3OSGA

The structure of protozoan parasite trichomonas vaginalis myb2 in complex with mre-1-12 dna
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
111
structure length
110
Chain Sequence
VQVNKAAKKQKFTPEEDEMLKRAVAQHGSDWKMIAATFPNRNARQCRDRWKNYLAPSISHTPWTAEEDALLVQKIQEYGRQWAIIAKFFPGRTDIHIKNRWVTISNKLGI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MYB21
publication title Molecular basis of the recognition of the ap65-1 gene transcription promoter elements by a Myb protein from the protozoan parasite Trichomonas vaginalis.
pubmed doi rcsb
source organism Trichomonas vaginalis
molecule tags Transcription/dna
total genus 37
structure length 110
sequence length 111
chains with identical sequence D
ec nomenclature
pdb deposition date 2010-09-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13921 Myb_DNA-bind_6 Myb-like DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 3osgA01
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 3osgA02
2I10A 2D5VA 1ZTRA 3IH4A 3Q3SA 4RBOA 3BG9A 1ETWA 1ZKGA 2EQRA 2HXOA 2ID3A 5K7ZA 2JA8J 1BW5A 1Z0XA 2AHQA 3BQZA 3B6AA 5IOZA 3TEDA 5IP7J 2E2JJ 2Y30A 1E3OC 5J3LA 2LY9A 3BG3A 2H8RA 3ZOBA 2FJ1A 1IUFA 5FKKA 1JUPA 2VUMJ 4C3IJ 1FTTA 2E2IJ 4BKXA 4BBSJ 1ETYA 4C2MJ 3LSPA 1IDZA 2NS7A 3S14J 1QVTA 3GTJJ 3HBLA 1AHDP 4M3FA 2DA5A 3S2DJ 3BR6A 1NTCA 5J1UA 1VI0A 1OCTC 1UG2A 2JA5J 2XB5A 3BTJA 1B72B 5BNGA 2EZHA 3DEWA 5EGOB 3W6VA 2FX0A 3S16J 3HEFA 2VI6A 4M3DA 3BTIA 1BW6A 4DZPA 3HOWJ 3ZQHA 1RKTA 3IV5A 1QRYA 1WI3A 4D7MA 1LE8A 3I4MJ 1Z77A 4M3GA 1JGGA 2LK2A 1HOMA 2W48A 4W97A 4MFEA 1APLC 1IDYA 1HDPA 3BTLA 4A3CJ 2FQ4A 3FIWA 3RZDJ 1U78A 3HDDA 3PO3J 2DMQA 4UUTA 4QTRA 5GPCA 1AKHB 1F43A 3WHCA 1OFCX 2FD5A 2Y9ZA 1B8IB 2YU9J 2HI3A 3Q0VA 1H8AC 3MN2A 3S1RJ 1RESA 2QF7A 3S1QJ 2VKEA 5IPAA 1LFBA 3OOUA 2E2HJ 5EEAA 1IJWC 4QSHA 1YRNA 1GV5A 1Q1VA 3MVPA 4A3KJ 2GLOA 5F08A 1ITYA 5EG0B 3HKZN 5GPAA 2VPRA 2YUSA 3H0GJ 1BL0A 5J1YA 2CU7A 4A3GJ 2B63J 2DA4A 2EZKA 1IV6A 2AO9A 3TW7A 2DN0A 4B3AA 2OF7A 2IBDA 1DU6A 2L7ZA 1TWCJ 5M5XJ 2JMWA 5C4JJ 3A02A 4DW6A 1ZR2A 1WGXA 2E19A 4CYCB 3JRHA 4BY7J 1OJLA 2XPVA 1XG1A 4I6ZA 2DMPA 3QQAA 5E3OA 5EZGA 1K61A 3PO2J 5IP6A 5HODA 1TWFJ 3HOVJ 2GM4A 1GUUA 4FE7A 3LSRA 1Y1VJ 1X58A 3SDGA 3GTGJ 5FKLA 4MFDA 4UUSA 3ZQFA 3GTPJ 3NARA 3ZQLA 1UHSA 2R0QC 2P81A 3HOUJ 2ELKA 2ME0A 3CCYA 4A3JJ 1EF4A 4A3BJ 1VF9A 1P7IA 4BXXJ 2EH3A 3G1LA 3RKQA 3DCFA 1IRZA 3HGYA 2R5YA 2PMZN 4A3FJ 2Y31A 1LFUP 4AYBN 1FIAA 5F0HA 3D1NI 4J19A 3GTQJ 5FLVA 2X6OA 3JR9A 2M0CA 4JX4A 4B4CA 3CQZJ 4V2FA 1BJZA 4A3MJ 1PUFA 2M2EA 1JT6A 5E3MA 1R9TJ 5F27A 1JTYA 4IHXA 4RDUA 4FE4A 2JN6A 1VNDA 4FTHA 1ETKA 1OCPA 2OPTA 2XGEA 2ECBA 5EYRA 5FKMA 5F1JA 1K83J 1S7EA 3HM5A 2Y0SN 2CQQA 3SFIA 1W0TA 3BG5A 2IEKA 2Y9YA 3PM1A 3E7LA 2HOTA 2O7OA 1GDTA 3FISA 5IYDJ 2K9QA 1A5JA 4AUXA 2H1KA 2JA6J 3C2BA 1MH3A 2MGQA 3HGGA 1LE8B 3JRGA 1MSEC 2X9DA 2K9SA 3QPLA 2XGCA 2ID6A 2M8GX 2RAEA 1MH4A 2CJJA 2CUFA 1TWAJ 2IAIA 1X2MA 1MBJA 1P7JA 2NVYJ 2YS9A 4D7NA 1AU7A 2GBYA 3OIOA 4FISA 2R5ZA 1HDDC 4AC0A 1WH5A 1TC3C 2L7MP 2KT0A 2DMUA 1JKOC 2R93J 1TWGJ 3FK6A 4G12A 3A03A 1MSFC 5C4XJ 1ETXA 1I50J 1ZR4A 1IG7A 5GP9A 3IH3A 3CMYA 5DTDA 1YRNB 5K7FA 3JRDA 2DMNA 2LR8A 5E3LA 4BBRJ 1F36A 1JKRC 1A6IA 3BR1A 1ENHA 3BT9A 3O8HA 4XK4A 5F0CA 1O4XA 4MIMA 2CUEA 1JUMA 5FLMJ 1MBGA 2NVTJ 4LOCA 1ZK8A 1CQTA 5M3FJ 4I76A 4DZJA 3SJMA 2COBA 3FK7A 4JX6A 4JP0A 5JLWA 1JKPC 5C3EJ 2Y2ZA 2DA2A 5F0FA 5M5YJ 3GTLJ 2EZLA 4D5FA 3G1MA 3JREA 3FKIJ 3BR0A 5IYBJ 4A3IJ 1MBFA 3OSFA 3A01A 2XGDA 2DMTA 5FKNA 3OSGA 4ABZA 5M5WJ 3TP0A 5F04A 9ANTA 4EEFG 2K9NA 1I3QJ 2VKVA 4V2GA 3HOZJ 1MBEA 4DYCA 3K2AA 2MG4A 4UUSB 1JTXA 3IH2A 3GTMJ 4M3EA 2EZIA 4A3EJ 2XPWA 3NAUA 2LP0A 4S0HB 3LSJA 2ZB9A 4IEJA 4IHYA 2TRTA 4Y52J 2NVQJ 1TWHJ 2JJ7A 3JRFA 1Y1WJ 3BR5A 3TW6A 2EBIA 1U9OA 2WV1A 2R5YB 1GVDA 2HQ5A 2DA6A 1H89C 2JA7J 3S15J 3HOXJ 4IHWA 5IOYA 2XB0X 1RKWA 3GTOJ 4HNVA 1JUSA 1SANA 2HOSA 1FTZA 1PUFB 4C3HJ 1WCMJ 1NK3P 1UMQA 2MSYA 1HF0A 2DTZA 3JRBA 5IYCJ 3MKLA 4B1RA 2JWTA 3RQIA 4M3BA 1FEXA 2HYJA 1U8BA 2NS8A 2XRLA 4X1EA 2DJNA 4FCYA 3TP3A 4XIDA 3LNQA 3B6CA 1QPIA 1ZGWA 1JKQC 3O8GA 2DA7A 3ZQGA 1XS9A 2TCTA 1WH7A 2L9RA 2HXIA 1B72A 2L0KA 4NDLA 2LVSA 3BQYA 2R92J 5DS9A 1RR7A 5EGOA 4D5CA 3LSGA 3I4NJ 3S1NJ 3ZQIA 1VFCA 2NVXJ 3G1OA 3Q0WA 3JRCA 4X6AJ 1BA5A 3JRIA 3CDLA 2XSDC 5J1RA 4XRSG 4MLOA 3GBGA 4A69C 1QVUA 5M3MJ 1D5YA 2O9LA 2E1OA 2G0EA 5EDNA 1IGNA 1ZQ3P 4JYKA 1SFOJ 1RPWA 3BR2A 1XC5A 4M6VA 1T56A 2LFBA 3K7AJ 2R5ZB 4JX5A 4QIWN 1G2HA 2WAQN 3BTCA 2K40A 3ZQCA 4MO7A 2ECCA 1ORKA 2QCOA 2JK3A 5EZHA 3LOCA 1MBHA 4Y7NJ 4DYQA 4BY1J 3M4OJ 3S2HJ 5JLXA 1AKHA 4DYRA 1U9NA 5C44J 3Q0UA 2HDDA 3JRAA 1B8IA 4XRMA 3M3YJ 1T33A 2CQXA 2M9HA 5IP9J 2LKXA 2LLKA 3UKGA 1DU0A 3H3VK 3S1MJ 1I6HJ 2N8GA 2XPUA 4L5EA 1IC8A 1MBKA 2DA3A 5E3NA 2WB1N 1MNMC 5EG0A 3BR3A 1ETOA 3QPSA 4W1UA 1JJ8C 3RZOJ 2ME6A 4A3LJ 5FKOA 1HCRA 2L7FP 2MW8A 5K7HA 1GV2A 2R7ZJ 3HOYJ 1GT0C 1HLVA 1POGA 2KDZA 1ETQA 1RETA 1FJLA 3A01B 2NOGA 4C3JJ 4CYCA 3HB9A 4XRSA 4A3DJ 1H88C 2CRGA 2DA1A 5EF6A 1JT0A 1WPKA 3WHBA 4GFBA 2LD5A 2LTPA 4XICA 3S17J 2O8KA 3VPRA 2M34A 1JJ6C 2HOAA 3F0CA 4A93J 5FJ8J 1FIPA 3GTKJ 2X48A 4IHVA 1NK2P 1ETVA 1W0UA 1X2NA 3L1PA
chains in the Genus database with same CATH superfamily
2D5VA 3S3NA 1ZKGA 2JA8J 1MMNA 2JUGA 1K79A 1BW5A 1Z0XA 1FWZA 1EKEA 3BQZA 4XORA 4ZC3A 4U7BA 5IOZA 3TEDA 5IP7J 2E2JJ 2Y30A 5J3LA 1YOVB 1U5TA 3BG3A 2H8RA 2WB1A 1WJ5A 1HW2A 1A35A 2ETHA 4L5IA 4XLCA 1FP2A 3L2UA 4ESJA 4C3IJ 1R1TA 2CW0F 4BHCA 1WKMA 5DUKA 3SQNA 5CVRA 4F91B 3LSPA 1FX7A 4DGWB 4DIQA 4ZYDA 1WHUA 1VQ7I 4TV7A 5FLXK 3D5SC 5HNFA 3EDPA 4M3FA 2BY0A 2DA5A 4NC7A 2OQRA 2PI0A 3LSHA 4G6DA 1RRJA 3KCCA 2EIJH 5CVUA 5BMZA 2QYOA 3BTJA 4A2UA 3C18A 3CMMA 3LAPA 4HAMA 2DFFA 2HVSA 5BNGA 2EZHA 2XDVA 3ABMH 5EGOB 3RKYA 3PFIA 1FOYA 3JAMZ 3OYIA 2HEOA 1BR2A 2VI6A 2CH0A 1P9QC 4II2A 1KQ0A 4M3DA 4CO8A 2X1EA 4F52A 3MKZA 3ZQHA 2E7XA 2FU4A 4I09A 2LC2A 4D7MA 1LE8A 2CQ7A 1ZG3A 4CCKA 4WXHA 4M3GA 3WTXC 3SFZA 3TOBA 2ZCWA 4ZDLA 3NEUA 1XX5A 2FQ4A 3BC8A 4L5JA 4QPOA 2RVCA 2DU9A 3C7JA 4PJLA 2FNPA 2LF7A 3WHCA 2DQLA 3E0JB 5EEHA 2FSWA 4F7ZA 2Y9ZA 3G6EI 2NVUB 1K6YA 1O7LA 3Q9SA 2HI3A 1RESA 2VJ4A 3S1QJ 3ZN1A 2VKEA 4FQGA 2PJRB 4IHSA 3FF5A 1IJWC 1U5TC 2K85A 3HSFA 2LY1A 1GV5A 3KEQA 1H9TA 1IO2A 1OCRH 2VOPA 3ECHA 4A3KJ 1U2WA 1HSJA 5F08A 2HZDA 2ZJRF 5JR3A 3LA3A 3CCRI 2VPRA 3FMSA 3H0GJ 4XOTA 2O03A 1VQ4I 3Q5FA 1IV6A 3MZYA 2EFNA 3W2WA 4PJMA 3C2GA 2HR3A 5AONA 2OTJI 1X1DA 3A02A 4DW6A 1RUNA 2ICWG 2E19A 2L9SA 1B4AA 3JRHA 3J7AY 3I71A 4I6ZA 1SD5A 5J4YA 1YW8A 4C2TA 2WY7Q 1K61A 1ZN2A 3QWLA 5GAGJ 3PO2J 4Q48A 4XN0A 3TO7A 3HIFA 3I56I 2MH9A 3COAC 4HDUA 1V3FA 3FKJA 2VE8A 1Y1VJ 1X58A 3GTGJ 2E60A 4MFDA 2B9SA 2JUCA 3GTPJ 3NARA 2RGVA 3ZQLA 2QM3A 1USSA 1UHSA 3WU2C 3ZMSA 3HOUJ 2P81A 4UNOA 2A3SA 3PNTA 3IRRA 1EF4A 1VF9A 1U6GA 2EV5A 3DCFA 2ZFWA 2BV6A 1IRZA 2RC4A 5HNHA 4A3FJ 1LFUP 5B1AH 1WSUA 1FIAA 1UB9A 3H1CA 3L2CA 2BXZA 4OIPF 5CVVA 5DD8A 3I54A 3RKXA 1T95A 3F9KA 3HKZA 2W25A 3HC7A 2FOWA 3L2VA 2A05A 4KYWA 3SZPA 2RKHA 4Z2YA 3D0SA 1R9TJ 1P4WA 2D2WA 2GAUA 1WVRA 1J09A 1BI3A 2PEXA 3SEQA 3KYCB 4FE4A 2JN6A 4FTHA 2C6YA 1HSTA 5FKMA 5F1JA 4Y3OA 2M1BA 3HM5A 1PP7U 5D5XB 1EV7A 2P7VB 3SFIA 2DXIA 1S7AA 4CYDA 2OBPA 3KP5A 3E7LA 2HOTA 3CCQI 1K6OA 2X1CA 2KLOA 2LKSA 3M7GA 1R49A 2Q1ZB 2VLAA 1A5JA 1T39A 2A5YB 3H9GA 4B8XA 1LJ9A 1SMYF 5DM7F 4ZJZA 3GFIA 3HRSA 4AUXA 4LFUA 1WZ2A 3C2BA 1ZGAA 2XAGA 1WJFA 1HKSA 2G9WA 2MGQA 4LMYA 3K0LA 1DP7P 2X9DA 2K9SA 3OIQA 3CZ6A 4FHTA 3TO6A 1MH4A 5LBQA 2KKOA 2V6CA 3EUKL 2M7BA 2PMZA 4CXFA 4CCLA 5HS7A 2YS9A 2GBYA 4E6KG 1HDDC 3CTAA 4IVNA 3IC7A 2KT0A 1I3AA 1MMGA 2DMUA 2DFEA 2YR2A 2CMPA 2IS2A 3CJRB 2EWNA 2GIVA 1JKOC 3VODA 2GIZA 1KQ8A 3FK6A 3QAHA 2DT5A 1UCRA 1OR7C 5ILSA 3BJOA 3W6KB 1ZR4A 3E3VA 3CP2A 4P9FA 2M3AA 3OL4A 3J7YJ 1YRNB 3W2VA 3S3OA 5E3LA 4BBRJ 1W5TA 4CHUA 4E7HA 3CESA 1N25A 2Y0SA 1A6IA 2IA1A 1YITI 2QVOA 1MW7A 2E36A 3BT9A 4XK4A 5F0CA 1K78A 2CUEA 2HQRA 1MBGA 2VC1A 4EV0A 4FX4A 2DJIA 4LOCA 5HLHA 3HPHA 4RB1A 3HXLA 2COBA 4JX6A 1MGTA 5JLWA 1DQUA 3ASNH 4HQMA 4B3XA 2JQ7A 4HV5A 5LGTA 2CV2A 4B48A 2A69F 4GCVA 3FXOA 1TQMA 3ONQA 1ZG1A 3FZVA 4HV6A 4IF4A 3BR0A 3ULQB 5HS9A 3V7CA 2VONA 4MEYF 5ICCA 3A01A 2KIMA 4PFPA 5LRRA 1G8XA 3OSGA 5EEGA 4ABZA 5M5WJ 1TNTA 3O3KA 5F04A 4B09A 1T0FC 2K9NA 2Q2EB 3WU1B 3CCJI 4RS8A 4F92B 4Q5SF 3PSIA 2XPWA 2LP0A 4CUGA 4IZZA 4S0HB 1ERDA 2KQRA 3KEYA 3K2ZA 4IEJA 4EGYA 1S6LA 2BGCA 1VQOI 2WC2A 4IHYA 1FYLA 3CCSI 1TWHJ 3JRFA 2DBBA 1Y1WJ 1VQNI 2EBIA 2H27A 1PVEA 3S15J 4O5VA 1Z3YA 5L3GA 4H0EA 2QSFX 4IL6C 1ZAOA 1FYKA 1RIOH 2PQ8A 2KIQA 2VJIA 1JUSA 2HTJA 3K6GA 4IOCF 5FRMA 5B1BH 2V9KA 3X2QH 3LSTA 2MSYA 5J40A 1HF0A 1O7FA 3JRBA 5KVRA 2IP2A 1TL8A 2O5RA 4UXNA 1DPRA 2JWTA 4BXFA 3PUBA 3JTGA 4XLNF 4M3BA 4PJNA 4E7SA 3H5NA 1U8BA 2NS8A 5LEJA 3LQQA 2AXLA 3JW4A 4EATA 4E7KA 2OUMA 3E5QA 4BQOA 1Y0UA 2OAZA 4P96A 2YX4A 3E1SA 2L0KA 2LVSA 2R92J 4IX7A 1PJRA 2DPDA 2KMUA 2DK5A 5EGOA 2FNAA 2IS4A 3WTSC 4U0WA 2LBFB 2COMA 3JRCA 4XLFA 1G6NA 2GOMA 5J1RA 2QENA 3H5AA 2FUG2 4MLOA 1SAUA 2XAQA 3GBGA 1QVUA 1EA3A 2O9LA 5JHUA 2E1OA 2G0EA 4AIHA 1IGNA 1OKRA 1GXQA 1R58A 5LD2C 2CSOA 1Z91A 5DCFA 2X1DA 4QPQA 1XC5A 4M6VA 3ZMDA 1T56A 3BDDA 5AIPA 3CCMI 4A0YA 1VZ0A 2R5ZB 4M71A 2WAQN 1W36C 1IN5A 2WAEA 4GXOA 4N4NB 5EZHA 2L9NA 3ELKA 4RLFA 2JA2A 3T1BA 5BS6A 3S2HJ 4LK1F 1FC3A 3ZP5A 2Z1DA 5KAIC 4DYRA 3BROA 2W1OA 1EJ9A 1OISA 3DKXA 3HUGB 2LKXA 1DU0A 3H3VK 3S1MJ 1KU2A 4KT6A 4HX7A 2PJRA 1R23A 1Z7UA 3BWGA 4ZH4F 2DA3A 4S05A 1ZRDA 2LY2A 3E5UA 1MNMC 2PG4A 2CV1A 3RZOJ 4BHBA 2P0WA 2ME6A 3GLXA 1WJDA 2PMHA 3MWMA 3K4CA 5FKOA 4L9TA 2L7FP 3E97A 3OS1A 5LFAA 1Z21A 4BNCA 1GT0C 4L9JA 5D4RA 2QQAA 4UVBA 3MZ8A 3MAJA 2HOEA 3H3ZA 1ETQA 2LRDA 2NOGA 4C3JJ 5E18F 1T98A 3ECOA 4GGGA 4A3DJ 3GVAA 2CRGA 2DA1A 4M9ZA 3OYFA 5LHHA 4BDYA 1JT0A 4OIQF 4GFBA 3S3MA 5BOXA 2XASA 2LTPA 3S17J 2EILH 2VXDA 4BYYA 3MKWB 3DU5A 4A93J 1XDSA 2X48A 3F72A 1KYWA 1ETVA 1RZ4A 3PQKA 2FA5A 1OMIA 2DTRA 3TQNA 2NYXA 4OAYA 2I10A 1ZTRA 3K1PA 4UV9A 1QZEA 2VN2A 4RBOA 5D5UB 2HXOA 2EQRA 3E5XA 3VWBA 3P9CA 1X1AA 1D1AA 3M1CA 5HLTA 3IKTA 2V9PA 3DBRB 4LLLA 1LDKB 3B6AA 3SEZA 2HDCA 3QOEA 1XGNA 1A04A 2K27A 2E71A 2X4HA 2X0LA 3J81K 1IF1A 2P5LC 1YFHA 2F4OB 4I2OA 2DOAA 4YFXF 4KIBA 2L4MA 1WFXA 3R61A 3HL2A 2WA0A 3FXMA 1JUPA 1J2XA 3F6OA 5L3DA 3WTUC 2E2IJ 2IS1A 4YIIA 1ETYA 3F22A 1IDZA 1OPCA 2OCEA 2NAZA 4BH9A 4ENKA 1QVTA 3GTJJ 3HBLA 1AHDP 1SAXA 1R00A 3L7WA 3S2DJ 1I6XA 4NQWB 1JGSA 1WJAA 2VT2A 4K2EA 2XB5A 2IGNA 5TISC 2F5CA 2JPBA 3V8LA 5D8LB 3DEWA 3DLAA 2EPFA 3W6VA 4KUMA 2CV0A 3S16J 2H1LA 4L18B 2VE9A 3HEFA 3OWTA 3PJRA 2IS6A 4YIFA 1YS6A 1JHHA 2OZUA 2UZKA 4HNTA 5J6XA 2HPMA 1WJEA 2H8WA 2HKXA 4G8XA 4N0BA 4BHPA 4BAYA 2LK2A 2R7RA 1XTAA 4W97A 4MFEA 1APLC 1IDYA 2BYVE 2EFQA 4OIRF 1HDPA 4U7DA 1YJ9I 4A3CJ 1IAWA 1LEAA 3NWTA 1VQ5I 1LB2A 5HVQC 2JZYA 3FXKA 1F43A 1OFCX 2GA1A 1MMSA 1EH8A 5F64A 3DBHB 1B9MA 2YU9J 4AIJA 4KITB 1H8AC 1UJ8A 3G2BA 3NQOA 3S1RJ 1XD7A 5IPAA 4YRVA 1LFBA 4UHTA 1P2FA 2MD0A 2E35A 1YS7A 1YRNA 2JSCA 2AXTC 3D5LA 4JQFA 1XCVA 3OYCA 5TJJA 5E8GA 2GLOA 3B73A 2VJJA 1DPUA 4G9YA 3AFHA 1ZRFA 1MNEA 4R8HA 4XONA 1D5VA 5DYMA 4HPQA 1GVJA 3GEZA 3VFZA 2GZWA 1FLIA 2QSGX 2OQGA 3TW7A 4KICA 5DV5A 4BEHB 3PFYA 3O6BB 3MKYB 3OS2A 2EFWA 3AL0B 5E1XA 2MBFA 2K7LA 5C4JJ 2QA4I 1IXCA 3CUOA 2XPVA 2BVMA 1Z05A 5TGTA 2DMPA 3NWSA 3NRVA 5F6FA 4ETSA 3IKVA 1F4KA 4AIKA 4YFNF 3K1MA 4A5NA 5IP6A 2QUFA 3FXLA 3TOAA 4ESFA 1LKXA 5GAEJ 3VSKA 1IUYA 5FKLA 2AQEA 2Q2EA 2XAUA 2R7QA 4ENMA 1K4SA 1WI9A 1LFPA 2Z16A 2ELKA 1NHAA 4XLPF 2DK8A 1IXSB 4A3JJ 1LUJB 5L3EA 2L01A 4HSTA 1P7IA 4BXXJ 2EH3A 3G1LA 3IP4B 2EFPA 1VQKI 5K5QA 1N75A 5FO5A 1SFKA 2Y31A 4J00A 1O3RA 5F0HA 1MMAA 2XF7A 3BP8A 4NNJA 4BE1A 4LD5A 2R7VA 4GO1A 2HQNA 1MZBA 1W7PB 4YEJA 2ZXWH 1TT0A 2X6OA 3LAJA 1FY7A 2M0MA 1WJCA 1HBXG 2R7WA 1R1UA 5FB2A 4HYEA 2L54A 3F21A 5LEKA 4Y17A 2ZBKA 3WTWC 4IHXA 1P92A 2FEZA 2VT3A 2H09A 1HW1A 4U0YA 2B0LA 1T6SA 4XL9A 3VOEA 1OCPA 4HLYA 1DGRM 2OPTA 2XGEA 2XC7A 4EMSA 3L00A 2KZGA 1S7EA 1Z6TA 5HDKA 3CJNA 3WTVC 2NNYA 2STTA 3BG5A 3PM1A 4UVCA 2LREA 4HSRA 4MQVA 1Z3XA 2O7OA 1GDTA 4V19K 4GYIA 3OIPA 4DNCA 2VKDA 3CMEI 1KU7A 1VTNC 3OYHA 1B6AA 4HBLA 3J80K 4OINF 2LBFA 1LQ1A 1HQCA 5HLIA 2JA6J 3HGGA 3VYUB 4B44A 3OL3A 3QPLA 2PMUA 3QODA 2ID6A 2M8GX 2W24A 3HSEA 5LGUA 4M72A 2H94A 1MJBA 1TT5B 2DOFA 5CLSA 1MBJA 3IWFA 1P7JA 3DQVC 5KCMA 3I64A 2LNBA 4FISA 2R5ZA 3E6CC 1TC3C 3KPHA 2L7MP 2QKMB 4LJZF 3LSMA 4E7JA 3BG6A 4G12A 3A03A 1MSFC 2VXZA 1ETXA 3KFWX 3ZN0A 3HUGA 1W5CC 1IG7A 5GP9A 2GOXB 3W6JB 3DFGA 4CZCA 3KIOA 5JI6A 4HRIA 2E1CA 2LR8A 5FD5A 1V4RA 5ICGA 1IN4A 4C30A 1W7PD 1E0EA 1GHCA 2M87A 5A2QK 1ENHA 2A6TA 5BPDA 3ZQ7A 2EV6A 4MIMA 5FLMJ 4P55A 2R7DA 1EH7A 1A6QA 3K70C 2EB7A 1CQTA 1S72I 4MNUA 3AG4H 3ZMUA 3QRFF 4JP0A 1BI2A 1JKPC 2L02A 3IWZA 2OA4A 1FP1D 2P7CB 4B43A 2RNGA 5M5YJ 5FGMA 3GTLJ 4D5FA 3GZ5A 3F6VA 1O3QA 4LIUA 4CH7A 2BY1A 4HQEA 5IYBJ 5FD6A 1J9IA 2JT1A 2RV8A 2XGDA 2DMTA 2CW7A 2BXYA 1QBJA 9ANTA 2H6BA 4Y4RA 4HW0A 2VKVA 5E17F 2WBMA 2K4JA 3C3WA 2CQKA 3K4MA 3FXRA 2NNNA 2D1HA 1FBQA 5EJCA 1JTXA 3GTMJ 4PSWA 4BS9A 4M3EA 4A3EJ 3E6BA 2CG4A 6PAXA 2EIKH 2TRTA 1OCCH 3PSFA 2NVQJ 1YLFA 2JJ7A 5HDNA 3TW6A 4F55A 1U9OA 1KU3A 2R5YB 3H35A 1B1BA 4U88A 4PFOA 4C2UA 3U9GA 5CPRB 3A4CA 3SZGA 1JXSA 2K3FA 2EK5A 4FX0A 4G7ZF 4HNVA 2HOSA 1PUFB 3PNVA 4C3HJ 1WCMJ 2F5EA 2QQBA 3N4MA 1NK3P 1CGPA 2DTZA 3TDZC 5IYCJ 4XOPA 5L3FA 3HPGA 2FXAA 3RQIA 4Y15A 2F2EA 1FEXA 2DJNA 4IHTA 3IAS2 3TP3A 3UNGC 2VIXA 3O8GA 1KQ9A 4NQWA 3ZQGA 3MFKA 5K5OA 4AIDA 4M73A 2L9RA 3AG2H 3KP2A 1LPQA 3DWLE 3FXUA 3BQYA 2NXNB 4II3A 4PGGA 2CWEA 3LSGA 4I02A 2ZSHB 4Z6YA 4WX9A 1U8RA 1SVMA 2XRNA 3G1OA 3Q0WA 3ROUA 3WGGA 3LSIA 1BA5A 3CDLA 5CYVA 2WTEA 4XRSG 3N97A 3DEEA 4RGSA 4U0VA 3BG7A 3MEXA 3QYFA 1FPQA 4RLQA 3H9QA 3G71I 4ENNA 1BM9A 1ZQ3P 4EM1A 1RPWA 2ELJA 2MC3A 1H0MA 1NG6A 1V55H 2LFBA 1FMWA 3K7AJ 4QIWN 2G7HA 4HG2A 3DKYA 2K40A 3ZQCA 4MO7A 3FMQA 1MJAA 5AIQA 4DBQA 4DYQA 3P9IA 2LG4A 3GYHX 1OLTA 1G4DA 5JLXA 2E1NA 2NRAC 1LVAA 1U9NA 2QGUA 4I7HA 3K4LA 5C44J 3H9JA 1FOKA 1TTYA 4KT5C 4XRMA 3M3YJ 1T33A 2CQXA 2CQNA 2XKPA 1GLNA 2N8GA 5KAFC 5DD4A 2CYYA 3F8CA 4L5EA 5H20A 3OYNA 4P1WA 1IRFA 1XPXA 1PP8F 5E1WA 3J7ZI 2R7SA 3J81Z 5D8KB 2M7AA 2X6WA 4FETA 4HF0A 1OCOH 2OU2A 2JSPA 3WTTC 1FBSA 2BE5F 3BR3A 1VQ8I 2BZTA 2MD5A 4RGUA 4A12A 4A3LJ 3ZMVA 4KN7X 2DFHA 2V6EA 3OR1C 2MW8A 3LQRA 1KONA 5E79C 3LA2A 3JAMK 1O3SA 5CJ9A 4BEHA 3F23A 5DDGA 3CO6C 2MYSA 2YU3A 4PZJA 1RETA 3BJAA 3V7RA 3U2RA 1TQPA 3LFKA 1XSVA 4XSXF 4XRSA 1WPKA 3WHBA 2V79A 4BJ6C 2WAQA 2FBKA 1JHFA 4ITVA 1SFUA 1NH3A 2JVHA 1FT9A 2QZ8A 1Z7LA 4RGXA 3KYLA 3HOTA 3A0BC 2M34A 3EQLF 3VPRA 4BGDA 1QNTA 3DPLC 3CCEI 3F0CA 4L0YB 3H5RA 1FIPA 5J4VA 4IHVA 2YPRA 3LSKA 1LEBA 2Y0MA 2VBXA 3K9TA 2W57A 1UG0A 1YE9A 1G3TA 4IXAA 3ZCOA 2YSRA 1STZA 2XKOA 5CVIA 2CUJA 3ZPLA 3Q3SA 3DTKA 4AD9A 2KRHA 1B59A 4PJ0C 2ID3A 5K7ZA 2E1MB 5B66C 3GFMA 3OYLA 2IA0A 5B3SH 3OMYA 2AHQA 3P5JA 3RCOA 2DW4A 2ZMEA 2RDPA 4A6EA 1XGSA 1E3OC 2LY9A 3WGIA 3ZOBA 2QBYB 4KNYA 2CFXA 2M8EA 1W7PA 1LNWA 3OY9A 5BPIA 1R1VA 4KMUX 4R79A 4BKXA 4OMZA 4C2MJ 3CUQB 1CF7B 2O0YA 4OOIA 4X0GA 4WWCA 2NS7A 4I0AA 1K4TA 3IUOA 4PUSA 1WWXA 2K3PA 4ZTFA 4WXDA 3HTUA 3KLOA 2JPCA 3A2KA 5J1UA 1NTCA 1OCTC 2XSJC 1UG2A 3OV8A 4RAFA 1A31A 3E6DA 2ZSIB 1X4PA 1B72B 3TGNA 2HQAA 4OWRB 3GWZA 3ERED 4EJTA 4ZYEA 4LGWA 2HS5A 1FMVA 4CA0A 2GXBA 3M8JA 3W2AA 3I55I 1X3UA 3BTIA 3AL0C 3CF2A 1BW6A 5FFXA 4ZYAA 2R7TA 2QQ8A 3MCZA 2FRHA 1T08B 1Z77A 2CW8A 1JGGA 5L3BA 3GX4X 1J75A 1BI1A 1X19A 4KISA 2VQHA 2WADA 2W48A 3BPXA 3RQ4A 1MKMA 3SHFA 1OYIA 3BTLA 2ZXHA 1R71A 3F3XA 3FIWA 3ABUA 4HX8A 4LLGF 1U78A 5LRSA 3HDDA 2DMQA 4UUTA 1TQIA 1YI2I 1AKHB 3RI4A 3BCBA 4CGZA 4LB6B 2E34A 1H9GA 2HYFA 3WU0A 3ABTA 3Q0VA 3O2PE 4BDZA 2VQCA 2XF6A 4DQ2A 2E2HJ 2L3DA 3CCUI 5GADJ 4M9SA 1S3JA 1QHGA 3DU6A 3L9FA 4JBAA 4CCJA 4AWXB 1VQMI 1ITYA 2UXXA 4NC6A 5GPAA 1BL0A 2B7EA 3WTYC 5J1YA 2CS3A 1W4MA 1J59A 2CU7A 4A3GJ 2B63J 2DCEA 2ZJ2A 2LMDA 5FLXZ 5CVJA 2DN0A 4B3AA 3CCVI 2UWMA 2IBDA 1ON1A 3F8MA 2Z3YA 2R7OA 3I53A 4CICA 4P5OA 2JMWA 3S93A 5M5XJ 3PQJA 2A61A 2LF8A 5E1ZB 2A07F 1ZR2A 3QYEA 1WGXA 1ZELA 1D1CA 1OJLA 1MJ9A 2CFOA 4Q4ZF 3PNYA 3QQAA 3S8PA 5E3OA 2ESNA 1NG7A 5EZGA 2KIFA 3LFUA 3DPUA 4WF2A 1TBXA 1ZLJA 5HODA 3HOVJ 3HRUA 3VDXA 2GM4A 1GUUA 2XAJA 3LSRA 2UUZA 4EM0B 1R5GA 3SDGA 3VSLA 3QPTA 2WV0A 2IGMA 3C2HA 1FOWA 4N9HA 5JVTA 2EA4A 2I8DA 1J0RA 3RSNA 2R0QC 1FZPB 5K5RA 2ME0A 3L09A 3CCYA 2ESHA 4XR6A 1AOYA 3RKQA 2KDOA 1HA8A 5GTIC 3LA7A 3T8TA 1SVLA 2L2OA 3A1YA 1V5GA 3HGYA 2R5YA 3VYTB 1ZG5A 1FYMA 2ZXJA 4AYBN 4HX4A 3D1NI 4ESBA 4JOMA 4IOAF 1I27A 3F8BA 3OYDA 4J19A 2E7WA 2V1UA 3K1NA 4KDPA 3GTQJ 2CUZA 3R0JA 4F3QA 1ON2A 3HSRA 3CQZJ 4V2FA 1IRGA 5LHIA 1BJZA 4A3MJ 1PUFA 2M2EA 1Y6IA 4N4OB 1D8KA 1JT6A 4AVZA 4IJAA 1IXRC 1J5YA 1JTYA 5BQTA 4KMFA 2TDXA 1Y8RB 4RDUA 1G59A 2A5WA 1R36A 1VNDA 1AA7A 1ETKA 4E7IA 1F1ZA 2XVCA 4LB5A 1K83J 2LKPA 3LMMA 1BOAA 2ELHA 2KHMA 2ISZA 2GXGA 2CQQA 1I1SA 2BVLA 1IN8A 5A2QZ 1ACIA 2EFOA 2STWA 3GLLA 3PUFA 2IEKA 1IW7F 3FISA 1YX3A 4L0ZB 3M07A 1F9NA 5IYDJ 1SFXA 3GFLA 1WRJA 3PIOF 2Y75A 4FT8A 2BW3B 2BOLA 3SDBA 3JSOA 3FBIB 2H1KA 2A6EF 3JRGA 3CC7I 2F5FA 1EH6A 2RQPA 4PK4A 3SZTA 2CUFA 1KZHA 3HJEA 1TWAJ 4YELA 3FHZA 1IN6A 1M1EB 4Y33A 5ICEA 4D7NA 1AU7A 4D1QA 1X4OA 4AC0A 3D5RC 3TBIA 2ZJPF 2R4GA 2HNHA 2HU9A 1UHWA 1MDMB 2DDAA 2F5DA 1R7JA 4IPAA 3R6SA 2KJCA 1MMDA 2A68F 2IJLA 1HC8A 3GMEA 3ISPA 1RI7A 5C4XJ 2KFDA 5H6RA 3KX2A 2VKHA 1V54H 3ABLH 5DTDA 4IRIA 3CD6I 3VB2A 3MZHA 5K7FA 2DMNA 4U87A 4OMYA 4I99C 3VYSB 2P5VA 3J7AO 1P4XA 1W1WE 2W82A 1E3HA 3O8HA 3L2WA 2ZJQF 4NC8A 1JUMA 2LYCA 4IO9F 4YFKF 2NVTJ 2R7FA 1ZK8A 3EETA 4I76A 2O3FA 2WWYA 3FK7A 3TDUC 2O8XA 4MQ9F 2Y2ZA 2HKOA 3AKZA 1QO0D 2DA2A 1PYVA 5F0FA 1S5LC 2EZLA 2VBZA 2ZNZA 2HYGD 3E6MA 3JREA 1E2XA 3FKIJ 5FRNA 5HS8A 4OU0A 2XF5A 3BLYA 5B5EC 2K4BA 1DUXC 3CC4I 3R4KA 1MIJA 2DOEA 1Y56A 5FKNA 3VEPA 2CO5A 3EYIA 2ZKZA 3FXJA 2JVGA 3K10A 5IY5H 2VASA 1I3QJ 2VC0A 1LVKA 4LIVA 1MBEA 2KL4A 4DYCA 2QWWA 2X51A 4UUSB 3IH2A 1OCZH 1FOXA 4G6TB 1YG2A 3EUAA 3CLOA 1Z67A 3ZQQA 4CSWA 1VQ6I 3NAUA 2M4GA 4KIGA 3LSJA 2ZMEB 2ZB9A 3CJTB 3ABKH 2XGXA 4L9NA 2IRFG 2V9VA 2KPMA 4R1HA 2PJPA 4M74A 1B9NA 2J5OA 2WV1A 1KYZA 2DLLA 4XLEA 5JHFA 4MTEA 1H89C 2DO7A 5ILUA 4HOBA 3HOXJ 3V42A 3G3ZA 4ENJA 2XB0X 1YJWI 2QBYA 3GTOJ 2W4SA 1SANA 4BE0A 4RB2C 2BY2A 2DDBA 3AG1H 1T38A 1DGWY 4XN3A 3CMAI 3CUQA 1CF7A 4ZZLA 1N77A 3MKLA 4EGZA 2IA2A 5DUIA 2HFHA 2HYJA 3TKYA 2XRLA 3LNQA 3QOPA 2RNJA 1X3ZB 1BC7C 4IKFA 1ZGWA 4LG0B 1JKQC 4UB6C 2DA7A 3WE2A 4Y13A 3KP4A 1XS9A 3M9AA 5KK1A 2HXIA 1SC7A 4RM2A 1B72A 3OYGA 2DI3A 3CO7C 3CDHA 1HXDA 1LDJA 3ML6A 3SYTA 3CDIA 4BE2A 1RR7A 4E7ZA 2VL8A 3CJQB 2P6SA 2NVXJ 3CC2I 2FE3A 1XCBA 3H3UA 1X1BA 2LSOA 2ADUA 1D5YA 2A6HF 3HYIA 1QA6A 3DTEA 3RIRA 5EDNA 1DDNA 4NHJA 4JYKA 1I39A 3WG9A 1SFOJ 1R4MB 2OV7A 2W84A 4NUBA 4PCQA 4EJWA 4JX5A 1FNNA 1G2HA 5LGNA 1U0JA 4XRFA 2V1XA 2QCOA 2OC6A 1W36D 3MMYB 1MBHA 1S8NA 4BY1J 4KIFA 4EQQA 2Z33A 2FF4A 3QU6A 4ZDOA 2YX7A 1AKHA 1FSHA 3I59B 1IRXA 5H6QA 5LHGA 3RJPA 2FMLA 1SD7A 3JRAA 4PJJA 3L2QA 2E1MC 3UKGA 2M9HA 4P9UA 4EJOA 5IP9J 1I6HJ 3HRTA 4F93B 3JSPA 3BZKA 2FBHA 2XPUA 3ASOH 3WG7H 1IC8A 2XUBA 3IHUA 1Y8QB 3K4NA 1XB4A 4J01A 4A6DA 4BU2A 1BR4A 1C0WA 1J7KA 2K9MA 2WB1N 5D5VB 4JK1X 5CQEA 4LK0F 2R7XA 2HGCA 2ZC2A 4OAZA 5DCMB 1ETOA 1SMTA 3QPSA 4LG3A 4W1UA 4ASNA 1Q1HA 4M6YA 4BJTA 3CUQC 2VB6A 5DEQA 4C9YA 4YG2F 1ZYRF 3ZGKA 1F5TA 4A5MA 5K7HA 2D45A 2KZVA 3HOYJ 4RMNA 2VQLA 3I58A 1POGA 1KA8A 3LL7A 3KETA 1FJLA 3ZRGA 1R22A 3KZIC 4UB8C 1BI0A 2FBIA 2MA3A 3HB9A 4UVAA 1H88C 2E5NA 4ZTJA 5EF6A 3OYAA 3K4BA 1G3WA 3S2WA 1Z6RA 2HTSA 2O8KA 1Y39A 2DT7B 4M6XA 5E20A 4MTDA 5HLGA 1JJ6C 3ZR8X 5FJ8J 3GTKJ 2PX9A 2MC4A 3BOQA 3KP7A 5JFRA 3Q9VA 1Y0NA 2Y48A 3L1PA 3BJ6A 3H0DA 1TZLA 5KHDA 4A0ZA 3IH4A 3GZ6A 1YIJI 3REOA 3BG9A 1ETWA 3OYJA 1SVOA 2DT6A 3HG9A 3RPQA 2IT0A 4M9XA 1IZ1A 5JVGF 1OR7A 4A0XA 2MH2A 1IN7A 2FJ1A 1O3TA 2BHZA 4XSZF 1E17A 1R6RA 1IUFA 5FKKA 3H36A 4XBFA 2VUMJ 4HF2A 2GQQA 1TW3A 1FTTA 4XKVA 3M1EA 4BBSJ 4EVIA 1HW5A 4HF1A 1YIOA 4ZZDA 4ZYGA 1ZREA 3S14J 2JTVA 2M30A 3IL2A 2RN7A 3G73A 2UXNA 3I4PA 4LITA 5F1RA 2RQQA 3MD2A 4N9IA 2DPUA 3BR6A 1QZYA 2R7UA 1VI0A 1OYYA 2JA5J 2MFZA 4HDVA 3RYRA 3U1KA 3RPUD 5L3CA 4RAZA 3DLLF 5IT9K 4H4KC 2Z99A 1UELB 4BJ5C 3KZZA 2FX0A 3DBLB 1Z9CA 1OYWA 3GFJA 3RTRA 5H2FC 3FMRA 1JE8A 1S7OA 4AVPA 2BW3A 4DZPA 3HOWJ 1T0FA 3IV5A 1RKTA 2V26A 1G3SA 2EIMH 1VQLI 3KE2A 1QRYA 1WI3A 3I4MJ 1ODDA 4YIRX 2JRMA 2H6CA 2OD5A 3QU3A 1HOMA 1D3YA 5K1YA 1BBYA 2QLZA 4WXCA 1Z1DA 2DQRA 4AM3A 2X85A 1VQPI 3U1DA 5LLQA 2PBIA 1KGSA 1ONVA 2P8TA 3RZDJ 3PO3J 4QTRA 5GPCA 2EV0A 1MDMA 1WQ2A 3TMOA 2FD5A 3I3LA 1QU3A 1B8IB 2F6CA 2HWVA 3JTHA 3MN2A 1ZLKA 2QF7A 3KP6A 2V1DA 2F4MB 1TNSA 3OOUA 5J8FA 5EEAA 1XMKA 2IGOA 4L9VA 4QSHA 1ULYA 3BCAA 4DJAA 1BIBA 1Q1VA 3LWFA 3MVPA 4G7OF 3GZNB 5J47A 4DBRA 1E3PA 2HPIA 4RM3A 5EG0B 4RB3C 1GXPA 3T0YA 3HKZN 4KA4A 2YUSA 4HZFA 3HHGA 2IW5A 2DA4A 2EZKA 3QP5A 2AO9A 2J5PA 2KRFA 2OF7A 3WODF 5ILVA 1DU6A 1ZGJA 2IVMA 2L7ZA 1TWCJ 4BQNA 2M5WA 4XKBA 3ZXSA 2AS5F 4NB5A 4CCOA 1R5HA 4G94A 2QQ9A 4MGRA 4CYCB 4CZZA 3B02A 4BY7J 1YYVA 2FQ3A 3BY6A 5GAHJ 1XG1A 1DP3A 3FX3A 5ED4A 1SEUA 1JI8A 3OYMA 4QWQA 2XIGA 1SD6A 1YQAA 3KP3A 3OYKA 3DEUA 3EYYA 2KJBA 1TWFJ 4EJUA 1S9HA 4FE7A 3DXJF 4XKWA 3FXQA 4UUSA 3ZQFA 4BL0B 3RDIA 3CLQA 1P6RA 1RNLA 2EINH 3SXYA 1HKQA 4FASD 4A3BJ 4O6JA 2DAOA 4KJZA 1U5TB 2PMZN 2F4IA 3ZMZA 4GDFA 1BR1A 4ON0A 2I5UA 2KRCA 1QQIA 5FLVA 3JR9A 4UV8A 2M0CA 1YW9A 2HVQA 3KLNA 2OCCH 4JX4A 4B4CA 5E3MA 4HEA2 4HA8A 5F27A 3T5XA 1LDDA 3PIPF 2PN6A 2X6XA 2XAHA 5HDGA 5EYRA 2ECBA 3BZCA 3GUDA 1WJBA 1XMAA 4MHGA 1USTA 2L5QA 5ICFA 2K5CA 2BHYA 3A0HC 2Y0SN 4D0PA 4LG0A 4UUVA 1SD4A 1W0TA 2W00A 3I9V2 2Y9YA 4QLCU 1BIAA 1YW7A 3WTZA 4Q47A 2CGPA 3HTSB 1T8IA 1A36A 4IQ4A 2K9QA 3F8NA 4BUPA 4UY8I 1S29A 3FM5A 3JCUC 2RREA 1MH3A 2E5ZA 1LE8B 1X3WB 3FHNA 1MSEC 2K02A 2LDUA 2XGCA 2RAEA 3CCLI 4MEXF 1YX5A 3P9KA 2CJJA 1RC9A 2IAIA 1X2MA 1XSXA 1XMXA 2Z2SB 3QPHA 1ZH5A 2KISA 4AYBA 2NVYJ 5DM6F 3OIOA 3WE3A 2NOJB 1WH5A 2AQFA 3K4JA 4ZDPA 2VQGA 4WK8F 3EPZA 5D4SA 4I98B 3BPVA 3K69A 3TO9A 2QSHX 1T2KA 2VBYA 2R93J 3DKWA 1TWGJ 3I0TA 5IT3A 3P7NA 4DOZA 3EUHA 2ZMEC 5ERIA 2XROA 1P4AA 3I59A 3L2RA 2VPLA 2K9LA 1YTYA 2K86A 1I50J 1UFMA 1L0OC 2WAFA 3IH3A 4B47A 3CMYA 4XLAA 1D1BA 2BEOA 2G7UA 3JRDA 2MLGA 3DPTA 1QZZA 1F36A 3AAFA 3HOSA 3FM3A 3V8KA 1JKRC 3BR1A 1D8JA 4CCMA 1O4XA 2F48A 2ZNYA 2P5KA 3V8JA 1XDUA 1D0XA 3HZJA 2Y69H 2VBWA 5DCMA 5M3FJ 4DZJA 3SJMA 1RR8C 4D9JA 1UZCA 3K4KA 3K70D 4XLHA 4G7HF 3DF8A 2UV1A 2DYSH 3GXOA 3RPUA 5C3EJ 1BOBA 2ZXIA 1OQYA 2ACJA 1N78A 3FBNB 1QPMA 1PDNC 3G1MA 1BJAA 4A3IJ 2QKLB 3QP6A 2FMYA 1MNDA 5D6EA 1MBFA 1V5FA 1D0YA 3OSFA 2VOOA 1XGMA 2JRTA 3OYEA 3R60A 1UHMA 4EM2A 3TP0A 1QGPA 1L3LA 1K7AA 3V4GA 4EEFG 2GWRA 3CF5F 1HKTA 1X1CA 2Q8KA 3J80Z 4V2GA 3HOZJ 2HZTA 1VQ9I 2PFBA 2MLKA 3K2AA 2MG4A 4CCNA 4CDGA 2P6TA 4ZYHA 2D1VA 3N05A 4RGRA 1YO5C 3PL8A 2EZIA 2X6YA 2XV4S 4NBQA 4E7LA 5E8IA 5FFZA 4XQFA 2VODA 4PGHA 5TRDA 4Y52J 2FOKA 3VYRB 3F8FA 3KYDB 3BR5A 2IPQX 1GVDA 3OOPA 2HQ5A 2DA6A 5CKTA 2JA7J 5CQGA 2OJED 4IHWA 2LOOA 2W7NA 5D6FA 3TL4X 4GRIA 3AG3H 5IOYA 1FBUA 1TP4A 3QYBA 4WCGA 1RKWA 2O6GE 1YHQI 2V4JC 1KU9A 3EUHC 1FTZA 4AU7A 1XN7A 2PLYA 1UMQA 2L4AA 3HHHA 2HDWA 3GCMA 4HLXA 3RYPA 3UR3C 4B1RA 3W3CA 4ANJA 3U21A 4I01A 4HNUA 4EJVA 4X1EA 4FCYA 2O61A 4XIDA 1QPIA 3B6CA 1TW2A 4S04A 2L7KA 3ZMTA 1PUEE 1W5SA 2GXAA 2TCTA 1WH7A 3GO5A 4RB0A 3I5UA 1MD0A 4NDLA 1AWCA 2EJRA 5DS9A 2GA2A 1I5ZA 3S32A 3DTIA 5HOOA 1RUOA 4D5CA 4PSXA 3I4NJ 2HVRA 3S1NJ 3ZQIA 2ISYA 1VFCA 4X6AJ 2IGKA 4XKCA 3JRIA 1X1PA 2M45A 4BQQA 2XSDC 2LH9A 1ZARA 2XHKA 3OYBA 4BQAA 4A69C 5M3MJ 4KFCA 3IRQA 1XGOA 2WY8Q 1V5EA 2Z9OA 1FSEA 4G6QA 1I1GA 4I0BA 3BR2A 1TLHB 3OR2C 2MABA 4PDKA 5FROA 4IRHA 3OS0A 1XSDA 3BTCA 3DV8A 3T8RA 2ECCA 1SFEA 1ORKA 2JK3A 5KNLA 3LOCA 1D0ZA 4Y7NJ 4E4HA 3M4OJ 2KIUA 1U3EM 1UAAA 3ESWB 4RA2A 4XNFA 2P4WA 3Q0UA 2HDDA 3GW2A 3G4SI 4E70A 1B8IA 1QHHD 1YJNI 2ZFUA 4O3MA 2Q0OA 3C1DA 2LLKA 5D5WB 3KZYA 3ERMA 2DFIA 1MBKA 3CP8A 4RAYA 1BC8C 5E3NA 2L9VA 1ZHFA 2QEXI 2OTLI 4BXUA 1K78B 2XAFA 1O57A 2OZ6A 1REPC 1R5ID 5EG0A 3IAM2 1ZRCA 2NS0A 4KN4X 2DYRH 4XMYA 4OIOF 2DODA 1JJ8C 4IRGA 3RKWA 4LLNA 4GYGA 2ZO4A 1HCRA 2M4KA 2BY3A 3WGHA 1GV2A 5GTHC 2R7ZJ 1R4NB 1IV8A 3V7SA 3HRMA 1HLVA 2V7FA 2KDZA 3M8FA 3A01B 3FWEA 4CYCA 4RAGA 2W85A 2EA2A 1G3YA 3MQ0A 2VJ5A 2IXSA 2LD5A 1BN5A 4XICA 2BBYA 2V1NA 3FDYA 5IT9Z 2HOAA 2F5VA 3H92A 2Z5UA 3BZ6A 3GF2A 5J8CA 4XM3A 3KEOA 4BACA 1NK2P 1W0UA 4IQJA 3R0AA 2R3SA 1X2NA 3M8EA 2KP6A 3DP7A
chains in the Genus database with same CATH topology
2I10A 2D5VA 1ZTRA 3IH4A 3Q3SA 4RBOA 3BG9A 1ETWA 1ZKGA 2EQRA 2HXOA 2ID3A 5K7ZA 2JA8J 1BW5A 1Z0XA 2AHQA 3BQZA 3B6AA 5IOZA 3TEDA 5IP7J 2E2JJ 2Y30A 1E3OC 5J3LA 2LY9A 3BG3A 2H8RA 3ZOBA 2FJ1A 1IUFA 5FKKA 1JUPA 2VUMJ 4C3IJ 1FTTA 2E2IJ 4BKXA 4BBSJ 1ETYA 4C2MJ 3LSPA 1IDZA 2NS7A 3S14J 1QVTA 3GTJJ 3HBLA 1AHDP 4M3FA 2DA5A 3S2DJ 3BR6A 1NTCA 5J1UA 1VI0A 1OCTC 1UG2A 2JA5J 2XB5A 3BTJA 1B72B 5BNGA 2EZHA 3DEWA 5EGOB 3W6VA 2FX0A 3S16J 3HEFA 2VI6A 4M3DA 3BTIA 1BW6A 4DZPA 3HOWJ 3ZQHA 1RKTA 3IV5A 1QRYA 1WI3A 4D7MA 1LE8A 3I4MJ 1Z77A 4M3GA 1JGGA 2LK2A 1HOMA 2W48A 4W97A 4MFEA 1APLC 1IDYA 1HDPA 3BTLA 4A3CJ 2FQ4A 3FIWA 3RZDJ 1U78A 3HDDA 3PO3J 2DMQA 4UUTA 4QTRA 5GPCA 1AKHB 1F43A 3WHCA 1OFCX 2FD5A 2Y9ZA 1B8IB 2YU9J 2HI3A 3Q0VA 1H8AC 3MN2A 3S1RJ 1RESA 2QF7A 3S1QJ 2VKEA 5IPAA 1LFBA 3OOUA 2E2HJ 5EEAA 1IJWC 4QSHA 1YRNA 1GV5A 1Q1VA 3MVPA 4A3KJ 2GLOA 5F08A 1ITYA 5EG0B 3HKZN 5GPAA 2VPRA 2YUSA 3H0GJ 1BL0A 5J1YA 2CU7A 4A3GJ 2B63J 2DA4A 2EZKA 1IV6A 2AO9A 3TW7A 2DN0A 4B3AA 2OF7A 2IBDA 1DU6A 2L7ZA 1TWCJ 5M5XJ 2JMWA 5C4JJ 3A02A 4DW6A 1ZR2A 1WGXA 2E19A 4CYCB 3JRHA 4BY7J 1OJLA 2XPVA 1XG1A 4I6ZA 2DMPA 3QQAA 5E3OA 5EZGA 1K61A 3PO2J 5IP6A 5HODA 1TWFJ 3HOVJ 2GM4A 1GUUA 4FE7A 3LSRA 1Y1VJ 1X58A 3SDGA 3GTGJ 5FKLA 4MFDA 4UUSA 3ZQFA 3GTPJ 3NARA 3ZQLA 1UHSA 2R0QC 2P81A 3HOUJ 2ELKA 2ME0A 3CCYA 4A3JJ 1EF4A 4A3BJ 1VF9A 1P7IA 4BXXJ 2EH3A 3G1LA 3RKQA 3DCFA 1IRZA 3HGYA 2R5YA 2PMZN 4A3FJ 2Y31A 1LFUP 4AYBN 1FIAA 5F0HA 3D1NI 4J19A 3GTQJ 5FLVA 2X6OA 3JR9A 2M0CA 4JX4A 4B4CA 3CQZJ 4V2FA 1BJZA 4A3MJ 1PUFA 2M2EA 1JT6A 5E3MA 1R9TJ 5F27A 1JTYA 4IHXA 4RDUA 4FE4A 2JN6A 1VNDA 4FTHA 1ETKA 1OCPA 2OPTA 2XGEA 2ECBA 5EYRA 5FKMA 5F1JA 1K83J 1S7EA 3HM5A 2Y0SN 2CQQA 3SFIA 1W0TA 3BG5A 2IEKA 2Y9YA 3PM1A 3E7LA 2HOTA 2O7OA 1GDTA 3FISA 5IYDJ 2K9QA 1A5JA 4AUXA 2H1KA 2JA6J 3C2BA 1MH3A 2MGQA 3HGGA 1LE8B 3JRGA 1MSEC 2X9DA 2K9SA 3QPLA 2XGCA 2ID6A 2M8GX 2RAEA 1MH4A 2CJJA 2CUFA 1TWAJ 2IAIA 1X2MA 1MBJA 1P7JA 2NVYJ 2YS9A 4D7NA 1AU7A 2GBYA 3OIOA 4FISA 2R5ZA 1HDDC 4AC0A 1WH5A 1TC3C 2L7MP 2KT0A 2DMUA 1JKOC 2R93J 1TWGJ 3FK6A 4G12A 3A03A 1MSFC 5C4XJ 1ETXA 1I50J 1ZR4A 1IG7A 5GP9A 3IH3A 3CMYA 5DTDA 1YRNB 5K7FA 3JRDA 2DMNA 2LR8A 5E3LA 4BBRJ 1F36A 1JKRC 1A6IA 3BR1A 1ENHA 3BT9A 3O8HA 4XK4A 5F0CA 1O4XA 4MIMA 2CUEA 1JUMA 5FLMJ 1MBGA 2NVTJ 4LOCA 1ZK8A 1CQTA 5M3FJ 4I76A 4DZJA 3SJMA 2COBA 3FK7A 4JX6A 4JP0A 5JLWA 1JKPC 5C3EJ 2Y2ZA 2DA2A 5F0FA 5M5YJ 3GTLJ 2EZLA 4D5FA 3G1MA 3JREA 3FKIJ 3BR0A 5IYBJ 4A3IJ 1MBFA 3OSFA 3A01A 2XGDA 2DMTA 5FKNA 3OSGA 4ABZA 5M5WJ 3TP0A 5F04A 9ANTA 4EEFG 2K9NA 1I3QJ 2VKVA 4V2GA 3HOZJ 1MBEA 4DYCA 3K2AA 2MG4A 4UUSB 1JTXA 3IH2A 3GTMJ 4M3EA 2EZIA 4A3EJ 2XPWA 3NAUA 2LP0A 4S0HB 3LSJA 2ZB9A 4IEJA 4IHYA 2TRTA 4Y52J 2NVQJ 1TWHJ 2JJ7A 3JRFA 1Y1WJ 3BR5A 3TW6A 2EBIA 1U9OA 2WV1A 2R5YB 1GVDA 2HQ5A 2DA6A 1H89C 2JA7J 3S15J 3HOXJ 4IHWA 5IOYA 2XB0X 1RKWA 3GTOJ 4HNVA 1JUSA 1SANA 2HOSA 1FTZA 1PUFB 4C3HJ 1WCMJ 1NK3P 1UMQA 2MSYA 1HF0A 2DTZA 3JRBA 5IYCJ 3MKLA 4B1RA 2JWTA 3RQIA 4M3BA 1FEXA 2HYJA 1U8BA 2NS8A 2XRLA 4X1EA 2DJNA 4FCYA 3TP3A 4XIDA 3LNQA 3B6CA 1QPIA 1ZGWA 1JKQC 3O8GA 2DA7A 3ZQGA 1XS9A 2TCTA 1WH7A 2L9RA 2HXIA 1B72A 2L0KA 4NDLA 2LVSA 3BQYA 2R92J 5DS9A 1RR7A 5EGOA 4D5CA 3LSGA 3I4NJ 3S1NJ 3ZQIA 1VFCA 2NVXJ 3G1OA 3Q0WA 3JRCA 4X6AJ 1BA5A 3JRIA 3CDLA 2XSDC 5J1RA 4XRSG 4MLOA 3GBGA 4A69C 1QVUA 5M3MJ 1D5YA 2O9LA 2E1OA 2G0EA 5EDNA 1IGNA 1ZQ3P 4JYKA 1SFOJ 1RPWA 3BR2A 1XC5A 4M6VA 1T56A 2LFBA 3K7AJ 2R5ZB 4JX5A 4QIWN 1G2HA 2WAQN 3BTCA 2K40A 3ZQCA 4MO7A 2ECCA 1ORKA 2QCOA 2JK3A 5EZHA 3LOCA 1MBHA 4Y7NJ 4DYQA 4BY1J 3M4OJ 3S2HJ 5JLXA 1AKHA 4DYRA 1U9NA 5C44J 3Q0UA 2HDDA 3JRAA 1B8IA 4XRMA 3M3YJ 1T33A 2CQXA 2M9HA 5IP9J 2LKXA 2LLKA 3UKGA 1DU0A 3H3VK 3S1MJ 1I6HJ 2N8GA 2XPUA 4L5EA 1IC8A 1MBKA 2DA3A 5E3NA 2WB1N 1MNMC 5EG0A 3BR3A 1ETOA 3QPSA 4W1UA 1JJ8C 3RZOJ 2ME6A 4A3LJ 5FKOA 1HCRA 2L7FP 2MW8A 5K7HA 1GV2A 2R7ZJ 3HOYJ 1GT0C 1HLVA 1POGA 2KDZA 1ETQA 1RETA 1FJLA 3A01B 2NOGA 4C3JJ 4CYCA 3HB9A 4XRSA 4A3DJ 1H88C 2CRGA 2DA1A 5EF6A 1JT0A 1WPKA 3WHBA 4GFBA 2LD5A 2LTPA 4XICA 3S17J 2O8KA 3VPRA 2M34A 1JJ6C 2HOAA 3F0CA 4A93J 5FJ8J 1FIPA 3GTKJ 2X48A 4IHVA 1NK2P 1ETVA 1W0UA 1X2NA 3L1PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2I10 A;  2D5V A;  1ZTR A;  3IH4 A;  3Q3S A;  4RBO A;  3BG9 A;  1ETW A;  1ZKG A;  2EQR A;  2HXO A;  2ID3 A;  5K7Z A;  2JA8 J;  1BW5 A;  1Z0X A;  2AHQ A;  3BQZ A;  3B6A A;  5IOZ A;  3TED A;  5IP7 J;  2E2J J;  2Y30 A;  1E3O C;  5J3L A;  2LY9 A;  3BG3 A;  2H8R A;  3ZOB A;  2FJ1 A;  1IUF A;  5FKK A;  1JUP A;  2VUM J;  4C3I J;  1FTT A;  2E2I J;  4BKX A;  4BBS J;  1ETY A;  4C2M J;  3LSP A;  1IDZ A;  2NS7 A;  3S14 J;  1QVT A;  3GTJ J;  3HBL A;  1AHD P;  4M3F A;  2DA5 A;  3S2D J;  3BR6 A;  1NTC A;  5J1U A;  1VI0 A;  1OCT C;  1UG2 A;  2JA5 J;  2XB5 A;  3BTJ A;  1B72 B;  5BNG A;  2EZH A;  3DEW A;  5EGO B;  3W6V A;  2FX0 A;  3S16 J;  3HEF A;  2VI6 A;  4M3D A;  3BTI A;  1BW6 A;  4DZP A;  3HOW J;  3ZQH A;  1RKT A;  3IV5 A;  1QRY A;  1WI3 A;  4D7M A;  1LE8 A;  3I4M J;  1Z77 A;  4M3G A;  1JGG A;  2LK2 A;  1HOM A;  2W48 A;  4W97 A;  4MFE A;  1APL C;  1IDY A;  1HDP A;  3BTL A;  4A3C J;  2FQ4 A;  3FIW A;  3RZD J;  1U78 A;  3HDD A;  3PO3 J;  2DMQ A;  4UUT A;  4QTR A;  5GPC A;  1AKH B;  1F43 A;  3WHC A;  1OFC X;  2FD5 A;  2Y9Z A;  1B8I B;  2YU9 J;  2HI3 A;  3Q0V A;  1H8A C;  3MN2 A;  3S1R J;  1RES A;  2QF7 A;  3S1Q J;  2VKE A;  5IPA A;  1LFB A;  3OOU A;  2E2H J;  5EEA A;  1IJW C;  4QSH A;  1YRN A;  1GV5 A;  1Q1V A;  3MVP A;  4A3K J;  2GLO A;  5F08 A;  1ITY A;  5EG0 B;  3HKZ N;  5GPA A;  2VPR A;  2YUS A;  3H0G J;  1BL0 A;  5J1Y A;  2CU7 A;  4A3G J;  2B63 J;  2DA4 A;  2EZK A;  1IV6 A;  2AO9 A;  3TW7 A;  2DN0 A;  4B3A A;  2OF7 A;  2IBD A;  1DU6 A;  2L7Z A;  1TWC J;  5M5X J;  2JMW A;  5C4J J;  3A02 A;  4DW6 A;  1ZR2 A;  1WGX A;  2E19 A;  4CYC B;  3JRH A;  4BY7 J;  1OJL A;  2XPV A;  1XG1 A;  4I6Z A;  2DMP A;  3QQA A;  5E3O A;  5EZG A;  1K61 A;  3PO2 J;  5IP6 A;  5HOD A;  1TWF J;  3HOV J;  2GM4 A;  1GUU A;  4FE7 A;  3LSR A;  1Y1V J;  1X58 A;  3SDG A;  3GTG J;  5FKL A;  4MFD A;  4UUS A;  3ZQF A;  3GTP J;  3NAR A;  3ZQL A;  1UHS A;  2R0Q C;  2P81 A;  3HOU J;  2ELK A;  2ME0 A;  3CCY A;  4A3J J;  1EF4 A;  4A3B J;  1VF9 A;  1P7I A;  4BXX J;  2EH3 A;  3G1L A;  3RKQ A;  3DCF A;  1IRZ A;  3HGY A;  2R5Y A;  2PMZ N;  4A3F J;  2Y31 A;  1LFU P;  4AYB N;  1FIA A;  5F0H A;  3D1N I;  4J19 A;  3GTQ J;  5FLV A;  2X6O A;  3JR9 A;  2M0C A;  4JX4 A;  4B4C A;  3CQZ J;  4V2F A;  1BJZ A;  4A3M J;  1PUF A;  2M2E A;  1JT6 A;  5E3M A;  1R9T J;  5F27 A;  1JTY A;  4IHX A;  4RDU A;  4FE4 A;  2JN6 A;  1VND A;  4FTH A;  1ETK A;  1OCP A;  2OPT A;  2XGE A;  2ECB A;  5EYR A;  5FKM A;  5F1J A;  1K83 J;  1S7E A;  3HM5 A;  2Y0S N;  2CQQ A;  3SFI A;  1W0T A;  3BG5 A;  2IEK A;  2Y9Y A;  3PM1 A;  3E7L A;  2HOT A;  2O7O A;  1GDT A;  3FIS A;  5IYD J;  2K9Q A;  1A5J A;  4AUX A;  2H1K A;  2JA6 J;  3C2B A;  1MH3 A;  2MGQ A;  3HGG A;  1LE8 B;  3JRG A;  1MSE C;  2X9D A;  2K9S A;  3QPL A;  2XGC A;  2ID6 A;  2M8G X;  2RAE A;  1MH4 A;  2CJJ A;  2CUF A;  1TWA J;  2IAI A;  1X2M A;  1MBJ A;  1P7J A;  2NVY J;  2YS9 A;  4D7N A;  1AU7 A;  2GBY A;  3OIO A;  4FIS A;  2R5Z A;  1HDD C;  4AC0 A;  1WH5 A;  1TC3 C;  2L7M P;  2KT0 A;  2DMU A;  1JKO C;  2R93 J;  1TWG J;  3FK6 A;  4G12 A;  3A03 A;  1MSF C;  5C4X J;  1ETX A;  1I50 J;  1ZR4 A;  1IG7 A;  5GP9 A;  3IH3 A;  3CMY A;  5DTD A;  1YRN B;  5K7F A;  3JRD A;  2DMN A;  2LR8 A;  5E3L A;  4BBR J;  1F36 A;  1JKR C;  1A6I A;  3BR1 A;  1ENH A;  3BT9 A;  3O8H A;  4XK4 A;  5F0C A;  1O4X A;  4MIM A;  2CUE A;  1JUM A;  5FLM J;  1MBG A;  2NVT J;  4LOC A;  1ZK8 A;  1CQT A;  5M3F J;  4I76 A;  4DZJ A;  3SJM A;  2COB A;  3FK7 A;  4JX6 A;  4JP0 A;  5JLW A;  1JKP C;  5C3E J;  2Y2Z A;  2DA2 A;  5F0F A;  5M5Y J;  3GTL J;  2EZL A;  4D5F A;  3G1M A;  3JRE A;  3FKI J;  3BR0 A;  5IYB J;  4A3I J;  1MBF A;  3OSF A;  3A01 A;  2XGD A;  2DMT A;  5FKN A;  3OSG A;  4ABZ A;  5M5W J;  3TP0 A;  5F04 A;  9ANT A;  4EEF G;  2K9N A;  1I3Q J;  2VKV A;  4V2G A;  3HOZ J;  1MBE A;  4DYC A;  3K2A A;  2MG4 A;  4UUS B;  1JTX A;  3IH2 A;  3GTM J;  4M3E A;  2EZI A;  4A3E J;  2XPW A;  3NAU A;  2LP0 A;  4S0H B;  3LSJ A;  2ZB9 A;  4IEJ A;  4IHY A;  2TRT A;  4Y52 J;  2NVQ J;  1TWH J;  2JJ7 A;  3JRF A;  1Y1W J;  3BR5 A;  3TW6 A;  2EBI A;  1U9O A;  2WV1 A;  2R5Y B;  1GVD A;  2HQ5 A;  2DA6 A;  1H89 C;  2JA7 J;  3S15 J;  3HOX J;  4IHW A;  5IOY A;  2XB0 X;  1RKW A;  3GTO J;  4HNV A;  1JUS A;  1SAN A;  2HOS A;  1FTZ A;  1PUF B;  4C3H J;  1WCM J;  1NK3 P;  1UMQ A;  2MSY A;  1HF0 A;  2DTZ A;  3JRB A;  5IYC J;  3MKL A;  4B1R A;  2JWT A;  3RQI A;  4M3B A;  1FEX A;  2HYJ A;  1U8B A;  2NS8 A;  2XRL A;  4X1E A;  2DJN A;  4FCY A;  3TP3 A;  4XID A;  3LNQ A;  3B6C A;  1QPI A;  1ZGW A;  1JKQ C;  3O8G A;  2DA7 A;  3ZQG A;  1XS9 A;  2TCT A;  1WH7 A;  2L9R A;  2HXI A;  1B72 A;  2L0K A;  4NDL A;  2LVS A;  3BQY A;  2R92 J;  5DS9 A;  1RR7 A;  5EGO A;  4D5C A;  3LSG A;  3I4N J;  3S1N J;  3ZQI A;  1VFC A;  2NVX J;  3G1O A;  3Q0W A;  3JRC A;  4X6A J;  1BA5 A;  3JRI A;  3CDL A;  2XSD C;  5J1R A;  4XRS G;  4MLO A;  3GBG A;  4A69 C;  1QVU A;  5M3M J;  1D5Y A;  2O9L A;  2E1O A;  2G0E A;  5EDN A;  1IGN A;  1ZQ3 P;  4JYK A;  1SFO J;  1RPW A;  3BR2 A;  1XC5 A;  4M6V A;  1T56 A;  2LFB A;  3K7A J;  2R5Z B;  4JX5 A;  4QIW N;  1G2H A;  2WAQ N;  3BTC A;  2K40 A;  3ZQC A;  4MO7 A;  2ECC A;  1ORK A;  2QCO A;  2JK3 A;  5EZH A;  3LOC A;  1MBH A;  4Y7N J;  4DYQ A;  4BY1 J;  3M4O J;  3S2H J;  5JLX A;  1AKH A;  4DYR A;  1U9N A;  5C44 J;  3Q0U A;  2HDD A;  3JRA A;  1B8I A;  4XRM A;  3M3Y J;  1T33 A;  2CQX A;  2M9H A;  5IP9 J;  2LKX A;  2LLK A;  3UKG A;  1DU0 A;  3H3V K;  3S1M J;  1I6H J;  2N8G A;  2XPU A;  4L5E A;  1IC8 A;  1MBK A;  2DA3 A;  5E3N A;  2WB1 N;  1MNM C;  5EG0 A;  3BR3 A;  1ETO A;  3QPS A;  4W1U A;  1JJ8 C;  3RZO J;  2ME6 A;  4A3L J;  5FKO A;  1HCR A;  2L7F P;  2MW8 A;  5K7H A;  1GV2 A;  2R7Z J;  3HOY J;  1GT0 C;  1HLV A;  1POG A;  2KDZ A;  1ETQ A;  1RET A;  1FJL A;  3A01 B;  2NOG A;  4C3J J;  4CYC A;  3HB9 A;  4XRS A;  4A3D J;  1H88 C;  2CRG A;  2DA1 A;  5EF6 A;  1JT0 A;  1WPK A;  3WHB A;  4GFB A;  2LD5 A;  2LTP A;  4XIC A;  3S17 J;  2O8K A;  3VPR A;  2M34 A;  1JJ6 C;  2HOA A;  3F0C A;  4A93 J;  5FJ8 J;  1FIP A;  3GTK J;  2X48 A;  4IHV A;  1NK2 P;  1ETV A;  1W0U A;  1X2N A;  3L1P A; 
#chains in the Genus database with same CATH topology
 2D5V A;  3S3N A;  1ZKG A;  2JA8 J;  1MMN A;  2JUG A;  1K79 A;  1BW5 A;  1Z0X A;  1FWZ A;  1EKE A;  3BQZ A;  4XOR A;  4ZC3 A;  4U7B A;  5IOZ A;  3TED A;  5IP7 J;  2E2J J;  2Y30 A;  5J3L A;  1YOV B;  1U5T A;  3BG3 A;  2H8R A;  2WB1 A;  1WJ5 A;  1HW2 A;  1A35 A;  2ETH A;  4L5I A;  4XLC A;  1FP2 A;  3L2U A;  4ESJ A;  4C3I J;  1R1T A;  2CW0 F;  4BHC A;  1WKM A;  5DUK A;  3SQN A;  5CVR A;  4F91 B;  3LSP A;  1FX7 A;  4DGW B;  4DIQ A;  4ZYD A;  1WHU A;  1VQ7 I;  4TV7 A;  5FLX K;  3D5S C;  5HNF A;  3EDP A;  4M3F A;  2BY0 A;  2DA5 A;  4NC7 A;  2OQR A;  2PI0 A;  3LSH A;  4G6D A;  1RRJ A;  3KCC A;  2EIJ H;  5CVU A;  5BMZ A;  2QYO A;  3BTJ A;  4A2U A;  3C18 A;  3CMM A;  3LAP A;  4HAM A;  2DFF A;  2HVS A;  5BNG A;  2EZH A;  2XDV A;  3ABM H;  5EGO B;  3RKY A;  3PFI A;  1FOY A;  3JAM Z;  3OYI A;  2HEO A;  1BR2 A;  2VI6 A;  2CH0 A;  1P9Q C;  4II2 A;  1KQ0 A;  4M3D A;  4CO8 A;  2X1E A;  4F52 A;  3MKZ A;  3ZQH A;  2E7X A;  2FU4 A;  4I09 A;  2LC2 A;  4D7M A;  1LE8 A;  2CQ7 A;  1ZG3 A;  4CCK A;  4WXH A;  4M3G A;  3WTX C;  3SFZ A;  3TOB A;  2ZCW A;  4ZDL A;  3NEU A;  1XX5 A;  2FQ4 A;  3BC8 A;  4L5J A;  4QPO A;  2RVC A;  2DU9 A;  3C7J A;  4PJL A;  2FNP A;  2LF7 A;  3WHC A;  2DQL A;  3E0J B;  5EEH A;  2FSW A;  4F7Z A;  2Y9Z A;  3G6E I;  2NVU B;  1K6Y A;  1O7L A;  3Q9S A;  2HI3 A;  1RES A;  2VJ4 A;  3S1Q J;  3ZN1 A;  2VKE A;  4FQG A;  2PJR B;  4IHS A;  3FF5 A;  1IJW C;  1U5T C;  2K85 A;  3HSF A;  2LY1 A;  1GV5 A;  3KEQ A;  1H9T A;  1IO2 A;  1OCR H;  2VOP A;  3ECH A;  4A3K J;  1U2W A;  1HSJ A;  5F08 A;  2HZD A;  2ZJR F;  5JR3 A;  3LA3 A;  3CCR I;  2VPR A;  3FMS A;  3H0G J;  4XOT A;  2O03 A;  1VQ4 I;  3Q5F A;  1IV6 A;  3MZY A;  2EFN A;  3W2W A;  4PJM A;  3C2G A;  2HR3 A;  5AON A;  2OTJ I;  1X1D A;  3A02 A;  4DW6 A;  1RUN A;  2ICW G;  2E19 A;  2L9S A;  1B4A A;  3JRH A;  3J7A Y;  3I71 A;  4I6Z A;  1SD5 A;  5J4Y A;  1YW8 A;  4C2T A;  2WY7 Q;  1K61 A;  1ZN2 A;  3QWL A;  5GAG J;  3PO2 J;  4Q48 A;  4XN0 A;  3TO7 A;  3HIF A;  3I56 I;  2MH9 A;  3COA C;  4HDU A;  1V3F A;  3FKJ A;  2VE8 A;  1Y1V J;  1X58 A;  3GTG J;  2E60 A;  4MFD A;  2B9S A;  2JUC A;  3GTP J;  3NAR A;  2RGV A;  3ZQL A;  2QM3 A;  1USS A;  1UHS A;  3WU2 C;  3ZMS A;  3HOU J;  2P81 A;  4UNO A;  2A3S A;  3PNT A;  3IRR A;  1EF4 A;  1VF9 A;  1U6G A;  2EV5 A;  3DCF A;  2ZFW A;  2BV6 A;  1IRZ A;  2RC4 A;  5HNH A;  4A3F J;  1LFU P;  5B1A H;  1WSU A;  1FIA A;  1UB9 A;  3H1C A;  3L2C A;  2BXZ A;  4OIP F;  5CVV A;  5DD8 A;  3I54 A;  3RKX A;  1T95 A;  3F9K A;  3HKZ A;  2W25 A;  3HC7 A;  2FOW A;  3L2V A;  2A05 A;  4KYW A;  3SZP A;  2RKH A;  4Z2Y A;  3D0S A;  1R9T J;  1P4W A;  2D2W A;  2GAU A;  1WVR A;  1J09 A;  1BI3 A;  2PEX A;  3SEQ A;  3KYC B;  4FE4 A;  2JN6 A;  4FTH A;  2C6Y A;  1HST A;  5FKM A;  5F1J A;  4Y3O A;  2M1B A;  3HM5 A;  1PP7 U;  5D5X B;  1EV7 A;  2P7V B;  3SFI A;  2DXI A;  1S7A A;  4CYD A;  2OBP A;  3KP5 A;  3E7L A;  2HOT A;  3CCQ I;  1K6O A;  2X1C A;  2KLO A;  2LKS A;  3M7G A;  1R49 A;  2Q1Z B;  2VLA A;  1A5J A;  1T39 A;  2A5Y B;  3H9G A;  4B8X A;  1LJ9 A;  1SMY F;  5DM7 F;  4ZJZ A;  3GFI A;  3HRS A;  4AUX A;  4LFU A;  1WZ2 A;  3C2B A;  1ZGA A;  2XAG A;  1WJF A;  1HKS A;  2G9W A;  2MGQ A;  4LMY A;  3K0L A;  1DP7 P;  2X9D A;  2K9S A;  3OIQ A;  3CZ6 A;  4FHT A;  3TO6 A;  1MH4 A;  5LBQ A;  2KKO A;  2V6C A;  3EUK L;  2M7B A;  2PMZ A;  4CXF A;  4CCL A;  5HS7 A;  2YS9 A;  2GBY A;  4E6K G;  1HDD C;  3CTA A;  4IVN A;  3IC7 A;  2KT0 A;  1I3A A;  1MMG A;  2DMU A;  2DFE A;  2YR2 A;  2CMP A;  2IS2 A;  3CJR B;  2EWN A;  2GIV A;  1JKO C;  3VOD A;  2GIZ A;  1KQ8 A;  3FK6 A;  3QAH A;  2DT5 A;  1UCR A;  1OR7 C;  5ILS A;  3BJO A;  3W6K B;  1ZR4 A;  3E3V A;  3CP2 A;  4P9F A;  2M3A A;  3OL4 A;  3J7Y J;  1YRN B;  3W2V A;  3S3O A;  5E3L A;  4BBR J;  1W5T A;  4CHU A;  4E7H A;  3CES A;  1N25 A;  2Y0S A;  1A6I A;  2IA1 A;  1YIT I;  2QVO A;  1MW7 A;  2E36 A;  3BT9 A;  4XK4 A;  5F0C A;  1K78 A;  2CUE A;  2HQR A;  1MBG A;  2VC1 A;  4EV0 A;  4FX4 A;  2DJI A;  4LOC A;  5HLH A;  3HPH A;  4RB1 A;  3HXL A;  2COB A;  4JX6 A;  1MGT A;  5JLW A;  1DQU A;  3ASN H;  4HQM A;  4B3X A;  2JQ7 A;  4HV5 A;  5LGT A;  2CV2 A;  4B48 A;  2A69 F;  4GCV A;  3FXO A;  1TQM A;  3ONQ A;  1ZG1 A;  3FZV A;  4HV6 A;  4IF4 A;  3BR0 A;  3ULQ B;  5HS9 A;  3V7C A;  2VON A;  4MEY F;  5ICC A;  3A01 A;  2KIM A;  4PFP A;  5LRR A;  1G8X A;  3OSG A;  5EEG A;  4ABZ A;  5M5W J;  1TNT A;  3O3K A;  5F04 A;  4B09 A;  1T0F C;  2K9N A;  2Q2E B;  3WU1 B;  3CCJ I;  4RS8 A;  4F92 B;  4Q5S F;  3PSI A;  2XPW A;  2LP0 A;  4CUG A;  4IZZ A;  4S0H B;  1ERD A;  2KQR A;  3KEY A;  3K2Z A;  4IEJ A;  4EGY A;  1S6L A;  2BGC A;  1VQO I;  2WC2 A;  4IHY A;  1FYL A;  3CCS I;  1TWH J;  3JRF A;  2DBB A;  1Y1W J;  1VQN I;  2EBI A;  2H27 A;  1PVE A;  3S15 J;  4O5V A;  1Z3Y A;  5L3G A;  4H0E A;  2QSF X;  4IL6 C;  1ZAO A;  1FYK A;  1RIO H;  2PQ8 A;  2KIQ A;  2VJI A;  1JUS A;  2HTJ A;  3K6G A;  4IOC F;  5FRM A;  5B1B H;  2V9K A;  3X2Q H;  3LST A;  2MSY A;  5J40 A;  1HF0 A;  1O7F A;  3JRB A;  5KVR A;  2IP2 A;  1TL8 A;  2O5R A;  4UXN A;  1DPR A;  2JWT A;  4BXF A;  3PUB A;  3JTG A;  4XLN F;  4M3B A;  4PJN A;  4E7S A;  3H5N A;  1U8B A;  2NS8 A;  5LEJ A;  3LQQ A;  2AXL A;  3JW4 A;  4EAT A;  4E7K A;  2OUM A;  3E5Q A;  4BQO A;  1Y0U A;  2OAZ A;  4P96 A;  2YX4 A;  3E1S A;  2L0K A;  2LVS A;  2R92 J;  4IX7 A;  1PJR A;  2DPD A;  2KMU A;  2DK5 A;  5EGO A;  2FNA A;  2IS4 A;  3WTS C;  4U0W A;  2LBF B;  2COM A;  3JRC A;  4XLF A;  1G6N A;  2GOM A;  5J1R A;  2QEN A;  3H5A A;  2FUG 2;  4MLO A;  1SAU A;  2XAQ A;  3GBG A;  1QVU A;  1EA3 A;  2O9L A;  5JHU A;  2E1O A;  2G0E A;  4AIH A;  1IGN A;  1OKR A;  1GXQ A;  1R58 A;  5LD2 C;  2CSO A;  1Z91 A;  5DCF A;  2X1D A;  4QPQ A;  1XC5 A;  4M6V A;  3ZMD A;  1T56 A;  3BDD A;  5AIP A;  3CCM I;  4A0Y A;  1VZ0 A;  2R5Z B;  4M71 A;  2WAQ N;  1W36 C;  1IN5 A;  2WAE A;  4GXO A;  4N4N B;  5EZH A;  2L9N A;  3ELK A;  4RLF A;  2JA2 A;  3T1B A;  5BS6 A;  3S2H J;  4LK1 F;  1FC3 A;  3ZP5 A;  2Z1D A;  5KAI C;  4DYR A;  3BRO A;  2W1O A;  1EJ9 A;  1OIS A;  3DKX A;  3HUG B;  2LKX A;  1DU0 A;  3H3V K;  3S1M J;  1KU2 A;  4KT6 A;  4HX7 A;  2PJR A;  1R23 A;  1Z7U A;  3BWG A;  4ZH4 F;  2DA3 A;  4S05 A;  1ZRD A;  2LY2 A;  3E5U A;  1MNM C;  2PG4 A;  2CV1 A;  3RZO J;  4BHB A;  2P0W A;  2ME6 A;  3GLX A;  1WJD A;  2PMH A;  3MWM A;  3K4C A;  5FKO A;  4L9T A;  2L7F P;  3E97 A;  3OS1 A;  5LFA A;  1Z21 A;  4BNC A;  1GT0 C;  4L9J A;  5D4R A;  2QQA A;  4UVB A;  3MZ8 A;  3MAJ A;  2HOE A;  3H3Z A;  1ETQ A;  2LRD A;  2NOG A;  4C3J J;  5E18 F;  1T98 A;  3ECO A;  4GGG A;  4A3D J;  3GVA A;  2CRG A;  2DA1 A;  4M9Z A;  3OYF A;  5LHH A;  4BDY A;  1JT0 A;  4OIQ F;  4GFB A;  3S3M A;  5BOX A;  2XAS A;  2LTP A;  3S17 J;  2EIL H;  2VXD A;  4BYY A;  3MKW B;  3DU5 A;  4A93 J;  1XDS A;  2X48 A;  3F72 A;  1KYW A;  1ETV A;  1RZ4 A;  3PQK A;  2FA5 A;  1OMI A;  2DTR A;  3TQN A;  2NYX A;  4OAY A;  2I10 A;  1ZTR A;  3K1P A;  4UV9 A;  1QZE A;  2VN2 A;  4RBO A;  5D5U B;  2HXO A;  2EQR A;  3E5X A;  3VWB A;  3P9C A;  1X1A A;  1D1A A;  3M1C A;  5HLT A;  3IKT A;  2V9P A;  3DBR B;  4LLL A;  1LDK B;  3B6A A;  3SEZ A;  2HDC A;  3QOE A;  1XGN A;  1A04 A;  2K27 A;  2E71 A;  2X4H A;  2X0L A;  3J81 K;  1IF1 A;  2P5L C;  1YFH A;  2F4O B;  4I2O A;  2DOA A;  4YFX F;  4KIB A;  2L4M A;  1WFX A;  3R61 A;  3HL2 A;  2WA0 A;  3FXM A;  1JUP A;  1J2X A;  3F6O A;  5L3D A;  3WTU C;  2E2I J;  2IS1 A;  4YII A;  1ETY A;  3F22 A;  1IDZ A;  1OPC A;  2OCE A;  2NAZ A;  4BH9 A;  4ENK A;  1QVT A;  3GTJ J;  3HBL A;  1AHD P;  1SAX A;  1R00 A;  3L7W A;  3S2D J;  1I6X A;  4NQW B;  1JGS A;  1WJA A;  2VT2 A;  4K2E A;  2XB5 A;  2IGN A;  5TIS C;  2F5C A;  2JPB A;  3V8L A;  5D8L B;  3DEW A;  3DLA A;  2EPF A;  3W6V A;  4KUM A;  2CV0 A;  3S16 J;  2H1L A;  4L18 B;  2VE9 A;  3HEF A;  3OWT A;  3PJR A;  2IS6 A;  4YIF A;  1YS6 A;  1JHH A;  2OZU A;  2UZK A;  4HNT A;  5J6X A;  2HPM A;  1WJE A;  2H8W A;  2HKX A;  4G8X A;  4N0B A;  4BHP A;  4BAY A;  2LK2 A;  2R7R A;  1XTA A;  4W97 A;  4MFE A;  1APL C;  1IDY A;  2BYV E;  2EFQ A;  4OIR F;  1HDP A;  4U7D A;  1YJ9 I;  4A3C J;  1IAW A;  1LEA A;  3NWT A;  1VQ5 I;  1LB2 A;  5HVQ C;  2JZY A;  3FXK A;  1F43 A;  1OFC X;  2GA1 A;  1MMS A;  1EH8 A;  5F64 A;  3DBH B;  1B9M A;  2YU9 J;  4AIJ A;  4KIT B;  1H8A C;  1UJ8 A;  3G2B A;  3NQO A;  3S1R J;  1XD7 A;  5IPA A;  4YRV A;  1LFB A;  4UHT A;  1P2F A;  2MD0 A;  2E35 A;  1YS7 A;  1YRN A;  2JSC A;  2AXT C;  3D5L A;  4JQF A;  1XCV A;  3OYC A;  5TJJ A;  5E8G A;  2GLO A;  3B73 A;  2VJJ A;  1DPU A;  4G9Y A;  3AFH A;  1ZRF A;  1MNE A;  4R8H A;  4XON A;  1D5V A;  5DYM A;  4HPQ A;  1GVJ A;  3GEZ A;  3VFZ A;  2GZW A;  1FLI A;  2QSG X;  2OQG A;  3TW7 A;  4KIC A;  5DV5 A;  4BEH B;  3PFY A;  3O6B B;  3MKY B;  3OS2 A;  2EFW A;  3AL0 B;  5E1X A;  2MBF A;  2K7L A;  5C4J J;  2QA4 I;  1IXC A;  3CUO A;  2XPV A;  2BVM A;  1Z05 A;  5TGT A;  2DMP A;  3NWS A;  3NRV A;  5F6F A;  4ETS A;  3IKV A;  1F4K A;  4AIK A;  4YFN F;  3K1M A;  4A5N A;  5IP6 A;  2QUF A;  3FXL A;  3TOA A;  4ESF A;  1LKX A;  5GAE J;  3VSK A;  1IUY A;  5FKL A;  2AQE A;  2Q2E A;  2XAU A;  2R7Q A;  4ENM A;  1K4S A;  1WI9 A;  1LFP A;  2Z16 A;  2ELK A;  1NHA A;  4XLP F;  2DK8 A;  1IXS B;  4A3J J;  1LUJ B;  5L3E A;  2L01 A;  4HST A;  1P7I A;  4BXX J;  2EH3 A;  3G1L A;  3IP4 B;  2EFP A;  1VQK I;  5K5Q A;  1N75 A;  5FO5 A;  1SFK A;  2Y31 A;  4J00 A;  1O3R A;  5F0H A;  1MMA A;  2XF7 A;  3BP8 A;  4NNJ A;  4BE1 A;  4LD5 A;  2R7V A;  4GO1 A;  2HQN A;  1MZB A;  1W7P B;  4YEJ A;  2ZXW H;  1TT0 A;  2X6O A;  3LAJ A;  1FY7 A;  2M0M A;  1WJC A;  1HBX G;  2R7W A;  1R1U A;  5FB2 A;  4HYE A;  2L54 A;  3F21 A;  5LEK A;  4Y17 A;  2ZBK A;  3WTW C;  4IHX A;  1P92 A;  2FEZ A;  2VT3 A;  2H09 A;  1HW1 A;  4U0Y A;  2B0L A;  1T6S A;  4XL9 A;  3VOE A;  1OCP A;  4HLY A;  1DGR M;  2OPT A;  2XGE A;  2XC7 A;  4EMS A;  3L00 A;  2KZG A;  1S7E A;  1Z6T A;  5HDK A;  3CJN A;  3WTV C;  2NNY A;  2STT A;  3BG5 A;  3PM1 A;  4UVC A;  2LRE A;  4HSR A;  4MQV A;  1Z3X A;  2O7O A;  1GDT A;  4V19 K;  4GYI A;  3OIP A;  4DNC A;  2VKD A;  3CME I;  1KU7 A;  1VTN C;  3OYH A;  1B6A A;  4HBL A;  3J80 K;  4OIN F;  2LBF A;  1LQ1 A;  1HQC A;  5HLI A;  2JA6 J;  3HGG A;  3VYU B;  4B44 A;  3OL3 A;  3QPL A;  2PMU A;  3QOD A;  2ID6 A;  2M8G X;  2W24 A;  3HSE A;  5LGU A;  4M72 A;  2H94 A;  1MJB A;  1TT5 B;  2DOF A;  5CLS A;  1MBJ A;  3IWF A;  1P7J A;  3DQV C;  5KCM A;  3I64 A;  2LNB A;  4FIS A;  2R5Z A;  3E6C C;  1TC3 C;  3KPH A;  2L7M P;  2QKM B;  4LJZ F;  3LSM A;  4E7J A;  3BG6 A;  4G12 A;  3A03 A;  1MSF C;  2VXZ A;  1ETX A;  3KFW X;  3ZN0 A;  3HUG A;  1W5C C;  1IG7 A;  5GP9 A;  2GOX B;  3W6J B;  3DFG A;  4CZC A;  3KIO A;  5JI6 A;  4HRI A;  2E1C A;  2LR8 A;  5FD5 A;  1V4R A;  5ICG A;  1IN4 A;  4C30 A;  1W7P D;  1E0E A;  1GHC A;  2M87 A;  5A2Q K;  1ENH A;  2A6T A;  5BPD A;  3ZQ7 A;  2EV6 A;  4MIM A;  5FLM J;  4P55 A;  2R7D A;  1EH7 A;  1A6Q A;  3K70 C;  2EB7 A;  1CQT A;  1S72 I;  4MNU A;  3AG4 H;  3ZMU A;  3QRF F;  4JP0 A;  1BI2 A;  1JKP C;  2L02 A;  3IWZ A;  2OA4 A;  1FP1 D;  2P7C B;  4B43 A;  2RNG A;  5M5Y J;  5FGM A;  3GTL J;  4D5F A;  3GZ5 A;  3F6V A;  1O3Q A;  4LIU A;  4CH7 A;  2BY1 A;  4HQE A;  5IYB J;  5FD6 A;  1J9I A;  2JT1 A;  2RV8 A;  2XGD A;  2DMT A;  2CW7 A;  2BXY A;  1QBJ A;  9ANT A;  2H6B A;  4Y4R A;  4HW0 A;  2VKV A;  5E17 F;  2WBM A;  2K4J A;  3C3W A;  2CQK A;  3K4M A;  3FXR A;  2NNN A;  2D1H A;  1FBQ A;  5EJC A;  1JTX A;  3GTM J;  4PSW A;  4BS9 A;  4M3E A;  4A3E J;  3E6B A;  2CG4 A;  6PAX A;  2EIK H;  2TRT A;  1OCC H;  3PSF A;  2NVQ J;  1YLF A;  2JJ7 A;  5HDN A;  3TW6 A;  4F55 A;  1U9O A;  1KU3 A;  2R5Y B;  3H35 A;  1B1B A;  4U88 A;  4PFO A;  4C2U A;  3U9G A;  5CPR B;  3A4C A;  3SZG A;  1JXS A;  2K3F A;  2EK5 A;  4FX0 A;  4G7Z F;  4HNV A;  2HOS A;  1PUF B;  3PNV A;  4C3H J;  1WCM J;  2F5E A;  2QQB A;  3N4M A;  1NK3 P;  1CGP A;  2DTZ A;  3TDZ C;  5IYC J;  4XOP A;  5L3F A;  3HPG A;  2FXA A;  3RQI A;  4Y15 A;  2F2E A;  1FEX A;  2DJN A;  4IHT A;  3IAS 2;  3TP3 A;  3UNG C;  2VIX A;  3O8G A;  1KQ9 A;  4NQW A;  3ZQG A;  3MFK A;  5K5O A;  4AID A;  4M73 A;  2L9R A;  3AG2 H;  3KP2 A;  1LPQ A;  3DWL E;  3FXU A;  3BQY A;  2NXN B;  4II3 A;  4PGG A;  2CWE A;  3LSG A;  4I02 A;  2ZSH B;  4Z6Y A;  4WX9 A;  1U8R A;  1SVM A;  2XRN A;  3G1O A;  3Q0W A;  3ROU A;  3WGG A;  3LSI A;  1BA5 A;  3CDL A;  5CYV A;  2WTE A;  4XRS G;  3N97 A;  3DEE A;  4RGS A;  4U0V A;  3BG7 A;  3MEX A;  3QYF A;  1FPQ A;  4RLQ A;  3H9Q A;  3G71 I;  4ENN A;  1BM9 A;  1ZQ3 P;  4EM1 A;  1RPW A;  2ELJ A;  2MC3 A;  1H0M A;  1NG6 A;  1V55 H;  2LFB A;  1FMW A;  3K7A J;  4QIW N;  2G7H A;  4HG2 A;  3DKY A;  2K40 A;  3ZQC A;  4MO7 A;  3FMQ A;  1MJA A;  5AIQ A;  4DBQ A;  4DYQ A;  3P9I A;  2LG4 A;  3GYH X;  1OLT A;  1G4D A;  5JLX A;  2E1N A;  2NRA C;  1LVA A;  1U9N A;  2QGU A;  4I7H A;  3K4L A;  5C44 J;  3H9J A;  1FOK A;  1TTY A;  4KT5 C;  4XRM A;  3M3Y J;  1T33 A;  2CQX A;  2CQN A;  2XKP A;  1GLN A;  2N8G A;  5KAF C;  5DD4 A;  2CYY A;  3F8C A;  4L5E A;  5H20 A;  3OYN A;  4P1W A;  1IRF A;  1XPX A;  1PP8 F;  5E1W A;  3J7Z I;  2R7S A;  3J81 Z;  5D8K B;  2M7A A;  2X6W A;  4FET A;  4HF0 A;  1OCO H;  2OU2 A;  2JSP A;  3WTT C;  1FBS A;  2BE5 F;  3BR3 A;  1VQ8 I;  2BZT A;  2MD5 A;  4RGU A;  4A12 A;  4A3L J;  3ZMV A;  4KN7 X;  2DFH A;  2V6E A;  3OR1 C;  2MW8 A;  3LQR A;  1KON A;  5E79 C;  3LA2 A;  3JAM K;  1O3S A;  5CJ9 A;  4BEH A;  3F23 A;  5DDG A;  3CO6 C;  2MYS A;  2YU3 A;  4PZJ A;  1RET A;  3BJA A;  3V7R A;  3U2R A;  1TQP A;  3LFK A;  1XSV A;  4XSX F;  4XRS A;  1WPK A;  3WHB A;  2V79 A;  4BJ6 C;  2WAQ A;  2FBK A;  1JHF A;  4ITV A;  1SFU A;  1NH3 A;  2JVH A;  1FT9 A;  2QZ8 A;  1Z7L A;  4RGX A;  3KYL A;  3HOT A;  3A0B C;  2M34 A;  3EQL F;  3VPR A;  4BGD A;  1QNT A;  3DPL C;  3CCE I;  3F0C A;  4L0Y B;  3H5R A;  1FIP A;  5J4V A;  4IHV A;  2YPR A;  3LSK A;  1LEB A;  2Y0M A;  2VBX A;  3K9T A;  2W57 A;  1UG0 A;  1YE9 A;  1G3T A;  4IXA A;  3ZCO A;  2YSR A;  1STZ A;  2XKO A;  5CVI A;  2CUJ A;  3ZPL A;  3Q3S A;  3DTK A;  4AD9 A;  2KRH A;  1B59 A;  4PJ0 C;  2ID3 A;  5K7Z A;  2E1M B;  5B66 C;  3GFM A;  3OYL A;  2IA0 A;  5B3S H;  3OMY A;  2AHQ A;  3P5J A;  3RCO A;  2DW4 A;  2ZME A;  2RDP A;  4A6E A;  1XGS A;  1E3O C;  2LY9 A;  3WGI A;  3ZOB A;  2QBY B;  4KNY A;  2CFX A;  2M8E A;  1W7P A;  1LNW A;  3OY9 A;  5BPI A;  1R1V A;  4KMU X;  4R79 A;  4BKX A;  4OMZ A;  4C2M J;  3CUQ B;  1CF7 B;  2O0Y A;  4OOI A;  4X0G A;  4WWC A;  2NS7 A;  4I0A A;  1K4T A;  3IUO A;  4PUS A;  1WWX A;  2K3P A;  4ZTF A;  4WXD A;  3HTU A;  3KLO A;  2JPC A;  3A2K A;  5J1U A;  1NTC A;  1OCT C;  2XSJ C;  1UG2 A;  3OV8 A;  4RAF A;  1A31 A;  3E6D A;  2ZSI B;  1X4P A;  1B72 B;  3TGN A;  2HQA A;  4OWR B;  3GWZ A;  3ERE D;  4EJT A;  4ZYE A;  4LGW A;  2HS5 A;  1FMV A;  4CA0 A;  2GXB A;  3M8J A;  3W2A A;  3I55 I;  1X3U A;  3BTI A;  3AL0 C;  3CF2 A;  1BW6 A;  5FFX A;  4ZYA A;  2R7T A;  2QQ8 A;  3MCZ A;  2FRH A;  1T08 B;  1Z77 A;  2CW8 A;  1JGG A;  5L3B A;  3GX4 X;  1J75 A;  1BI1 A;  1X19 A;  4KIS A;  2VQH A;  2WAD A;  2W48 A;  3BPX A;  3RQ4 A;  1MKM A;  3SHF A;  1OYI A;  3BTL A;  2ZXH A;  1R71 A;  3F3X A;  3FIW A;  3ABU A;  4HX8 A;  4LLG F;  1U78 A;  5LRS A;  3HDD A;  2DMQ A;  4UUT A;  1TQI A;  1YI2 I;  1AKH B;  3RI4 A;  3BCB A;  4CGZ A;  4LB6 B;  2E34 A;  1H9G A;  2HYF A;  3WU0 A;  3ABT A;  3Q0V A;  3O2P E;  4BDZ A;  2VQC A;  2XF6 A;  4DQ2 A;  2E2H J;  2L3D A;  3CCU I;  5GAD J;  4M9S A;  1S3J A;  1QHG A;  3DU6 A;  3L9F A;  4JBA A;  4CCJ A;  4AWX B;  1VQM I;  1ITY A;  2UXX A;  4NC6 A;  5GPA A;  1BL0 A;  2B7E A;  3WTY C;  5J1Y A;  2CS3 A;  1W4M A;  1J59 A;  2CU7 A;  4A3G J;  2B63 J;  2DCE A;  2ZJ2 A;  2LMD A;  5FLX Z;  5CVJ A;  2DN0 A;  4B3A A;  3CCV I;  2UWM A;  2IBD A;  1ON1 A;  3F8M A;  2Z3Y A;  2R7O A;  3I53 A;  4CIC A;  4P5O A;  2JMW A;  3S93 A;  5M5X J;  3PQJ A;  2A61 A;  2LF8 A;  5E1Z B;  2A07 F;  1ZR2 A;  3QYE A;  1WGX A;  1ZEL A;  1D1C A;  1OJL A;  1MJ9 A;  2CFO A;  4Q4Z F;  3PNY A;  3QQA A;  3S8P A;  5E3O A;  2ESN A;  1NG7 A;  5EZG A;  2KIF A;  3LFU A;  3DPU A;  4WF2 A;  1TBX A;  1ZLJ A;  5HOD A;  3HOV J;  3HRU A;  3VDX A;  2GM4 A;  1GUU A;  2XAJ A;  3LSR A;  2UUZ A;  4EM0 B;  1R5G A;  3SDG A;  3VSL A;  3QPT A;  2WV0 A;  2IGM A;  3C2H A;  1FOW A;  4N9H A;  5JVT A;  2EA4 A;  2I8D A;  1J0R A;  3RSN A;  2R0Q C;  1FZP B;  5K5R A;  2ME0 A;  3L09 A;  3CCY A;  2ESH A;  4XR6 A;  1AOY A;  3RKQ A;  2KDO A;  1HA8 A;  5GTI C;  3LA7 A;  3T8T A;  1SVL A;  2L2O A;  3A1Y A;  1V5G A;  3HGY A;  2R5Y A;  3VYT B;  1ZG5 A;  1FYM A;  2ZXJ A;  4AYB N;  4HX4 A;  3D1N I;  4ESB A;  4JOM A;  4IOA F;  1I27 A;  3F8B A;  3OYD A;  4J19 A;  2E7W A;  2V1U A;  3K1N A;  4KDP A;  3GTQ J;  2CUZ A;  3R0J A;  4F3Q A;  1ON2 A;  3HSR A;  3CQZ J;  4V2F A;  1IRG A;  5LHI A;  1BJZ A;  4A3M J;  1PUF A;  2M2E A;  1Y6I A;  4N4O B;  1D8K A;  1JT6 A;  4AVZ A;  4IJA A;  1IXR C;  1J5Y A;  1JTY A;  5BQT A;  4KMF A;  2TDX A;  1Y8R B;  4RDU A;  1G59 A;  2A5W A;  1R36 A;  1VND A;  1AA7 A;  1ETK A;  4E7I A;  1F1Z A;  2XVC A;  4LB5 A;  1K83 J;  2LKP A;  3LMM A;  1BOA A;  2ELH A;  2KHM A;  2ISZ A;  2GXG A;  2CQQ A;  1I1S A;  2BVL A;  1IN8 A;  5A2Q Z;  1ACI A;  2EFO A;  2STW A;  3GLL A;  3PUF A;  2IEK A;  1IW7 F;  3FIS A;  1YX3 A;  4L0Z B;  3M07 A;  1F9N A;  5IYD J;  1SFX A;  3GFL A;  1WRJ A;  3PIO F;  2Y75 A;  4FT8 A;  2BW3 B;  2BOL A;  3SDB A;  3JSO A;  3FBI B;  2H1K A;  2A6E F;  3JRG A;  3CC7 I;  2F5F A;  1EH6 A;  2RQP A;  4PK4 A;  3SZT A;  2CUF A;  1KZH A;  3HJE A;  1TWA J;  4YEL A;  3FHZ A;  1IN6 A;  1M1E B;  4Y33 A;  5ICE A;  4D7N A;  1AU7 A;  4D1Q A;  1X4O A;  4AC0 A;  3D5R C;  3TBI A;  2ZJP F;  2R4G A;  2HNH A;  2HU9 A;  1UHW A;  1MDM B;  2DDA A;  2F5D A;  1R7J A;  4IPA A;  3R6S A;  2KJC A;  1MMD A;  2A68 F;  2IJL A;  1HC8 A;  3GME A;  3ISP A;  1RI7 A;  5C4X J;  2KFD A;  5H6R A;  3KX2 A;  2VKH A;  1V54 H;  3ABL H;  5DTD A;  4IRI A;  3CD6 I;  3VB2 A;  3MZH A;  5K7F A;  2DMN A;  4U87 A;  4OMY A;  4I99 C;  3VYS B;  2P5V A;  3J7A O;  1P4X A;  1W1W E;  2W82 A;  1E3H A;  3O8H A;  3L2W A;  2ZJQ F;  4NC8 A;  1JUM A;  2LYC A;  4IO9 F;  4YFK F;  2NVT J;  2R7F A;  1ZK8 A;  3EET A;  4I76 A;  2O3F A;  2WWY A;  3FK7 A;  3TDU C;  2O8X A;  4MQ9 F;  2Y2Z A;  2HKO A;  3AKZ A;  1QO0 D;  2DA2 A;  1PYV A;  5F0F A;  1S5L C;  2EZL A;  2VBZ A;  2ZNZ A;  2HYG D;  3E6M A;  3JRE A;  1E2X A;  3FKI J;  5FRN A;  5HS8 A;  4OU0 A;  2XF5 A;  3BLY A;  5B5E C;  2K4B A;  1DUX C;  3CC4 I;  3R4K A;  1MIJ A;  2DOE A;  1Y56 A;  5FKN A;  3VEP A;  2CO5 A;  3EYI A;  2ZKZ A;  3FXJ A;  2JVG A;  3K10 A;  5IY5 H;  2VAS A;  1I3Q J;  2VC0 A;  1LVK A;  4LIV A;  1MBE A;  2KL4 A;  4DYC A;  2QWW A;  2X51 A;  4UUS B;  3IH2 A;  1OCZ H;  1FOX A;  4G6T B;  1YG2 A;  3EUA A;  3CLO A;  1Z67 A;  3ZQQ A;  4CSW A;  1VQ6 I;  3NAU A;  2M4G A;  4KIG A;  3LSJ A;  2ZME B;  2ZB9 A;  3CJT B;  3ABK H;  2XGX A;  4L9N A;  2IRF G;  2V9V A;  2KPM A;  4R1H A;  2PJP A;  4M74 A;  1B9N A;  2J5O A;  2WV1 A;  1KYZ A;  2DLL A;  4XLE A;  5JHF A;  4MTE A;  1H89 C;  2DO7 A;  5ILU A;  4HOB A;  3HOX J;  3V42 A;  3G3Z A;  4ENJ A;  2XB0 X;  1YJW I;  2QBY A;  3GTO J;  2W4S A;  1SAN A;  4BE0 A;  4RB2 C;  2BY2 A;  2DDB A;  3AG1 H;  1T38 A;  1DGW Y;  4XN3 A;  3CMA I;  3CUQ A;  1CF7 A;  4ZZL A;  1N77 A;  3MKL A;  4EGZ A;  2IA2 A;  5DUI A;  2HFH A;  2HYJ A;  3TKY A;  2XRL A;  3LNQ A;  3QOP A;  2RNJ A;  1X3Z B;  1BC7 C;  4IKF A;  1ZGW A;  4LG0 B;  1JKQ C;  4UB6 C;  2DA7 A;  3WE2 A;  4Y13 A;  3KP4 A;  1XS9 A;  3M9A A;  5KK1 A;  2HXI A;  1SC7 A;  4RM2 A;  1B72 A;  3OYG A;  2DI3 A;  3CO7 C;  3CDH A;  1HXD A;  1LDJ A;  3ML6 A;  3SYT A;  3CDI A;  4BE2 A;  1RR7 A;  4E7Z A;  2VL8 A;  3CJQ B;  2P6S A;  2NVX J;  3CC2 I;  2FE3 A;  1XCB A;  3H3U A;  1X1B A;  2LSO A;  2ADU A;  1D5Y A;  2A6H F;  3HYI A;  1QA6 A;  3DTE A;  3RIR A;  5EDN A;  1DDN A;  4NHJ A;  4JYK A;  1I39 A;  3WG9 A;  1SFO J;  1R4M B;  2OV7 A;  2W84 A;  4NUB A;  4PCQ A;  4EJW A;  4JX5 A;  1FNN A;  1G2H A;  5LGN A;  1U0J A;  4XRF A;  2V1X A;  2QCO A;  2OC6 A;  1W36 D;  3MMY B;  1MBH A;  1S8N A;  4BY1 J;  4KIF A;  4EQQ A;  2Z33 A;  2FF4 A;  3QU6 A;  4ZDO A;  2YX7 A;  1AKH A;  1FSH A;  3I59 B;  1IRX A;  5H6Q A;  5LHG A;  3RJP A;  2FML A;  1SD7 A;  3JRA A;  4PJJ A;  3L2Q A;  2E1M C;  3UKG A;  2M9H A;  4P9U A;  4EJO A;  5IP9 J;  1I6H J;  3HRT A;  4F93 B;  3JSP A;  3BZK A;  2FBH A;  2XPU A;  3ASO H;  3WG7 H;  1IC8 A;  2XUB A;  3IHU A;  1Y8Q B;  3K4N A;  1XB4 A;  4J01 A;  4A6D A;  4BU2 A;  1BR4 A;  1C0W A;  1J7K A;  2K9M A;  2WB1 N;  5D5V B;  4JK1 X;  5CQE A;  4LK0 F;  2R7X A;  2HGC A;  2ZC2 A;  4OAZ A;  5DCM B;  1ETO A;  1SMT A;  3QPS A;  4LG3 A;  4W1U A;  4ASN A;  1Q1H A;  4M6Y A;  4BJT A;  3CUQ C;  2VB6 A;  5DEQ A;  4C9Y A;  4YG2 F;  1ZYR F;  3ZGK A;  1F5T A;  4A5M A;  5K7H A;  2D45 A;  2KZV A;  3HOY J;  4RMN A;  2VQL A;  3I58 A;  1POG A;  1KA8 A;  3LL7 A;  3KET A;  1FJL A;  3ZRG A;  1R22 A;  3KZI C;  4UB8 C;  1BI0 A;  2FBI A;  2MA3 A;  3HB9 A;  4UVA A;  1H88 C;  2E5N A;  4ZTJ A;  5EF6 A;  3OYA A;  3K4B A;  1G3W A;  3S2W A;  1Z6R A;  2HTS A;  2O8K A;  1Y39 A;  2DT7 B;  4M6X A;  5E20 A;  4MTD A;  5HLG A;  1JJ6 C;  3ZR8 X;  5FJ8 J;  3GTK J;  2PX9 A;  2MC4 A;  3BOQ A;  3KP7 A;  5JFR A;  3Q9V A;  1Y0N A;  2Y48 A;  3L1P A;  3BJ6 A;  3H0D A;  1TZL A;  5KHD A;  4A0Z A;  3IH4 A;  3GZ6 A;  1YIJ I;  3REO A;  3BG9 A;  1ETW A;  3OYJ A;  1SVO A;  2DT6 A;  3HG9 A;  3RPQ A;  2IT0 A;  4M9X A;  1IZ1 A;  5JVG F;  1OR7 A;  4A0X A;  2MH2 A;  1IN7 A;  2FJ1 A;  1O3T A;  2BHZ A;  4XSZ F;  1E17 A;  1R6R A;  1IUF A;  5FKK A;  3H36 A;  4XBF A;  2VUM J;  4HF2 A;  2GQQ A;  1TW3 A;  1FTT A;  4XKV A;  3M1E A;  4BBS J;  4EVI A;  1HW5 A;  4HF1 A;  1YIO A;  4ZZD A;  4ZYG A;  1ZRE A;  3S14 J;  2JTV A;  2M30 A;  3IL2 A;  2RN7 A;  3G73 A;  2UXN A;  3I4P A;  4LIT A;  5F1R A;  2RQQ A;  3MD2 A;  4N9I A;  2DPU A;  3BR6 A;  1QZY A;  2R7U A;  1VI0 A;  1OYY A;  2JA5 J;  2MFZ A;  4HDV A;  3RYR A;  3U1K A;  3RPU D;  5L3C A;  4RAZ A;  3DLL F;  5IT9 K;  4H4K C;  2Z99 A;  1UEL B;  4BJ5 C;  3KZZ A;  2FX0 A;  3DBL B;  1Z9C A;  1OYW A;  3GFJ A;  3RTR A;  5H2F C;  3FMR A;  1JE8 A;  1S7O A;  4AVP A;  2BW3 A;  4DZP A;  3HOW J;  1T0F A;  3IV5 A;  1RKT A;  2V26 A;  1G3S A;  2EIM H;  1VQL I;  3KE2 A;  1QRY A;  1WI3 A;  3I4M J;  1ODD A;  4YIR X;  2JRM A;  2H6C A;  2OD5 A;  3QU3 A;  1HOM A;  1D3Y A;  5K1Y A;  1BBY A;  2QLZ A;  4WXC A;  1Z1D A;  2DQR A;  4AM3 A;  2X85 A;  1VQP I;  3U1D A;  5LLQ A;  2PBI A;  1KGS A;  1ONV A;  2P8T A;  3RZD J;  3PO3 J;  4QTR A;  5GPC A;  2EV0 A;  1MDM A;  1WQ2 A;  3TMO A;  2FD5 A;  3I3L A;  1QU3 A;  1B8I B;  2F6C A;  2HWV A;  3JTH A;  3MN2 A;  1ZLK A;  2QF7 A;  3KP6 A;  2V1D A;  2F4M B;  1TNS A;  3OOU A;  5J8F A;  5EEA A;  1XMK A;  2IGO A;  4L9V A;  4QSH A;  1ULY A;  3BCA A;  4DJA A;  1BIB A;  1Q1V A;  3LWF A;  3MVP A;  4G7O F;  3GZN B;  5J47 A;  4DBR A;  1E3P A;  2HPI A;  4RM3 A;  5EG0 B;  4RB3 C;  1GXP A;  3T0Y A;  3HKZ N;  4KA4 A;  2YUS A;  4HZF A;  3HHG A;  2IW5 A;  2DA4 A;  2EZK A;  3QP5 A;  2AO9 A;  2J5P A;  2KRF A;  2OF7 A;  3WOD F;  5ILV A;  1DU6 A;  1ZGJ A;  2IVM A;  2L7Z A;  1TWC J;  4BQN A;  2M5W A;  4XKB A;  3ZXS A;  2AS5 F;  4NB5 A;  4CCO A;  1R5H A;  4G94 A;  2QQ9 A;  4MGR A;  4CYC B;  4CZZ A;  3B02 A;  4BY7 J;  1YYV A;  2FQ3 A;  3BY6 A;  5GAH J;  1XG1 A;  1DP3 A;  3FX3 A;  5ED4 A;  1SEU A;  1JI8 A;  3OYM A;  4QWQ A;  2XIG A;  1SD6 A;  1YQA A;  3KP3 A;  3OYK A;  3DEU A;  3EYY A;  2KJB A;  1TWF J;  4EJU A;  1S9H A;  4FE7 A;  3DXJ F;  4XKW A;  3FXQ A;  4UUS A;  3ZQF A;  4BL0 B;  3RDI A;  3CLQ A;  1P6R A;  1RNL A;  2EIN H;  3SXY A;  1HKQ A;  4FAS D;  4A3B J;  4O6J A;  2DAO A;  4KJZ A;  1U5T B;  2PMZ N;  2F4I A;  3ZMZ A;  4GDF A;  1BR1 A;  4ON0 A;  2I5U A;  2KRC A;  1QQI A;  5FLV A;  3JR9 A;  4UV8 A;  2M0C A;  1YW9 A;  2HVQ A;  3KLN A;  2OCC H;  4JX4 A;  4B4C A;  5E3M A;  4HEA 2;  4HA8 A;  5F27 A;  3T5X A;  1LDD A;  3PIP F;  2PN6 A;  2X6X A;  2XAH A;  5HDG A;  5EYR A;  2ECB A;  3BZC A;  3GUD A;  1WJB A;  1XMA A;  4MHG A;  1UST A;  2L5Q A;  5ICF A;  2K5C A;  2BHY A;  3A0H C;  2Y0S N;  4D0P A;  4LG0 A;  4UUV A;  1SD4 A;  1W0T A;  2W00 A;  3I9V 2;  2Y9Y A;  4QLC U;  1BIA A;  1YW7 A;  3WTZ A;  4Q47 A;  2CGP A;  3HTS B;  1T8I A;  1A36 A;  4IQ4 A;  2K9Q A;  3F8N A;  4BUP A;  4UY8 I;  1S29 A;  3FM5 A;  3JCU C;  2RRE A;  1MH3 A;  2E5Z A;  1LE8 B;  1X3W B;  3FHN A;  1MSE C;  2K02 A;  2LDU A;  2XGC A;  2RAE A;  3CCL I;  4MEX F;  1YX5 A;  3P9K A;  2CJJ A;  1RC9 A;  2IAI A;  1X2M A;  1XSX A;  1XMX A;  2Z2S B;  3QPH A;  1ZH5 A;  2KIS A;  4AYB A;  2NVY J;  5DM6 F;  3OIO A;  3WE3 A;  2NOJ B;  1WH5 A;  2AQF A;  3K4J A;  4ZDP A;  2VQG A;  4WK8 F;  3EPZ A;  5D4S A;  4I98 B;  3BPV A;  3K69 A;  3TO9 A;  2QSH X;  1T2K A;  2VBY A;  2R93 J;  3DKW A;  1TWG J;  3I0T A;  5IT3 A;  3P7N A;  4DOZ A;  3EUH A;  2ZME C;  5ERI A;  2XRO A;  1P4A A;  3I59 A;  3L2R A;  2VPL A;  2K9L A;  1YTY A;  2K86 A;  1I50 J;  1UFM A;  1L0O C;  2WAF A;  3IH3 A;  4B47 A;  3CMY A;  4XLA A;  1D1B A;  2BEO A;  2G7U A;  3JRD A;  2MLG A;  3DPT A;  1QZZ A;  1F36 A;  3AAF A;  3HOS A;  3FM3 A;  3V8K A;  1JKR C;  3BR1 A;  1D8J A;  4CCM A;  1O4X A;  2F48 A;  2ZNY A;  2P5K A;  3V8J A;  1XDU A;  1D0X A;  3HZJ A;  2Y69 H;  2VBW A;  5DCM A;  5M3F J;  4DZJ A;  3SJM A;  1RR8 C;  4D9J A;  1UZC A;  3K4K A;  3K70 D;  4XLH A;  4G7H F;  3DF8 A;  2UV1 A;  2DYS H;  3GXO A;  3RPU A;  5C3E J;  1BOB A;  2ZXI A;  1OQY A;  2ACJ A;  1N78 A;  3FBN B;  1QPM A;  1PDN C;  3G1M A;  1BJA A;  4A3I J;  2QKL B;  3QP6 A;  2FMY A;  1MND A;  5D6E A;  1MBF A;  1V5F A;  1D0Y A;  3OSF A;  2VOO A;  1XGM A;  2JRT A;  3OYE A;  3R60 A;  1UHM A;  4EM2 A;  3TP0 A;  1QGP A;  1L3L A;  1K7A A;  3V4G A;  4EEF G;  2GWR A;  3CF5 F;  1HKT A;  1X1C A;  2Q8K A;  3J80 Z;  4V2G A;  3HOZ J;  2HZT A;  1VQ9 I;  2PFB A;  2MLK A;  3K2A A;  2MG4 A;  4CCN A;  4CDG A;  2P6T A;  4ZYH A;  2D1V A;  3N05 A;  4RGR A;  1YO5 C;  3PL8 A;  2EZI A;  2X6Y A;  2XV4 S;  4NBQ A;  4E7L A;  5E8I A;  5FFZ A;  4XQF A;  2VOD A;  4PGH A;  5TRD A;  4Y52 J;  2FOK A;  3VYR B;  3F8F A;  3KYD B;  3BR5 A;  2IPQ X;  1GVD A;  3OOP A;  2HQ5 A;  2DA6 A;  5CKT A;  2JA7 J;  5CQG A;  2OJE D;  4IHW A;  2LOO A;  2W7N A;  5D6F A;  3TL4 X;  4GRI A;  3AG3 H;  5IOY A;  1FBU A;  1TP4 A;  3QYB A;  4WCG A;  1RKW A;  2O6G E;  1YHQ I;  2V4J C;  1KU9 A;  3EUH C;  1FTZ A;  4AU7 A;  1XN7 A;  2PLY A;  1UMQ A;  2L4A A;  3HHH A;  2HDW A;  3GCM A;  4HLX A;  3RYP A;  3UR3 C;  4B1R A;  3W3C A;  4ANJ A;  3U21 A;  4I01 A;  4HNU A;  4EJV A;  4X1E A;  4FCY A;  2O61 A;  4XID A;  1QPI A;  3B6C A;  1TW2 A;  4S04 A;  2L7K A;  3ZMT A;  1PUE E;  1W5S A;  2GXA A;  2TCT A;  1WH7 A;  3GO5 A;  4RB0 A;  3I5U A;  1MD0 A;  4NDL A;  1AWC A;  2EJR A;  5DS9 A;  2GA2 A;  1I5Z A;  3S32 A;  3DTI A;  5HOO A;  1RUO A;  4D5C A;  4PSX A;  3I4N J;  2HVR A;  3S1N J;  3ZQI A;  2ISY A;  1VFC A;  4X6A J;  2IGK A;  4XKC A;  3JRI A;  1X1P A;  2M45 A;  4BQQ A;  2XSD C;  2LH9 A;  1ZAR A;  2XHK A;  3OYB A;  4BQA A;  4A69 C;  5M3M J;  4KFC A;  3IRQ A;  1XGO A;  2WY8 Q;  1V5E A;  2Z9O A;  1FSE A;  4G6Q A;  1I1G A;  4I0B A;  3BR2 A;  1TLH B;  3OR2 C;  2MAB A;  4PDK A;  5FRO A;  4IRH A;  3OS0 A;  1XSD A;  3BTC A;  3DV8 A;  3T8R A;  2ECC A;  1SFE A;  1ORK A;  2JK3 A;  5KNL A;  3LOC A;  1D0Z A;  4Y7N J;  4E4H A;  3M4O J;  2KIU A;  1U3E M;  1UAA A;  3ESW B;  4RA2 A;  4XNF A;  2P4W A;  3Q0U A;  2HDD A;  3GW2 A;  3G4S I;  4E70 A;  1B8I A;  1QHH D;  1YJN I;  2ZFU A;  4O3M A;  2Q0O A;  3C1D A;  2LLK A;  5D5W B;  3KZY A;  3ERM A;  2DFI A;  1MBK A;  3CP8 A;  4RAY A;  1BC8 C;  5E3N A;  2L9V A;  1ZHF A;  2QEX I;  2OTL I;  4BXU A;  1K78 B;  2XAF A;  1O57 A;  2OZ6 A;  1REP C;  1R5I D;  5EG0 A;  3IAM 2;  1ZRC A;  2NS0 A;  4KN4 X;  2DYR H;  4XMY A;  4OIO F;  2DOD A;  1JJ8 C;  4IRG A;  3RKW A;  4LLN A;  4GYG A;  2ZO4 A;  1HCR A;  2M4K A;  2BY3 A;  3WGH A;  1GV2 A;  5GTH C;  2R7Z J;  1R4N B;  1IV8 A;  3V7S A;  3HRM A;  1HLV A;  2V7F A;  2KDZ A;  3M8F A;  3A01 B;  3FWE A;  4CYC A;  4RAG A;  2W85 A;  2EA2 A;  1G3Y A;  3MQ0 A;  2VJ5 A;  2IXS A;  2LD5 A;  1BN5 A;  4XIC A;  2BBY A;  2V1N A;  3FDY A;  5IT9 Z;  2HOA A;  2F5V A;  3H92 A;  2Z5U A;  3BZ6 A;  3GF2 A;  5J8C A;  4XM3 A;  3KEO A;  4BAC A;  1NK2 P;  1W0U A;  4IQJ A;  3R0A A;  2R3S A;  1X2N A;  3M8E A;  2KP6 A;  3DP7 A; 
#chains in the Genus database with same CATH homology
 2I10 A;  2D5V A;  1ZTR A;  3IH4 A;  3Q3S A;  4RBO A;  3BG9 A;  1ETW A;  1ZKG A;  2EQR A;  2HXO A;  2ID3 A;  5K7Z A;  2JA8 J;  1BW5 A;  1Z0X A;  2AHQ A;  3BQZ A;  3B6A A;  5IOZ A;  3TED A;  5IP7 J;  2E2J J;  2Y30 A;  1E3O C;  5J3L A;  2LY9 A;  3BG3 A;  2H8R A;  3ZOB A;  2FJ1 A;  1IUF A;  5FKK A;  1JUP A;  2VUM J;  4C3I J;  1FTT A;  2E2I J;  4BKX A;  4BBS J;  1ETY A;  4C2M J;  3LSP A;  1IDZ A;  2NS7 A;  3S14 J;  1QVT A;  3GTJ J;  3HBL A;  1AHD P;  4M3F A;  2DA5 A;  3S2D J;  3BR6 A;  1NTC A;  5J1U A;  1VI0 A;  1OCT C;  1UG2 A;  2JA5 J;  2XB5 A;  3BTJ A;  1B72 B;  5BNG A;  2EZH A;  3DEW A;  5EGO B;  3W6V A;  2FX0 A;  3S16 J;  3HEF A;  2VI6 A;  4M3D A;  3BTI A;  1BW6 A;  4DZP A;  3HOW J;  3ZQH A;  1RKT A;  3IV5 A;  1QRY A;  1WI3 A;  4D7M A;  1LE8 A;  3I4M J;  1Z77 A;  4M3G A;  1JGG A;  2LK2 A;  1HOM A;  2W48 A;  4W97 A;  4MFE A;  1APL C;  1IDY A;  1HDP A;  3BTL A;  4A3C J;  2FQ4 A;  3FIW A;  3RZD J;  1U78 A;  3HDD A;  3PO3 J;  2DMQ A;  4UUT A;  4QTR A;  5GPC A;  1AKH B;  1F43 A;  3WHC A;  1OFC X;  2FD5 A;  2Y9Z A;  1B8I B;  2YU9 J;  2HI3 A;  3Q0V A;  1H8A C;  3MN2 A;  3S1R J;  1RES A;  2QF7 A;  3S1Q J;  2VKE A;  5IPA A;  1LFB A;  3OOU A;  2E2H J;  5EEA A;  1IJW C;  4QSH A;  1YRN A;  1GV5 A;  1Q1V A;  3MVP A;  4A3K J;  2GLO A;  5F08 A;  1ITY A;  5EG0 B;  3HKZ N;  5GPA A;  2VPR A;  2YUS A;  3H0G J;  1BL0 A;  5J1Y A;  2CU7 A;  4A3G J;  2B63 J;  2DA4 A;  2EZK A;  1IV6 A;  2AO9 A;  3TW7 A;  2DN0 A;  4B3A A;  2OF7 A;  2IBD A;  1DU6 A;  2L7Z A;  1TWC J;  5M5X J;  2JMW A;  5C4J J;  3A02 A;  4DW6 A;  1ZR2 A;  1WGX A;  2E19 A;  4CYC B;  3JRH A;  4BY7 J;  1OJL A;  2XPV A;  1XG1 A;  4I6Z A;  2DMP A;  3QQA A;  5E3O A;  5EZG A;  1K61 A;  3PO2 J;  5IP6 A;  5HOD A;  1TWF J;  3HOV J;  2GM4 A;  1GUU A;  4FE7 A;  3LSR A;  1Y1V J;  1X58 A;  3SDG A;  3GTG J;  5FKL A;  4MFD A;  4UUS A;  3ZQF A;  3GTP J;  3NAR A;  3ZQL A;  1UHS A;  2R0Q C;  2P81 A;  3HOU J;  2ELK A;  2ME0 A;  3CCY A;  4A3J J;  1EF4 A;  4A3B J;  1VF9 A;  1P7I A;  4BXX J;  2EH3 A;  3G1L A;  3RKQ A;  3DCF A;  1IRZ A;  3HGY A;  2R5Y A;  2PMZ N;  4A3F J;  2Y31 A;  1LFU P;  4AYB N;  1FIA A;  5F0H A;  3D1N I;  4J19 A;  3GTQ J;  5FLV A;  2X6O A;  3JR9 A;  2M0C A;  4JX4 A;  4B4C A;  3CQZ J;  4V2F A;  1BJZ A;  4A3M J;  1PUF A;  2M2E A;  1JT6 A;  5E3M A;  1R9T J;  5F27 A;  1JTY A;  4IHX A;  4RDU A;  4FE4 A;  2JN6 A;  1VND A;  4FTH A;  1ETK A;  1OCP A;  2OPT A;  2XGE A;  2ECB A;  5EYR A;  5FKM A;  5F1J A;  1K83 J;  1S7E A;  3HM5 A;  2Y0S N;  2CQQ A;  3SFI A;  1W0T A;  3BG5 A;  2IEK A;  2Y9Y A;  3PM1 A;  3E7L A;  2HOT A;  2O7O A;  1GDT A;  3FIS A;  5IYD J;  2K9Q A;  1A5J A;  4AUX A;  2H1K A;  2JA6 J;  3C2B A;  1MH3 A;  2MGQ A;  3HGG A;  1LE8 B;  3JRG A;  1MSE C;  2X9D A;  2K9S A;  3QPL A;  2XGC A;  2ID6 A;  2M8G X;  2RAE A;  1MH4 A;  2CJJ A;  2CUF A;  1TWA J;  2IAI A;  1X2M A;  1MBJ A;  1P7J A;  2NVY J;  2YS9 A;  4D7N A;  1AU7 A;  2GBY A;  3OIO A;  4FIS A;  2R5Z A;  1HDD C;  4AC0 A;  1WH5 A;  1TC3 C;  2L7M P;  2KT0 A;  2DMU A;  1JKO C;  2R93 J;  1TWG J;  3FK6 A;  4G12 A;  3A03 A;  1MSF C;  5C4X J;  1ETX A;  1I50 J;  1ZR4 A;  1IG7 A;  5GP9 A;  3IH3 A;  3CMY A;  5DTD A;  1YRN B;  5K7F A;  3JRD A;  2DMN A;  2LR8 A;  5E3L A;  4BBR J;  1F36 A;  1JKR C;  1A6I A;  3BR1 A;  1ENH A;  3BT9 A;  3O8H A;  4XK4 A;  5F0C A;  1O4X A;  4MIM A;  2CUE A;  1JUM A;  5FLM J;  1MBG A;  2NVT J;  4LOC A;  1ZK8 A;  1CQT A;  5M3F J;  4I76 A;  4DZJ A;  3SJM A;  2COB A;  3FK7 A;  4JX6 A;  4JP0 A;  5JLW A;  1JKP C;  5C3E J;  2Y2Z A;  2DA2 A;  5F0F A;  5M5Y J;  3GTL J;  2EZL A;  4D5F A;  3G1M A;  3JRE A;  3FKI J;  3BR0 A;  5IYB J;  4A3I J;  1MBF A;  3OSF A;  3A01 A;  2XGD A;  2DMT A;  5FKN A;  3OSG A;  4ABZ A;  5M5W J;  3TP0 A;  5F04 A;  9ANT A;  4EEF G;  2K9N A;  1I3Q J;  2VKV A;  4V2G A;  3HOZ J;  1MBE A;  4DYC A;  3K2A A;  2MG4 A;  4UUS B;  1JTX A;  3IH2 A;  3GTM J;  4M3E A;  2EZI A;  4A3E J;  2XPW A;  3NAU A;  2LP0 A;  4S0H B;  3LSJ A;  2ZB9 A;  4IEJ A;  4IHY A;  2TRT A;  4Y52 J;  2NVQ J;  1TWH J;  2JJ7 A;  3JRF A;  1Y1W J;  3BR5 A;  3TW6 A;  2EBI A;  1U9O A;  2WV1 A;  2R5Y B;  1GVD A;  2HQ5 A;  2DA6 A;  1H89 C;  2JA7 J;  3S15 J;  3HOX J;  4IHW A;  5IOY A;  2XB0 X;  1RKW A;  3GTO J;  4HNV A;  1JUS A;  1SAN A;  2HOS A;  1FTZ A;  1PUF B;  4C3H J;  1WCM J;  1NK3 P;  1UMQ A;  2MSY A;  1HF0 A;  2DTZ A;  3JRB A;  5IYC J;  3MKL A;  4B1R A;  2JWT A;  3RQI A;  4M3B A;  1FEX A;  2HYJ A;  1U8B A;  2NS8 A;  2XRL A;  4X1E A;  2DJN A;  4FCY A;  3TP3 A;  4XID A;  3LNQ A;  3B6C A;  1QPI A;  1ZGW A;  1JKQ C;  3O8G A;  2DA7 A;  3ZQG A;  1XS9 A;  2TCT A;  1WH7 A;  2L9R A;  2HXI A;  1B72 A;  2L0K A;  4NDL A;  2LVS A;  3BQY A;  2R92 J;  5DS9 A;  1RR7 A;  5EGO A;  4D5C A;  3LSG A;  3I4N J;  3S1N J;  3ZQI A;  1VFC A;  2NVX J;  3G1O A;  3Q0W A;  3JRC A;  4X6A J;  1BA5 A;  3JRI A;  3CDL A;  2XSD C;  5J1R A;  4XRS G;  4MLO A;  3GBG A;  4A69 C;  1QVU A;  5M3M J;  1D5Y A;  2O9L A;  2E1O A;  2G0E A;  5EDN A;  1IGN A;  1ZQ3 P;  4JYK A;  1SFO J;  1RPW A;  3BR2 A;  1XC5 A;  4M6V A;  1T56 A;  2LFB A;  3K7A J;  2R5Z B;  4JX5 A;  4QIW N;  1G2H A;  2WAQ N;  3BTC A;  2K40 A;  3ZQC A;  4MO7 A;  2ECC A;  1ORK A;  2QCO A;  2JK3 A;  5EZH A;  3LOC A;  1MBH A;  4Y7N J;  4DYQ A;  4BY1 J;  3M4O J;  3S2H J;  5JLX A;  1AKH A;  4DYR A;  1U9N A;  5C44 J;  3Q0U A;  2HDD A;  3JRA A;  1B8I A;  4XRM A;  3M3Y J;  1T33 A;  2CQX A;  2M9H A;  5IP9 J;  2LKX A;  2LLK A;  3UKG A;  1DU0 A;  3H3V K;  3S1M J;  1I6H J;  2N8G A;  2XPU A;  4L5E A;  1IC8 A;  1MBK A;  2DA3 A;  5E3N A;  2WB1 N;  1MNM C;  5EG0 A;  3BR3 A;  1ETO A;  3QPS A;  4W1U A;  1JJ8 C;  3RZO J;  2ME6 A;  4A3L J;  5FKO A;  1HCR A;  2L7F P;  2MW8 A;  5K7H A;  1GV2 A;  2R7Z J;  3HOY J;  1GT0 C;  1HLV A;  1POG A;  2KDZ A;  1ETQ A;  1RET A;  1FJL A;  3A01 B;  2NOG A;  4C3J J;  4CYC A;  3HB9 A;  4XRS A;  4A3D J;  1H88 C;  2CRG A;  2DA1 A;  5EF6 A;  1JT0 A;  1WPK A;  3WHB A;  4GFB A;  2LD5 A;  2LTP A;  4XIC A;  3S17 J;  2O8K A;  3VPR A;  2M34 A;  1JJ6 C;  2HOA A;  3F0C A;  4A93 J;  5FJ8 J;  1FIP A;  3GTK J;  2X48 A;  4IHV A;  1NK2 P;  1ETV A;  1W0U A;  1X2N A;  3L1P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...