3OSGA

The structure of protozoan parasite trichomonas vaginalis myb2 in complex with mre-1-12 dna
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
111
structure length
110
Chain Sequence
VQVNKAAKKQKFTPEEDEMLKRAVAQHGSDWKMIAATFPNRNARQCRDRWKNYLAPSISHTPWTAEEDALLVQKIQEYGRQWAIIAKFFPGRTDIHIKNRWVTISNKLGI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MYB21
publication title Molecular basis of the recognition of the ap65-1 gene transcription promoter elements by a Myb protein from the protozoan parasite Trichomonas vaginalis.
pubmed doi rcsb
source organism Trichomonas vaginalis
molecule tags Transcription/dna
total genus 37
structure length 110
sequence length 111
chains with identical sequence D
ec nomenclature
pdb deposition date 2010-09-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13921 Myb_DNA-bind_6 Myb-like DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 3osgA01
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 3osgA02
3UKGA 1IDYA 3S17J 2DA3A 1LFUP 4IEJA 4M3FA 4AUXA 3ZQGA 5EGOB 1LE8B 1WPKA 1X2NA 1MSEC 3S2HJ 1OJLA 3S16J 2VUMJ 1W0UA 4A3BJ 2LK2A 4MLOA 5GPAA 4DYCA 2GM4A 2I10A 2XGEA 2ECCA 5F27A 4BY1J 2D5VA 1D5YA 4FISA 1T33A 1TWAJ 3PO2J 1FIPA 2L7ZA 2VKVA 3SDGA 1FEXA 2DN0A 2YUSA 3TEDA 4A3IJ 2JJ7A 3TP0A 5FKNA 1TWHJ 3JRDA 2CU7A 2CJJA 4L5EA 2MG4A 1JUPA 2LY9A 1ZR4A 3WHCA 2DA6A 2LR8A 4S0HB 3SJMA 2DMNA 5K7HA 3ZQCA 1MBEA 1FTTA 3CCYA 3ZQFA 1RKWA 3Q0WA 1TWGJ 1WH5A 3MN2A 4JX6A 2P81A 4D5CA 1B8IB 3M4OJ 2M2EA 2DMTA 2LP0A 3A03A 2LTPA 2XGDA 4UUTA 2K9SA 3PM1A 1E3OC 4LOCA 3RKQA 1MNMC 2X9DA 3S1NJ 1ZK8A 1WI3A 2Y2ZA 4BBSJ 1UHSA 2XRLA 3LNQA 5FKKA 1NTCA 2XPVA 4MFDA 2R5YB 1ENHA 1ETYA 2Y9ZA 3PO3J 3BQYA 3ZOBA 3BR3A 2ME6A 1BL0A 4X6AJ 5EG0A 1HDPA 2FQ4A 1ZGWA 2N8GA 4JX5A 2L7FP 1H89C 4A3EJ 1U78A 2IEKA 4DW6A 4JP0A 5IOYA 3E7LA 5FLVA 2JA7J 2DMPA 2M34A 2M8GX 2Y31A 1I3QJ 1S7EA 5EF6A 1SFOJ 2IBDA 1H8AC 2CQXA 4AC0A 1W0TA 3I4NJ 5M3FJ 5IYBJ 2MGQA 3FK6A 1X58A 1ZQ3P 5C4JJ 2HI3A 1QRYA 2X48A 1GDTA 5M5XJ 3K7AJ 3QPLA 4B3AA 4RDUA 3BT9A 5BNGA 1RKTA 1B72B 1FIAA 3G1LA 3HB9A 5K7ZA 1VF9A 3BR0A 3A01A 3HOUJ 3BTJA 3IH2A 5F04A 4GFBA 2LVSA 1GT0C 1O4XA 1JJ8C 2FJ1A 1QPIA 3IH4A 4M6VA 4C3JJ 5F08A 1JJ6C 2EZLA 2TRTA 4C2MJ 2R5YA 5FKLA 2E19A 3K2AA 3GTKJ 4DZJA 2O8KA 3HOYJ 3BTLA 1BA5A 4DZPA 1Y1WJ 2G0EA 2E2IJ 5F0FA 5JLWA 4B1RA 5K7FA 2JA8J 2E2HJ 2R7ZJ 5J1RA 2RAEA 3VPRA 1JUSA 1P7JA 1VFCA 3S1QJ 4XK4A 5EG0B 3OSFA 2L7MP 1NK2P 4J19A 3O8HA 2Y0SN 1SANA 4XRSA 3HKZN 3GTQJ 3FKIJ 1GUUA 1U9OA 1Y1VJ 3I4MJ 1VNDA 1PUFA 2L9RA 2M0CA 1TC3C 1ZKGA 4UUSA 3TP3A 4IHXA 1AKHA 2CRGA 5EZGA 2W48A 3A02A 3ZQIA 3Q0UA 4IHWA 1UMQA 4I76A 1B72A 1JTXA 5F0HA 1MH4A 3RZDJ 1Q1VA 2DA1A 4QTRA 4A93J 2XB0X 5IYCJ 2PMZN 1A5JA 1HF0A 2LFBA 5M5YJ 4W97A 1IJWC 3JR9A 1WCMJ 4A3FJ 3WHBA 4BY7J 3A01B 1IV6A 3G1MA 3Q0VA 2O7OA 5EZHA 5JLXA 5FKOA 5FKMA 4EEFG 2E1OA 3O8GA 3S15J 2Y9YA 2KDZA 1DU6A 2EZIA 4M3BA 1GV2A 2HXIA 2ECBA 2NVTJ 4JX4A 2DMQA 1XS9A 3S14J 2EQRA 1BJZA 2XGCA 2ID6A 4Y7NJ 2HQ5A 4A3MJ 3NAUA 4G12A 2R92J 2TCTA 1ETXA 5IP9J 4X1EA 5IOZA 2CUFA 5E3MA 1MH3A 2JA5J 1ORKA 2EH3A 2HOSA 1IDZA 2Y30A 2NVQJ 1JT0A 2VPRA 1PUFB 1ETKA 3HDDA 5IPAA 1APLC 2NVXJ 3BR5A 4UUSB 4XICA 1AKHB 1K83J 1TWFJ 3JRGA 1IC8A 1H88C 4M3DA 1WH7A 4IHYA 1JKRC 1ETWA 2B63J 3GTLJ 4CYCA 1VI0A 2H8RA 1IGNA 3JRIA 2JWTA 5GP9A 1JTYA 2NVYJ 2VKEA 2XB5A 1JKQC 1IUFA 1G2HA 3F0CA 2OF7A 2JK3A 1CQTA 3FISA 3JRBA 2LD5A 3JRCA 2LLKA 1YRNA 1JGGA 1MBJA 5EDNA 2K9QA 3MKLA 1F36A 2COBA 1ETQA 3Q3SA 2XSDC 2HDDA 3QPSA 2ME0A 1GV5A 2AHQA 1FTZA 1HCRA 2HYJA 2NS8A 5J1UA 5C44J 2DA2A 1JKPC 4I6ZA 2EZHA 2M9HA 2FX0A 2R0QC 1POGA 2L0KA 2JA6J 4V2GA 3ZQHA 1QVTA 3DCFA 4A3JJ 5IYDJ 3CDLA 3GTGJ 1OFCX 2GBYA 3LSGA 1U9NA 2HOAA 2ZB9A 2CQQA 5E3OA 4D7NA 2O9LA 4A3DJ 1BW6A 2FD5A 3DEWA 2XPWA 2CUEA 2QCOA 3HEFA 2R5ZA 3LSRA 1IRZA 4FE4A 2DA4A 3LOCA 1Z77A 5EEAA 4AYBN 2NS7A 4QSHA 1JUMA 1LFBA 4QIWN 1MBHA 1X2MA 1MBGA 3H3VK 4D7MA 4DYRA 1DU0A 5GPCA 2DA7A 2WV1A 3BR6A 3C2BA 4ABZA 2HOTA 5FJ8J 2DTZA 5EYRA 2KT0A 3B6AA 2DJNA 1U8BA 5DTDA 2YS9A 1F43A 4CYCB 4MFEA 2LKXA 4W1UA 1T56A 2VI6A 5J1YA 5IP6A 5F0CA 1R9TJ 5M3MJ 1XC5A 1WGXA 3MVPA 1JKOC 4BXXJ 1RESA 4A69C 3S2DJ 2JMWA 4D5FA 4XRMA 3B6CA 5E3LA 5HODA 3BQZA 3JREA 4FE7A 4BKXA 4DYQA 5F1JA 3BR2A 3RQIA 1IG7A 3FK7A 3HM5A 1YRNB 2MSYA 3OIOA 1GVDA 2X6OA 1MBFA 3HGYA 1UG2A 2XPUA 4C3HJ 1ETOA 1OCTC 2H1KA 1K61A 3IV5A 3GTJJ 3RZOJ 3ZQLA 4A3CJ 4XIDA 4MIMA 1XG1A 1ZTRA 3BR1A 5J3LA 3LSPA 4NDLA 3S1RJ 1ZR2A 3H0GJ 2GLOA 5C4XJ 3HGGA 3HOWJ 2K9NA 3GTPJ 5EGOA 4RBOA 1NK3P 3L1PA 1LE8A 2E2JJ 1AHDP 3TW6A 2MW8A 3IH3A 1OCPA 2WAQN 4HNVA 2ID3A 3FIWA 5C3EJ 4A3KJ 3HOVJ 1I50J 4C3IJ 1ETVA 1A6IA 3CMYA 2R5ZB 1FJLA 2HXOA 4FTHA 3OOUA 5IP7J 3BG9A 4A3GJ 3BTIA 2IAIA 2AO9A 5M5WJ 1MSFC 2YU9J 3JRAA 3JRFA 4A3LJ 9ANTA 1QVUA 4B4CA 1HDDC 3SFIA 4V2FA 1Z0XA 1RETA 3TW7A 3GTMJ 1HLVA 4MO7A 3BG5A 3CQZJ 3M3YJ 3LSJA 1RR7A 1JT6A 4BBRJ 1B8IA 1AU7A 3GTOJ 2OPTA 1MBKA 3HOXJ 1P7IA 1I6HJ 3GBGA 3HBLA 3BTCA 1TWCJ 2DMUA 2JN6A 5E3NA 5FLMJ 1ITYA 2QF7A 3S1MJ 2DA5A 4IHVA 2NOGA 4M3GA 2EBIA 2WB1N 3D1NI 2ELKA 3OSGA 1EF4A 3BG3A 1RPWA 4FCYA 3JRHA 3QQAA 4Y52J 2EZKA 2K40A 3HOZJ 4M3EA 2R93J 3W6VA 3G1OA 1HOMA 4XRSG 4JYKA 5DS9A 1BW5A 3NARA
chains in the Genus database with same CATH superfamily
1V3FA 1MD0A 1IDYA 2LC2A 3GFMA 4M3FA 1F5TA 1SVLA 3CCJI 4KFCA 1QU3A 2EILH 1WPKA 3HPGA 1YJ9I 4Q47A 4EGZA 2WAQA 4XLCA 2VUMJ 4O5VA 1W0UA 2EFNA 4A3BJ 2LK2A 4E7KA 5GPAA 3E3VA 4XKBA 5LRSA 3L2RA 2I10A 5F27A 3KEQA 2DXIA 5AIPA 5L3CA 4FISA 2IGMA 2L4MA 4DGWB 1HSTA 1DPRA 3JAMK 1FIPA 4MQVA 3F6VA 2VKVA 3SHFA 3SDGA 1OYYA 2DQRA 2DN0A 3TEDA 2XF6A 2KJCA 3CCQI 1TZLA 2CU7A 2MG4A 3I58A 2XV4S 3I3LA 1I5ZA 2BEOA 1IRFA 2LY9A 1WRJA 4N9IA 3S93A 3W6JB 3WHCA 2LR8A 5DDGA 4S0HB 1XCVA 4RA2A 4IRHA 3MWMA 4IRGA 1MBEA 2DFEA 2XKOA 2PJPA 2IJLA 2IW5A 2JRTA 3Q0WA 3GFJA 4JX6A 2OBPA 2M2EA 5CPRB 3ZCOA 2AXLA 2WBMA 4ZDLA 3ZN1A 2QQ8A 4A6EA 3RKQA 3QAHA 1MNMC 1WVRA 2QBYB 3S1NJ 4P96A 4O6JA 4BDZA 1UHSA 3ZR8X 4L0YB 5BOXA 2FE3A 3LNQA 1BIAA 2V9VA 3BG7A 3F8BA 5FKKA 2PJRA 1NTCA 5B1AH 2MYSA 1OR7C 5GADJ 2Y9ZA 1QHGA 4G7ZF 1XTAA 3RQ4A 3BR3A 4DOZA 4L9TA 5EG0A 1HDPA 1R1TA 3RSNA 1MJ9A 2H1LA 1MNEA 2OCCH 5A2QK 2FBHA 3FX3A 2IEKA 3BCAA 2V6CA 2ZMEB 2AXTC 3BC8A 2CQKA 2Z99A 3RKXA 4OAYA 1BOBA 4JOMA 1ZYRF 2M34A 2M8GX 3M1CA 2BOLA 2OV7A 2IBDA 2RC4A 1XSXA 4PSWA 3GO5A 1JE8A 4LB6B 4Z6YA 1W0TA 4KIFA 2F5CA 2KL4A 2OU2A 3LA2A 3QYBA 2X48A 2HFHA 3FMQA 1ULYA 1XGOA 1D1CA 3WU2C 2J5OA 1IN6A 2E5ZA 3J81K 4PDKA 1QQIA 3HXLA 5DUKA 3BT9A 3W3CA 4KYWA 1FIAA 3DBLB 5B1BH 2ZMEC 4DNCA 4RGXA 2Z16A 1BJAA 5K7ZA 1XMKA 3TOAA 3ECHA 3BTJA 4GFBA 4MEYF 2EJRA 1O4XA 5DD4A 1GT0C 1JJ8C 2OA4A 3HUGA 5H20A 3HJEA 2IGOA 3IH4A 4IOCF 4C3JJ 3OR1C 4AU7A 1IRXA 2ZXJA 1JJ6C 2VQCA 1H9GA 1TP4A 2PN6A 3KYDB 5H2FC 5FKLA 3T0YA 4MNUA 3GTKJ 5TGTA 2WA0A 4DZJA 4XKCA 3QU3A 4CGZA 3K10A 2BY2A 2DAOA 4HLXA 4PFPA 1Y1WJ 3CJTB 3G3ZA 1S5LC 1EKEA 4M9SA 4EQQA 4IQJA 2LNBA 1RUOA 1KYWA 4ZH4F 2ISYA 3EUAA 4P5OA 5FLXK 3WU0A 3PJRA 2RV8A 3HSEA 4NC7A 1A6QA 3JSPA 3G73A 1BM9A 1NK2P 3FHZA 2PEXA 3KP6A 4J19A 3AG3H 3C3WA 5FFXA 1SANA 1BI3A 3MQ0A 3CD6I 3FXLA 3DTKA 3MKYB 1RZ4A 2IA2A 3TDUC 1ZKGA 1B9NA 2R7FA 4AWXB 4CCOA 2W7NA 3GMEA 2CRGA 3FMRA 2MFZA 4F55A 5CVUA 3G71I 4BNCA 3A02A 3JTGA 3HPHA 3NWTA 4I76A 1FBQA 3CTAA 3HTSB 1ZGAA 4XN3A 3CJNA 1Q1VA 2XB0X 1TQPA 4HSRA 3X2QH 4NQWB 1A5JA 3UR3C 2R7SA 2K86A 1K4SA 2WY8Q 1IJWC 3B73A 1KA8A 3GFLA 1W5SA 4A6DA 1ZLJA 2YX4A 3A01B 4U88A 2LBFA 2CFOA 3Q0VA 3V42A 4PCQA 1UELB 3OV8A 1GXQA 2HPIA 2DK5A 3KP7A 2FEZA 4I09A 5HS9A 2DDBA 3FZVA 2H8WA 5D5UB 5BQTA 1HA8A 2G9WA 3CC4I 5LHIA 2L54A 1YW7A 1SVMA 2ECBA 2RVCA 1BBYA 4F93B 2HYGD 1K6OA 1VQPI 5IY5H 2ZFWA 4NC8A 3I4PA 2VOOA 2FOWA 4A5MA 4B48A 5HDKA 1SD5A 2TCTA 2NS0A 3G6EI 4J01A 4RM2A 5IP9J 2E34A 5KCMA 4X1EA 5JHFA 2VL8A 2OD5A 2OJED 1OKRA 1MH3A 3E97A 2ZJQF 1VQ7I 4HNTA 5GAHJ 4UNOA 4GYIA 4A0ZA 2JVGA 1PUFB 1HXDA 3ZP5A 2M0MA 5LLQA 1SEUA 2O03A 4MGRA 2ADUA 3J80Z 3DU6A 1AKHB 3DLLF 3NRVA 1MMDA 4EVIA 1IC8A 1H88C 2HPMA 4RAGA 1I39A 2B63J 4EJUA 4CYCA 3BJ6A 3CCMI 2PMUA 4E7HA 2CMPA 4OINF 5GP9A 5CVVA 4BH9A 1G3SA 2NVYJ 1QPMA 5ICEA 4YG2F 3RTRA 2WY7Q 2XB5A 5DM7F 1JKQC 4C2TA 1W5CC 1V5GA 1IUFA 1G2HA 4IX7A 4OMYA 4KICA 5D6FA 3OS0A 1GLNA 5E18F 3KE2A 1CQTA 1R1VA 2WV0A 1G3WA 3V8LA 3EUHA 2F5VA 3H92A 2X1EA 1Y6IA 1YRNA 2XC7A 3CDHA 1MBJA 2XAJA 3AG4H 1MZBA 1O3QA 4L0ZB 2K9QA 3SEZA 4BQAA 2BY0A 1EH7A 2AHQA 2GQQA 2IA0A 1VTNC 2MD5A 1X1BA 2LSOA 5K5RA 1YFHA 4I6ZA 3ML6A 2EZHA 1WHUA 2FX0A 1LVAA 1POGA 2BY1A 4HQEA 5CVIA 2X1DA 4WXHA 2ELHA 3LMMA 3GTGJ 2M4GA 3MD2A 4O3MA 1P92A 4L9VA 1OFCX 4AIDA 4Y17A 5LBQA 4LLGF 3LSGA 4LIUA 2HOAA 4CH7A 3R0JA 1VZ0A 4D7NA 2DPUA 3NQOA 4A3DJ 3DEWA 1W7PA 3ABUA 5F1RA 1BC7C 3EUKL 2VBXA 5KK1A 1YOVB 3HEFA 3BPXA 3WTYC 2VJ5A 3OYEA 1IRZA 1IUYA 2QENA 5EEAA 4AYBN 2XROA 2P6SA 4QSHA 2V4JC 4HDUA 1I3AA 1LFBA 4XQFA 1X2MA 3HC7A 5E1ZB 4D7MA 3OYLA 1XD7A 3H3VK 2LG4A 3GZ5A 3IRRA 3C2BA 2K3PA 5HLIA 1ZELA 2DTZA 4P9UA 2F4IA 3B6AA 1MMNA 2YS9A 3H9QA 2LKXA 4AD9A 5F0CA 3I54A 1WGXA 2PX9A 3MVPA 3L2QA 4ESJA 2KPMA 2W1OA 3HZJA 2KISA 4BXXJ 4A5NA 3I59B 2ESNA 4ENKA 4A69C 3OS2A 2OAZA 3K70C 3CCRI 3FBNB 5HOOA 3FXJA 2V26A 3BR2A 1NHAA 3RQIA 4UB6C 3DKWA 1IV8A 3HM5A 3K4LA 1KZHA 4BE1A 3S3MA 4YRVA 3HGYA 1UG2A 3K4MA 4C3HJ 1OLTA 4KT5C 4TV7A 4WK8F 1K61A 4X0GA 3IV5A 2A6TA 2WTEA 3P9IA 4BJTA 4XIDA 1UCRA 4KDPA 2D1VA 3K70D 2M5WA 3FWEA 3EETA 2GLOA 1ZRDA 4IJAA 3HOWJ 1X4OA 4RBOA 4P9FA 1DP7P 4U0YA 1AHDP 1TT0A 3TW6A 3BJOA 4XM3A 4ENNA 3C7JA 5LEKA 2IP2A 2X6XA 2ID3A 4G9YA 3LSHA 5C3EJ 4QWQA 2RDPA 1R00A 1I50J 2V9PA 3K4BA 4FT8A 3WTSC 4BDYA 1A6IA 3CMYA 4HA8A 2HXOA 3COAC 1IF1A 1STZA 4L5JA 3LAJA 4KMFA 4BJ6C 4DIQA 5M5WJ 2AO9A 2A68F 1MSFC 1O7LA 3HSFA 4M73A 2IS6A 1Y8RB 5DYMA 1HDDC 4M6XA 3PFYA 4V2FA 1EJ9A 3CESA 1RETA 2LKPA 3CF2A 3LFKA 1DDNA 2ZNYA 2JSCA 1REPC 2FF4A 2G7HA 2XAHA 4XN0A 5AONA 5F6FA 1RR7A 4D0PA 2BXYA 4BBRJ 1F4KA 3GVAA 5CLSA 2ZXHA 3DLAA 1I6HJ 3AFHA 3C1DA 2L7KA 3J7AY 2K7LA 4AM3A 3I56I 4BE2A 1LKXA 3DU5A 4RB1A 1EH8A 2QBYA 5TJJA 5JHUA 4NB5A 4IHVA 4UVAA 1RPWA 3JRHA 4RB0A 4BACA 3FXOA 2K40A 4BQQA 1VQ5I 4I02A 2FQ3A 2PLYA 1BI0A 2E35A 2HEOA 5DS9A 4JYKA 2ZSIB 2V1UA 5FRNA 3ZMSA 4DBRA 3M1EA 1WWXA 2RNJA 4XLEA 2E71A 2FRHA 3S17J 2RNGA 3GFIA 2JUGA 4YFXF 2DQLA 3KX2A 2LY1A 1LFUP 2ZMEA 5EGOB 1MSEC 3S2HJ 1KU9A 2HU9A 1E3PA 4PGGA 5LGUA 5IT9K 4HF0A 5L3FA 4MLOA 2M30A 4CYDA 1LDDA 1E0EA 2D45A 2XGEA 2ECCA 2ZSHB 4H0EA 2D5VA 1BI1A 3FF5A 4CZCA 2FSWA 1X1AA 4IHSA 1X3ZB 2BV6A 2B7EA 3PO2J 5ERIA 1LUJB 3F9KA 4BEHA 4A3IJ 1WJEA 4UV8A 1R5ID 2CQ7A 2JJ7A 5EJCA 1YQAA 1ZGJA 1TWHJ 4XRFA 4L5EA 2L9VA 3RKWA 1QA6A 4RAFA 2DA6A 2FMLA 3GXOA 3FDYA 4ZYEA 3ZQCA 1MGTA 3PSFA 2F4MB 1ACIA 3PUBA 5HDNA 1IN4A 1U5TB 3M4OJ 4UXNA 2K85A 2BYVE 1C0WA 4XBFA 5E20A 2QVOA 2XGDA 1W1WE 4UUTA 1Y0NA 1N75A 1BI2A 3LL7A 4IOAF 4OWRB 4M74A 2NNYA 1QGPA 4BBSJ 3M7GA 2VBWA 2QSHX 4CCJA 1KU2A 3E5XA 3F8NA 5ICFA 4MFDA 4PJLA 1Z21A 1ETYA 2R5YB 2VC1A 3OWTA 2MBFA 2JA2A 3ZOBA 2I5UA 2H94A 4EATA 4X6AJ 1YW8A 2FQ4A 3TOBA 1LQ1A 1CF7B 4B47A 4DW6A 1Z67A 5FLXZ 3IC7A 1DP3A 3PIOF 1FOXA 2LF7A 1I3QJ 5J6XA 3BZKA 2O5RA 1Z05A 4HRIA 1K7AA 4AC0A 4FX0A 2LH9A 2W25A 2Y0MA 4I0BA 2R7QA 3TO6A 1ZQ3P 5ILVA 5C4JJ 3VDXA 2BE5F 4B44A 3L09A 2KIQA 1GDTA 4V19K 1FC3A 3K7AJ 3QPLA 4NQWA 5HLGA 4XLNF 4HOBA 2Q8KA 4HPQA 2DOFA 4BAYA 5TRDA 1RKTA 4JBAA 1AA7A 2PQ8A 4A0YA 3OS1A 2CG4A 1BR1A 2VOPA 2LY2A 3G1LA 3ASNH 4S05A 1ERDA 3BR0A 1R4NB 3A01A 3HOUJ 3CMMA 2NOJB 2W84A 3IH2A 2LVSA 3RPUD 3DTEA 4XL9A 1U6GA 3QP5A 3U1DA 4ZDOA 1X4PA 4M6VA 2NYXA 1FYMA 4LIVA 4U0VA 2EZLA 4UVBA 1ZG1A 2HTSA 2RN7A 4PFOA 2TRTA 4C2MJ 3L2VA 2E19A 2DOAA 3IRQA 5E79C 3N05A 2O8KA 3HOYJ 3HYIA 4E7LA 1BA5A 2DK8A 4DZPA 1R4MB 2G0EA 3VFZA 2CQNA 4B1RA 2ZXIA 3SZPA 4YIIA 5DEQA 4R1HA 5J1RA 3OYHA 1XMAA 3FXRA 1P7JA 4XK4A 1J09A 2XAGA 2Y0SN 1VQMI 1T08B 4YFKF 1GUUA 1U9OA 3BWGA 1T95A 1IN7A 3I4MJ 1PUFA 2L9SA 2FU4A 1P9QC 3F23A 3TP3A 3WE2A 4KIBA 1AKHA 4ANJA 4EJVA 1R49A 1J59A 2K4JA 1HW2A 1TQMA 4Y13A 1B72A 1P6RA 1JTXA 5F0HA 1R58A 3QPHA 5J8FA 1IN5A 4QTRA 3TQNA 3LAPA 4P55A 3MKWB 3PIPF 1OCOH 4W97A 3E5UA 3OR2C 3VWBA 4M6YA 3IKTA 3JR9A 4NHJA 2YU3A 2Q1ZB 3WGIA 4UB8C 5B5EC 2MH2A 3SFZA 1I27A 1LPQA 2O7OA 2QYOA 3RKYA 5JLXA 1V5FA 2E60A 4HDVA 5FKMA 1TNTA 1B59A 2X1CA 4F91B 1YIOA 3BP8A 2KDZA 1J5YA 4M3BA 5ED4A 1WJBA 2X6WA 2BW3B 3H36A 3WTZA 1LVKA 3V8JA 3DF8A 3FKJA 4Y15A 4ESBA 2C6YA 3S14J 2R7TA 2KRCA 1QHHD 2EQRA 4BGDA 3BZ6A 2HQNA 4ON0A 2WWYA 2R7UA 2ID6A 2DBBA 4Q4ZF 3E6MA 1HW5A 3H0DA 2BGCA 1KQ9A 4A3MJ 1ETXA 3Q9SA 2LKSA 3DXJF 3LQRA 4F92B 3R0AA 1UB9A 2FNAA 1S29A 2P4WA 3T8TA 2R7WA 1PDNC 2JA5J 1ORKA 4P1WA 1T38A 2HOSA 2ZKZA 3C2GA 3V8KA 3BZCA 3WTVC 1HKQA 2Y30A 2NVQJ 2ZCWA 2P5VA 1JT0A 2E5NA 2VPRA 1ETKA 5IPAA 1IN8A 2EK5A 1PP7U 2Y48A 2KIMA 2NAZA 3IKVA 4MQ9F 5DCMB 4XICA 5D4RA 4M3DA 3KYLA 3EQLF 2IVMA 1ETWA 1G3TA 3GTLJ 3VSKA 2H8RA 2OQRA 1KU7A 3JRIA 2JWTA 1YIJI 3M07A 1JTYA 4CSWA 1VQKI 2HTJA 1XSDA 1PYVA 1TQIA 1V4RA 1S7OA 2LOOA 2JK3A 4PGHA 2YX7A 4AIHA 1FMWA 3DKXA 4ZZLA 1FWZA 3MFKA 2LD5A 1OMIA 3N97A 2HWVA 4HQMA 1JGGA 3HSRA 2L02A 4F7ZA 3MKLA 1F36A 2ZJ2A 2KMUA 2HDDA 3WTTC 2ME0A 1GV5A 1I6XA 1UG0A 2HKXA 2M7BA 5J1UA 4YFNF 1JKPC 2M9HA 3K0LA 5LHHA 3MZYA 2DTRA 4PK4A 4A3JJ 2DODA 2Q2EB 5CYVA 4E7ZA 3ZMUA 4B43A 4ZYGA 1IXSB 3H5RA 4ITVA 1BW6A 2P0WA 3K69A 4PJNA 3J7AO 2QCOA 3LSKA 3KZIC 2D2WA 2KRHA 5FRMA 2MLGA 2DA4A 3LOCA 4NNJA 4IVNA 5H6QA 4RAZA 1DGWY 1MBGA 2YR2A 3M8JA 4OOIA 1G59A 1G3YA 4E70A 3FM3A 2MC3A 4Y33A 5EEHA 4EMSA 2KT0A 3RYPA 4M9ZA 4L5IA 4MFEA 4W1UA 1T56A 2MC4A 2VI6A 4LITA 5M3MJ 1XC5A 4C9YA 3WG7H 2K3FA 3CUQC 3RI4A 2KJBA 2XSJC 3PFIA 4IKFA 4D5FA 3L00A 4I7HA 3MEXA 3D5SC 1MJBA 5HODA 2UXNA 3E5QA 2DPDA 3BQZA 1L3LA 3JREA 2YPRA 3FK7A 2EA2A 3SQNA 5LFAA 5LRRA 3DKYA 3MMYB 1J7KA 4LMYA 1GVDA 2X6OA 4ESFA 2H1KA 1ETOA 1WI9A 2HVSA 2QKMB 3E6CC 5KVRA 3NWSA 2J5PA 2KQRA 1D8JA 5FROA 3GTJJ 3RZOJ 4E7IA 4B8XA 1VQ9I 1EA3A 4RGUA 2NRAC 3C2HA 3VEPA 1XG1A 3BR1A 1XX5A 3SZGA 2Z9OA 1X1PA 2QSFX 3H0GJ 1A36A 2IT0A 3NEUA 1T0FA 2K9NA 4S04A 2HDCA 2EPFA 5EGOA 1NK3P 3HKZA 4PZJA 4OMZA 2MW8A 3IH3A 3KCCA 1V5EA 3CP2A 1OCPA 1DPUA 4ZZDA 4IRIA 2GA1A 3K6GA 5FB2A 2XDVA 4IZZA 1TT5B 4HV5A 2L4AA 2IRFG 1X3UA 4FTHA 2ESHA 3OOUA 2UWMA 1WZ2A 1YYVA 5IT9Z 1OCZH 2IAIA 4II3A 2CUZA 1QZEA 1G6NA 2PMZA 1U8RA 2A69F 5HDGA 3OL4A 2HQAA 3FM5A 2FUG2 3SFIA 4IQ4A 3TW7A 3GTMJ 5JFRA 1HLVA 4XNFA 3BG5A 3KP5A 5F64A 3CQZJ 3M3YJ 3LSJA 4LFUA 2XAFA 4A2UA 1VQ6I 5FFZA 3HRSA 1BIBA 1M1EB 1WJCA 1A35A 1U5TA 3GTOJ 2UXXA 2QM3A 2OPTA 3M8EA 1MBKA 3RDIA 2IGNA 1MIJA 1P7IA 3GBGA 3J7ZI 1OCRH 1LFPA 1P2FA 2M4KA 2Z2SB 5J47A 1FOKA 3S1MJ 4IL6C 2ELKA 2BBYA 2GWRA 3DEUA 3CCEI 4FCYA 3S3OA 2Z3YA 3C18A 2EZKA 5D8LB 1B9MA 1B1BA 5BPIA 4A0XA 2R93J 3AL0B 4AIKA 5J4YA 2OQGA 2VC0A 2JVHA 1O3TA 4XRSG 3KLNA 1CF7A 5HLHA 4KNYA 4AUXA 1XGNA 4I98B 2VODA 3LA3A 1LJ9A 1XGSA 3DWLE 1OJLA 3IL2A 4RMNA 3S16J 2K9LA 3U1KA 5CQEA 4CCKA 4IF4A 2E7XA 1BC8C 2R7RA 4N4NB 4DYCA 3EYYA 2GXGA 4BY1J 2HR3A 1D5YA 3EPZA 3OYBA 2R3SA 4GDFA 4KISA 2P6TA 1D5VA 5KHDA 1T33A 3OYFA 1G8XA 3ZQ7A 1VQNI 3A1YA 3KZYA 2L7ZA 1FEXA 3AL0C 2DFHA 2YUSA 3GF2A 2W4SA 3TP0A 1ZARA 3DBHB 5FKNA 3ZMVA 3JRDA 2CJJA 2XKPA 1JUPA 2R7OA 5BPDA 2M3AA 2H27A 4BE0A 1YE9A 2KHMA 2HKOA 3P9KA 4H4KC 1ZG3A 3SJMA 4F52A 5K7HA 1A31A 3KEYA 3R4KA 1GVJA 2MD0A 1RKWA 1TWGJ 4D5CA 1FP2A 2K5CA 2JTVA 1MMGA 3EDPA 2OUMA 2EA4A 3P5JA 2LTPA 1ZG5A 4EM1A 3OMYA 2K9SA 3PM1A 3BG6A 4OU0A 4OIPF 1YW9A 4E7JA 2A07F 2Y2ZA 1O3SA 1WJ5A 3LWFA 3KP4A 2BY3A 3OYJA 1D3YA 1KQ8A 2XPVA 3A0BC 3PO3J 2RKHA 1HKTA 2AQEA 1Z7UA 3OY9A 3QP6A 5TISC 4YELA 1OYWA 2K9MA 2N8GA 3QWLA 1ZGWA 4JX5A 3BPVA 2DU9A 1H89C 4DBQA 1FYLA 4EGYA 4XLAA 1FPQA 5FLVA 5J4VA 3E7LA 2JA7J 2DMPA 2JZYA 1SAUA 4WF2A 2WAFA 3CUOA 2R7VA 2JRMA 1T6SA 3ULQB 3ERED 5EF6A 1H8AC 4BJ5C 5EEGA 4XSXF 2ICWG 1V54H 4L9JA 4XMYA 3I4NJ 2IPQX 5M3FJ 5IYBJ 4G7HF 2W82A 3FK6A 3OIPA 1OR7A 3JAMZ 4OIOF 2HI3A 2MLKA 1QRYA 1R36A 3UNGC 1FZPB 2VXZA 3CDIA 3WTWC 5JR3A 1UFMA 2R4GA 2XGXA 2M1BA 4B3AA 1HQCA 4D9JA 3JSOA 3V7RA 5BNGA 5KNLA 1ON2A 3HB9A 4LG0B 1VF9A 1JGSA 2W85A 4LD5A 4Y4RA 2HQRA 4ENJA 1QPIA 4XLFA 5F08A 3OYCA 2JSPA 2KZVA 2CW7A 2NVUB 5LHGA 2HOEA 2MA3A 3F3XA 1FOWA 2RGVA 3LFUA 3I71A 2A61A 3F6OA 2BW3A 3H3UA 2QUFA 2QEXI 2V79A 3CMAI 2E2IJ 5F0FA 5JLWA 5HS8A 3FMSA 5L3EA 5FO5A 5K7FA 3K1NA 5DUIA 2JA8J 2R7ZJ 4JQFA 1ZRCA 1JUSA 1VFCA 4CCNA 4OIQF 3S1QJ 1QO0D 1XCBA 2QQBA 3SEQA 5A2QZ 1LEBA 2L7MP 1XN7A 4HLYA 2DCEA 1T39A 3PNTA 3DPLC 3FXQA 2BHYA 2PI0A 2EB7A 2Y75A 3CC2I 3GTQJ 4HAMA 2IGKA 2F4OB 3CLQA 3FXMA 3H9JA 4XKVA 1VNDA 2K27A 4LG3A 1OQYA 3ASOH 3ROUA 1XPXA 1TC3C 2PFBA 2VBZA 5DCMA 1ONVA 1SFXA 3MZ8A 1TL8A 3J80K 3GZ6A 3WU1B 4FX4A 2ZC2A 3Q0UA 1XMXA 3VYTB 1P4AA 2Z33A 3IWFA 2ISZA 3ERMA 2W00A 1O7FA 1MH4A 3KPHA 3VYSB 3RZDJ 3DP7A 2DA1A 3I9V2 3K1PA 4A93J 5IYCJ 1OISA 4BS9A 3J81Z 1HC8A 1HF0A 5JVGF 1WJFA 1MW7A 2VKDA 3DV8A 2EIKH 2BHZA 4CCLA 1R7JA 4PJJA 3VODA 1B4AA 1IV6A 3HTUA 4EJOA 2G7UA 1FYKA 2GXAA 2WAEA 5FKOA 2WB1A 2GAUA 1JXSA 2DLLA 3HG9A 2EFQA 4EEFG 1D1AA 3I55I 2E1OA 3O8GA 3R61A 4XR6A 1PVEA 2XHKA 1JHFA 1P4XA 4QLCU 3O6BB 5KAFC 2HXIA 4HYEA 4FQGA 2E1CA 2NVTJ 4PJMA 3OIQA 4JX4A 1ZLKA 1XS9A 5L3GA 4XONA 4AIJA 4U7DA 1FLIA 1VQOI 3D5LA 3W2AA 5CVRA 3ABTA 2CFXA 4Y7NJ 5BMZA 2HQ5A 2FA5A 2E1MB 3NAUA 1BR2A 4G12A 2VPLA 1SMYF 2DFIA 2CO5A 4GO1A 2CUFA 2VBYA 1V55H 3H5NA 2UZKA 2CGPA 3D0SA 2Z1DA 3W2WA 5DV5A 3PQJA 3OYIA 3VYUB 2P5LC 3EUHC 3D5RC 3AG2H 2VJIA 1APLC 2NVXJ 1YLFA 4UUSB 4XSZF 4ZYAA 1JHHA 3JRGA 3K4NA 2B9SA 4IHYA 1UAAA 1JKRC 4WWCA 3K4CA 1HKSA 1J9IA 1USSA 1VI0A 3GLXA 4ZYDA 2DT7B 3KETA 3I5UA 2E1MC 4EJTA 2KIUA 1D8KA 1IO2A 2VKEA 3H9GA 5DM6F 1LB2A 1YJWI 2VN2A 2X85A 2TDXA 3FISA 1FBSA 1OYIA 2LLKA 3R6SA 1L0OC 2BXZA 2M8EA 3DPTA 5EDNA 3BY6A 2DYRH 3B02A 2COBA 1ETQA 1NG7A 1TW2A 2XSDC 3QPSA 2A5WA 1FTZA 1HCRA 1GXPA 2HS5A 1YHQI 1W5TA 1Z3YA 3CMEI 4N9HA 3TO7A 5CVJA 2JA6J 3ZQHA 3DCFA 3QOEA 5IYDJ 4Q48A 1FBUA 2QSGX 1Y39A 3OYDA 4KT6A 5J40A 1W7PD 3IP4B 2DT6A 1U9NA 2ZB9A 1J2XA 2XVCA 5CKTA 5E3OA 2O9LA 1ZRFA 2RQPA 2CUEA 3G2BA 2DO7A 2NNNA 2CS3A 4FE4A 3QODA 4G8XA 3EYIA 3Q9VA 1Z77A 3HHGA 2NS7A 4EM2A 1FSEA 4FETA 6PAXA 2CW8A 4DYRA 5E1WA 1YO5C 1XSVA 3GW2A 3MZHA 2DA7A 2WV1A 2KIFA 1AWCA 2HOTA 1Y56A 2EV6A 2F6CA 5DTDA 5K5QA 2HYFA 2IS1A 1R9TJ 2CW0F 1LDKB 3N4MA 3CP8A 3V4GA 4BQOA 1JKOC 2F5FA 4J00A 4UHTA 1RESA 4I0AA 1E2XA 2YSRA 1YI2I 2KDOA 3WE3A 4Q5SF 1USTA 1UZCA 4KN7X 1IAWA 3S2DJ 2XF5A 2ZJPF 3JW4A 4FE7A 4BKXA 5F1JA 5L3BA 3I64A 4L9NA 4F3QA 1TLHB 4HEA2 4ZYHA 3IUOA 1IG7A 1IW7F 2A3SA 2MSYA 3GUDA 2HVRA 1SVOA 1FNNA 1KU3A 2A05A 2CUJA 1MBFA 4L18B 3A0HC 5FD6A 1OCTC 1R5GA 1I1SA 3K4JA 3ZQLA 3CJRB 3QYEA 4BYYA 4MIMA 2LMDA 2P8TA 1ZTRA 3LSPA 3CZ6A 4NDLA 1ZR2A 3KLOA 5B66C 4GYGA 4DJAA 3HGGA 4KITB 2ZO4A 2WC2A 3ZMZA 3L1PA 3K2ZA 3HHHA 5D5VB 3SDBA 4CA0A 2VJJA 2L5QA 5JVTA 2WAQN 1UHMA 2LDUA 2E7WA 3A4CA 3FIWA 4A3KJ 3PNYA 1DGRM 1XDUA 2IS4A 2ZNZA 3T1BA 1ETVA 4C3IJ 2R5ZB 3J7YJ 1Q1HA 2LREA 1YS6A 3PUFA 2FNPA 4CDGA 3W2VA 1J0RA 4I01A 3BG9A 3GYHX 2EFWA 2OZUA 2EV0A 3KP2A 4Z2YA 3BTIA 4A3GJ 2ZXWH 3JRFA 5LGTA 4AVPA 4A3LJ 2KFDA 1QVUA 4M72A 4BXUA 3H5AA 4CO8A 3I59A 5K5OA 4LLNA 4BXFA 4HG2A 4B3XA 4GCVA 2LRDA 4HF1A 2CV1A 2LYCA 1E17A 4BEHB 1T98A 2ETHA 5E1XA 4G6QA 1HSJA 5HVQC 2NXNB 1D0YA 1AU7A 2IXSA 3FXKA 1ZHFA 3PSIA 4XLHA 3L2WA 2DDAA 4GRIA 1F1ZA 1TWCJ 2DMUA 5LEJA 4FASD 5E3NA 5FLMJ 1X1CA 1FX7A 2NOGA 4M3GA 2EBIA 4YEJA 3K4KA 3D1NI 4KMUX 3CCSI 3CJQB 1Z1DA 2AS5F 3QQAA 4MEXF 4Y52J 5ILUA 4CZZA 1T8IA 2DI3A 2H6CA 1R5HA 4M3EA 2XAUA 1MKMA 1YG2A 4LLLA 3G1OA 3W6VA 4A12A 3E6BA 4UV9A 3IHUA 3PQKA 1A04A 3L2UA 3CCUI 1BOAA 2COMA 5E17F 1W4MA 1MDMB 2O0YA 3CUQB 3NARA 3UKGA 2X51A 2DA3A 4B09A 4IEJA 1S6LA 3E0JB 3ZQGA 3OYMA 1IXRC 1X2NA 3HIFA 3LSIA 1RIOH 1LE8B 2STTA 3ISPA 2ZJRF 1PUEE 3LSTA 2JQ7A 3SYTA 1RC9A 3BROA 1MMSA 2KZGA 3OYAA 1RUNA 2GM4A 2F2EA 4XOTA 2LF8A 3OOPA 2GA2A 4ZC3A 4BHBA 3ZMDA 2K4BA 2VIXA 4XKWA 2K02A 1TWAJ 1BR4A 2DJIA 4KIGA 3CCVI 4ETSA 2VASA 4U87A 1K78B 4RS8A 3QYFA 3VB2A 3JTHA 2KLOA 5AIQA 1UJ8A 3KFWX 3ZN0A 1W36C 3ZRGA 3U21A 2M7AA 1ZR4A 2OC6A 1RR8C 1R22A 4UVCA 1H0MA 4LG0A 3T5XA 3OYNA 2DMNA 1S9HA 2FBKA 2HGCA 3MCZA 1FTTA 4IPAA 3GZNB 1RNLA 4RB2C 2QQAA 3CCYA 3ZQFA 1EH6A 3TGNA 5GAEJ 1WFXA 1WH5A 3F8CA 3MN2A 2P81A 4RLQA 3QPTA 1B8IB 3F72A 2DMTA 3FBIB 4KA4A 2LP0A 3PNVA 3A03A 4GGGA 1D0XA 1D1BA 4MHGA 1W36D 1K4TA 1E3OC 4LOCA 2FOKA 1O57A 4HZFA 2HZDA 2X9DA 4FHTA 3HL2A 1ZK8A 1WI3A 2AQFA 2XRLA 2V7FA 1SFUA 2V9KA 3KZZA 4PUSA 1ENHA 2KKOA 3S32A 4DQ2A 1Z6RA 1ZN2A 3BQYA 3RCOA 3AKZA 2Q0OA 2KRFA 2ME6A 4XOPA 1BL0A 3E6DA 2EFOA 2JUCA 3P7NA 4ZTJA 2P5KA 2UUZA 3ABKH 2L7FP 4A3EJ 2RQQA 1U78A 3KEOA 3WG9A 4JP0A 5IOYA 2GIZA 1B6AA 4AYBA 2EIMH 2Y31A 3Q5FA 1S7EA 3LA7A 1FMVA 5E8GA 1SFOJ 2X6YA 2XF7A 5KAIC 3IWZA 1SFKA 2CQXA 1EV7A 2MGQA 4IO9F 1X58A 4C30A 4PJ0C 4M9XA 2O8XA 5ICCA 3RJPA 4II2A 1WJDA 4RB3C 1SMTA 5M5XJ 2QKLB 5BS6A 2E1NA 4LB5A 2OTJI 4RDUA 3RPQA 1J75A 3HRMA 1YTYA 2F5EA 5L3DA 1B72B 1K6YA 4G7OF 4GXOA 1S8NA 2A5YB 3DPUA 3P9CA 2F5DA 5F04A 1R1UA 3ZPLA 2FJ1A 3R60A 4NC6A 4CICA 1DUXC 2R7DA 2D1HA 2CSOA 2GZWA 4HX4A 3RPUA 3F8MA 2M87A 1ZAOA 3DBRB 2R5YA 4HBLA 5FGMA 3K2AA 5D6EA 5JI6A 4QPQA 3BTLA 2V1DA 3GLLA 4RGSA 3ECOA 1Y8QB 2EINH 2HZTA 5D4SA 4UY8I 3BLYA 4HX7A 3OYKA 2PJRB 2E2HJ 3S8PA 2L01A 2RAEA 3VPRA 1Z9CA 2QA4I 1QNTA 2RREA 1Y0UA 4BL0B 2GIVA 2VE8A 3TBIA 4E6KG 3KYCB 5EG0B 2IA1A 4BU2A 3OSFA 1BN5A 3O8HA 4CUGA 3REOA 4XRSA 2ZBKA 1FY7A 2MABA 3HKZN 2FXAA 3FKIJ 1Y1VJ 3QU6A 4G6DA 1R23A 1N25A 3ZXSA 3L2CA 2ZFUA 2L9RA 2M0CA 1AOYA 4UUSA 4IHXA 3BDDA 4ZJZA 1QZZA 2VXDA 3KP3A 5EZGA 2W48A 4WXCA 3E1SA 3V7SA 3S2WA 3ZQIA 4IHWA 3K9TA 1UMQA 1IXCA 4I99C 3IAM2 5GTHC 2VLAA 4KUMA 1I1GA 3ONQA 2PMZN 1MNDA 2LFBA 5M5YJ 2Z5UA 4G6TB 4MTDA 4C2UA 2VQLA 3K1MA 2A6HF 1WCMJ 2L2OA 4A3FJ 2BZTA 2XRNA 3VYRB 5GTIC 3WHBA 1K79A 2P7VB 4BY7J 4HV6A 3G1MA 3CC7I 2PBIA 1TTYA 5EZHA 1X3WB 2XAQA 3HUGB 3ABLH 2PG4A 3CO6C 1LEAA 3FHNA 3TKYA 5GAGJ 2FMYA 1NH3A 2Y9YA 3S15J 1DU6A 1O3RA 2EZIA 2JT1A 1GV2A 3M8FA 2GOMA 3CLOA 2W24A 5LD2C 2OTLI 2DMQA 2CV2A 3H3ZA 2VT3A 1QZYA 4NUBA 1BJZA 3FXUA 2XGCA 4K2EA 2F48A 4N4OB 5D5WB 2R92J 1KGSA 1R6RA 2E36A 2I8DA 3HOSA 1KYZA 4BQNA 5HNFA 5IOZA 2P7CB 5E3MA 1F9NA 3GCMA 1CGPA 3F22A 2EH3A 2OCEA 3F8FA 1IDZA 4WXDA 2STWA 2VT2A 3HDDA 2BVLA 1Z7LA 3CO7C 5J8CA 2VJ4A 2OZ6A 1TBXA 2HDWA 3BR5A 3ZMTA 2W57A 4HNUA 1YX5A 3TDZC 1K83J 1TWFJ 1NG6A 1ODDA 1WH7A 4EV0A 4ASNA 2GXBA 3U2RA 1SD7A 4E4HA 2DOEA 3RYRA 3S3NA 1LNWA 5HLTA 1SFEA 2BVMA 3O3KA 4M71A 1IGNA 2H09A 1KONA 1FOYA 2L9NA 1WJAA 1XDSA 2V1XA 4LGWA 3MAJA 2VQGA 1QBJA 4HX8A 3JCUC 1Z6TA 3F0CA 5LGNA 2DT5A 2OF7A 1ZREA 2X0LA 5H6RA 1MMAA 1P4WA 3JRBA 4EJWA 3JRCA 2LBFB 3VSLA 3ABMH 1VQ4I 1FP1D 3KIOA 1N77A 1UHWA 2ACJA 2O6GE 3ZGKA 1X19A 3Q3SA 4IHTA 5E8IA 2IS2A 4PSXA 2WADA 1FSHA 2HYJA 3O2PE 2NS8A 3TL4X 3TMOA 1Z3XA 5IT3A 5C44J 2DA2A 3ZQQA 4XLPF 3I0TA 2R0QC 2VB6A 3PL8A 2L0KA 2Y69H 1S7AA 4V2GA 2O61A 4WX9A 1QVTA 1X1DA 4U0WA 2O3FA 3CDLA 1H9TA 3CCLI 2VONA 2GBYA 2DFFA 3BJAA 2CQQA 4HSTA 4I2OA 4HW0A 4EM0B 4LJZF 1E3HA 2FD5A 3U9GA 3T8RA 2XPWA 3ESWB 2XUBA 2QQ9A 1SC7A 1ON1A 2R5ZA 2A6EF 1KQ0A 4D1QA 3LSRA 4AVZA 3CF5F 2CV0A 1N78A 5ICGA 4BUPA 1JUMA 3WGGA 4QIWN 5B3SH 2PMHA 1MBHA 5DD8A 3DEEA 1XB4A 3H35A 1DU0A 5GPCA 3AAFA 2UV1A 3BR6A 4RAYA 4Y3OA 2CYYA 4ABZA 3SXYA 5FJ8J 3A2KA 3LQQA 1Z91A 5EYRA 5K1YA 3F21A 2DJNA 1U8BA 1F43A 4CYCB 5J1YA 5IP6A 2QGUA 4U7BA 4CCMA 1S72I 4KJZA 2JPCA 2QZ8A 5D8KB 4JK1X 1OPCA 4NBQA 4RLFA 1T0FC 5ILSA 3GWZA 3L7WA 1D0ZA 2JMWA 4XRMA 3B6CA 5E3LA 1SAXA 2JPBA 5D5XB 4DYQA 1LDJA 4YIFA 1G4DA 3L9FA 1YRNB 1IRGA 3LSMA 3OIOA 1HBXG 1SD6A 2H6BA 4RGRA 4QPOA 3HOTA 5CJ9A 2QWWA 3H1CA 3GEZA 2XPUA 2GOXB 1U0JA 4WCGA 4R79A 2HVQA 2CWEA 2Q2EA 5FD5A 4ZDPA 3BCBA 1WQ2A 1YS7A 2EWNA 2HNHA 5DCFA 4A3CJ 1YITI 4N0BA 1PJRA 5J3LA 3TO9A 1R71A 1MDMA 1ZH5A 3CUQA 3S1RJ 4LK1F 5C4XJ 2QLZA 1RI7A 1T2KA 2EFPA 2Y0SA 3GTPJ 3G4SI 4CHUA 2VKHA 1LE8A 2E2JJ 3ELKA 2XASA 1TNSA 2X4HA 1GHCA 4MTEA 4OIRF 1PP8F 1MJAA 4HNVA 1WSUA 4ENMA 2M45A 1VQ8I 4YIRX 1W7PB 3WODF 1HW1A 3HOVJ 1U5TC 2VQHA 1FJLA 3M9AA 3GX4X 4OAZA 4IXAA 1XGMA 3DQVC 1DQUA 3QOPA 4E7SA 1SD4A 5IP7J 4CXFA 2XIGA 2VE9A 4UUVA 2R7XA 2FBIA 1K78A 3JRAA 2YU9J 3DTIA 4BHCA 3AG1H 4G94A 1FT9A 9ANTA 4B4CA 4BHPA 1Z0XA 3MKZA 1OCCH 1IZ1A 5HNHA 4HF2A 4MO7A 3WTXC 1TW3A 2L3DA 1U3EM 1WKMA 3I53A 3V7CA 3OL3A 2ELJA 1JT6A 3SZTA 1B8IA 2CH0A 3HOXJ 3BOQA 3WGHA 1S3JA 3HRUA 3HBLA 2B0LA 4KN4X 3BTCA 2JN6A 2EV5A 4R8HA 3WTUC 1U2WA 3RIRA 1ITYA 2DW4A 2QF7A 4LK0F 2DA5A 1RRJA 2WB1N 1YJNI 2DYSH 2EIJH 4RM3A 3HRTA 4XORA 3BG3A 2V1NA 3VOEA 3OSGA 1EF4A 1YX3A 3OYGA 1VQLI 3HOZJ 5CQGA 3IAS2 5HS7A 2KP6A 4ZTFA 1HOMA 1JI8A 1BW5A 3QRFF 3DFGA 2MH9A 3W6KB 2V6EA
chains in the Genus database with same CATH topology
3UKGA 1IDYA 3S17J 2DA3A 1LFUP 4IEJA 4M3FA 4AUXA 3ZQGA 5EGOB 1LE8B 1WPKA 1X2NA 1MSEC 3S2HJ 1OJLA 3S16J 2VUMJ 1W0UA 4A3BJ 2LK2A 4MLOA 5GPAA 4DYCA 2GM4A 2I10A 2XGEA 2ECCA 5F27A 4BY1J 2D5VA 1D5YA 4FISA 1T33A 1TWAJ 3PO2J 1FIPA 2L7ZA 2VKVA 3SDGA 1FEXA 2DN0A 2YUSA 3TEDA 4A3IJ 2JJ7A 3TP0A 5FKNA 1TWHJ 3JRDA 2CU7A 2CJJA 4L5EA 2MG4A 1JUPA 2LY9A 1ZR4A 3WHCA 2DA6A 2LR8A 4S0HB 3SJMA 2DMNA 5K7HA 3ZQCA 1MBEA 1FTTA 3CCYA 3ZQFA 1RKWA 3Q0WA 1TWGJ 1WH5A 3MN2A 4JX6A 2P81A 4D5CA 1B8IB 3M4OJ 2M2EA 2DMTA 2LP0A 3A03A 2LTPA 2XGDA 4UUTA 2K9SA 3PM1A 1E3OC 4LOCA 3RKQA 1MNMC 2X9DA 3S1NJ 1ZK8A 1WI3A 2Y2ZA 4BBSJ 1UHSA 2XRLA 3LNQA 5FKKA 1NTCA 2XPVA 4MFDA 2R5YB 1ENHA 1ETYA 2Y9ZA 3PO3J 3BQYA 3ZOBA 3BR3A 2ME6A 1BL0A 4X6AJ 5EG0A 1HDPA 2FQ4A 1ZGWA 2N8GA 4JX5A 2L7FP 1H89C 4A3EJ 1U78A 2IEKA 4DW6A 4JP0A 5IOYA 3E7LA 5FLVA 2JA7J 2DMPA 2M34A 2M8GX 2Y31A 1I3QJ 1S7EA 5EF6A 1SFOJ 2IBDA 1H8AC 2CQXA 4AC0A 1W0TA 3I4NJ 5M3FJ 5IYBJ 2MGQA 3FK6A 1X58A 1ZQ3P 5C4JJ 2HI3A 1QRYA 2X48A 1GDTA 5M5XJ 3K7AJ 3QPLA 4B3AA 4RDUA 3BT9A 5BNGA 1RKTA 1B72B 1FIAA 3G1LA 3HB9A 5K7ZA 1VF9A 3BR0A 3A01A 3HOUJ 3BTJA 3IH2A 5F04A 4GFBA 2LVSA 1GT0C 1O4XA 1JJ8C 2FJ1A 1QPIA 3IH4A 4M6VA 4C3JJ 5F08A 1JJ6C 2EZLA 2TRTA 4C2MJ 2R5YA 5FKLA 2E19A 3K2AA 3GTKJ 4DZJA 2O8KA 3HOYJ 3BTLA 1BA5A 4DZPA 1Y1WJ 2G0EA 2E2IJ 5F0FA 5JLWA 4B1RA 5K7FA 2JA8J 2E2HJ 2R7ZJ 5J1RA 2RAEA 3VPRA 1JUSA 1P7JA 1VFCA 3S1QJ 4XK4A 5EG0B 3OSFA 2L7MP 1NK2P 4J19A 3O8HA 2Y0SN 1SANA 4XRSA 3HKZN 3GTQJ 3FKIJ 1GUUA 1U9OA 1Y1VJ 3I4MJ 1VNDA 1PUFA 2L9RA 2M0CA 1TC3C 1ZKGA 4UUSA 3TP3A 4IHXA 1AKHA 2CRGA 5EZGA 2W48A 3A02A 3ZQIA 3Q0UA 4IHWA 1UMQA 4I76A 1B72A 1JTXA 5F0HA 1MH4A 3RZDJ 1Q1VA 2DA1A 4QTRA 4A93J 2XB0X 5IYCJ 2PMZN 1A5JA 1HF0A 2LFBA 5M5YJ 4W97A 1IJWC 3JR9A 1WCMJ 4A3FJ 3WHBA 4BY7J 3A01B 1IV6A 3G1MA 3Q0VA 2O7OA 5EZHA 5JLXA 5FKOA 5FKMA 4EEFG 2E1OA 3O8GA 3S15J 2Y9YA 2KDZA 1DU6A 2EZIA 4M3BA 1GV2A 2HXIA 2ECBA 2NVTJ 4JX4A 2DMQA 1XS9A 3S14J 2EQRA 1BJZA 2XGCA 2ID6A 4Y7NJ 2HQ5A 4A3MJ 3NAUA 4G12A 2R92J 2TCTA 1ETXA 5IP9J 4X1EA 5IOZA 2CUFA 5E3MA 1MH3A 2JA5J 1ORKA 2EH3A 2HOSA 1IDZA 2Y30A 2NVQJ 1JT0A 2VPRA 1PUFB 1ETKA 3HDDA 5IPAA 1APLC 2NVXJ 3BR5A 4UUSB 4XICA 1AKHB 1K83J 1TWFJ 3JRGA 1IC8A 1H88C 4M3DA 1WH7A 4IHYA 1JKRC 1ETWA 2B63J 3GTLJ 4CYCA 1VI0A 2H8RA 1IGNA 3JRIA 2JWTA 5GP9A 1JTYA 2NVYJ 2VKEA 2XB5A 1JKQC 1IUFA 1G2HA 3F0CA 2OF7A 2JK3A 1CQTA 3FISA 3JRBA 2LD5A 3JRCA 2LLKA 1YRNA 1JGGA 1MBJA 5EDNA 2K9QA 3MKLA 1F36A 2COBA 1ETQA 3Q3SA 2XSDC 2HDDA 3QPSA 2ME0A 1GV5A 2AHQA 1FTZA 1HCRA 2HYJA 2NS8A 5J1UA 5C44J 2DA2A 1JKPC 4I6ZA 2EZHA 2M9HA 2FX0A 2R0QC 1POGA 2L0KA 2JA6J 4V2GA 3ZQHA 1QVTA 3DCFA 4A3JJ 5IYDJ 3CDLA 3GTGJ 1OFCX 2GBYA 3LSGA 1U9NA 2HOAA 2ZB9A 2CQQA 5E3OA 4D7NA 2O9LA 4A3DJ 1BW6A 2FD5A 3DEWA 2XPWA 2CUEA 2QCOA 3HEFA 2R5ZA 3LSRA 1IRZA 4FE4A 2DA4A 3LOCA 1Z77A 5EEAA 4AYBN 2NS7A 4QSHA 1JUMA 1LFBA 4QIWN 1MBHA 1X2MA 1MBGA 3H3VK 4D7MA 4DYRA 1DU0A 5GPCA 2DA7A 2WV1A 3BR6A 3C2BA 4ABZA 2HOTA 5FJ8J 2DTZA 5EYRA 2KT0A 3B6AA 2DJNA 1U8BA 5DTDA 2YS9A 1F43A 4CYCB 4MFEA 2LKXA 4W1UA 1T56A 2VI6A 5J1YA 5IP6A 5F0CA 1R9TJ 5M3MJ 1XC5A 1WGXA 3MVPA 1JKOC 4BXXJ 1RESA 4A69C 3S2DJ 2JMWA 4D5FA 4XRMA 3B6CA 5E3LA 5HODA 3BQZA 3JREA 4FE7A 4BKXA 4DYQA 5F1JA 3BR2A 3RQIA 1IG7A 3FK7A 3HM5A 1YRNB 2MSYA 3OIOA 1GVDA 2X6OA 1MBFA 3HGYA 1UG2A 2XPUA 4C3HJ 1ETOA 1OCTC 2H1KA 1K61A 3IV5A 3GTJJ 3RZOJ 3ZQLA 4A3CJ 4XIDA 4MIMA 1XG1A 1ZTRA 3BR1A 5J3LA 3LSPA 4NDLA 3S1RJ 1ZR2A 3H0GJ 2GLOA 5C4XJ 3HGGA 3HOWJ 2K9NA 3GTPJ 5EGOA 4RBOA 1NK3P 3L1PA 1LE8A 2E2JJ 1AHDP 3TW6A 2MW8A 3IH3A 1OCPA 2WAQN 4HNVA 2ID3A 3FIWA 5C3EJ 4A3KJ 3HOVJ 1I50J 4C3IJ 1ETVA 1A6IA 3CMYA 2R5ZB 1FJLA 2HXOA 4FTHA 3OOUA 5IP7J 3BG9A 4A3GJ 3BTIA 2IAIA 2AO9A 5M5WJ 1MSFC 2YU9J 3JRAA 3JRFA 4A3LJ 9ANTA 1QVUA 4B4CA 1HDDC 3SFIA 4V2FA 1Z0XA 1RETA 3TW7A 3GTMJ 1HLVA 4MO7A 3BG5A 3CQZJ 3M3YJ 3LSJA 1RR7A 1JT6A 4BBRJ 1B8IA 1AU7A 3GTOJ 2OPTA 1MBKA 3HOXJ 1P7IA 1I6HJ 3GBGA 3HBLA 3BTCA 1TWCJ 2DMUA 2JN6A 5E3NA 5FLMJ 1ITYA 2QF7A 3S1MJ 2DA5A 4IHVA 2NOGA 4M3GA 2EBIA 2WB1N 3D1NI 2ELKA 3OSGA 1EF4A 3BG3A 1RPWA 4FCYA 3JRHA 3QQAA 4Y52J 2EZKA 2K40A 3HOZJ 4M3EA 2R93J 3W6VA 3G1OA 1HOMA 4XRSG 4JYKA 5DS9A 1BW5A 3NARA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UKG A;  1IDY A;  3S17 J;  2DA3 A;  1LFU P;  4IEJ A;  4M3F A;  4AUX A;  3ZQG A;  5EGO B;  1LE8 B;  1WPK A;  1X2N A;  1MSE C;  3S2H J;  1OJL A;  3S16 J;  2VUM J;  1W0U A;  4A3B J;  2LK2 A;  4MLO A;  5GPA A;  4DYC A;  2GM4 A;  2I10 A;  2XGE A;  2ECC A;  5F27 A;  4BY1 J;  2D5V A;  1D5Y A;  4FIS A;  1T33 A;  1TWA J;  3PO2 J;  1FIP A;  2L7Z A;  2VKV A;  3SDG A;  1FEX A;  2DN0 A;  2YUS A;  3TED A;  4A3I J;  2JJ7 A;  3TP0 A;  5FKN A;  1TWH J;  3JRD A;  2CU7 A;  2CJJ A;  4L5E A;  2MG4 A;  1JUP A;  2LY9 A;  1ZR4 A;  3WHC A;  2DA6 A;  2LR8 A;  4S0H B;  3SJM A;  2DMN A;  5K7H A;  3ZQC A;  1MBE A;  1FTT A;  3CCY A;  3ZQF A;  1RKW A;  3Q0W A;  1TWG J;  1WH5 A;  3MN2 A;  4JX6 A;  2P81 A;  4D5C A;  1B8I B;  3M4O J;  2M2E A;  2DMT A;  2LP0 A;  3A03 A;  2LTP A;  2XGD A;  4UUT A;  2K9S A;  3PM1 A;  1E3O C;  4LOC A;  3RKQ A;  1MNM C;  2X9D A;  3S1N J;  1ZK8 A;  1WI3 A;  2Y2Z A;  4BBS J;  1UHS A;  2XRL A;  3LNQ A;  5FKK A;  1NTC A;  2XPV A;  4MFD A;  2R5Y B;  1ENH A;  1ETY A;  2Y9Z A;  3PO3 J;  3BQY A;  3ZOB A;  3BR3 A;  2ME6 A;  1BL0 A;  4X6A J;  5EG0 A;  1HDP A;  2FQ4 A;  1ZGW A;  2N8G A;  4JX5 A;  2L7F P;  1H89 C;  4A3E J;  1U78 A;  2IEK A;  4DW6 A;  4JP0 A;  5IOY A;  3E7L A;  5FLV A;  2JA7 J;  2DMP A;  2M34 A;  2M8G X;  2Y31 A;  1I3Q J;  1S7E A;  5EF6 A;  1SFO J;  2IBD A;  1H8A C;  2CQX A;  4AC0 A;  1W0T A;  3I4N J;  5M3F J;  5IYB J;  2MGQ A;  3FK6 A;  1X58 A;  1ZQ3 P;  5C4J J;  2HI3 A;  1QRY A;  2X48 A;  1GDT A;  5M5X J;  3K7A J;  3QPL A;  4B3A A;  4RDU A;  3BT9 A;  5BNG A;  1RKT A;  1B72 B;  1FIA A;  3G1L A;  3HB9 A;  5K7Z A;  1VF9 A;  3BR0 A;  3A01 A;  3HOU J;  3BTJ A;  3IH2 A;  5F04 A;  4GFB A;  2LVS A;  1GT0 C;  1O4X A;  1JJ8 C;  2FJ1 A;  1QPI A;  3IH4 A;  4M6V A;  4C3J J;  5F08 A;  1JJ6 C;  2EZL A;  2TRT A;  4C2M J;  2R5Y A;  5FKL A;  2E19 A;  3K2A A;  3GTK J;  4DZJ A;  2O8K A;  3HOY J;  3BTL A;  1BA5 A;  4DZP A;  1Y1W J;  2G0E A;  2E2I J;  5F0F A;  5JLW A;  4B1R A;  5K7F A;  2JA8 J;  2E2H J;  2R7Z J;  5J1R A;  2RAE A;  3VPR A;  1JUS A;  1P7J A;  1VFC A;  3S1Q J;  4XK4 A;  5EG0 B;  3OSF A;  2L7M P;  1NK2 P;  4J19 A;  3O8H A;  2Y0S N;  1SAN A;  4XRS A;  3HKZ N;  3GTQ J;  3FKI J;  1GUU A;  1U9O A;  1Y1V J;  3I4M J;  1VND A;  1PUF A;  2L9R A;  2M0C A;  1TC3 C;  1ZKG A;  4UUS A;  3TP3 A;  4IHX A;  1AKH A;  2CRG A;  5EZG A;  2W48 A;  3A02 A;  3ZQI A;  3Q0U A;  4IHW A;  1UMQ A;  4I76 A;  1B72 A;  1JTX A;  5F0H A;  1MH4 A;  3RZD J;  1Q1V A;  2DA1 A;  4QTR A;  4A93 J;  2XB0 X;  5IYC J;  2PMZ N;  1A5J A;  1HF0 A;  2LFB A;  5M5Y J;  4W97 A;  1IJW C;  3JR9 A;  1WCM J;  4A3F J;  3WHB A;  4BY7 J;  3A01 B;  1IV6 A;  3G1M A;  3Q0V A;  2O7O A;  5EZH A;  5JLX A;  5FKO A;  5FKM A;  4EEF G;  2E1O A;  3O8G A;  3S15 J;  2Y9Y A;  2KDZ A;  1DU6 A;  2EZI A;  4M3B A;  1GV2 A;  2HXI A;  2ECB A;  2NVT J;  4JX4 A;  2DMQ A;  1XS9 A;  3S14 J;  2EQR A;  1BJZ A;  2XGC A;  2ID6 A;  4Y7N J;  2HQ5 A;  4A3M J;  3NAU A;  4G12 A;  2R92 J;  2TCT A;  1ETX A;  5IP9 J;  4X1E A;  5IOZ A;  2CUF A;  5E3M A;  1MH3 A;  2JA5 J;  1ORK A;  2EH3 A;  2HOS A;  1IDZ A;  2Y30 A;  2NVQ J;  1JT0 A;  2VPR A;  1PUF B;  1ETK A;  3HDD A;  5IPA A;  1APL C;  2NVX J;  3BR5 A;  4UUS B;  4XIC A;  1AKH B;  1K83 J;  1TWF J;  3JRG A;  1IC8 A;  1H88 C;  4M3D A;  1WH7 A;  4IHY A;  1JKR C;  1ETW A;  2B63 J;  3GTL J;  4CYC A;  1VI0 A;  2H8R A;  1IGN A;  3JRI A;  2JWT A;  5GP9 A;  1JTY A;  2NVY J;  2VKE A;  2XB5 A;  1JKQ C;  1IUF A;  1G2H A;  3F0C A;  2OF7 A;  2JK3 A;  1CQT A;  3FIS A;  3JRB A;  2LD5 A;  3JRC A;  2LLK A;  1YRN A;  1JGG A;  1MBJ A;  5EDN A;  2K9Q A;  3MKL A;  1F36 A;  2COB A;  1ETQ A;  3Q3S A;  2XSD C;  2HDD A;  3QPS A;  2ME0 A;  1GV5 A;  2AHQ A;  1FTZ A;  1HCR A;  2HYJ A;  2NS8 A;  5J1U A;  5C44 J;  2DA2 A;  1JKP C;  4I6Z A;  2EZH A;  2M9H A;  2FX0 A;  2R0Q C;  1POG A;  2L0K A;  2JA6 J;  4V2G A;  3ZQH A;  1QVT A;  3DCF A;  4A3J J;  5IYD J;  3CDL A;  3GTG J;  1OFC X;  2GBY A;  3LSG A;  1U9N A;  2HOA A;  2ZB9 A;  2CQQ A;  5E3O A;  4D7N A;  2O9L A;  4A3D J;  1BW6 A;  2FD5 A;  3DEW A;  2XPW A;  2CUE A;  2QCO A;  3HEF A;  2R5Z A;  3LSR A;  1IRZ A;  4FE4 A;  2DA4 A;  3LOC A;  1Z77 A;  5EEA A;  4AYB N;  2NS7 A;  4QSH A;  1JUM A;  1LFB A;  4QIW N;  1MBH A;  1X2M A;  1MBG A;  3H3V K;  4D7M A;  4DYR A;  1DU0 A;  5GPC A;  2DA7 A;  2WV1 A;  3BR6 A;  3C2B A;  4ABZ A;  2HOT A;  5FJ8 J;  2DTZ A;  5EYR A;  2KT0 A;  3B6A A;  2DJN A;  1U8B A;  5DTD A;  2YS9 A;  1F43 A;  4CYC B;  4MFE A;  2LKX A;  4W1U A;  1T56 A;  2VI6 A;  5J1Y A;  5IP6 A;  5F0C A;  1R9T J;  5M3M J;  1XC5 A;  1WGX A;  3MVP A;  1JKO C;  4BXX J;  1RES A;  4A69 C;  3S2D J;  2JMW A;  4D5F A;  4XRM A;  3B6C A;  5E3L A;  5HOD A;  3BQZ A;  3JRE A;  4FE7 A;  4BKX A;  4DYQ A;  5F1J A;  3BR2 A;  3RQI A;  1IG7 A;  3FK7 A;  3HM5 A;  1YRN B;  2MSY A;  3OIO A;  1GVD A;  2X6O A;  1MBF A;  3HGY A;  1UG2 A;  2XPU A;  4C3H J;  1ETO A;  1OCT C;  2H1K A;  1K61 A;  3IV5 A;  3GTJ J;  3RZO J;  3ZQL A;  4A3C J;  4XID A;  4MIM A;  1XG1 A;  1ZTR A;  3BR1 A;  5J3L A;  3LSP A;  4NDL A;  3S1R J;  1ZR2 A;  3H0G J;  2GLO A;  5C4X J;  3HGG A;  3HOW J;  2K9N A;  3GTP J;  5EGO A;  4RBO A;  1NK3 P;  3L1P A;  1LE8 A;  2E2J J;  1AHD P;  3TW6 A;  2MW8 A;  3IH3 A;  1OCP A;  2WAQ N;  4HNV A;  2ID3 A;  3FIW A;  5C3E J;  4A3K J;  3HOV J;  1I50 J;  4C3I J;  1ETV A;  1A6I A;  3CMY A;  2R5Z B;  1FJL A;  2HXO A;  4FTH A;  3OOU A;  5IP7 J;  3BG9 A;  4A3G J;  3BTI A;  2IAI A;  2AO9 A;  5M5W J;  1MSF C;  2YU9 J;  3JRA A;  3JRF A;  4A3L J;  9ANT A;  1QVU A;  4B4C A;  1HDD C;  3SFI A;  4V2F A;  1Z0X A;  1RET A;  3TW7 A;  3GTM J;  1HLV A;  4MO7 A;  3BG5 A;  3CQZ J;  3M3Y J;  3LSJ A;  1RR7 A;  1JT6 A;  4BBR J;  1B8I A;  1AU7 A;  3GTO J;  2OPT A;  1MBK A;  3HOX J;  1P7I A;  1I6H J;  3GBG A;  3HBL A;  3BTC A;  1TWC J;  2DMU A;  2JN6 A;  5E3N A;  5FLM J;  1ITY A;  2QF7 A;  3S1M J;  2DA5 A;  4IHV A;  2NOG A;  4M3G A;  2EBI A;  2WB1 N;  3D1N I;  2ELK A;  3OSG A;  1EF4 A;  3BG3 A;  1RPW A;  4FCY A;  3JRH A;  3QQA A;  4Y52 J;  2EZK A;  2K40 A;  3HOZ J;  4M3E A;  2R93 J;  3W6V A;  3G1O A;  1HOM A;  4XRS G;  4JYK A;  5DS9 A;  1BW5 A;  3NAR A; 
#chains in the Genus database with same CATH topology
 1V3F A;  1MD0 A;  1IDY A;  2LC2 A;  3GFM A;  4M3F A;  1F5T A;  1SVL A;  3CCJ I;  4KFC A;  1QU3 A;  2EIL H;  1WPK A;  3HPG A;  1YJ9 I;  4Q47 A;  4EGZ A;  2WAQ A;  4XLC A;  2VUM J;  4O5V A;  1W0U A;  2EFN A;  4A3B J;  2LK2 A;  4E7K A;  5GPA A;  3E3V A;  4XKB A;  5LRS A;  3L2R A;  2I10 A;  5F27 A;  3KEQ A;  2DXI A;  5AIP A;  5L3C A;  4FIS A;  2IGM A;  2L4M A;  4DGW B;  1HST A;  1DPR A;  3JAM K;  1FIP A;  4MQV A;  3F6V A;  2VKV A;  3SHF A;  3SDG A;  1OYY A;  2DQR A;  2DN0 A;  3TED A;  2XF6 A;  2KJC A;  3CCQ I;  1TZL A;  2CU7 A;  2MG4 A;  3I58 A;  2XV4 S;  3I3L A;  1I5Z A;  2BEO A;  1IRF A;  2LY9 A;  1WRJ A;  4N9I A;  3S93 A;  3W6J B;  3WHC A;  2LR8 A;  5DDG A;  4S0H B;  1XCV A;  4RA2 A;  4IRH A;  3MWM A;  4IRG A;  1MBE A;  2DFE A;  2XKO A;  2PJP A;  2IJL A;  2IW5 A;  2JRT A;  3Q0W A;  3GFJ A;  4JX6 A;  2OBP A;  2M2E A;  5CPR B;  3ZCO A;  2AXL A;  2WBM A;  4ZDL A;  3ZN1 A;  2QQ8 A;  4A6E A;  3RKQ A;  3QAH A;  1MNM C;  1WVR A;  2QBY B;  3S1N J;  4P96 A;  4O6J A;  4BDZ A;  1UHS A;  3ZR8 X;  4L0Y B;  5BOX A;  2FE3 A;  3LNQ A;  1BIA A;  2V9V A;  3BG7 A;  3F8B A;  5FKK A;  2PJR A;  1NTC A;  5B1A H;  2MYS A;  1OR7 C;  5GAD J;  2Y9Z A;  1QHG A;  4G7Z F;  1XTA A;  3RQ4 A;  3BR3 A;  4DOZ A;  4L9T A;  5EG0 A;  1HDP A;  1R1T A;  3RSN A;  1MJ9 A;  2H1L A;  1MNE A;  2OCC H;  5A2Q K;  2FBH A;  3FX3 A;  2IEK A;  3BCA A;  2V6C A;  2ZME B;  2AXT C;  3BC8 A;  2CQK A;  2Z99 A;  3RKX A;  4OAY A;  1BOB A;  4JOM A;  1ZYR F;  2M34 A;  2M8G X;  3M1C A;  2BOL A;  2OV7 A;  2IBD A;  2RC4 A;  1XSX A;  4PSW A;  3GO5 A;  1JE8 A;  4LB6 B;  4Z6Y A;  1W0T A;  4KIF A;  2F5C A;  2KL4 A;  2OU2 A;  3LA2 A;  3QYB A;  2X48 A;  2HFH A;  3FMQ A;  1ULY A;  1XGO A;  1D1C A;  3WU2 C;  2J5O A;  1IN6 A;  2E5Z A;  3J81 K;  4PDK A;  1QQI A;  3HXL A;  5DUK A;  3BT9 A;  3W3C A;  4KYW A;  1FIA A;  3DBL B;  5B1B H;  2ZME C;  4DNC A;  4RGX A;  2Z16 A;  1BJA A;  5K7Z A;  1XMK A;  3TOA A;  3ECH A;  3BTJ A;  4GFB A;  4MEY F;  2EJR A;  1O4X A;  5DD4 A;  1GT0 C;  1JJ8 C;  2OA4 A;  3HUG A;  5H20 A;  3HJE A;  2IGO A;  3IH4 A;  4IOC F;  4C3J J;  3OR1 C;  4AU7 A;  1IRX A;  2ZXJ A;  1JJ6 C;  2VQC A;  1H9G A;  1TP4 A;  2PN6 A;  3KYD B;  5H2F C;  5FKL A;  3T0Y A;  4MNU A;  3GTK J;  5TGT A;  2WA0 A;  4DZJ A;  4XKC A;  3QU3 A;  4CGZ A;  3K10 A;  2BY2 A;  2DAO A;  4HLX A;  4PFP A;  1Y1W J;  3CJT B;  3G3Z A;  1S5L C;  1EKE A;  4M9S A;  4EQQ A;  4IQJ A;  2LNB A;  1RUO A;  1KYW A;  4ZH4 F;  2ISY A;  3EUA A;  4P5O A;  5FLX K;  3WU0 A;  3PJR A;  2RV8 A;  3HSE A;  4NC7 A;  1A6Q A;  3JSP A;  3G73 A;  1BM9 A;  1NK2 P;  3FHZ A;  2PEX A;  3KP6 A;  4J19 A;  3AG3 H;  3C3W A;  5FFX A;  1SAN A;  1BI3 A;  3MQ0 A;  3CD6 I;  3FXL A;  3DTK A;  3MKY B;  1RZ4 A;  2IA2 A;  3TDU C;  1ZKG A;  1B9N A;  2R7F A;  4AWX B;  4CCO A;  2W7N A;  3GME A;  2CRG A;  3FMR A;  2MFZ A;  4F55 A;  5CVU A;  3G71 I;  4BNC A;  3A02 A;  3JTG A;  3HPH A;  3NWT A;  4I76 A;  1FBQ A;  3CTA A;  3HTS B;  1ZGA A;  4XN3 A;  3CJN A;  1Q1V A;  2XB0 X;  1TQP A;  4HSR A;  3X2Q H;  4NQW B;  1A5J A;  3UR3 C;  2R7S A;  2K86 A;  1K4S A;  2WY8 Q;  1IJW C;  3B73 A;  1KA8 A;  3GFL A;  1W5S A;  4A6D A;  1ZLJ A;  2YX4 A;  3A01 B;  4U88 A;  2LBF A;  2CFO A;  3Q0V A;  3V42 A;  4PCQ A;  1UEL B;  3OV8 A;  1GXQ A;  2HPI A;  2DK5 A;  3KP7 A;  2FEZ A;  4I09 A;  5HS9 A;  2DDB A;  3FZV A;  2H8W A;  5D5U B;  5BQT A;  1HA8 A;  2G9W A;  3CC4 I;  5LHI A;  2L54 A;  1YW7 A;  1SVM A;  2ECB A;  2RVC A;  1BBY A;  4F93 B;  2HYG D;  1K6O A;  1VQP I;  5IY5 H;  2ZFW A;  4NC8 A;  3I4P A;  2VOO A;  2FOW A;  4A5M A;  4B48 A;  5HDK A;  1SD5 A;  2TCT A;  2NS0 A;  3G6E I;  4J01 A;  4RM2 A;  5IP9 J;  2E34 A;  5KCM A;  4X1E A;  5JHF A;  2VL8 A;  2OD5 A;  2OJE D;  1OKR A;  1MH3 A;  3E97 A;  2ZJQ F;  1VQ7 I;  4HNT A;  5GAH J;  4UNO A;  4GYI A;  4A0Z A;  2JVG A;  1PUF B;  1HXD A;  3ZP5 A;  2M0M A;  5LLQ A;  1SEU A;  2O03 A;  4MGR A;  2ADU A;  3J80 Z;  3DU6 A;  1AKH B;  3DLL F;  3NRV A;  1MMD A;  4EVI A;  1IC8 A;  1H88 C;  2HPM A;  4RAG A;  1I39 A;  2B63 J;  4EJU A;  4CYC A;  3BJ6 A;  3CCM I;  2PMU A;  4E7H A;  2CMP A;  4OIN F;  5GP9 A;  5CVV A;  4BH9 A;  1G3S A;  2NVY J;  1QPM A;  5ICE A;  4YG2 F;  3RTR A;  2WY7 Q;  2XB5 A;  5DM7 F;  1JKQ C;  4C2T A;  1W5C C;  1V5G A;  1IUF A;  1G2H A;  4IX7 A;  4OMY A;  4KIC A;  5D6F A;  3OS0 A;  1GLN A;  5E18 F;  3KE2 A;  1CQT A;  1R1V A;  2WV0 A;  1G3W A;  3V8L A;  3EUH A;  2F5V A;  3H92 A;  2X1E A;  1Y6I A;  1YRN A;  2XC7 A;  3CDH A;  1MBJ A;  2XAJ A;  3AG4 H;  1MZB A;  1O3Q A;  4L0Z B;  2K9Q A;  3SEZ A;  4BQA A;  2BY0 A;  1EH7 A;  2AHQ A;  2GQQ A;  2IA0 A;  1VTN C;  2MD5 A;  1X1B A;  2LSO A;  5K5R A;  1YFH A;  4I6Z A;  3ML6 A;  2EZH A;  1WHU A;  2FX0 A;  1LVA A;  1POG A;  2BY1 A;  4HQE A;  5CVI A;  2X1D A;  4WXH A;  2ELH A;  3LMM A;  3GTG J;  2M4G A;  3MD2 A;  4O3M A;  1P92 A;  4L9V A;  1OFC X;  4AID A;  4Y17 A;  5LBQ A;  4LLG F;  3LSG A;  4LIU A;  2HOA A;  4CH7 A;  3R0J A;  1VZ0 A;  4D7N A;  2DPU A;  3NQO A;  4A3D J;  3DEW A;  1W7P A;  3ABU A;  5F1R A;  1BC7 C;  3EUK L;  2VBX A;  5KK1 A;  1YOV B;  3HEF A;  3BPX A;  3WTY C;  2VJ5 A;  3OYE A;  1IRZ A;  1IUY A;  2QEN A;  5EEA A;  4AYB N;  2XRO A;  2P6S A;  4QSH A;  2V4J C;  4HDU A;  1I3A A;  1LFB A;  4XQF A;  1X2M A;  3HC7 A;  5E1Z B;  4D7M A;  3OYL A;  1XD7 A;  3H3V K;  2LG4 A;  3GZ5 A;  3IRR A;  3C2B A;  2K3P A;  5HLI A;  1ZEL A;  2DTZ A;  4P9U A;  2F4I A;  3B6A A;  1MMN A;  2YS9 A;  3H9Q A;  2LKX A;  4AD9 A;  5F0C A;  3I54 A;  1WGX A;  2PX9 A;  3MVP A;  3L2Q A;  4ESJ A;  2KPM A;  2W1O A;  3HZJ A;  2KIS A;  4BXX J;  4A5N A;  3I59 B;  2ESN A;  4ENK A;  4A69 C;  3OS2 A;  2OAZ A;  3K70 C;  3CCR I;  3FBN B;  5HOO A;  3FXJ A;  2V26 A;  3BR2 A;  1NHA A;  3RQI A;  4UB6 C;  3DKW A;  1IV8 A;  3HM5 A;  3K4L A;  1KZH A;  4BE1 A;  3S3M A;  4YRV A;  3HGY A;  1UG2 A;  3K4M A;  4C3H J;  1OLT A;  4KT5 C;  4TV7 A;  4WK8 F;  1K61 A;  4X0G A;  3IV5 A;  2A6T A;  2WTE A;  3P9I A;  4BJT A;  4XID A;  1UCR A;  4KDP A;  2D1V A;  3K70 D;  2M5W A;  3FWE A;  3EET A;  2GLO A;  1ZRD A;  4IJA A;  3HOW J;  1X4O A;  4RBO A;  4P9F A;  1DP7 P;  4U0Y A;  1AHD P;  1TT0 A;  3TW6 A;  3BJO A;  4XM3 A;  4ENN A;  3C7J A;  5LEK A;  2IP2 A;  2X6X A;  2ID3 A;  4G9Y A;  3LSH A;  5C3E J;  4QWQ A;  2RDP A;  1R00 A;  1I50 J;  2V9P A;  3K4B A;  4FT8 A;  3WTS C;  4BDY A;  1A6I A;  3CMY A;  4HA8 A;  2HXO A;  3COA C;  1IF1 A;  1STZ A;  4L5J A;  3LAJ A;  4KMF A;  4BJ6 C;  4DIQ A;  5M5W J;  2AO9 A;  2A68 F;  1MSF C;  1O7L A;  3HSF A;  4M73 A;  2IS6 A;  1Y8R B;  5DYM A;  1HDD C;  4M6X A;  3PFY A;  4V2F A;  1EJ9 A;  3CES A;  1RET A;  2LKP A;  3CF2 A;  3LFK A;  1DDN A;  2ZNY A;  2JSC A;  1REP C;  2FF4 A;  2G7H A;  2XAH A;  4XN0 A;  5AON A;  5F6F A;  1RR7 A;  4D0P A;  2BXY A;  4BBR J;  1F4K A;  3GVA A;  5CLS A;  2ZXH A;  3DLA A;  1I6H J;  3AFH A;  3C1D A;  2L7K A;  3J7A Y;  2K7L A;  4AM3 A;  3I56 I;  4BE2 A;  1LKX A;  3DU5 A;  4RB1 A;  1EH8 A;  2QBY A;  5TJJ A;  5JHU A;  4NB5 A;  4IHV A;  4UVA A;  1RPW A;  3JRH A;  4RB0 A;  4BAC A;  3FXO A;  2K40 A;  4BQQ A;  1VQ5 I;  4I02 A;  2FQ3 A;  2PLY A;  1BI0 A;  2E35 A;  2HEO A;  5DS9 A;  4JYK A;  2ZSI B;  2V1U A;  5FRN A;  3ZMS A;  4DBR A;  3M1E A;  1WWX A;  2RNJ A;  4XLE A;  2E71 A;  2FRH A;  3S17 J;  2RNG A;  3GFI A;  2JUG A;  4YFX F;  2DQL A;  3KX2 A;  2LY1 A;  1LFU P;  2ZME A;  5EGO B;  1MSE C;  3S2H J;  1KU9 A;  2HU9 A;  1E3P A;  4PGG A;  5LGU A;  5IT9 K;  4HF0 A;  5L3F A;  4MLO A;  2M30 A;  4CYD A;  1LDD A;  1E0E A;  2D45 A;  2XGE A;  2ECC A;  2ZSH B;  4H0E A;  2D5V A;  1BI1 A;  3FF5 A;  4CZC A;  2FSW A;  1X1A A;  4IHS A;  1X3Z B;  2BV6 A;  2B7E A;  3PO2 J;  5ERI A;  1LUJ B;  3F9K A;  4BEH A;  4A3I J;  1WJE A;  4UV8 A;  1R5I D;  2CQ7 A;  2JJ7 A;  5EJC A;  1YQA A;  1ZGJ A;  1TWH J;  4XRF A;  4L5E A;  2L9V A;  3RKW A;  1QA6 A;  4RAF A;  2DA6 A;  2FML A;  3GXO A;  3FDY A;  4ZYE A;  3ZQC A;  1MGT A;  3PSF A;  2F4M B;  1ACI A;  3PUB A;  5HDN A;  1IN4 A;  1U5T B;  3M4O J;  4UXN A;  2K85 A;  2BYV E;  1C0W A;  4XBF A;  5E20 A;  2QVO A;  2XGD A;  1W1W E;  4UUT A;  1Y0N A;  1N75 A;  1BI2 A;  3LL7 A;  4IOA F;  4OWR B;  4M74 A;  2NNY A;  1QGP A;  4BBS J;  3M7G A;  2VBW A;  2QSH X;  4CCJ A;  1KU2 A;  3E5X A;  3F8N A;  5ICF A;  4MFD A;  4PJL A;  1Z21 A;  1ETY A;  2R5Y B;  2VC1 A;  3OWT A;  2MBF A;  2JA2 A;  3ZOB A;  2I5U A;  2H94 A;  4EAT A;  4X6A J;  1YW8 A;  2FQ4 A;  3TOB A;  1LQ1 A;  1CF7 B;  4B47 A;  4DW6 A;  1Z67 A;  5FLX Z;  3IC7 A;  1DP3 A;  3PIO F;  1FOX A;  2LF7 A;  1I3Q J;  5J6X A;  3BZK A;  2O5R A;  1Z05 A;  4HRI A;  1K7A A;  4AC0 A;  4FX0 A;  2LH9 A;  2W25 A;  2Y0M A;  4I0B A;  2R7Q A;  3TO6 A;  1ZQ3 P;  5ILV A;  5C4J J;  3VDX A;  2BE5 F;  4B44 A;  3L09 A;  2KIQ A;  1GDT A;  4V19 K;  1FC3 A;  3K7A J;  3QPL A;  4NQW A;  5HLG A;  4XLN F;  4HOB A;  2Q8K A;  4HPQ A;  2DOF A;  4BAY A;  5TRD A;  1RKT A;  4JBA A;  1AA7 A;  2PQ8 A;  4A0Y A;  3OS1 A;  2CG4 A;  1BR1 A;  2VOP A;  2LY2 A;  3G1L A;  3ASN H;  4S05 A;  1ERD A;  3BR0 A;  1R4N B;  3A01 A;  3HOU J;  3CMM A;  2NOJ B;  2W84 A;  3IH2 A;  2LVS A;  3RPU D;  3DTE A;  4XL9 A;  1U6G A;  3QP5 A;  3U1D A;  4ZDO A;  1X4P A;  4M6V A;  2NYX A;  1FYM A;  4LIV A;  4U0V A;  2EZL A;  4UVB A;  1ZG1 A;  2HTS A;  2RN7 A;  4PFO A;  2TRT A;  4C2M J;  3L2V A;  2E19 A;  2DOA A;  3IRQ A;  5E79 C;  3N05 A;  2O8K A;  3HOY J;  3HYI A;  4E7L A;  1BA5 A;  2DK8 A;  4DZP A;  1R4M B;  2G0E A;  3VFZ A;  2CQN A;  4B1R A;  2ZXI A;  3SZP A;  4YII A;  5DEQ A;  4R1H A;  5J1R A;  3OYH A;  1XMA A;  3FXR A;  1P7J A;  4XK4 A;  1J09 A;  2XAG A;  2Y0S N;  1VQM I;  1T08 B;  4YFK F;  1GUU A;  1U9O A;  3BWG A;  1T95 A;  1IN7 A;  3I4M J;  1PUF A;  2L9S A;  2FU4 A;  1P9Q C;  3F23 A;  3TP3 A;  3WE2 A;  4KIB A;  1AKH A;  4ANJ A;  4EJV A;  1R49 A;  1J59 A;  2K4J A;  1HW2 A;  1TQM A;  4Y13 A;  1B72 A;  1P6R A;  1JTX A;  5F0H A;  1R58 A;  3QPH A;  5J8F A;  1IN5 A;  4QTR A;  3TQN A;  3LAP A;  4P55 A;  3MKW B;  3PIP F;  1OCO H;  4W97 A;  3E5U A;  3OR2 C;  3VWB A;  4M6Y A;  3IKT A;  3JR9 A;  4NHJ A;  2YU3 A;  2Q1Z B;  3WGI A;  4UB8 C;  5B5E C;  2MH2 A;  3SFZ A;  1I27 A;  1LPQ A;  2O7O A;  2QYO A;  3RKY A;  5JLX A;  1V5F A;  2E60 A;  4HDV A;  5FKM A;  1TNT A;  1B59 A;  2X1C A;  4F91 B;  1YIO A;  3BP8 A;  2KDZ A;  1J5Y A;  4M3B A;  5ED4 A;  1WJB A;  2X6W A;  2BW3 B;  3H36 A;  3WTZ A;  1LVK A;  3V8J A;  3DF8 A;  3FKJ A;  4Y15 A;  4ESB A;  2C6Y A;  3S14 J;  2R7T A;  2KRC A;  1QHH D;  2EQR A;  4BGD A;  3BZ6 A;  2HQN A;  4ON0 A;  2WWY A;  2R7U A;  2ID6 A;  2DBB A;  4Q4Z F;  3E6M A;  1HW5 A;  3H0D A;  2BGC A;  1KQ9 A;  4A3M J;  1ETX A;  3Q9S A;  2LKS A;  3DXJ F;  3LQR A;  4F92 B;  3R0A A;  1UB9 A;  2FNA A;  1S29 A;  2P4W A;  3T8T A;  2R7W A;  1PDN C;  2JA5 J;  1ORK A;  4P1W A;  1T38 A;  2HOS A;  2ZKZ A;  3C2G A;  3V8K A;  3BZC A;  3WTV C;  1HKQ A;  2Y30 A;  2NVQ J;  2ZCW A;  2P5V A;  1JT0 A;  2E5N A;  2VPR A;  1ETK A;  5IPA A;  1IN8 A;  2EK5 A;  1PP7 U;  2Y48 A;  2KIM A;  2NAZ A;  3IKV A;  4MQ9 F;  5DCM B;  4XIC A;  5D4R A;  4M3D A;  3KYL A;  3EQL F;  2IVM A;  1ETW A;  1G3T A;  3GTL J;  3VSK A;  2H8R A;  2OQR A;  1KU7 A;  3JRI A;  2JWT A;  1YIJ I;  3M07 A;  1JTY A;  4CSW A;  1VQK I;  2HTJ A;  1XSD A;  1PYV A;  1TQI A;  1V4R A;  1S7O A;  2LOO A;  2JK3 A;  4PGH A;  2YX7 A;  4AIH A;  1FMW A;  3DKX A;  4ZZL A;  1FWZ A;  3MFK A;  2LD5 A;  1OMI A;  3N97 A;  2HWV A;  4HQM A;  1JGG A;  3HSR A;  2L02 A;  4F7Z A;  3MKL A;  1F36 A;  2ZJ2 A;  2KMU A;  2HDD A;  3WTT C;  2ME0 A;  1GV5 A;  1I6X A;  1UG0 A;  2HKX A;  2M7B A;  5J1U A;  4YFN F;  1JKP C;  2M9H A;  3K0L A;  5LHH A;  3MZY A;  2DTR A;  4PK4 A;  4A3J J;  2DOD A;  2Q2E B;  5CYV A;  4E7Z A;  3ZMU A;  4B43 A;  4ZYG A;  1IXS B;  3H5R A;  4ITV A;  1BW6 A;  2P0W A;  3K69 A;  4PJN A;  3J7A O;  2QCO A;  3LSK A;  3KZI C;  2D2W A;  2KRH A;  5FRM A;  2MLG A;  2DA4 A;  3LOC A;  4NNJ A;  4IVN A;  5H6Q A;  4RAZ A;  1DGW Y;  1MBG A;  2YR2 A;  3M8J A;  4OOI A;  1G59 A;  1G3Y A;  4E70 A;  3FM3 A;  2MC3 A;  4Y33 A;  5EEH A;  4EMS A;  2KT0 A;  3RYP A;  4M9Z A;  4L5I A;  4MFE A;  4W1U A;  1T56 A;  2MC4 A;  2VI6 A;  4LIT A;  5M3M J;  1XC5 A;  4C9Y A;  3WG7 H;  2K3F A;  3CUQ C;  3RI4 A;  2KJB A;  2XSJ C;  3PFI A;  4IKF A;  4D5F A;  3L00 A;  4I7H A;  3MEX A;  3D5S C;  1MJB A;  5HOD A;  2UXN A;  3E5Q A;  2DPD A;  3BQZ A;  1L3L A;  3JRE A;  2YPR A;  3FK7 A;  2EA2 A;  3SQN A;  5LFA A;  5LRR A;  3DKY A;  3MMY B;  1J7K A;  4LMY A;  1GVD A;  2X6O A;  4ESF A;  2H1K A;  1ETO A;  1WI9 A;  2HVS A;  2QKM B;  3E6C C;  5KVR A;  3NWS A;  2J5P A;  2KQR A;  1D8J A;  5FRO A;  3GTJ J;  3RZO J;  4E7I A;  4B8X A;  1VQ9 I;  1EA3 A;  4RGU A;  2NRA C;  3C2H A;  3VEP A;  1XG1 A;  3BR1 A;  1XX5 A;  3SZG A;  2Z9O A;  1X1P A;  2QSF X;  3H0G J;  1A36 A;  2IT0 A;  3NEU A;  1T0F A;  2K9N A;  4S04 A;  2HDC A;  2EPF A;  5EGO A;  1NK3 P;  3HKZ A;  4PZJ A;  4OMZ A;  2MW8 A;  3IH3 A;  3KCC A;  1V5E A;  3CP2 A;  1OCP A;  1DPU A;  4ZZD A;  4IRI A;  2GA1 A;  3K6G A;  5FB2 A;  2XDV A;  4IZZ A;  1TT5 B;  4HV5 A;  2L4A A;  2IRF G;  1X3U A;  4FTH A;  2ESH A;  3OOU A;  2UWM A;  1WZ2 A;  1YYV A;  5IT9 Z;  1OCZ H;  2IAI A;  4II3 A;  2CUZ A;  1QZE A;  1G6N A;  2PMZ A;  1U8R A;  2A69 F;  5HDG A;  3OL4 A;  2HQA A;  3FM5 A;  2FUG 2;  3SFI A;  4IQ4 A;  3TW7 A;  3GTM J;  5JFR A;  1HLV A;  4XNF A;  3BG5 A;  3KP5 A;  5F64 A;  3CQZ J;  3M3Y J;  3LSJ A;  4LFU A;  2XAF A;  4A2U A;  1VQ6 I;  5FFZ A;  3HRS A;  1BIB A;  1M1E B;  1WJC A;  1A35 A;  1U5T A;  3GTO J;  2UXX A;  2QM3 A;  2OPT A;  3M8E A;  1MBK A;  3RDI A;  2IGN A;  1MIJ A;  1P7I A;  3GBG A;  3J7Z I;  1OCR H;  1LFP A;  1P2F A;  2M4K A;  2Z2S B;  5J47 A;  1FOK A;  3S1M J;  4IL6 C;  2ELK A;  2BBY A;  2GWR A;  3DEU A;  3CCE I;  4FCY A;  3S3O A;  2Z3Y A;  3C18 A;  2EZK A;  5D8L B;  1B9M A;  1B1B A;  5BPI A;  4A0X A;  2R93 J;  3AL0 B;  4AIK A;  5J4Y A;  2OQG A;  2VC0 A;  2JVH A;  1O3T A;  4XRS G;  3KLN A;  1CF7 A;  5HLH A;  4KNY A;  4AUX A;  1XGN A;  4I98 B;  2VOD A;  3LA3 A;  1LJ9 A;  1XGS A;  3DWL E;  1OJL A;  3IL2 A;  4RMN A;  3S16 J;  2K9L A;  3U1K A;  5CQE A;  4CCK A;  4IF4 A;  2E7X A;  1BC8 C;  2R7R A;  4N4N B;  4DYC A;  3EYY A;  2GXG A;  4BY1 J;  2HR3 A;  1D5Y A;  3EPZ A;  3OYB A;  2R3S A;  4GDF A;  4KIS A;  2P6T A;  1D5V A;  5KHD A;  1T33 A;  3OYF A;  1G8X A;  3ZQ7 A;  1VQN I;  3A1Y A;  3KZY A;  2L7Z A;  1FEX A;  3AL0 C;  2DFH A;  2YUS A;  3GF2 A;  2W4S A;  3TP0 A;  1ZAR A;  3DBH B;  5FKN A;  3ZMV A;  3JRD A;  2CJJ A;  2XKP A;  1JUP A;  2R7O A;  5BPD A;  2M3A A;  2H27 A;  4BE0 A;  1YE9 A;  2KHM A;  2HKO A;  3P9K A;  4H4K C;  1ZG3 A;  3SJM A;  4F52 A;  5K7H A;  1A31 A;  3KEY A;  3R4K A;  1GVJ A;  2MD0 A;  1RKW A;  1TWG J;  4D5C A;  1FP2 A;  2K5C A;  2JTV A;  1MMG A;  3EDP A;  2OUM A;  2EA4 A;  3P5J A;  2LTP A;  1ZG5 A;  4EM1 A;  3OMY A;  2K9S A;  3PM1 A;  3BG6 A;  4OU0 A;  4OIP F;  1YW9 A;  4E7J A;  2A07 F;  2Y2Z A;  1O3S A;  1WJ5 A;  3LWF A;  3KP4 A;  2BY3 A;  3OYJ A;  1D3Y A;  1KQ8 A;  2XPV A;  3A0B C;  3PO3 J;  2RKH A;  1HKT A;  2AQE A;  1Z7U A;  3OY9 A;  3QP6 A;  5TIS C;  4YEL A;  1OYW A;  2K9M A;  2N8G A;  3QWL A;  1ZGW A;  4JX5 A;  3BPV A;  2DU9 A;  1H89 C;  4DBQ A;  1FYL A;  4EGY A;  4XLA A;  1FPQ A;  5FLV A;  5J4V A;  3E7L A;  2JA7 J;  2DMP A;  2JZY A;  1SAU A;  4WF2 A;  2WAF A;  3CUO A;  2R7V A;  2JRM A;  1T6S A;  3ULQ B;  3ERE D;  5EF6 A;  1H8A C;  4BJ5 C;  5EEG A;  4XSX F;  2ICW G;  1V54 H;  4L9J A;  4XMY A;  3I4N J;  2IPQ X;  5M3F J;  5IYB J;  4G7H F;  2W82 A;  3FK6 A;  3OIP A;  1OR7 A;  3JAM Z;  4OIO F;  2HI3 A;  2MLK A;  1QRY A;  1R36 A;  3UNG C;  1FZP B;  2VXZ A;  3CDI A;  3WTW C;  5JR3 A;  1UFM A;  2R4G A;  2XGX A;  2M1B A;  4B3A A;  1HQC A;  4D9J A;  3JSO A;  3V7R A;  5BNG A;  5KNL A;  1ON2 A;  3HB9 A;  4LG0 B;  1VF9 A;  1JGS A;  2W85 A;  4LD5 A;  4Y4R A;  2HQR A;  4ENJ A;  1QPI A;  4XLF A;  5F08 A;  3OYC A;  2JSP A;  2KZV A;  2CW7 A;  2NVU B;  5LHG A;  2HOE A;  2MA3 A;  3F3X A;  1FOW A;  2RGV A;  3LFU A;  3I71 A;  2A61 A;  3F6O A;  2BW3 A;  3H3U A;  2QUF A;  2QEX I;  2V79 A;  3CMA I;  2E2I J;  5F0F A;  5JLW A;  5HS8 A;  3FMS A;  5L3E A;  5FO5 A;  5K7F A;  3K1N A;  5DUI A;  2JA8 J;  2R7Z J;  4JQF A;  1ZRC A;  1JUS A;  1VFC A;  4CCN A;  4OIQ F;  3S1Q J;  1QO0 D;  1XCB A;  2QQB A;  3SEQ A;  5A2Q Z;  1LEB A;  2L7M P;  1XN7 A;  4HLY A;  2DCE A;  1T39 A;  3PNT A;  3DPL C;  3FXQ A;  2BHY A;  2PI0 A;  2EB7 A;  2Y75 A;  3CC2 I;  3GTQ J;  4HAM A;  2IGK A;  2F4O B;  3CLQ A;  3FXM A;  3H9J A;  4XKV A;  1VND A;  2K27 A;  4LG3 A;  1OQY A;  3ASO H;  3ROU A;  1XPX A;  1TC3 C;  2PFB A;  2VBZ A;  5DCM A;  1ONV A;  1SFX A;  3MZ8 A;  1TL8 A;  3J80 K;  3GZ6 A;  3WU1 B;  4FX4 A;  2ZC2 A;  3Q0U A;  1XMX A;  3VYT B;  1P4A A;  2Z33 A;  3IWF A;  2ISZ A;  3ERM A;  2W00 A;  1O7F A;  1MH4 A;  3KPH A;  3VYS B;  3RZD J;  3DP7 A;  2DA1 A;  3I9V 2;  3K1P A;  4A93 J;  5IYC J;  1OIS A;  4BS9 A;  3J81 Z;  1HC8 A;  1HF0 A;  5JVG F;  1WJF A;  1MW7 A;  2VKD A;  3DV8 A;  2EIK H;  2BHZ A;  4CCL A;  1R7J A;  4PJJ A;  3VOD A;  1B4A A;  1IV6 A;  3HTU A;  4EJO A;  2G7U A;  1FYK A;  2GXA A;  2WAE A;  5FKO A;  2WB1 A;  2GAU A;  1JXS A;  2DLL A;  3HG9 A;  2EFQ A;  4EEF G;  1D1A A;  3I55 I;  2E1O A;  3O8G A;  3R61 A;  4XR6 A;  1PVE A;  2XHK A;  1JHF A;  1P4X A;  4QLC U;  3O6B B;  5KAF C;  2HXI A;  4HYE A;  4FQG A;  2E1C A;  2NVT J;  4PJM A;  3OIQ A;  4JX4 A;  1ZLK A;  1XS9 A;  5L3G A;  4XON A;  4AIJ A;  4U7D A;  1FLI A;  1VQO I;  3D5L A;  3W2A A;  5CVR A;  3ABT A;  2CFX A;  4Y7N J;  5BMZ A;  2HQ5 A;  2FA5 A;  2E1M B;  3NAU A;  1BR2 A;  4G12 A;  2VPL A;  1SMY F;  2DFI A;  2CO5 A;  4GO1 A;  2CUF A;  2VBY A;  1V55 H;  3H5N A;  2UZK A;  2CGP A;  3D0S A;  2Z1D A;  3W2W A;  5DV5 A;  3PQJ A;  3OYI A;  3VYU B;  2P5L C;  3EUH C;  3D5R C;  3AG2 H;  2VJI A;  1APL C;  2NVX J;  1YLF A;  4UUS B;  4XSZ F;  4ZYA A;  1JHH A;  3JRG A;  3K4N A;  2B9S A;  4IHY A;  1UAA A;  1JKR C;  4WWC A;  3K4C A;  1HKS A;  1J9I A;  1USS A;  1VI0 A;  3GLX A;  4ZYD A;  2DT7 B;  3KET A;  3I5U A;  2E1M C;  4EJT A;  2KIU A;  1D8K A;  1IO2 A;  2VKE A;  3H9G A;  5DM6 F;  1LB2 A;  1YJW I;  2VN2 A;  2X85 A;  2TDX A;  3FIS A;  1FBS A;  1OYI A;  2LLK A;  3R6S A;  1L0O C;  2BXZ A;  2M8E A;  3DPT A;  5EDN A;  3BY6 A;  2DYR H;  3B02 A;  2COB A;  1ETQ A;  1NG7 A;  1TW2 A;  2XSD C;  3QPS A;  2A5W A;  1FTZ A;  1HCR A;  1GXP A;  2HS5 A;  1YHQ I;  1W5T A;  1Z3Y A;  3CME I;  4N9H A;  3TO7 A;  5CVJ A;  2JA6 J;  3ZQH A;  3DCF A;  3QOE A;  5IYD J;  4Q48 A;  1FBU A;  2QSG X;  1Y39 A;  3OYD A;  4KT6 A;  5J40 A;  1W7P D;  3IP4 B;  2DT6 A;  1U9N A;  2ZB9 A;  1J2X A;  2XVC A;  5CKT A;  5E3O A;  2O9L A;  1ZRF A;  2RQP A;  2CUE A;  3G2B A;  2DO7 A;  2NNN A;  2CS3 A;  4FE4 A;  3QOD A;  4G8X A;  3EYI A;  3Q9V A;  1Z77 A;  3HHG A;  2NS7 A;  4EM2 A;  1FSE A;  4FET A;  6PAX A;  2CW8 A;  4DYR A;  5E1W A;  1YO5 C;  1XSV A;  3GW2 A;  3MZH A;  2DA7 A;  2WV1 A;  2KIF A;  1AWC A;  2HOT A;  1Y56 A;  2EV6 A;  2F6C A;  5DTD A;  5K5Q A;  2HYF A;  2IS1 A;  1R9T J;  2CW0 F;  1LDK B;  3N4M A;  3CP8 A;  3V4G A;  4BQO A;  1JKO C;  2F5F A;  4J00 A;  4UHT A;  1RES A;  4I0A A;  1E2X A;  2YSR A;  1YI2 I;  2KDO A;  3WE3 A;  4Q5S F;  1UST A;  1UZC A;  4KN7 X;  1IAW A;  3S2D J;  2XF5 A;  2ZJP F;  3JW4 A;  4FE7 A;  4BKX A;  5F1J A;  5L3B A;  3I64 A;  4L9N A;  4F3Q A;  1TLH B;  4HEA 2;  4ZYH A;  3IUO A;  1IG7 A;  1IW7 F;  2A3S A;  2MSY A;  3GUD A;  2HVR A;  1SVO A;  1FNN A;  1KU3 A;  2A05 A;  2CUJ A;  1MBF A;  4L18 B;  3A0H C;  5FD6 A;  1OCT C;  1R5G A;  1I1S A;  3K4J A;  3ZQL A;  3CJR B;  3QYE A;  4BYY A;  4MIM A;  2LMD A;  2P8T A;  1ZTR A;  3LSP A;  3CZ6 A;  4NDL A;  1ZR2 A;  3KLO A;  5B66 C;  4GYG A;  4DJA A;  3HGG A;  4KIT B;  2ZO4 A;  2WC2 A;  3ZMZ A;  3L1P A;  3K2Z A;  3HHH A;  5D5V B;  3SDB A;  4CA0 A;  2VJJ A;  2L5Q A;  5JVT A;  2WAQ N;  1UHM A;  2LDU A;  2E7W A;  3A4C A;  3FIW A;  4A3K J;  3PNY A;  1DGR M;  1XDU A;  2IS4 A;  2ZNZ A;  3T1B A;  1ETV A;  4C3I J;  2R5Z B;  3J7Y J;  1Q1H A;  2LRE A;  1YS6 A;  3PUF A;  2FNP A;  4CDG A;  3W2V A;  1J0R A;  4I01 A;  3BG9 A;  3GYH X;  2EFW A;  2OZU A;  2EV0 A;  3KP2 A;  4Z2Y A;  3BTI A;  4A3G J;  2ZXW H;  3JRF A;  5LGT A;  4AVP A;  4A3L J;  2KFD A;  1QVU A;  4M72 A;  4BXU A;  3H5A A;  4CO8 A;  3I59 A;  5K5O A;  4LLN A;  4BXF A;  4HG2 A;  4B3X A;  4GCV A;  2LRD A;  4HF1 A;  2CV1 A;  2LYC A;  1E17 A;  4BEH B;  1T98 A;  2ETH A;  5E1X A;  4G6Q A;  1HSJ A;  5HVQ C;  2NXN B;  1D0Y A;  1AU7 A;  2IXS A;  3FXK A;  1ZHF A;  3PSI A;  4XLH A;  3L2W A;  2DDA A;  4GRI A;  1F1Z A;  1TWC J;  2DMU A;  5LEJ A;  4FAS D;  5E3N A;  5FLM J;  1X1C A;  1FX7 A;  2NOG A;  4M3G A;  2EBI A;  4YEJ A;  3K4K A;  3D1N I;  4KMU X;  3CCS I;  3CJQ B;  1Z1D A;  2AS5 F;  3QQA A;  4MEX F;  4Y52 J;  5ILU A;  4CZZ A;  1T8I A;  2DI3 A;  2H6C A;  1R5H A;  4M3E A;  2XAU A;  1MKM A;  1YG2 A;  4LLL A;  3G1O A;  3W6V A;  4A12 A;  3E6B A;  4UV9 A;  3IHU A;  3PQK A;  1A04 A;  3L2U A;  3CCU I;  1BOA A;  2COM A;  5E17 F;  1W4M A;  1MDM B;  2O0Y A;  3CUQ B;  3NAR A;  3UKG A;  2X51 A;  2DA3 A;  4B09 A;  4IEJ A;  1S6L A;  3E0J B;  3ZQG A;  3OYM A;  1IXR C;  1X2N A;  3HIF A;  3LSI A;  1RIO H;  1LE8 B;  2STT A;  3ISP A;  2ZJR F;  1PUE E;  3LST A;  2JQ7 A;  3SYT A;  1RC9 A;  3BRO A;  1MMS A;  2KZG A;  3OYA A;  1RUN A;  2GM4 A;  2F2E A;  4XOT A;  2LF8 A;  3OOP A;  2GA2 A;  4ZC3 A;  4BHB A;  3ZMD A;  2K4B A;  2VIX A;  4XKW A;  2K02 A;  1TWA J;  1BR4 A;  2DJI A;  4KIG A;  3CCV I;  4ETS A;  2VAS A;  4U87 A;  1K78 B;  4RS8 A;  3QYF A;  3VB2 A;  3JTH A;  2KLO A;  5AIQ A;  1UJ8 A;  3KFW X;  3ZN0 A;  1W36 C;  3ZRG A;  3U21 A;  2M7A A;  1ZR4 A;  2OC6 A;  1RR8 C;  1R22 A;  4UVC A;  1H0M A;  4LG0 A;  3T5X A;  3OYN A;  2DMN A;  1S9H A;  2FBK A;  2HGC A;  3MCZ A;  1FTT A;  4IPA A;  3GZN B;  1RNL A;  4RB2 C;  2QQA A;  3CCY A;  3ZQF A;  1EH6 A;  3TGN A;  5GAE J;  1WFX A;  1WH5 A;  3F8C A;  3MN2 A;  2P81 A;  4RLQ A;  3QPT A;  1B8I B;  3F72 A;  2DMT A;  3FBI B;  4KA4 A;  2LP0 A;  3PNV A;  3A03 A;  4GGG A;  1D0X A;  1D1B A;  4MHG A;  1W36 D;  1K4T A;  1E3O C;  4LOC A;  2FOK A;  1O57 A;  4HZF A;  2HZD A;  2X9D A;  4FHT A;  3HL2 A;  1ZK8 A;  1WI3 A;  2AQF A;  2XRL A;  2V7F A;  1SFU A;  2V9K A;  3KZZ A;  4PUS A;  1ENH A;  2KKO A;  3S32 A;  4DQ2 A;  1Z6R A;  1ZN2 A;  3BQY A;  3RCO A;  3AKZ A;  2Q0O A;  2KRF A;  2ME6 A;  4XOP A;  1BL0 A;  3E6D A;  2EFO A;  2JUC A;  3P7N A;  4ZTJ A;  2P5K A;  2UUZ A;  3ABK H;  2L7F P;  4A3E J;  2RQQ A;  1U78 A;  3KEO A;  3WG9 A;  4JP0 A;  5IOY A;  2GIZ A;  1B6A A;  4AYB A;  2EIM H;  2Y31 A;  3Q5F A;  1S7E A;  3LA7 A;  1FMV A;  5E8G A;  1SFO J;  2X6Y A;  2XF7 A;  5KAI C;  3IWZ A;  1SFK A;  2CQX A;  1EV7 A;  2MGQ A;  4IO9 F;  1X58 A;  4C30 A;  4PJ0 C;  4M9X A;  2O8X A;  5ICC A;  3RJP A;  4II2 A;  1WJD A;  4RB3 C;  1SMT A;  5M5X J;  2QKL B;  5BS6 A;  2E1N A;  4LB5 A;  2OTJ I;  4RDU A;  3RPQ A;  1J75 A;  3HRM A;  1YTY A;  2F5E A;  5L3D A;  1B72 B;  1K6Y A;  4G7O F;  4GXO A;  1S8N A;  2A5Y B;  3DPU A;  3P9C A;  2F5D A;  5F04 A;  1R1U A;  3ZPL A;  2FJ1 A;  3R60 A;  4NC6 A;  4CIC A;  1DUX C;  2R7D A;  2D1H A;  2CSO A;  2GZW A;  4HX4 A;  3RPU A;  3F8M A;  2M87 A;  1ZAO A;  3DBR B;  2R5Y A;  4HBL A;  5FGM A;  3K2A A;  5D6E A;  5JI6 A;  4QPQ A;  3BTL A;  2V1D A;  3GLL A;  4RGS A;  3ECO A;  1Y8Q B;  2EIN H;  2HZT A;  5D4S A;  4UY8 I;  3BLY A;  4HX7 A;  3OYK A;  2PJR B;  2E2H J;  3S8P A;  2L01 A;  2RAE A;  3VPR A;  1Z9C A;  2QA4 I;  1QNT A;  2RRE A;  1Y0U A;  4BL0 B;  2GIV A;  2VE8 A;  3TBI A;  4E6K G;  3KYC B;  5EG0 B;  2IA1 A;  4BU2 A;  3OSF A;  1BN5 A;  3O8H A;  4CUG A;  3REO A;  4XRS A;  2ZBK A;  1FY7 A;  2MAB A;  3HKZ N;  2FXA A;  3FKI J;  1Y1V J;  3QU6 A;  4G6D A;  1R23 A;  1N25 A;  3ZXS A;  3L2C A;  2ZFU A;  2L9R A;  2M0C A;  1AOY A;  4UUS A;  4IHX A;  3BDD A;  4ZJZ A;  1QZZ A;  2VXD A;  3KP3 A;  5EZG A;  2W48 A;  4WXC A;  3E1S A;  3V7S A;  3S2W A;  3ZQI A;  4IHW A;  3K9T A;  1UMQ A;  1IXC A;  4I99 C;  3IAM 2;  5GTH C;  2VLA A;  4KUM A;  1I1G A;  3ONQ A;  2PMZ N;  1MND A;  2LFB A;  5M5Y J;  2Z5U A;  4G6T B;  4MTD A;  4C2U A;  2VQL A;  3K1M A;  2A6H F;  1WCM J;  2L2O A;  4A3F J;  2BZT A;  2XRN A;  3VYR B;  5GTI C;  3WHB A;  1K79 A;  2P7V B;  4BY7 J;  4HV6 A;  3G1M A;  3CC7 I;  2PBI A;  1TTY A;  5EZH A;  1X3W B;  2XAQ A;  3HUG B;  3ABL H;  2PG4 A;  3CO6 C;  1LEA A;  3FHN A;  3TKY A;  5GAG J;  2FMY A;  1NH3 A;  2Y9Y A;  3S15 J;  1DU6 A;  1O3R A;  2EZI A;  2JT1 A;  1GV2 A;  3M8F A;  2GOM A;  3CLO A;  2W24 A;  5LD2 C;  2OTL I;  2DMQ A;  2CV2 A;  3H3Z A;  2VT3 A;  1QZY A;  4NUB A;  1BJZ A;  3FXU A;  2XGC A;  4K2E A;  2F48 A;  4N4O B;  5D5W B;  2R92 J;  1KGS A;  1R6R A;  2E36 A;  2I8D A;  3HOS A;  1KYZ A;  4BQN A;  5HNF A;  5IOZ A;  2P7C B;  5E3M A;  1F9N A;  3GCM A;  1CGP A;  3F22 A;  2EH3 A;  2OCE A;  3F8F A;  1IDZ A;  4WXD A;  2STW A;  2VT2 A;  3HDD A;  2BVL A;  1Z7L A;  3CO7 C;  5J8C A;  2VJ4 A;  2OZ6 A;  1TBX A;  2HDW A;  3BR5 A;  3ZMT A;  2W57 A;  4HNU A;  1YX5 A;  3TDZ C;  1K83 J;  1TWF J;  1NG6 A;  1ODD A;  1WH7 A;  4EV0 A;  4ASN A;  2GXB A;  3U2R A;  1SD7 A;  4E4H A;  2DOE A;  3RYR A;  3S3N A;  1LNW A;  5HLT A;  1SFE A;  2BVM A;  3O3K A;  4M71 A;  1IGN A;  2H09 A;  1KON A;  1FOY A;  2L9N A;  1WJA A;  1XDS A;  2V1X A;  4LGW A;  3MAJ A;  2VQG A;  1QBJ A;  4HX8 A;  3JCU C;  1Z6T A;  3F0C A;  5LGN A;  2DT5 A;  2OF7 A;  1ZRE A;  2X0L A;  5H6R A;  1MMA A;  1P4W A;  3JRB A;  4EJW A;  3JRC A;  2LBF B;  3VSL A;  3ABM H;  1VQ4 I;  1FP1 D;  3KIO A;  1N77 A;  1UHW A;  2ACJ A;  2O6G E;  3ZGK A;  1X19 A;  3Q3S A;  4IHT A;  5E8I A;  2IS2 A;  4PSX A;  2WAD A;  1FSH A;  2HYJ A;  3O2P E;  2NS8 A;  3TL4 X;  3TMO A;  1Z3X A;  5IT3 A;  5C44 J;  2DA2 A;  3ZQQ A;  4XLP F;  3I0T A;  2R0Q C;  2VB6 A;  3PL8 A;  2L0K A;  2Y69 H;  1S7A A;  4V2G A;  2O61 A;  4WX9 A;  1QVT A;  1X1D A;  4U0W A;  2O3F A;  3CDL A;  1H9T A;  3CCL I;  2VON A;  2GBY A;  2DFF A;  3BJA A;  2CQQ A;  4HST A;  4I2O A;  4HW0 A;  4EM0 B;  4LJZ F;  1E3H A;  2FD5 A;  3U9G A;  3T8R A;  2XPW A;  3ESW B;  2XUB A;  2QQ9 A;  1SC7 A;  1ON1 A;  2R5Z A;  2A6E F;  1KQ0 A;  4D1Q A;  3LSR A;  4AVZ A;  3CF5 F;  2CV0 A;  1N78 A;  5ICG A;  4BUP A;  1JUM A;  3WGG A;  4QIW N;  5B3S H;  2PMH A;  1MBH A;  5DD8 A;  3DEE A;  1XB4 A;  3H35 A;  1DU0 A;  5GPC A;  3AAF A;  2UV1 A;  3BR6 A;  4RAY A;  4Y3O A;  2CYY A;  4ABZ A;  3SXY A;  5FJ8 J;  3A2K A;  3LQQ A;  1Z91 A;  5EYR A;  5K1Y A;  3F21 A;  2DJN A;  1U8B A;  1F43 A;  4CYC B;  5J1Y A;  5IP6 A;  2QGU A;  4U7B A;  4CCM A;  1S72 I;  4KJZ A;  2JPC A;  2QZ8 A;  5D8K B;  4JK1 X;  1OPC A;  4NBQ A;  4RLF A;  1T0F C;  5ILS A;  3GWZ A;  3L7W A;  1D0Z A;  2JMW A;  4XRM A;  3B6C A;  5E3L A;  1SAX A;  2JPB A;  5D5X B;  4DYQ A;  1LDJ A;  4YIF A;  1G4D A;  3L9F A;  1YRN B;  1IRG A;  3LSM A;  3OIO A;  1HBX G;  1SD6 A;  2H6B A;  4RGR A;  4QPO A;  3HOT A;  5CJ9 A;  2QWW A;  3H1C A;  3GEZ A;  2XPU A;  2GOX B;  1U0J A;  4WCG A;  4R79 A;  2HVQ A;  2CWE A;  2Q2E A;  5FD5 A;  4ZDP A;  3BCB A;  1WQ2 A;  1YS7 A;  2EWN A;  2HNH A;  5DCF A;  4A3C J;  1YIT I;  4N0B A;  1PJR A;  5J3L A;  3TO9 A;  1R71 A;  1MDM A;  1ZH5 A;  3CUQ A;  3S1R J;  4LK1 F;  5C4X J;  2QLZ A;  1RI7 A;  1T2K A;  2EFP A;  2Y0S A;  3GTP J;  3G4S I;  4CHU A;  2VKH A;  1LE8 A;  2E2J J;  3ELK A;  2XAS A;  1TNS A;  2X4H A;  1GHC A;  4MTE A;  4OIR F;  1PP8 F;  1MJA A;  4HNV A;  1WSU A;  4ENM A;  2M45 A;  1VQ8 I;  4YIR X;  1W7P B;  3WOD F;  1HW1 A;  3HOV J;  1U5T C;  2VQH A;  1FJL A;  3M9A A;  3GX4 X;  4OAZ A;  4IXA A;  1XGM A;  3DQV C;  1DQU A;  3QOP A;  4E7S A;  1SD4 A;  5IP7 J;  4CXF A;  2XIG A;  2VE9 A;  4UUV A;  2R7X A;  2FBI A;  1K78 A;  3JRA A;  2YU9 J;  3DTI A;  4BHC A;  3AG1 H;  4G94 A;  1FT9 A;  9ANT A;  4B4C A;  4BHP A;  1Z0X A;  3MKZ A;  1OCC H;  1IZ1 A;  5HNH A;  4HF2 A;  4MO7 A;  3WTX C;  1TW3 A;  2L3D A;  1U3E M;  1WKM A;  3I53 A;  3V7C A;  3OL3 A;  2ELJ A;  1JT6 A;  3SZT A;  1B8I A;  2CH0 A;  3HOX J;  3BOQ A;  3WGH A;  1S3J A;  3HRU A;  3HBL A;  2B0L A;  4KN4 X;  3BTC A;  2JN6 A;  2EV5 A;  4R8H A;  3WTU C;  1U2W A;  3RIR A;  1ITY A;  2DW4 A;  2QF7 A;  4LK0 F;  2DA5 A;  1RRJ A;  2WB1 N;  1YJN I;  2DYS H;  2EIJ H;  4RM3 A;  3HRT A;  4XOR A;  3BG3 A;  2V1N A;  3VOE A;  3OSG A;  1EF4 A;  1YX3 A;  3OYG A;  1VQL I;  3HOZ J;  5CQG A;  3IAS 2;  5HS7 A;  2KP6 A;  4ZTF A;  1HOM A;  1JI8 A;  1BW5 A;  3QRF F;  3DFG A;  2MH9 A;  3W6K B;  2V6E A; 
#chains in the Genus database with same CATH homology
 3UKG A;  1IDY A;  3S17 J;  2DA3 A;  1LFU P;  4IEJ A;  4M3F A;  4AUX A;  3ZQG A;  5EGO B;  1LE8 B;  1WPK A;  1X2N A;  1MSE C;  3S2H J;  1OJL A;  3S16 J;  2VUM J;  1W0U A;  4A3B J;  2LK2 A;  4MLO A;  5GPA A;  4DYC A;  2GM4 A;  2I10 A;  2XGE A;  2ECC A;  5F27 A;  4BY1 J;  2D5V A;  1D5Y A;  4FIS A;  1T33 A;  1TWA J;  3PO2 J;  1FIP A;  2L7Z A;  2VKV A;  3SDG A;  1FEX A;  2DN0 A;  2YUS A;  3TED A;  4A3I J;  2JJ7 A;  3TP0 A;  5FKN A;  1TWH J;  3JRD A;  2CU7 A;  2CJJ A;  4L5E A;  2MG4 A;  1JUP A;  2LY9 A;  1ZR4 A;  3WHC A;  2DA6 A;  2LR8 A;  4S0H B;  3SJM A;  2DMN A;  5K7H A;  3ZQC A;  1MBE A;  1FTT A;  3CCY A;  3ZQF A;  1RKW A;  3Q0W A;  1TWG J;  1WH5 A;  3MN2 A;  4JX6 A;  2P81 A;  4D5C A;  1B8I B;  3M4O J;  2M2E A;  2DMT A;  2LP0 A;  3A03 A;  2LTP A;  2XGD A;  4UUT A;  2K9S A;  3PM1 A;  1E3O C;  4LOC A;  3RKQ A;  1MNM C;  2X9D A;  3S1N J;  1ZK8 A;  1WI3 A;  2Y2Z A;  4BBS J;  1UHS A;  2XRL A;  3LNQ A;  5FKK A;  1NTC A;  2XPV A;  4MFD A;  2R5Y B;  1ENH A;  1ETY A;  2Y9Z A;  3PO3 J;  3BQY A;  3ZOB A;  3BR3 A;  2ME6 A;  1BL0 A;  4X6A J;  5EG0 A;  1HDP A;  2FQ4 A;  1ZGW A;  2N8G A;  4JX5 A;  2L7F P;  1H89 C;  4A3E J;  1U78 A;  2IEK A;  4DW6 A;  4JP0 A;  5IOY A;  3E7L A;  5FLV A;  2JA7 J;  2DMP A;  2M34 A;  2M8G X;  2Y31 A;  1I3Q J;  1S7E A;  5EF6 A;  1SFO J;  2IBD A;  1H8A C;  2CQX A;  4AC0 A;  1W0T A;  3I4N J;  5M3F J;  5IYB J;  2MGQ A;  3FK6 A;  1X58 A;  1ZQ3 P;  5C4J J;  2HI3 A;  1QRY A;  2X48 A;  1GDT A;  5M5X J;  3K7A J;  3QPL A;  4B3A A;  4RDU A;  3BT9 A;  5BNG A;  1RKT A;  1B72 B;  1FIA A;  3G1L A;  3HB9 A;  5K7Z A;  1VF9 A;  3BR0 A;  3A01 A;  3HOU J;  3BTJ A;  3IH2 A;  5F04 A;  4GFB A;  2LVS A;  1GT0 C;  1O4X A;  1JJ8 C;  2FJ1 A;  1QPI A;  3IH4 A;  4M6V A;  4C3J J;  5F08 A;  1JJ6 C;  2EZL A;  2TRT A;  4C2M J;  2R5Y A;  5FKL A;  2E19 A;  3K2A A;  3GTK J;  4DZJ A;  2O8K A;  3HOY J;  3BTL A;  1BA5 A;  4DZP A;  1Y1W J;  2G0E A;  2E2I J;  5F0F A;  5JLW A;  4B1R A;  5K7F A;  2JA8 J;  2E2H J;  2R7Z J;  5J1R A;  2RAE A;  3VPR A;  1JUS A;  1P7J A;  1VFC A;  3S1Q J;  4XK4 A;  5EG0 B;  3OSF A;  2L7M P;  1NK2 P;  4J19 A;  3O8H A;  2Y0S N;  1SAN A;  4XRS A;  3HKZ N;  3GTQ J;  3FKI J;  1GUU A;  1U9O A;  1Y1V J;  3I4M J;  1VND A;  1PUF A;  2L9R A;  2M0C A;  1TC3 C;  1ZKG A;  4UUS A;  3TP3 A;  4IHX A;  1AKH A;  2CRG A;  5EZG A;  2W48 A;  3A02 A;  3ZQI A;  3Q0U A;  4IHW A;  1UMQ A;  4I76 A;  1B72 A;  1JTX A;  5F0H A;  1MH4 A;  3RZD J;  1Q1V A;  2DA1 A;  4QTR A;  4A93 J;  2XB0 X;  5IYC J;  2PMZ N;  1A5J A;  1HF0 A;  2LFB A;  5M5Y J;  4W97 A;  1IJW C;  3JR9 A;  1WCM J;  4A3F J;  3WHB A;  4BY7 J;  3A01 B;  1IV6 A;  3G1M A;  3Q0V A;  2O7O A;  5EZH A;  5JLX A;  5FKO A;  5FKM A;  4EEF G;  2E1O A;  3O8G A;  3S15 J;  2Y9Y A;  2KDZ A;  1DU6 A;  2EZI A;  4M3B A;  1GV2 A;  2HXI A;  2ECB A;  2NVT J;  4JX4 A;  2DMQ A;  1XS9 A;  3S14 J;  2EQR A;  1BJZ A;  2XGC A;  2ID6 A;  4Y7N J;  2HQ5 A;  4A3M J;  3NAU A;  4G12 A;  2R92 J;  2TCT A;  1ETX A;  5IP9 J;  4X1E A;  5IOZ A;  2CUF A;  5E3M A;  1MH3 A;  2JA5 J;  1ORK A;  2EH3 A;  2HOS A;  1IDZ A;  2Y30 A;  2NVQ J;  1JT0 A;  2VPR A;  1PUF B;  1ETK A;  3HDD A;  5IPA A;  1APL C;  2NVX J;  3BR5 A;  4UUS B;  4XIC A;  1AKH B;  1K83 J;  1TWF J;  3JRG A;  1IC8 A;  1H88 C;  4M3D A;  1WH7 A;  4IHY A;  1JKR C;  1ETW A;  2B63 J;  3GTL J;  4CYC A;  1VI0 A;  2H8R A;  1IGN A;  3JRI A;  2JWT A;  5GP9 A;  1JTY A;  2NVY J;  2VKE A;  2XB5 A;  1JKQ C;  1IUF A;  1G2H A;  3F0C A;  2OF7 A;  2JK3 A;  1CQT A;  3FIS A;  3JRB A;  2LD5 A;  3JRC A;  2LLK A;  1YRN A;  1JGG A;  1MBJ A;  5EDN A;  2K9Q A;  3MKL A;  1F36 A;  2COB A;  1ETQ A;  3Q3S A;  2XSD C;  2HDD A;  3QPS A;  2ME0 A;  1GV5 A;  2AHQ A;  1FTZ A;  1HCR A;  2HYJ A;  2NS8 A;  5J1U A;  5C44 J;  2DA2 A;  1JKP C;  4I6Z A;  2EZH A;  2M9H A;  2FX0 A;  2R0Q C;  1POG A;  2L0K A;  2JA6 J;  4V2G A;  3ZQH A;  1QVT A;  3DCF A;  4A3J J;  5IYD J;  3CDL A;  3GTG J;  1OFC X;  2GBY A;  3LSG A;  1U9N A;  2HOA A;  2ZB9 A;  2CQQ A;  5E3O A;  4D7N A;  2O9L A;  4A3D J;  1BW6 A;  2FD5 A;  3DEW A;  2XPW A;  2CUE A;  2QCO A;  3HEF A;  2R5Z A;  3LSR A;  1IRZ A;  4FE4 A;  2DA4 A;  3LOC A;  1Z77 A;  5EEA A;  4AYB N;  2NS7 A;  4QSH A;  1JUM A;  1LFB A;  4QIW N;  1MBH A;  1X2M A;  1MBG A;  3H3V K;  4D7M A;  4DYR A;  1DU0 A;  5GPC A;  2DA7 A;  2WV1 A;  3BR6 A;  3C2B A;  4ABZ A;  2HOT A;  5FJ8 J;  2DTZ A;  5EYR A;  2KT0 A;  3B6A A;  2DJN A;  1U8B A;  5DTD A;  2YS9 A;  1F43 A;  4CYC B;  4MFE A;  2LKX A;  4W1U A;  1T56 A;  2VI6 A;  5J1Y A;  5IP6 A;  5F0C A;  1R9T J;  5M3M J;  1XC5 A;  1WGX A;  3MVP A;  1JKO C;  4BXX J;  1RES A;  4A69 C;  3S2D J;  2JMW A;  4D5F A;  4XRM A;  3B6C A;  5E3L A;  5HOD A;  3BQZ A;  3JRE A;  4FE7 A;  4BKX A;  4DYQ A;  5F1J A;  3BR2 A;  3RQI A;  1IG7 A;  3FK7 A;  3HM5 A;  1YRN B;  2MSY A;  3OIO A;  1GVD A;  2X6O A;  1MBF A;  3HGY A;  1UG2 A;  2XPU A;  4C3H J;  1ETO A;  1OCT C;  2H1K A;  1K61 A;  3IV5 A;  3GTJ J;  3RZO J;  3ZQL A;  4A3C J;  4XID A;  4MIM A;  1XG1 A;  1ZTR A;  3BR1 A;  5J3L A;  3LSP A;  4NDL A;  3S1R J;  1ZR2 A;  3H0G J;  2GLO A;  5C4X J;  3HGG A;  3HOW J;  2K9N A;  3GTP J;  5EGO A;  4RBO A;  1NK3 P;  3L1P A;  1LE8 A;  2E2J J;  1AHD P;  3TW6 A;  2MW8 A;  3IH3 A;  1OCP A;  2WAQ N;  4HNV A;  2ID3 A;  3FIW A;  5C3E J;  4A3K J;  3HOV J;  1I50 J;  4C3I J;  1ETV A;  1A6I A;  3CMY A;  2R5Z B;  1FJL A;  2HXO A;  4FTH A;  3OOU A;  5IP7 J;  3BG9 A;  4A3G J;  3BTI A;  2IAI A;  2AO9 A;  5M5W J;  1MSF C;  2YU9 J;  3JRA A;  3JRF A;  4A3L J;  9ANT A;  1QVU A;  4B4C A;  1HDD C;  3SFI A;  4V2F A;  1Z0X A;  1RET A;  3TW7 A;  3GTM J;  1HLV A;  4MO7 A;  3BG5 A;  3CQZ J;  3M3Y J;  3LSJ A;  1RR7 A;  1JT6 A;  4BBR J;  1B8I A;  1AU7 A;  3GTO J;  2OPT A;  1MBK A;  3HOX J;  1P7I A;  1I6H J;  3GBG A;  3HBL A;  3BTC A;  1TWC J;  2DMU A;  2JN6 A;  5E3N A;  5FLM J;  1ITY A;  2QF7 A;  3S1M J;  2DA5 A;  4IHV A;  2NOG A;  4M3G A;  2EBI A;  2WB1 N;  3D1N I;  2ELK A;  3OSG A;  1EF4 A;  3BG3 A;  1RPW A;  4FCY A;  3JRH A;  3QQA A;  4Y52 J;  2EZK A;  2K40 A;  3HOZ J;  4M3E A;  2R93 J;  3W6V A;  3G1O A;  1HOM A;  4XRS G;  4JYK A;  5DS9 A;  1BW5 A;  3NAR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...