3OS7A

Crystal structure of a galactose mutarotase-like protein (ca_c0697) from clostridium acetobutylicum at 1.80 a resolution
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
338
structure length
338
Chain Sequence
b'NKDLWIKEEIIWSEHKCIRFAAGGYEALIIPDVGGNVVELKDTNKGVTILRTPKKDLKFEDFKNRPQVYGLPVLFPPNRIDDGTFKLGDKTYKFPINEAKNNNYIHGFIKNSKWTVHKKKIDQDKALVEVVFDFTKENEAYKYFSHEFQFKLSYELSSKGLKQTTSVVNLSSEEMPLSVGYHSAFNVPFIEGSEDSNCRVKISIDKFWKQDSRNLPTGESFAPTGEQKEYLENGVAVASHPIESLFSLKDIDVNGKTFRGACIEDASKNTRVVYEMSSEYKYLVIWNDMGDKKYACIEPQTSIINSPNVKLDRSVSGFKTLKPNESWSGVCKLYIENM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords galactose mutarotase-like protein
publication title Crystal structure of a galactose mutarotase-like protein (CA_C0697) from CLOSTRIDIUM ACETOBUTYLICUM at 1.80 A resolution
rcsb
source organism Clostridium acetobutylicum
molecule tags Isomerase
total genus 78
structure length 338
sequence length 338
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-09-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01263 Aldose_epim Aldose 1-epimerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.98.10 Mainly Beta Distorted Sandwich Beta-galactosidase; Chain A, domain 5 Beta-galactosidase; Chain A, domain 5 3os7A00
1DP0A 1NSSA 2Q1FA 3DYPA 3NJVA 3VD5A 1JZ4A 2BRPA 1PX4A 1MMZA 2X03A 1RW9A 3I3DA 3MV11 1F9GA 3T0BA 1OJPA 1EGUA 4DUXA 1X1JA 1MMXA 1NS2A 1MMUA 2WVYA 1NSXA 3T2OA 1NSVA 1RWAA 1NS4A 2WVXB 1HM3A 3T08A 4RNLA 1HM2A 1JZ5A 1NSRA 1N7NA 1RWHA 1PX3A 3A24A 3IAPA 2WW2A 1OJOA 3BGAA 3J7HA 1JYNA 4BZGA 1I8QA 2ZXQA 3MUZ1 2XSGA 2CIQA 3NJXA 1JZ7A 3VDAA 3I3BA 5A1AA 1NKGA 3VD7A 3SEPA 1K1WA 1F4HA 2WZSA 1HN1A 1RWGA 4DUVA 1JYVA 3DYMA 1Z45A 2BRWA 1NSMA 1MMYA 2E22A 1JOVA 3T0AA 3DYOA 1YGAA 3OB8A 1J0MA 3T0DA 3ECQA 1N7RA 1L7KA 1OJNA 1F4AA 1SNZA 2HTAA 3MUY1 3OS7A 1LOHA 2HTBA 1LF6A 1SO0A 2WVXA 1HMWA 1RWFA 1JZ3A 1MN0A 1L7JA 1JZ8A 1RWCA 1LXMA 1CB8A 1J0NA 1HN0A 1N7PA 3VDCA 3MV01 5E1QA 1W3YA 1N7QA 2JKAA 3IMHA 3DCDA 1C82A 1NS7A 2XHNA 2JKEA 3T2PA 3VDBA 2BRVX 1NS0A 1HMUA 1YQ2A 4BZEA 1F1SA 3NREA 3DECA 4BZHA 2ZQ0A 2WW3A 1LF9A 2WCOA 1NS8A 2WW1A 3IAQA 3T2QA 1K1YA 3OBAA 1UG9A 4BZFA 3I3EA 1NSUA 3VD3A 1JYWA 2CISA 4TTGA 2WW0A 1X1HA 3E1F1 1JZ6A 3VD4A 3Q1NA 1LURA 1TXKA 4DUWA 3WFAA 1JZ2A 3T09A 1X1IA 2WVZA 2WDAA 4AQ0A 1LXKA 2JKPA 2D73A 1N7OA 1OJMA 3MWXA 3K25A 3CZJA 1NSZA 1ULVA 1K1XA 2E24A 2CIRA 1JYXA 3VD9A
chains in the Genus database with same CATH superfamily
2XN1A 2F7PA 1DP0A 2Q1FA 3NJVA 3DYPA 3VD5A 3X3YA 4KFEA 2WOHA 1EGUA 3KN4A 1NS2A 2RDYA 3AFLA 5KBPA 1NSVA 1RWAA 1NS4A 1W4NA 3BUPA 3DDGA 3T08A 1QX1A 1OACA 1JZ5A 1N7NA 1PX3A 3WVFA 1W7CA 3AMOB 5JMDA 1TQVA 2OW6A 2E2VA 3HI7A 2ALWA 3VDAA 3I3BA 3SEPA 1RKYA 1JYVA 1Z45A 3MI6A 3OB8A 1J0MA 3ECQA 1N7RA 1IQXA 1OJNA 1PS3A 3E80A 3BLCA 4OK2A 4MMIA 2FYVA 1HMWA 1MN0A 1CB8A 1QWUA 3MV01 3BLBA 1N7QA 3ACSA 3IMHA 3DCDA 3D52A 3SX1A 3VDBA 1WMNA 1NS0A 2C10A 3S4AA 1QAFA 3D4ZA 2ZQ0A 2WW3A 3S4CA 3T2QA 3K5TA 2F18A 2WW0A 1X1HA 3BVXA 3PGBA 3WFAA 1JZ2A 3W7SA 3T09A 3LOYA 3S4DA 2OQEC 1LXKA 3ACTA 2D73A 1N7OA 3E7JA 3QG0A 3MWXA 3QDEA 2CQSA 3CZJA 2Y73A 2E24A 2CIRA 1JYXA 4MMHA 1W5ZA 2BRPA 1MMZA 3W7UA 1RW9A 3T0BA 4FNPA 2Y74A 2WVXB 3WIRA 1HWWA 4RNLA 1RWHA 4NEIA 3A24A 3VSMA 3HIIA 1AVKA 3BGAA 3J7HA 1JYNA 2ZXQA 2F1AA 2EABA 2CIQA 5A1AA 3VD7A 1D6UA 3NBBA 1RWGA 4DUVA 2BRWA 1NSMA 3T0UA 3BUQA 1W6CA 1JOVA 3T0AA 1YGAA 3A0OA 2CFWA 2CQTA 3D4YA 3QFZA 3OS7A 3X40A 1SO0A 1RWFA 3BVVA 1L7JA 1WMPA 1J0NA 4K3AA 3MPHA 3EJSA 3AMOA 1W3YA 1NS7A 2XHNA 2BRVX 2PNCA 4BTWA 1AVLA 2CFKA 2WW1A 3DX0A 3OBAA 3CV5A 3CZSA 2CISA 4TTGA 2WYIA 2YFNA 1TQUA 3NBJA 3LVTA 1RJOA 1IVXA 3EJTA 2ZL8A 1V7VA 3X41A 2YX9A 3WA3A 1W6GA 2JKPA 1OJMA 2C11A 3K25A 5GW7A 1ULVA 4FNUA 5CA3A 1IU7A 4BTYA 3BVUA 1D6ZA 2WYHA 1PX4A 1WMOA 3DX1A 1HTYA 3I3DA 1A2VA 1F9GA 3D3IA 1QALA 1X1JA 1MMUA 1NSXA 3T2OA 2CWVA 3WA2X 1HM3A 3X42A 2FUTA 3BVTA 1HM2A 2F7OA 2WW2A 3S4BA 1D6YA 4BZGA 1I8QA 2XSGA 4EV2A 1NKGA 2D1WA 3RSYA 1K1WA 1F4HA 4KFFA 1HN1A 1UI7A 3AFJA 3BUDA 4OJZA 1MMYA 2E22A 2F7RA 1H54A 1SNZA 4UFCA 2E2UA 3MUY1 3ALAA 1LOHA 2HTBA 1LF6A 2WVXA 1JZ3A 3BVWA 1JZ8A 1SIIA 1LXMA 1O7DD 2OOVA 3BS6A 1TQSA 3D50A 5E1QA 3DX4A 1C82A 2JKEA 2EACA 1DYUA 1HMUA 1AV4A 1YQ2A 1F1SA 3NREA 3DECA 3DX2A 4FNVA 1LF9A 1NS8A 3WIQA 4K35A 1K1YA 4KFDA 4BZFA 3I3EA 1NSUA 3QFYA 1R34A 3VD3A 3DX3A 3E1F1 4OK4A 2WOFA 1HXKA 3EJQA 4DUWA 4FNTA 1X1IA 1IVVA 3SXXA 1NSZA 1K1XA 3X3ZA 1JRQA 1NSSA 1JZ4A 2CG1A 2X03A 1IVWA 2XN0A 3MV11 2WGQA 1OJPA 4DUXA 1LVNA 2CG0A 1MMXA 4BTXA 2WVYA 2YFOA 3RRSA 4EV5A 1NSRA 4KTRA 3IAPA 5JMFA 1IVUA 1R33A 3W7XA 4FNQA 1OJOA 3HIGA 3MUZ1 3NJXA 1JZ7A 3CZNA 1QWNA 3W7TA 3W7WA 2WZSA 2F1BA 1IQYA 3DYMA 3TY1A 1EKMA 2CWUA 1US1A 3EJPA 3DYOA 3EJUA 3KIIA 3T0DA 2OW7A 2CFDA 1L7KA 2HTAA 1F4AA 3D51A 2CFGA 1RWCA 1HN0A 1N7PA 2W0QA 1QAKA 3VDCA 2OOVC 1TQWA 2E2TA 2FUQA 4FNSA 2JKAA 1TU5A 2F7QA 2WO0A 3T2PA 3BUIA 3VSNA 3X3XA 4BZEA 3DDFA 4BZHA 1SIHA 2WCOA 3IAQA 2EADA 1UI8A 2XN2A 1UG9A 3EJRA 1SPUA 1JYWA 1V7WA 4FNRA 4J5TA 1PU4A 2BT3A 3N9HA 1TQTA 1JZ6A 3VD4A 1N9EA 3Q1NA 1LURA 1TXKA 3BUBA 2OQEA 2WVZA 2WDAA 4AQ0A 1W2ZA 1KSIA 4KTPA 2EAEA 2CWTA 1V7XA 2CFLA 3VD9A
chains in the Genus database with same CATH topology
4MMHA 1DP0A 1NSSA 2Q1FA 3DYPA 3NJVA 3VD5A 1JZ4A 2BRPA 1PX4A 1MMZA 2X03A 1RW9A 3I3DA 3MV11 1F9GA 3T0BA 1OJPA 1EGUA 4DUXA 1X1JA 1MMXA 1NS2A 3AFLA 1MMUA 2WVYA 1NSXA 3T2OA 1NSVA 1RWAA 1NS4A 2WVXB 1HM3A 3T08A 2FUTA 4RNLA 1HM2A 1JZ5A 1NSRA 1N7NA 1RWHA 4NEIA 1PX3A 3A24A 3IAPA 3WVFA 3VSMA 2WW2A 5JMFA 1OJOA 3BGAA 3J7HA 5JMDA 1JYNA 4BZGA 1I8QA 2ZXQA 3MUZ1 2XSGA 2CIQA 3NJXA 1JZ7A 3VDAA 3I3BA 5A1AA 1NKGA 3VD7A 3SEPA 1K1WA 1F4HA 2WZSA 1HN1A 1RWGA 4DUVA 1JYVA 3DYMA 1Z45A 3TY1A 2BRWA 1NSMA 4OJZA 1MMYA 2E22A 1JOVA 3T0AA 3DYOA 1YGAA 3OB8A 3A0OA 1J0MA 3T0DA 3ECQA 1N7RA 1L7KA 1OJNA 1F4AA 1SNZA 2HTAA 3MUY1 3E80A 3OS7A 1LOHA 3BLCA 4OK2A 4MMIA 2HTBA 1LF6A 1SO0A 2WVXA 1HMWA 1RWFA 1JZ3A 1MN0A 1L7JA 1JZ8A 1RWCA 1LXMA 1CB8A 1J0NA 1HN0A 1N7PA 3BS6A 3VDCA 3MV01 5E1QA 1W3YA 2FUQA 1N7QA 2JKAA 3IMHA 3DCDA 1C82A 1NS7A 2XHNA 2JKEA 3T2PA 3VDBA 2BRVX 1NS0A 1HMUA 3VSNA 1YQ2A 4BZEA 1F1SA 3NREA 3DECA 4BZHA 2ZQ0A 2WW3A 4FNVA 1LF9A 2WCOA 1NS8A 2WW1A 3IAQA 3T2QA 1K1YA 3OBAA 1UG9A 4BZFA 3I3EA 1NSUA 3VD3A 1JYWA 2CISA 4J5TA 4TTGA 2WW0A 1X1HA 3E1F1 4OK4A 1JZ6A 3VD4A 3Q1NA 1LURA 1TXKA 4DUWA 3WFAA 1JZ2A 3T09A 1X1IA 2WVZA 2WDAA 4AQ0A 1LXKA 2JKPA 2D73A 1N7OA 3E7JA 1OJMA 3MWXA 3K25A 3CZJA 1NSZA 1ULVA 1K1XA 2E24A 2CIRA 1JYXA 3VD9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DP0 A;  1NSS A;  2Q1F A;  3DYP A;  3NJV A;  3VD5 A;  1JZ4 A;  2BRP A;  1PX4 A;  1MMZ A;  2X03 A;  1RW9 A;  3I3D A;  3MV1 1;  1F9G A;  3T0B A;  1OJP A;  1EGU A;  4DUX A;  1X1J A;  1MMX A;  1NS2 A;  1MMU A;  2WVY A;  1NSX A;  3T2O A;  1NSV A;  1RWA A;  1NS4 A;  2WVX B;  1HM3 A;  3T08 A;  4RNL A;  1HM2 A;  1JZ5 A;  1NSR A;  1N7N A;  1RWH A;  1PX3 A;  3A24 A;  3IAP A;  2WW2 A;  1OJO A;  3BGA A;  3J7H A;  1JYN A;  4BZG A;  1I8Q A;  2ZXQ A;  3MUZ 1;  2XSG A;  2CIQ A;  3NJX A;  1JZ7 A;  3VDA A;  3I3B A;  5A1A A;  1NKG A;  3VD7 A;  3SEP A;  1K1W A;  1F4H A;  2WZS A;  1HN1 A;  1RWG A;  4DUV A;  1JYV A;  3DYM A;  1Z45 A;  2BRW A;  1NSM A;  1MMY A;  2E22 A;  1JOV A;  3T0A A;  3DYO A;  1YGA A;  3OB8 A;  1J0M A;  3T0D A;  3ECQ A;  1N7R A;  1L7K A;  1OJN A;  1F4A A;  1SNZ A;  2HTA A;  3MUY 1;  3OS7 A;  1LOH A;  2HTB A;  1LF6 A;  1SO0 A;  2WVX A;  1HMW A;  1RWF A;  1JZ3 A;  1MN0 A;  1L7J A;  1JZ8 A;  1RWC A;  1LXM A;  1CB8 A;  1J0N A;  1HN0 A;  1N7P A;  3VDC A;  3MV0 1;  5E1Q A;  1W3Y A;  1N7Q A;  2JKA A;  3IMH A;  3DCD A;  1C82 A;  1NS7 A;  2XHN A;  2JKE A;  3T2P A;  3VDB A;  2BRV X;  1NS0 A;  1HMU A;  1YQ2 A;  4BZE A;  1F1S A;  3NRE A;  3DEC A;  4BZH A;  2ZQ0 A;  2WW3 A;  1LF9 A;  2WCO A;  1NS8 A;  2WW1 A;  3IAQ A;  3T2Q A;  1K1Y A;  3OBA A;  1UG9 A;  4BZF A;  3I3E A;  1NSU A;  3VD3 A;  1JYW A;  2CIS A;  4TTG A;  2WW0 A;  1X1H A;  3E1F 1;  1JZ6 A;  3VD4 A;  3Q1N A;  1LUR A;  1TXK A;  4DUW A;  3WFA A;  1JZ2 A;  3T09 A;  1X1I A;  2WVZ A;  2WDA A;  4AQ0 A;  1LXK A;  2JKP A;  2D73 A;  1N7O A;  1OJM A;  3MWX A;  3K25 A;  3CZJ A;  1NSZ A;  1ULV A;  1K1X A;  2E24 A;  2CIR A;  1JYX A;  3VD9 A; 
#chains in the Genus database with same CATH topology
 2XN1 A;  2F7P A;  1DP0 A;  2Q1F A;  3NJV A;  3DYP A;  3VD5 A;  3X3Y A;  4KFE A;  2WOH A;  1EGU A;  3KN4 A;  1NS2 A;  2RDY A;  3AFL A;  5KBP A;  1NSV A;  1RWA A;  1NS4 A;  1W4N A;  3BUP A;  3DDG A;  3T08 A;  1QX1 A;  1OAC A;  1JZ5 A;  1N7N A;  1PX3 A;  3WVF A;  1W7C A;  3AMO B;  5JMD A;  1TQV A;  2OW6 A;  2E2V A;  3HI7 A;  2ALW A;  3VDA A;  3I3B A;  3SEP A;  1RKY A;  1JYV A;  1Z45 A;  3MI6 A;  3OB8 A;  1J0M A;  3ECQ A;  1N7R A;  1IQX A;  1OJN A;  1PS3 A;  3E80 A;  3BLC A;  4OK2 A;  4MMI A;  2FYV A;  1HMW A;  1MN0 A;  1CB8 A;  1QWU A;  3MV0 1;  3BLB A;  1N7Q A;  3ACS A;  3IMH A;  3DCD A;  3D52 A;  3SX1 A;  3VDB A;  1WMN A;  1NS0 A;  2C10 A;  3S4A A;  1QAF A;  3D4Z A;  2ZQ0 A;  2WW3 A;  3S4C A;  3T2Q A;  3K5T A;  2F18 A;  2WW0 A;  1X1H A;  3BVX A;  3PGB A;  3WFA A;  1JZ2 A;  3W7S A;  3T09 A;  3LOY A;  3S4D A;  2OQE C;  1LXK A;  3ACT A;  2D73 A;  1N7O A;  3E7J A;  3QG0 A;  3MWX A;  3QDE A;  2CQS A;  3CZJ A;  2Y73 A;  2E24 A;  2CIR A;  1JYX A;  4MMH A;  1W5Z A;  2BRP A;  1MMZ A;  3W7U A;  1RW9 A;  3T0B A;  4FNP A;  2Y74 A;  2WVX B;  3WIR A;  1HWW A;  4RNL A;  1RWH A;  4NEI A;  3A24 A;  3VSM A;  3HII A;  1AVK A;  3BGA A;  3J7H A;  1JYN A;  2ZXQ A;  2F1A A;  2EAB A;  2CIQ A;  5A1A A;  3VD7 A;  1D6U A;  3NBB A;  1RWG A;  4DUV A;  2BRW A;  1NSM A;  3T0U A;  3BUQ A;  1W6C A;  1JOV A;  3T0A A;  1YGA A;  3A0O A;  2CFW A;  2CQT A;  3D4Y A;  3QFZ A;  3OS7 A;  3X40 A;  1SO0 A;  1RWF A;  3BVV A;  1L7J A;  1WMP A;  1J0N A;  4K3A A;  3MPH A;  3EJS A;  3AMO A;  1W3Y A;  1NS7 A;  2XHN A;  2BRV X;  2PNC A;  4BTW A;  1AVL A;  2CFK A;  2WW1 A;  3DX0 A;  3OBA A;  3CV5 A;  3CZS A;  2CIS A;  4TTG A;  2WYI A;  2YFN A;  1TQU A;  3NBJ A;  3LVT A;  1RJO A;  1IVX A;  3EJT A;  2ZL8 A;  1V7V A;  3X41 A;  2YX9 A;  3WA3 A;  1W6G A;  2JKP A;  1OJM A;  2C11 A;  3K25 A;  5GW7 A;  1ULV A;  4FNU A;  5CA3 A;  1IU7 A;  4BTY A;  3BVU A;  1D6Z A;  2WYH A;  1PX4 A;  1WMO A;  3DX1 A;  1HTY A;  3I3D A;  1A2V A;  1F9G A;  3D3I A;  1QAL A;  1X1J A;  1MMU A;  1NSX A;  3T2O A;  2CWV A;  3WA2 X;  1HM3 A;  3X42 A;  2FUT A;  3BVT A;  1HM2 A;  2F7O A;  2WW2 A;  3S4B A;  1D6Y A;  4BZG A;  1I8Q A;  2XSG A;  4EV2 A;  1NKG A;  2D1W A;  3RSY A;  1K1W A;  1F4H A;  4KFF A;  1HN1 A;  1UI7 A;  3AFJ A;  3BUD A;  4OJZ A;  1MMY A;  2E22 A;  2F7R A;  1H54 A;  1SNZ A;  4UFC A;  2E2U A;  3MUY 1;  3ALA A;  1LOH A;  2HTB A;  1LF6 A;  2WVX A;  1JZ3 A;  3BVW A;  1JZ8 A;  1SII A;  1LXM A;  1O7D D;  2OOV A;  3BS6 A;  1TQS A;  3D50 A;  5E1Q A;  3DX4 A;  1C82 A;  2JKE A;  2EAC A;  1DYU A;  1HMU A;  1AV4 A;  1YQ2 A;  1F1S A;  3NRE A;  3DEC A;  3DX2 A;  4FNV A;  1LF9 A;  1NS8 A;  3WIQ A;  4K35 A;  1K1Y A;  4KFD A;  4BZF A;  3I3E A;  1NSU A;  3QFY A;  1R34 A;  3VD3 A;  3DX3 A;  3E1F 1;  4OK4 A;  2WOF A;  1HXK A;  3EJQ A;  4DUW A;  4FNT A;  1X1I A;  1IVV A;  3SXX A;  1NSZ A;  1K1X A;  3X3Z A;  1JRQ A;  1NSS A;  1JZ4 A;  2CG1 A;  2X03 A;  1IVW A;  2XN0 A;  3MV1 1;  2WGQ A;  1OJP A;  4DUX A;  1LVN A;  2CG0 A;  1MMX A;  4BTX A;  2WVY A;  2YFO A;  3RRS A;  4EV5 A;  1NSR A;  4KTR A;  3IAP A;  5JMF A;  1IVU A;  1R33 A;  3W7X A;  4FNQ A;  1OJO A;  3HIG A;  3MUZ 1;  3NJX A;  1JZ7 A;  3CZN A;  1QWN A;  3W7T A;  3W7W A;  2WZS A;  2F1B A;  1IQY A;  3DYM A;  3TY1 A;  1EKM A;  2CWU A;  1US1 A;  3EJP A;  3DYO A;  3EJU A;  3KII A;  3T0D A;  2OW7 A;  2CFD A;  1L7K A;  2HTA A;  1F4A A;  3D51 A;  2CFG A;  1RWC A;  1HN0 A;  1N7P A;  2W0Q A;  1QAK A;  3VDC A;  2OOV C;  1TQW A;  2E2T A;  2FUQ A;  4FNS A;  2JKA A;  1TU5 A;  2F7Q A;  2WO0 A;  3T2P A;  3BUI A;  3VSN A;  3X3X A;  4BZE A;  3DDF A;  4BZH A;  1SIH A;  2WCO A;  3IAQ A;  2EAD A;  1UI8 A;  2XN2 A;  1UG9 A;  3EJR A;  1SPU A;  1JYW A;  1V7W A;  4FNR A;  4J5T A;  1PU4 A;  2BT3 A;  3N9H A;  1TQT A;  1JZ6 A;  3VD4 A;  1N9E A;  3Q1N A;  1LUR A;  1TXK A;  3BUB A;  2OQE A;  2WVZ A;  2WDA A;  4AQ0 A;  1W2Z A;  1KSI A;  4KTP A;  2EAE A;  2CWT A;  1V7X A;  2CFL A;  3VD9 A; 
#chains in the Genus database with same CATH homology
 4MMH A;  1DP0 A;  1NSS A;  2Q1F A;  3DYP A;  3NJV A;  3VD5 A;  1JZ4 A;  2BRP A;  1PX4 A;  1MMZ A;  2X03 A;  1RW9 A;  3I3D A;  3MV1 1;  1F9G A;  3T0B A;  1OJP A;  1EGU A;  4DUX A;  1X1J A;  1MMX A;  1NS2 A;  3AFL A;  1MMU A;  2WVY A;  1NSX A;  3T2O A;  1NSV A;  1RWA A;  1NS4 A;  2WVX B;  1HM3 A;  3T08 A;  2FUT A;  4RNL A;  1HM2 A;  1JZ5 A;  1NSR A;  1N7N A;  1RWH A;  4NEI A;  1PX3 A;  3A24 A;  3IAP A;  3WVF A;  3VSM A;  2WW2 A;  5JMF A;  1OJO A;  3BGA A;  3J7H A;  5JMD A;  1JYN A;  4BZG A;  1I8Q A;  2ZXQ A;  3MUZ 1;  2XSG A;  2CIQ A;  3NJX A;  1JZ7 A;  3VDA A;  3I3B A;  5A1A A;  1NKG A;  3VD7 A;  3SEP A;  1K1W A;  1F4H A;  2WZS A;  1HN1 A;  1RWG A;  4DUV A;  1JYV A;  3DYM A;  1Z45 A;  3TY1 A;  2BRW A;  1NSM A;  4OJZ A;  1MMY A;  2E22 A;  1JOV A;  3T0A A;  3DYO A;  1YGA A;  3OB8 A;  3A0O A;  1J0M A;  3T0D A;  3ECQ A;  1N7R A;  1L7K A;  1OJN A;  1F4A A;  1SNZ A;  2HTA A;  3MUY 1;  3E80 A;  3OS7 A;  1LOH A;  3BLC A;  4OK2 A;  4MMI A;  2HTB A;  1LF6 A;  1SO0 A;  2WVX A;  1HMW A;  1RWF A;  1JZ3 A;  1MN0 A;  1L7J A;  1JZ8 A;  1RWC A;  1LXM A;  1CB8 A;  1J0N A;  1HN0 A;  1N7P A;  3BS6 A;  3VDC A;  3MV0 1;  5E1Q A;  1W3Y A;  2FUQ A;  1N7Q A;  2JKA A;  3IMH A;  3DCD A;  1C82 A;  1NS7 A;  2XHN A;  2JKE A;  3T2P A;  3VDB A;  2BRV X;  1NS0 A;  1HMU A;  3VSN A;  1YQ2 A;  4BZE A;  1F1S A;  3NRE A;  3DEC A;  4BZH A;  2ZQ0 A;  2WW3 A;  4FNV A;  1LF9 A;  2WCO A;  1NS8 A;  2WW1 A;  3IAQ A;  3T2Q A;  1K1Y A;  3OBA A;  1UG9 A;  4BZF A;  3I3E A;  1NSU A;  3VD3 A;  1JYW A;  2CIS A;  4J5T A;  4TTG A;  2WW0 A;  1X1H A;  3E1F 1;  4OK4 A;  1JZ6 A;  3VD4 A;  3Q1N A;  1LUR A;  1TXK A;  4DUW A;  3WFA A;  1JZ2 A;  3T09 A;  1X1I A;  2WVZ A;  2WDA A;  4AQ0 A;  1LXK A;  2JKP A;  2D73 A;  1N7O A;  3E7J A;  1OJM A;  3MWX A;  3K25 A;  3CZJ A;  1NSZ A;  1ULV A;  1K1X A;  2E24 A;  2CIR A;  1JYX A;  3VD9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...