3OSEA

Structure of the kinase associated domain 1 (ka1) from mark1 kinase
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
100
structure length
100
Chain Sequence
KPRSLRFTWSMKTTSSMDPNDMMREIRKVLDANNCDYEQKERFLLFCVHGDARQDSLVQWEMEVCKLPRLSLNGVRFKRISGTSIAFKNIASKIANELKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Serine/threonine-protein kinase MARK1
publication title Kinase Associated-1 Domains Drive MARK/PAR1 Kinases to Membrane Targets by Binding Acidic Phospholipids.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Lipid binding protein
total genus 27
structure length 100
sequence length 100
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2010-09-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02149 KA1 Kinase associated domain 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.310.80 Alpha Beta 2-Layer Sandwich TATA-Binding Protein Kinase associated domain 1, KA1 3oseA00
4EAKA 1V5SA 3OSEA 3TE5A 4EAJA 2OOXA 2QRDA 3T4NA 4EAIA 2QREA 2QLVA 4EALA 1UL7A 3TDHA 2V9JA 2QR1A 2OOYA 2Y8QA 2YA3A 2EHBD 2V8QA 4EAGA 2QRCA 4CFFA 2Y8LA 2ZFDB 2V92A
chains in the Genus database with same CATH superfamily
1N39A 3SNSA 3OH9A 1VTLE 2NOZA 1V5SA 5AN4A 1RM1A 2MJ7A 1KO9A 3CWAA 4QG5A 3OSMA 1WQAA 1PVSA 5EPCA 1W80A 2QLVA 4EALA 1P5GX 1UL7A 3TDHA 3HS9A 3N89A 1MP9A 2HL9A 1C47A 2Y8QA 3OCIA 2R5XA 3DPTA 1KYDA 1QN4A 4D7QA 1QN6A 1CDWA 2EHBD 2MZ8A 1PCMX 3F0ZA 4EAGA 3PMGA 1YTFA 1K35A 1TGHA 1MPGA 4PY5A 1QN5A 1Q9UA 1LXTA 5BMNA 2Y8LA 2D0CA 2Z8UA 4WZSD 1LWWA 1KYFA 2O3OA 4RODB 3OLPA 2DKCA 2HL8A 1B9KA 3KTUA 3OSEA 3TE5A 4ROCB 4EAJA 3D4VA 2NOFA 5IYDP 3C04A 3T4NA 5F9CA 4BJUA 2NVMA 1P5DX 1YTBA 2NOBA 1VKLA 2NOEA 3I0WA 1E42A 3ASMA 1KY7A 5JMVD 1LWVA 3OSTA 2D0AA 1YQLA 4I8OA 1VOKA 2G30A 1EUVA 1K2YX 1C4GA 1QN9A 1QN8A 1NVPA 2I5WA 1YQRA 3CVTA 1C9BB 2HZMA 2FUVA 3ENOC 1LWYA 3RSMA 4CFFA 4HJHA 1YQKA 1TBPA 2H5AX 1DIZA 1TUOA 1KYUA 1KY6A 2DKDA 2IV9A 4EJYA 1UT7A 1M5Q1 4EAKA 4B0AA 2JPIA 4MRQA 2IV8A 1J3MA 2QRDA 2JHNA 2XHIA 1D3UA 1N3AA 1PZDA 2DKAA 3NA5A 1PCZA 1TBAB 4Q11A 4D7RA 3IH7A 1YQMA 2H4LX 2QR1A 2OOYA 1KFQA 3EAYA 2NLVA 1VTOA 1QNEA 5JN5A 3OGDA 1M3HA 3F10A 5IYBP 2V8QA 1FN7A 3UW2A 3KRMA 4C7PA 1QNCA 1QTPA 3H1ZA 3ENCA 3BKQX 5KL0A 1QNBA 2QRCA 1NGMA 3CW7A 4WXAA 2NOLA 3I0XA 2YH5A 2HZSA 3VN5A 2NOHA 2Z0FA 1R4XA 3ULXA 1QN3A 3CWUA 2OOXA 3HS8A 2LAEA 1QN7A 1N3CA 5HSHA 1QNAA 1M3QA 2NOIA 4EAIA 2QREA 1QTSA 4ROEB 4TPSA 2FGTA 3I3WA 1KFIA 1T6AA 3DPUA 2NWVA 3PDKA 3OH6A 4EJZA 2V9JA 3OC3C 1HU0A 1XSZA 2YA3A 4IL8A 1JDYA 3EIKA 3CWSA 2F7LA 2PWWA 3RPJA 2D0BA 5BMPA 3CWTA 4WX8A 1AISA 1EBMA 3D7QA 2HKPA 2VJ0A 4DULA 2JHJA 1PCJX 5IYCP 1WJWA 2FKMX 1NH2A 2ZFDB 1JFIC 1VOLB 2JOIA 3CVSA 1UT4A 2FKFA 2V92A
chains in the Genus database with same CATH topology
4EAKA 1V5SA 3OSEA 3TE5A 4EAJA 2OOXA 2QRDA 3T4NA 4EAIA 2QREA 2QLVA 4EALA 1UL7A 3TDHA 2V9JA 2QR1A 2OOYA 2Y8QA 2YA3A 2EHBD 2V8QA 4EAGA 2QRCA 4CFFA 2Y8LA 2ZFDB 2V92A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EAK A;  1V5S A;  3OSE A;  3TE5 A;  4EAJ A;  2OOX A;  2QRD A;  3T4N A;  4EAI A;  2QRE A;  2QLV A;  4EAL A;  1UL7 A;  3TDH A;  2V9J A;  2QR1 A;  2OOY A;  2Y8Q A;  2YA3 A;  2EHB D;  2V8Q A;  4EAG A;  2QRC A;  4CFF A;  2Y8L A;  2ZFD B;  2V92 A; 
#chains in the Genus database with same CATH topology
 1N39 A;  3SNS A;  3OH9 A;  1VTL E;  2NOZ A;  1V5S A;  5AN4 A;  1RM1 A;  2MJ7 A;  1KO9 A;  3CWA A;  4QG5 A;  3OSM A;  1WQA A;  1PVS A;  5EPC A;  1W80 A;  2QLV A;  4EAL A;  1P5G X;  1UL7 A;  3TDH A;  3HS9 A;  3N89 A;  1MP9 A;  2HL9 A;  1C47 A;  2Y8Q A;  3OCI A;  2R5X A;  3DPT A;  1KYD A;  1QN4 A;  4D7Q A;  1QN6 A;  1CDW A;  2EHB D;  2MZ8 A;  1PCM X;  3F0Z A;  4EAG A;  3PMG A;  1YTF A;  1K35 A;  1TGH A;  1MPG A;  4PY5 A;  1QN5 A;  1Q9U A;  1LXT A;  5BMN A;  2Y8L A;  2D0C A;  2Z8U A;  4WZS D;  1LWW A;  1KYF A;  2O3O A;  4ROD B;  3OLP A;  2DKC A;  2HL8 A;  1B9K A;  3KTU A;  3OSE A;  3TE5 A;  4ROC B;  4EAJ A;  3D4V A;  2NOF A;  5IYD P;  3C04 A;  3T4N A;  5F9C A;  4BJU A;  2NVM A;  1P5D X;  1YTB A;  2NOB A;  1VKL A;  2NOE A;  3I0W A;  1E42 A;  3ASM A;  1KY7 A;  5JMV D;  1LWV A;  3OST A;  2D0A A;  1YQL A;  4I8O A;  1VOK A;  2G30 A;  1EUV A;  1K2Y X;  1C4G A;  1QN9 A;  1QN8 A;  1NVP A;  2I5W A;  1YQR A;  3CVT A;  1C9B B;  2HZM A;  2FUV A;  3ENO C;  1LWY A;  3RSM A;  4CFF A;  4HJH A;  1YQK A;  1TBP A;  2H5A X;  1DIZ A;  1TUO A;  1KYU A;  1KY6 A;  2DKD A;  2IV9 A;  4EJY A;  1UT7 A;  1M5Q 1;  4EAK A;  4B0A A;  2JPI A;  4MRQ A;  2IV8 A;  1J3M A;  2QRD A;  2JHN A;  2XHI A;  1D3U A;  1N3A A;  1PZD A;  2DKA A;  3NA5 A;  1PCZ A;  1TBA B;  4Q11 A;  4D7R A;  3IH7 A;  1YQM A;  2H4L X;  2QR1 A;  2OOY A;  1KFQ A;  3EAY A;  2NLV A;  1VTO A;  1QNE A;  5JN5 A;  3OGD A;  1M3H A;  3F10 A;  5IYB P;  2V8Q A;  1FN7 A;  3UW2 A;  3KRM A;  4C7P A;  1QNC A;  1QTP A;  3H1Z A;  3ENC A;  3BKQ X;  5KL0 A;  1QNB A;  2QRC A;  1NGM A;  3CW7 A;  4WXA A;  2NOL A;  3I0X A;  2YH5 A;  2HZS A;  3VN5 A;  2NOH A;  2Z0F A;  1R4X A;  3ULX A;  1QN3 A;  3CWU A;  2OOX A;  3HS8 A;  2LAE A;  1QN7 A;  1N3C A;  5HSH A;  1QNA A;  1M3Q A;  2NOI A;  4EAI A;  2QRE A;  1QTS A;  4ROE B;  4TPS A;  2FGT A;  3I3W A;  1KFI A;  1T6A A;  3DPU A;  2NWV A;  3PDK A;  3OH6 A;  4EJZ A;  2V9J A;  3OC3 C;  1HU0 A;  1XSZ A;  2YA3 A;  4IL8 A;  1JDY A;  3EIK A;  3CWS A;  2F7L A;  2PWW A;  3RPJ A;  2D0B A;  5BMP A;  3CWT A;  4WX8 A;  1AIS A;  1EBM A;  3D7Q A;  2HKP A;  2VJ0 A;  4DUL A;  2JHJ A;  1PCJ X;  5IYC P;  1WJW A;  2FKM X;  1NH2 A;  2ZFD B;  1JFI C;  1VOL B;  2JOI A;  3CVS A;  1UT4 A;  2FKF A;  2V92 A; 
#chains in the Genus database with same CATH homology
 4EAK A;  1V5S A;  3OSE A;  3TE5 A;  4EAJ A;  2OOX A;  2QRD A;  3T4N A;  4EAI A;  2QRE A;  2QLV A;  4EAL A;  1UL7 A;  3TDH A;  2V9J A;  2QR1 A;  2OOY A;  2Y8Q A;  2YA3 A;  2EHB D;  2V8Q A;  4EAG A;  2QRC A;  4CFF A;  2Y8L A;  2ZFD B;  2V92 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...