3OSJA

X-ray structure of phycobilisome lcm core-membrane linker polypeptide (fragment 254-400) from synechocystis sp. pcc 6803, northeast structural genomics consortium target sgr209c
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
135
structure length
135
Chain Sequence
QKYAMKPGLSALEKNAVIKAAYRQIFERDITKAYSQSISYLESQVRNGDISMKEFVRRLAKSPLYRKQFFEPFINSRALELAFRHILGRGPSSREEVQKYFSIVSSGGLPALVDALVDSQEYADYFGEETVPYLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Phycobilisome LCM core-membrane linker polypeptide
publication title Northeast Structural Genomics Consortium Target SgR209C
rcsb
molecule tags Protein binding
total genus 47
structure length 135
sequence length 135
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-09-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00427 PBS_linker_poly Phycobilisome Linker polypeptide
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.3130.20 Mainly Alpha Orthogonal Bundle serine acetyltransferase, domain 1 serine acetyltransferase, domain 1 3osjA01
2L3WA 3OSJA 2L06A 2L8VA 3PRUA 3NPHB 3OHWA 2KY4A
chains in the Genus database with same CATH superfamily
4HZCA 3OSJA 1SSQA 3PRUA 4N69A 4N6BA 3GVDA 2L8VA 4HZDA 1SSTA 2KY4A 4H7OA 3P47A 2L06A 3P1BA 1S80A 3MC4A 2L3WA 4N6AA 1T3DA 1SSMA 3Q1XA 3NPHB 3OHWA 3F1XA
chains in the Genus database with same CATH topology
4HZCA 3OSJA 1SSQA 3PRUA 4N69A 4N6BA 3GVDA 2L8VA 4HZDA 1SSTA 2KY4A 4H7OA 3P47A 2L06A 3P1BA 1S80A 3MC4A 2L3WA 4N6AA 1T3DA 1SSMA 3Q1XA 3NPHB 3OHWA 3F1XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2L3W A;  3OSJ A;  2L06 A;  2L8V A;  3PRU A;  3NPH B;  3OHW A;  2KY4 A; 
#chains in the Genus database with same CATH topology
 4HZC A;  3OSJ A;  1SSQ A;  3PRU A;  4N69 A;  4N6B A;  3GVD A;  2L8V A;  4HZD A;  1SST A;  2KY4 A;  4H7O A;  3P47 A;  2L06 A;  3P1B A;  1S80 A;  3MC4 A;  2L3W A;  4N6A A;  1T3D A;  1SSM A;  3Q1X A;  3NPH B;  3OHW A;  3F1X A; 
#chains in the Genus database with same CATH homology
 4HZC A;  3OSJ A;  1SSQ A;  3PRU A;  4N69 A;  4N6B A;  3GVD A;  2L8V A;  4HZD A;  1SST A;  2KY4 A;  4H7O A;  3P47 A;  2L06 A;  3P1B A;  1S80 A;  3MC4 A;  2L3W A;  4N6A A;  1T3D A;  1SSM A;  3Q1X A;  3NPH B;  3OHW A;  3F1X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...