3OS0A

Pfv strand transfer complex (stc) at 2.81 a resolution
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
365
structure length
365
Chain Sequence
AELDQLLQGHYIKGYPKQYTYFLEDGKVKVSRPEGVKIIPPQSDRQKIVLQAHNLAHTGREATLLKIANLYWWPNMRKDVVKQLGRCQQCLITNASNKASGPILRPDRPQKPFDKFFIDYIGPLPPSQGYLYVLVVVDGMTGFTWLYPTKAPSTSATVKSLNVLTSIAIPKVIHSDQGAAFTSSTFAEWAKERGIHLEFSTPYHPQSSGKVERKNSDIKRLLTKLLVGRPTKWYDLLPVVQLALNNTYSPVLKYTPHQLLFGIDSNTPFANQDTLDLTREEELSLLQEIRTSLYHPSTPPASSRSWSPVVGQLVQERVARPASLRPRWHKPSTVLKVLNPRTVVILDHLGNNRTVSIDNLKPTSH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The mechanism of retroviral integration from X-ray structures of its key intermediates
pubmed doi rcsb
source organism Human spumaretrovirus
molecule tags Recombination/dna
molecule keywords Integrase
total genus 103
structure length 365
sequence length 365
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2010-09-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
A PF17921 Integrase_H2C2 Integrase zinc binding domain
A PF18103 SH3_11 Retroviral integrase C-terminal SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2300 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3os0A04
1.10.340.70 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Endonuclease III; domain 1 3os0A01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3os0A02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3os0A03
4PWDA 4NZGA 2X4WA 3TAEA 3DLKA 1HPZA 4KAZA 3AVKA 2QQRA 4CGGA 4F2SA 3NH0A 1RI0A 1TVRA 4IUPA 3V1QA 3KTQA 1WAFA 4HCBA 2EKOA 2RJEA 3FDRA 4OGEA 4CJFA 2E6MA 3LP1A 5D3GA 4JRPA 1L3UA 4AHCA 3DLMA 1EXQA 1RT1A 4AHSA 3CFOA 1CZBA 1KVCA 4QVZA 1RBVA 1TKTA 4DSLA 1I3AA 1C1CA 3SZ2A 4B9WA 2M0OA 1BHLA 4XIUA 1MHNA 4FK4A 1T03A 4F2RA 3VQ9A 4KTQA 4ELTA 4UC4A 4JLHA 4DQPA 3KKSA 3OA6A 2EQKA 3PO4A 3K5OA 4J2EA 4PUOA 1ZBIA 3FFIA 3VA0A 3RWUA 4Y1DA 4C8MA 3NE6A 4NCAA 4KHNA 4Z4IA 1IG9A 1DLOA 4L59A 3HP9A 4BWJA 1TK0A 3LH0A 3PMIA 4RW9A 4KHUA 2BIVA 1RDDA 1KFDA 3HYFA 4CK3A 1S1WA 2RKIA 4ICLA 3T3FA 2XY5A 4DTUA 3NF6A 4KREA 2DTUA 2P0KA 1XNIA 1RDAA 4HUEA 1L3TA 4FK0A 3SQ1A 1L3SA 4FM2A 2G8VA 2YHAA 3CM5A 3AV9A 1SKRA 2YKNA 1J54A 3ZSVA 4RG8A 2HHVA 1VSMA 3KD5E 2R57A 4GW6A 3V1RA 2PYJA 1BQMA 3AA5X 1IH7A 3MXJA 4EP5A 1NKCA 3TR8A 1U4BA 2RHIA 4CCHA 4PA1A 1QSSA 3LP2A 3MEWA 2F5KA 2QXFA 4CERA 4DFJA 4KB1A 1D9DA 2LTOA 4O0IA 2VWJA 1ZBHA 2E4LA 3KK1A 3L2RA 3HJFA 5T7BA 2ZD1A 4CJ4A 3V81A 1JKHA 2IG0A 2L3RA 3EYZA 2FHDA 4FLVA 1QSLA 3AVHA 1VSHA 5KGXA 4FL6A 2FBYA 4RW7A 3KK2A 3K5LA 3TANA 4BACA 3O3FA 3MEEA 2XY7A 4B9NA 3K5NA 4CJSA 2EQJA 2OPSA 4W5RA 3NF7A 4ELUA 1RILA 3IS9A 1X9SA 1U04A 1Z25A 4KB0A 2HVHA 3S6WA 3VQ7A 3K58A 2HHTA 3VN5A 3VQ6A 3ZSZA 3LPUA 3P8HA 3AVNA 3AVMA 3ITHA 2K3XA 4BE1A 2CKKA 2MWOA 1C0TA 1KLMA 2QKBA 3H6ZA 2LDMA 3LYIA 5KE2A 3ZSRA 3HPOA 3MP6A 3NF9A 3K59A 1TK8A 3MEGA 3QNOA 2OPRA 3CFRA 4CEAA 4E89A 2R58A 2RHXA 3QKJA 3TARA 1T8EA 3GOXA 1TKZA 4KI4A 4OLAA 3M8RA 1S1VA 3QJ6A 4C5IA 1BQNA 3ZSQA 4I9QA 3TAFA 1QTMA 1LAVA 1RT6A 4X34A 1CZ9A 4CIEA 4KRFA 4JRQA 2EQUA 4F4KA 3FEOA 3TWHA 2EX3A 3OYAA 1JXBA 3CM6A 4CHZA 1NK4A 2O4XA 1OI1A 4GVMA 3DB4A 1J53A 3MP1A 2QQSA 3C6TA 3HPGA 3HP6A 3V1OA 4B9LA 1RDBA 4Q5WA 3LAMA 4EP4A 2YHBA 3ZT1A 3MO8A 4W5NA 1UWBA 3WNFA 2XY6A 1KSPA 4DWIA 3ASKA 4FZZA 2WONA 3HPHA 2D0AA 2RN2A 4QAGA 4H4MA 1HQEA 3QIIA 4DQQA 3QERA 1WAJA 4CJVA 5KCOA 3TI0A 3OYCA 5D6YA 1FXXA 4ZHRA 1W0HA 3RRHA 1YTAA 1S6PA 3SD4A 2RI2A 1U49A 1WSHA 2DFHA 3PX6A 3TAPA 3PY8A 4FJGA 4M3XA 4I2PA 2VYTA 2D0BA 3VQPA 4DTNA 3ZT4A 3NCIA 4L8RB 3OS2A 1U48A 1VRTA 4DTXA 3MEAA 3U6FA 3AO3A 1JLFA 1NK0A 3OQ5A 3SUNA 3META 3BGRA 4EZ6A 2YNGA 4CESA 3DLBA 4FJLA 2R5MA 1BIUA 2GV9A 2JLEA 3V9XA 1TAQA 3Q1JA 4DTRA 4OKEA 3PUFA 4LD0A 1TK5A 3NF8A 2O4XB 3JYTA 2VWKA 3VQAA 3LZJA 2E5QA 1OYXA 2Z1IA 1KCFA 3C6UA 1XHZA 4K8XA 1RTDA 4BDZA 3QEVA 1O1WA 2IS3A 3DRPA 3HL8A 4E7JA 4CJWA 2XHBA 3E01A 5J2MA 4Q0BA 1UOCA 4F8RA 3S9HA 2DIGA 4AHTA 2B6AA 4EDUA 3AA4A 3V6DA 4QQDA 3S3NA 3OMCA 1VSIA 1WSIA 3OMGA 2P51A 4GMJB 3LWMA 2X4XA 1BCMA 1X1PA 4OKJA 4CEOA 4C8NA 3QBYA 4CHOA 3M8QA 4R5PA 1J5OA 3NTHA 2BE2A 1S5JA 3ZSWA 4A4EA 2RJDA 3ISNC 2NLUA 1ZBLA 1L5UA 4DLEA 3SUOA 4IFYA 1JLBA 1KRPA 4KPYA 1K6YA 5C0MA 2XDPA 1XHXA 1XI1A 4CJ5A 2OZSA 3LLRA 4E7LA 3T19A 4UQGA 2JTFA 3OYBA 3NHGA 4KHYA 3QLHA 2G8FA 3TAMA 4KTWA 1RDCA 3PFSA 4KV8A 4PY5A 3DB3A 4YFUA 3IG1A 2LCCA 5KE3A 1HQUA 5SZTA 1TAUA 3UWNA 2YNFA 5C24A 4LH5A 3SV4A 3ZT0A 4N56A 4GY5A 3DM2A 1QHTA 4OPKA 2Y1JA 2HVIA 4DTOA 1N5YA 5JS2A 4CJPA 4M3TA 1WNSA 4FLZA 3PMTA 3QETA 1LWFA 2PZSA 2KZZA 4AH9A 4DSIA 1UAXA 4ELVA 2RO0A 1S9EA 4DU1A 3WNGA 4CEDA 2HHSA 2RJFA 2G8WA 3K5MA 1D8YA 3LPTA 3C4SA 4LH4A 3HVTA 1VSFA 4Z0UA 3VQ4A 3VQQA 1NK5A 4M3RA 2Y1IA 1ZBFA 1RT5A 5FDLA 4CK1A 1I39A 1T05A 4C8OA 4PLLA 4CHYA 4FJMA 5J2PA 4FJ9A 1SKSA 3I8DA 3NGZA 3OB9A 1JLCA 2X6NA 4QOZB 4CHQA 3VA3A 4EZ9A 5FROA 1KVBA 4FJIA 4Z4EA 4CFBA 1IKXA 1QS4A 3CG7A 1BCOA 1LWCA 3H8ZA 3KUFA 3MEVA 2Z1HA 3AVAA 3LP3A 4CIGA 1RBSA 3KLHA 2ZQBA 2FBTA 4FW1A 2BANA 2A1RA 2HNYA 5I42A 3O3HA 3DLHA 1REVA 4BDYA 1VRUA 2LSNA 4ID1A 3VQDA 2Z1JA 4CGFA 3SQ2A 3IAYA 3RTVA 3HT3A 2WACA 4KHWA 3MXMA 1G15A 3CEYA 3AVGA 4CGJA 4CECA 4CF2A 3M8PA 3KLGA 2HNDA 1NKEA 4DF4A 3RR7A 5KTQA 3HSTB 3OYMA 1FKOA 1RBTA 3SI6A 4N4HA 5IN1A 2GUIA 1BI4B 4KKOA 3SYZA 3SNNA 1NKBA 1YTUA 3LDSA 2LRQA 4OJRA 3RRGA 1ASVA 1HNVA 3VQ5A 4AHUA 4O4GA 2F8TA 3OS0A 4PLIA 2PQWA 4IUVA 3HVRA 4PL6A 3U3GA 3RMAA 2YNHA 2FC0A 5KCHA 2YNIA 3DYAA 3L2UA 4IBNA 3L8BA 3SJJA 4E3SA 5CYQA 4M42A 4B9XA 4DFPA 2XRIA 2OYQA 3L2WA 1LW0A 3I0RA 4N41A 3OYDA 2IOCA 3EAEA 1NK7A 3L3VA 3SQ4A 3VQBA 3ULDA 3HO1A 3PV8A 1ITGA 1KTQA 1RBUA 1VSEA 1VSJA 4DU3A 1G5VA 4O44A 3SQ0A 3K2PA 3B6OA 3MECA 3VQEA 1QSYA 4OLBA 1WJSA 2QK9A 1VSLA 4KHSA 2F96A 3AO1A 3OYLA 5KH6A 4DU4A 2GFAA 4B3OA 5K14A 3TAGA 2HHQA 1BGXT 2GBZA 4HUFA 4O5BA 4CFDA 4BE0A 2ETJA 2RPIA 4CFCA 2P1JA 4E7KA 2RHZA 3OS1A 1KHCA 1LW2A 1TL3A 3DI6A 4CF9A 1SKWA 2HHWA 3OYFA 4J2BA 1WSFA 3F73A 5CZ1A 1KVAA 3THVA 5KRSA 3BDLA 1HJRA 2KW4A 4WE1A 3NTIA 4E19A 4ZTFA 3KLEA 3SV3A 4H8KA 4CJRA 4FZXC 3VQ8A 4B9UA 1X9MA 3V4IA 4FJXA 2AJQA 1WGSA 4FVMA 1NK6A 1WSEA 5CIUA 1TL1A 1DTTA 2HQEA 4CF1A 4KTZA 2DIQA 1JLQA 1BISA 4N4IA 1IKYA 1CXUA 5IAYA 3DLRA 2BKDN 3ZEHA 2OPQA 4FLTA 5J2NA 4Z4FA 4O0JA 1RT4A 3ZT3A 1S6QA 1VSKA 2RF2A 3A2FA 3AVJA 3H08A 3NAEA 4FJ5A 2HW3A 2HMIA 4DS4A 3P5JA 4CEZA 5HRRA 5FRNA 1QE1A 1ZBUA 5HROA 4C8LA 2KTQA 3DLGA 3NDKA 2M16A 1FKPA 4F3TA 1EX4A 4RG2A 5J26A 1RTJA 4DQRA 1U45A 4ID5A 3P83D 3KLIA 4LY7A 5CZ2A 4QCLA 1IKWA 3NH1A 3KJVA 3CQ8A 4NCGA 1J9AA 1WJRA 1Z26A 2X78A 2DFFA 5HBMA 1OZ2A 4TSXA 3OY9A 4FLXA 3QNNA 4QQGA 1KFSA 3DLEA 4CJTA 3QEIA 3O8VA 1D5AA 3G10A 2G8KA 4ZTJA 4JS5A 2F8SA 3CFPA 2HHXA 2P5OA 1WSJA 2G8IA 3AA2A 4E1MA 4O55A 3RMCA 4CEQA 4MFBA 4CEBA 4CF8A 4AHRA 3LWLA 1NJXA 5J39A 2WOMA 4DS5A 4J2AA 1S1XA 4J2DA 1RNHA 3LGFA 3TAQA 1NK9A 2LVMA 1RT2A 2YV0X 4DF8A 5I3UA 2R7YA 1RT3A 3SCXA 2JGUA 2FBXA 3U3YA 3QEPA 4B9VA 4FJKA 4KHQA 1A5WA 1WLJA 3I0SA 4Z4HA 4IG0A 4FK2A 1B9DA 2IC3A 1RBRA 4CIFA 3AVIA 1CLQA 3MP8A 4FW2A 4Q5VA 2HQXA 4HCZA 3NGIA 3G0ZA 1JLGA 3AVBA 5KGWA 3WNEA 3QEXA 3OYEA 4C5HA 2X74A 4G1QA 2E6NA 1X9WA 1IO2A 1SL0A 4W5QA 2XK0A 2EHGA 4QW2A 4FU6A 4RW4A 4Y1CA 3TABA 4M45A 1ASWA 5HRPA 1C6VA 3SUPA 3LANA 4F3OA 4IUQA 4W5OA 2IDOA 3SUQA 2IAJA 2ZE2A 5M9OA 4RW8A 3LGLA 3LX7A 4RW6A 3RMDA 4FJ8A 4M3ZA 3NFAA 5KI6A 2OA8A 3LALA 3ZSXA 4C8KA 1A5VA 3AO4A 4CK2A 1H3ZA 5SWMA 2L89A 3ASMA 3V9ZA 1UA0A 5HRSA 4JS4A 1TKXA 1WSGA 4LD6A 1C1BA 3F9KA 1W9HA 4FCYA 1YVUA 4NYFA 4CE9A 5JS1A 4IKFA 3K57A 5DK5A 3RR8A 3M8SA 4CGHA 2W42A 4DSEA 3L3UA 1ZYQA 4HCCA 1MU2A 1RCHA 5KRTA 1L3VA 3DOLA 2X35A 2X4YA 3QIPA 4I2QA 4C5GA 1EP4A 2O4GA 1SSFA 3AVCA 2JZ2A 4DG1A 1U47A 2BUDA 3RMBA 1R0AA 3NTKA 4LSNA 2B8AA 3OVNA 4A4HA 4KO0A 3LAKA 2XY8A 4CJEA 3O3GA 1RTIA 4PQUA 3WNHA 3AA3A 4B8AB 5J2QA 2I5JA 4IURA 2ATQA 1NOYA 4BWMA 1TV6A 2KQ2A 1DTQA 3QINA 5HP1A 4DSKA 4FXDA 2D9TA 3UT1A 2B5JA 3O4NA 4DSJA 3P1GA 3OYHA 4B08A 2RI5A 1C1AA 4FJJA 2B4JA 3L2QA 1S9GA 1RT7A 2A1SA 2VG5A 3DRRA 1BL3A 4A4GA 3L42A 3QIOA 3ZT2A 4CF0A 4KI6A 4FJNA 1HMVA 2DAQA 1NJYA 3CYMA 1NJWA 3AVLA 3UIQA 4FJHA 1T7PA 2QKKA 1Q8IA 3D45A 5J1EA 2IGIA 3NGYA 3OJSA 1S1TA 3ALYA 2NUBA 3PX0A 3ZSYA 1LAWA 4CEEA 3T1AA 3SPYA 2R5AA 1B92A 1SL2A 4FYDA 1HYVA 4B8CA 3L2VA 2K3YA 2EFIA 3OJUA 2BDPA 2L8DA 4CJQA 4FM0A 3DRSA 2RHUA 4IUUA 4CJLA 3EY1A 3HXMA 5HLFA 4M3WA 3LZIA 3FC3A 4M3UA 2G3RA 3KIOA 4B9TA 2KZMA 1GOAA 4CEFA 2PY5A 4W5TA 3MEUA 1EETA 1HYZA 4DMNA 1GOCA 4OVLA 1NK8A 4M3YA 3FLGA 2D0CA 2HB5A 2HHUA 3D0PA 3SPZA 1GOBA 1IKVA 2Q3SA 3MEDA 1TGOA 1NJZA 2DFEA 4E7HA 4HVJA 1RTHA 2VG6A 2RJCA 3DMJA 4YNQA 1XC9A 3P8DA 3F70A 2Z1GA 3AO2A 3C94A 3KKRA 3V9UA 3BDPA 2ITGA 4FLUA 2VG7A 5D6WA 4DFMA 1TKDA 3AVFA 3OYKA 4FLWA 4DLGA 4FZYA 2O4IA 1B9FA 4H4OA 3ZCMA 4CGIA 2BGGA 1JL1A 4N5SA 4I9LA 1ASUA 4Z02A 5C42A 4Z4CA 5HRNA 1UA1A 1N6QA 3E9FA 2X6SA 3OYGA 2G8UA 2GFUA 3OYNA 4CFAA 1BI4A 4KFBA 3VQCA 4I7FA 5E41A 2G8HA 4N76A 1XWLA 2OPPA 4DTMA 3S3OA 4N4GA 4NYNA 3QEWA 1WJQA 4OGCA 2DY4A 1JLEA 3S3MA 4DTJA 1SUQA 4B9SA 4DQSA 3AO5A 3ME9A 1HRHA 4MQ3A 2OZMA 1EKEA 3OYJA 3MAQA 2RHYA 4IUTA 4NS5A 1JL2A 1VK0A 2MWPA 1VSDA 3O4QA 4CHNA 4DSFA 4DTSA 3PX4A 1KLNA 3HK2A 3KD1E 4E7IA 5FRMA 4CGDA 1BIZA 2EQMA 3C95A 5CY4A 4HUGA 3NNQA 4DTPA 1D9FA 4CJUA 2D5RA 1CXQA 4E1NA 4CHPA 3B6PA 1Q9YA 5C6SA 4IFVA 4M41A 4DQIA 2KFZA 4CJ3A 4A4FA 1JXEA 3NBPA 3DOKA 4OKKA 4LSLA 4HTUA 1Q9XA 4NCBA 3V9WA 1LV5A 4FJ7A 2PYLA 2P5GA 2M1HA 3V9SA 4II1A 4BE2A 3LP0A 2KFNA 4OVAA 4BD3A 4AILC 1N27A 1SV5A 3OYIA 3IRXA 3QO9A 3NH2A 4FLYA 4FM1A 1Y97A 5DMRA 5EU7A 3MXIA 4Z4GA 3HM9A 3KK3A 4QQ6A 2E6LA 2RI3A 4HHTA 3EZ5A 1SL1A 3PO5A 1LWEA 3M9QA 4AHVA 4CRIA 5D6XA 1HNIA 1YT3A 4IDKA 4N47A 4CJKA 3JSMA 5C25A 4E0DA 1F21A 4IG3A 5CYMA 2YRVA 1S1UA 3KLFA 1C0MA 1HYSA 1C0UA 1QQCA 3PNWC 4BDPA 4K8ZA 2HNZA 4DFKA 1NOZA 1WN7A 1A5XA 1JLAA 4OPJA 2FBVA 2YKMA 2GF7A 1OZ3A 4B9MA 3QESA 2XO7A 3ZSOA 3E9GA 4C5EA 1FK9A
chains in the Genus database with same CATH superfamily
1G6NA 4HSRA 4N9IA 5AQFA 4RDUA 2QQRA 2EYZA 1TOVA 4F2SA 4D6WA 2XRNA 1WAFA 1K9MO 1W97L 1OQKA 1RT1A 2LQWA 5HDKA 4H0TB 2UXBK 4IEIA 4OB2B 2QGUA 3KKSA 5M1PA 8AT1B 3WTUC 1VQ7I 4K25A 3GWZA 3AGRA 2V1DA 3Q5FA 1KJWA 1LVAA 1IRFA 1D8KA 3CM5A 4G8XA 1GUUA 1DJ7B 4F7UB 2PYJA 2ZPHB 2TCTA 3CUQB 2JS0A 1QSSA 1JKOC 1XC5A 3BY6A 2YWWA 1N3AA 4M7AF 3CXCS 1KYWA 2YU9J 3ZQCA 3EUHC 3HB9A 4FL6A 1S3XA 4B3SK 5ICGA 3KLOA 2JPBA 4EMSA 2I7PA 3ZMTA 1HLUA 3LCNA 2RQVA 2CUJA 2AXTC 2YSQA 1C0TA 1WOQA 1IUFA 1N25A 1ZRDA 1JUPA 2XAJA 1WPKA 3GOXA 3M8RA 4AQYK 3O9RA 1J6ZA 1MMNA 2OFKA 3ZLJA 3QB0A 1VQ7T 3CM6A 2VKEA 4L5JA 3I5SA 2YCHA 1CGPA 2CDTA 3NRVA 2XICA 4II3A 5KCOA 5KCMA 4DBQA 1EQYA 4F17A 4BQOA 3ECHA 4M3XA 2JVGA 2A3ZA 2M87A 3NCIA 2F1LA 2HHHK 3META 1EH8A 2F7TA 1TAQA 5M3MJ 1KD1R 3FFKB 2VWKA 3BZKA 4H03B 5CHIA 2FE3A 1KCFA 3DRPA 4C92E 3GE1A 5DLOA 2JG6A 4NOYA 3OMCA 5TKWA 1FTZA 2YJEA 1J5OA 2I5WA 3NTHA 2DX1A 1WXTA 2OZSA 3CD6I 2P4WA 1RDWX 3H9JA 4B8XA 2LCCA 2Z2SB 3HOVJ 4WQ5C 3BTIA 3IDHA 1Q82C 4MDWA 2A36A 2OTLI 4DTOA 1WNSA 4DEYA 2P9UB 4PSWA 2JRMA 4EIKA 3REAB 4Z0UA 1YITN 1ZBFA 3ZETB 3MMVA 4UV9A 3I8DA 4A0XA 3FX3A 4QOZB 3CDIA 1Q81R 1BCOA 3HTSB 3CCMQ 1DEJA 5I42A 2KI7A 2JA5J 2XV4S 1VTNC 1HSQA 1PSFA 4JBAA 2BV6A 3AVGA 1NKEA 2WY8Q 3EUKL 1FKOA 1FLIA 2GUIA 5IN1A 4YFKF 4AFSC 1ARKA 1MSEC 3TEEA 4IUVA 2L3DA 2W85A 2MOXA 2IGMA 5D8KB 3H36A 4PDKA 1FIAA 1WHGA 4JX4A 4R1HA 3SQ4A 2VQCA 2DXBA 1NJIC 1U5SA 2M0YA 2C0OA 3SQ0A 1H9GA 3RBBB 2AA4A 1S72I 2DXIA 4ESJA 4MO5A 4XQFA 4E7KA 1WKMA 4M3DA 5DCMA 2K9MA 5IPAA 1RRSA 5GIPA 2KNBB 1TL1A 1BISA 3IAM2 3C3WA 3NAEA 2C06A 1QE1A 4FASD 5J26A 2O0YA 2QM1A 3KLNA 4H5WA 3F0ZA 1R5ID 3LA2A 4BBSJ 1ZUUA 5LJ3j 3CFPA 1GRIA 1IRGA 4XTVA 3T1BA 3T8TA 4CEQA 4DV2K 2VODA 2WV1A 3VEOA 3LGFA 5KQDA 1PD1A 1M90C 5AIPA 1KXPA 2L3SA 3QEPA 4Z4HA 2XF7A 4L0ZB 1XI1A 3QEXA 2NS8A 3KHYA 2ZMEC 4W5QA 1H8KA 2XMFA 3CCEQ 1ZBSA 3SK3A 3OW2M 4RW6A 3LX7A 3W3CA 4M3ZA 3ZSXA 2VI6A 4C8KA 1K73R 3C6AA 4CK2A 1NG6A 1PRMC 4OO1J 3BE3A 4IRHA 1KGSA 3O6WA 1U5TC 4X64K 1SSFA 3RMBA 3IAS2 2ZNZA 3DJCA 1JT0A 3KP7A 1P4WA 1DPRA 3ZQGA 1ZXOA 4M9XA 4F93B 4B08A 4IQ4A 2FF3B 3L2QA 2V4JC 2BYVE 1Q8IA 5J1EA 1FBQA 1TZLA 3S32A 1ORPA 2PN6A 2QEXQ 3G4SI 3L2VA 2BDPA 3DRSA 5A2QE 4W5TA 3HTUA 2HB5A 2O8FB 3K4BA 1AT1B 4XOPA 3HHTB 2DFEA 4A3GJ 4LLLA 3VMFB 3TSPA 2Z1GA 3O8MA 1WXBA 1X19A 3ZYYX 1HUXA 4EW4A 4BR4A 4IOCL 2O8EB 4OMFB 1N77A 1BI4A 3JREA 5KK1A 2P0WA 2BTTA 4A3JJ 2IVPA 2QQAA 3QQAA 5CY4A 4E1NA 4CBWA 1FPQA 1VQ4A 4DR5K 5I9EB 2EA4A 1JXEA 4OKKA 2EGEA 4NCBA 2QG9B 2WFBA 4HKEA 2EILH 3FXOA 4AFQC 4FLYA 3CJCA 4KULA 2BXZA 3NVMA 3KK3A 4UV8A 4UY8O 1LWEA 2DT7B 4RA2A 4RLFA 3E1SA 1E6GA 1Y6IA 2HNZA 4BKXA 4AVZA 2GF7A 2DNUA 3IUCA 5CHZA 3O08A 3CCRN 3THVA 1KU2A 3ZSOA 5AQMA 1NGHA 3BJOA 1P7IA 3RTRA 3VF4A 2HL5C 2EBPA 4OGEA 4CJFA 2Z99A 5IOYA 1VQ5Q 4QVZA 3FSPA 2O61A 2PNIA 4UB8C 3DBHB 4P9UA 3HOSA 1K0XA 3E9OA 1K78B 4JI4K 4EV0A 3A02A 3CCMA 5CE3A 2WA0A 3NE6A 3A1YA 2CZ0B 4L59A 1TK0A 4RW9A 2BIVA 4CK3A 1KFDA 4DTUA 1TUGB 3MCZA 3FZVA 2RHIA 2JWTA 3MEWA 4KB1A 4RS8A 2GCXA 3K1MA 2HQ5A 4LN2A 2KRFA 2XHCA 2FHDA 1Z6TA 3Q9VA 5BN8A 4NL3A 2MYSA 4FE4A 1ACMB 1PC0A 4JP0A 4HRIA 3VDXA 3ITHA 1PDNC 1HXDA 3LNQA 5C12A 3CJAA 1T8EA 4LF6K 5GAMd 3M5AA 1BQNA 3OIQA 1YRNA 1OEBA 3OIPA 5FKKA 3LMMA 3WTSC 5HLGA 4KGZB 3C6TA 4YOUA 1TQIA 3CJBA 4XLNF 1DIZA 1UWBA 1TQPA 2WONA 4BL0B 3AAFA 1W36D 1WJEA 2A37A 4AIAA 3RKQA 2AP1A 3CWTA 2XB5A 1M5Q1 3U6FA 4V2FA 2BOLA 1FBUA 3PUFA 4LD0A 2CH6A 4N4NB 1E3MA 5LD2C 4CSWA 2V9PA 4A53A 1U6GA 4DA4A 3DBRB 2JS2A 3EL2A 4GLKA 2COZA 2D5VA 4CJ5A 3R6OA 1BA0A 1BO5O 4YOYA 2UV1A 3AHUA 1RDCA 3I59B 3J80Z 4A6DA 5D7UA 5AQZA 1HQUA 5A0DA 5C24A 2W82A 3I56A 1BM9A 4OWRB 3QOPA 2J06A 2RO0A 2Q31A 3CMAQ 1TT5B 5A2QK 2NOLA 1Y8RB 4FJMA 2E60A 2K27A 4PFOA 5DLQE 1OCOH 1QS4A 2O01E 3ZR8X 4XRSA 5DPKA 3CPWA 4CGFA 3ELKA 5E3LA 4RAYA 2M0MA 1KC8R 2KDSA 2GZWA 3LDSA 5FB2A 3RJPA 1M4ZA 2D6FA 4J00A 3B8AX 5AZJB 4JDSA 3OS0A 4Y33A 1BC8C 2A05A 2VC0A 3ISPA 3J8AA 2P9SB 5DS9A 2R7RA 4DR3K 2UZKA 2K9QA 1KTQA 3SYTA 1VSJA 2LQ8A 4E2FB 4FWRA 5C0YA 2JSPA 3L4IA 1VSLA 3AO1A 4M75F 4M6VA 3OIOA 2DMNA 3QJYA 4XKVA 3K2AA 3OS1A 2DYRH 5KRSA 1JJ2A 2H3GX 3EG1A 3KLEA 3SV3A 2AHQA 1WFXA 2EAYA 4FVMA 1VNDA 2DAOA 3CUQA 3ZP5A 4JYKA 3DCFA 3AVJA 1YOVB 1YW8A 2K9NA 4BQAA 1K8AU 2W0ZA 4QCLA 3QWXX 2F4MB 4MLHA 3WTZA 3ZEUB 2STTA 4UXNA 2F8SA 2XAUA 1QVFA 1P9QC 4L3QA 4GGGA 2DJIA 2GIZA 3M8EA 1X9JA 4UUTA 4B3XA 2XKOC 3PIOL 4NC8A 4OIOF 4MFEA 2XROA 5AFUH 3HFNA 1B9DA 3CLQA 1VQ8Q 2ME6A 5GAMj 3WNEA 4LD5A 4QIWN 3GFJA 3FDYA 1ZHFA 1QQMA 4QW2A 3VS7A 4RM2A 2EBIA 1A5VA 1H8AC 2DA2A 4B3TK 4WXHA 3JTHA 4QLCU 5BRDA 4B1XB 1Z7LA 4Q48A 1UGRB 3ROUA 1BI2A 4NYFA 4CBUA 3FWEA 3VGMA 2R5ZA 2KZVA 5AQHA 2HS5A 2E3IA 3LAKA 3AAPA 4XH4A 1HPMA 1PM3A 1NOYA 2ZMEA 2HYGD 3FXKA 4FXDA 3ECOA 4XKWA 2VJIA 3CF2A 4B09A 2WAQN 4M7XA 2IGIA 1ZH5A 1B59A 1LAWA 2MI6A 2EB7A 1B9NA 1JKPC 2FSWA 3KIOA 2ZCFB 3J7AP 2DT5A 1TYQA 1JBMA 4RUGA 2W6LA 3UKRB 4ESBA 1U8BA 1QVFS 1YFHA 4C8QC 2HZYA 1DQUA 4QWQA 5FU7C 3DMJA 2GWRA 1KQ2A 1ZHIA 3EKSA 1UHMA 4H4OA 4BR7A 3VPZA 1XMQK 5C42A 4DQ2A 2M1BA 1MSFC 1XWLA 2E35A 2GUPA 3AO5A 2Z16A 4C3IJ 5CKTA 4FVUA 4DSFA 2MWPA 3ENBA 3ZL7C 2OCEA 3W6JB 1UMQA 2XKPA 3NNQA 2LBFB 2HTSA 4PJOD 2QWRA 4M41A 2L02A 5FKLA 5JLXA 4EMKB 1D5YA 1IBMK 1JCEA 2GOMA 3TSUA 3V9WA 4M9ZA 3W6KB 4BH9A 1PUFB 4QVDA 4C8QD 4M6XA 3EZ5A 1W2BM 5HDGA 1AOYA 4HLYA 3LSHA 1LE8B 1ATNA 1S1UA 3KLFA 1RADB 1C0UA 4RTVA 3I56N 1VQMA 3CCUI 3SMPA 2QWWA 1JKQC 4C5EA 4M3EA 3C65A 3MAJA 3V1QA 2O8XA 2XAHA 4M7DB 1YG2A 3WE3A 4LG3A 3HM5A 1C1CA 1SF9A 4B9WA 4XIUA 4IOAL 3THXB 2KLOA 3IRRA 4UC4A 2X1EA 2ELKA 2OPTA 1XPXA 2F6CA 3LH0A 1I5OB 1DP7P 2LRDA 4UUVA 2IGOA 3GUDA 2DTUA 2DFIA 5D5XB 3D5SC 2YHAA 2ZJQF 3TR8A 1MZBA 2HAXA 4PUSA 4H0EA 1X43A 4CCKA 3CP8A 3O8HA 5FWCA 2OX7A 2EZIA 2QBYA 3VUZA 1LNXA 4MNUA 3S1RJ 1M8VA 3K5LA 3RI4A 3CCMT 3VQ7A 3U9GA 1K0SA 1JEGA 5CKDA 3GNFB 2LJ3A 3FF5A 3VQ6A 1UE9A 2EH3A 4BE1A 4EJVA 2QYOA 1ZSZB 1IG7A 2O4IA 3HPOA 3IMXA 4M77E 3K69A 1BWFO 2K3BA 2E10A 1Q7YR 4E89A 1WB9A 2DA7A 3ATUA 4A3LJ 5E17F 3ZPLA 4F4KA 2CSIA 1VQ6A 1T0HA 4C8QA 5DM7F 3V8JA 5GAN6 3LAMA 1X69A 2HF4A 3FK7A 2YHBA 1YJNA 3HPHA 3QIIA 1TL8A 3TBIA 1VQ8T 2HCKA 5GAGP 2NZTA 4Q0BA 1VQ4Q 1NK0A 4FJLA 4J9DA 2R5MA 3S1MJ 4ON0A 4L18B 4JKCA 5CR4A 2WSCE 5J2MA 2YX6A 3GFLA 4I6MB 3WHCA 1H0MA 1VSIA 2PX9A 1XQPA 1S5JA 2UU9K 4A4EA 4M78E 4DLEA 1GLFO 3FJPA 4KTWA 3PFSA 2HNHA 2F2VA 2X9HA 3IG1A 5BPLA 2B0LA 2A0FB 4LB6B 2JVVA 1ORKA 5L3BA 2HOTA 2E88A 3CCQI 4M7DC 1D8YA 1FYKA 3J7YP 3OB9A 2XAQA 5FPEA 3WXIA 2WAFA 1YIJT 2QXLA 1HDPA 4XLAA 3CEYA 4CF2A 3GLXA 5LLQA 2V8JA 3CUOA 1BR4A 4D7MA 1Y96B 4AHUA 4KBOA 3FMQA 1JXMA 3EHRA 3AG2H 1S72N 2VWBA 1AVZC 2RPNA 1BOTO 1YYVA 2L9NA 2ELHA 4IHXA 3K9KA 2IOCA 1GV5A 1RUOA 1NK7A 1PRLC 3VETA 5JVTA 4JI2K 4PFZA 1WJSA 2L9SA 1T3VA 2UXNA 1D0XA 5EGOB 1JU5C 4HT9A 4O8UA 3IWZA 1TL3A 3IQLA 3M1CA 2L4MA 3SXYA 1BIAA 1WHUA 1HJRA 2DA6A 2O8BA 2XRLA 5JVHL 2DK3A 1NK6A 4NDLA 3ER0A 2AS5F 7AT1B 3BEXA 2FLOA 3C0CA 4M7AC 3JAMO 4C92A 2COWA 1T38A 1S6QA 1W36C 2BZTA 1OR7C 4YORA 1C0WA 2FF4A 1EX4A 1U45A 5GAMg 3CC7Q 1SKWA 2IPQX 1FSEA 2A41A 3QNNA 3KTQA 3ABLH 2PG4A 4BJ5C 1KC8U 5DUIA 3E66A 2AKLA 4Q4ZF 3J7YJ 1RNHA 3ZQLA 5ELZA 1XCVA 1QVFP 4DF8A 5I3UA 3ZMSA 2NS0A 2HDCA 3TU5A 4B9VA 1A5WA 4HV5A 4X1EA 5H20A 1YJ9I 4XQ3A 1HC8A 4RW4A 2HVSA 1C6VA 2PVOB 2HDWA 3CZ6A 5GANh 1RAIB 3FZFA 2IVNA 5FKOA 4CDGA 4U0YA 1S8NA 4IKFA 1MU2A 2X85A 1R77A 4IHVA 4UOBA 1EP4A 4X66K 1YO5C 2E1CA 3CCVN 5EG0A 4A4HA 3I56I 2CGHA 2YUOA 2QA4A 4K11A 4B3AA 1W7PA 1G3YA 4A2AA 3CCST 3ZX3A 1C1AA 3H0DA 3E5XA 3ABTA 2O8BB 5FPDA 4XR6A 2DAQA 2CH4A 2EZLA 2UUAK 4LDYA 3IH4A 2V8IA 2M3AA 3SHWA 3JCMX 4KJZA 3N4PA 4CEEA 2HPIA 1HYVA 2K3YA 1S72T 4CJLA 3LZIA 2OQRA 1FOXA 4JK9A 1N6AA 4CEFA 4BGBA 5M5YJ 1QGPA 4EA5A 3FLGA 2D0CA 3WHBA 2DETA 3SEMA 1IV0A 2W57A 2RJCA 3F70A 3U9DA 2VC8A 3OV8A 1J0RA 1TKDA 1Q82O 4BY9C 2O88A 2BEOA 1ZN2A 1HCRA 3PE0A 3CUQC 2LR8A 4G94A 1JTXA 5IYBJ 3EFOB 5B66C 3OW2P 4DTJA 3GG4A 1EKEA 2DYSH 4LLGF 2LFBA 3PNVA 1PKSA 1GLDG 3KD1E 2MABA 5J4YA 1X75C 4DTPA 1Z6RA 2VKHA 3VYUB 3IWFA 4DV7K 4LSLA 2DI3A 2P5GA 2V52B 4CC7A 5EU7A 4A6EA 3DKWA 4UNFA 3EYIA 1YT3A 1LEBA 3EGUA 2VL8A 2R7WA 2F2XA 2YRVA 1A5XA 2Q36A 2QENA 1WEGA 2VV5A 1OZ3A 4F3TA 4C9YA 2DEUA 3C0BA 5GANe 5GAOl 3JB9H 3R2XC 3CMEA 2EKOA 3LP1A 1R0BG 3UB5A 3IH2A 3EUAA 2HR3A 5KQ8A 4M77G 2VT3A 1I3AA 4XORA 5E1XA 4IF4A 4YIFA 2VWFA 2F9TA 3FFIA 4DEXA 1YQLA 2KRSA 4GFBA 2H3JA 4HEA2 1RDDA 3CERA 3UKRA 1L3SA 4FM2A 2HHVA 1MJAA 2RVCA 1WBBA 2YPRA 2NLXA 1PJRA 1JKHA 2PEXA 4M7DG 2FG0A 5KGXA 4M3FA 3TANA 1O9SA 1B1BA 1V4SA 1HQCA 5GPAA 1Z25A 2HHTA 4YG2F 3LWHA 3JTGA 1REPC 4XICA 2YUSA 2O8KA 1YS7A 3HYIA 2E6ZA 2NUPA 2QI2A 1Y1VJ 1JCGA 1R1VA 3CPWS 1KD1U 4JRKA 2QGGA 1YLFA 1RT6A 3A0HC 4YOQA 3L1AA 5E8IA 1U84A 4YIRX 1JRIA 2JMCA 2JHNA 4JQFA 3MO8A 4WFAL 4JZ4A 1KSPA 2QYZA 3BR5A 1JUSA 5A0LA 2AO9A 1WAJA 5F6FA 3TDZC 1XG7A 3TAPA 1TWFJ 4JI8K 4A5MA 3GIBA 3JB9I 3VQPA 4F7UG 2DL7A 1UDLA 4L9NA 1HK9A 2VASA 2F48A 3ZCOA 2PFBA 4HF1A 2X3WD 1ZREA 4PJOA 3HL8A 1YRNB 3SWNC 3R4KA 4F8RA 2X6YA 3S9HA 2L5QA 5I21A 2NOGA 5J6XA 1B72B 1F43A 4MZPA 1X1PA 1BCMA 1ATRA 3OL4A 2A6AA 4J19A 3GTMJ 1T39A 4PJMA 3BG5A 2CZ6B 3FBIB 1OX9A 3CD6Q 4M75D 1WJAA 5AQGA 1ILYA 3ZQIA 4WX9A 3O9TA 2E5LK 1MW7A 3WU0A 4GV9A 1AU7A 4DSIA 2MD0A 1YQRA 1LWVA 2XD0A 1ODDA 1YF5L 5LEKA 3C4SA 4FL9A 1NEGA 3ZRGA 2ZWHA 1TW2A 3I4PA 3BT9A 3EGDA 2JTVA 2COYA 2GM4A 1A6IA 3I9V2 1LWCA 3MEVA 4XU1A 3KLHA 4ID1A 3MPUB 3HT3A 1Z91A 1G15A 2BH1A 3JRDA 5FJ8J 1BDGA 2ZC2A 3WXLA 1GLJO 1IGUA 4XH5A 2EV0A 4BHPA 4O4GA 1MMSA 2PQWA 4M7AE 4NXMK 3DYAA 3FZMA 5C2DA 4RTXA 1FMWA 1QVUA 2V26A 1OR7A 2P9IB 3OYDA 2F96A 5KH6A 1MMAA 4UHTA 1M1KC 3K0LA 3R61A 3UA7A 3ZN0A 3L4QA 5GAHP 3HRUA 2AQEA 3A5LC 1XN7A 2DL3A 5BOXA 4E9GA 1VQOI 1HLVA 4N0AC 3M0SA 4WYBA 1K9MU 2V1XA 1U2VB 4DR2K 3CCET 5IAYA 1AZGB 3CCSN 1B6AA 1UG2A 1HKCA 4C8LA 5IYCJ 2Y4XA 4BAYA 4M7DF 4JHDA 3CC7I 5H6QA 2BBYA 5CZ2A 1WJRA 4JRIA 3QEIA 2D1VA 4RM3A 3K2ZA 3F8NA 3OMYA 2J6OA 3S15J 3WXKA 4MFBA 2K9LA 4BS9A 4J2DA 2P9LA 3NFCA 4C3JJ 3S16J 1YHQA 1XC3A 3C18A 1J59A 4WQ4A 3E97A 1GXPA 4BHCA 1WDXA 4J5YA 5DD4A 1WLJA 3F8BA 1VQON 4Q5VA 3G0ZA 3DTKA 5CQGA 3OYEA 4KT0E 2X74A 3W6VA 3KYLA 5GAOp 3QYBA 4OMMA 1JXOA 2W10A 3FMRA 3U1DA 1VQPQ 1W5SA 1IRZA 4A93J 1W9HA 3A5ZB 1EWRA 4C30A 1ZK8A 5FD6A 1ZYQA 4LFBK 1L3VA 3NMZC 4LXCA 3WU2C 2HBPA 4DOVA 1YI2A 1XSVA 3R1XA 1ATSA 2R7OA 1P4AA 3CLOA 2UUBK 1X2NA 2C6YA 4GO1A 2KY9A 4MZTA 4LF9K 4A4GA 2IIMA 3UIQA 1DKGD 1D1BA 2VT2A 1OYWA 3D45A 1RLPC 4Q47A 3ESWB 3L00A 3BWGA 2CQKA 1FOWA 1FOKA 3KTUA 1GOCA 4RAGA 2IS2A 1X3NA 3SPZA 4GV3A 5KYXA 4HVJA 2OCCH 1K4TA 4RB3C 2GIVA 4KNYA 3CJ9A 2C0IA 3K4NA 2KJCA 1RAHB 3AVFA 3PNTA 2XHKA 2P8TA 5HRNA 2F4IA 2DTHA 2G8UA 5AT1B 1XSXA 4N76A 4DTMA 4HV6A 1UHWA 3CXCA 1ZQ3P 3QEWA 4HF0A 2WAEA 1TYQB 3S3MA 3O1BA 2V6CA 1ONVA 4DQSA 2A68F 2H8RA 2DVEA 3RESA 3IH3A 1NMDA 1ZLMA 4L9VA 3HK2A 4ZN3A 4V19K 1WRJA 2IA1A 5FRMA 3A2KA 1BBYA 2EQMA 4AC0A 1EF4A 4IIMA 4HT8A 2BVLA 2LT1A 1N27A 4XLFA 1ETWA 2OTLQ 2NRWA 3HM8A 3PO5A 2R7ZJ 1YI2T 1IO6A 4N47A 1VQ8N 1MJ9A 2QQ9A 2HKXA 4K8ZA 1NOZA 2D45A 3BTJA 2VGMA 3O1WA 3M1EA 2ZXJA 1I1SA 5GJVB 2X4JA 3G1MA 4PWDA 1HR0K 1HPZA 3A8HB 5M1NA 3IHOA 1Y0NA 1HKBA 2QWQA 4B1RA 2DTZA 5EG2A 1ZUYA 3VEVA 2CV1A 2VBXA 1BOBA 2L3QA 2VB6A 1VQKN 2M4KA 3FHZA 1M3HA 1P4XA 1IG9A 2BY3A 3HP9A 4KHUA 2M45A 1GV2A 3EEQA 4G12A 3ZXSA 2PMZA 1SKRA 5ADXH 2YKNA 4RG8A 2R57A 3M59A 2BHYA 1U4BA 2E1OA 1LB2A 3QFUA 2OZUA 4A63B 1LCUA 2I5UA 3EYZA 4RGXA 4EJTA 3M0PA 1N8RR 3QP5A 1YJNN 3TOAA 2P9PA 2EQJA 3FK6A 4PKHA 1YTYA 3DXJF 1ZGWA 3FRNA 3CCEN 1EV7A 4FISA 1NZ9A 4KH6A 3LPUA 1ZG5A 3RUXA 2K4BA 3EG9A 3WVEB 2H6BA 3CD6A 1FYMA 3LA7A 4HLXA 2RDPA 1VIEA 3QKJA 3HUGA 5AYFA 4YY3K 1YN8A 2FX0A 3HI0A 1NHAA 1LFPA 1OU9A 4XLCA 4GVMA 4EP4A 4FWMA 4DWIA 1OPLA 2LMDA 3ENHA 5GAN7 3LL3A 2VLAA 2E5NA 3MZ8A 4B24A 3OYCA 2L2OA 3HXLA 1U49A 3PX6A 4CYCB 1AHDP 4I2PA 1UHSA 1WHKA 2HQRA 3MEAA 4M7DE 2QM3A 1KFZA 3J81O 2M4GA 3DPUA 4JI3K 1RTDA 5LJVA 2IVMA 1IXCA 3SFIA 1T0JA 1UOCA 4DJAA 3AFHA 5C15A 2X4XA 1KG6A 4CEOA 1KQ9A 2BE2A 1T56A 2CMPA 1MNMC 1I6XA 5C0MA 4QTRA 2CYYA 4KHYA 2DXTA 2PLYA 4RAZA 4KV8A 2YJFA 1M1KU 3SV4A 3ZMZA 4HNVA 3G73A 2H6CA 5JS2A 5L3FA 2MH9A 4Y15A 2KT8A 1TLHB 4ELVA 2EINH 2HHSA 1K76A 2RJFA 4C0DB 1W4SA 2E64A 4RB1A 5GMKj 4C8OA 4U0VA 4I01A 1JLCA 2RQWA 4CHQA 3C1DA 4CIGA 2QDYB 4S05A 1RBSA 4BREA 2FBIA 3AL0B 5M3FJ 2BANA 3N05A 2LBFA 2LNVA 3RYPA 4ZDLA 1NBEB 4CGZA 3DU5A 2LZ6B 4XMYA 4BQLA 3HIFA 4RTFD 1O3RA 4IEEA 1VQNN 4ILGB 3C2BA 5KCHA 2FC0A 3TTDA 3A5MC 2Y69H 4RCHA 1TTYA 2I7NA 3H41A 1VAZA 3L3VA 3VS2A 4L5EA 3MZYA 3MFKA 3PV8A 1VSEA 4M7AA 3F10A 2QSHX 1ETKA 3VQEA 4ISGA 1POGA 3KETA 5FPNA 4IEJA 2CFXA 5K14A 1QRYA 3TAGA 4ENMA 2HBWA 4O5BA 5BREA 4JK8A 2WTEA 3HKZA 3DKXA 4G6QA 1MDMB 3ZGKA 1SQKA 3OYFA 2ACJA 1WHHA 3T7ZA 3JRAA 4WE1A 4ZTFA 1VQLI 4XTXA 5CAIA 4B9UA 1U78A 3CC2A 5F1XA 4A57A 3A98A 1WGSA 1HOMA 4HQEA 1VQPA 2P9SA 3MX2A 3QPHA 3I5UA 1IKYA 4FWSA 3DFGA 5CVRA 3QRFF 1CF7A 1Z3YA 2E2JJ 2NWMA 1E4FT 2QEXA 2IA0A 1EZZB 4HWIA 1RTJA 3JSCA 2W40A 2HVRA 1X2QA 4EMKC 2K40A 2ED0A 5LJ3e 3NH1A 5TJJA 1J9AA 3QYEA 3ATVA 4CJTA 1X3WB 1NNEA 4BR9A 1Q86R 2G8IA 1YNZA 3KP5A 2Q8KA 4CF8A 1XOVA 3TQNA 2WOMA 1HKTA 4IZ9A 4LK1F 1IDZA 2YV0X 3VS6A 3F6OA 1ZSZA 3I56Q 1KD1C 2D1HA 1WQWA 3AG4H 3AVIA 4HCZA 3M0QA 2E1MB 5K5OA 3C12A 3ULQB 1TXQA 2XK0A 1QWEA 3EGDB 3VOVA 1V4RA 1LQ1A 3DEEA 3SUPA 2IDOA 3RKYA 3RMDA 4HF2A 2HKOA 2ASPA 1ZC6A 2WBNA 4AU7A 3F9MA 4ZGJB 3RZOJ 1B9MA 3M58A 1UA0A 1TKXA 4FCYA 4M75A 4CE9A 2DMUA 2YLCA 3QDFA 3M8SA 5GANj 1VIFA 2Z33A 4KUMA 2ZPBB 2D0PA 2E19A 5DYMA 4IURA 2KQ2A 3TMOA 4DSKA 2ZPFB 2JWLA 2D9TA 2UXXA 5M1OA 1NPRA 4R79A 2P9PB 2A1SA 3H46O 2FA5A 1GDTA 1FY7A 2A40A 3CWAA 1HMVA 4LITA 3TW6A 2AK5A 3DWLA 2JWKA 3PX0A 3K4KA 4B44A 2QVOA 1EO1A 5HLFA 2V1RA 1PP7U 3CPWP 3MEDA 1B72A 3HRGA 4PGGA 1UEBA 3AO2A 2FSNA 2ITGA 2MPXC 4Y28E 1ETVA 1NJIR 1B9FA 2JT1A 1W5CC 3H5RA 1ASUA 2Q1NA 4Z4CA 4CZZA 5E41A 1X1AA 4DV0K 5FLXO 1SUQA 1I4K1 4M77C 2RKHA 2XF5A 3LM2A 2H94A 1MPGA 3VSLA 1BU1A 5TRDA 1QU3A 3M5RA 1D9FA 3P4IA 4A5AA 4A5BA 1QBJA 4CJ3A 3J80E 4LNPA 3NBPA 1SZ2A 4A59A 3CMMA 4FJ7A 3KXTA 3RSEB 1XCBA 3V9SA 3IKMA 1SV5A 4DHYA 3WT0A 2XVCA 3VGKA 1XTAA 5D6XA 3JSMA 3CF5F 2R7VA 1C0MA 5DD8A 2KHMA 2W48A 2LX9A 3LSRA 5ERIA 1NM1A 1YJ9A 4B6MA 3O9UA 2CP2A 4LF4K 4KAZA 1P6RA 5GMKl 1QP2A 2JN6A 2YS9A 1VOMA 1FIPA 1L3UA 1R5GA 2I2LA 4DSLA 1SEMA 1GLEG 3GZ5A 1NBWA 2DW4A 1G3SA 3RDIA 1CKAA 4JLHA 4NB4A 1A5JA 2KKZA 1WI3A 3MWPA 2CUZA 3RWUA 1JKRC 4X1VA 2P0KA 1K73C 2JXBA 2G8VA 2AKKA 2NNWA 2FEIA 3AV9A 4JKAA 1J54A 1WFWA 3KD5E 1BQMA 5AJ3K 1JCFA 3NGPA 4FM4B 1D9DA 3O2PE 2E4LA 1ZBHA 4LE9A 1FMVA 4CH7A 4FLVA 2D1XA 3E19A 1KAZA 1LPQA 2JW4A 1OU8A 1KQJA 1W2BA 3NQOA 2LF8A 3K58A 3DEUA 1ZBJA 1KQ0A 1ZG1A 2HSPA 4DV4K 5GAOq 4D5CA 2LDMA 1WH5A 4MHGA 4EPCA 4XONA 1TK8A 2OPRA 2RHXA 5D6EA 1IGNA 1Y96A 1VQOA 2R7TA 4BXUA 1XDUA 3TWHA 4I7HA 1K8AR 4XLEA 2V1NA 4GCVA 2EJRA 5B1AH 1X4OA 3WNFA 1TUYA 3ID6A 2QQ8A 4RKUE 3VYHB 3CC4A 3RRHA 1W0HA 1SG5A 1OPKA 2WAQA 4DTNA 2DMTA 1A36A 5GMKh 4L8RB 1U48A 4CZMA 3BGRA 1GCQA 2E5QA 3O80A 2MMPA 3H35A 1R23A 3G71I 4K8XA 4BDZA 1O1WA 4BRLA 1YIJN 4J01A 3PFIA 4B1UB 3M8QA 5IT9K 1YW9A 2FNAA 3S2DJ 2I8DA 3CJTB 5LJ3d 3TAMA 4YFUA 5B8HA 3DM2A 1QHTA 1ZYRF 1VHXA 2CV0A 1N5YA 4RTWA 1MH3A 1NG7A 3PMTA 3MKLA 4AH9A 3FGUA 4C2UA 1TS9A 3K5MA 3NWSA 1M30A 1VQ7Q 4CHYA 1S72A 2D4WA 3I5RA 1UGPB 1V54H 3KLGA 4DF4A 2E4HA 1T3LA 4KKOA 2QUFA 3VTHA 4ANJA 3RRGA 4A3MJ 2FB7A 5JVGF 1NU0A 3HVRA 1K9MC 2EZHA 2EIKH 2RA2A 1XNRK 2DTRA 1TWHJ 5FU6B 4ZJZA 4OLBA 4NL2A 3CCVT 1UUEA 2GBZA 3MEXA 2DD4A 4S04A 1YJNQ 4OFAA 3L2CA 4YTLA 3M6GA 1QO0D 3I64A 1W1FA 1F36A 3RMSA 3QWYA 1JLQA 2PZ1A 5IT3A 4FJ5A 1RAGB 3EGXA 2ZPIB 3TKYA 4XRFA 2DJNA 2LKSA 1QQOA 3BDUA 1R4MB 2ZB9A 2QSFX 1VQPT 3LSMA 4Z2YA 1T95A 3O8VA 3LDQA 2O6GE 2P5OA 3EFSA 5ILVA 4E1MA 2KZGA 5CQEA 5KN8A 1S1XA 1IDYA 2E36A 1NK9A 2FBKA 2OTJT 1RT3A 5GIOA 3JRHA 1PVEA 2P9UA 1Z05A 3Q0WA 1OKJA 2WUSA 2DK8A 5BMZA 5LJWA 4B9QA 2FZKB 2KHOA 4MTEA 4FU6A 4EM2A 4RGSA 3QFPA 3HBTA 1D0YA 1YJWI 2FZGB 3R9PA 5SWMA 2KSSA 1SSHA 3PTAA 3VWBA 4M3GA 3CBOA 2V75A 5AR0A 1AKHB 2O4GA 3WUHA 1JGGA 1QVPA 2OAWA 2NOJB 1BC7C 2XB0X 4U7DA 1IN6A 4KUDK 4E7ZA 2ISZA 4JKFA 3C7NB 4JK1X 3NAUA 3HGYA 1UGVA 2QSGX 2EYXA 5KYWA 2HQHA 4KIFA 4OIPF 3N0UA 1ZSZC 2K85A 2MLGA 4C1NI 1T7PA 3GFMA 2K9SA 3OJSA 2M30A 4FYDA 2O8CA 3FC3A 1X4PA 3CMEN 4ORZA 2BVMA 3GBGA 1YJWT 4CZIA 1WEIA 4M78B 2H1LA 3HOXJ 2KL4A 4E7HA 2RMOA 1TG0A 2VG6A 3SHFA 3GXOA 3E1YA 3QODA 1U5TB 5CKBA 3CD6N 4ZGDB 2UUCK 2DPUA 1NH3A 4CGIA 4J7IA 4OMYA 2CW8A 3E6BA 4UVCA 1HKSA 4HX7A 4CFAA 3VQCA 2G8HA 1WLPB 1NTCA 3JCMf 3K9TA 2DY4A 1R71A 1HRHA 3QUIA 1SMYF 4BRMA 4AWXB 4DTSA 4XBFA 2M7BA 3EUHA 5C3EJ 1DDNA 4UY8I 1WNLA 2LC4A 4BRQA 5C6SA 5DM6F 3DXKA 3JCMJ 1LV5A 4OMLA 3LP0A 2DOEA 1K9AA 4Z4GA 2J5PA 2GOXB 1JGSA 1YUWA 3UF4A 4E0DA 2UUZA 1AKHA 1KSWA 4G6TB 4BDPA 1K8KB 4DFKA 4CCMA 1JLAA 2E1NA 2BHZA 3RPQA 4OPAA 3QESA 3B73A 2JN0A 4V2SA 3AGKA 2LMJA 2ZJPF 3NH0A 3CBMA 2B86A 3FR0A 5D3GA 4HAMA 1FMKA 4WCEL 1KVCA 3QBXA 1TKTA 4DKWA 4FK4A 1MHNA 1T03A 3VYGA 4IOAF 3HRSA 3L9FA 4V19S 1NGIA 4Y1DA 1S3JA 1BB9A 4I2OA 3BLYA 5FO5A 4KREA 1FT9A 1MNEA 3AAQA 4HUEA 3SQ1A 2GQQA 3QYHB 4EVIA 1VSMA 4E9HA 4D1QA 5KVRA 1SEUA 2QXFA 4C8QB 1ZSGA 5I11A 3AVHA 1FYNA 1VSHA 1BW6A 4JI6K 1P7MA 4CJSA 3SWNA 4PJOC 3VRYA 3AVNA 2CP7A 2K3XA 2O8EA 1WHMA 3K59A 1X1BA 3QNOA 3JCMe 5C2FA 4ISEA 1WIEA 1X2MA 4I9QA 2GXAA 1IJWC 4MFDA 3GPLA 1YQAA 4Q5WA 2V8KA 1EIFA 2D0AA 4C2TA 2ZJRL 5GAMf 4HW0A 2E2QA 4EJYA 3JV3A 3SD4A 2FVUA 2LLKA 3I56T 2VYTA 5BRFA 2VIXA 3MCPA 5E79C 1B07A 4EZ6A 1H92A 2Q97A 2YNGA 3DLBA 4DTRA 3KEYA 2O4XB 4H5TA 2Y0SN 3LZJA 4I0BA 2NYXA 1K4US 1X6BA 3I0XA 2CP5A 2RQTA 4XTYA 3H3NO 3BCBA 1ZA1B 4CJWA 3E9LA 2RQQA 4EDUA 3AA4A 4CD3A 1PNJA 4OKJA 5LJ5g 4B1VA 1PU7A 1EA3A 4ZDOA 4C92B 1S7OA 4J6XA 1K6YA 1YIJQ 3H45C 1KC8O 2G8FA 3DB3A 2E2OA 3DKYA 1FBSA 2RGVA 2RQRA 3M4GA 4OPKA 1KG5A 2VJ4A 2M7AA 1PD0A 1FJLA 4NC7A 2BW3A 4DIQA 2K4JA 2M5WA 2PBDA 2ZXHA 1O13A 1VQKI 4BY6B 2MAMA 2BE5F 4PLLA 4H5NA 2JHJA 4BUPA 3G4SN 4AM3A 3ULEA 5HKCA 4EHTA 1U3EM 3I0SA 3C7NA 4BDYA 1EFNA 3P8BB 3CMET 1QZYA 4JX6A 1QWFA 2OF7A 3VS0A 4OIQF 2IIRA 4LMYA 3HJEA 2HBLA 1W7PD 1QHGA 4M3BA 5EOYA 3L8BA 4JKGA 3FM5A 5ICFA 4M78G 2OYQA 2ELJA 4N41A 2D0QB 1M90U 1RBUA 1G5VA 3K2PA 3A4CA 2SEMA 3WXJA 3V8LA 2A3SA 5LJ5f 3IP4B 4BC4A 4HXJA 3CO6C 4HQMA 2LDUA 2FSKA 5HODA 3H3VK 1CQTA 1BR1A 3IV5A 5L3DA 4CF1A 5CQXA 5ICEA 4KA4A 4O0JA 1VSKA 3RIRA 3M3ZA 3JRCA 3K7AJ 4ZN1A 2CZ1B 1R58A 3Q0UA 3SZGA 2X1CA 1RESA 2DDBA 4ID5A 4C23A 4NO7A 2ZCWA 4CD1A 4A54A 5KYYA 1KFSA 1OCRH 3VS1A 1YQMA 3NARA 3JRZA 2CO5A 4Z89A 2WC9A 2QA4T 3RPUA 3G6EQ 3KP4A 1KD1O 5J39A 4DS5A 4ELZC 2DEQA 3LWFA 3CCSI 4Y0WA 4A5NA 1NJIU 1U2VA 1LDJA 1BN5A 4GKKK 1RBRA 3R6SA 4X0GA 2FOKA 1SL0A 4XLHA 3F5TA 3TABA 2F5CA 3UA6A 2OTJA 5C44J 4W5OA 1I5ZA 2LKXA 4J8OA 1H3ZA 2L89A 2JQ7A 1N8RO 5J2QA 4G6DA 4LD6A 1C1BA 2O8CB 3RR8A 4Q5SF 4CGHA 2K02A 3PM1A 3AVCA 3I55I 3VEZA 4GYGA 2M8GX 2QA4I 1E7OA 3G4ST 3MN2A 1GVJA 4JPBW 4DBRA 3HHGA 4BXXJ 1QCNA 2Q2RA 3ABMH 4A69C 3CYMA 4EEFG 2Y2ZA 2COBA 4G7OF 3JCMh 4I6MA 1MBJA 2RAEA 2EFIA 2EYYA 4DR6K 4KN4X 1B3QA 2ENMA 3EZWA 3KP2A 1SHFA 1YFNA 1PYVA 1TGOA 3I71A 3BR2A 2WB1N 4M78D 3JRIA 4Y17A 3DF8A 2GBQA 4D7NA 4IOCF 1J09A 3P39A 4FWNA 2PUOB 1LWYA 4EQQA 4EATA 3D7SB 3FXLA 4J6WA 3OYJA 2QLZA 4JI5K 4HX8A 2RHYA 2CQXA 1JUMA 1ZGAA 4E7IA 5I22A 1Y0MA 1NK2P 4IX7A 5CCAA 2NRRA 4FE7A 1LCKA 4IFEA 2G7UA 4OVAA 4IHYA 2LY9A 3WEEA 4QQ6A 3DLLF 2ZJRF 1HNIA 4IDKA 2ECBA 1VQ9A 3CMEQ 1MJBA 5F0CA 2ZZDA 2LQNA 1UB4A 3TREA 2XGCA 2Q0RA 1K4SA 2KRCA 4AYBA 1FK9A 3A01B 3OWTA 1G83A 3DLKA 4QS7A 1LWWA 3MQ0A 2FQ4A 2F5VA 5GAN5 3CC4Q 4IUPA 1TW3A 1Z3XA 3K70D 2GXBA 3FDRA 3LDNA 1EXQA 1OVQA 5TISC 5CKFA 3INZA 2EFNA 4X65K 4ELTA 3BF3A 3JCMg 2VXEA 1PVSA 2YLBA 1GCQC 2LCLA 2RKIA 3T3FA 2XY5A 2K5IA 1OISA 2DN0A 3V1RA 3E5QA 2OU2A 1QKXA 3E0JB 3VEXA 4YPRA 3K4LA 2P9KB 1SPKA 1QSLA 4XLPF 2ASOA 3C7JA 2YRDA 2IT0A 4M78A 2O9SA 2DA4A 5LRSA 3K5NA 1EH6A 1DUXC 5F0XA 3IS9A 1BKBA 4JAXA 3W3DA 1QVGM 2MWOA 2NRVA 3ZSRA 3MP6A 1KYZA 3AKZA 5GAEJ 3LM9A 1S7AA 4CIEA 1OCPA 2EX3A 4P9FA 4M78C 2FPEA 2E70A 5JI6A 5KHDA 2YHTA 2PQ8A 4FT4A 4W5NA 4FZZA 3CBPA 1F1ZA 4WK8F 2EGCA 4KH5A 1V5EA 3QERA 3BC8A 4I6ZA 1Q81C 3KZBA 4D5FA 2D0BA 4HVWA 1AHJB 1TTHB 2QTVA 1E17A 2JUGA 2NUZA 3NF8A 3JYTA 3M07A 2VPLA 2UXDK 2ZAEA 1LJ9A 2E2IJ 4YOWA 4AI5A 2DIGA 4CC3A 4FYWB 2HVQA 2LG4A 3GDQA 2ZBKA 2M2EA 2QKLB 1Q1HA 2EGAA 5HK3A 3R60A 4CA0A 5CKEA 1ZAOA 4EGZA 4PY5A 2K7LA 2A6HF 5J47A 3BR0A 1Z9ZA 2X51A 1XMKA 2GTJA 4CZGA 4B23A 1JJ6C 4FLZA 2ZSIB 4GV6A 3WTWC 1D5VA 3VQ4A 1ZX6A 4I99C 1NK5A 3OOPA 1QMCA 5GAOm 2DRMA 4X62K 4Z94A 3O9SA 2YUPA 1XSDA 4B3RK 1YVNA 4U7BA 3CG7A 2CP3A 2KPMA 3IAYA 2K4YA 4WXCA 2VXZA 3HSTB 3CMAT 2E7XA 1LE8A 3SYZA 4H0OA 4QS9A 2LRQA 4OJRA 3C2GA 3VQ5A 1RAAB 3J81Z 1VQMQ 4OU0A 1XGOA 3VS4A 5F64A 2E2NA 4M42A 4OFEA 3FHGA 5IOZA 2DODA 4JK7A 3CJ7A 4QS8A 2NOFA 1V55H 1CSKA 4O44A 2D2WA 3B6OA 4R0KA 3MECA 4Y13A 1BK2A 4BVOA 5LBQA 2STWA 3TPQA 4YHHK 4LF7K 3QU3A 1KVAA 1SS6A 3JCMb 1D1CA 3BDLA 3A01A 2KW4A 2HKNA 2VYPA 4KITB 4XL9A 2ME0A 5J8FA 3TSWA 1WSEA 3S93A 1M1FA 3MMYB 4F9OA 1ESVA 2FXAA 2ROTA 2RF2A 3LH5A 5D6FA 3P5JA 2K9GA 5FRNA 4DYQA 3J7ZI 2M16A 4ENKA 2G9WA 2ZGZA 1IKWA 2DT6A 1OZ2A 4FLXA 1NM7A 2A7YA 3IUOA 3TTFA 3R8EA 3WQTA 4IHTA 1VYVA 1Y57A 3GW2A 4XN0A 2M02A 2LVMA 2DZCA 4HNTA 3L6QA 4UNOA 3FMSA 2O31A 4FK2A 4CIFA 2EZKA 3R6NA 1JLGA 4JI7K 3DKMA 2HQAA 4LUEA 2HOEA 3K9JA 3SUQA 2DXUA 1MMDA 2ZE2A 4RW8A 1D3BA 5E1ZB 4CC2A 3JCMP 1G2HA 3F9KA 1WSGA 2LJ1A 4U0WA 1PCXA 2DXCA 1XMXA 4GRIA 1QHAA 1SD5A 3F6VA 3WNHA 1NGNA 2I5JA 2P9KA 4DW6A 4J83A 3L2ZA 4IZZA 2O3FA 5JHFA 2X6XA 2VG5A 3DRRA 1M1KO 1WQ2A 1EBMA 4L5IA 1X3MA 1MIJA 2DF6A 3VEYA 1BIBA 3OS5A 1RFQA 3SPYA 4KICA 1SL2A 2IPOB 1VQKQ 4ZH4F 4DK9A 1EH7A 4F7ZA 1RNLA 3BG7A 2GBYA 3I4NJ 3O5BA 1XDSA 3MWTA 2R5ZB 3CC2Q 1R0CB 1GOBA 3F72A 2Q3SA 1LUJB 1ULYA 3OTOK 3HOTA 3GZ6A 2LH9A 3P8DA 2GTDA 3S1QJ 3EE9A 3X26B 1ZLJA 3OSFA 4FLUA 3CCQQ 3QG1A 1BR2A 1N78A 1HW1A 4N9HA 4I9LA 5HLHA 1KIKA 5IH2A 2KE9A 4LDVA 1OH6A 2PFUA 1UCRA 4YELA 4N4GA 1OH7A 2L7MP 5J3LA 4P96A 4B9SA 2O03A 1JE8A 3J81K 3G6EI 1ON2A 2VE8A 1HX1A 1KAYA 3C95A 4HUGA 2X48A 2D5RA 3B6PA 4DYRA 3LAPA 1FW6A 3GLLA 1O75A 4M77B 4LJZF 3R0JA 4JOMA 1M1EB 4IXAA 1X58A 3GVAA 3X20B 1CKBA 2HNIA 3VEWA 4LDUA 2XGXA 4X6AJ 6AT1B 2CT3A 1SAXA 2LF7A 2NOEA 2HXOA 5GAOn 1AOJA 2E3HA 4CHUA 1C6VX 1GVDA 8ATCB 3LSPA 3OSGA 5ICCA 2EFWA 3M4YA 4CGGA 3EGXB 2I0NA 3VYTB 2KLAA 3LAJA 3EPZA 1R36A 3QU6A 3ASNH 3QYFA 3GCMA 1Q7YU 1DPUA 4F2RA 3WXMB 1ZBIA 2EQKA 3VA0A 5LHIA 4Z4IA 4BVPA 5GTIC 3P38A 2F9WA 4LF5K 3ZETA 2MLKA 4FK0A 3TO9A 3EG2A 3T1YK 2QZ8A 2CUDA 4CCHA 2L4AA 3LP2A 2EJFA 3CWUA 3EETA 1NKUA 4EGYA 4M77F 3LOCA 4DYCA 2YDLA 4M77D 5DM6L 1J7KA 2CJJA 4BG9A 2IA2A 1QCFA 4RW7A 3GFIA 1KG7A 4B9NA 4MMKA 4ILHA 5JMVA 1M3QA 1HSJA 2JPSA 2NYSA 3P8HA 3AVMA 4IJNA 4DB3A 2F4VK 1IB8A 2DYBA 2NRZA 4BU2A 2LQKA 1NG2A 1S1VA 4C5IA 3CCLQ 1YJWA 3TAFA 1CZ9A 1K61A 2EQUA 2ISYA 3OYAA 2O4XA 1OI1A 5DM7L 3C6HA 1RDUA 1B4AA 4BJ6C 1ITYA 3VFZA 3ZQFA 4CJVA 4C92F 2J5OA 1YTAA 3SFZA 4DV5K 2JVHA 1VRTA 2HPMA 2NXNB 4CESA 4BEHA 4KHPK 1KQSS 1KC8C 4NLBA 2ZNYA 2Z1IA 3QMLA 5KPRA 3THWA 3E01A 3JW4A 2XAFA 4NQWB 1SVMA 1G8XA 2HD0A 4B9LA 4RLQA 2QTDA 1X2KA 3K70C 2J6KA 4WQ4C 2BY2A 5CVJA 1ZBLA 2VOPA 4WCGA 2QGFB 3GBQA 3KPHA 3OYBA 3QLHA 5M1FA 1KEAA 4C8QE 5K7HA 1USSA 1YJWN 3MN6A 3QETA 2PZSA 1A0NB 1YW7A 4DU1A 3JRBA 2MH2A 2UYTA 3DWLE 4DCHA 1Q82U 3URGA 5FWBA 1D1AA 3RVCA 1ZG3A 1I39A 1YJNT 1IAWA 1F5TA 3E3VA 2PI0A 1KVBA 4CFBA 1TNSA 3CC2T 2X0LA 3TVTA 2H8HA 5EGOA 3G7ZA 4KHWA 4CECA 3JSOA 2QEXT 1WJBA 1K1ZA 3RNJA 2F8TA 2CW0F 1Q18A 2G7HA 4L0YB 3A8GB 1MDUB 2P9NA 5CLSA 3O4WA 2MC4A 4XRMA 1DU0A 3OW2A 3KFWX 4O5VA 1WXUA 2L0KA 2RB6A 4Z8AA 5K7ZA 2DL4A 2F69A 4PSXA 1UG0A 2HL3A 4KHSA 1RRQA 4BE0A 3V8KA 2RPIA 1V5GA 1FJGK 1GLLO 2RHZA 3CCQA 1T3SA 3SAHA 1YJNI 2HHWA 3EKUA 1NGGA 1JB0E 1W2BS 3J7ZO 3V4IA 2AJQA 4A0YA 4M9SA 3H1QA 1CXUA 4FYVB 3KYDB 4FLTA 4B48A 5F0FA 1S9HA 3M54A 4LD9K 1IZ1A 2CWEA 3WE2A 2HZTA 1K7AA 3MN9A 3P83D 2NNNA 4B43A 3KJVA 1XNQK 4IOXA 2VJ5A 4BGDA 1NK4A 1NPPA 4TSXA 5A2QZ 1IGQA 3G10A 3ABKH 5DCFA 1U5TA 1WSJA 4E9EA 5FLXK 3RMCA 3PIPF 1ZR4A 4CZKA 3VF2A 2LTPA 3PUBA 3W2VA 4OX9K 2MD5A 3A8MB 1U6ZA 1RT2A 2KK4A 1M90R 5IHNA 1J2XA 3TCJA 2LX7A 3MP8A 4FW2A 2DYIA 2J4RA 3F8FA 2EHGA 1XUPO 5A2QO 2MA3A 1NYGA 1ASWA 4IUQA 4I76A 1B8IA 4D8DA 2ZJ2A 1DU6A 3TSZA 5GAN4 4CBXA 1XX5A 3L0QA 5GMKe 3KZIC 4A3BJ 1V3FA 3BY7A 4H0PA 4AT1B 5DK5A 3N4MA 2OANA 4DOZA 2K5FA 3KE2A 4RTYA 2A28A 3OVNA 3W0LA 4XM3A 1TBXA 5E1WA 4BWMA 2XF6A 1VQLN 1DTQA 4DR4K 4BY7J 4AIKA 1BI0A 1F4KA 4YFXF 2DO7A 2M51A 3E6CC 1JHFA 4FJNA 1H88C 3GTKJ 4E9FA 1NJYA 1J9IA 4AUXA 3E2UA 2CRGA 3QPTA 2HYJA 4FM0A 2HU9A 1TUCA 4O6JA 1ZKGA 4CI0C 2HHUA 4XEIA 1VQNI 2P5VA 3CCLA 3T0YA 4LIVA 1X6GA 4KFCA 4XKCA 4FLWA 4FZYA 4BRDA 2ZFUA 4M75G 5FGMA 2DLLA 1UA1A 2ROLA 3AG1H 2EIFA 1W1WE 3CCLI 2O9LA 2EFPA 4EA4A 1V29B 3P9IA 3I8BA 1WBDA 4G9YA 3H3UA 5GANg 1VSDA 3PX4A 2WC2A 3U2RA 1ZUKA 1KG4A 5AIQA 4DQIA 4O5FA 5B5EC 4PZJA 1FNNA 3O8GA 3GTGJ 2NOBA 3E9PA 4IQJA 2QKMB 3MXIA 1YBYA 5LL6S 3UNGC 1SL1A 4AHVA 4CRIA 1S29A 2XASA 5L3EA 1SC7A 1RKTA 3PNWC 4XK4A 2DA3A 3H5AA 2CREA 2EWSA 3CC2N 2X4HA 2WB1A 4WQ5A 4X9DA 3FLCO 1I50J 1YI2Q 3TAEA 1Q7YC 1X3ZB 3T8RA 4HCBA 4OMQA 1P90A 3OL3A 3CFOA 2NAZA 3R0AA 1YS6A 4UVBA 4KTQA 5FLMJ 4DQPA 3PO4A 5GPCA 1DLOA 5FKMA 2E8AA 2FD5A 1AWWA 2R93J 3NF6A 4W1UA 5E3OA 4P5OA 1MNDA 1L3TA 4NUBA 4FETA 3AA5X 3ZMDA 1PU6A 4ZYHA 2ZD1A 2KIQA 1ZGJA 2E65A 4BACA 2OC6A 3CCRT 4AD9A 1X9SA 2F2EA 4KB0A 1YITA 3ZSZA 2R92J 5LGTA 4BR0A 3A8YA 3VYRB 4A3DJ 3VB2A 2JJ9A 2H56A 3ZBDA 1GBRA 2KQRA 1NJIO 1JXBA 1UHFA 2O8DA 2CGKA 1RDBA 4QPOA 2XY6A 4RBOA 3CPFA 2V51B 3LDLA 5C10A 5AQRA 1S6PA 1WSHA 4NC6A 2IJLA 5H6RA 4CICA 1A35A 3QP6A 5BNGA 3AO3A 2MIOA 2A5YB 3PQKA 3EH1A 1IF1A 2DPNA 4EMHA 2MBFA 4CZJA 3FKJA 2H3EB 4BNCA 3O6BB 4E7JA 3BPVA 4AHTA 2CV2A 3ZEUA 3LWMA 4A12A 4CHOA 4XNFA 2F5DA 5M1KA 1V5FA 2ID3A 4K2EA 4JLIA 1KRPA 3LLRA 2MGQA 3T19A 4FWOA 4S0HB 1M1GA 3ULRB 3CW7A 2GTOA 2Y1JA 2HVIA 1K8KA 4OMOA 1VI0A 1JXSA 4FX0A 2QTXA 3H0IA 2Y1IA 5AZIA 1HYOA 3VA3A 1ENHA 2D1KA 1B7TA 2DZ9A 4CCOA 1IKXA 4DTXA 1IN7A 3OH9A 2ZQBA 2DBKA 1IHVA 1TU0B 3O3HA 1IN8A 3OYYA 2XC7A 2WY7Q 2FOWA 1NMNA 3QO3A 3M8PA 3UKUB 3OYMA 2KT0A 2Z0WA 4B1YB 2LD5A 1NKBA 1YAGA 1OULA 1ASVA 5E3NA 3K10A 3M0TA 3WEEB 5LJ5j 4A2BA 4PL6A 5ED4A 2YNIA 2DVJA 4BB7A 1NGDA 3TO7A 2RNJA 1MUYA 2L01A 3M0RA 4IJAA 1TUDA 3BR6A 3TGNA 5F1RA 2DERA 3I9QA 1R59O 2B7EA 2JUFA 4YIIA 2DJZA 1JJ2P 3OYLA 1IN4A 1FYLA 2KRMA 3N4QA 2OV7A 1Q82R 5EZGA 2O8DB 4PJOG 1Q95G 1KG1A 2RN8A 4E19A 2E71A 3H0GJ 2L3PA 2V1UA 4PL8A 1M90O 3H3OB 1DTTA 2HQEA 2CUFA 4N4IA 2BZ8A 4HG2A 1RT4A 4FPAA 3ZT3A 2HW3A 3A2FA 3QDKA 1WGXA 4G7ZF 1NGEA 5FLXE 4ITVA 2KTQA 2Y0SA 4CUGA 4DQRA 4BC3A 1VQLA 1T44A 4A61A 4OP0A 4BQZA 3QWLA 3OY9A 2IAIA 3EH2A 4O55A 3CPWM 2A07F 4ILJA 1NJXA 3SEZA 2VQGA 4WF2A 1VA7A 3CC7T 5D4RA 2R7YA 4F55A 3D5LA 4HDVA 3CETA 3G1OA 3KK7A 4QT7A 4IG0A 1XGSA 5ADXA 1I6HJ 2R7XA 2B9SA 5F27A 1BU6O 4XU3A 3QOEA 4FJ8A 3RCOA 4OMPA 5M9OA 1YCSB 1KQ1A 3IL2A 1PG5B 3NFAA 1U8RA 2M0CA 4FSVA 2KISA 2NUTA 4B3MK 2DA9A 4PJOF 2CGPA 4JS4A 5CKHA 3OR1C 5GINA 1VQ4I 5AQQA 2KIUA 2X35A 2YR2A 3NTKA 4LSNA 4ASNA 3SFMA 3P1GA 3A03A 3OYHA 2RI5A 5IP9J 3OA9A 5GMKi 2BTFA 4IO9F 1SKUB 4KI6A 2QKKA 4M63C 2CQNA 1MGQA 4M7AG 3F8MA 5K5RA 5CVUA 3D6RA 3CCSQ 1M3CA 1WZOA 4MDXA 2G3RA 3MWMA 1KG2A 2YG9A 4DGWB 5FFZA 1Q81U 2Q0OA 3UATA 2CP0A 3CCVQ 4R56A 2E34A 4NQWA 2ZGYA 4YNQA 3V9UA 3C94A 3NHNA 5LJ3f 4OFHA 4LFUA 4EFHA 2A6EF 1NLOC 5D6WA 3JXUA 3SZPA 4JI1K 3KX2A 3VOEA 4MO7A 1PP8F 2KROA 4Z02A 2K5CA 2QAZA 2JNGA 1N6QA 1D4XA 3OYNA 4I7FA 2QWOA 3D2FA 1MH4A 3S3OA 1VQNA 2XGDA 2FRYA 2RH2A 2OZMA 5AQWA 1XQOA 4KMUX 1YIJI 2GX9A 3X25B 5BR9A 2HOAA 2ESHA 2P5LC 4CJUA 1CXQA 1Q86U 4EMGA 2Y48A 2CQQA 3DOKA 1Q9XA 2DK5A 1UB9A 1VQ5N 5L3CA 4II1A 4AILC 1OFCX 5IP7J 5AQIA 1AD5A 3KFVA 2X6OA 2V7YA 1WJFA 2L0AA 5GANf 4EVVA 1QQCA 3D2EA 4IO8A 3JRGA 4QVCA 2BUPA 1BJAA 2P9NB 2NVQJ 1UTIA 4NZGA 1NYFA 4KMFA 4AF1A 2OTLT 1VYUA 2V7FA 2RJEA 3CC4I 4KGXB 3DBLB 3HGGA 4WWCA 2IW5A 2IGNA 3DLMA 4BXFA 1CZBA 1DGRM 4KT5C 1KU7A 4CZEA 1ZTRA 2MW8A 4I09A 4A3KJ 3SAGA 1YIOA 2VE9A 5FKNA 3QYGB 3PMIA 2J05A 4ZYEA 3CCUQ 2O8FA 1NGFA 1XNIA 4B1WB 2G0EA 1IH7A 4BI4A 1NKCA 3CMYA 1LOTB 4AM6A 2CFOA 2WV0A 2RREA 1SAZA 2BXYA 1RKWA 2QF7A 2OPSA 3NF7A 3L1PA 1R1TA 2BZYA 2KYMA 1V1CA 3G1LA 4ABZA 3J80O 3H6ZA 4ZYDA 5HVQC 4CEAA 1W2BP 2R58A 3QSUA 4ETSA 5LJ5h 1KA8A 4EHUA 5E3MA 3ERED 2DDAA 4PJLA 3HP6A 3ZT1A 4D0PA 4GYIA 2JM9A 3G71A 1GBQA 4QAGA 1VQ7N 2WADA 3GX4X 2R7SA 3TW7A 1W0UA 3I55T 3X24B 1VQKT 4GVEA 5BPMA 3OS2A 3FHFA 3HG9A 1BIUA 3V9XA 5GAMe 3UE5A 1ETYA 3VQAA 2YG8A 4NNJA 4H4KC 3PIOF 4XH1A 3H1CA 2XDBA 4KDPA 2A61A 4IRGA 4G7HF 2XGEA 2B6AA 3REBB 1U0JA 2P51A 1YI2I 1VQ6Q 2KFDA 4R5PA 4C8NA 1M3AA 3ISNC 2RJDA 4BRFA 3SUOA 3WTYC 2XG8D 4F7UE 1BA5A 4E7LA 3NHGA 4JJNK 2GGRA 4F14A 4EAHD 1QVGA 3FZKA 5SZTA 4F52A 1TAUA 3HC7A 3BQYA 4I0AA 2FRWA 3BFMA 4CJPA 4BRNA 4JKGB 2FQ3A 5GTHC 2VQLA 2G8WA 4LUDA 4F7UF 3HVTA 1Z1DA 3DU6A 4A3CJ 4JUVA 2P84A 5GAOr 4C92D 5J2PA 5GAN8 3RSEA 4OINF 2A69F 3KUFA 1RRJA 5M1QA 1SVOA 2XKOA 2HNYA 5EJCA 3SQ2A 3V7SA 5LY3A 4A2UA 4M7AB 3RR7A 5KTQA 3SI6A 3SNNA 1DGWY 3Q0VA 2COMA 3G6EN 2P0PA 5EG0B 2DO3A 2BGCA 2J7IA 4B9XA 3D4VA 3CESA 2AHJB 3CCSA 2NNYA 2QASA 3HZJA 3CCJQ 2W25A 4DU3A 3BR1A 2TRTA 5KPZA 2ATCB 1TC3C 1UJ0A 2GFAA 5IWAK 3CCUT 4HUFA 4N0AA 5ECAA 5JVGL 1KHCA 5HY6A 3CCQN 2NOZA 1WSFA 2F5EA 3HKZN 1XD7A 1IZ6A 3CXCM 2CG4A 2DD5A 3M53A 4H8KA 4CJRA 1VQ5T 2L2PA 3CCJN 4XOTA 3K0SA 2K79A 3PIPA 4BG8A 1USTA 3RERA 2P9IA 5IYDJ 4DS4A 1VUBA 2KXCA 5HRRA 3HTVA 3NDKA 2RNAA 4OPHA 2IP2A 4DQ8A 4JKDA 3CQ8A 5GANd 5HBMA 4Z88A 4ZGEB 1R6RA 1XTDA 3RZDJ 2DOFA 3BZCA 3IKTA 3TAQA 3JAMZ 3VV0A 4E4HA 2K2VA 3KVGA 2L7KA 4M7DD 2RM4A 2IC3A 3WG7H 3NGIA 3SWNB 4C5HA 4BC5A 3KP3A 4Y1CA 3MN7A 1F9NA 4M45A 5HRPA 4CYDA 3CC7A 5HK0A 2IAJA 2G6FX 4TV7A 4LG0A 2XDDA 4PQUA 1GT0C 1GFCA 2D8HA 4M75C 1YHQN 3ASMA 3V9ZA 4HCKA 1YVUA 2W42A 3WTXC 4HCCA 5FPMA 4HVUA 3BF1A 2LP5A 1VQNQ 3CCUA 1K8AC 4DG1A 1WHJA 4B21A 4CJEA 2PAVA 3QINA 2IS4A 1B34B 1LPLA 3UT1A 3IKVA 2XSDC 2EK5A 3IH7A 3AARA 1I27A 2B4JA 3F22A 4KRTA 3QIOA 1FX7A 2E1YA 3O5ZA 1JI8A 1EJ9A 5HNHA 2FU4A 4LDXA 3NGYA 1U3OA 1Z21A 4A3IJ 2OZ6A 3GTOJ 3VS5A 2R5AA 4B8CA 2VQEK 2DU9A 1IXRC 2RHUA 3EY1A 2L7ZA 5K1YA 2P7VB 4CZLA 2VCPA 3HSCA 2E1MC 3MEUA 1HYZA 3M56A 2LKPA 3V7RA 2P7CB 3IRQA 3D0PA 5LJ3h 1ZRCA 3S2HJ 4EMKA 1NJZA 5HDNA 2OTJN 1VQLT 3I33A 3PFYA 3KKRA 2JMWA 3W2AA 3ZX2A 3OGDA 2JSCA 4DLGA 3LSJA 1ACIA 3NPFA 1JHHA 4U88A 3EG0A 3DXKB 1TWCJ 3CCQT 3G71Q 3WGIA 2P4TA 2OPPA 5HLIA 1JJ2M 3E7LA 1FP1D 2LY2A 5GAHJ 3FIFA 5AZIB 4E6KG 1I07A 4KH4A 4NS5A 3CJQB 2KT1A 2A5XA 1E3HA 4JKHA 3UPUA 3H92A 2W03A 3D2EB 4CHPA 2HMPA 4FYYB 1Y39A 2EYWA 4J9HA 1VQ9Q 2X1DA 3BQZA 4W97A 3JRFA 5LHHA 1PWTA 4BE2A 5AFUA 3OYIA 3GL1A 4EJWA 5JFRA 3HHHA 5DMRA 1QP3A 4RMNA 5AQNA 1N8RC 3MK6A 3SAFA 1TWBA 2KEAA 2R7FA 3RPUD 1N39A 1NEBA 4OPJA 3CVSA 3HZ6A 1FP2A 1N8RU 1J5EK 1MBHA 2F4OB 1YJWQ 2XO7A 1O4XA 3TU4K 4GY5A 5H1SQ 5KNLA 5GADJ 1TP4A 4MLOA 2RC4A 1IBLK 1AZEA 5CYVA 4AYBN 2GA1A 2KIFA 4NLCA 2NRHA 1PKTA 2FNPA 1TT0A 2K6DA 3GYHX 3VESA 1VQ9N 3CQZJ 2EVRA 2DA5A 1EWQA 2WBMA 5KYWB 3P31A 4BWJA 1I1JA 3JR9A 1GXQA 2ETHA 1OYIA 3JCMV 4HYEA 3IFRA 3BUZB 2VONA 3KP6A 3VUBA 4BUGA 5GMKm 4DFJA 2LTOA 4O0IA 2VWJA 3L2RA 1MA9B 2Z9OA 4CJ4A 2ABKA 1TSFA 2Y4YA 3LFKA 3BJAA 2A5WA 1OLTA 1JJ2S 3EFOA 4IO9L 4ELUA 2DMPA 2CP6A 1U04A 2HVHA 3SJHA 2MG4A 1R49A 1VQNT 4ME7A 3BW1A 2NVXJ 1WHLA 4RCBA 3CQYA 3VERA 2C0TA 1YJ9T 2CH0A 1OQYA 1NGJA 5IP6A 4KI4A 1MBKA 4C8QF 4KGVB 2KJBA 1S1NA 3QJ6A 5JLFA 1LEAA 4ESRA 4AIJA 1Y1WJ 4JRQA 5J8CA 3QZ9B 4RWTA 1KO9A 2ICWG 3CCLT 1RUWA 2HTJA 2HZDA 3V1OA 1HDDC 4MIMA 5M5XJ 3D1NI 1MBFA 2DQRA 4BQNA 1G59A 4PKIA 3CMAN 1TWGJ 5EYRA 3PO3J 3LQRA 3GO5A 4EM1A 4PHTX 2GV9A 2KKOA 4FOEA 1QPIA 3HOYJ 3C6UA 1WZ2A 1SFXA 1M9SA 2XHBA 2MCNA 4Y3OA 3LA3A 1VQKA 2AXLA 4OB0B 4QQDA 3BY5A 3SQNA 1WSIA 3CCUN 3OMGA 3ULEB 4M73A 1BA1A