDA 3ERED 1VIEA 1STZA 3VTHA 5JI6A 1ZGWA 5J1EA 4KUMA 1I6HJ 5GAOm 4QVDA 1O1WA 3RMAA 2PTKA 1TWAJ 2ZGYA 3NH2A 5J2QA 2MMPA 4BYYA 3ZQ7A 1NM1A 1FMWA 1RT6A 4XLNF 1Q86U 2PVGB 1Z3XA 1AWWA 4Q4ZF 4B8CA 1NEBA 2OCCH 2IVNA 2YRDA 2G8WA 3DU5A 2VG6A 5KQ8A 4KREA 1BK2A 1NK2P 1TG0A 5DMRA 2EIMH 2QWPA 4DQIA 3C2HA 1KQ9A 2O01E 2AJQA 1Y96B 2ASPA 2H94A 4JX4A 2ZE2A 2DQRA 4CBWA 2QK9A 2B86A 4E7KA 3EG3A 1R8OB 4EJOA 1K61A 3VS7A 1UHFA 2OC6A 2XIDA 5IP6A 2E12A 3PIPA 1E17A 2OV7A 4EMKA 2OTJI 1GBQA 2MF2A 2IAJA 5GAEP 1UGPB 2DFIA 4LE9A 2R7UA 3KX2A 4KGZB 3THWB 1W7AA 1VSLA 2BZTA 3LDQA 1OYXA 2XGEA 3BG5A 1UUEA 5F64A 3ZT1A 2VXZA 4J7FA 3CM6A 1XNRK 4EGYA 1KSPA 2RM4A 2LCSA 3I56N 3JSOA 1GCQC 2GOMA 2RI2A 1GLJO 2F4IA 3JRCA 2PUOB 1GL5A 3OBWA 1RKTA 3D45A 2ZJPF 3CF5L 1QZYA 1WEFA 2WADA 3DTEA 3GZ6A 1S9GA 3BG3A 1IDYA 3WXKA 3C6AA 4CI6A 1QKXA 1LKXA 1U5TC 2VC0A 3SZGA 3KKSA 3E19A 3NARA 3NMUA 3ABMH 1R49A 3C0CA 4IEJA 2OJ2A 4CHPA 2NUPB 2MGQA 4ASNA 2JA6J 4IHSA 3F73A 2H8HA 1Y0NA 4ZYHA 5E18F 2FF4A 2G8HA 3E5UA 2F5VA 3ZEHA 2KJCA 5GMKj 4PIIA 2I10A 3G3ZA 3I53A 2YDLA 1U6ZA 3G1MA 3OMYA 2OQRA 3SQ0A 2VGNA 2NRHA 2YR2A 2ZAEA 1XTDA 2YX4A 5HRPA 2RN7A 1L0OC 1YJNA 1WHGA 2IDOA 1KA8A 1VSDA 4DNCA 2E64A 4C8QF 4ZGDB 3G0QA 1NLOC 3OW2A 1UA1A 5CJ9A 3VYUB 3BCAA 1PU8A 1FKOA 3DLHA 2W6KA 4P9UA 2ZPEB 1VQ6Q 3OYJA 4B9XA 2ZJ2A 2R57A 4A2AA 1JQQA 3EY1A 4J00A 5AQUA 2XGDA 2VE9A 2DJQA 4OAYA 3ZQCA 3L2UA 2NS8A 2O4GA 1ZAOA 1L3UA 4EIKA 3VA0A 3LDOA 4DSJA 3KYLA 1IN6A 4J19A 4J2DA 3G2BA 2XHIA 1QQCA 4EAHD 2G3RA 3QPTA 5BR8K 1ZXOA 1FMVA 1U04A 2LC2A 4Y15A 4C92G 1X1CA 2KLOA 1TUGB 3JSMA 3DLGA 4B1UB 2CFOA 2AZVA 1NGHA 4JAXA 4G7HF 1Y8RB 4XH1A 2XD0A 4BRPA 2D0OA 4ZNXA 2ZSIB 1RR8C 1C1BA 5KN9A 3ZSYA 1XSXA 3ESWB 3J7AP 3IV5A 1DT9A 4RGUA 1IRXA 1MBJA 1D5VA 3EFRA 2D1KA 2NWMA 1CSKA 4H5TA 2H56A 3CJTB 4ZH4F 1RC9A 1ZRCA 4YG2F 3C7NB 2W40A 1XGMA 3N4PA 2XUBA 1HNZK 3M3YJ 2P9KA 1ILYA 3G25A 1VQLQ 4LLLA 4FZZA 3WTYC 5DUIA 1Q81R 1RABB 2P4RA 4FWPA 4OMNA 1TYQB 2CUFA 2KIFA 3LAJA 3M7GA 1CF7A 2XRLA 2ZXJA 4XRMA 2P0KA 1TWFJ 2Q36A 3TAMA 5FLXZ 1DP7P 4HSBA 1I27A 1VQPT 4DQRA 1WX6A 3CCMA 2BH1A 3VQ7A 1JXOA 3JB9D 3HUGB 3HBTA 3B8AX 2M9UA 2EQRA 3VS2A 1FTZA 3VW4A 4UUVA 3SEMA 3KLFA 4RW6A 4ZYEA 3HOSA 3KHYA 4YFNF 1MWMA 1E7OA 1YCSB 4CEBA 4AHVA 4BR5A 2QYZA 1BQMA 3I5RA 3TVTA 2DFFA 2IVOA 4E1JA 3F22A 5JLHA 1N77A 3IH7A 1SAUA 1V29B 1HK9A 2V26A 1T05A 1IZ1A 2KK4A 3M8EA 2VYTA 1QVGP 1SQKA 1KG1A 2YSRA 4IG0A 1W97L 3PMIA 3NRVA 5CKDA 4M3YA 3CCMI 3LMMA 3K0LA 1TTHB 5TJJA 1K9MC 2YLCA 4DR1K 2M0MA 3CJCA 4ZHRA 1ZBLA 3DEUA 4DR4K 5CHZA 1G15A 2HTJA 4JJDA 4RG8A 4JKGB 3TSUA 1R0BG 1FBSA 4PJOD 2VUBA 1UHSA 3L2RA 3VEXA 1DGWY 3VS6A 3W2AA 1I6XA 5HCKA 1VQMQ 4XRSA 4H4KC 5TKYA 3CJ9A 2DL4A 3L3VA 1LWCA 1D8KA 1WSEA 2BZ8A 3RZDJ 4DA4A 1RKWA 2L9NA 4M7DD 3OVNA 3J81K 3CCMQ 4EQQA 2Q0UA 4EJVA 4O8UA 1R4NB 3SNNA 4XIUA 3DP7A 1HYSA 2GELA 3E3VA 3LQRA 3G4SA 4HDVA 3BEXA 2L54A 4O44A 3IRXA 4FL9A 3K10A 4IKFA 1M1GA 4A3GJ 2DE0X 1IBLK 3FM5A 2CWEA 3K2PA 1LUJB 2HD0A 2DXBA 4QAGA 4HBLA 2FPEA 5KPTA 3H92A 1ZSZA 1KLMA 3GFJA 3GE1A 4XU0A 4ICLA 3HP9A 3NF6A 1V76A 2K5CA 3I0XA 3DLMA 1JB0E 1RILA 1PVSA 1F43A 3CXCA 1IRGA 2MK5A 4V19S 3G4SI 4IBNA 2D4WA 2OZUA 4V2SA 2O9SA 4VUBA 3TTDA 1IG9A 1OH7A 2KISA 3J81Z 3LAKA 3JCMe 2G8KA 3LDSA 3CMEI 2ITMA 5M1OA 3TOAA 3CBMA 3R6MA 5AYFA 1PJRA 1VQ9I 5HRRA 4Q5WA 1HKSA 4IHWA 2PBIA 2IGIA 5EU7A 3VOVA 2EV5A 3OYGA 4DSEA 4YOVA 2IA0A 3QAHA 3ENBA 3URGA 2H09A 4ORZA 5GIOA 3AVLA 2RAEA 5GMKl 1VQ7I 4P55A 4JRPA 1VQ9N 3AVHA 3WQUA 3SWNA 1A5XA 2G9WA 3AG1H 4XRFA 4NCAA 3CESA 1PRMC 4BDPA 2FZGB 1W6XA 1AZEA 1LDJA 4HNVA 3M4YA 4FK2A 3PL8A 3CMEA 3KD1E 3SJMA 3KZIC 5BPMA 2FOWA 3ABLH 4J2AA 3K0SA 4DJAA 1OULA 4CEFA 1JT0A 3CBPA 3H3OB 3CXCM 2ZXWH 1S22A 1FMKA 2KJBA 1QU3A 1PUFB 2HHHK 5J3BA 3ZT4A 1NHAA 3SZ2A 2HNIA 5BR9A 1HLVA 4CHUA 2ZPHB 2C0IA 5HS8A 2F2VA 2I7PA 3NE6A 1SKRA 2JS0A 5GAGP 2CUZA 2QYOA 2LNVA 2CT3A 4A5AA 1RRSA 4C3IJ 2E36A 7AT1B 2ROTA 2LKPA 2OTJT 4LFUA 3CJ7A 2DD5A 4FJGA 4OIQF 3A5MC 1O4XA 4RKUE 5FU6B 5JLWA 2CW8A 1YJNI 2GIZA 3CBOA 3S41A 1XCVA 1B59A 3RSNA 1BJZA 3HDDA 1NU0A 4QS8A 2BUPA 1SFOJ 4CESA 1RETA 1LWEA 3H46O 4BJ6C 2DZ9A 4KAZA 1RTIA 4YORA 2LNBA 3WVEB 3KJVA 4K41A 5JS1A 3K1PA 1G8XA 1PP8F 5HLHA 2ZCWA 4L0ZB 3ZN1A 3D6RA 4DQ8A 3NGPA 1A31A 4M7DA 1ZHFA 4WFNL 2CV2A 5C2DA 2IGOA 2PEXA 2DFHA 1Q82U 4OVLA 2DERA 1XWLA 3MXIA 1QLYA 2I2LA 5TGTA 4RTFD 3DXKB 2A3SA 3OHRA 2HKQB 1RRJA 4B8AB 4CEOA 1QVTA 3OYDA 1HSQA 5FLMJ 3OQ5A 5IOYA 3PGGA 4C30A 3U3YA 3R9PA 5FW9A 1S72A 4NS5A 4BR7A 4LF4K 3P5JA 2ESWA 2IIRA 4Y1DA 1T7PA 1JEGA 3GP8A 2FPDA 2RDPA 4BRDA 2V8KA 2JTFA 5EG0B 5LGTA 3S17J 3R1XA 2QKLB 3LWMA 2YHYA 3TCJA 3CCEQ 2L5QA 1B3QA 2CP5A 4WXDA 1I3AA 5K7FA 4CF1A 1S7EA 3G71N 2H6CA 4A3DJ 1K73C 2KROA 1GUUA 2V79A 4QW2A 3FZLA 3IKTA 5DTDA 1XDSA 4X1EA 1ZG3A 4A69C 1XCBA 2XY6A 1WKMA 4B1WB 1N39A 3LCNA 1X43A 3ULDA 1MD0A 2P9SA 1MMNA 2VIXA 1VQPN 1XGSA 1RGIA 2NOEA 1NKUA 4J6YA 2UXXA 4M78G 4M78E 2EILH 2V7YA 2JN6A 3GTOJ 1RDDA 2FLOA 2M9HA 4A0XA 3CPWS 3L2QA 1N34K 3WTSC 4YHHK 4AHRA 2W41A 4ELVA 4HQEA 4DYRA 1Q86C 4C5EA 4H5RA 5GAEJ 2B63J 1WDXA 5EVZA 3V9ZA 4QWQA 5C0MA 3LQQA 1VQKN 3CWTA 1WFXA 2OD5A 2FO0A 5I21A 1WH5A 1NK7A 3LSJA 2K57A 2YU3A 2JPCA 1ZLJA 3OYBA 3ZYYX 1ZREA 3BLYA 2SEMA 1X58A 2LQ8A 1YVUA 3H36A 1GV2A 2QA4A 1P6RA 4B09A 1LFPA 3M6GA 1YE9A 1KG6A 1QKWA 2X9HA 4GMJB 4IRGA 1YYVA 2X6SA 1UHMA 3U21A 3CF5F 2P9NB 3FJ5A 2PJRB 2JNGA 1ZGJA 5EG2A 3C7JA 4HT9A 4FLYA 2D0BA 4UVAA 1YFNA 3EG9A 1LCUA 2JT1A 3F5TA 2STTA 1SRLA 3FIWA 4AIAA 3HUGA 2CGLA 4BRCA 1VHXA 4JI2K 5KCHA 4A4GA 4C3JJ 1Q7YC 2X6YA 2F5KA 3BGRA 3T1YK 4E9HA 4J2BA 2VOOA 3SFZA 1NBWA 3NWTA 5DS9A 4FM1A 2PLYA 2VWKA 1MJAA 1QHHD 2YNGA 3QPHA 4XK4A 3TABA 1GVJA 2KMTA 4AIKA 1KAXA 1Y71A 3MN2A 2BE7D 4G9ZA 1BI3A 2QM1A 2QSHX 3J7YJ 1GV5A 1WSIA 1B92A 4Y52J 2RNGA 1KHCA 1VSKA 3VQ5A 3OYNA 3L1AA 4CECA 5CKBA 2CGJA 2EH3A 5GAN2 4AFSC 1MJ9A 4D7NA 3R60A 2XPVA 3HSEA 1IJWC 2A61A 4L5EA 4AQYK 4F55A 4JKDA 1YG2A 1T2KA 3CCJA 2VODA 4OIOF 3BY6A 4OKJA 1X9MA 4KKOA 3NGIA 3GFIA 4MTEA 2HYGD 2ECZA 3SCXA 2LY9A 2DETA 5ERIA 1GXPA 3CMAA 2RQVA 4C0ZA 2DA7A 4FWOA 2HEOA 2QSFX 3K2ZA 3ZEUB 4C8QE 4KV8A 3WNGA 4OPKA 3WTVC 2N8GA 1ZYQA 3OR1C 4M9XA 2XGXA 3HZJA 1F4KA 2DRMA 2E34A 3QEVA 1TV6A 4KT0E 4CJPA 3CWUA 2R93J 1TUUA 3TAQA 2WA0A 1J5EK 4IIOA 1HOMA 1UEBA 4KTQA 1QVFP 2K3XA 3ZL7C 3VESA 3QERA 4F17A 4I2OA 4NLBA 1MJBA 4BRHA 4JS5A 2DVEA 1O13A 2V9VA 2RO0A 4AM6A 2ASOA 5TRDA 4XTXA 4KIGA 3WU0A 3TI0A 5E3NA 3SB2A 4BUGA 5L3CA 3C6UA 3K59A 4R1HA 1JJ2M 2KNBB 4IOCL 4BXFA 2CW7A 1J0RA 1MGQA 1VQLN 5E8IA 2E1OA 4CI0C 1TKDA 4FYDA 1MSFC 2LDMA 2RK2A 5AZJB 3PLAA 4J9EA 1ZARA 2EIKH 3THYB 1UFMA 1R1UA 3FMQA 3L6QA 4RB3C 1YVNA 2ZJQF 3QJ6A 3HRGA 4M45A 2E19A 2L0AA 2HNYA 2EBPA 4N4IA 2OAZA 2IT0A 4HF0A 2IG0A 4Y7NJ 1YQKA 1NH3A 2IOCA 2LY1A 3RPQA 4RW4A 3T5XA 2KT1A 2VWFA 4YPRA 4NC7A 5LRRA 4ANJA 1GDTA 3QXEB 3MEEA 4DTOA 5AZIA 2KMUA 4HDUA 2PN6A 4M75E 4F2RA 4OB2B 3AGRA 5FWBA 4MGRA 3SDZA 1WOQA 1X6GA 2XDDA 3GFMA 5HNFA 1T56A 4DQPA 4JJBA 3BDPA 2ATQA 5HLGA 3GDQA 2KZZA 5LJ3h 2A3ZA 4MMLA 4B9TA 4Y1CA 3KVGA 2HOAA 2PQ8A 2DTOA 5LL6S 1MUNA 4IUUA 1PUEE 1JCEA 1JLGA 2GXGA 1YWOA 4CF8A 3P4IA 3W6KB 2XDBA 2CZ0B 3OY9A 4RLQA 1DPUA 3OSSC 2O4XB 4M72A 4A57A 3TWHA 3MDQA 1FNNA 3O9UA 3WUHA 3EO3A 1N27A 4OPJA 3AVFA 4E9GA 1P59A 3QFPA 4CJVA 4C5GA 5C15A 2VXDA 5CVJA 3W6JB 3RI4A 3I55Q 4BQZA 4AYBN 3WNFA 4ID5A 2PI0A 3GOIA 4N0AC 5AQXA 3R61A 2QQBA 4B9QA 2EFWA 2XPUA 4H4MA 1VQOQ 1I5LA 4NC8A 2EYWA 2A6AA 2DJIA 4XR6A 4Y28E 4DMNA 3E7LA 1K9AA 3DU6A 4PQUA 2CQQA 1S6PA 4DTXA 3O6BB 3VQ9A 3DXJF 3BWGA 1BCOA 3INZA 4IJAA 3ZQFA 1WZOA 5KRSA 1B72A 2QQSA 1VQ5N 5JHFA 4KITB 2P4TA 4ISGA 4IVNA 1JKPC 4KT5C 2LF8A 1GVDA 4QQGA 2P6TA 4DQQA 3PFYA 2CSQA 3CMEN 4HT8A 1LPQA 4FIBA 2PVDB 4I99C 1N33K 1VQ8N 3CJAA 2COBA 3ZQLA 2R7DA 1N32K 2DQLA 3E1SA 4B9WA 4C8KA 3OSGA 3CLOA 1D1CA 2P5VA 3ZSZA 5CKTA 2MC4A 1W0TA 1KQ1A 2WC2A 4CHQA 4YIFA 4IHVA 5DM7F 3RQ4A 3LP1A 4DR2K 2HB5A 3D4VA 3UF4A 2A36A 4KTZA 2RQQA 1VQKT 1V4SA 4PUSA 3CMMA 4CIGA 3SAGA 1USTA 3A01A 3OSFA 1BQNA 3WNHA 2CGKA 4FZXC 2KBTA 4ZDOA 2JPBA 3K5NA 3QETA 2DOAA 1MDMA 2J05A 3ZR8X 2IA2A 4A6DA 3OBYA 2NNWA 1WXUA 5EGOB 4D0PA 4EM1A 1YITI 1LOJA 3RESA 2ROLA 3LP0A 4JUVA 2LRDA 1H641 1P4AA 3VQBA 2R7OA 1K9MR 4B4CA 1UGVA 4PKIA 1QP2A 2VBZA 3BY5A 4FSXA 4IOAF 2FXAA 1EWRA 5J8FA 4C9YA 1KAZA 2K85A 2HDWA 2DTHA 2HZYA 1XGNA 3P83D 3QP5A 1I1JA 4DTJA 3SD4A 3G6ET 1N75A 1YJ9Q 2XY8A 1R58A 1DDNA 1X2QA 2YU9J 2GQVA 3VGMA 1LAVA 2LT4A 3TL4X 2XAQA 1FP1D 3KP4A 2DT5A 4H03B 3CCEI 3MZHA 1YRNB 2O31A 1B9MA 4E89A 5EEGA 1QP3A 3DBLB 1NTCA 3I59A 4PJLA 1ZR2A 4ISFA 2DMPA 3CUOA 4H0XB 5HK0A 2FYKA 4JKBA 2BY3A 1A36A 4M3UA 2JWKA 2CDTA 4BXUA 4N76A 1AWOA 1RT5A 2CH5A 1RADB 1V55H 3CCLN 3K4KA 4BGBA 5JVTA 4Q48A 2FZCB 2EGAA 3TW6A 2WV1A 4EVIA 2VC1A 1TL8A 5HY6A 2LJ1A 1BN5A 3PQJA 3T0YA 4C8QC 1OPLA 3CCEA 3HOXJ 2RKHA 4R56A 2TCTA 5DLQE 2GBZA 4BHPA 4Z4HA 3HP6A 4C0DC 2E4LA 2JOYA 4M78A 2JMAA 3WTUC 3A0IX 3A8OB 2VVKA 5LHGA 1UOCA 2DDBA 4X0GA 4C2UA 2HI3A 3RDVA 1RESA 3EE9A 4Q47A 3PSFA 1RDCA 4NL3A 4XNFA 3KFWX 3OOPA 2XF5A 3ZMUA 4HUGA 4FYXB 2BTTA 1T33A 5CKEA 1WSUA 4XKBA 2ED1A 1KTQA 4FM2A 2KW4A 3OYYA 4G9YA 4MQ9F 1GCQA 1QVFM 3FKJA 3ALYA 3H8ZA 1VQPA 2JWLA 5GAN3 2OAWA 4JI8K 4DS5A 1D09B 4HF2A 2JPSA 4RTUA 4YOYA 4MQVA 2MD0A 3RSEB 2CH4W 3QBWA 1RIOH 3DLLL 2G8FA 3AG3H 4W1UA 3MP1A 3HL2A 3SUNA 1U84A 4CBUA 4JLIA 4AHSA 3GIBA 3M0UA 4CJEA 3AG4H 2HQNA 3IH3A 3RTVA 3K69A 3ZQHA 4JKEA 3M1FA 1ZC6A 1W0HA 1MH4A 3EYYA 2IW5A 1EKEA 3WHCA 3F72A 1SHGA 1QHTA 4CJ7A 1E3PA 3EUHC 2UZKA 1WJSA 2X6NA 5KE2A 3ZSVA 2K5IA 2DPNA 1ZKGA 2HU9A 5LJWA 1O3RA 2JA2A 4H5VA 1KC8U 3VS5A 2YHBA 5GIPA 5AZIB 1WQ2A 1VQ4A 2VONA 2P51A 5C4XJ 4BWJA 4M75A 2YUQA 3G1OA 2O5RA 3M1EA 4BR0A 1KU3A 1K8KB 4GRIA 3UA6A 4AIJA 5FFZA 4FJ5A 2EK5A 5ILVA 4CIEA 5B1AH 2YHWA 4BR2A 2PX9A 2UYTA 2EQMA 2HR3A 2AS5F 2X1CA 4M7AE 2FRHA 4B48A 1YP5A 4M3GA 3V4IA 1IN5A 5FU7B 1VF9A 1DUXC 5LJ5e 3IUCA 2GM4A 3CCST 3TQNA 2CP3A 5ICEA 2RHYA 3PNWC 1XS9A 1V5GA 2XKOC 3I56Q 2O8EB 2ZQBA 2VLAA 1H88C 2BHZA 3RKQA 5B8HA 5KYWA 1RTHA 3MQ0A 2O8XA 3QBXA 2HNDA 3OL4A 3I33A 4FJMA 3EUHA 1Q9XA 3QEXA 4CEDA 4OLAA 4HTLA 2A69F 2KZGA 2NOIA 3BZ6A 4D8DA 3LPUA 3O9SA 4FHTA 3ITHA 3CCQN 4XLPF 4NYFA 3CCUI 3S3NA 4RS8A 1QVGS 1R00A 3ZSOA 2EYXA 4PGHA 3QUIA 4UXNA 3F2KA 3KLGA 1UMQA 2XHKA 5DM7R 1PCXA 5M1QA 2F48A 5ICCA 3GWZA 3JCMW 4PWDA 5AQZA 4HNUA 2JM8A 4PJOB 1OQYA 5IHIA 2HOTA 3LFKA 1S72T 5I9EB 3K9TA 4ZDPA 3VQEA 3MWMA 3LDLA 2P9LA 1ZELA 3AO3A 3TOBA 3TTCA 2KT0A 1NJXA 5CZ2A 4LD5A 1N9RA 3OS2A 2BANA 2ELJA 5IYBJ 5DEQA 2DEQA 2KDZA 2R7VA 2LH9A 4B9LA 1VQ6N 2GQQA 3MEAA 3GUDA 3EN9A 3PO3J 2MFZA 5AQTA 1ETOA 2W82A 2LTPA 3E2UA 1WB9A 4U0VA 3WEEA 2VKEA 2HSPA 4ILJA 5JMVA 3HSRA 4E19A 3VYSB 3AO4A 3K9JA 4DFPA 1UGRB 4FCYA 2L3SA 2MI6A 2EKOA 3QO3A 1N8RU 1YITT 1RBRA 1D5AA 1H0MA 3QYHB 4XICA 3OB9A 1CKAA 4EVVA 2R58A 4N9IA 1KO9A 4BHCA 4JZ4A 2RN2A 3V81A 1RNHA 3EYIA 5GAMf 3I56T 3JCMX 4OU0A 5C4JJ 3RNJA 2OPQA 4JJNK 4BC4A 4UV8A 3RR7A 3I4MJ 1S9EA 4QTRA 1G3WA 1ZUKA 3MK6A 4M3RA 1OX8A 1NK5A 2YT6A 2MH9A 3Q0UA 4E7SA 2EJ9A 2EPDA 3A5OC 3Q0VA 4CGFA 1EQYA 4ME7A 3EUAA 1T3SA 3CCVA 2W10A 3NHNA 3S2DJ 5M1FA 3BOQA 1E6GA 3VFZA 2RN8A 3WGGA 3PT9A 4NHJA 3SUQA 4FETA 4FWQA 3ZP5A 2FXUA 1BUPA 2OPTA 4KBOA 1VQMN 2CP6A 3K7AJ 1K76A 2EX3A 5ED4A 1U0JA 3SQNA 2M4KA 2F5CA 3THKA 4RMNA 4CYCA 2DA6A 2ISZA 1U78A 2HGCA 2K9SA 2NUBA 1JJ6C 4B22A 2O8CB 2J6KA 2V4JC 3QESA 1IV8A 2XC7A 1Q1VA 2KQRA 2HPIA 4HVVA 1T3LA 4QQ6A 3V7RA 1BR1A 3J80K 2K3FA 1IG7A 1K73O 3L4QA 2GWRA 1LNWA 3CWAA 5EGOA 1TVRA 2CRGA 2XRIA 2IS4A 3UA7A 2M02A 1CKBA 3FK7A 3A01B 2QK0A 2L3QA 1C6VA 1I94K 5GAN8 3DKMA 4DR7K 3GTJJ 4JK1X 4EATA 4M42A 2CJJA 4A3FJ 3GMEA 1XN7A 4F16A 1OPCA 2R7XA 1HRHA 2JSCA 5CE3A 1WIEA 2DILA 2Y0SA 2Z0WA 3CCLT 5GAOr 2PMZN 1NBEB 4N4GA 2QEXT 5ILSA 1S7OA 1S1VA 3C0BA 1X3WB 3MFKA 2WV0A 2FSKA 4F8RA 2QWWA 3EQLF 3PFIA 2XASA 3C94A 3K1MA 4HKEA 2WONA 3JRDA 4GFBA 2XY5A 4IFVA 3VGKA 1REPC 2K5LA 2FBVA 4CZJA 3CVSA 1JCGA 3DLRA 4FWRA 4G7ZF 1VQNI 5D8LB 4WQ5A 2ME0A 4NLCA 2A5XA 4E7HA 3HPOA 2LTOA 4AI5A 4N4HA 1YX3A 3QLHA 1BBZA 3GL1A 3OYHA 3I55A 4RTZA 1D8YA 3TO9A 1K8KA 3QRFF 1WEIA 2QUFA 2VQGA 4M75B 3ID8A 1TKZA 3WU2C 1W36C 3SMPA 2JQ7A 3D5RC 5IXFA 5L3DA 1HSJA 4EM0B 2P0WA 4CCJA 3X28B 1QSLA 3K5LA 2V6EA 2DCEA 3BDDA 2CMPA 1CZAN 1S29A 4OFEA 1LWYA 3A8YA 4X65K 2HVSA 4K8XA 1VQNA 3M0PA 2D45A 2E1MB 3IS9A 2OU2A 1XC9A 2Q2EB 2X1DA 5D5UB 1LW2A 1Y8QB 2CG4A 3CC2A 4LG0B 5A0DA 2O4XA 5AFUA 1DP3A 2VQHA 3LL3A 4RLFA 2LK2A 3OMCA 4P1WA 4ITVA 2PU9B 2F5EA 1C0FA 1XJWB 2DPPB 2Z1IA 4YOWA 4CYDA 3BW1A 3F23A 4EW4A 3OS1A 1MBKA 1YJWT 2DOFA 4DCHA 2B9SA 2GXBA 2RC4A 3OMGA 1N9SA 4XH4A 1A0NB 2Y1IA 3I8BA 3ISPA 3WTWC 3DI6A 3KLEA 2FD5A 2P8TA 3F9MA 3CCET 2KI7A 4CIFA 2HHWA 3MX2A 2UV1A 3UNGC 5AQHA 3GTPJ 2P5LC 1M2VB 2HXIA 1ARKA 5E17F 1Y39A 5KYNA 3AAPA 1FOXA 5AQFA 2YG9A 4E1NA 4ETSA 4HYEA 4LG0A 5F1XA 5DK5A 4M3TA 3TAFA 3M54A 5HS7A 4LB6B 1OISA 1HDPA 4ILGB 4EHTA 2NOZA 2X74A 3CCQQ 3CC4T 2XO7A 3GXOA 1KQ0A 3H1VX 3NH1A 4J5YA 4EM2A 3WG7H 4CUGA 3ABKH 1YF5L 5EC7A 3CLQA 3OGDA 1D0ZA 2E70A 4D1QA 1X4OA 2E65A 1WLJA 4F7UB 2HBMA 2D1VA 2Z16A 4IPAA 1X9JA 1CZBA 4XM3A 4FOEA 5D6YA 2FZKB 1DQUA 1ZR4A 1MNMC 4BXXJ 4KULA 2GGRA 2X1EA 2GEMA 2CZ1B 2BGCA 3JTHA 2A41A 3VETA 3U9GA 3BPVA 1WXTA 3D0PA 2OFKA 5E79C 1D0YA 3QWXX 4FW1A 3LP2A 3LAMA 1DGRM 1NLVA 2AXTC 4BY9C 3ZQQA 4X64K 3SZTA 2BUDA 3G6EA 1PNJA 4DZPA 3DYAA 1WRJA 1W1FA 3VQDA 3I9QA 1H1VA 1Z9ZA 3CJRB 2BGGA 1K9MU 4NUBA 3RYRA 1AKHB 3DKXA 1BB9A 2E2JJ 4KH1B 5KYXA 1OCOH 3FHNA 2EGEA 1Q18A 2KRFA 4AF1A 1WHUA 5D6EA 2ZXHA 5D6FA 4XLCA 1YFHA 4DR5K 8ATCB 2HOSA 4XAXB 1EX4A 4CK1A 2LY2A 2HDDA 2NOBA 4S0HB 1YQLA 1YJ9N 2OPPA 1KC8R 2RA2A 1XUPO 2LYCA 3M5RA 1LEAA 3O4NA 2K9LA 4CCLA 5J4VA 4F14A 2CH0A 3SPYA 3ZCMA 1WJRA 1VOMA 4KHUA 4DFKA 1WGSA 3IWZA 2JUGA 4RWTA 3OTOK 3DJCA 4GKKK 5E1ZB 2ABKA 1EO1A 2PG4A 1QE1A 1WJCA 4IFEA 3JCMf 5KYUA 1M30A 4QPQA 2QGGA 1Y6IA 2ZJRL 1X01A 4G8XA 1PSEA 1TL3A 4M7AC 2IAIA 3UIQA 2TRTA 1CXQA 4FWMA 4LDYA 1M2OA 3CCVI 4E6RA 5CYMA 5E3OA 1JUPA 1YHQI 1MPGA 4ZGEB 1HYVA 5JHUA 2K4YA 3LW5E 1HQCA 1U3OA 4CRIA 4OPHA 1YHQT 1XMKA 3CJQB 3A8GB 5AQRA 4OMPA 2HQHA 4F04B 5J2PA 1KQSM 4ZN1A 1M90C 4GVEA 3ZFJA 2GCXA 4AC0A 2DTZA 4KI4A 1XB4A 2CQNA 1XNIA 5LFAA 4JKGA 4JK8A 3QHSA 2ZFUA 2E2NA 3QIOA 4M9SA 3RTRA 4DF4A 4IEEA 1S3JA 5A2QE 1LJ9A 1WN7A 4XMYA 4BGDA 2KDOA 2OTLN 2K02A 2K4BA 4M4ZA 5J6XA 3ULEB 4CZFA 4FSVA 1YHQA 2JTVA 2D8JA 1S6LA 4FX4A 2W1OA 2OTLT 4IDHA 3HJFA 3WG9A 1TK8A 1R59O 3HEFA 1TGOA 3TSPA 2GX9A 4PGGA 2VB6A 3ASNH 4R55A 1V4RA 4DOZA 5IYDJ 1RUNA 1W4MA 3W2WA 1IKYA 3F6OA 3H5AA 2BY0A 1ETYA 2EQKA 4CJRA 2MLKA 1ONVA 4EA5A 1R6RA 3I5SA 2IC3A 4BJ5C 1R0AA 1IH7A 4OO1J 1UHWA 2Y30A 3VV0A 1ETVA 1YW8A 1NG6A 4RB2C 5GANh 4RCHA 1VSJA 2KQ2A 4IWVA 3MCZA 1VQ4Q 3MCAB 4M74A 4BEHB 2R5ZB 3JRAA 2L8DA 2JZYA 2MPXC 2QQRA 2P9SB 5J1YA 4Z0UA 1ETQA 1JGGA 1KG7A 4BHBA 1J54A 1EA3A 3O5BA 2FHDA 3UKRA 2ZJQL 2JRTA 5E8GA 3M8RA 1YITQ 3I55I 1WHHA 2JVVA 4RBOA 4LFCK 3L00A 4OMZA 2HPMA 2ABLA 4GY2B 1PC0A 1MMSA 2BY1A 2EKHA 4LXCA 5GANe 1N6AA 4WXCA 2M2EA 1GHCA 3SYZA 1G99A 4D9JA 1YQRA 4KHQA 2KZMA 4B21A 3HRUA 3LSMA 3TKYA 1VQ5T 2XKPA 1VFCA 2L89A 5BPNA 4EJZA 2ELHA 2LP5A 2O8EA 3PIOF 2E5ZA 4JZ3A 4Z94A 3I58A 4IJNA 2V1RA 3LSGA 3RMSA 2VKVA 2E10A 3AVNA 2NUTB 2FQ4A 4DYCA 4X1VA 2PBDA 2W0ZA 3FE1A 3REAB 2X0LA 2L3DA 4CEEA 5LJ3d 2ZXIA 3DLBA 3K2AA 1NG7A 4BRQA 2HBWA 3FWEA 2JUFA 3M8SA 4ZYGA 2OZSA 1VSMA 4GXOA 4JLGA 1GOBA 4JKHA 3VPZA 3CMAT 2BE5F 2JLEA 4C0FA 2FQ3A 1Y7XA 4LLNA 9ATCB 2KVQG 2FNPA 5LJ5d 1REVA 1NLPC 2HZDA 2Q0OA 2W4SA 1YO5C 2DM1A 3C3WA 4LDVA 2MLGA 1ERDA 4CXFA 2E41A 2KGTA 1LVKA 5KTQA 3GEZA 4L8RB 2DPDA 1QS4A 3RWUA 3ZEUA 4B1XB 3H9GA 1KQ2A 1UAAA 3L0QA 5GAOq 3IH2A 4DKWA 1NJIO 2IPOB 2G7HA 2PMHA 1YCYA 4XSXF 2OA8A 1ZUUA 1X9SA 2OI3A 2NUPA 1SSHA 4M63C 2EHGA 2M8GX 2NZTA 1OV3A 2JVHA 3TGNA 5KCOA 2ZPIB 2FVUA 3S8PA 5L23A 4MZTA 1P90A 2FBKA 4IO9F 4IXCA 1S9HA 4BBRJ 1E6HA 3EG1A 2NOHA 5KPRA 3TTFA 1DEJA 3PO2J 2V1UA 2JHNA 3R6SA 3G73A 3MCPA 4OMQA 3KNTA 5IT9O 2I8DA 2X3XD 1Q82R 3HPWA 3L3UA 4HCZA 2KE9A 2RK1A 2DA1A 1VQNT 4LJZF 2LQKA 2HBLA 3WXLA 2OZ6A 3VUBA 2CQKA 2R5AA 4F2SA 1NJIU 1IN4A 1LVAA 2AP1A 3D7SB 3PX6A 3ZMTA 3KE2A 2FBHA 4W5QA 1WYXA 3H9NA 2RHIA 1NKCA 5EZGA 3UPUA 4PFOA 3MO8A 4BI8B 5C12A 4OJRA 2L7ZA 4AVPA 3M59A 4OVAA 3FHZA 4JI7K 1WHKA 3SEZA 3QU3A 4B8XA 4XEIA 2R7QA 3VGLA 4LF9K 4IQJA 1S1NA 4PSWA 2XY7A 5LJ3g 4HOBA 3KEYA 5ILUA 5HOOA 1H8KA 4NXNK 1W5TA 2X4YA 2WSEE 4CFAA 1GLBG 1CLQA 1VQ9Q 4HUEA 2OTLA 4C8LA 4FLVA 4MO4A 2L3PA 2HAXA 1PKTA 4Z4GA 3PMTA 4F92B 3I59B 3E9GA 2RJCA 1TSFA 2ZC2A 1NK9A 2E6ZA 2DK8A 2B6AA 4BY6B 2F2WA 3BTCA 1MUYA 1RI9A 2OFIA 1FXXA 3FR0A 1T98A 3D2FA 1KQJA 5D4RA 1NGBA 5GINA 4B1RA 1W2BS 3E9FA 1WUAA 2RHKA 4CGDA 3KBGA 4B3RK 1Q81O 2DODA 3CC7Q 2DYRH 2M30A 2M16A 2GTJA 4FX0A 1BM9A 2BTFA 2HMIA 1QGPA 4OMMA 3WVDB 3P38A 1I4K1 5AQLA 5E20A 3ID6A 1U1SA 1QWFA 1BOTO 2LMJA 4LF5K 4ZZLA 2VG7A 1KVAA 4EP4A 1SEMA 4O4GA 2MYSA 1X6OA 2AQEA 2HOEA 4AG1C 5F1RA 1IV0A 1WFWA 1BI4B 1PSFA 2ZF5O 4WCIA 1HKBA 2RJEA 2W6LA 3SHWA 1OCTC 5GJWB 3I4NJ 3CCJI 4L18B 4X66K 3M56A 4KGXB 1MWKA 1K73U 1KQ8A 3M53A 4BR9A 1GLLO 1SFKA 1VSFA 4CZKA 4NQWB 2ZNZA 4B3MK 4YNQA 1TAUA 4XLEA 1KD1R 3CQXA 3GFLA 2PUKB 3KZBA 2A3LA 4BRGA 1KG4A 2E1HA 1M3QA 3G6EQ 4A6EA 2RQTA 4F7UA 3RKWA 4OMOA 3DKYA 2ZPFB 1YIJI 3CCSN 4AHTA 1Y1WJ 1BDGA 3PNTA 3BF3A 1JL1A 1MA9B 5ADXA 2QI2A 4B3TK 3QNOA 2JA5J 1RFQA 1QQIA 1W70A 3QWLA 3U23A 2RF2A 1GRIA 2XGCA 4AIDA 4B9NA 4H0YB 3K57A 2K5FA 3UWNA 3WEEB 3JAMZ 1IBMK 4A4FA 3H0FA 3HSBA 3L1PA 3NVMA 3EL2A 2YX7A 2YUNA 4JKAA 3B02A 4U7BA 3CVTA 1YI2T 4PHTX 3AAFA 2HF3A 3NTKA 4V2FA 2LBFA 3BJAA 3EG0A 2FEIA 4BGAA 4DBFA 4ZYAA 2MWOA 4KYWA 3F8MA 3F6VA 3U1KA 2JUCA 4CE9A 4XU3A 2Y69H 3DEEA 1T0JA 4JI6K 4M6VA 2R7ZJ 4H5WA 4ABZA 2R7WA 2Z1DA 2O61A 1EP4A 4FM0A 1TYQA 2BXYA 2LSOA 4JI0K 1AHDP 2UXDK 3JAMK 1YJNN 1VQ6I 4KH0B 4HSRA 3W3DA 2YXYA 1J5OA 3TBIA 3IG1A 4OP0A 4O5VA 3FFIA 2EJGA 1VQ6T 4OINF 4L0YB 4FWSA 3A8MB 2ZKZA 2JT4A 4FLZA 5CK9A 3CMET 3MEDA 2VBYA 1HF0A 2R7YA 2F8TA 4YOQA 2ID3A 1ZBXA 3CD6I 2QA4Q 2Q97A 2EV0A 2ZB9A 1ITYA 3BG6A 4I9LA 2QWLA 1GLCG 3SUOA 1VQ9T 2Z2SB 1MNDA 1SD7A 5CPRB 2DNUA 2M87A 1P4XA 1XSDA 1C1AA 3AVCA 1VQ6A 4RB1A 3VQPA 4MFDA 4FZYA 5HL7L 1J6ZA 3IH4A 2CP2A 1IKWA 3BR2A 3AL0C 4IX7A 2O3FA 1HA8A 3G4ST 4IDKA 3AO2A 4Y3OA 1RT1A 1B8IB 5AQJA 2EYZA 1NPPA 2GNCA 3WXMB 4FASD 5K14A 3R6NA 2MA3A 4CJUA 1HYOA 2A7YA 3TAEA 2DL7A 1IN7A 3IMXA 1TXQA 4HG2A 3ZRGA 1TT5B 1KFDA 3DM2A 1OH6A 3CC4Q 2L4AA 4NCBA 3VQCA 1BOAA 3HKZN 1N3CA 1ZBJA 5C2FA 1SAXA 4C8NA 3ASKA 1WPYA 2LKSA 1ZSGA 2YNHA 1EFNA 1HNXK 1IXRC 1FSEA 4EJWA 2YUOA 2EFOA 4BVOA 1IJJA 3I0WA 4GDFA 2C0OA 1MKMA 4HVJA 4ENNA 2L9SA 2P4WA 3QWYA 5B1BH 5H2FC 2Z99A 2VXEA 3TP0A 2BYVE 2L7FP 1ZG1A 2ZJPL 2L0KA 1QHGA 4DG1A 3T19A 2DXCA 4M41A 3WNEA 3HJEA 2OJED 1W2BA 3HTUA 1Q86R 2DTRA 1JGSA 4KA4A 3P9CA 3AV9A 4MDAA 1T6DA 4LD0A 5GAMd 1EV7A 1BW5A 1JXMA 4PJMA 2I7NA 1SUQA 3ML6A 2YS9A 2D5RA 2RVCA 4FWLA 3AVGA 5FLXE 4RM2A 1WI3A 4HZFA 1EBMA 4DFJA 4A3MJ 2VI6A 1S72Q 4MHGA 2BHYA 1APLC 3BTLA 2FB7A 3V8LA 3DLLA 2KFZA 2YPRA 2CU7A 3RPUA 3ZETA 3L09A 2LKXA 1UTIA 5BREA 1Y57A 2Q3SA 1NKBA 1RLQC 3DLLF 4JOMA 3M8JA 4MEXF 2K7AA 3NF7A 3DTIA 2IS6A 4DR3K 4W5RA 1SVMA 2MWPA 2OTJQ 5LMUK 2XF6A 2YWWA 3UB5A 5IPAA 3HOTA 1XI1A 4CZGA 1D4XA 4FOIA 3CIPA 1BCMA 1U49A 5AQGA 2NYSA 1LCKA 3VUZA 1ZUYA 2E2PA 3ATVA 3QEIA 2EWNA 3WXIA 2EFQA 3L7WA 2XKOA 2AK5A 3ABTA 3KK2A 1ACMB 1PHTA 4EPCA 2CT4A 3S93A 4I7FA 3J7AO 4RDUA 3AA3A 3NBPA 4HPQA 5FKMA 3BE3A 3G1LA 5BPDA 3REOA 3Q9SA 4UUSA 1RDWX 1ZG5A 1QZ5A 4CCKA 1KQSP 3H0DA 4ZC3A 3AA5X 2FA5A 3VWBA 2XB0X 3SI6A 2QTVA 2Y31A 5CVRA 2GUIA 1SVLA 3BR3A 3VEYA 4XK8E 4M9ZA 2FRYA 1NGFA 1VQLT 3RPUD 3JW4A 3X26B 1K4SA 1SHFA 1IXCA 4HCKA 4QPOA 4CF9A 5DY9A 3TO7A 3H1CA 4BAYA 4Y91A 2L7KA 1YQAA 2A5YB 2E2HJ 2QXLA 3ZT0A 3RRHA 4EJTA 4LN2A 3LSKA 1YTYA 1X2NA 1RAIB 3CCQA 2VG5A 3E66A 5GAOp 5LL6Z 3H3ZA 2VYPA 3FZVA 4PKCC 2QBYA 5A2QK 2NNNA 3CCEN 3VODA 5I2SA 5EYRA 2VQEK 3BPXA 2RB6A 1TP4A 1YNZA 3P8BB 1XMOK 4E6KG 3G71Q 1I3QJ 4FU6A 2O8DA 2FSWA 4OMLA 3L8BA 2QSGX 4CHYA 4PJOC 3P9IA 3A8LB 4JP0A 3M55A 3ZX0A 1P7MA 4FVMA 2R3SA 1HNVA 5MLCQ 2K4JA 3QYBA 1ITGA 3H9QA 3BROA 2ZJRF 2LCCA 3E97A 3M4GA 2F2XA 2KP6A 3CMAI 1YBYA 1KRPA 1MNEA 2VWJA 4MDXA 3SFMA 5AQYA 5IWAK 2P84A 1L3SA 4MMKA 3SBTA 1IRZA 3S14J 1I07A 1AWCA 3MP6A 2OCEA 2WAQA 1RT3A 2B4JA 1WJ5A 4U67L 5LHHA 1HJOA 3WU1B 4EIAA 1YIOA 1YX5A 2EGCA 1JU5C 1VSIA 5HDGA 4KT6A 4QSHA 2EZHA 1VQMA 2FUG2 2WTUA 3LL7A 2WBNA 4CJTA 4CFDA 1YXQA 4XLAA 2K2VA 1DTQA 1SF9A 1ORPA 2Q0RA 2HVHA 1OR7C 1MDUB 3OS5A 1X1AA 5HROA 3ECHA 1N6QA 3H45C 2NOLA 4UNFA 4QKUA 1HW5A 2XROA 3S15J 1KU2A 2PVOB 1TNTA 4OB0B 3RDIA 3RMQA 5JVHL 3AKZA 4DBQA 2DTIA 4FJLA 2A40A 1C0MA 4L6V5 4U7DA 2NRXA 1WHJA 1OZ2A 3JR9A 1ENHA 1OMIA 5GANd 1RBUA 2W04A 3L42A 3K58A 4KICA 3T1BA 4B1VA 4PJNA 2P6SA 2O8KA 1NPRA 1NM7A 4IOAL 1QPIA 1QVGA 3CD6A 2E71A 3RQIA 3ER0A 2DOEA 2HMAA 2ZM6K 2HF4A 2M1HA 3VQ8A 3NF8A 5DM6L 1F1ZA 1RL2A 5J26A 2AHQA 3FC3A 4Z4CA 2E7XA 4RTXA 2D5VA 1WJEA 2K9MA 2G7UA 3OYCA 1Z9CA 2BIVA 3K70C 3PM1A 4LD9K 1SANA 1B4AA 3LAPA 1ZBHA 1J59A 1LWVA 4E70A 1U4BA 3VDXA 3LWLA 1VQKI 3VEPA 4LK0F 2HW3A 4MQ3A 2X51A 5J3LA 3WTXC 4J9DA 3K6GA 4CJQA 3WXJA 4PY5A 1TWGJ 3C7NA 3J7AF 5LJ3j 4KB0A 2RV8A 2DA2A 5HLFA 2A28A 2COYA 4XTVA 5GADJ 4II1A 2XDPA 2CW0F 2Q8KA 4JRIA 3JRGA 1VTNC 1NKEA 4M7AG 3WGIA 4WYBA 3A0HC 1M90O 3DXMA 2X3WD 2BVLA 1IC8A 1ON2A 4GYGA 4CGJA 4X62K 3MKZA 3A98A 2JVGA 5M1NA 1Q82C 5GMKi 4B6MA 3UKUA 2V6CA 1G6NA 2HSEB 3LDNA 1KD1O 4DTNA 4EZ9A 4C23A 4M75F 3CCSA 3B6CA 3HG9A 2DX1A 2W48A 5JVGF 4IG3A 2B0LA 4JS4A 5TISC 5HRNA 4NC6A 4CGHA 3R8EA 3MX5A 4UVCA 1Z91A 2F4VK 3NFCA 1ORNA 3MXJA 1J9AA 1F9NA 3CPWP 5E84A 3HYFA 2ZMEB 2DD4A 4XTYA 2RGVA 1FJGK 3GOXA 4JEPA 2DYSH 3SAHA 4KRTA 1XMXA 4R0KA 3C18A 3LSTA 5FLXO 1JKOC 4UC4A 5KGXA 4CCMA 2DJNA 3GF5A 4GV9A 4DSLA 3N5NX 4UOBA 1G83A 1WA7A 2KYMA 3JYTA 1ATSA 1WSGA 4B9SA 1KIKA 4F91B 2KDSA 2R5YA 4CH7A 5EZHA 3OOUA 4C92D 3G10A 4W5NA 4N0AA 3VF4A 3O9QA 4ELYC 1YJNQ 3CQ8A 2CV1A 3N97A 2E3IA 4DYQA 1FW6A 2QM3A 5EXWA 3SK3A 2O8BA 2O2OA 4I6ZA 1VQOI 5EDNA 3BC8A 5H20A 2EZKA 2DMNA 2K27A 5SWMA 1VSHA 1HNIA 2EPFA 3O3GA 1OYWA 4A3EJ 1J75A 2VASA 4HX7A 4JYKA 2JK3A 2O4IA 5DPKA 4I2QA 1B7TA 5FU6C 4GCVA 4O55A 4B3OA 3LH5A 3HRSA 3CQTA 1P2FA 5JLXA 4M7AB 2FU4A 1NJIC 4LDWA 4DU4A 4JX5A 2OUMA 1IN8A 1LOTB 2F4OB 3JCMQ 1PDNC 3U9ZA 3CUQC 1BW6A 4BR4A 2EA2A 3LH0A 4JYAK 2ED0A 3QYGB 1IRFA 4R8HA 3NGZA 1HLUA 3O08A 1R5HA 4BEHA 1P7IA 1TU0B 3CC2Q 4HLYA 2IXSA 1SAZA 5KCMA 2X4XA 3I5UA 5BPLA 1M1FA 2DMQA 1NWKA 4OKKA 2DFEA 3QIPA 3J80E 1QSYA 1TOVA 3V1QA 2WAFA 1V5EA 4JRKA 4RA2A 1O3SA 1CZ9A 3KP5A 1U8BA 3HKZA 4V2GA 2CH4A 2ZMEA 1NGCA 1A5WA 4LGWA 1VNDA 5GJVB 3ZQIA 3X20B 1QQOA 3GCMA 2L02A 1AZGB 1HSTA 3DRRA 2UUAK 3ZMSA 1AA7A 1QO0D 5GMKm 2A37A 4A93J 5K1YA 1O57A 1KEAA 4HCBA 5H6RA 3ZOBA 3KTQA 1VQ8A 2RHXA 4QVZA 4J9CA 3VF6A 4WFAL 2A1RA 3SPZA 2OPRA 1LV5A 4E1MA 1YOVB 4CHNA 2J5OA 3FXUA 3U9DA 2VXFA 2VJ5A 4OB1B 3HXLA 1ZRDA 4MLHA 3IHOA 4IXAA 2CUDA 1AU7A 2OZMA 3VQQA 4CZLA 2BOLA 3KPHA 4B9VA 2IJLA 3ASOH 4LB5A 3IKVA 3NAUA 2NS0A 5A0LA 5KI6A 1B34A 1P9QC 2X6WA 4LF6K 2IPQX 3HT3A 3REBB 1GLAG 2RNJA 2QENA 3JTGA 4HXJA 2K40A 4IUTA 2MABA 3BZCA 3HOUJ 4OF1A 3PX0A 1ZSZC 3C4SA 2ECCA 2QA4N 1F1BB 5GTHC 4IRIA 4DIQA 2VWBA 4GW6A 3I8DA 2ZWHA 4YRVA 1MZBA 4MFBA 2FC0A 5CKFA 4WXHA 5BQTA 2E4HA 2JTEA 1Z9QA 4KJZA 1Y97A 1KJWA 2DMOA 1SMYF 3S1RJ 4PKHA 5FB2A 2O8FB 5KH6A 4DOWA 1FTTA 1U2VB 2NYXA 5IT9E 1RPWA 3CDHA 3HTVA 3N05A 2YNIA 4UUTA 2LP0A 3CC2N 4RTVA 4XSZF 4ZJZA 1VQMI 5LJ5g 1VQPI 3KXTA 4H5NA 1M1KU 3DLEA 1BI2A 4BWMA 2X9DA 4S05A 1UGSB 1BGXT 1T95A 3RRGA 4FK0A 4QLCU 2EQIA 3IDHA 2FX0A 1X75C 3QDKA 1FIPA 3META 3IC7A 4F7ZA 2O8BB 2K9GA 2YV0X 3EKUA 3F8CA 2DKGA 4QS7A 4BE0A 3KYCB 4M78F 4LY7A 1W2BP 2BBYA 3ZSXA 2G6FX 2GXAA 5M1KA 2D8HA 1YJ9T 3HHTB 1GXIE 2KY9A 3J7YP 2NOJB 4JPBW 3LM9A 4EHUA 4DK9A 3BQYA 1BHLA 2RI3A 1X3MA 1BIAA 2B7EA 5BMZA 3DB4A 4M6YA 3A1PA 1J3TA 3SDGA 4FT8A 3J80Z 1VUBA 1T08B 3GF2A 1TAQA 3LX7A 3GYHX 4B23A 3V1RA 3QEWA 4FJ7A 5LHIA 3CQYA 3BY7A 1YWPA 4LF7K 5EX5A 3VEZA 3O8VA 3MP8A 1A5JA 1B8IA 3D5LA 2ZFWA 2E6MA 4LSNA 3K70D 3GPLA 2EVRA 1H8AC 3VS3A 1KU7A 3CO6C 4PNOA 2P9PB 4DS4A 3GVAA 2DZCA 3I0SA 1FJLA 1OKRA 1NGEA 1QCNA 1I0CA 4B3AA 3UR3C 3OW2S 2PZSA 1MW7A 3I3LA 3O9TA 3I0RA 1D3YA 3QEPA 3FISA 4EGZA 1RTDA 4C8QD 1RI7A 2YHXA 3BR6A 2HNZA 5AQQA 4A0ZA 4A3BJ 3FHGA 2R7SA 1U9NA 3EGUA 1KD1U 4F3QA 4DTSA 4V19K 5CO7A 4JK9A 2BEOA 4QCLA 3BG9A 1WQWA 1M2VA 2CS7A 3IRRA 2X48A 3UKRB 3M9QA 1ZTRA 3CCJQ 1VQ7T 1TS9A 2L3RA 1JLQA 1OPKA 4BUPA 5AIQA 3JCMV 1S7AA 5H6QA 2OX7A 1L3LA 1VK0A 5HS9A 3KZZA 5GMKh 4DFMA 1VQ7N 1C1CA 5E3MA 2R5ZA 5J40A 2LJ3A 2P9UA 3QBYA 3MVPA 2Z9OA 2VCPA 2DJZA 3HO1A 5JS2A 1O9SA 1KD1C 3THVA 4RTYA 5LJ3f 4PKGA 2F8SA 1O3TA 4KTWA 1ZGAA 2L9VA 5J1UA 1YS6A 1KK7A 5FWCA 1M8VA 5EOYA 2C6YA 1SFUA 1FYKA 1UJYA 3EG9B 1WJDA 3R6OA 1A6IA 2IVWA 2I0NA 4J9IA 3QU6A 2CP0A 4FSSA 3P9KA 4DZJA 1Z26A 4MLOA 4NXMK 2Q2RA 2YHTA 4BG9A 1Y56A 5CAIA 1OH8A 5JR3A 4FJ9A 2DF6A 3OS0A 1VA7A 2KR3A 3RUXA 5T7BA 4ESJA 3TQ7P 5HKCA 3VOEA 3MEXA 5GAMj 4CA0A 3GZ5A 3QQAA 5ECAA 1E3MA 1XMAA 2EFNA 3FXOA 4NYNA 1QBJA 2CGPA 2D9TA 1S72N 3T3FA 1VQOA 3ULEA 1SD4A 3H6ZA 4L3QA 4A5NA 1HU0A 2UUCK 1W2BM 4FJIA 3QDRB 4CC2A 2LD5A 2NS7A 1IKVA 4O0IA 4LDXA 1EH6A 2GV9A 2RPNA 1KONA 2H8WA 4CO8A 3G71T 2EFIA 1ODDA 4QS9A 3JREA 4IURA 3MKYB 1N8RC 2VQCA 1KAYA 2UUBK 3TEEA 5LRSA 3CD6N 3NAEA 3X25B 4TVRA 4IRHA 1S1UA 1WHMA 4LNPA 4M3DA 1YJWA 3LA2A 1W0UA 2EQUA 4AYBA 1NJYA 4LF8K 3ZCOA 2CFXA 4J7IA 1F36A 4JI4K 1SFXA 3UATA 2C0TA 1KG5A 4C92B 3OJSA 1RAEB 5AQOA 3J80O 4HSTA 3GZNB 5KYYB 4KHPK 1EH8A 2KIMA 4R79A 1TL1A 5CIUA 3R0AA 2VKNA 2LQWA 3MZ8A 3RR8A 5IN1A 4FPBA 4FQGA 5DYMA 2O88A 4FJXA 3E9LA 1M27C 3O3KA 4KGVB 2MC3A 3LALA 3MN9A 1LWWA 2DIGA 3BR0A 5KPZA 3ONQA 1HXDA 1UZCA 3AVAA 1YJWI 3SUPA 4M78C 2ZZDA 3A5ZB 3GX4X 1NK0A 3MECA 3U2RA 4HWIA 4C8QA 3QIIA 3TAGA 3I35A 3DOKA 3JB9J 2XK0A 2NLXA 1ATRA 5E1XA 4K11A 2B5JA 5HLIA 4D5FA 1FWZA 3D0SA 4MLEA 4Z4IA 2JMCA 3P1GA 4AIHA 3FBIB 1SD6A 4RB0A 3V8JA 1JLEA 2HDCA 4DBHA 4XKVA 2FNAA 5BRDA 4E9FA 4UY8I 2HKNA 5D6XA 3TW7A 3CXCP 3FZKA 1X1DA 2VBXA 1PG5B 2MOXA 4IFYA 2HEQA 1K6YA 2CO5A 3O9RA 2F4MB 3LWHA 2JGUA 4YPHA 3FMSA 4BQOA 1BYMA 4IO8A 1RI0A 2XV4S 1G3TA 2QQAA 4N0BA 1JBMA 1HR0K 3OYKA 4CZHA 3KP6A 3P31A 4Z4FA 3AARA 1ZQ1A 2HQXA 4A3IJ 2H3EB 1UWBA 3R3LA 3KFVA 4KH5A 4HQMA 4LOCA 3D5SC 1BIZA 3GBTA 3U8XA 4I9QA 3GBGA 3KIOA 3ZMZA 2O6GE 3O3HA 5D3GA 1BWFO 2OTLQ 1VQOT 3F9KA 4YOUA 1JE8A 3D7EO 3N4MA 2F9TA 1FBQA 1GCPA 1VYTA 1UFFA 1ABQA 4RTTA 1T0HA 1B9FA 3NPFA 1PUFA 1N8RR 4Y33A 2X35A 1K1ZA 2DIQA 2AZSA 2QGUA 1OFCX 3S1QJ 4AFQC 2LREA 1OLTA 3HZ6A 1A5VA 2K3BA 3CETA 3ECOA 3TO6A 2IEKA 2CREA 1YAGA 5LJ5f 1EZZB 1S5JA 3FXQA 1KLNA 2H3GX 4LK1F 4AD9A 3M8FA 2P9PA 3U3GA 1H3HA 4DQSA 3H1QA 2K9QA 1I5ZA 1VQ5Q 4X9DA 4CC3A 2P9LB 2A6TA 1IGUA 5CVIA 2D1XA 4N4OB 4DV3K 1BI0A 2DT6A 5GAHJ 2JN0A 1FZPB 5IT9K 3CCUQ 2E1NA 4G94A 2LBFB 3E5QA 3WE3A 4BE1A 3RVCA 2EAYA 3FXMA 4BC2A 5AQVA 2M34A 5GAMg 5E1WA 2FPFA 2DDAA 1G5VA 3JAME 3SAFA 3PNVA 1HUXA 1QPMA 2EWSA 1PP7U 1ZBSA 2BXZA 3CFPA 2XAUA 2K6DA 5DM6F 2ETHA 2NVYJ 1IF1A 2VPRA 1BR4A 1DIZA 3A2FA 3KKRA 3VENA 4B44A 3HSFA 4Q5VA 2KKOA 3MJXA 2LOOA 1ZA2B 5FROA 3K9KA 5C24A 4F52A 2V7FA 4A2UA 3FBNB 3CCRT 3FZHA 5L3EA 2GAUA 1DGKN 3X2QH 5F6FA 4J9HA 4CGZA 1Q95G 2ME6A 3NTHA 2HHSA 3IQLA 1VI0A 2XU8A 1YHQN 5GAGJ 2Z3YA 1D3BA 5HBMA 3NQOA 2EQJA 4DV2K 2IGKA 3VS0A 3MKWB 1VQKQ 3FHFA 1AWXA 1QVGM 2RMOA 5GAN5 4OFAA 1C0TA 2XI9A 2VBWA 2V8IA 1TWHJ 4CCOA 3NWSA 2DL8A 1NYFA 4TSXA 4NQWA 4EEFG 1X1PA 3I56I 3GG4A 4GNIA 4DTPA 2BY2A 3HOWJ 4F3OA 4OGEA 1J53A 2J6FA 2OTLI 2M4GA 3DEWA 1ZQ3P 3LP3A 1UELB 2ZCFB 3JRHA 4J6WA 4DU1A 4ZDLA 4M3BA 4Z88A 3E01A 3G6EI 3SFIA 2ZGWA 1AVZC 1TUCA 3CC4N 4HF1A 2O9VA 3G71I 3BT9A 3FEOA 1IKXA 4YIIA 4B9MA 5D7UA 4F7UF 2M51A 1KHIA 2VPLA 2G8VA 1RAAB 4C92E 2ENMA 1M3AA 1X3ZB 4JK7A 2HFHA 3KZYA 1OKJA 4J9GA 1WZ2A 2MSYA 3CCVN 5CY4A 3SQ4A 1YI2N 5A0GA 3V9SA 2EIJH 2DK3A 3ZLJA 4KHWA 2NNYA 3T1HK 3K4CA 4N56A 4L5GA 4FJ8A 3D2FB 6PAXA 1K83J 3S2HJ 5M5XJ 3CCVT 3FLGA 2P9IA 3QKJA 2BVMA 2VC8A 5IHKA 2DLPA 2FBXA 2EZIA 4XTUA 1KC8C 1K73R 5H1SQ 5LBQA 4H0VB 3BR5A 4PJOE 2EYQA 4UVBA 2J06A 4WCGA 3J7ZO 2H3JA 4X6AJ 1VQLA 2W25A 2PY5A 3TEDA 2XSJC 4BD3A