3OSSC

The crystal structure of enterotoxigenic escherichia coli gspc-gspd complex from the type ii secretion system
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
65
structure length
65
Chain Sequence
b'ETRLNVVLRGIAFGARPGAVIEEGGKQQVYLQGERLDSHNAVIEEINRDHVMLRYQGKIERLSLA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords TYPE 2 SECRETION SYSTEM, GSPC
publication title Structural and functional studies on the interaction of GspC and GspD in the type II secretion system.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Protein transport
total genus 9
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2010-09-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.830 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3ossC00
2IVWA 3OSSC 2Y4XA 2Y4YA 2LNVA 2LC4A
chains in the Genus database with same CATH superfamily
1K76A 1K8AC 1VQKA 1R0CB 3UWNA 1Q86C 2DTHA 1WA7A 3A8GB 1BCOA 1YJNT 1YITA 4M7DF 1VQ9Q 2QI2A 5GAMd 4OB0B 5CKDA 1ZUKA 3F70A 4O5VA 3CMEA 2QA4A 3M0SA 2YRVA 3X28B 1UEBA 2EYXA 4X9CA 4FCYA 3JCMd 1XQHA 2DBMA 1R77A 2K3YA 3LYIA 5D7UA 3QO3A 4WF2A 4XAXB 2KK4A 4XTWA 2AKKA 4KBMB 1GCPA 1K73C 1VQ7A 1Z9ZA 2X35A 2ZZDA 4N4GA 3JB9J 1VQ4Q 3I35A 4M75G 1VQLQ 4EIKA 2HQXA 3OYNA 1M30A 4KGVB 1QMCA 2O01E 2JVVA 2GQVA 4EMKB 1PSEA 2QAZA 4M78A 5D6WA 2KT1A 2OAUA 3M0QA 2KE9A 4XK8E 1T0HA 5GANh 1V76A 1M90U 4C0DC 3X25B 3JAME 3NGPA 2RQVA 2PQWA 1KQ1A 1EX4A 1NJIR 4FYYB 2LT1A 3DLMA 1LPLA 1UJYA 4QQDA 4RCCA 5C0MA 5GAOn 4M78G 3HP9A 2NUTB 1PD0A 2XIDA 1I8FA 4KH0B 4JJDA 5AYFA 4C0FA 3M4GA 2RI2A 3HL8A 1KG1A 1GXIE 4DEXA 4ZGJB 3OYDA 2MWPA 1RAFB 2RO0A 1JRIA 8AT1B 3I56T 2DNUA 5KYNA 3OS1A 1YIJT 2J06A 3OW2P 1VQNT 3MEVA 1X6GA 5LJ3g 4M75E 3HRTA 4PJOA 1S72T 2K57A 3A8HB 3EHQA 1JQQA 1VQKT 4CC2A 2CKKA 2KYBA 2BZXA 1QVGA 1YITT 2M1HA 3S6WA 1VQ6Q 3CCUQ 1M1GA 2CREA 2D0NA 5KYYA 4J9GA 1PM3A 3VS1A 3OYAA 4PJOG 3CCJA 4C0DB 3CMET 2QA4T 3HPWA 2RHZA 4BI3A 1PCXA 5HCKA 3VS0A 1UHFA 1ZBJA 4PJMA 5KYUB 3CPWS 2MI6A 1Q81R 2COYA 3CCEA 2GNCA 1X2KA 3C94A 4FIBA 3OYIA 4FYVB 4BD3A 1BYMA 4BI8B 1M2OA 1SG5A 4M78F 1KQSA 1ZBXA 2LT4A 1VQ7T 2RD1A 2DRMA 4JJCA 2YUQA 2VYTA 1SHFA 4KULA 2G6FX 3ZFJA 5IHIA 1Q7YR 2LC4A 2L0AA 3L1AA 4DOVA 2DVJA 2QXFA 1YJ9A 4Y92A 1ACMB 4OVAA 3H6ZA 2DBKA 4C8QE 1N8RU 4C0ZA 4F7UA 2ZAEA 2NWMA 2NYSA 4HXJA 5L23A 4XU0A 2DO3A 1YNZA 1K4US 1FWZA 5GAN4 1SPKA 3BW1A 4R55A 1LCKA 1W2BP 1NPRA 5GAOr 3EHRA 4LNPA 4F7UG 2GCXA 5J3BA 3FJ5A 2CZ1B 4PJOF 1T0JA 2MAMA 1KFZA 4B9WA 1G3YA 4FM4B 1WJRA 1MV3A 4RTXA 4J9CA 3HFOA 1XJWB 3L42A 1YN8A 1WX6A 3FRNA 4C92D 3X26B 2CUDA 2FYKA 1QCOA 3M0TA 1YCYA 2RM4A 1KC8U 1H3ZA 2DIQA 2J05A 1BBZA 1CSKA 3D7SB 2VB6A 4QT7A 2CT3A 2DL5A 4Z89A 5GANd 2JMCA 1OU9A 1X01A 1M1KC 4HT8A 4J9FA 1WJSA 4Y28E 1QWEA 5LJ5g 3QDFA 1NPPA 4M7AA 3J7AF 1Y57A 5GAN3 2H8HA 2V8KA 4ATOA 1PWTA 2COWA 2DK3A 3CXCA 3OYMA 3CCJT 4M7AD 2KBTA 3EGDB 2OX7A 5LJ3h 2LDMA 4M77E 4IIMA 1D1BA 5KE3A 4EMKA 4PNOA 2ESWA 1KD1C 5FW9A 1NE8A 1BI3A 1YJWA 2FRWA 3TVTA 2ZPBB 3CCET 1A0NB 4B9XA 2HAXA 1HD3A 3M53A 3GF5A 1D0YA 1SSHA 2CH4W 4OB3B 4F7UF 4IIOA 1MMAA 4PFOA 4ELYC 3DB4A 4J9BA 1RAEB 4E7LA 5GAMe 4FSXA 1UGQB 3BDLA 3RMSA 2K4YA 1NLPC 3SHWA 1M90R 2RMOA 4RTYA 3VS5A 1TG0A 1HK9A 1AWWA 2GQIA 2NUTA 4GY5A 2IVWA 1AT1B 2ZCFB 5FU6C 1YJ9T 5DLQE 3VV0A 2JS0A 4Y91A 2Z0WA 5KCHA 1PHTA 2V8JA 2LX7A 2QQAA 1JU5C 5LJ3j 3OYLA 2DZ9A 2C0IA 2LTOA 1Q82C 1GL5A 3JCMX 4ME7A 5FWCA 2CP2A 4TVRA 2HSEB 3JV3A 4E7SA 4KRTA 4A54A 4OB2B 2HDAA 2F5TX 2EBPA 3PFSA 3HRSA 2FEIA 3UT1A 3CPWP 1GFCA 4EMHA 2PVDB 1H3HA 1VQOA 3INZA 1UGVA 3I5RA 2L3RA 1OI1A 4NS5A 1BI0A 4RKUE 2I0NA 3H9NA 2QQRA 4E7KA 2BZ8A 2RJDA 2KXCA 2D6FA 3LW5E 3GOXA 5DY9A 4E7ZA 1VQ4A 1VQ8Q 1MGQA 5GMKm 1VQLA 4J9EA 2RB6A 1WHHA 2EFIA 4ELZC 5KYUA 3CEYA 2EYWA 1I1JA 3QIIA 1N9SA 1BB9A 4ZTJA 2CP6A 2RQTA 1TWBA 2W0ZA 5GAOq 2CYZB 2KYMA 2X4JA 1N5ZA 5GAMf 4PLIA 2JW4A 5FU6B 3CCSQ 1NBEB 2RJCA 5A0GA 1C6VX 2DPPB 3JCMQ 1MV0B 3CCMQ 2L3PA 4FT4A 3I55Q 5CKHA 2A36A 1VUBA 1YWOA 2RK1A 1NJIU 2QGFB 2FHDA 4E7HA 3T9NA 2EQIA 5HK0A 2QG9B 1YJWT 2O31A 3PMTA 2IPOB 2RQUA 3QKJA 2CUBA 2F2WA 1VQPQ 2LNHB 2DFUA 5LJ5h 2ROLA 2BZYA 1YBYA 1N8RR 3VUBA 3A1PA 5GAMj 4BE1A 1QWFA 2MPXC 3MP6A 1AOJA 3QJ6A 4MDXA 2DX1A 1GBQA 5GAN5 1XNIA 3QUIA 4RMOA 2DJZA 2DEQA 4JJBA 1QVFS 3GIBA 3CC4Q 1QW1A 4ZN1A 4BE2A 1WXTA 1M9SA 5GMKj 2EYYA 2P0PA 3CCUA 2E1HA 3RKWA 1TSFA 2L2PA 4JS4A 4AFSC 3PIPA 1X27A 1U8RA 3CQTA 4LDWA 2ZPEB 4OMPA 1UG1A 5LJ3d 1PD1A 2RH2A 2XK0A 1WQ7A 2MCNA 2DRKA 3LGFA 5LJ5j 3AT1B 1H641 1OULA 5EC7A 1M3BA 2DTIA 2J6FA 2P0KA 2PUOB 2CGHA 1VQOT 4M7DG 3LWHA 4MZTA 2RPNA 1YI2Q 2JS2A 1KQSS 2EW3A 1ARKA 4OMMA 5CAIA 4HKEA 3J81E 2CH4A 1VQ4T 1VQLT 3MKDA 1N6AA 4C92C 4BUGA 3ULRB 1Q7YU 2X3XD 2BE7D 2HZYA 4NOYA 1CKAA 4YTLA 5IHNA 4L59A 1M5Q1 4QQGA 2LMJA 4IUUA 3JCMW 3CCQQ 3KFVA 1TUGB 2YLCA 4BI4A 2NUPB 3BY7A 4MDWA 3OS2A 4II1A 2FRYA 1JJ2A 3MEAA 4C5HA 2ABLA 4M7AC 4O6JA 2K5FA 4J9IA 3EAEA 2DL4A 4J8OA 3VYHB 2M51A 3V8KA 2M02A 2RHXA 2VC8A 3TEEA 4C5IA 4BDYA 2H3JA 5GANe 4EMGA 3JSCA 3FEOA 1OX8A 4OMLA 3SD4A 1N27A 4OF1A 1AEYA 4J6XA 1PSFA 2JM9A 3SDZA 1HYOA 4RTUA 2HL5C 3ZBDA 4ZGDB 3CBPA 3L2ZA 2OTJQ 4OB1B 3CMAQ 4DA4A 4KGZB 2DYBA 2FG0A 1K9MU 1WIEA 4OGCA 4C92B 1WI7A 2R58A 1UECA 2QDLA 4XTUA 1QVPA 3UPUA 3G71A 1BU1A 1AZEA 2PVGB 3QSUA 5L8RE 3EFRA 3CCUT 1KSWA 2E5QA 2HKQB 2LQWA 3QXEB 1D1AA 4MZPA 1BI1A 3RDVA 1RACB 2QQSA 1OEBA 2DYIA 5KYWB 5I11A 1H92A 3CXCS 1ZA2B 2CSQA 4ESRA 3G4SQ 4M7AB 1OPKA 1S1NA 1W6XA 3QYGB 2O88A 1OZ3A 1RAIB 5LJ5d 2GF7A 2QYZA 3V7RA 2LVMA 2QQBA 2M0YA 3BDUA 4M75D 3MO8A 1QP2A 2EGEA 4J7FA 1IGUA 2DTOA 4ZNXA 1IRXA 2RK2A 3HHTB 2W10A 3VRYA 4PJLA 1WJQA 4Z02A 5GANf 4LUEA 3META 2A7YA 2DM1A 1IXDA 1KHCA 2YRDA 5GAOl 4BACA 1VQMA 2LX9A 1HJDA 2KNBB 2DERA 2YHTA 3L2QA 1ZUYA 4B6MA 1X43A 4OGEA 1QVGP 1O75A 1VYTA 3CCRQ 1K9AA 2K9GA 1FMVA 4J6YA 3EG2A 5FU7C 3SFMA 3CCVQ 2DXCA 2GBQA 3HFNA 1FYNA 1IB8A 1PG5B 3P8DA 1QQJA 2E3IA 4XQ3A 1QVFA 5M9OA 2RHUA 2AHJB 1HXDA 3THKA 1TU0B 5GANj 1E6HA 2LJ3A 1UDLA 2J6KA 3PIOA 1KIKA 2K6DA 3KBGA 4C8QD 2J7IA 2X9HA 4JLGA 4EDUA 1YJNQ 1BIAA 2CDTA 2VUBA 4FYWB 3A8OB 2AIRB 1Q81C 4GLKA 1VQ8A 1AD5A 2XDDA 2FZCB 2JNGA 2F1LA 4ORZA 3A8LB 5DM7R 1ZA1B 2V26A 2K2VA 4KUIA 1E7OA 2GTOA 4LDXA 2LJ0A 3CCSA 3G71T 1TS9A 2Y4YA 2V8IA 4DBRA 4OMQA 1TXQA 4M78E 1C0MA 2DD5A 1C1AA 3CCMA 2D9TA 3I55A 4DBHA 2HBPA 2EKOA 1QCNA 4JRKA 3OSVA 5FU7B 1NEGA 3OB9A 1NLOC 2P0QA 1WNLA 2PU9B 3RNJA 4N4HA 1V1CA 2RHIA 3C95A 3EFOB 3MPUB 1M8MA 5CKFA 4NL3A 3ZEHA 2JTFA 1PKTA 4R56A 1VQPA 2NUPA 2MWOA 1Y7XA 4QKUA 2AKLA 5KYXB 3QZ5B 1LNXA 2LQ8A 2YDLA 2E41A 5LJ3e 3HTRA 2PZ1A 1GRIA 1BKBA 1RAAB 4HCCA 4M77A 1OX9A 3G6EA 3CC4A 1GCQC 2EPDA 2YUPA 4HVUA 5HK3A 3V8LA 4M77D 3H0IA 1TUCA 4PJOE 1VQMT 1SEMA 4ZTFA 2D8HA 4J7IA 4AG2C 3GNGA 1W70A 1X75C 2RF0A 3JB9H 2F69A 4X34A 4C92A 1YCSB 5CKBA 1X6OA 4PFZA 2D1XA 1IHWA 5D6YA 1RABB 3M9QA 4QQ6A 2EYZA 1NM7A 2K2MA 5D6XA 1K9MR 3E19A 4A4GA 1YFNA 2CZ7B 4BE0A 3M57A 5DLOA 1YI2A 1S72Q 2VWFA 2E4HA 1D0XA 1KK7A 2JMAA 4R0KA 3AHUA 1Y0MA 4C92G 1VQKQ 4HVVA 3OYHA 2VASA 3H0HA 2DJQA 2AZVA 5KYWA 9ATCB 1YHQA 3SWNC 2EGAA 1VQ8T 3GNFB 5GAN6 2DETA 2FO0A 3GP8A 5AT1B 2CZ0B 4QVCA 2A37A 1AZGB 4ZN3A 3WXMB 1RLQC 4JDSA 4JUVA 3CCQA 3P8HA 5KCOA 1I5OB 3LLRA 1M90C 5LJ3f 5GAN2 1OU8A 3CCST 2OJ2A 2J6OA 4M7AG 3VRZA 5A0LA 2A28A 1K1ZA 2NUZA 4F7UE 5GMKl 2E64A 5EG2A 3QJYA 1OYXA 3CCMT 1RLPC 3ZL7C 3OA6A 3I55T 2VXEA 3JCMJ 3NTIA 1JJ2S 4EPCA 4J5YA 1GBRA 3H8ZA 5C6SA 3A8MB 1G3SA 1W4SA 4LD6A 4E47A 3REAB 3MEUA 4L5GA 1NZ9A 4HT9A 1VA7A 3JCMe 3VS2A 1VQ5Q 1M2VA 4M75C 1VQPT 1JXMA 2L8DA 2D8JA 1WHJA 2K5IA 2E6NA 3C12A 1QKXA 2CT4A 1PC0A 5GMKe 4VUBA 1BCMA 1VQ9A 1F1BB 2OTJA 2BIVA 1PNJA 1U06A 3CMAA 2EAYA 3SWNB 4C92F 4DQ2A 2MIOA 4FL6A 2R57A 2B86A 3G6ET 3CC4T 3M0RA 4NL2A 4OMNA 1K0SA 1B34B 1BI2A 4PFPA 5LJ5e 4V2SA 3PTAA 1RAGB 4E7JA 1ZHIA 3LGLA 1B3QA 2K3XA 1WXUA 4JS5A 2FL7A 4K11A 2M9UA 3R6OA 1G5VA 2B8AA 1M8VA 2EIFA 3QWXX 3RERA 1K8AU 2CP5A 2EJ9A 2KAFA 1Q86U 4M7AF 1OPLA 1NYGA 3G1JA 2K3BA 2BUDA 3NFCA 4JRPA 4PL6A 3FJPA 1MNEA 2EJGA 1RUWA 3M0UA 1YI2T 1MMDA 2GTJA 2KQWA 4N0AC 3I5SA 3PVQA 2RHYA 4M75B 4C8QC 3NHNA 4MMLA 5GAOp 1Y07A 2LQKA 1RAHB 1LVKA 1XTDA 3OMCA 4RTZA 1YHQT 2V1QA 1OQKA 3EGXB 2PUKB 3JCMf 3EFOA 3M59A 3CCJQ 1R8OB 2L3QA 1QCFA 1N8RC 3OS5A 5IAYA 3OYKA 2QEXQ 3OYBA 3CCQT 5CCAA 4A63B 1WZOA 5KYXA 4FW1A 8ATCB 3LX7A 2JT4A 3CCRA 3EG0A 2EGCA 1VYVA 3CCVA 2MF2A 3OQ5A 3A98A 1B07A 1UGSB 4AFUC 5A0DA 5LJ5f 1WLPB 2LNVA 3J80E 5CQYA 4UC4A 1UGPB 2YT6A 5A2QE 3VYGA 5CKEA 2EJFA 2SEMA 1AWXA 4PJNA 1HSQA 5IT9E 3V7CA 4PLLA 3UATA 1SHGA 2O2OA 1BK2A 2FVUA 4LD9K 2ZPGB 3EG1A 4XU1A 1VQ6A 3QWYA 4C8QB 1VQ9T 1RL2A 1KC8C 1U5SA 2OTJT 3LWIA 3CMAT 2BKDN 2HKNA 5LL6S 1K0XA 4ANJA 1PRMC 2KRSA 4J9DA 2QDYB 5CVIA 3VS4A 5GMKi 4M77C 3NTHA 5FRMA 3FC3A 3BFMA 4OMOA 1ZQ1A 2BE9B 1O9SA 2YUOA 1MMNA 3E9GA 3FB9A 2K79A 3REBB 4M7DD 1JJ2P 2XG8D 4PK4A 3MP1A 4CRIA 3EFSA 2K5LA 3JB9D 1GCQA 1JEGA 2E3HA 2E65A 4WTOB 3VS6A 2VKNA 4XTYA 3EGUA 3M58A 2EQKA 2QTVA 4CC3A 2MYSA 2JN0A 1VYUA 2KROA 1UUEA 2Y90A 3CC7Q 4IURA 2HL3A 3HRUA 1MHNA 3URGA 1BIBA 2C0OA 4LN2A 4X9DA 5KH6A 3GLXA 7AT1B 2CS7A 3SEMA 2CP3A 2WSFE 3S3NA 3N5BB 1UGRB 2PVOB 3PT9A 3O8VA 3MP8A 1IREB 2WACA 5CO7A 1DJ7B 4LUDA 3X24B 4AFZC 5GJWB 3IQLA 3TCJA 4M77B 2ENMA 3CCRT 2EKHA 3RBBB 1OV3A 1UE9A 2JZ2A 2PNIA 3OYYA 3SWNA 3CCVT 2E6ZA 4M7DE 1B34A 4WCIA 1SRLA 3CD6Q 1T3LA 2EYQA 4HA8A 5HY6A 2E10A 2OTLQ 5IHKA 3M55A 3A5ZB 2O4XB 2MMPA 3S3MA 1KHIA 3HSBA 2GFUA 4AFQC 3OYCA 3VS3A 1Y96A 2P4RA 2CSIA 5CK9A 4JLIA 3PGGA 5J26A 2JTEA 1VQ6T 1WHKA 3O5ZA 5IH2A 1FXXA 4XTXA 3JB9F 3V7SA 4X1VA 3CC2Q 4OMFB 1K8AR 4F16A 2QGGA 1EIFA 1P92A 2DL8A 1W2BS 1Q86R 2DIGA 2X4WA 2VGNA 4A53A 4M75A 3VUZA 1G3WA 1VQOQ 1VIFA 2GGRA 1GFDA 2DE0X 3UA7A 2L5QA 2VVKA 3CCLQ 2KMTA 4MZMA 3EGXA 4AT1B 1NJIC 2KRNA 2VGMA 4LE9A 2ZGWA 2BTTA 1RADB 1M1KU 2JOYA 1JO8A 2SRCA 4XU2A 3U23A 3UF4A 4J6WA 3E2UA 1ZSZC 1VQ5A 1QVFP 4IUPA 5IXBA 3G7ZA 1AWOA 4E6RA 3GBQA 1K73R 2DZCA 3MHXA 2DAQA 4C5GA 2DL3A 1IHVA 1VOMA 2DILA 1KD1U 1M2VB 3DKMA 4M78D 2A0FB 2KT8A 3E1SA 3M5AA 1QP3A 3L2UA 3CBMA 2YRCA 5FLXE 4BB7A 3SB2A 1SRMA 2ED1A 3RR6A 2DMOA 3QDRB 4HCBA 2DEUA 2DD4A 5ECAA 3OYFA 2XDBA 1ZLMA 2VXFA 4N0AA 1WPYA 4HCZA 4M4ZA 3C4SA 4FYXB 3OBYA 4C8QA 1QKWA 1I07A 1M27C 1TH7A 1XOVA 1D3BB 3RKXA 1WFWA 4A4HA 3JCMP 2CP7A 1ABOA 1KQSP 3TREA 2LRQA 5FROA 4PKCC 1JXOA 3EH2A 1Z9QA 2QASA 1Q82U 4C8QG 1AWJA 3JCMc 4RG8A 1X2QA 2AK5A 1M1FA 1R0BG 3QHSA 1ZSZB 1FX7A 3DB3A 1WHLA 4M75F 3FDRA 2C06A 4PJOD 3PMIA 2KRMA 1Q7YC 4A4KA 3RIRA 3C0CA 4RTWA 2RA2A 4F17A 2EQJA 2HNIA 2QEXA 3H0FA 3OW2A 2JM8A 2G3RA 2CZ6B 2OAWA 2LQNA 2KSSA 1G3TA 5GAOm 5IXFA 4XTZA 2HD0A 3QPHA 1NG2A 2HCKA 1PKSA 4Z8AA 1QLYA 1KJWA 2M16A 2Y4XA 4M7DC 1Y71A 1M3AA 5CR2A 4FW2A 3TSZA 1WXBA 2DVEA 3RESA 4E2FB 2ZPHB 3QBYA 1VQ5T 2HSPA 2EQUA 4KT0E 1E6GA 4AMCA 1U1TA 2A08A 4C8QF 3OYEA 3OYGA 4PJJA 1NYFA 1YP5A 3WVDB 1MMGA 1K9MC 1WGSA 4QW2A 4M77G 2QTXA 2IG0A 4C5EA 1ZUUA 2O4XA 4A4EA 1WDXA 2P84A 3OS0A 3I56Q 3CXCP 3M0PA 2E12A 4C0GA 3NTKA 3EH1A 2YWWA 1YIJQ 5GAMg 1VQNQ 1G2BA 3KUFA 1V29B 4JRIA 4KH1B 1X6BA 4AG1C 4D6WA 3E9FA 1X69A 2FZGB 3JCMg 1G8XA 4DBFA 5GAN7 1YITQ 1PRLC 4GBQA 4M7DB 2KI7A 5FRNA 1ZX6A 4ZGEB 2DXTA 3ME9A 3CMEQ 3NPFA 2QA4Q 1W2BA 3P8BB 2KEAA 4J83A 5GJVB 3CC7A 2KY9A 2CP0A 4Q5WA 1SF9A 4HCKA 3G71Q 1UB4A 3EG9B 3TQ7P 3ASKA 4IUQA 2E70A 2ED0A 2MOXA 1EZZB 2ECZA 4DOWA 1SSFA 1VQ7Q 2COZA 1H8KA 4CC4B 4D8KA 4IUTA 2PTKA 3OMGA 2QEXT 2M0OA 2NLUA 2HQHA 1JB0E 1M1KR 2FPEA 4M77F 2FB7A 2YSQA 2QK0A 3RKYA 1NEBA 3QZ9B 2XICA 1ZSGA 4N4IA 2V1RA 2LCCA 3VKIA 3H41A 1KQ2A 4DEYA 4BY6C 4RTTA 1M3CA 2WSCE 4CI0C 2ROTA 2RQRA 1UHCA 2FPDA 2HQEA 1KD1R 3CD6A 1IZ6A 4C92E 2QQ9A 1OZ2A 2X51A 2L3SA 3Q1JA 2OTLA 1W1FA 3RMQA 2O9SA 3LH5A 1IGQA 1I4K1 3CBOA 1D3BA 1JBMA 2YLBA 3I9QA 5I2MA 1VQMQ 1TUDA 6AT1B 1EFNA 4GLMA 4OP0A 2AT1B 2KVQG 4M78C 2DL7A 4FU6A 3CC2A 2JTMA 2DLPA 4P5NA 1Y96B 4M7AE 1ZSZA 4HVWA 3UA6A 3G4SA 1TOVA 2YXYA 1Q82R 2C0TA 3CCLA 1G83A 3HKSA 2EVRA 4DBQA 2X4YA 2OI3A 5FWBA 2XKOC 3M4YA 4FT2A 3UDCA 1UFFA 1UTIA 2RNAA 1I5LA 2DF6A 4BY6B 2DKGA 3GPLA 4JJNK 3WVEB 3LH0A 4XTVA 1UJ0A 2KDSA 2XMFA 2XU8A 4BDZA 3OY9A 2LZ6B 2XDPA 2KR3A 5GAMh 4F14A 3L2WA 3OYJA 2XI9A 2ZPIB 1J3TA 2I2LA 5IN1A 3CPWA 1K73U 5CIUA 4IKFA 3CC7T 2LJ1A 2A3LA 3VS7A 4PJOC 2DXUA 4XU3A 2LCLA 3JCMh 2DA9A 1B7TA 3CCEQ 2RJEA 1WYXA 1T3SA 4A4FA 3ER0A 2O9VA 3X20B 2IIMA 2HBWA 5GMKh 4M78B 1AVZC 4RG2A 2HEQA 3JCMb 4JZ3A 2H3EB 2F2VA 4RCBA 2KGTA 1LJOA 1M4ZA 4KUDK 3TSWA 5I22A 1SKUB 4MMKA 1I81A 1D09B 1YJ9Q 2ATCB 2F5KA 1YJNA 1N9RA 3CD6T 5J39A 2FZKB 1WQWA 3FIFA 2OTLT 3G6EQ 3RUXA 2VV5A 3M56A 5HKCA 4JPBW 1WHGA 3EG3A 2DXBA 2ZPFB 5I2SA 2K7AA 2JXBA 1IO6A 4RTVA 1QVGS 4PJOB 2AZSA 4M7DA 1D1CA 1TTHB 3MEWA 3MCAB 1OOTA 4L6V5 1U3OA 1MNDA 5CQXA 5GAN8 3CC2T 2JJ9A 1CKBA 3V8JA 3L2VA 2GFAA 1RI9A 3JRZA 5GANg 2XHCA 1FMKA 4FSSA 2E5KA 1WHMA 5KYYB 3BE3A 3G4ST 1Q81U 3EG9A 1U1SA 3S3OA 2YUNA 3OW2S 3OSSC 1LOJA 1KC8R 2X3WD 4LDUA 3CCLT 2EQMA 4JRQA 3JB9G 1AHJB 3JB9I 3DLLA 1YWPA 4KGXB 3PVLA 1VIEA 3R6NA 1ABQA 3EGDA 1D0ZA 1YHQQ 5KE2A 2RQWA 3CPFA 3QYHB 3M54A 4RUGA 5I21A 2LCSA 2JUFA 2RN8A 3MJXA 1MUZA 3PNWC 4CC7A 2HMAA 4LDYA 3NMZC 3OBWA 1YJWQ 4F04B 3JCMV 3TU4K 2XD0A 3PE0A 4QVZA 2L89A 4LXCA 2RI3A 4Z88A 1Q95G 1RI0A 4QVDA 4IUVA 2FPFA 2EWNA 2RJFA 3VJPA 2R5MA 4D8DA 4F7UB 3KXTA 3I56A 2D0QB 2RI5A 4JZ4A 2R5AA 2KXDA 3VU3C 4J9HA 1YIJA 2F2XA 2MK5A 2P4TA 1FMWA 2X4XA 1VQNA 3QG1A 3FLGA 4LDVA 1S72A 4EMKC 2LP5A 1I0CA 4E7IA 2WSEE 3L2RA
chains in the Genus database with same CATH topology
3CCST 3FDRA 2C06A 4PJOD 1K8AC 3QKJA 1VQKA 3UWNA 5LJ5h 3PMIA 5A0LA 1Q86C 2DTHA 4M7AG 4F7UE 5GMKl 3A8GB 1Q7YC 4A4KA 1YITA 2E64A 5EG2A 1YJNT 1YBYA 3QJYA 4M7DF 3RIRA 3VUBA 1OYXA 3CCMT 5GAMj 2QI2A 4BE1A 3OA6A 3I55T 2VXEA 5GAMd 3JCMJ 2RA2A 3NTIA 4OB0B 3MP6A 4EPCA 2EQJA 4J5YA 5CKDA 1JJ2S 2HNIA 3H8ZA 5C6SA 3QJ6A 3A8MB 4MDXA 1G3SA 3F70A 4O5VA 3CMEA 1W4SA 5GAN5 1XNIA 3QUIA 4LD6A 2QA4A 2YRVA 3X28B 4E47A 5GAN2 2QEXA 3MEUA 1UEBA 4RMOA 2DJZA 4X9CA 4L5GA 2DEQA 1NZ9A 3OW2A 1QVFS 4HT9A 3GIBA 3JCMd 1QW1A 1XQHA 4ZN1A 2G3RA 3JCMe 2CZ6B 2K3YA 4BE2A 3LYIA 4M75C 1VQPT 1M9SA 3QO3A 4WF2A 2KSSA 1G3TA 5GMKj 5GAOm 4XAXB 2L8DA 4XTZA 2HD0A 2KK4A 3QPHA 2K5IA 2E6NA 2P0PA 3C12A 3CCUA 4XTWA 2E1HA 3RKWA 5GMKe 4JS4A 3PIPA 4VUBA 1U8RA 4KBMB 2M16A 2Y4XA 1VQ9A 4M7DC 4LDWA 1K73C 1VQ7A 2ZPEB 2OTJA 2BIVA 2X35A 5LJ3d 3CMAA 2RH2A 2EAYA 3SWNB 4C92F 2XK0A 1WQ7A 1Y71A 2ZZDA 4N4GA 4DQ2A 3JB9J 4FL6A 5CR2A 2R57A 4M75G 3LGFA 5LJ5j 3G6ET 3CC4T 2DVEA 2HQXA 1H641 4NL2A 3RESA 3OYNA 2DTIA 2ZPHB 3QBYA 1B34B 1VQ5T 1BI2A 5LJ5e 2P0KA 2O01E 2PUOB 2EQUA 4V2SA 3PTAA 2CGHA 1VQOT 2JVVA 4E7JA 4KT0E 4M7DG 3LWHA 1ZHIA 3LGLA 4MZTA 2K3XA 2GQVA 4JS5A 4EMKB 1U1TA 2FL7A 4C8QF 3OYEA 3OYGA 1PSEA 4M78A 5D6WA 3WVDB 2M9UA 3R6OA 2OAUA 1K9MC 1WGSA 1G5VA 1KQSS 2B8AA 4XK8E 4QW2A 5CAIA 2EIFA 5GANh 1M8VA 4M77G 4HKEA 1M90U 2QTXA 2IG0A 3J81E 3RERA 4C5EA 4C0DC 1K8AU 3X25B 1VQ4T 2EJ9A 3JAME 2KAFA 2O4XA 1N6AA 1Q86U 4C92C 4A4EA 4BUGA 1VQLT 4M7AF 2PQWA 3OS0A 1Q7YU 2BUDA 3NFCA 1KQ1A 4NOYA 4JRPA 2E12A 4PL6A 4C0GA 2LT1A 3NTKA 3FJPA 3DLMA 4YTLA 4QQDA 4RCCA 5C0MA 5GAOn 2EJGA 4L59A 4M78G 5GAMg 1M5Q1 4QQGA 3HP9A 1YI2T 4IUUA 3JCMW 2XIDA 2KQWA 3KUFA 4N0AC 1V29B 1I8FA 2RHYA 4M75B 5AYFA 4C0FA 4JRIA 4C8QC 4MMLA 3M4GA 2RI2A 3HL8A 4D6WA 3E9FA 5GAOp 2YLCA 1KG1A 1GXIE 1Y07A 2LQKA 3OMCA 1XTDA 3JCMg 4BI4A 4ZGJB 3OYDA 5GAN7 3BY7A 4MDWA 3OS2A 4II1A 1YHQT 2MWPA 2RO0A 1JJ2A 3MEAA 4C5HA 1JRIA 4M7DB 2PUKB 3JCMf 3I56T 5FRNA 3M59A 4M7AC 4O6JA 2K5FA 1R8OB 3EAEA 4J8OA 3VYHB 4ZGEB 1N8RC 2DXTA 3OS1A 3ME9A 3V8KA 1YIJT 3OS5A 1W2BA 5IAYA 3P8BB 3OYKA 4J83A 2RHXA 1VQNT 3MEVA 2VC8A 3TEEA 5LJ3g 3OYBA 4M75E 3HRTA 5CCAA 2KY9A 3CC7A 3CCQT 1S72T 4PJOA 4Q5WA 4C5IA 4BDYA 2H3JA 2K57A 3A8HB 5GANe 3LX7A 1UB4A 4EMGA 3JSCA 3FEOA 3CCRA 1VQKT 3ASKA 2CKKA 4IUQA 3SD4A 2E70A 1N27A 1QVGA 4OF1A 4J6XA 1PSFA 3CCVA 1YITT 2M1HA 3S6WA 2MF2A 3OQ5A 3SDZA 1M1GA 1UGSB 5A0DA 5LJ5f 4DOWA 1SSFA 2LNVA 3ZBDA 4ZGDB 3CBPA 3J80E 3L2ZA 4OB1B 5CQYA 3OYAA 4IUTA 4PJOG 4UC4A 3CCJA 4DA4A 1UGPB 4C0DB 3CMET 2QA4T 3HPWA 1K9MU 3OMGA 2RHZA 5A2QE 2QEXT 2M0OA 2NLUA 4OGCA 5CKEA 1JB0E 3VYGA 4BI3A 4C92B 2EJFA 4M77F 2FB7A 5IT9E 2R58A 4XTUA 1QVPA 3V7CA 3RKYA 3UPUA 4PLLA 2MI6A 3CPWS 3QZ9B 2XICA 3G71A 3CCEA 3PMTA 2PVGB 4N4IA 2LCCA 3QSUA 3VKIA 5L8RE 2FVUA 3C94A 4FIBA 3OYIA 4LD9K 1KQ2A 4BD3A 3EFRA 3CCUT 1BYMA 2ZPGB 4BI8B 2E5QA 4XU1A 4M78F 1KQSA 1VQ6A 3QXEB 4BY6C 1ZBXA 4C8QB 2LT4A 1VQ9T 1RL2A 2WSCE 4CI0C 1KC8C 1VQ7T 2OTJT 2RD1A 2HQEA 3LWIA 3CMAT 1IZ6A 3CD6A 4MZPA 1BI1A 4C92E 2BKDN 2QQ9A 5LL6S 1OZ2A 2QQSA 2VYTA 3Q1JA 4KULA 2OTLA 3RMQA 3CXCS 3ZFJA 2QDYB 2LC4A 3L1AA 5CVIA 4M7AB 3QYGB 4DOVA 5GMKi 1OZ3A 2QXFA 4M77C 5LJ5d 2GF7A 1YJ9A 1I4K1 3CBOA 2LVMA 3NTHA 1D3BA 2QQBA 1JBMA 3V7RA 3FC3A 2YLBA 5I2MA 5FRMA 3BFMA 3BDUA 4OVAA 4M75D 3MO8A 1ZQ1A 3H6ZA 1QP2A 4C8QE 1O9SA 1N8RU 4OP0A 4C0ZA 4F7UA 3E9GA 3FB9A 4J7FA 2DTOA 2KVQG 4M78C 4XU0A 4FU6A 4M7DD 2DO3A 3CC2A 2JTMA 1FWZA 2RK2A 2XG8D 3HHTB 4P5NA 1Y96B 3MP1A 5GAN4 4M7AE 4CRIA 3EFSA 2K5LA 3JB9D 1WJQA 4Z02A 2E65A 3BW1A 5GANf 4R55A 3G4SA 3META 1NPRA 5GAOr 2A7YA 4F7UG 1KHCA 2GCXA 4XTYA 5GAOl 4BACA 5J3BA 3M58A 1VQMA 2EQKA 2CZ1B 2LX9A 3CCLA 3HKSA 4PJOF 2JN0A 2YHTA 2X4YA 2MAMA 2Y90A 3L2QA 4B9WA 4IURA 3HRUA 4OGEA 1MHNA 1G3YA 3URGA 1BIBA 2XKOC 3M4YA 4FM4B 4FT2A 4X9DA 3UDCA 5KH6A 1O75A 1WJRA 3GLXA 2CS7A 3HFOA 4J6YA 2WSFE 3S3NA 1I5LA 5FU7C 3SFMA 2DXCA 2DKGA 3L42A 3N5BB 4BY6B 1UGRB 3GPLA 3WVEB 3LH0A 4JJNK 2PVOB 3PT9A 4XTVA 2KDSA 2XU8A 3FRNA 3HFNA 3MP8A 1IREB 3O8VA 2WACA 3OY9A 4BDZA 4C92D 3P8DA 5CO7A 2XDPA 1DJ7B 3X26B 2FYKA 5GAMh 1YCYA 3X24B 3L2WA 2RM4A 3OYJA 1KC8U 2XI9A 4XQ3A 2ZPIB 1QVFA 5M9OA 2I2LA 5IN1A 1H3ZA 2RHUA 3CPWA 1K73U 2DIQA 5CIUA 2AHJB 4IKFA 1HXDA 3CC7T 2A3LA 3TCJA 4M77B 5GANj 4PJOC 2DXUA 4XU3A 5GANd 3PIOA 2LCLA 3CCRT 3JCMh 1X01A 1M1KC 4HT8A 2JZ2A 1WJSA 2RJEA 3KBGA 4Y28E 4C8QD 3OYYA 3SWNA 4JLGA 4EDUA 4A4FA 3CCVT 1BIAA 2E6ZA 3ER0A 5LJ5g 1VQ8A 2VUBA 1NPPA 3A8OB 3X20B 1Q81C 4GLKA 3J7AF 4M7AA 2XDDA 4M7DE 5GMKh 5GAN3 2JNGA 4M78B 2V8KA 3A8LB 4RG2A 5DM7R 4ATOA 1B34A 3JCMb 2DK3A 3CXCA 3OYMA 3CCJT 4M7AD 2EYQA 4HA8A 5HY6A 4RCBA 2K2VA 2E10A 4KUIA 5LJ3h 2LDMA 1LJOA 1M4ZA 4KUDK 4M77E 3M55A 5KE3A 3A5ZB 4EMKA 4PNOA 2O4XB 1KD1C 1NE8A 2MMPA 1BI3A 3S3MA 1KHIA 1YJWA 4MMKA 3HSBA 2GFUA 4LDXA 1I81A 2ZPBB 3CCSA 3G71T 3CCET 2Y4YA 4B9XA 3OYCA 2HAXA 1Y96A 2V8IA 3M53A 3GF5A 5CK9A 2F5KA 3PGGA 4JLIA 5J26A 4M78E 1N9RA 4OB3B 4F7UF 1YJNA 2DD5A 1VQ6T 3CCMA 1FXXA 2D9TA 4ELYC 4E7LA 3DB4A 3I55A 5GAMe 4XTXA 3JB9F 2HBPA 2EKOA 4FSXA 1UGQB 3CD6T 4JRKA 3BDLA 3V7SA 3RMSA 2K4YA 3OSVA 5J39A 1WQWA 5FU7B 3FIFA 4OMFB 3OB9A 1HK9A 2OTLT 2P0QA 1WNLA 2PU9B 1EIFA 1P92A 3RUXA 4N4HA 2VV5A 4GY5A 1W2BS 3M56A 2DIGA 2X4WA 2IVWA 2RHIA 2VGNA 3C95A 5HKCA 4A53A 5CKFA 4M75A 4NL3A 3ZEHA 3VUZA 2ZCFB 2JTFA 5FU6C 1G3WA 2DXBA 1YJ9T 4R56A 5DLQE 3VV0A 1VQPA 2ZPFB 5I2SA 1VIFA 4Y91A 2MWOA 5KCHA 1Y7XA 2V8JA 2L5QA 2KMTA 4MZMA 1QVGS 4PJOB 4M7DA 2QQAA 3MEWA 1NJIC 2LQ8A 1LNXA 3MCAB 3QZ5B 5LJ3j 2DZ9A 2VGMA 4L6V5 2LTOA 3OYLA 1Q82C 2E41A 3JCMX 4ME7A 5LJ3e 5CQXA 5GAN8 3CC2T 2ZGWA 3V8JA 4TVRA 3L2VA 1BKBA 2GFAA 3JRZA 5GANg 1M1KU 2JOYA 4HCCA 2XHCA 4M77A 3G6EA 3CC4A 4A54A 4OB2B 4XU2A 4J6WA 3G4ST 2F5TX 1Q81U 1VQ5A 3PFSA 3HRSA 1U1SA 3S3OA 4IUPA 3OW2S 3OSSC 3UT1A 1LOJA 5HK3A 3V8LA 4M77D 2PVDB 3G7ZA 4EMHA 1VQOA 3INZA 4PJOE 1VQMT 4ZTFA 4LDUA 3CCLT 2L3RA 1OI1A 2EQMA 4J7IA 2DZCA 4JRQA 3MHXA 1BI0A 4NS5A 3JB9G 2DAQA 4C5GA 1AHJB 3GNGA 4RKUE 3JB9I 3DLLA 2QQRA 4E7KA 1KD1U 1VIEA 1X75C 2RJDA 3DKMA 4M78D 2D6FA 3LW5E 5KE2A 3JB9H 3GOXA 3E1SA 2F69A 1QP3A 3M5AA 4X34A 4C92A 5DY9A 3L2UA 3CBMA 5CKBA 1X6OA 5FLXE 1MGQA 1VQ4A 3CPFA 5GMKm 3QYHB 1VQLA 2RB6A 3M54A 2EFIA 4BB7A 5I21A 3SB2A 5D6YA 4ELZC 3CEYA 3M9QA 4QQ6A 2JUFA 3QIIA 3QDRB 4HCBA 1N9SA 2DD4A 3OYFA 4ZTJA 5D6XA 2XDBA 3PNWC 5GAOq 3E19A 4A4GA 2CYZB 2CZ7B 2VXFA 4N0AA 4BE0A 3M57A 1WPYA 2X4JA 4HCZA 4LDYA 5DLOA 1YI2A 3C4SA 5GAMf 3OBYA 3OBWA 4C8QA 4PLIA 5FU6B 3AHUA 3JCMV 4C92G 3TU4K 2XD0A 1TH7A 1XOVA 3OYHA 4QVZA 1D3BB 3RKXA 2RJCA 2L89A 4A4HA 3JCMP 2RI3A 5A0GA 1RI0A 4QVDA 1YHQA 3SWNC 1VQ8T 2DPPB 3TREA 3GNFB 4IUVA 5GAN6 2LRQA 2EWNA 5FROA 2RJFA 4PKCC 2R5MA 3VJPA 4F7UB 3JCMQ 3KXTA 3GP8A 4FT4A 3I56A 2D0QB 2CZ0B 2RI5A 5CKHA 4QVCA 1VUBA 2R5AA 2RK1A 1NJIU 3VU3C 1Q82U 4C8QG 1YIJA 4ZN3A 2FHDA 3WXMB 3JCMc 4RG8A 2P4TA 2X4XA 4E7HA 3T9NA 1VQNA 4JDSA 3QG1A 1M1FA 3FLGA 4JUVA 3QHSA 4LDVA 5HK0A 3CCQA 1FX7A 1YJWT 3P8HA 3DB3A 5KCOA 1S72A 4M75F 4EMKC 3LLRA 4E7IA 2WSEE 1M90C 5LJ3f 3L2RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IVW A;  3OSS C;  2Y4X A;  2Y4Y A;  2LNV A;  2LC4 A; 
#chains in the Genus database with same CATH topology
 1K76 A;  1K8A C;  1VQK A;  1R0C B;  3UWN A;  1Q86 C;  2DTH A;  1WA7 A;  3A8G B;  1BCO A;  1YJN T;  1YIT A;  4M7D F;  1VQ9 Q;  2QI2 A;  5GAM d;  4OB0 B;  5CKD A;  1ZUK A;  3F70 A;  4O5V A;  3CME A;  2QA4 A;  3M0S A;  2YRV A;  3X28 B;  1UEB A;  2EYX A;  4X9C A;  4FCY A;  3JCM d;  1XQH A;  2DBM A;  1R77 A;  2K3Y A;  3LYI A;  5D7U A;  3QO3 A;  4WF2 A;  4XAX B;  2KK4 A;  4XTW A;  2AKK A;  4KBM B;  1GCP A;  1K73 C;  1VQ7 A;  1Z9Z A;  2X35 A;  2ZZD A;  4N4G A;  3JB9 J;  1VQ4 Q;  3I35 A;  4M75 G;  1VQL Q;  4EIK A;  2HQX A;  3OYN A;  1M30 A;  4KGV B;  1QMC A;  2O01 E;  2JVV A;  2GQV A;  4EMK B;  1PSE A;  2QAZ A;  4M78 A;  5D6W A;  2KT1 A;  2OAU A;  3M0Q A;  2KE9 A;  4XK8 E;  1T0H A;  5GAN h;  1V76 A;  1M90 U;  4C0D C;  3X25 B;  3JAM E;  3NGP A;  2RQV A;  2PQW A;  1KQ1 A;  1EX4 A;  1NJI R;  4FYY B;  2LT1 A;  3DLM A;  1LPL A;  1UJY A;  4QQD A;  4RCC A;  5C0M A;  5GAO n;  4M78 G;  3HP9 A;  2NUT B;  1PD0 A;  2XID A;  1I8F A;  4KH0 B;  4JJD A;  5AYF A;  4C0F A;  3M4G A;  2RI2 A;  3HL8 A;  1KG1 A;  1GXI E;  4DEX A;  4ZGJ B;  3OYD A;  2MWP A;  1RAF B;  2RO0 A;  1JRI A;  8AT1 B;  3I56 T;  2DNU A;  5KYN A;  3OS1 A;  1YIJ T;  2J06 A;  3OW2 P;  1VQN T;  3MEV A;  1X6G A;  5LJ3 g;  4M75 E;  3HRT A;  4PJO A;  1S72 T;  2K57 A;  3A8H B;  3EHQ A;  1JQQ A;  1VQK T;  4CC2 A;  2CKK A;  2KYB A;  2BZX A;  1QVG A;  1YIT T;  2M1H A;  3S6W A;  1VQ6 Q;  3CCU Q;  1M1G A;  2CRE A;  2D0N A;  5KYY A;  4J9G A;  1PM3 A;  3VS1 A;  3OYA A;  4PJO G;  3CCJ A;  4C0D B;  3CME T;  2QA4 T;  3HPW A;  2RHZ A;  4BI3 A;  1PCX A;  5HCK A;  3VS0 A;  1UHF A;  1ZBJ A;  4PJM A;  5KYU B;  3CPW S;  2MI6 A;  1Q81 R;  2COY A;  3CCE A;  2GNC A;  1X2K A;  3C94 A;  4FIB A;  3OYI A;  4FYV B;  4BD3 A;  1BYM A;  4BI8 B;  1M2O A;  1SG5 A;  4M78 F;  1KQS A;  1ZBX A;  2LT4 A;  1VQ7 T;  2RD1 A;  2DRM A;  4JJC A;  2YUQ A;  2VYT A;  1SHF A;  4KUL A;  2G6F X;  3ZFJ A;  5IHI A;  1Q7Y R;  2LC4 A;  2L0A A;  3L1A A;  4DOV A;  2DVJ A;  2QXF A;  1YJ9 A;  4Y92 A;  1ACM B;  4OVA A;  3H6Z A;  2DBK A;  4C8Q E;  1N8R U;  4C0Z A;  4F7U A;  2ZAE A;  2NWM A;  2NYS A;  4HXJ A;  5L23 A;  4XU0 A;  2DO3 A;  1YNZ A;  1K4U S;  1FWZ A;  5GAN 4;  1SPK A;  3BW1 A;  4R55 A;  1LCK A;  1W2B P;  1NPR A;  5GAO r;  3EHR A;  4LNP A;  4F7U G;  2GCX A;  5J3B A;  3FJ5 A;  2CZ1 B;  4PJO F;  1T0J A;  2MAM A;  1KFZ A;  4B9W A;  1G3Y A;  4FM4 B;  1WJR A;  1MV3 A;  4RTX A;  4J9C A;  3HFO A;  1XJW B;  3L42 A;  1YN8 A;  1WX6 A;  3FRN A;  4C92 D;  3X26 B;  2CUD A;  2FYK A;  1QCO A;  3M0T A;  1YCY A;  2RM4 A;  1KC8 U;  1H3Z A;  2DIQ A;  2J05 A;  1BBZ A;  1CSK A;  3D7S B;  2VB6 A;  4QT7 A;  2CT3 A;  2DL5 A;  4Z89 A;  5GAN d;  2JMC A;  1OU9 A;  1X01 A;  1M1K C;  4HT8 A;  4J9F A;  1WJS A;  4Y28 E;  1QWE A;  5LJ5 g;  3QDF A;  1NPP A;  4M7A A;  3J7A F;  1Y57 A;  5GAN 3;  2H8H A;  2V8K A;  4ATO A;  1PWT A;  2COW A;  2DK3 A;  3CXC A;  3OYM A;  3CCJ T;  4M7A D;  2KBT A;  3EGD B;  2OX7 A;  5LJ3 h;  2LDM A;  4M77 E;  4IIM A;  1D1B A;  5KE3 A;  4EMK A;  4PNO A;  2ESW A;  1KD1 C;  5FW9 A;  1NE8 A;  1BI3 A;  1YJW A;  2FRW A;  3TVT A;  2ZPB B;  3CCE T;  1A0N B;  4B9X A;  2HAX A;  1HD3 A;  3M53 A;  3GF5 A;  1D0Y A;  1SSH A;  2CH4 W;  4OB3 B;  4F7U F;  4IIO A;  1MMA A;  4PFO A;  4ELY C;  3DB4 A;  4J9B A;  1RAE B;  4E7L A;  5GAM e;  4FSX A;  1UGQ B;  3BDL A;  3RMS A;  2K4Y A;  1NLP C;  3SHW A;  1M90 R;  2RMO A;  4RTY A;  3VS5 A;  1TG0 A;  1HK9 A;  1AWW A;  2GQI A;  2NUT A;  4GY5 A;  2IVW A;  1AT1 B;  2ZCF B;  5FU6 C;  1YJ9 T;  5DLQ E;  3VV0 A;  2JS0 A;  4Y91 A;  2Z0W A;  5KCH A;  1PHT A;  2V8J A;  2LX7 A;  2QQA A;  1JU5 C;  5LJ3 j;  3OYL A;  2DZ9 A;  2C0I A;  2LTO A;  1Q82 C;  1GL5 A;  3JCM X;  4ME7 A;  5FWC A;  2CP2 A;  4TVR A;  2HSE B;  3JV3 A;  4E7S A;  4KRT A;  4A54 A;  4OB2 B;  2HDA A;  2F5T X;  2EBP A;  3PFS A;  3HRS A;  2FEI A;  3UT1 A;  3CPW P;  1GFC A;  4EMH A;  2PVD B;  1H3H A;  1VQO A;  3INZ A;  1UGV A;  3I5R A;  2L3R A;  1OI1 A;  4NS5 A;  1BI0 A;  4RKU E;  2I0N A;  3H9N A;  2QQR A;  4E7K A;  2BZ8 A;  2RJD A;  2KXC A;  2D6F A;  3LW5 E;  3GOX A;  5DY9 A;  4E7Z A;  1VQ4 A;  1VQ8 Q;  1MGQ A;  5GMK m;  1VQL A;  4J9E A;  2RB6 A;  1WHH A;  2EFI A;  4ELZ C;  5KYU A;  3CEY A;  2EYW A;  1I1J A;  3QII A;  1N9S A;  1BB9 A;  4ZTJ A;  2CP6 A;  2RQT A;  1TWB A;  2W0Z A;  5GAO q;  2CYZ B;  2KYM A;  2X4J A;  1N5Z A;  5GAM f;  4PLI A;  2JW4 A;  5FU6 B;  3CCS Q;  1NBE B;  2RJC A;  5A0G A;  1C6V X;  2DPP B;  3JCM Q;  1MV0 B;  3CCM Q;  2L3P A;  4FT4 A;  3I55 Q;  5CKH A;  2A36 A;  1VUB A;  1YWO A;  2RK1 A;  1NJI U;  2QGF B;  2FHD A;  4E7H A;  3T9N A;  2EQI A;  5HK0 A;  2QG9 B;  1YJW T;  2O31 A;  3PMT A;  2IPO B;  2RQU A;  3QKJ A;  2CUB A;  2F2W A;  1VQP Q;  2LNH B;  2DFU A;  5LJ5 h;  2ROL A;  2BZY A;  1YBY A;  1N8R R;  3VUB A;  3A1P A;  5GAM j;  4BE1 A;  1QWF A;  2MPX C;  3MP6 A;  1AOJ A;  3QJ6 A;  4MDX A;  2DX1 A;  1GBQ A;  5GAN 5;  1XNI A;  3QUI A;  4RMO A;  2DJZ A;  2DEQ A;  4JJB A;  1QVF S;  3GIB A;  3CC4 Q;  1QW1 A;  4ZN1 A;  4BE2 A;  1WXT A;  1M9S A;  5GMK j;  2EYY A;  2P0P A;  3CCU A;  2E1H A;  3RKW A;  1TSF A;  2L2P A;  4JS4 A;  4AFS C;  3PIP A;  1X27 A;  1U8R A;  3CQT A;  4LDW A;  2ZPE B;  4OMP A;  1UG1 A;  5LJ3 d;  1PD1 A;  2RH2 A;  2XK0 A;  1WQ7 A;  2MCN A;  2DRK A;  3LGF A;  5LJ5 j;  3AT1 B;  1H64 1;  1OUL A;  5EC7 A;  1M3B A;  2DTI A;  2J6F A;  2P0K A;  2PUO B;  2CGH A;  1VQO T;  4M7D G;  3LWH A;  4MZT A;  2RPN A;  1YI2 Q;  2JS2 A;  1KQS S;  2EW3 A;  1ARK A;  4OMM A;  5CAI A;  4HKE A;  3J81 E;  2CH4 A;  1VQ4 T;  1VQL T;  3MKD A;  1N6A A;  4C92 C;  4BUG A;  3ULR B;  1Q7Y U;  2X3X D;  2BE7 D;  2HZY A;  4NOY A;  1CKA A;  4YTL A;  5IHN A;  4L59 A;  1M5Q 1;  4QQG A;  2LMJ A;  4IUU A;  3JCM W;  3CCQ Q;  3KFV A;  1TUG B;  2YLC A;  4BI4 A;  2NUP B;  3BY7 A;  4MDW A;  3OS2 A;  4II1 A;  2FRY A;  1JJ2 A;  3MEA A;  4C5H A;  2ABL A;  4M7A C;  4O6J A;  2K5F A;  4J9I A;  3EAE A;  2DL4 A;  4J8O A;  3VYH B;  2M51 A;  3V8K A;  2M02 A;  2RHX A;  2VC8 A;  3TEE A;  4C5I A;  4BDY A;  2H3J A;  5GAN e;  4EMG A;  3JSC A;  3FEO A;  1OX8 A;  4OML A;  3SD4 A;  1N27 A;  4OF1 A;  1AEY A;  4J6X A;  1PSF A;  2JM9 A;  3SDZ A;  1HYO A;  4RTU A;  2HL5 C;  3ZBD A;  4ZGD B;  3CBP A;  3L2Z A;  2OTJ Q;  4OB1 B;  3CMA Q;  4DA4 A;  4KGZ B;  2DYB A;  2FG0 A;  1K9M U;  1WIE A;  4OGC A;  4C92 B;  1WI7 A;  2R58 A;  1UEC A;  2QDL A;  4XTU A;  1QVP A;  3UPU A;  3G71 A;  1BU1 A;  1AZE A;  2PVG B;  3QSU A;  5L8R E;  3EFR A;  3CCU T;  1KSW A;  2E5Q A;  2HKQ B;  2LQW A;  3QXE B;  1D1A A;  4MZP A;  1BI1 A;  3RDV A;  1RAC B;  2QQS A;  1OEB A;  2DYI A;  5KYW B;  5I11 A;  1H92 A;  3CXC S;  1ZA2 B;  2CSQ A;  4ESR A;  3G4S Q;  4M7A B;  1OPK A;  1S1N A;  1W6X A;  3QYG B;  2O88 A;  1OZ3 A;  1RAI B;  5LJ5 d;  2GF7 A;  2QYZ A;  3V7R A;  2LVM A;  2QQB A;  2M0Y A;  3BDU A;  4M75 D;  3MO8 A;  1QP2 A;  2EGE A;  4J7F A;  1IGU A;  2DTO A;  4ZNX A;  1IRX A;  2RK2 A;  3HHT B;  2W10 A;  3VRY A;  4PJL A;  1WJQ A;  4Z02 A;  5GAN f;  4LUE A;  3MET A;  2A7Y A;  2DM1 A;  1IXD A;  1KHC A;  2YRD A;  5GAO l;  4BAC A;  1VQM A;  2LX9 A;  1HJD A;  2KNB B;  2DER A;  2YHT A;  3L2Q A;  1ZUY A;  4B6M A;  1X43 A;  4OGE A;  1QVG P;  1O75 A;  1VYT A;  3CCR Q;  1K9A A;  2K9G A;  1FMV A;  4J6Y A;  3EG2 A;  5FU7 C;  3SFM A;  3CCV Q;  2DXC A;  2GBQ A;  3HFN A;  1FYN A;  1IB8 A;  1PG5 B;  3P8D A;  1QQJ A;  2E3I A;  4XQ3 A;  1QVF A;  5M9O A;  2RHU A;  2AHJ B;  1HXD A;  3THK A;  1TU0 B;  5GAN j;  1E6H A;  2LJ3 A;  1UDL A;  2J6K A;  3PIO A;  1KIK A;  2K6D A;  3KBG A;  4C8Q D;  2J7I A;  2X9H A;  4JLG A;  4EDU A;  1YJN Q;  1BIA A;  2CDT A;  2VUB A;  4FYW B;  3A8O B;  2AIR B;  1Q81 C;  4GLK A;  1VQ8 A;  1AD5 A;  2XDD A;  2FZC B;  2JNG A;  2F1L A;  4ORZ A;  3A8L B;  5DM7 R;  1ZA1 B;  2V26 A;  2K2V A;  4KUI A;  1E7O A;  2GTO A;  4LDX A;  2LJ0 A;  3CCS A;  3G71 T;  1TS9 A;  2Y4Y A;  2V8I A;  4DBR A;  4OMQ A;  1TXQ A;  4M78 E;  1C0M A;  2DD5 A;  1C1A A;  3CCM A;  2D9T A;  3I55 A;  4DBH A;  2HBP A;  2EKO A;  1QCN A;  4JRK A;  3OSV A;  5FU7 B;  1NEG A;  3OB9 A;  1NLO C;  2P0Q A;  1WNL A;  2PU9 B;  3RNJ A;  4N4H A;  1V1C A;  2RHI A;  3C95 A;  3EFO B;  3MPU B;  1M8M A;  5CKF A;  4NL3 A;  3ZEH A;  2JTF A;  1PKT A;  4R56 A;  1VQP A;  2NUP A;  2MWO A;  1Y7X A;  4QKU A;  2AKL A;  5KYX B;  3QZ5 B;  1LNX A;  2LQ8 A;  2YDL A;  2E41 A;  5LJ3 e;  3HTR A;  2PZ1 A;  1GRI A;  1BKB A;  1RAA B;  4HCC A;  4M77 A;  1OX9 A;  3G6E A;  3CC4 A;  1GCQ C;  2EPD A;  2YUP A;  4HVU A;  5HK3 A;  3V8L A;  4M77 D;  3H0I A;  1TUC A;  4PJO E;  1VQM T;  1SEM A;  4ZTF A;  2D8H A;  4J7I A;  4AG2 C;  3GNG A;  1W70 A;  1X75 C;  2RF0 A;  3JB9 H;  2F69 A;  4X34 A;  4C92 A;  1YCS B;  5CKB A;  1X6O A;  4PFZ A;  2D1X A;  1IHW A;  5D6Y A;  1RAB B;  3M9Q A;  4QQ6 A;  2EYZ A;  1NM7 A;  2K2M A;  5D6X A;  1K9M R;  3E19 A;  4A4G A;  1YFN A;  2CZ7 B;  4BE0 A;  3M57 A;  5DLO A;  1YI2 A;  1S72 Q;  2VWF A;  2E4H A;  1D0X A;  1KK7 A;  2JMA A;  4R0K A;  3AHU A;  1Y0M A;  4C92 G;  1VQK Q;  4HVV A;  3OYH A;  2VAS A;  3H0H A;  2DJQ A;  2AZV A;  5KYW A;  9ATC B;  1YHQ A;  3SWN C;  2EGA A;  1VQ8 T;  3GNF B;  5GAN 6;  2DET A;  2FO0 A;  3GP8 A;  5AT1 B;  2CZ0 B;  4QVC A;  2A37 A;  1AZG B;  4ZN3 A;  3WXM B;  1RLQ C;  4JDS A;  4JUV A;  3CCQ A;  3P8H A;  5KCO A;  1I5O B;  3LLR A;  1M90 C;  5LJ3 f;  5GAN 2;  1OU8 A;  3CCS T;  2OJ2 A;  2J6O A;  4M7A G;  3VRZ A;  5A0L A;  2A28 A;  1K1Z A;  2NUZ A;  4F7U E;  5GMK l;  2E64 A;  5EG2 A;  3QJY A;  1OYX A;  3CCM T;  1RLP C;  3ZL7 C;  3OA6 A;  3I55 T;  2VXE A;  3JCM J;  3NTI A;  1JJ2 S;  4EPC A;  4J5Y A;  1GBR A;  3H8Z A;  5C6S A;  3A8M B;  1G3S A;  1W4S A;  4LD6 A;  4E47 A;  3REA B;  3MEU A;  4L5G A;  1NZ9 A;  4HT9 A;  1VA7 A;  3JCM e;  3VS2 A;  1VQ5 Q;  1M2V A;  4M75 C;  1VQP T;  1JXM A;  2L8D A;  2D8J A;  1WHJ A;  2K5I A;  2E6N A;  3C12 A;  1QKX A;  2CT4 A;  1PC0 A;  5GMK e;  4VUB A;  1BCM A;  1VQ9 A;  1F1B B;  2OTJ A;  2BIV A;  1PNJ A;  1U06 A;  3CMA A;  2EAY A;  3SWN B;  4C92 F;  4DQ2 A;  2MIO A;  4FL6 A;  2R57 A;  2B86 A;  3G6E T;  3CC4 T;  3M0R A;  4NL2 A;  4OMN A;  1K0S A;  1B34 B;  1BI2 A;  4PFP A;  5LJ5 e;  4V2S A;  3PTA A;  1RAG B;  4E7J A;  1ZHI A;  3LGL A;  1B3Q A;  2K3X A;  1WXU A;  4JS5 A;  2FL7 A;  4K11 A;  2M9U A;  3R6O A;  1G5V A;  2B8A A;  1M8V A;  2EIF A;  3QWX X;  3RER A;  1K8A U;  2CP5 A;  2EJ9 A;  2KAF A;  1Q86 U;  4M7A F;  1OPL A;  1NYG A;  3G1J A;  2K3B A;  2BUD A;  3NFC A;  4JRP A;  4PL6 A;  3FJP A;  1MNE A;  2EJG A;  1RUW A;  3M0U A;  1YI2 T;  1MMD A;  2GTJ A;  2KQW A;  4N0A C;  3I5S A;  3PVQ A;  2RHY A;  4M75 B;  4C8Q C;  3NHN A;  4MML A;  5GAO p;  1Y07 A;  2LQK A;  1RAH B;  1LVK A;  1XTD A;  3OMC A;  4RTZ A;  1YHQ T;  2V1Q A;  1OQK A;  3EGX B;  2PUK B;  3JCM f;  3EFO A;  3M59 A;  3CCJ Q;  1R8O B;  2L3Q A;  1QCF A;  1N8R C;  3OS5 A;  5IAY A;  3OYK A;  2QEX Q;  3OYB A;  3CCQ T;  5CCA A;  4A63 B;  1WZO A;  5KYX A;  4FW1 A;  8ATC B;  3LX7 A;  2JT4 A;  3CCR A;  3EG0 A;  2EGC A;  1VYV A;  3CCV A;  2MF2 A;  3OQ5 A;  3A98 A;  1B07 A;  1UGS B;  4AFU C;  5A0D A;  5LJ5 f;  1WLP B;  2LNV A;  3J80 E;  5CQY A;  4UC4 A;  1UGP B;  2YT6 A;  5A2Q E;  3VYG A;  5CKE A;  2EJF A;  2SEM A;  1AWX A;  4PJN A;  1HSQ A;  5IT9 E;  3V7C A;  4PLL A;  3UAT A;  1SHG A;  2O2O A;  1BK2 A;  2FVU A;  4LD9 K;  2ZPG B;  3EG1 A;  4XU1 A;  1VQ6 A;  3QWY A;  4C8Q B;  1VQ9 T;  1RL2 A;  1KC8 C;  1U5S A;  2OTJ T;  3LWI A;  3CMA T;  2BKD N;  2HKN A;  5LL6 S;  1K0X A;  4ANJ A;  1PRM C;  2KRS A;  4J9D A;  2QDY B;  5CVI A;  3VS4 A;  5GMK i;  4M77 C;  3NTH A;  5FRM A;  3FC3 A;  3BFM A;  4OMO A;  1ZQ1 A;  2BE9 B;  1O9S A;  2YUO A;  1MMN A;  3E9G A;  3FB9 A;  2K79 A;  3REB B;  4M7D D;  1JJ2 P;  2XG8 D;  4PK4 A;  3MP1 A;  4CRI A;  3EFS A;  2K5L A;  3JB9 D;  1GCQ A;  1JEG A;  2E3H A;  2E65 A;  4WTO B;  3VS6 A;  2VKN A;  4XTY A;  3EGU A;  3M58 A;  2EQK A;  2QTV A;  4CC3 A;  2MYS A;  2JN0 A;  1VYU A;  2KRO A;  1UUE A;  2Y90 A;  3CC7 Q;  4IUR A;  2HL3 A;  3HRU A;  1MHN A;  3URG A;  1BIB A;  2C0O A;  4LN2 A;  4X9D A;  5KH6 A;  3GLX A;  7AT1 B;  2CS7 A;  3SEM A;  2CP3 A;  2WSF E;  3S3N A;  3N5B B;  1UGR B;  2PVO B;  3PT9 A;  3O8V A;  3MP8 A;  1IRE B;  2WAC A;  5CO7 A;  1DJ7 B;  4LUD A;  3X24 B;  4AFZ C;  5GJW B;  3IQL A;  3TCJ A;  4M77 B;  2ENM A;  3CCR T;  2EKH A;  3RBB B;  1OV3 A;  1UE9 A;  2JZ2 A;  2PNI A;  3OYY A;  3SWN A;  3CCV T;  2E6Z A;  4M7D E;  1B34 A;  4WCI A;  1SRL A;  3CD6 Q;  1T3L A;  2EYQ A;  4HA8 A;  5HY6 A;  2E10 A;  2OTL Q;  5IHK A;  3M55 A;  3A5Z B;  2O4X B;  2MMP A;  3S3M A;  1KHI A;  3HSB A;  2GFU A;  4AFQ C;  3OYC A;  3VS3 A;  1Y96 A;  2P4R A;  2CSI A;  5CK9 A;  4JLI A;  3PGG A;  5J26 A;  2JTE A;  1VQ6 T;  1WHK A;  3O5Z A;  5IH2 A;  1FXX A;  4XTX A;  3JB9 F;  3V7S A;  4X1V A;  3CC2 Q;  4OMF B;  1K8A R;  4F16 A;  2QGG A;  1EIF A;  1P92 A;  2DL8 A;  1W2B S;  1Q86 R;  2DIG A;  2X4W A;  2VGN A;  4A53 A;  4M75 A;  3VUZ A;  1G3W A;  1VQO Q;  1VIF A;  2GGR A;  1GFD A;  2DE0 X;  3UA7 A;  2L5Q A;  2VVK A;  3CCL Q;  2KMT A;  4MZM A;  3EGX A;  4AT1 B;  1NJI C;  2KRN A;  2VGM A;  4LE9 A;  2ZGW A;  2BTT A;  1RAD B;  1M1K U;  2JOY A;  1JO8 A;  2SRC A;  4XU2 A;  3U23 A;  3UF4 A;  4J6W A;  3E2U A;  1ZSZ C;  1VQ5 A;  1QVF P;  4IUP A;  5IXB A;  3G7Z A;  1AWO A;  4E6R A;  3GBQ A;  1K73 R;  2DZC A;  3MHX A;  2DAQ A;  4C5G A;  2DL3 A;  1IHV A;  1VOM A;  2DIL A;  1KD1 U;  1M2V B;  3DKM A;  4M78 D;  2A0F B;  2KT8 A;  3E1S A;  3M5A A;  1QP3 A;  3L2U A;  3CBM A;  2YRC A;  5FLX E;  4BB7 A;  3SB2 A;  1SRM A;  2ED1 A;  3RR6 A;  2DMO A;  3QDR B;  4HCB A;  2DEU A;  2DD4 A;  5ECA A;  3OYF A;  2XDB A;  1ZLM A;  2VXF A;  4N0A A;  1WPY A;  4HCZ A;  4M4Z A;  3C4S A;  4FYX B;  3OBY A;  4C8Q A;  1QKW A;  1I07 A;  1M27 C;  1TH7 A;  1XOV A;  1D3B B;  3RKX A;  1WFW A;  4A4H A;  3JCM P;  2CP7 A;  1ABO A;  1KQS P;  3TRE A;  2LRQ A;  5FRO A;  4PKC C;  1JXO A;  3EH2 A;  1Z9Q A;  2QAS A;  1Q82 U;  4C8Q G;  1AWJ A;  3JCM c;  4RG8 A;  1X2Q A;  2AK5 A;  1M1F A;  1R0B G;  3QHS A;  1ZSZ B;  1FX7 A;  3DB3 A;  1WHL A;  4M75 F;  3FDR A;  2C06 A;  4PJO D;  3PMI A;  2KRM A;  1Q7Y C;  4A4K A;  3RIR A;  3C0C A;  4RTW A;  2RA2 A;  4F17 A;  2EQJ A;  2HNI A;  2QEX A;  3H0F A;  3OW2 A;  2JM8 A;  2G3R A;  2CZ6 B;  2OAW A;  2LQN A;  2KSS A;  1G3T A;  5GAO m;  5IXF A;  4XTZ A;  2HD0 A;  3QPH A;  1NG2 A;  2HCK A;  1PKS A;  4Z8A A;  1QLY A;  1KJW A;  2M16 A;  2Y4X A;  4M7D C;  1Y71 A;  1M3A A;  5CR2 A;  4FW2 A;  3TSZ A;  1WXB A;  2DVE A;  3RES A;  4E2F B;  2ZPH B;  3QBY A;  1VQ5 T;  2HSP A;  2EQU A;  4KT0 E;  1E6G A;  4AMC A;  1U1T A;  2A08 A;  4C8Q F;  3OYE A;  3OYG A;  4PJJ A;  1NYF A;  1YP5 A;  3WVD B;  1MMG A;  1K9M C;  1WGS A;  4QW2 A;  4M77 G;  2QTX A;  2IG0 A;  4C5E A;  1ZUU A;  2O4X A;  4A4E A;  1WDX A;  2P84 A;  3OS0 A;  3I56 Q;  3CXC P;  3M0P A;  2E12 A;  4C0G A;  3NTK A;  3EH1 A;  2YWW A;  1YIJ Q;  5GAM g;  1VQN Q;  1G2B A;  3KUF A;  1V29 B;  4JRI A;  4KH1 B;  1X6B A;  4AG1 C;  4D6W A;  3E9F A;  1X69 A;  2FZG B;  3JCM g;  1G8X A;  4DBF A;  5GAN 7;  1YIT Q;  1PRL C;  4GBQ A;  4M7D B;  2KI7 A;  5FRN A;  1ZX6 A;  4ZGE B;  2DXT A;  3ME9 A;  3CME Q;  3NPF A;  2QA4 Q;  1W2B A;  3P8B B;  2KEA A;  4J83 A;  5GJV B;  3CC7 A;  2KY9 A;  2CP0 A;  4Q5W A;  1SF9 A;  4HCK A;  3G71 Q;  1UB4 A;  3EG9 B;  3TQ7 P;  3ASK A;  4IUQ A;  2E70 A;  2ED0 A;  2MOX A;  1EZZ B;  2ECZ A;  4DOW A;  1SSF A;  1VQ7 Q;  2COZ A;  1H8K A;  4CC4 B;  4D8K A;  4IUT A;  2PTK A;  3OMG A;  2QEX T;  2M0O A;  2NLU A;  2HQH A;  1JB0 E;  1M1K R;  2FPE A;  4M77 F;  2FB7 A;  2YSQ A;  2QK0 A;  3RKY A;  1NEB A;  3QZ9 B;  2XIC A;  1ZSG A;  4N4I A;  2V1R A;  2LCC A;  3VKI A;  3H41 A;  1KQ2 A;  4DEY A;  4BY6 C;  4RTT A;  1M3C A;  2WSC E;  4CI0 C;  2ROT A;  2RQR A;  1UHC A;  2FPD A;  2HQE A;  1KD1 R;  3CD6 A;  1IZ6 A;  4C92 E;  2QQ9 A;  1OZ2 A;  2X51 A;  2L3S A;  3Q1J A;  2OTL A;  1W1F A;  3RMQ A;  2O9S A;  3LH5 A;  1IGQ A;  1I4K 1;  3CBO A;  1D3B A;  1JBM A;  2YLB A;  3I9Q A;  5I2M A;  1VQM Q;  1TUD A;  6AT1 B;  1EFN A;  4GLM A;  4OP0 A;  2AT1 B;  2KVQ G;  4M78 C;  2DL7 A;  4FU6 A;  3CC2 A;  2JTM A;  2DLP A;  4P5N A;  1Y96 B;  4M7A E;  1ZSZ A;  4HVW A;  3UA6 A;  3G4S A;  1TOV A;  2YXY A;  1Q82 R;  2C0T A;  3CCL A;  1G83 A;  3HKS A;  2EVR A;  4DBQ A;  2X4Y A;  2OI3 A;  5FWB A;  2XKO C;  3M4Y A;  4FT2 A;  3UDC A;  1UFF A;  1UTI A;  2RNA A;  1I5L A;  2DF6 A;  4BY6 B;  2DKG A;  3GPL A;  4JJN K;  3WVE B;  3LH0 A;  4XTV A;  1UJ0 A;  2KDS A;  2XMF A;  2XU8 A;  4BDZ A;  3OY9 A;  2LZ6 B;  2XDP A;  2KR3 A;  5GAM h;  4F14 A;  3L2W A;  3OYJ A;  2XI9 A;  2ZPI B;  1J3T A;  2I2L A;  5IN1 A;  3CPW A;  1K73 U;  5CIU A;  4IKF A;  3CC7 T;  2LJ1 A;  2A3L A;  3VS7 A;  4PJO C;  2DXU A;  4XU3 A;  2LCL A;  3JCM h;  2DA9 A;  1B7T A;  3CCE Q;  2RJE A;  1WYX A;  1T3S A;  4A4F A;  3ER0 A;  2O9V A;  3X20 B;  2IIM A;  2HBW A;  5GMK h;  4M78 B;  1AVZ C;  4RG2 A;  2HEQ A;  3JCM b;  4JZ3 A;  2H3E B;  2F2V A;  4RCB A;  2KGT A;  1LJO A;  1M4Z A;  4KUD K;  3TSW A;  5I22 A;  1SKU B;  4MMK A;  1I81 A;  1D09 B;  1YJ9 Q;  2ATC B;  2F5K A;  1YJN A;  1N9R A;  3CD6 T;  5J39 A;  2FZK B;  1WQW A;  3FIF A;  2OTL T;  3G6E Q;  3RUX A;  2VV5 A;  3M56 A;  5HKC A;  4JPB W;  1WHG A;  3EG3 A;  2DXB A;  2ZPF B;  5I2S A;  2K7A A;  2JXB A;  1IO6 A;  4RTV A;  1QVG S;  4PJO B;  2AZS A;  4M7D A;  1D1C A;  1TTH B;  3MEW A;  3MCA B;  1OOT A;  4L6V 5;  1U3O A;  1MND A;  5CQX A;  5GAN 8;  3CC2 T;  2JJ9 A;  1CKB A;  3V8J A;  3L2V A;  2GFA A;  1RI9 A;  3JRZ A;  5GAN g;  2XHC A;  1FMK A;  4FSS A;  2E5K A;  1WHM A;  5KYY B;  3BE3 A;  3G4S T;  1Q81 U;  3EG9 A;  1U1S A;  3S3O A;  2YUN A;  3OW2 S;  3OSS C;  1LOJ A;  1KC8 R;  2X3W D;  4LDU A;  3CCL T;  2EQM A;  4JRQ A;  3JB9 G;  1AHJ B;  3JB9 I;  3DLL A;  1YWP A;  4KGX B;  3PVL A;  1VIE A;  3R6N A;  1ABQ A;  3EGD A;  1D0Z A;  1YHQ Q;  5KE2 A;  2RQW A;  3CPF A;  3QYH B;  3M54 A;  4RUG A;  5I21 A;  2LCS A;  2JUF A;  2RN8 A;  3MJX A;  1MUZ A;  3PNW C;  4CC7 A;  2HMA A;  4LDY A;  3NMZ C;  3OBW A;  1YJW Q;  4F04 B;  3JCM V;  3TU4 K;  2XD0 A;  3PE0 A;  4QVZ A;  2L89 A;  4LXC A;  2RI3 A;  4Z88 A;  1Q95 G;  1RI0 A;  4QVD A;  4IUV A;  2FPF A;  2EWN A;  2RJF A;  3VJP A;  2R5M A;  4D8D A;  4F7U B;  3KXT A;  3I56 A;  2D0Q B;  2RI5 A;  4JZ4 A;  2R5A A;  2KXD A;  3VU3 C;  4J9H A;  1YIJ A;  2F2X A;  2MK5 A;  2P4T A;  1FMW A;  2X4X A;  1VQN A;  3QG1 A;  3FLG A;  4LDV A;  1S72 A;  4EMK C;  2LP5 A;  1I0C A;  4E7I A;  2WSE E;  3L2R A; 
#chains in the Genus database with same CATH homology
 3CCS T;  3FDR A;  2C06 A;  4PJO D;  1K8A C;  3QKJ A;  1VQK A;  3UWN A;  5LJ5 h;  3PMI A;  5A0L A;  1Q86 C;  2DTH A;  4M7A G;  4F7U E;  5GMK l;  3A8G B;  1Q7Y C;  4A4K A;  1YIT A;  2E64 A;  5EG2 A;  1YJN T;  1YBY A;  3QJY A;  4M7D F;  3RIR A;  3VUB A;  1OYX A;  3CCM T;  5GAM j;  2QI2 A;  4BE1 A;  3OA6 A;  3I55 T;  2VXE A;  5GAM d;  3JCM J;  2RA2 A;  3NTI A;  4OB0 B;  3MP6 A;  4EPC A;  2EQJ A;  4J5Y A;  5CKD A;  1JJ2 S;  2HNI A;  3H8Z A;  5C6S A;  3QJ6 A;  3A8M B;  4MDX A;  1G3S A;  3F70 A;  4O5V A;  3CME A;  1W4S A;  5GAN 5;  1XNI A;  3QUI A;  4LD6 A;  2QA4 A;  2YRV A;  3X28 B;  4E47 A;  5GAN 2;  2QEX A;  3MEU A;  1UEB A;  4RMO A;  2DJZ A;  4X9C A;  4L5G A;  2DEQ A;  1NZ9 A;  3OW2 A;  1QVF S;  4HT9 A;  3GIB A;  3JCM d;  1QW1 A;  1XQH A;  4ZN1 A;  2G3R A;  3JCM e;  2CZ6 B;  2K3Y A;  4BE2 A;  3LYI A;  4M75 C;  1VQP T;  1M9S A;  3QO3 A;  4WF2 A;  2KSS A;  1G3T A;  5GMK j;  5GAO m;  4XAX B;  2L8D A;  4XTZ A;  2HD0 A;  2KK4 A;  3QPH A;  2K5I A;  2E6N A;  2P0P A;  3C12 A;  3CCU A;  4XTW A;  2E1H A;  3RKW A;  5GMK e;  4JS4 A;  3PIP A;  4VUB A;  1U8R A;  4KBM B;  2M16 A;  2Y4X A;  1VQ9 A;  4M7D C;  4LDW A;  1K73 C;  1VQ7 A;  2ZPE B;  2OTJ A;  2BIV A;  2X35 A;  5LJ3 d;  3CMA A;  2RH2 A;  2EAY A;  3SWN B;  4C92 F;  2XK0 A;  1WQ7 A;  1Y71 A;  2ZZD A;  4N4G A;  4DQ2 A;  3JB9 J;  4FL6 A;  5CR2 A;  2R57 A;  4M75 G;  3LGF A;  5LJ5 j;  3G6E T;  3CC4 T;  2DVE A;  2HQX A;  1H64 1;  4NL2 A;  3RES A;  3OYN A;  2DTI A;  2ZPH B;  3QBY A;  1B34 B;  1VQ5 T;  1BI2 A;  5LJ5 e;  2P0K A;  2O01 E;  2PUO B;  2EQU A;  4V2S A;  3PTA A;  2CGH A;  1VQO T;  2JVV A;  4E7J A;  4KT0 E;  4M7D G;  3LWH A;  1ZHI A;  3LGL A;  4MZT A;  2K3X A;  2GQV A;  4JS5 A;  4EMK B;  1U1T A;  2FL7 A;  4C8Q F;  3OYE A;  3OYG A;  1PSE A;  4M78 A;  5D6W A;  3WVD B;  2M9U A;  3R6O A;  2OAU A;  1K9M C;  1WGS A;  1G5V A;  1KQS S;  2B8A A;  4XK8 E;  4QW2 A;  5CAI A;  2EIF A;  5GAN h;  1M8V A;  4M77 G;  4HKE A;  1M90 U;  2QTX A;  2IG0 A;  3J81 E;  3RER A;  4C5E A;  4C0D C;  1K8A U;  3X25 B;  1VQ4 T;  2EJ9 A;  3JAM E;  2KAF A;  2O4X A;  1N6A A;  1Q86 U;  4C92 C;  4A4E A;  4BUG A;  1VQL T;  4M7A F;  2PQW A;  3OS0 A;  1Q7Y U;  2BUD A;  3NFC A;  1KQ1 A;  4NOY A;  4JRP A;  2E12 A;  4PL6 A;  4C0G A;  2LT1 A;  3NTK A;  3FJP A;  3DLM A;  4YTL A;  4QQD A;  4RCC A;  5C0M A;  5GAO n;  2EJG A;  4L59 A;  4M78 G;  5GAM g;  1M5Q 1;  4QQG A;  3HP9 A;  1YI2 T;  4IUU A;  3JCM W;  2XID A;  2KQW A;  3KUF A;  4N0A C;  1V29 B;  1I8F A;  2RHY A;  4M75 B;  5AYF A;  4C0F A;  4JRI A;  4C8Q C;  4MML A;  3M4G A;  2RI2 A;  3HL8 A;  4D6W A;  3E9F A;  5GAO p;  2YLC A;  1KG1 A;  1GXI E;  1Y07 A;  2LQK A;  3OMC A;  1XTD A;  3JCM g;  4BI4 A;  4ZGJ B;  3OYD A;  5GAN 7;  3BY7 A;  4MDW A;  3OS2 A;  4II1 A;  1YHQ T;  2MWP A;  2RO0 A;  1JJ2 A;  3MEA A;  4C5H A;  1JRI A;  4M7D B;  2PUK B;  3JCM f;  3I56 T;  5FRN A;  3M59 A;  4M7A C;  4O6J A;  2K5F A;  1R8O B;  3EAE A;  4J8O A;  3VYH B;  4ZGE B;  1N8R C;  2DXT A;  3OS1 A;  3ME9 A;  3V8K A;  1YIJ T;  3OS5 A;  1W2B A;  5IAY A;  3P8B B;  3OYK A;  4J83 A;  2RHX A;  1VQN T;  3MEV A;  2VC8 A;  3TEE A;  5LJ3 g;  3OYB A;  4M75 E;  3HRT A;  5CCA A;  2KY9 A;  3CC7 A;  3CCQ T;  1S72 T;  4PJO A;  4Q5W A;  4C5I A;  4BDY A;  2H3J A;  2K57 A;  3A8H B;  5GAN e;  3LX7 A;  1UB4 A;  4EMG A;  3JSC A;  3FEO A;  3CCR A;  1VQK T;  3ASK A;  2CKK A;  4IUQ A;  3SD4 A;  2E70 A;  1N27 A;  1QVG A;  4OF1 A;  4J6X A;  1PSF A;  3CCV A;  1YIT T;  2M1H A;  3S6W A;  2MF2 A;  3OQ5 A;  3SDZ A;  1M1G A;  1UGS B;  5A0D A;  5LJ5 f;  4DOW A;  1SSF A;  2LNV A;  3ZBD A;  4ZGD B;  3CBP A;  3J80 E;  3L2Z A;  4OB1 B;  5CQY A;  3OYA A;  4IUT A;  4PJO G;  4UC4 A;  3CCJ A;  4DA4 A;  1UGP B;  4C0D B;  3CME T;  2QA4 T;  3HPW A;  1K9M U;  3OMG A;  2RHZ A;  5A2Q E;  2QEX T;  2M0O A;  2NLU A;  4OGC A;  5CKE A;  1JB0 E;  3VYG A;  4BI3 A;  4C92 B;  2EJF A;  4M77 F;  2FB7 A;  5IT9 E;  2R58 A;  4XTU A;  1QVP A;  3V7C A;  3RKY A;  3UPU A;  4PLL A;  2MI6 A;  3CPW S;  3QZ9 B;  2XIC A;  3G71 A;  3CCE A;  3PMT A;  2PVG B;  4N4I A;  2LCC A;  3QSU A;  3VKI A;  5L8R E;  2FVU A;  3C94 A;  4FIB A;  3OYI A;  4LD9 K;  1KQ2 A;  4BD3 A;  3EFR A;  3CCU T;  1BYM A;  2ZPG B;  4BI8 B;  2E5Q A;  4XU1 A;  4M78 F;  1KQS A;  1VQ6 A;  3QXE B;  4BY6 C;  1ZBX A;  4C8Q B;  2LT4 A;  1VQ9 T;  1RL2 A;  2WSC E;  4CI0 C;  1KC8 C;  1VQ7 T;  2OTJ T;  2RD1 A;  2HQE A;  3LWI A;  3CMA T;  1IZ6 A;  3CD6 A;  4MZP A;  1BI1 A;  4C92 E;  2BKD N;  2QQ9 A;  5LL6 S;  1OZ2 A;  2QQS A;  2VYT A;  3Q1J A;  4KUL A;  2OTL A;  3RMQ A;  3CXC S;  3ZFJ A;  2QDY B;  2LC4 A;  3L1A A;  5CVI A;  4M7A B;  3QYG B;  4DOV A;  5GMK i;  1OZ3 A;  2QXF A;  4M77 C;  5LJ5 d;  2GF7 A;  1YJ9 A;  1I4K 1;  3CBO A;  2LVM A;  3NTH A;  1D3B A;  2QQB A;  1JBM A;  3V7R A;  3FC3 A;  2YLB A;  5I2M A;  5FRM A;  3BFM A;  3BDU A;  4OVA A;  4M75 D;  3MO8 A;  1ZQ1 A;  3H6Z A;  1QP2 A;  4C8Q E;  1O9S A;  1N8R U;  4OP0 A;  4C0Z A;  4F7U A;  3E9G A;  3FB9 A;  4J7F A;  2DTO A;  2KVQ G;  4M78 C;  4XU0 A;  4FU6 A;  4M7D D;  2DO3 A;  3CC2 A;  2JTM A;  1FWZ A;  2RK2 A;  2XG8 D;  3HHT B;  4P5N A;  1Y96 B;  3MP1 A;  5GAN 4;  4M7A E;  4CRI A;  3EFS A;  2K5L A;  3JB9 D;  1WJQ A;  4Z02 A;  2E65 A;  3BW1 A;  5GAN f;  4R55 A;  3G4S A;  3MET A;  1NPR A;  5GAO r;  2A7Y A;  4F7U G;  1KHC A;  2GCX A;  4XTY A;  5GAO l;  4BAC A;  5J3B A;  3M58 A;  1VQM A;  2EQK A;  2CZ1 B;  2LX9 A;  3CCL A;  3HKS A;  4PJO F;  2JN0 A;  2YHT A;  2X4Y A;  2MAM A;  2Y90 A;  3L2Q A;  4B9W A;  4IUR A;  3HRU A;  4OGE A;  1MHN A;  1G3Y A;  3URG A;  1BIB A;  2XKO C;  3M4Y A;  4FM4 B;  4FT2 A;  4X9D A;  3UDC A;  5KH6 A;  1O75 A;  1WJR A;  3GLX A;  2CS7 A;  3HFO A;  4J6Y A;  2WSF E;  3S3N A;  1I5L A;  5FU7 C;  3SFM A;  2DXC A;  2DKG A;  3L42 A;  3N5B B;  4BY6 B;  1UGR B;  3GPL A;  3WVE B;  3LH0 A;  4JJN K;  2PVO B;  3PT9 A;  4XTV A;  2KDS A;  2XU8 A;  3FRN A;  3HFN A;  3MP8 A;  1IRE B;  3O8V A;  2WAC A;  3OY9 A;  4BDZ A;  4C92 D;  3P8D A;  5CO7 A;  2XDP A;  1DJ7 B;  3X26 B;  2FYK A;  5GAM h;  1YCY A;  3X24 B;  3L2W A;  2RM4 A;  3OYJ A;  1KC8 U;  2XI9 A;  4XQ3 A;  2ZPI B;  1QVF A;  5M9O A;  2I2L A;  5IN1 A;  1H3Z A;  2RHU A;  3CPW A;  1K73 U;  2DIQ A;  5CIU A;  2AHJ B;  4IKF A;  1HXD A;  3CC7 T;  2A3L A;  3TCJ A;  4M77 B;  5GAN j;  4PJO C;  2DXU A;  4XU3 A;  5GAN d;  3PIO A;  2LCL A;  3CCR T;  3JCM h;  1X01 A;  1M1K C;  4HT8 A;  2JZ2 A;  1WJS A;  2RJE A;  3KBG A;  4Y28 E;  4C8Q D;  3OYY A;  3SWN A;  4JLG A;  4EDU A;  4A4F A;  3CCV T;  1BIA A;  2E6Z A;  3ER0 A;  5LJ5 g;  1VQ8 A;  2VUB A;  1NPP A;  3A8O B;  3X20 B;  1Q81 C;  4GLK A;  3J7A F;  4M7A A;  2XDD A;  4M7D E;  5GMK h;  5GAN 3;  2JNG A;  4M78 B;  2V8K A;  3A8L B;  4RG2 A;  5DM7 R;  4ATO A;  1B34 A;  3JCM b;  2DK3 A;  3CXC A;  3OYM A;  3CCJ T;  4M7A D;  2EYQ A;  4HA8 A;  5HY6 A;  4RCB A;  2K2V A;  2E10 A;  4KUI A;  5LJ3 h;  2LDM A;  1LJO A;  1M4Z A;  4KUD K;  4M77 E;  3M55 A;  5KE3 A;  3A5Z B;  4EMK A;  4PNO A;  2O4X B;  1KD1 C;  1NE8 A;  2MMP A;  1BI3 A;  3S3M A;  1KHI A;  1YJW A;  4MMK A;  3HSB A;  2GFU A;  4LDX A;  1I81 A;  2ZPB B;  3CCS A;  3G71 T;  3CCE T;  2Y4Y A;  4B9X A;  3OYC A;  2HAX A;  1Y96 A;  2V8I A;  3M53 A;  3GF5 A;  5CK9 A;  2F5K A;  3PGG A;  4JLI A;  5J26 A;  4M78 E;  1N9R A;  4OB3 B;  4F7U F;  1YJN A;  2DD5 A;  1VQ6 T;  3CCM A;  1FXX A;  2D9T A;  4ELY C;  4E7L A;  3DB4 A;  3I55 A;  5GAM e;  4XTX A;  3JB9 F;  2HBP A;  2EKO A;  4FSX A;  1UGQ B;  3CD6 T;  4JRK A;  3BDL A;  3V7S A;  3RMS A;  2K4Y A;  3OSV A;  5J39 A;  1WQW A;  5FU7 B;  3FIF A;  4OMF B;  3OB9 A;  1HK9 A;  2OTL T;  2P0Q A;  1WNL A;  2PU9 B;  1EIF A;  1P92 A;  3RUX A;  4N4H A;  2VV5 A;  4GY5 A;  1W2B S;  3M56 A;  2DIG A;  2X4W A;  2IVW A;  2RHI A;  2VGN A;  3C95 A;  5HKC A;  4A53 A;  5CKF A;  4M75 A;  4NL3 A;  3ZEH A;  3VUZ A;  2ZCF B;  2JTF A;  5FU6 C;  1G3W A;  2DXB A;  1YJ9 T;  4R56 A;  5DLQ E;  3VV0 A;  1VQP A;  2ZPF B;  5I2S A;  1VIF A;  4Y91 A;  2MWO A;  5KCH A;  1Y7X A;  2V8J A;  2L5Q A;  2KMT A;  4MZM A;  1QVG S;  4PJO B;  4M7D A;  2QQA A;  3MEW A;  1NJI C;  2LQ8 A;  1LNX A;  3MCA B;  3QZ5 B;  5LJ3 j;  2DZ9 A;  2VGM A;  4L6V 5;  2LTO A;  3OYL A;  1Q82 C;  2E41 A;  3JCM X;  4ME7 A;  5LJ3 e;  5CQX A;  5GAN 8;  3CC2 T;  2ZGW A;  3V8J A;  4TVR A;  3L2V A;  1BKB A;  2GFA A;  3JRZ A;  5GAN g;  1M1K U;  2JOY A;  4HCC A;  2XHC A;  4M77 A;  3G6E A;  3CC4 A;  4A54 A;  4OB2 B;  4XU2 A;  4J6W A;  3G4S T;  2F5T X;  1Q81 U;  1VQ5 A;  3PFS A;  3HRS A;  1U1S A;  3S3O A;  4IUP A;  3OW2 S;  3OSS C;  3UT1 A;  1LOJ A;  5HK3 A;  3V8L A;  4M77 D;  2PVD B;  3G7Z A;  4EMH A;  1VQO A;  3INZ A;  4PJO E;  1VQM T;  4ZTF A;  4LDU A;  3CCL T;  2L3R A;  1OI1 A;  2EQM A;  4J7I A;  2DZC A;  4JRQ A;  3MHX A;  1BI0 A;  4NS5 A;  3JB9 G;  2DAQ A;  4C5G A;  1AHJ B;  3GNG A;  4RKU E;  3JB9 I;  3DLL A;  2QQR A;  4E7K A;  1KD1 U;  1VIE A;  1X75 C;  2RJD A;  3DKM A;  4M78 D;  2D6F A;  3LW5 E;  5KE2 A;  3JB9 H;  3GOX A;  3E1S A;  2F69 A;  1QP3 A;  3M5A A;  4X34 A;  4C92 A;  5DY9 A;  3L2U A;  3CBM A;  5CKB A;  1X6O A;  5FLX E;  1MGQ A;  1VQ4 A;  3CPF A;  5GMK m;  3QYH B;  1VQL A;  2RB6 A;  3M54 A;  2EFI A;  4BB7 A;  5I21 A;  3SB2 A;  5D6Y A;  4ELZ C;  3CEY A;  3M9Q A;  4QQ6 A;  2JUF A;  3QII A;  3QDR B;  4HCB A;  1N9S A;  2DD4 A;  3OYF A;  4ZTJ A;  5D6X A;  2XDB A;  3PNW C;  5GAO q;  3E19 A;  4A4G A;  2CYZ B;  2CZ7 B;  2VXF A;  4N0A A;  4BE0 A;  3M57 A;  1WPY A;  2X4J A;  4HCZ A;  4LDY A;  5DLO A;  1YI2 A;  3C4S A;  5GAM f;  3OBY A;  3OBW A;  4C8Q A;  4PLI A;  5FU6 B;  3AHU A;  3JCM V;  4C92 G;  3TU4 K;  2XD0 A;  1TH7 A;  1XOV A;  3OYH A;  4QVZ A;  1D3B B;  3RKX A;  2RJC A;  2L89 A;  4A4H A;  3JCM P;  2RI3 A;  5A0G A;  1RI0 A;  4QVD A;  1YHQ A;  3SWN C;  1VQ8 T;  2DPP B;  3TRE A;  3GNF B;  4IUV A;  5GAN 6;  2LRQ A;  2EWN A;  5FRO A;  2RJF A;  4PKC C;  2R5M A;  3VJP A;  4F7U B;  3JCM Q;  3KXT A;  3GP8 A;  4FT4 A;  3I56 A;  2D0Q B;  2CZ0 B;  2RI5 A;  5CKH A;  4QVC A;  1VUB A;  2R5A A;  2RK1 A;  1NJI U;  3VU3 C;  1Q82 U;  4C8Q G;  1YIJ A;  4ZN3 A;  2FHD A;  3WXM B;  3JCM c;  4RG8 A;  2P4T A;  2X4X A;  4E7H A;  3T9N A;  1VQN A;  4JDS A;  3QG1 A;  1M1F A;  3FLG A;  4JUV A;  3QHS A;  4LDV A;  5HK0 A;  3CCQ A;  1FX7 A;  1YJW T;  3P8H A;  3DB3 A;  5KCO A;  1S72 A;  4M75 F;  4EMK C;  3LLR A;  4E7I A;  2WSE E;  1M90 C;  5LJ3 f;  3L2R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...