3OSEA

Structure of the kinase associated domain 1 (ka1) from mark1 kinase
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
100
structure length
100
Chain Sequence
KPRSLRFTWSMKTTSSMDPNDMMREIRKVLDANNCDYEQKERFLLFCVHGDARQDSLVQWEMEVCKLPRLSLNGVRFKRISGTSIAFKNIASKIANELKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Serine/threonine-protein kinase MARK1
publication title Kinase Associated-1 Domains Drive MARK/PAR1 Kinases to Membrane Targets by Binding Acidic Phospholipids.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Lipid binding protein
total genus 27
structure length 100
sequence length 100
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2010-09-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02149 KA1 Kinase associated domain 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.310.80 Alpha Beta 2-Layer Sandwich TATA-Binding Protein Kinase associated domain 1, KA1 3oseA00
1V5SA 2OOXA 4EAGA 2Y8QA 2EHBD 2Y8LA 4EAKA 2V9JA 2ZFDB 3OSEA 2QRCA 4EALA 2QR1A 2OOYA 2QLVA 4EAIA 4CFFA 2V8QA 2V92A 1UL7A 2QRDA 3TDHA 2QREA 3T4NA 2YA3A 3TE5A 4EAJA
chains in the Genus database with same CATH superfamily
1V5SA 2DKDA 3OCIA 4EAGA 4QG5A 3CWTA 5BMNA 5IYBP 2F7LA 1MPGA 1PCJX 1WJWA 3OSTA 3PDKA 5F9CA 1QNAA 3I0XA 2NOIA 2V9JA 1JDYA 4EJYA 2JHJA 2ZFDB 1PCMX 2QLVA 2HL8A 3OGDA 4D7QA 2Z0FA 4BJUA 1QNEA 3N89A 5IYDP 3ENCA 2IV8A 1UL7A 4MRQA 3KTUA 3C04A 1LWYA 3OH9A 3I0WA 3TDHA 1QNBA 2NOEA 1KYFA 1M5Q1 3HS8A 1C47A 3IH7A 3CWSA 1M3QA 4EAJA 1VTLE 2DKCA 1TBPA 1EUVA 2R5XA 1YTBA 1VOKA 2HL9A 3H1ZA 3EIKA 1AISA 1J3MA 2Y8QA 1TUOA 2D0AA 3CVTA 2D0BA 2NOLA 4EAKA 1QN9A 4ROCB 3OSEA 4Q11A 2QRCA 1FN7A 2I5WA 2JHNA 2OOYA 2VJ0A 3ASMA 2LAEA 2DKAA 4EJZA 1LXTA 2NVMA 1PCZA 1QN5A 5AN4A 2V92A 1C4GA 2O3OA 3UW2A 4WX8A 1W80A 1TBAB 1JFIC 2HZMA 1T6AA 1KFIA 4WZSD 1R4XA 4C7PA 2NOHA 2YH5A 3OLPA 3TE5A 1LWVA 2HZSA 3CWUA 2JPIA 1NH2A 2XHIA 3D7QA 1VTOA 2OOXA 1QN8A 3OH6A 1D3UA 2FKFA 1K2YX 1QNCA 1QTPA 1HU0A 1DIZA 1PVSA 1NVPA 1E42A 3F10A 1XSZA 1QN6A 1K35A 1KYDA 1YQRA 1VOLB 1MP9A 2NOBA 2NLVA 4EALA 1UT7A 2PWWA 2QR1A 1YQKA 3CWAA 1NGMA 4I8OA 4CFFA 5JN5A 1TGHA 2V8QA 3CW7A 4PY5A 2Z8UA 1UT4A 3BKQX 3PMGA 5KL0A 2NOFA 3ULXA 3ENOC 2H4LX 1QN7A 3OSMA 1YQLA 4DULA 2QRDA 3RPJA 1PZDA 4B0AA 3T4NA 2H5AX 1M3HA 3DPTA 3NA5A 4WXAA 1N3AA 4ROEB 1B9KA 1Q9UA 2D0CA 2FGTA 1QN4A 1LWWA 1VKLA 3OC3C 5BMPA 3RSMA 1QTSA 1KO9A 2MJ7A 1WQAA 2EHBD 3KRMA 2Y8LA 3HS9A 1C9BB 1CDWA 4D7RA 1YTFA 3EAYA 2NWVA 1KY6A 3F0ZA 2G30A 1RM1A 4EAIA 1P5DX 1QN3A 2IV9A 3CVSA 2FKMX 3SNSA 1YQMA 1P5GX 2HKPA 2MZ8A 4IL8A 4RODB 5HSHA 3VN5A 5IYCP 1KFQA 1N3CA 3D4VA 1KYUA 4TPSA 1KY7A 1EBMA 2NOZA 2FUVA 5EPCA 4HJHA 2QREA 2YA3A 1N39A 3DPUA 5JMVD 3I3WA 2JOIA
chains in the Genus database with same CATH topology
1V5SA 2OOXA 4EAGA 2Y8QA 2EHBD 2Y8LA 4EAKA 2V9JA 2ZFDB 3OSEA 2QRCA 4EALA 2QR1A 2OOYA 2QLVA 4EAIA 4CFFA 2V8QA 2V92A 1UL7A 2QRDA 3TDHA 2QREA 3T4NA 2YA3A 3TE5A 4EAJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1V5S A;  2OOX A;  4EAG A;  2Y8Q A;  2EHB D;  2Y8L A;  4EAK A;  2V9J A;  2ZFD B;  3OSE A;  2QRC A;  4EAL A;  2QR1 A;  2OOY A;  2QLV A;  4EAI A;  4CFF A;  2V8Q A;  2V92 A;  1UL7 A;  2QRD A;  3TDH A;  2QRE A;  3T4N A;  2YA3 A;  3TE5 A;  4EAJ A; 
#chains in the Genus database with same CATH topology
 1V5S A;  2DKD A;  3OCI A;  4EAG A;  4QG5 A;  3CWT A;  5BMN A;  5IYB P;  2F7L A;  1MPG A;  1PCJ X;  1WJW A;  3OST A;  3PDK A;  5F9C A;  1QNA A;  3I0X A;  2NOI A;  2V9J A;  1JDY A;  4EJY A;  2JHJ A;  2ZFD B;  1PCM X;  2QLV A;  2HL8 A;  3OGD A;  4D7Q A;  2Z0F A;  4BJU A;  1QNE A;  3N89 A;  5IYD P;  3ENC A;  2IV8 A;  1UL7 A;  4MRQ A;  3KTU A;  3C04 A;  1LWY A;  3OH9 A;  3I0W A;  3TDH A;  1QNB A;  2NOE A;  1KYF A;  1M5Q 1;  3HS8 A;  1C47 A;  3IH7 A;  3CWS A;  1M3Q A;  4EAJ A;  1VTL E;  2DKC A;  1TBP A;  1EUV A;  2R5X A;  1YTB A;  1VOK A;  2HL9 A;  3H1Z A;  3EIK A;  1AIS A;  1J3M A;  2Y8Q A;  1TUO A;  2D0A A;  3CVT A;  2D0B A;  2NOL A;  4EAK A;  1QN9 A;  4ROC B;  3OSE A;  4Q11 A;  2QRC A;  1FN7 A;  2I5W A;  2JHN A;  2OOY A;  2VJ0 A;  3ASM A;  2LAE A;  2DKA A;  4EJZ A;  1LXT A;  2NVM A;  1PCZ A;  1QN5 A;  5AN4 A;  2V92 A;  1C4G A;  2O3O A;  3UW2 A;  4WX8 A;  1W80 A;  1TBA B;  1JFI C;  2HZM A;  1T6A A;  1KFI A;  4WZS D;  1R4X A;  4C7P A;  2NOH A;  2YH5 A;  3OLP A;  3TE5 A;  1LWV A;  2HZS A;  3CWU A;  2JPI A;  1NH2 A;  2XHI A;  3D7Q A;  1VTO A;  2OOX A;  1QN8 A;  3OH6 A;  1D3U A;  2FKF A;  1K2Y X;  1QNC A;  1QTP A;  1HU0 A;  1DIZ A;  1PVS A;  1NVP A;  1E42 A;  3F10 A;  1XSZ A;  1QN6 A;  1K35 A;  1KYD A;  1YQR A;  1VOL B;  1MP9 A;  2NOB A;  2NLV A;  4EAL A;  1UT7 A;  2PWW A;  2QR1 A;  1YQK A;  3CWA A;  1NGM A;  4I8O A;  4CFF A;  5JN5 A;  1TGH A;  2V8Q A;  3CW7 A;  4PY5 A;  2Z8U A;  1UT4 A;  3BKQ X;  3PMG A;  5KL0 A;  2NOF A;  3ULX A;  3ENO C;  2H4L X;  1QN7 A;  3OSM A;  1YQL A;  4DUL A;  2QRD A;  3RPJ A;  1PZD A;  4B0A A;  3T4N A;  2H5A X;  1M3H A;  3DPT A;  3NA5 A;  4WXA A;  1N3A A;  4ROE B;  1B9K A;  1Q9U A;  2D0C A;  2FGT A;  1QN4 A;  1LWW A;  1VKL A;  3OC3 C;  5BMP A;  3RSM A;  1QTS A;  1KO9 A;  2MJ7 A;  1WQA A;  2EHB D;  3KRM A;  2Y8L A;  3HS9 A;  1C9B B;  1CDW A;  4D7R A;  1YTF A;  3EAY A;  2NWV A;  1KY6 A;  3F0Z A;  2G30 A;  1RM1 A;  4EAI A;  1P5D X;  1QN3 A;  2IV9 A;  3CVS A;  2FKM X;  3SNS A;  1YQM A;  1P5G X;  2HKP A;  2MZ8 A;  4IL8 A;  4ROD B;  5HSH A;  3VN5 A;  5IYC P;  1KFQ A;  1N3C A;  3D4V A;  1KYU A;  4TPS A;  1KY7 A;  1EBM A;  2NOZ A;  2FUV A;  5EPC A;  4HJH A;  2QRE A;  2YA3 A;  1N39 A;  3DPU A;  5JMV D;  3I3W A;  2JOI A; 
#chains in the Genus database with same CATH homology
 1V5S A;  2OOX A;  4EAG A;  2Y8Q A;  2EHB D;  2Y8L A;  4EAK A;  2V9J A;  2ZFD B;  3OSE A;  2QRC A;  4EAL A;  2QR1 A;  2OOY A;  2QLV A;  4EAI A;  4CFF A;  2V8Q A;  2V92 A;  1UL7 A;  2QRD A;  3TDH A;  2QRE A;  3T4N A;  2YA3 A;  3TE5 A;  4EAJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...