3OSSC

The crystal structure of enterotoxigenic escherichia coli gspc-gspd complex from the type ii secretion system
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
65
structure length
65
Chain Sequence
b'ETRLNVVLRGIAFGARPGAVIEEGGKQQVYLQGERLDSHNAVIEEINRDHVMLRYQGKIERLSLA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords TYPE 2 SECRETION SYSTEM, GSPC
molecule tags Protein transport
source organism Escherichia coli
publication title Structural and functional studies on the interaction of GspC and GspD in the type II secretion system.
pubmed doi rcsb
total genus 9
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2010-09-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.830 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3ossC00
2LC4A 2IVWA 3OSSC 2LNVA 2Y4XA 2Y4YA
chains in the Genus database with same CATH superfamily
2DRKA 1RADB 3I9QA 2MF2A 1M1FA 2JM8A 4XTZA 2NLUA 5L8RE 3H41A 1KQ2A 3OYAA 4M7AE 1NYGA 2JOYA 2E1HA 2CZ0B 2EYYA 3GOXA 5IHIA 2HKNA 1OU8A 1WQWA 1AEYA 2JUFA 2XU8A 3OYYA 1GXIE 2CT3A 5IT9E 4ESRA 1NM7A 1ABOA 5FU6B 3L2RA 1R77A 2EGAA 1HSQA 4RTYA 1BI3A 4M77B 2GQIA 4KUDK 4IIMA 3SD4A 3JB9H 2DTHA 2EQUA 2VV5A 3M58A 3OYGA 4Z88A 3RKXA 1TU0B 1ZLMA 2YDLA 3VS2A 2WACA 3QHSA 2DJQA 8AT1B 1UGVA 4XTYA 3X20B 5D6YA 1HJDA 5FRNA 2V1QA 1PM3A 2F69A 3QWYA 1LNXA 3JCMJ 3G4SA 2EBPA 2DK3A 1OZ3A 1VQ4A 1P92A 2OI3A 3ER0A 2DETA 3GP8A 2P84A 3R6OA 1VQ5T 3HKSA 4QQGA 2VYTA 3EGDA 4NL2A 2MIOA 5KYYA 4L5GA 1DJ7B 4C5HA 2PUKB 3OSVA 2RD1A 4CC2A 5IXFA 1WHJA 3E2UA 2ED1A 1D09B 4J7FA 2DXBA 1I8FA 4XTXA 1Q7YR 4BDZA 1I1JA 5LJ3g 3VS3A 3OBYA 2E3HA 3CCUQ 2MI6A 3C4SA 2RI5A 4E47A 1OULA 2MWOA 3V8LA 4A4KA 3CC7Q 4C8QB 5GANh 1JQQA 4FM4B 1IXDA 3LH5A 1UGQB 2YT6A 2DTIA 3RESA 5GANd 4R56A 4C0ZA 1VQ7Q 1PHTA 3NTIA 2OTJQ 3CCVQ 1MMAA 2F1LA 1RAEB 2EWNA 4F7UG 5GAN3 2YWWA 2P0KA 3BDLA 4LNPA 1YNZA 4FW2A 1NJIU 1CKAA 1M1KU 3C95A 1Q7YU 2DFUA 2D6FA 1U06A 3TEEA 3I56Q 1NLPC 1UEBA 1XQHA 1X27A 3EFRA 4XAXB 3L2VA 1ZSZA 4DBFA 1NEGA 2BZXA 2W10A 3E1SA 3M0SA 3HFNA 2XICA 3X26B 1T3SA 2L3PA 1VQLT 4E7SA 2CDTA 1KK7A 4A4EA 1X75C 5FRMA 4MDWA 1BKBA 3FLGA 1BYMA 4DQ2A 1YCYA 3GBQA 5FWCA 3DB4A 4J9FA 3M59A 3THKA 1KD1C 2DL5A 4AFUC 1K9MU 2DBKA 2YXYA 1JXOA 1R0CB 4B9XA 2CSIA 4C0FA 4RTVA 2CZ6B 4X9DA 5FU7C 2ZPBB 2BZ8A 1H3HA 1CKBA 5EG2A 2DZ9A 2CP5A 2DD5A 3S3NA 5I11A 2ZCFB 5GAN4 4JRIA 4LXCA 3MKDA 2RQTA 3CPWS 2K3YA 1QVGP 2LDMA 2EQMA 2EFIA 3VKIA 2XIDA 3V7RA 4M77E 3LWHA 3LX7A 3T9NA 1EFNA 1U5SA 3QWXX 4FYVB 4FCYA 2JVVA 4EMGA 3CCST 4M7AG 1OV3A 4OB3B 2OJ2A 2AKLA 4RMOA 4QQ6A 2B8AA 2L5QA 5KCHA 3JCMe 1W4SA 2K57A 3L1AA 5KYUA 1C6VX 1K9MR 3CXCS 1VQ7A 2AT1B 2E65A 1Q95G 2K9GA 4J6YA 4PLLA 4QVZA 3CCLQ 3OYIA 4M7AD 2M0OA 1W70A 2A36A 3JCMW 3OMGA 3NTHA 1KQSP 1OI1A 2RK2A 2J05A 4K11A 3CMET 1UUEA 2RJCA 4L6V5 3HRTA 4XTWA 2C0OA 1LJOA 4MMKA 2DAQA 3WVDB 2FG0A 2DMOA 1NZ9A 2NUTB 4OGEA 1FYNA 1SRLA 4OF1A 4KT0E 2ECZA 4KH1B 3CD6T 2FHDA 5GAN5 1WXBA 3GIBA 2BKDN 1VIEA 3SFMA 5GAN6 5GAMf 4PJJA 3ASKA 1WIEA 2MCNA 4LDYA 2J7IA 2KY9A 5KYXA 2WSFE 1AVZC 5DLQE 2ZPHB 2X35A 4J6XA 4M77C 4E7IA 1M90C 5LJ3h 1M1KC 2DE0X 3M54A 3QJ6A 1TS9A 2VXFA 4NOYA 1M2VA 2HQHA 3WVEB 5KYWA 4OMOA 3HRUA 2O4XB 3MP8A 1WHKA 4DBQA 1IHWA 3VV0A 3IQLA 1LVKA 2EJFA 3CC7A 2CYZB 2H8HA 4BB7A 1E6HA 4AFSC 4D8KA 1JB0E 1G3TA 2LRQA 2LQNA 4A4GA 1UE9A 2K6DA 1VQPQ 3KBGA 1YJWQ 3SHWA 1VYUA 2XKOC 3PMTA 1D3BA 1I4K1 3OW2P 3CPFA 4BD3A 3Q1JA 3JCMg 3CMAT 1RABB 5I2MA 1MGQA 3R6NA 4R55A 3L2UA 3RKYA 4IKFA 4M75F 4AG2C 2A7YA 3G1JA 1YWOA 3OB9A 1BCOA 2FPFA 3RMQA 3AHUA 1N8RU 3UPUA 1SF9A 4MZMA 2MPXC 2JXBA 1M3AA 3CC4A 2XDBA 1TXQA 2OTLA 2AZVA 1HD3A 2O31A 2C06A 2ABLA 2EJ9A 1JJ2P 4ELYC 1RACB 2RQRA 4N4IA 4UC4A 5GAOn 1ABQA 3H0HA 1Z9QA 2QQ9A 4J7IA 1KFZA 4FYYB 1PD1A 4HT8A 2ROTA 3FB9A 3PIPA 3S6WA 1B07A 4D8DA 3OMCA 6AT1B 1D1CA 3U23A 1N8RR 1GCQC 1ZHIA 2E10A 2QEXQ 2KI7A 2YLBA 2DNUA 5LJ3d 1AWOA 2ZGWA 5D6XA 1W2BS 3MEUA 1QVFS 4FSXA 2Y4XA 4J9BA 2E3IA 4F14A 4F04B 2ZPFB 1TOVA 3LH0A 3TSZA 1RAIB 2QYZA 4BI3A 4BE0A 3JCMd 2RHIA 2I2LA 2DO3A 4LDXA 2CP3A 1SSHA 1BBZA 1WJSA 2RF0A 4YTLA 4F17A 2JTFA 2DEQA 2RI2A 3M0UA 2YUNA 3OA6A 4M77D 3J7AF 1YJNA 2V26A 3TCJA 2RPNA 1XNIA 2EQIA 3M0QA 2CP7A 2QXFA 4HT9A 2QG9B 1YIJA 2V1RA 1GBRA 1FMKA 3J81E 3JCMb 1AT1B 1N9RA 3X28B 1QVFP 4XU1A 2PQWA 3OS2A 2EW3A 3CCVT 2DLPA 1RLQC 3O8VA 1VQ7T 1T3LA 1B3QA 1D3BB 1IZ6A 2FRYA 1KHIA 3MO8A 2CS7A 2K5LA 1AZEA 1H92A 4IUTA 2QDLA 1Q86U 3X24B 1XJWB 4X1VA 1SG5A 5CO7A 4ZNXA 5GAMe 7AT1B 1YJ9A 1K0SA 2DM1A 3CQTA 1OOTA 2QQSA 3NPFA 1VQ9Q 5KH6A 2GGRA 2GTOA 2KT1A 1PNJA 4M77G 2H3EB 3CCJA 4HCZA 5CKHA 1WFWA 1M2VB 2D8JA 2DRMA 2J6OA 2WSCE 4M75G 1WLPB 1YI2T 4LE9A 4C5IA 2VGMA 2CZ1B 1W1FA 3EFOA 2LQKA 4J9HA 1OZ2A 1O9SA 2DZCA 4PNOA 5GAMj 2FB7A 1KD1R 2H3JA 4O5VA 3EGXB 2K5IA 3CCRQ 4FT2A 4AMCA 4M75B 1PC0A 4M7DD 1H641 2A37A 1BI0A 1OX8A 1EIFA 2LJ3A 1YJWA 1PCXA 4JPBW 3RBBB 2ESWA 2YUPA 2RQWA 2K2VA 5A0DA 1M9SA 1Q82R 1PSEA 3HL8A 4PJOC 1SRMA 1KSWA 3HSBA 3FJ5A 2E5QA 3EFSA 3MPUB 4M7DC 2LX7A 1HXDA 1D1BA 3PMIA 4JRPA 1JO8A 3RERA 2L3SA 1MMDA 1AWJA 1PRMC 1YHQA 1ZA2B 2WSEE 2DIGA 5LJ5e 1S72A 1Y96B 1QWFA 3URGA 4BUGA 4F7UB 3VU3C 4XTVA 1K9AA 4FYWB 1C0MA 5KYWB 2DJZA 2JT4A 5CVIA 1Y71A 3PVLA 1YIJQ 1NPPA 1IRXA 1RI9A 2BUDA 2EYQA 4N0AA 2PZ1A 4IURA 2YSQA 1SHFA 2JTMA 4OMMA 4WCIA 3BW1A 3E9FA 3OS1A 1BB9A 2SRCA 2LJ1A 4JZ4A 4KRTA 5KCOA 3EG9B 3QSUA 5GMKl 3OS0A 1I07A 4F16A 1N27A 2DF6A 2EYZA 4C8QD 3NTKA 1XOVA 2CKKA 9ATCB 2QDYB 2LTOA 1RAGB 4RG2A 2HZYA 3M9QA 3QG1A 3M0RA 1M2OA 2MMPA 4ZGJB 4TVRA 4BI8B 2YRCA 4HVUA 4M7DG 2DBMA 2BTTA 2DTOA 3VUBA 3LLRA 1X6GA 3SDZA 3CD6Q 1R0BG 1VQMA 1IO6A 3HPWA 4C8QC 5GMKm 2XD0A 3CCQA 1PKSA 5A0LA 4JRQA 4RUGA 1VQOT 1K73R 4E7JA 4RTXA 2MK5A 4HVWA 1YN8A 1Q81C 5FU6C 1BCMA 1SSFA 1RL2A 1AZGB 4JZ3A 2L2PA 1ZA1B 3CMEQ 1BI1A 1YHQT 2EGEA 2HSPA 2X4YA 3VS1A 3RUXA 3TQ7P 4N0AC 3CCLT 2KRMA 1LPLA 4DEYA 3FC3A 2DVJA 1VIFA 4A4FA 2BE9B 4C0DC 1UHFA 2LCLA 2GFAA 4AFQC 2PVOB 2X4JA 3EG0A 2HBWA 3LGFA 4M75E 2DA9A 2ZPGB 4BE2A 3CCUA 1M5Q1 1GCQA 4VUBA 4IIOA 2L8DA 3RNJA 2CP2A 1D1AA 3GNFB 5D7UA 2FVUA 2KDSA 4MZPA 3CCSQ 3HHTB 1AWWA 5DLOA 2XK0A 1WYXA 3GLXA 4C8QF 5FU7B 1G2BA 5CKFA 1IB8A 4M4ZA 2QASA 3REAB 4JJNK 5CIUA 3FDRA 4AT1B 2DYIA 3DLLA 4OMFB 3ZFJA 1IGQA 3V7CA 1V1CA 3G71Q 4DOVA 4FYXB 2QQBA 2LMJA 3H0IA 2V8JA 3OYNA 1LOJA 4M75A 5KYXB 4RG8A 3M53A 2E6NA 1JEGA 2CUDA 3RIRA 4B9WA 4IUUA 4PK4A 2QQRA 1SEMA 4OMQA 4PLIA 1HK9A 4M77A 2RB6A 2GBQA 1VQLQ 2XDPA 5CQYA 4N4HA 4QT7A 2K4YA 4C92F 5IHKA 1YJ9T 3BE3A 1QCNA 2HMAA 1J3TA 2MYSA 4A63B 1KQSS 4CC3A 3F70A 4ZN3A 3I56T 1JRIA 3ME9A 1VQ6T 2GCXA 1E7OA 2RMOA 5C6SA 1UGSB 2JW4A 2PNIA 3UF4A 1TG0A 3VYHB 1UFFA 2O9VA 3PTAA 1X43A 2NUPA 1I5OB 5DM7R 2I0NA 1YHQQ 3CCET 2OTJT 2YLCA 5FWBA 1TUGB 2GF7A 4DBHA 3G7ZA 4WTOB 3I5SA 3HP9A 4M78F 3MHXA 1RAAB 1VQOQ 5GANj 2DD4A 3CMAA 1WHLA 2EGCA 5A0GA 5J39A 1WJQA 2RJDA 2VASA 2K79A 5AT1B 2ROLA 5IXBA 1YJNT 5ECAA 2PUOB 1ARKA 4L59A 3V7SA 3HTRA 5GANe 4DA4A 3CPWP 1VQNQ 3TU4K 3UATA 2FO0A 2LNHB 3PVQA 1K1ZA 1WI7A 3FIFA 3EGXA 5I22A 4OB0B 1GRIA 2MAMA 4WF2A 4HVVA 2YUOA 2P4TA 3EH1A 3OYMA 3JCMc 1OPLA 4E7HA 1YITQ 1K9MC 1IREB 3H0FA 2A0FB 4DEXA 1W2BA 2M9UA 1QVFA 1OQKA 3DB3A 4J9EA 3JV3A 1ZQ1A 3CCEA 1WDXA 2DL7A 4QQDA 2KYBA 5LJ5j 1M8MA 2HQEA 1WQ7A 2D9TA 1M3BA 2HSEB 3M4GA 4XTUA 2X3WD 4J9IA 5LL6S 3CC2T 3OYLA 1N8RC 3OS5A 2Y4YA 4J8OA 4EMKA 1K73C 4FL6A 1UDLA 3ULRB 1GFDA 2QA4T 4OVAA 2HEQA 3REBB 1V76A 3EH2A 3VRYA 5CKDA 1Q82U 2J6KA 1ZBXA 3OQ5A 3WXMB 4C5GA 1LCKA 3RMSA 1Y07A 2EIFA 2O4XA 1S1NA 2OTJA 3OY9A 2ATCB 1N6AA 2YHTA 3CC4T 3EG1A 3QO3A 1FMVA 1X6OA 4HKEA 1KD1U 2EVRA 3CC2Q 3I56A 2DX1A 2RH2A 1UGPB 3PT9A 1MMGA 1MV3A 3M56A 1MMNA 1UGRB 2VXEA 3OBWA 1M4ZA 5D6WA 5J26A 2O9SA 1IHVA 2K3XA 3PIOA 2KRNA 3CCRT 2QK0A 1SPKA 3A8LB 4KULA 4EDUA 2LT4A 1WA7A 3VYGA 4PJOD 1QVGA 3KFVA 3MCAB 2PVGB 1Q7YC 4RCCA 2IPOB 1QW1A 1Q86R 2F5TX 2VVKA 4QKUA 5GMKi 1PRLC 4J9CA 2SEMA 1YI2Q 1KC8U 1OPKA 3QIIA 1Q86C 4M78G 1X2QA 4QVCA 5KYNA 4EPCA 1VQNA 4NL3A 1VQPA 2LC4A 1K8AR 1G8XA 4RTTA 1O75A 3UDCA 4E7KA 1VQ9T 2LP5A 2EQKA 1YJNQ 2FPDA 3M57A 1GFCA 3P8DA 1VQOA 3BDUA 2OAUA 3M0PA 3G71A 3CD6A 2C0TA 2QTXA 1UB4A 5I21A 3G6EQ 4OMNA 4Y28E 4LDUA 5HK0A 3EGUA 1ACMB 1I81A 2LVMA 3FEOA 4OMPA 4PKCC 1X2KA 2GNCA 1BIBA 3LYIA 3A8MB 2M51A 2QGGA 5A2QE 1KC8C 2M0YA 5IN1A 1PKTA 1RUWA 2X3XD 2EYWA 2L3QA 1C1AA 1I0CA 1VQ8A 1RAFB 2EYXA 3MP6A 1OEBA 5LJ5g 4PJOB 3MEWA 3VS7A 2AKKA 4GY5A 3HFOA 3CCQT 2VGNA 4GBQA 2OTLQ 1VQMT 2E5KA 3LGLA 1A0NB 5IAYA 4KH0B 4PFZA 5GAN7 2KYMA 4PL6A 5IHNA 1X01A 3L2ZA 1ZUYA 1WXTA 4QW2A 2DVEA 3NMZC 2NUPB 2O88A 1JBMA 3GF5A 1VQ4Q 3UA6A 2HL3A 2LT1A 1AD5A 3G71T 1K8AC 4M7DF 3OW2A 1VQ8T 3SWNA 4CC7A 2O2OA 2QEXT 1S72T 5CR2A 2G6FX 4V2SA 2DILA 2MOXA 3JCMP 2NWMA 4QVDA 1B7TA 3AT1B 5GAOl 4PJOG 4ZTJA 3OSSC 4C92C 2JJ9A 2DEUA 2YRDA 2JTEA 4RTWA 2BE7D 4C92A 5HKCA 2JNGA 1Q81U 1NYFA 2CGHA 4ZN1A 2RJFA 4LN2A 1VQLA 2RA2A 2L0AA 2E64A 3SB2A 3D7SB 5LJ3e 3A8HB 2X51A 2JN0A 3P8BB 3PFSA 2A08A 2CT4A 3JCMV 5LJ5d 2DXTA 3M0TA 1VQ9A 2Z0WA 3I55Q 2IVWA 1M1KR 4C0GA 1X69A 4C92D 3INZA 2D0NA 3J80E 4KUIA 1KHCA 1G3YA 4PJLA 2LJ0A 3EAEA 3BFMA 3JB9I 3OYEA 4CI0C 2FRWA 3CEYA 1B34B 2KVQG 4X9CA 4X34A 1JU5C 2OAWA 3M5AA 3NFCA 1YJWT 1D0XA 1G5VA 4J6WA 1KQ1A 3JCMX 3SEMA 3VS0A 4OB2B 1QVGS 2HDAA 4JS4A 3M4YA 3VS6A 3CCRA 4Z02A 2KGTA 4ANJA 4E6RA 1PWTA 4M7DA 3H9NA 4F7UE 1BK2A 1JJ2S 2HAXA 4M75C 1M8VA 1OYXA 2A3LA 2E12A 2FYKA 1E6GA 4J9DA 5EC7A 1FMWA 4R0KA 3MJXA 3JAME 1WHHA 3QUIA 1WHGA 2O01E 3A98A 4O6JA 1WXUA 1Y96A 4OP0A 1YI2A 1N5ZA 4HCBA 3BY7A 5M9OA 1QKWA 2B86A 3CCVA 2EJGA 3I35A 3PGGA 3CCMT 2DL3A 2M02A 5GAN8 4MZTA 5GMKe 2DYBA 2GQVA 4BACA 1YIJT 2F2WA 3G6EA 2RHZA 3CBOA 3RKWA 4CC4B 1GBQA 4EIKA 2EPDA 3JCMf 1FWZA 2GTJA 5GMKh 3KXTA 3GNGA 4ATOA 2C0IA 3MEAA 4DOWA 2DXUA 3TREA 4C92E 4C8QG 4JUVA 3I55T 1NJIC 4NS5A 1TUCA 1QKXA 4AFZC 2RO0A 4IUPA 2JS2A 2AK5A 5FROA 3S3OA 2E4HA 3QJYA 4C8QA 2CUBA 1K76A 1CSKA 2ED0A 4EMHA 4FU6A 5L23A 1WX6A 1K4US 2COYA 2LQWA 1V29B 4FT4A 4JS5A 4B6MA 1HYOA 5CKBA 8ATCB 1T0HA 5GJWB 3CBMA 2CSQA 4HA8A 1XTDA 4AG1C 3OYFA 3SWNC 3DKMA 4PJOA 2P4RA 4BI4A 1TWBA 1WZOA 1ZBJA 4GLKA 2R58A 2RQUA 4IUQA 3S3MA 2G3RA 1VQ8Q 1VQKQ 1M90R 3OW2S 3VS5A 4E2FB 4II1A 3JB9F 1G3WA 2OX7A 2RN8A 2FL7A 3KUFA 5GJVB 1K73U 2E6ZA 3RR6A 4OMLA 3CCMA 4M78C 3NGPA 5CKEA 5I2SA 5GAMh 1Y0MA 3OYBA 4M7AC 2HBPA 1VQMQ 2OTLT 2CP6A 1JXMA 2XI9A 3A1PA 2JMAA 4Z8AA 1Y57A 2FZCB 2LNVA 2PVDB 2COWA 2BIVA 3EG3A 1NJIR 1QLYA 1SHGA 1GCPA 2HKQB 1Z9ZA 2V8IA 4Y92A 3EFOB 1ZSGA 2LCCA 2D8HA 2KR3A 1ZUKA 2AZSA 4DBRA 1G3SA 4ZGDB 1RI0A 3EGDB 4M7AF 3QYGB 4OB1B 3QZ5B 1WPYA 2VUBA 4OGCA 3CC7T 4KGZB 2JS0A 2XDDA 3CCUT 1QCOA 5AYFA 5HCKA 2AIRB 4PFOA 1WGSA 2Y90A 3H6ZA 1BIAA 1NPRA 1KG1A 2LX9A 4XU3A 1H8KA 1KC8R 3JSCA 1NE8A 2RQVA 2XMFA 4M7DE 1G83A 4FW1A 4FSSA 2RHYA 2KBTA 4JJBA 2HL5C 2E41A 4BDYA 1ZX6A 1WHMA 3PNWC 2QEXA 3CBPA 1VUBA 2KNBB 3A8OB 3MP1A 2E70A 2YUQA 4C92G 1JJ2A 2R5MA 4C92B 4M78A 2XHCA 4M78B 4LUEA 2ZZDA 1KQSA 5LJ5h 3JB9D 1VQKT 3JB9J 4ELZC 1M30A 2K3BA 4M7AB 3X25B 2CH4W 2KROA 4KGVB 4PJOE 1X6BA 2PTKA 2ZAEA 1YP5A 2NUTA 2EKOA 2RHUA 3META 1VOMA 1NEBA 3H8ZA 2GFUA 1YFNA 1FXXA 2PU9B 3C12A 3TVTA 3A8GB 3L42A 3QYHB 4LD9K 1D0YA 3M55A 1TTHB 5KE2A 3L2WA 3RDVA 2F2VA 4XU2A 4A4HA 1Q81R 4RTUA 5C0MA 4LDWA 1UJ0A 4PJMA 1F1BB 2J06A 2YRVA 4GLMA 1BU1A 4E7ZA 2M16A 1FX7A 2KMTA 3CCSA 2ZPEB 4PJNA 3UWNA 4RTZA 5GAN2 3CMEA 3LW5E 2QA4Q 2VKNA 4M7AA 1K0XA 1WJRA 2KE9A 2P0QA 4PJOF 1KIKA 4ME7A 3CXCP 2QAZA 1TSFA 3CMAQ 2D0QB 4JLIA 5CQXA 5GAMg 4XQ3A 1WNLA 3E19A 5GAOp 1IGUA 4JRKA 4XK8E 2RI3A 1VQPT 2RJEA 2DL8A 1MHNA 3CCMQ 1Q82C 1EZZB 3E9GA 3NHNA 4A54A 4RKUE 1UJYA 4JDSA 1GL5A 2DERA 2QQAA 2JM9A 2QTVA 4A53A 3JB9G 3FRNA 1AHJB 5GAOr 1YITT 1YWPA 2K2MA 2FZKB 4LD6A 2DIQA 1QQJA 1TUDA 4F7UF 1T0JA 5GANg 4HCKA 1NLOC 1MNEA 2CH4A 2AHJB 2JZ2A 3QDFA 1VYVA 2KSSA 3QZ9B 1YITA 3A5ZB 1VQNT 2HD0A 4Q5WA 1SKUB 4HXJA 4ORZA 3CXCA 1ZSZB 4XU0A 4M7DB 2X4XA 1AOJA 2EKHA 4PFPA 3N5BB 3UA7A 1D0ZA 4Z89A 3TSWA 2KEAA 4FIBA 2FPEA 5KYUB 1W2BP 1UG1A 4MDXA 2FEIA 3ZBDA 1M90U 4D6WA 2R57A 4J83A 4M78E 1EX4A 3CCJT 3CCEQ 2QA4A 3DLMA 3LWIA 4M78D 2DKGA 1VQ5A 1VQ6Q 2KRSA 3SWNB 5KE3A 1ZUUA 1OX9A 1VYTA 1RAHB 1UTIA 2XG8D 5CAIA 3G4ST 1YJ9Q 4C5EA 3OYHA 3OYKA 1N9SA 3ZL7C 1KJWA 4C0DB 4P5NA 5LJ3f 2QGFB 1U8RA 3I5RA 2J6FA 1W6XA 2VC8A 5DY9A 2MWPA 4BY6C 5GAOm 2M1HA 3HRSA 1H3ZA 3V8JA 1MV0B 3OYCA 1S72Q 2RM4A 1M1GA 2KQWA 2FZGB 2CP0A 2RNAA 3MEVA 5GAOq 3CC2A 3OYJA 4LUDA 4ZTFA 3QDRB 5FW9A 1VQKA 4BE1A 1VQ4T 1PD0A 3VS4A 4RCBA 1RLPC 2NUZA 2KAFA 2BZYA 2HNIA 3EG9A 2HCKA 3GPLA 1AWXA 2ZPIB 2LQ8A 4J5YA 4EMKC 2DPPB 5CCAA 3L2QA 2JMCA 4N4GA 4CRIA 5HK3A 1QP2A 1MNDA 1QP3A 3CCQQ 4HCCA 2LZ6B 1B34A 5J3BA 4LDVA 1M3CA 3G4SQ 3EHRA 1UECA 1YCSB 1U1TA 1BI2A 4Y91A 2R5AA 2KT8A 2HQXA 1TH7A 2LCSA 1U1SA 3OYDA 3I55A 1QVPA 4F7UA 2COZA 4EMKB 2KXDA 1ZSZC 4KGXB 2K5FA 5CK9A 1PSFA 2VB6A 3QXEB 3QBYA 3CCJQ 3JRZA 4J9GA 2P0PA 2VWFA 1QCFA 3PE0A 3C94A 3VRZA 1M27C 2IIMA 5LJ5f 3G6ET 4JJCA 3ZEHA 2RHXA 3EG2A 4JJDA 2EAYA 2W0ZA 4ZGEB 3VJPA 3QKJA 3QPHA 1Y7XA 2X4WA 2L3RA 1U3OA 2D1XA 4M75D 4M77F 1MUZA 2A28A 2EQJA 3V8KA 5HY6A 1OU9A 1VA7A 1VQ5Q 1VQ6A 2KXCA 3P8HA 1K8AU 2IG0A 3JCMh 4C8QE 5GAMd 3UT1A 1R8OB 4KBMB 2V8KA 2DXCA 2NYSA 2CZ7B 2X9HA 4IUVA 4BY6B 4MMLA 1QMCA 1QWEA 1PG5B 2RK1A 2K7AA 4JLGA 1NBEB 2DL4A 1NG2A 3EHQA 5GANf 2F2XA 3C0CA 1I5LA 2F5KA 5KYYB 2QI2A 2CREA 2KK4A 5IH2A 5LJ3j 5GMKj 4E7LA 2L89A 3FJPA 3CCLA 1UHCA 5FLXE 1YBYA 2ENMA 3VUZA 3JCMQ 3CC4Q 3O5ZA 3CPWA
chains in the Genus database with same CATH topology
1YIJA 2QA4T 4OVAA 1G3SA 3J81E 3JCMb 1N9RA 4ZGDB 1RI0A 3X28B 4M7AF 2MF2A 1M1FA 4XU1A 4XTZA 2PQWA 5CKDA 3OS2A 1Q82U 1ZBXA 2NLUA 3OQ5A 5L8RE 3WXMB 4C5GA 3OYAA 1KQ2A 3RMSA 3QYGB 1Y07A 4OB1B 2EIFA 3CCVT 4M7AE 2O4XA 2JOYA 3O8VA 2E1HA 1WPYA 3QZ5B 1VQ7T 2CZ0B 1D3BB 2OTJA 3GOXA 3OY9A 1IZ6A 2VUBA 4OGCA 1KHIA 1N6AA 3MO8A 2CS7A 3CC7T 1WQWA 2K5LA 2YHTA 3CC4T 4IUTA 2XDDA 2JUFA 2XU8A 3OYYA 3CCUT 1Q86U 3QO3A 5AYFA 1GXIE 3X24B 5IT9E 1X6OA 4HKEA 1KD1U 1WGSA 5FU6B 3L2RA 2Y90A 3H6ZA 1BIAA 5CO7A 3I56A 1NPRA 1BI3A 2RH2A 1UGPB 4M77B 5GAMe 1KG1A 2LX9A 4XU3A 3PT9A 4KUDK 3SD4A 3JB9H 1YJ9A 2DTHA 2EQUA 3M56A 3JSCA 1UGRB 2VV5A 1NE8A 2QQSA 1M4ZA 2VXEA 3M58A 3OBWA 3OYGA 3RKXA 5D6WA 5J26A 5KH6A 4M7DE 2K3XA 3PIOA 2RHYA 4M77G 3CCRT 2WACA 3CCJA 2E41A 3QHSA 3A8LB 4HCZA 4KULA 5CKHA 4BDYA 4EDUA 3PNWC 2LT4A 2QEXA 3CBPA 1VUBA 3VYGA 4PJOD 3A8OB 3MP1A 2E70A 1QVGA 3MCAB 4C92G 4XTYA 3X20B 1JJ2A 2PVGB 5D6YA 1Q7YC 4RCCA 2R5MA 1QW1A 2WSCE 4M75G 5FRNA 2F5TX 4M78A 4C92B 1YI2T 4C5IA 2XHCA 2VGMA 5GMKi 4M78B 2CZ1B 2F69A 3JCMJ 1LNXA 3G4SA 2ZZDA 2DK3A 1KQSA 1OZ3A 1VQ4A 1P92A 5LJ5h 3JB9D 3JB9J 3ER0A 4ELZC 1KC8U 1VQKT 3GP8A 4M7AB 3QIIA 2LQKA 3R6OA 1OZ2A 1Q86C 1O9SA 2DZCA 1VQ5T 3HKSA 4PNOA 4M78G 3X25B 4QQGA 2VYTA 5GAMj 2FB7A 4NL2A 4PJOE 2H3JA 4QVCA 4O5VA 4EPCA 1VQNA 4NL3A 1VQPA 2LC4A 2K5IA 4L5GA 2EKOA 4FT2A 2RHUA 1O75A 3META 1DJ7B 4C5HA 4M75B 3H8ZA 3UDCA 4M7DD 2PUKB 2GFUA 2PU9B 1FXXA 3C12A 4E7KA 1H641 3A8GB 3OSVA 2RD1A 2EQKA 3L42A 1BI0A 3QYHB 1EIFA 3M57A 4LD9K 3M55A 3P8DA 4J7FA 2DXBA 5KE2A 3L2WA 1YJWA 1VQOA 1I8FA 3BDUA 2OAUA 4XTXA 3G71A 4BDZA 4XU2A 4A4HA 3CD6A 2QTXA 1UB4A 5LJ3g 5I21A 3OBYA 4Y28E 4LDUA 5C0MA 5HK0A 2MI6A 3C4SA 2RI5A 4LDWA 2K2VA 4E47A 5A0DA 2MWOA 1I81A 2LVMA 1M9SA 3FEOA 4PKCC 3V8LA 4A4KA 4C8QB 5GANh 1BIBA 2YRVA 1PSEA 3LYIA 4FM4B 3RESA 1UGQB 3A8MB 2DTIA 2M16A 3HL8A 1FX7A 2KMTA 5GANd 4C0ZA 4R56A 3CCSA 3HSBA 4PJOC 2E5QA 3EFSA 3NTIA 5A2QE 1KC8C 2ZPEB 4M7DC 3UWNA 2EWNA 5GAN2 1HXDA 4F7UG 5GAN3 2P0KA 3BDLA 3PMIA 4JRPA 3RERA 3CMEA 3LW5E 1NJIU 5IN1A 1YHQA 1M1KU 2WSEE 2DIGA 5LJ5e 1S72A 1Y96B 3C95A 1Q7YU 3URGA 2D6FA 4M7AA 3TEEA 4BUGA 4F7UB 1WJRA 1VQ8A 3VU3C 1UEBA 1XQHA 2P0QA 4PJOF 4ME7A 3MP6A 3EFRA 4XAXB 4XTVA 5LJ5g 3L2VA 4PJOB 2D0QB 3MEWA 3E1SA 4JLIA 2DJZA 5CQXA 5CVIA 3HFNA 2XICA 3X26B 4GY5A 4XQ3A 5GAMg 1Y71A 3HFOA 1WNLA 1NPPA 3CCQT 1VQLT 2EYQA 2BUDA 3E19A 1X75C 4N0AA 4A4EA 2VGNA 4MDWA 5GAOp 4JRKA 5FRMA 4XK8E 4IURA 2RI3A 1VQPT 2RJEA 1VQMT 1BKBA 2JTMA 3FLGA 4DQ2A 1MHNA 1BYMA 1Q82C 3E9GA 1YCYA 3LGLA 3DB4A 4A54A 3BW1A 3E9FA 4RKUE 3M59A 5IAYA 1KD1C 5GAN7 3OS1A 1K9MU 4JDSA 2QQAA 4PL6A 1X01A 3L2ZA 4B9XA 4QW2A 4A53A 3FRNA 3JB9G 2DVEA 1AHJB 4C0FA 5KCOA 5GAOr 1YITT 3QSUA 2CZ6B 5GMKl 3OS0A 1JBMA 3GF5A 4X9DA 5FU7C 2ZPBB 4LD6A 1N27A 2LT1A 4M7DF 3G71T 1K8AC 5EG2A 2DZ9A 4C8QD 2DIQA 2DD5A 3NTKA 3OW2A 3S3NA 1XOVA 4F7UF 2CKKA 1VQ8T 3SWNA 2ZCFB 2QDYB 2LTOA 5GAN4 2QEXT 5GANg 4JRIA 4RG2A 2AHJB 3CPWS 1S72T 3M9QA 2JZ2A 5CR2A 2KSSA 3QG1A 4V2SA 3QZ9B 2K3YA 2MMPA 3JCMP 1YITA 2LDMA 4ZGJB 4TVRA 4BI8B 2EQMA 2EFIA 4QVDA 3A5ZB 3VKIA 1VQNT 2XIDA 5GAOl 4PJOG 2HD0A 3V7RA 4M77E 4Q5WA 3LX7A 3T9NA 3OSSC 4C92C 3LWHA 4ZTJA 4M7DG 2DTOA 2JVVA 4EMGA 5HKCA 3CCST 3VUBA 3LLRA 4C92A 3CXCA 4XU0A 4M7AG 2JNGA 4OB3B 4M7DB 3SDZA 1Q81U 2X4XA 1VQMA 4C8QC 3HPWA 5GMKm 4RMOA 4QQ6A 2CGHA 3N5BB 4ZN1A 2B8AA 2RJFA 2L5QA 5KCHA 3JCMe 1VQLA 2RA2A 2XD0A 2E64A 3SB2A 1W4SA 2K57A 3L1AA 3CCQA 4FIBA 5LJ3e 3A8HB 5A0LA 2JN0A 3CXCS 4MDXA 4JRQA 1VQOT 1VQ7A 3P8BB 3PFSA 2E65A 4QVZA 4PLLA 4J6YA 3ZBDA 4E7JA 1M90U 3JCMV 4D6WA 1Q81C 5FU6C 2R57A 3OYIA 1SSFA 1RL2A 4J83A 4M78E 5LJ5d 2DXTA 4M7AD 1VQ9A 2M0OA 3CCJT 3JCMW 1BI1A 3OMGA 1YHQT 2IVWA 3NTHA 2QA4A 1OI1A 2RK2A 4C0GA 3CMET 4C92D 2RJCA 2X4YA 3INZA 3J80E 3DLMA 4KUIA 4L6V5 1KHCA 1G3YA 3HRTA 3RUXA 4N0AC 3LWIA 4XTWA 3EAEA 4M78D 3CCLT 2DKGA 3BFMA 4MMKA 1LJOA 3JB9I 2DAQA 4CI0C 3OYEA 3FC3A 1VQ5A 1VIFA 3WVDB 4A4FA 3SWNB 3CEYA 4C0DC 5KE3A 1B34B 2GFAA 1NZ9A 2KVQG 2LCLA 2PVOB 2X4JA 3LGFA 4OGEA 4M75E 4OF1A 2XG8D 2ZPGB 5CAIA 1M5Q1 3G4ST 4VUBA 3CCUA 4X9CA 4C5EA 4BE2A 2L8DA 4KT0E 4X34A 3OYHA 3M5AA 3CD6T 2FHDA 5GAN5 3GNFB 3GIBA 3NFCA 2BKDN 1VIEA 2FVUA 2KDSA 4MZPA 1N9SA 3SFMA 5GAN6 3HHTB 3OYKA 1YJWT 5GAMf 4C0DB 1G5VA 3ASKA 4J6WA 1KQ1A 4P5NA 5LJ3f 5DLOA 3JCMX 1U8RA 2XK0A 4LDYA 2KY9A 4OB2B 3GLXA 4C8QF 5FU7B 2WSFE 5DLQE 1QVGS 2ZPHB 2X35A 5CKFA 4JS4A 4J6XA 2VC8A 3M4YA 4M77C 2MWPA 5DY9A 4BY6C 4Z02A 3CCRA 4E7IA 1M90C 4JJNK 5GAOm 2M1HA 3HRSA 1H3ZA 5CIUA 5LJ3h 3FDRA 3V8JA 3DLLA 3OYCA 1M1KC 3M54A 3QJ6A 2RM4A 4M7DA 1M1GA 2KQWA 2VXFA 4NOYA 4OMFB 4F7UE 1JJ2S 3ZFJA 2HAXA 4M75C 3WVEB 1M8VA 1OYXA 2A3LA 3MEVA 2E12A 3V7CA 5GAOq 3CC2A 3OYJA 4ZTFA 4DOVA 2FYKA 3QDRB 1VQKA 4BE1A 3HRUA 2O4XB 1VQ4T 3MP8A 3JAME 2QQBA 4RCBA 3QUIA 2KAFA 2O01E 2V8JA 4O6JA 3VV0A 1Y96A 4OP0A 3OYNA 2EJFA 3CC7A 1YI2A 1LOJA 2CYZB 4M75A 4HCBA 2HNIA 3BY7A 4BB7A 5M9OA 4RG8A 3M53A 2E6NA 3GPLA 1JB0E 2ZPIB 2EJGA 3CCVA 1G3TA 2LRQA 3RIRA 4A4GA 2LQ8A 3PGGA 4B9WA 4IUUA 4J5YA 4EMKC 3CCMT 5GAN8 2DPPB 2QQRA 5CCAA 4PLIA 3L2QA 1HK9A 4M77A 4MZTA 5GMKe 3KBGA 4N4GA 4CRIA 2XKOC 2RB6A 2GQVA 1QP2A 5HK3A 3PMTA 1VQ9T 1D3BA 1I4K1 1QP3A 2XDPA 3CPFA 4BACA 5CQYA 1YIJT 4HCCA 4N4HA 4BD3A 3Q1JA 1B34A 3G6EA 2K4YA 5J3BA 4C92F 3JCMg 1YJ9T 4LDVA 3CMAT 2RHZA 3CBOA 5I2MA 1MGQA 3RKWA 4R55A 3L2UA 1KQSS 3RKYA 3F70A 4ZN3A 4IKFA 4M75F 1U1TA 2A7YA 1JRIA 3JCMf 1BI2A 4Y91A 3I56T 2R5AA 3ME9A 1VQ6T 2GCXA 2HQXA 3OB9A 5C6SA 1UGSB 1TH7A 1FWZA 3RMQA 1U1SA 1N8RU 3OYDA 3AHUA 3UPUA 4MZMA 1QVPA 4F7UA 3GNGA 4EMKB 5GMKh 3I55A 3KXTA 4ATOA 3VYHB 3CC4A 2XDBA 3MEAA 4DOWA 2OTLA 2DXUA 3TREA 3PTAA 4C92E 2K5FA 5CK9A 1PSFA 4C8QG 3QXEB 4JUVA 5DM7R 3I55T 1NJIC 4NS5A 3QBYA 3CCET 2OTJT 2YLCA 3JRZA 2GF7A 2P0PA 3G7ZA 2C06A 2EJ9A 3HP9A 4M78F 4ELYC 4N4IA 2RO0A 3MHXA 4IUPA 4UC4A 3C94A 5GAOn 5GANj 2DD4A 3CMAA 5FROA 3S3OA 5A0GA 3QJYA 4C8QA 5J39A 5LJ5f 3G6ET 4EMHA 1WJQA 4FU6A 2RJDA 3ZEHA 2RHXA 2EAYA 4ZGEB 3VJPA 2QQ9A 1V29B 4J7IA 1YJNT 4FT4A 3QKJA 4JS5A 2PUOB 3QPHA 5CKBA 1Y7XA 2X4WA 4L59A 3V7SA 2L3RA 4HT8A 3FB9A 5GANe 4M75D 3PIPA 3CBMA 3S6WA 4DA4A 4HA8A 3TU4K 1XTDA 4M77F 3OYFA 3OMCA 3SWNC 3DKMA 4PJOA 2EQJA 3FIFA 4BI4A 1ZHIA 2E10A 5HY6A 3V8KA 4OB0B 2MAMA 1VQ6A 4WF2A 3P8HA 4GLKA 1K8AU 2IG0A 2R58A 3JCMh 2YLBA 4IUQA 4C8QE 2G3RA 5GAMd 3S3MA 2P4TA 3UT1A 3OW2S 1R8OB 4KBMB 5LJ3d 2V8KA 2ZGWA 5D6XA 1W2BS 3MEUA 3OYMA 2DXCA 1QVFS 2CZ7B 4FSXA 3JCMc 2Y4XA 4II1A 3JB9F 1G3WA 4E7HA 4IUVA 1K9MC 2FL7A 3KUFA 1IREB 2ZPFB 4BY6B 1K73U 2E6ZA 4MMLA 3CCMA 1W2BA 4M78C 2M9UA 1QVFA 3LH0A 5CKEA 3DB3A 5I2SA 5GAMh 4BI3A 4BE0A 1ZQ1A 3JCMd 2RHIA 3CCEA 2RK1A 3OYBA 2I2LA 2DO3A 4QQDA 2HBPA 4LDXA 4M7AC 2OTLT 1WJSA 4JLGA 5LJ5j 2XI9A 2HQEA 4YTLA 2JTFA 2DEQA 5GANf 1WQ7A 2D9TA 2LNVA 2PVDB 1I5LA 2RI2A 2F5KA 2BIVA 3OA6A 3M4GA 4XTUA 5LL6S 2QI2A 4M77D 3CC2T 3OYLA 3J7AF 1YJNA 2KK4A 5LJ3j 5GMKj 1N8RC 4E7LA 2L89A 3OS5A 2Y4YA 1XNIA 3FJPA 3TCJA 2QXFA 4J8OA 3CCLA 2V8IA 4EMKA 4HT9A 1K73C 5FLXE 1YBYA 4FL6A 3VUZA 3JCMQ 2LCCA 3CPWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LC4 A;  2IVW A;  3OSS C;  2LNV A;  2Y4X A;  2Y4Y A; 
#chains in the Genus database with same CATH topology
 2DRK A;  1RAD B;  3I9Q A;  2MF2 A;  1M1F A;  2JM8 A;  4XTZ A;  2NLU A;  5L8R E;  3H41 A;  1KQ2 A;  3OYA A;  4M7A E;  1NYG A;  2JOY A;  2E1H A;  2CZ0 B;  2EYY A;  3GOX A;  5IHI A;  2HKN A;  1OU8 A;  1WQW A;  1AEY A;  2JUF A;  2XU8 A;  3OYY A;  1GXI E;  2CT3 A;  5IT9 E;  4ESR A;  1NM7 A;  1ABO A;  5FU6 B;  3L2R A;  1R77 A;  2EGA A;  1HSQ A;  4RTY A;  1BI3 A;  4M77 B;  2GQI A;  4KUD K;  4IIM A;  3SD4 A;  3JB9 H;  2DTH A;  2EQU A;  2VV5 A;  3M58 A;  3OYG A;  4Z88 A;  3RKX A;  1TU0 B;  1ZLM A;  2YDL A;  3VS2 A;  2WAC A;  3QHS A;  2DJQ A;  8AT1 B;  1UGV A;  4XTY A;  3X20 B;  5D6Y A;  1HJD A;  5FRN A;  2V1Q A;  1PM3 A;  2F69 A;  3QWY A;  1LNX A;  3JCM J;  3G4S A;  2EBP A;  2DK3 A;  1OZ3 A;  1VQ4 A;  1P92 A;  2OI3 A;  3ER0 A;  2DET A;  3GP8 A;  2P84 A;  3R6O A;  1VQ5 T;  3HKS A;  4QQG A;  2VYT A;  3EGD A;  4NL2 A;  2MIO A;  5KYY A;  4L5G A;  1DJ7 B;  4C5H A;  2PUK B;  3OSV A;  2RD1 A;  4CC2 A;  5IXF A;  1WHJ A;  3E2U A;  2ED1 A;  1D09 B;  4J7F A;  2DXB A;  1I8F A;  4XTX A;  1Q7Y R;  4BDZ A;  1I1J A;  5LJ3 g;  3VS3 A;  3OBY A;  2E3H A;  3CCU Q;  2MI6 A;  3C4S A;  2RI5 A;  4E47 A;  1OUL A;  2MWO A;  3V8L A;  4A4K A;  3CC7 Q;  4C8Q B;  5GAN h;  1JQQ A;  4FM4 B;  1IXD A;  3LH5 A;  1UGQ B;  2YT6 A;  2DTI A;  3RES A;  5GAN d;  4R56 A;  4C0Z A;  1VQ7 Q;  1PHT A;  3NTI A;  2OTJ Q;  3CCV Q;  1MMA A;  2F1L A;  1RAE B;  2EWN A;  4F7U G;  5GAN 3;  2YWW A;  2P0K A;  3BDL A;  4LNP A;  1YNZ A;  4FW2 A;  1NJI U;  1CKA A;  1M1K U;  3C95 A;  1Q7Y U;  2DFU A;  2D6F A;  1U06 A;  3TEE A;  3I56 Q;  1NLP C;  1UEB A;  1XQH A;  1X27 A;  3EFR A;  4XAX B;  3L2V A;  1ZSZ A;  4DBF A;  1NEG A;  2BZX A;  2W10 A;  3E1S A;  3M0S A;  3HFN A;  2XIC A;  3X26 B;  1T3S A;  2L3P A;  1VQL T;  4E7S A;  2CDT A;  1KK7 A;  4A4E A;  1X75 C;  5FRM A;  4MDW A;  1BKB A;  3FLG A;  1BYM A;  4DQ2 A;  1YCY A;  3GBQ A;  5FWC A;  3DB4 A;  4J9F A;  3M59 A;  3THK A;  1KD1 C;  2DL5 A;  4AFU C;  1K9M U;  2DBK A;  2YXY A;  1JXO A;  1R0C B;  4B9X A;  2CSI A;  4C0F A;  4RTV A;  2CZ6 B;  4X9D A;  5FU7 C;  2ZPB B;  2BZ8 A;  1H3H A;  1CKB A;  5EG2 A;  2DZ9 A;  2CP5 A;  2DD5 A;  3S3N A;  5I11 A;  2ZCF B;  5GAN 4;  4JRI A;  4LXC A;  3MKD A;  2RQT A;  3CPW S;  2K3Y A;  1QVG P;  2LDM A;  2EQM A;  2EFI A;  3VKI A;  2XID A;  3V7R A;  4M77 E;  3LWH A;  3LX7 A;  3T9N A;  1EFN A;  1U5S A;  3QWX X;  4FYV B;  4FCY A;  2JVV A;  4EMG A;  3CCS T;  4M7A G;  1OV3 A;  4OB3 B;  2OJ2 A;  2AKL A;  4RMO A;  4QQ6 A;  2B8A A;  2L5Q A;  5KCH A;  3JCM e;  1W4S A;  2K57 A;  3L1A A;  5KYU A;  1C6V X;  1K9M R;  3CXC S;  1VQ7 A;  2AT1 B;  2E65 A;  1Q95 G;  2K9G A;  4J6Y A;  4PLL A;  4QVZ A;  3CCL Q;  3OYI A;  4M7A D;  2M0O A;  1W70 A;  2A36 A;  3JCM W;  3OMG A;  3NTH A;  1KQS P;  1OI1 A;  2RK2 A;  2J05 A;  4K11 A;  3CME T;  1UUE A;  2RJC A;  4L6V 5;  3HRT A;  4XTW A;  2C0O A;  1LJO A;  4MMK A;  2DAQ A;  3WVD B;  2FG0 A;  2DMO A;  1NZ9 A;  2NUT B;  4OGE A;  1FYN A;  1SRL A;  4OF1 A;  4KT0 E;  2ECZ A;  4KH1 B;  3CD6 T;  2FHD A;  5GAN 5;  1WXB A;  3GIB A;  2BKD N;  1VIE A;  3SFM A;  5GAN 6;  5GAM f;  4PJJ A;  3ASK A;  1WIE A;  2MCN A;  4LDY A;  2J7I A;  2KY9 A;  5KYX A;  2WSF E;  1AVZ C;  5DLQ E;  2ZPH B;  2X35 A;  4J6X A;  4M77 C;  4E7I A;  1M90 C;  5LJ3 h;  1M1K C;  2DE0 X;  3M54 A;  3QJ6 A;  1TS9 A;  2VXF A;  4NOY A;  1M2V A;  2HQH A;  3WVE B;  5KYW A;  4OMO A;  3HRU A;  2O4X B;  3MP8 A;  1WHK A;  4DBQ A;  1IHW A;  3VV0 A;  3IQL A;  1LVK A;  2EJF A;  3CC7 A;  2CYZ B;  2H8H A;  4BB7 A;  1E6H A;  4AFS C;  4D8K A;  1JB0 E;  1G3T A;  2LRQ A;  2LQN A;  4A4G A;  1UE9 A;  2K6D A;  1VQP Q;  3KBG A;  1YJW Q;  3SHW A;  1VYU A;  2XKO C;  3PMT A;  1D3B A;  1I4K 1;  3OW2 P;  3CPF A;  4BD3 A;  3Q1J A;  3JCM g;  3CMA T;  1RAB B;  5I2M A;  1MGQ A;  3R6N A;  4R55 A;  3L2U A;  3RKY A;  4IKF A;  4M75 F;  4AG2 C;  2A7Y A;  3G1J A;  1YWO A;  3OB9 A;  1BCO A;  2FPF A;  3RMQ A;  3AHU A;  1N8R U;  3UPU A;  1SF9 A;  4MZM A;  2MPX C;  2JXB A;  1M3A A;  3CC4 A;  2XDB A;  1TXQ A;  2OTL A;  2AZV A;  1HD3 A;  2O31 A;  2C06 A;  2ABL A;  2EJ9 A;  1JJ2 P;  4ELY C;  1RAC B;  2RQR A;  4N4I A;  4UC4 A;  5GAO n;  1ABQ A;  3H0H A;  1Z9Q A;  2QQ9 A;  4J7I A;  1KFZ A;  4FYY B;  1PD1 A;  4HT8 A;  2ROT A;  3FB9 A;  3PIP A;  3S6W A;  1B07 A;  4D8D A;  3OMC A;  6AT1 B;  1D1C A;  3U23 A;  1N8R R;  1GCQ C;  1ZHI A;  2E10 A;  2QEX Q;  2KI7 A;  2YLB A;  2DNU A;  5LJ3 d;  1AWO A;  2ZGW A;  5D6X A;  1W2B S;  3MEU A;  1QVF S;  4FSX A;  2Y4X A;  4J9B A;  2E3I A;  4F14 A;  4F04 B;  2ZPF B;  1TOV A;  3LH0 A;  3TSZ A;  1RAI B;  2QYZ A;  4BI3 A;  4BE0 A;  3JCM d;  2RHI A;  2I2L A;  2DO3 A;  4LDX A;  2CP3 A;  1SSH A;  1BBZ A;  1WJS A;  2RF0 A;  4YTL A;  4F17 A;  2JTF A;  2DEQ A;  2RI2 A;  3M0U A;  2YUN A;  3OA6 A;  4M77 D;  3J7A F;  1YJN A;  2V26 A;  3TCJ A;  2RPN A;  1XNI A;  2EQI A;  3M0Q A;  2CP7 A;  2QXF A;  4HT9 A;  2QG9 B;  1YIJ A;  2V1R A;  1GBR A;  1FMK A;  3J81 E;  3JCM b;  1AT1 B;  1N9R A;  3X28 B;  1QVF P;  4XU1 A;  2PQW A;  3OS2 A;  2EW3 A;  3CCV T;  2DLP A;  1RLQ C;  3O8V A;  1VQ7 T;  1T3L A;  1B3Q A;  1D3B B;  1IZ6 A;  2FRY A;  1KHI A;  3MO8 A;  2CS7 A;  2K5L A;  1AZE A;  1H92 A;  4IUT A;  2QDL A;  1Q86 U;  3X24 B;  1XJW B;  4X1V A;  1SG5 A;  5CO7 A;  4ZNX A;  5GAM e;  7AT1 B;  1YJ9 A;  1K0S A;  2DM1 A;  3CQT A;  1OOT A;  2QQS A;  3NPF A;  1VQ9 Q;  5KH6 A;  2GGR A;  2GTO A;  2KT1 A;  1PNJ A;  4M77 G;  2H3E B;  3CCJ A;  4HCZ A;  5CKH A;  1WFW A;  1M2V B;  2D8J A;  2DRM A;  2J6O A;  2WSC E;  4M75 G;  1WLP B;  1YI2 T;  4LE9 A;  4C5I A;  2VGM A;  2CZ1 B;  1W1F A;  3EFO A;  2LQK A;  4J9H A;  1OZ2 A;  1O9S A;  2DZC A;  4PNO A;  5GAM j;  2FB7 A;  1KD1 R;  2H3J A;  4O5V A;  3EGX B;  2K5I A;  3CCR Q;  4FT2 A;  4AMC A;  4M75 B;  1PC0 A;  4M7D D;  1H64 1;  2A37 A;  1BI0 A;  1OX8 A;  1EIF A;  2LJ3 A;  1YJW A;  1PCX A;  4JPB W;  3RBB B;  2ESW A;  2YUP A;  2RQW A;  2K2V A;  5A0D A;  1M9S A;  1Q82 R;  1PSE A;  3HL8 A;  4PJO C;  1SRM A;  1KSW A;  3HSB A;  3FJ5 A;  2E5Q A;  3EFS A;  3MPU B;  4M7D C;  2LX7 A;  1HXD A;  1D1B A;  3PMI A;  4JRP A;  1JO8 A;  3RER A;  2L3S A;  1MMD A;  1AWJ A;  1PRM C;  1YHQ A;  1ZA2 B;  2WSE E;  2DIG A;  5LJ5 e;  1S72 A;  1Y96 B;  1QWF A;  3URG A;  4BUG A;  4F7U B;  3VU3 C;  4XTV A;  1K9A A;  4FYW B;  1C0M A;  5KYW B;  2DJZ A;  2JT4 A;  5CVI A;  1Y71 A;  3PVL A;  1YIJ Q;  1NPP A;  1IRX A;  1RI9 A;  2BUD A;  2EYQ A;  4N0A A;  2PZ1 A;  4IUR A;  2YSQ A;  1SHF A;  2JTM A;  4OMM A;  4WCI A;  3BW1 A;  3E9F A;  3OS1 A;  1BB9 A;  2SRC A;  2LJ1 A;  4JZ4 A;  4KRT A;  5KCO A;  3EG9 B;  3QSU A;  5GMK l;  3OS0 A;  1I07 A;  4F16 A;  1N27 A;  2DF6 A;  2EYZ A;  4C8Q D;  3NTK A;  1XOV A;  2CKK A;  9ATC B;  2QDY B;  2LTO A;  1RAG B;  4RG2 A;  2HZY A;  3M9Q A;  3QG1 A;  3M0R A;  1M2O A;  2MMP A;  4ZGJ B;  4TVR A;  4BI8 B;  2YRC A;  4HVU A;  4M7D G;  2DBM A;  2BTT A;  2DTO A;  3VUB A;  3LLR A;  1X6G A;  3SDZ A;  3CD6 Q;  1R0B G;  1VQM A;  1IO6 A;  3HPW A;  4C8Q C;  5GMK m;  2XD0 A;  3CCQ A;  1PKS A;  5A0L A;  4JRQ A;  4RUG A;  1VQO T;  1K73 R;  4E7J A;  4RTX A;  2MK5 A;  4HVW A;  1YN8 A;  1Q81 C;  5FU6 C;  1BCM A;  1SSF A;  1RL2 A;  1AZG B;  4JZ3 A;  2L2P A;  1ZA1 B;  3CME Q;  1BI1 A;  1YHQ T;  2EGE A;  2HSP A;  2X4Y A;  3VS1 A;  3RUX A;  3TQ7 P;  4N0A C;  3CCL T;  2KRM A;  1LPL A;  4DEY A;  3FC3 A;  2DVJ A;  1VIF A;  4A4F A;  2BE9 B;  4C0D C;  1UHF A;  2LCL A;  2GFA A;  4AFQ C;  2PVO B;  2X4J A;  3EG0 A;  2HBW A;  3LGF A;  4M75 E;  2DA9 A;  2ZPG B;  4BE2 A;  3CCU A;  1M5Q 1;  1GCQ A;  4VUB A;  4IIO A;  2L8D A;  3RNJ A;  2CP2 A;  1D1A A;  3GNF B;  5D7U A;  2FVU A;  2KDS A;  4MZP A;  3CCS Q;  3HHT B;  1AWW A;  5DLO A;  2XK0 A;  1WYX A;  3GLX A;  4C8Q F;  5FU7 B;  1G2B A;  5CKF A;  1IB8 A;  4M4Z A;  2QAS A;  3REA B;  4JJN K;  5CIU A;  3FDR A;  4AT1 B;  2DYI A;  3DLL A;  4OMF B;  3ZFJ A;  1IGQ A;  3V7C A;  1V1C A;  3G71 Q;  4DOV A;  4FYX B;  2QQB A;  2LMJ A;  3H0I A;  2V8J A;  3OYN A;  1LOJ A;  4M75 A;  5KYX B;  4RG8 A;  3M53 A;  2E6N A;  1JEG A;  2CUD A;  3RIR A;  4B9W A;  4IUU A;  4PK4 A;  2QQR A;  1SEM A;  4OMQ A;  4PLI A;  1HK9 A;  4M77 A;  2RB6 A;  2GBQ A;  1VQL Q;  2XDP A;  5CQY A;  4N4H A;  4QT7 A;  2K4Y A;  4C92 F;  5IHK A;  1YJ9 T;  3BE3 A;  1QCN A;  2HMA A;  1J3T A;  2MYS A;  4A63 B;  1KQS S;  4CC3 A;  3F70 A;  4ZN3 A;  3I56 T;  1JRI A;  3ME9 A;  1VQ6 T;  2GCX A;  1E7O A;  2RMO A;  5C6S A;  1UGS B;  2JW4 A;  2PNI A;  3UF4 A;  1TG0 A;  3VYH B;  1UFF A;  2O9V A;  3PTA A;  1X43 A;  2NUP A;  1I5O B;  5DM7 R;  2I0N A;  1YHQ Q;  3CCE T;  2OTJ T;  2YLC A;  5FWB A;  1TUG B;  2GF7 A;  4DBH A;  3G7Z A;  4WTO B;  3I5S A;  3HP9 A;  4M78 F;  3MHX A;  1RAA B;  1VQO Q;  5GAN j;  2DD4 A;  3CMA A;  1WHL A;  2EGC A;  5A0G A;  5J39 A;  1WJQ A;  2RJD A;  2VAS A;  2K79 A;  5AT1 B;  2ROL A;  5IXB A;  1YJN T;  5ECA A;  2PUO B;  1ARK A;  4L59 A;  3V7S A;  3HTR A;  5GAN e;  4DA4 A;  3CPW P;  1VQN Q;  3TU4 K;  3UAT A;  2FO0 A;  2LNH B;  3PVQ A;  1K1Z A;  1WI7 A;  3FIF A;  3EGX A;  5I22 A;  4OB0 B;  1GRI A;  2MAM A;  4WF2 A;  4HVV A;  2YUO A;  2P4T A;  3EH1 A;  3OYM A;  3JCM c;  1OPL A;  4E7H A;  1YIT Q;  1K9M C;  1IRE B;  3H0F A;  2A0F B;  4DEX A;  1W2B A;  2M9U A;  1QVF A;  1OQK A;  3DB3 A;  4J9E A;  3JV3 A;  1ZQ1 A;  3CCE A;  1WDX A;  2DL7 A;  4QQD A;  2KYB A;  5LJ5 j;  1M8M A;  2HQE A;  1WQ7 A;  2D9T A;  1M3B A;  2HSE B;  3M4G A;  4XTU A;  2X3W D;  4J9I A;  5LL6 S;  3CC2 T;  3OYL A;  1N8R C;  3OS5 A;  2Y4Y A;  4J8O A;  4EMK A;  1K73 C;  4FL6 A;  1UDL A;  3ULR B;  1GFD A;  2QA4 T;  4OVA A;  2HEQ A;  3REB B;  1V76 A;  3EH2 A;  3VRY A;  5CKD A;  1Q82 U;  2J6K A;  1ZBX A;  3OQ5 A;  3WXM B;  4C5G A;  1LCK A;  3RMS A;  1Y07 A;  2EIF A;  2O4X A;  1S1N A;  2OTJ A;  3OY9 A;  2ATC B;  1N6A A;  2YHT A;  3CC4 T;  3EG1 A;  3QO3 A;  1FMV A;  1X6O A;  4HKE A;  1KD1 U;  2EVR A;  3CC2 Q;  3I56 A;  2DX1 A;  2RH2 A;  1UGP B;  3PT9 A;  1MMG A;  1MV3 A;  3M56 A;  1MMN A;  1UGR B;  2VXE A;  3OBW A;  1M4Z A;  5D6W A;  5J26 A;  2O9S A;  1IHV A;  2K3X A;  3PIO A;  2KRN A;  3CCR T;  2QK0 A;  1SPK A;  3A8L B;  4KUL A;  4EDU A;  2LT4 A;  1WA7 A;  3VYG A;  4PJO D;  1QVG A;  3KFV A;  3MCA B;  2PVG B;  1Q7Y C;  4RCC A;  2IPO B;  1QW1 A;  1Q86 R;  2F5T X;  2VVK A;  4QKU A;  5GMK i;  1PRL C;  4J9C A;  2SEM A;  1YI2 Q;  1KC8 U;  1OPK A;  3QII A;  1Q86 C;  4M78 G;  1X2Q A;  4QVC A;  5KYN A;  4EPC A;  1VQN A;  4NL3 A;  1VQP A;  2LC4 A;  1K8A R;  1G8X A;  4RTT A;  1O75 A;  3UDC A;  4E7K A;  1VQ9 T;  2LP5 A;  2EQK A;  1YJN Q;  2FPD A;  3M57 A;  1GFC A;  3P8D A;  1VQO A;  3BDU A;  2OAU A;  3M0P A;  3G71 A;  3CD6 A;  2C0T A;  2QTX A;  1UB4 A;  5I21 A;  3G6E Q;  4OMN A;  4Y28 E;  4LDU A;  5HK0 A;  3EGU A;  1ACM B;  1I81 A;  2LVM A;  3FEO A;  4OMP A;  4PKC C;  1X2K A;  2GNC A;  1BIB A;  3LYI A;  3A8M B;  2M51 A;  2QGG A;  5A2Q E;  1KC8 C;  2M0Y A;  5IN1 A;  1PKT A;  1RUW A;  2X3X D;  2EYW A;  2L3Q A;  1C1A A;  1I0C A;  1VQ8 A;  1RAF B;  2EYX A;  3MP6 A;  1OEB A;  5LJ5 g;  4PJO B;  3MEW A;  3VS7 A;  2AKK A;  4GY5 A;  3HFO A;  3CCQ T;  2VGN A;  4GBQ A;  2OTL Q;  1VQM T;  2E5K A;  3LGL A;  1A0N B;  5IAY A;  4KH0 B;  4PFZ A;  5GAN 7;  2KYM A;  4PL6 A;  5IHN A;  1X01 A;  3L2Z A;  1ZUY A;  1WXT A;  4QW2 A;  2DVE A;  3NMZ C;  2NUP B;  2O88 A;  1JBM A;  3GF5 A;  1VQ4 Q;  3UA6 A;  2HL3 A;  2LT1 A;  1AD5 A;  3G71 T;  1K8A C;  4M7D F;  3OW2 A;  1VQ8 T;  3SWN A;  4CC7 A;  2O2O A;  2QEX T;  1S72 T;  5CR2 A;  2G6F X;  4V2S A;  2DIL A;  2MOX A;  3JCM P;  2NWM A;  4QVD A;  1B7T A;  3AT1 B;  5GAO l;  4PJO G;  4ZTJ A;  3OSS C;  4C92 C;  2JJ9 A;  2DEU A;  2YRD A;  2JTE A;  4RTW A;  2BE7 D;  4C92 A;  5HKC A;  2JNG A;  1Q81 U;  1NYF A;  2CGH A;  4ZN1 A;  2RJF A;  4LN2 A;  1VQL A;  2RA2 A;  2L0A A;  2E64 A;  3SB2 A;  3D7S B;  5LJ3 e;  3A8H B;  2X51 A;  2JN0 A;  3P8B B;  3PFS A;  2A08 A;  2CT4 A;  3JCM V;  5LJ5 d;  2DXT A;  3M0T A;  1VQ9 A;  2Z0W A;  3I55 Q;  2IVW A;  1M1K R;  4C0G A;  1X69 A;  4C92 D;  3INZ A;  2D0N A;  3J80 E;  4KUI A;  1KHC A;  1G3Y A;  4PJL A;  2LJ0 A;  3EAE A;  3BFM A;  3JB9 I;  3OYE A;  4CI0 C;  2FRW A;  3CEY A;  1B34 B;  2KVQ G;  4X9C A;  4X34 A;  1JU5 C;  2OAW A;  3M5A A;  3NFC A;  1YJW T;  1D0X A;  1G5V A;  4J6W A;  1KQ1 A;  3JCM X;  3SEM A;  3VS0 A;  4OB2 B;  1QVG S;  2HDA A;  4JS4 A;  3M4Y A;  3VS6 A;  3CCR A;  4Z02 A;  2KGT A;  4ANJ A;  4E6R A;  1PWT A;  4M7D A;  3H9N A;  4F7U E;  1BK2 A;  1JJ2 S;  2HAX A;  4M75 C;  1M8V A;  1OYX A;  2A3L A;  2E12 A;  2FYK A;  1E6G A;  4J9D A;  5EC7 A;  1FMW A;  4R0K A;  3MJX A;  3JAM E;  1WHH A;  3QUI A;  1WHG A;  2O01 E;  3A98 A;  4O6J A;  1WXU A;  1Y96 A;  4OP0 A;  1YI2 A;  1N5Z A;  4HCB A;  3BY7 A;  5M9O A;  1QKW A;  2B86 A;  3CCV A;  2EJG A;  3I35 A;  3PGG A;  3CCM T;  2DL3 A;  2M02 A;  5GAN 8;  4MZT A;  5GMK e;  2DYB A;  2GQV A;  4BAC A;  1YIJ T;  2F2W A;  3G6E A;  2RHZ A;  3CBO A;  3RKW A;  4CC4 B;  1GBQ A;  4EIK A;  2EPD A;  3JCM f;  1FWZ A;  2GTJ A;  5GMK h;  3KXT A;  3GNG A;  4ATO A;  2C0I A;  3MEA A;  4DOW A;  2DXU A;  3TRE A;  4C92 E;  4C8Q G;  4JUV A;  3I55 T;  1NJI C;  4NS5 A;  1TUC A;  1QKX A;  4AFZ C;  2RO0 A;  4IUP A;  2JS2 A;  2AK5 A;  5FRO A;  3S3O A;  2E4H A;  3QJY A;  4C8Q A;  2CUB A;  1K76 A;  1CSK A;  2ED0 A;  4EMH A;  4FU6 A;  5L23 A;  1WX6 A;  1K4U S;  2COY A;  2LQW A;  1V29 B;  4FT4 A;  4JS5 A;  4B6M A;  1HYO A;  5CKB A;  8ATC B;  1T0H A;  5GJW B;  3CBM A;  2CSQ A;  4HA8 A;  1XTD A;  4AG1 C;  3OYF A;  3SWN C;  3DKM A;  4PJO A;  2P4R A;  4BI4 A;  1TWB A;  1WZO A;  1ZBJ A;  4GLK A;  2R58 A;  2RQU A;  4IUQ A;  3S3M A;  2G3R A;  1VQ8 Q;  1VQK Q;  1M90 R;  3OW2 S;  3VS5 A;  4E2F B;  4II1 A;  3JB9 F;  1G3W A;  2OX7 A;  2RN8 A;  2FL7 A;  3KUF A;  5GJV B;  1K73 U;  2E6Z A;  3RR6 A;  4OML A;  3CCM A;  4M78 C;  3NGP A;  5CKE A;  5I2S A;  5GAM h;  1Y0M A;  3OYB A;  4M7A C;  2HBP A;  1VQM Q;  2OTL T;  2CP6 A;  1JXM A;  2XI9 A;  3A1P A;  2JMA A;  4Z8A A;  1Y57 A;  2FZC B;  2LNV A;  2PVD B;  2COW A;  2BIV A;  3EG3 A;  1NJI R;  1QLY A;  1SHG A;  1GCP A;  2HKQ B;  1Z9Z A;  2V8I A;  4Y92 A;  3EFO B;  1ZSG A;  2LCC A;  2D8H A;  2KR3 A;  1ZUK A;  2AZS A;  4DBR A;  1G3S A;  4ZGD B;  1RI0 A;  3EGD B;  4M7A F;  3QYG B;  4OB1 B;  3QZ5 B;  1WPY A;  2VUB A;  4OGC A;  3CC7 T;  4KGZ B;  2JS0 A;  2XDD A;  3CCU T;  1QCO A;  5AYF A;  5HCK A;  2AIR B;  4PFO A;  1WGS A;  2Y90 A;  3H6Z A;  1BIA A;  1NPR A;  1KG1 A;  2LX9 A;  4XU3 A;  1H8K A;  1KC8 R;  3JSC A;  1NE8 A;  2RQV A;  2XMF A;  4M7D E;  1G83 A;  4FW1 A;  4FSS A;  2RHY A;  2KBT A;  4JJB A;  2HL5 C;  2E41 A;  4BDY A;  1ZX6 A;  1WHM A;  3PNW C;  2QEX A;  3CBP A;  1VUB A;  2KNB B;  3A8O B;  3MP1 A;  2E70 A;  2YUQ A;  4C92 G;  1JJ2 A;  2R5M A;  4C92 B;  4M78 A;  2XHC A;  4M78 B;  4LUE A;  2ZZD A;  1KQS A;  5LJ5 h;  3JB9 D;  1VQK T;  3JB9 J;  4ELZ C;  1M30 A;  2K3B A;  4M7A B;  3X25 B;  2CH4 W;  2KRO A;  4KGV B;  4PJO E;  1X6B A;  2PTK A;  2ZAE A;  1YP5 A;  2NUT A;  2EKO A;  2RHU A;  3MET A;  1VOM A;  1NEB A;  3H8Z A;  2GFU A;  1YFN A;  1FXX A;  2PU9 B;  3C12 A;  3TVT A;  3A8G B;  3L42 A;  3QYH B;  4LD9 K;  1D0Y A;  3M55 A;  1TTH B;  5KE2 A;  3L2W A;  3RDV A;  2F2V A;  4XU2 A;  4A4H A;  1Q81 R;  4RTU A;  5C0M A;  4LDW A;  1UJ0 A;  4PJM A;  1F1B B;  2J06 A;  2YRV A;  4GLM A;  1BU1 A;  4E7Z A;  2M16 A;  1FX7 A;  2KMT A;  3CCS A;  2ZPE B;  4PJN A;  3UWN A;  4RTZ A;  5GAN 2;  3CME A;  3LW5 E;  2QA4 Q;  2VKN A;  4M7A A;  1K0X A;  1WJR A;  2KE9 A;  2P0Q A;  4PJO F;  1KIK A;  4ME7 A;  3CXC P;  2QAZ A;  1TSF A;  3CMA Q;  2D0Q B;  4JLI A;  5CQX A;  5GAM g;  4XQ3 A;  1WNL A;  3E19 A;  5GAO p;  1IGU A;  4JRK A;  4XK8 E;  2RI3 A;  1VQP T;  2RJE A;  2DL8 A;  1MHN A;  3CCM Q;  1Q82 C;  1EZZ B;  3E9G A;  3NHN A;  4A54 A;  4RKU E;  1UJY A;  4JDS A;  1GL5 A;  2DER A;  2QQA A;  2JM9 A;  2QTV A;  4A53 A;  3JB9 G;  3FRN A;  1AHJ B;  5GAO r;  1YIT T;  1YWP A;  2K2M A;  2FZK B;  4LD6 A;  2DIQ A;  1QQJ A;  1TUD A;  4F7U F;  1T0J A;  5GAN g;  4HCK A;  1NLO C;  1MNE A;  2CH4 A;  2AHJ B;  2JZ2 A;  3QDF A;  1VYV A;  2KSS A;  3QZ9 B;  1YIT A;  3A5Z B;  1VQN T;  2HD0 A;  4Q5W A;  1SKU B;  4HXJ A;  4ORZ A;  3CXC A;  1ZSZ B;  4XU0 A;  4M7D B;  2X4X A;  1AOJ A;  2EKH A;  4PFP A;  3N5B B;  3UA7 A;  1D0Z A;  4Z89 A;  3TSW A;  2KEA A;  4FIB A;  2FPE A;  5KYU B;  1W2B P;  1UG1 A;  4MDX A;  2FEI A;  3ZBD A;  1M90 U;  4D6W A;  2R57 A;  4J83 A;  4M78 E;  1EX4 A;  3CCJ T;  3CCE Q;  2QA4 A;  3DLM A;  3LWI A;  4M78 D;  2DKG A;  1VQ5 A;  1VQ6 Q;  2KRS A;  3SWN B;  5KE3 A;  1ZUU A;  1OX9 A;  1VYT A;  1RAH B;  1UTI A;  2XG8 D;  5CAI A;  3G4S T;  1YJ9 Q;  4C5E A;  3OYH A;  3OYK A;  1N9S A;  3ZL7 C;  1KJW A;  4C0D B;  4P5N A;  5LJ3 f;  2QGF B;  1U8R A;  3I5R A;  2J6F A;  1W6X A;  2VC8 A;  5DY9 A;  2MWP A;  4BY6 C;  5GAO m;  2M1H A;  3HRS A;  1H3Z A;  3V8J A;  1MV0 B;  3OYC A;  1S72 Q;  2RM4 A;  1M1G A;  2KQW A;  2FZG B;  2CP0 A;  2RNA A;  3MEV A;  5GAO q;  3CC2 A;  3OYJ A;  4LUD A;  4ZTF A;  3QDR B;  5FW9 A;  1VQK A;  4BE1 A;  1VQ4 T;  1PD0 A;  3VS4 A;  4RCB A;  1RLP C;  2NUZ A;  2KAF A;  2BZY A;  2HNI A;  3EG9 A;  2HCK A;  3GPL A;  1AWX A;  2ZPI B;  2LQ8 A;  4J5Y A;  4EMK C;  2DPP B;  5CCA A;  3L2Q A;  2JMC A;  4N4G A;  4CRI A;  5HK3 A;  1QP2 A;  1MND A;  1QP3 A;  3CCQ Q;  4HCC A;  2LZ6 B;  1B34 A;  5J3B A;  4LDV A;  1M3C A;  3G4S Q;  3EHR A;  1UEC A;  1YCS B;  1U1T A;  1BI2 A;  4Y91 A;  2R5A A;  2KT8 A;  2HQX A;  1TH7 A;  2LCS A;  1U1S A;  3OYD A;  3I55 A;  1QVP A;  4F7U A;  2COZ A;  4EMK B;  2KXD A;  1ZSZ C;  4KGX B;  2K5F A;  5CK9 A;  1PSF A;  2VB6 A;  3QXE B;  3QBY A;  3CCJ Q;  3JRZ A;  4J9G A;  2P0P A;  2VWF A;  1QCF A;  3PE0 A;  3C94 A;  3VRZ A;  1M27 C;  2IIM A;  5LJ5 f;  3G6E T;  4JJC A;  3ZEH A;  2RHX A;  3EG2 A;  4JJD A;  2EAY A;  2W0Z A;  4ZGE B;  3VJP A;  3QKJ A;  3QPH A;  1Y7X A;  2X4W A;  2L3R A;  1U3O A;  2D1X A;  4M75 D;  4M77 F;  1MUZ A;  2A28 A;  2EQJ A;  3V8K A;  5HY6 A;  1OU9 A;  1VA7 A;  1VQ5 Q;  1VQ6 A;  2KXC A;  3P8H A;  1K8A U;  2IG0 A;  3JCM h;  4C8Q E;  5GAM d;  3UT1 A;  1R8O B;  4KBM B;  2V8K A;  2DXC A;  2NYS A;  2CZ7 B;  2X9H A;  4IUV A;  4BY6 B;  4MML A;  1QMC A;  1QWE A;  1PG5 B;  2RK1 A;  2K7A A;  4JLG A;  1NBE B;  2DL4 A;  1NG2 A;  3EHQ A;  5GAN f;  2F2X A;  3C0C A;  1I5L A;  2F5K A;  5KYY B;  2QI2 A;  2CRE A;  2KK4 A;  5IH2 A;  5LJ3 j;  5GMK j;  4E7L A;  2L89 A;  3FJP A;  3CCL A;  1UHC A;  5FLX E;  1YBY A;  2ENM A;  3VUZ A;  3JCM Q;  3CC4 Q;  3O5Z A;  3CPW A; 
#chains in the Genus database with same CATH homology
 1YIJ A;  2QA4 T;  4OVA A;  1G3S A;  3J81 E;  3JCM b;  1N9R A;  4ZGD B;  1RI0 A;  3X28 B;  4M7A F;  2MF2 A;  1M1F A;  4XU1 A;  4XTZ A;  2PQW A;  5CKD A;  3OS2 A;  1Q82 U;  1ZBX A;  2NLU A;  3OQ5 A;  5L8R E;  3WXM B;  4C5G A;  3OYA A;  1KQ2 A;  3RMS A;  3QYG B;  1Y07 A;  4OB1 B;  2EIF A;  3CCV T;  4M7A E;  2O4X A;  2JOY A;  3O8V A;  2E1H A;  1WPY A;  3QZ5 B;  1VQ7 T;  2CZ0 B;  1D3B B;  2OTJ A;  3GOX A;  3OY9 A;  1IZ6 A;  2VUB A;  4OGC A;  1KHI A;  1N6A A;  3MO8 A;  2CS7 A;  3CC7 T;  1WQW A;  2K5L A;  2YHT A;  3CC4 T;  4IUT A;  2XDD A;  2JUF A;  2XU8 A;  3OYY A;  3CCU T;  1Q86 U;  3QO3 A;  5AYF A;  1GXI E;  3X24 B;  5IT9 E;  1X6O A;  4HKE A;  1KD1 U;  1WGS A;  5FU6 B;  3L2R A;  2Y90 A;  3H6Z A;  1BIA A;  5CO7 A;  3I56 A;  1NPR A;  1BI3 A;  2RH2 A;  1UGP B;  4M77 B;  5GAM e;  1KG1 A;  2LX9 A;  4XU3 A;  3PT9 A;  4KUD K;  3SD4 A;  3JB9 H;  1YJ9 A;  2DTH A;  2EQU A;  3M56 A;  3JSC A;  1UGR B;  2VV5 A;  1NE8 A;  2QQS A;  1M4Z A;  2VXE A;  3M58 A;  3OBW A;  3OYG A;  3RKX A;  5D6W A;  5J26 A;  5KH6 A;  4M7D E;  2K3X A;  3PIO A;  2RHY A;  4M77 G;  3CCR T;  2WAC A;  3CCJ A;  2E41 A;  3QHS A;  3A8L B;  4HCZ A;  4KUL A;  5CKH A;  4BDY A;  4EDU A;  3PNW C;  2LT4 A;  2QEX A;  3CBP A;  1VUB A;  3VYG A;  4PJO D;  3A8O B;  3MP1 A;  2E70 A;  1QVG A;  3MCA B;  4C92 G;  4XTY A;  3X20 B;  1JJ2 A;  2PVG B;  5D6Y A;  1Q7Y C;  4RCC A;  2R5M A;  1QW1 A;  2WSC E;  4M75 G;  5FRN A;  2F5T X;  4M78 A;  4C92 B;  1YI2 T;  4C5I A;  2XHC A;  2VGM A;  5GMK i;  4M78 B;  2CZ1 B;  2F69 A;  3JCM J;  1LNX A;  3G4S A;  2ZZD A;  2DK3 A;  1KQS A;  1OZ3 A;  1VQ4 A;  1P92 A;  5LJ5 h;  3JB9 D;  3JB9 J;  3ER0 A;  4ELZ C;  1KC8 U;  1VQK T;  3GP8 A;  4M7A B;  3QII A;  2LQK A;  3R6O A;  1OZ2 A;  1Q86 C;  1O9S A;  2DZC A;  1VQ5 T;  3HKS A;  4PNO A;  4M78 G;  3X25 B;  4QQG A;  2VYT A;  5GAM j;  2FB7 A;  4NL2 A;  4PJO E;  2H3J A;  4QVC A;  4O5V A;  4EPC A;  1VQN A;  4NL3 A;  1VQP A;  2LC4 A;  2K5I A;  4L5G A;  2EKO A;  4FT2 A;  2RHU A;  1O75 A;  3MET A;  1DJ7 B;  4C5H A;  4M75 B;  3H8Z A;  3UDC A;  4M7D D;  2PUK B;  2GFU A;  2PU9 B;  1FXX A;  3C12 A;  4E7K A;  1H64 1;  3A8G B;  3OSV A;  2RD1 A;  2EQK A;  3L42 A;  1BI0 A;  3QYH B;  1EIF A;  3M57 A;  4LD9 K;  3M55 A;  3P8D A;  4J7F A;  2DXB A;  5KE2 A;  3L2W A;  1YJW A;  1VQO A;  1I8F A;  3BDU A;  2OAU A;  4XTX A;  3G71 A;  4BDZ A;  4XU2 A;  4A4H A;  3CD6 A;  2QTX A;  1UB4 A;  5LJ3 g;  5I21 A;  3OBY A;  4Y28 E;  4LDU A;  5C0M A;  5HK0 A;  2MI6 A;  3C4S A;  2RI5 A;  4LDW A;  2K2V A;  4E47 A;  5A0D A;  2MWO A;  1I81 A;  2LVM A;  1M9S A;  3FEO A;  4PKC C;  3V8L A;  4A4K A;  4C8Q B;  5GAN h;  1BIB A;  2YRV A;  1PSE A;  3LYI A;  4FM4 B;  3RES A;  1UGQ B;  3A8M B;  2DTI A;  2M16 A;  3HL8 A;  1FX7 A;  2KMT A;  5GAN d;  4C0Z A;  4R56 A;  3CCS A;  3HSB A;  4PJO C;  2E5Q A;  3EFS A;  3NTI A;  5A2Q E;  1KC8 C;  2ZPE B;  4M7D C;  3UWN A;  2EWN A;  5GAN 2;  1HXD A;  4F7U G;  5GAN 3;  2P0K A;  3BDL A;  3PMI A;  4JRP A;  3RER A;  3CME A;  3LW5 E;  1NJI U;  5IN1 A;  1YHQ A;  1M1K U;  2WSE E;  2DIG A;  5LJ5 e;  1S72 A;  1Y96 B;  3C95 A;  1Q7Y U;  3URG A;  2D6F A;  4M7A A;  3TEE A;  4BUG A;  4F7U B;  1WJR A;  1VQ8 A;  3VU3 C;  1UEB A;  1XQH A;  2P0Q A;  4PJO F;  4ME7 A;  3MP6 A;  3EFR A;  4XAX B;  4XTV A;  5LJ5 g;  3L2V A;  4PJO B;  2D0Q B;  3MEW A;  3E1S A;  4JLI A;  2DJZ A;  5CQX A;  5CVI A;  3HFN A;  2XIC A;  3X26 B;  4GY5 A;  4XQ3 A;  5GAM g;  1Y71 A;  3HFO A;  1WNL A;  1NPP A;  3CCQ T;  1VQL T;  2EYQ A;  2BUD A;  3E19 A;  1X75 C;  4N0A A;  4A4E A;  2VGN A;  4MDW A;  5GAO p;  4JRK A;  5FRM A;  4XK8 E;  4IUR A;  2RI3 A;  1VQP T;  2RJE A;  1VQM T;  1BKB A;  2JTM A;  3FLG A;  4DQ2 A;  1MHN A;  1BYM A;  1Q82 C;  3E9G A;  1YCY A;  3LGL A;  3DB4 A;  4A54 A;  3BW1 A;  3E9F A;  4RKU E;  3M59 A;  5IAY A;  1KD1 C;  5GAN 7;  3OS1 A;  1K9M U;  4JDS A;  2QQA A;  4PL6 A;  1X01 A;  3L2Z A;  4B9X A;  4QW2 A;  4A53 A;  3FRN A;  3JB9 G;  2DVE A;  1AHJ B;  4C0F A;  5KCO A;  5GAO r;  1YIT T;  3QSU A;  2CZ6 B;  5GMK l;  3OS0 A;  1JBM A;  3GF5 A;  4X9D A;  5FU7 C;  2ZPB B;  4LD6 A;  1N27 A;  2LT1 A;  4M7D F;  3G71 T;  1K8A C;  5EG2 A;  2DZ9 A;  4C8Q D;  2DIQ A;  2DD5 A;  3NTK A;  3OW2 A;  3S3N A;  1XOV A;  4F7U F;  2CKK A;  1VQ8 T;  3SWN A;  2ZCF B;  2QDY B;  2LTO A;  5GAN 4;  2QEX T;  5GAN g;  4JRI A;  4RG2 A;  2AHJ B;  3CPW S;  1S72 T;  3M9Q A;  2JZ2 A;  5CR2 A;  2KSS A;  3QG1 A;  4V2S A;  3QZ9 B;  2K3Y A;  2MMP A;  3JCM P;  1YIT A;  2LDM A;  4ZGJ B;  4TVR A;  4BI8 B;  2EQM A;  2EFI A;  4QVD A;  3A5Z B;  3VKI A;  1VQN T;  2XID A;  5GAO l;  4PJO G;  2HD0 A;  3V7R A;  4M77 E;  4Q5W A;  3LX7 A;  3T9N A;  3OSS C;  4C92 C;  3LWH A;  4ZTJ A;  4M7D G;  2DTO A;  2JVV A;  4EMG A;  5HKC A;  3CCS T;  3VUB A;  3LLR A;  4C92 A;  3CXC A;  4XU0 A;  4M7A G;  2JNG A;  4OB3 B;  4M7D B;  3SDZ A;  1Q81 U;  2X4X A;  1VQM A;  4C8Q C;  3HPW A;  5GMK m;  4RMO A;  4QQ6 A;  2CGH A;  3N5B B;  4ZN1 A;  2B8A A;  2RJF A;  2L5Q A;  5KCH A;  3JCM e;  1VQL A;  2RA2 A;  2XD0 A;  2E64 A;  3SB2 A;  1W4S A;  2K57 A;  3L1A A;  3CCQ A;  4FIB A;  5LJ3 e;  3A8H B;  5A0L A;  2JN0 A;  3CXC S;  4MDX A;  4JRQ A;  1VQO T;  1VQ7 A;  3P8B B;  3PFS A;  2E65 A;  4QVZ A;  4PLL A;  4J6Y A;  3ZBD A;  4E7J A;  1M90 U;  3JCM V;  4D6W A;  1Q81 C;  5FU6 C;  2R57 A;  3OYI A;  1SSF A;  1RL2 A;  4J83 A;  4M78 E;  5LJ5 d;  2DXT A;  4M7A D;  1VQ9 A;  2M0O A;  3CCJ T;  3JCM W;  1BI1 A;  3OMG A;  1YHQ T;  2IVW A;  3NTH A;  2QA4 A;  1OI1 A;  2RK2 A;  4C0G A;  3CME T;  4C92 D;  2RJC A;  2X4Y A;  3INZ A;  3J80 E;  3DLM A;  4KUI A;  4L6V 5;  1KHC A;  1G3Y A;  3HRT A;  3RUX A;  4N0A C;  3LWI A;  4XTW A;  3EAE A;  4M78 D;  3CCL T;  2DKG A;  3BFM A;  4MMK A;  1LJO A;  3JB9 I;  2DAQ A;  4CI0 C;  3OYE A;  3FC3 A;  1VQ5 A;  1VIF A;  3WVD B;  4A4F A;  3SWN B;  3CEY A;  4C0D C;  5KE3 A;  1B34 B;  2GFA A;  1NZ9 A;  2KVQ G;  2LCL A;  2PVO B;  2X4J A;  3LGF A;  4OGE A;  4M75 E;  4OF1 A;  2XG8 D;  2ZPG B;  5CAI A;  1M5Q 1;  3G4S T;  4VUB A;  3CCU A;  4X9C A;  4C5E A;  4BE2 A;  2L8D A;  4KT0 E;  4X34 A;  3OYH A;  3M5A A;  3CD6 T;  2FHD A;  5GAN 5;  3GNF B;  3GIB A;  3NFC A;  2BKD N;  1VIE A;  2FVU A;  2KDS A;  4MZP A;  1N9S A;  3SFM A;  5GAN 6;  3HHT B;  3OYK A;  1YJW T;  5GAM f;  4C0D B;  1G5V A;  3ASK A;  4J6W A;  1KQ1 A;  4P5N A;  5LJ3 f;  5DLO A;  3JCM X;  1U8R A;  2XK0 A;  4LDY A;  2KY9 A;  4OB2 B;  3GLX A;  4C8Q F;  5FU7 B;  2WSF E;  5DLQ E;  1QVG S;  2ZPH B;  2X35 A;  5CKF A;  4JS4 A;  4J6X A;  2VC8 A;  3M4Y A;  4M77 C;  2MWP A;  5DY9 A;  4BY6 C;  4Z02 A;  3CCR A;  4E7I A;  1M90 C;  4JJN K;  5GAO m;  2M1H A;  3HRS A;  1H3Z A;  5CIU A;  5LJ3 h;  3FDR A;  3V8J A;  3DLL A;  3OYC A;  1M1K C;  3M54 A;  3QJ6 A;  2RM4 A;  4M7D A;  1M1G A;  2KQW A;  2VXF A;  4NOY A;  4OMF B;  4F7U E;  1JJ2 S;  3ZFJ A;  2HAX A;  4M75 C;  3WVE B;  1M8V A;  1OYX A;  2A3L A;  3MEV A;  2E12 A;  3V7C A;  5GAO q;  3CC2 A;  3OYJ A;  4ZTF A;  4DOV A;  2FYK A;  3QDR B;  1VQK A;  4BE1 A;  3HRU A;  2O4X B;  1VQ4 T;  3MP8 A;  3JAM E;  2QQB A;  4RCB A;  3QUI A;  2KAF A;  2O01 E;  2V8J A;  4O6J A;  3VV0 A;  1Y96 A;  4OP0 A;  3OYN A;  2EJF A;  3CC7 A;  1YI2 A;  1LOJ A;  2CYZ B;  4M75 A;  4HCB A;  2HNI A;  3BY7 A;  4BB7 A;  5M9O A;  4RG8 A;  3M53 A;  2E6N A;  3GPL A;  1JB0 E;  2ZPI B;  2EJG A;  3CCV A;  1G3T A;  2LRQ A;  3RIR A;  4A4G A;  2LQ8 A;  3PGG A;  4B9W A;  4IUU A;  4J5Y A;  4EMK C;  3CCM T;  5GAN 8;  2DPP B;  2QQR A;  5CCA A;  4PLI A;  3L2Q A;  1HK9 A;  4M77 A;  4MZT A;  5GMK e;  3KBG A;  4N4G A;  4CRI A;  2XKO C;  2RB6 A;  2GQV A;  1QP2 A;  5HK3 A;  3PMT A;  1VQ9 T;  1D3B A;  1I4K 1;  1QP3 A;  2XDP A;  3CPF A;  4BAC A;  5CQY A;  1YIJ T;  4HCC A;  4N4H A;  4BD3 A;  3Q1J A;  1B34 A;  3G6E A;  2K4Y A;  5J3B A;  4C92 F;  3JCM g;  1YJ9 T;  4LDV A;  3CMA T;  2RHZ A;  3CBO A;  5I2M A;  1MGQ A;  3RKW A;  4R55 A;  3L2U A;  1KQS S;  3RKY A;  3F70 A;  4ZN3 A;  4IKF A;  4M75 F;  1U1T A;  2A7Y A;  1JRI A;  3JCM f;  1BI2 A;  4Y91 A;  3I56 T;  2R5A A;  3ME9 A;  1VQ6 T;  2GCX A;  2HQX A;  3OB9 A;  5C6S A;  1UGS B;  1TH7 A;  1FWZ A;  3RMQ A;  1U1S A;  1N8R U;  3OYD A;  3AHU A;  3UPU A;  4MZM A;  1QVP A;  4F7U A;  3GNG A;  4EMK B;  5GMK h;  3I55 A;  3KXT A;  4ATO A;  3VYH B;  3CC4 A;  2XDB A;  3MEA A;  4DOW A;  2OTL A;  2DXU A;  3TRE A;  3PTA A;  4C92 E;  2K5F A;  5CK9 A;  1PSF A;  4C8Q G;  3QXE B;  4JUV A;  5DM7 R;  3I55 T;  1NJI C;  4NS5 A;  3QBY A;  3CCE T;  2OTJ T;  2YLC A;  3JRZ A;  2GF7 A;  2P0P A;  3G7Z A;  2C06 A;  2EJ9 A;  3HP9 A;  4M78 F;  4ELY C;  4N4I A;  2RO0 A;  3MHX A;  4IUP A;  4UC4 A;  3C94 A;  5GAO n;  5GAN j;  2DD4 A;  3CMA A;  5FRO A;  3S3O A;  5A0G A;  3QJY A;  4C8Q A;  5J39 A;  5LJ5 f;  3G6E T;  4EMH A;  1WJQ A;  4FU6 A;  2RJD A;  3ZEH A;  2RHX A;  2EAY A;  4ZGE B;  3VJP A;  2QQ9 A;  1V29 B;  4J7I A;  1YJN T;  4FT4 A;  3QKJ A;  4JS5 A;  2PUO B;  3QPH A;  5CKB A;  1Y7X A;  2X4W A;  4L59 A;  3V7S A;  2L3R A;  4HT8 A;  3FB9 A;  5GAN e;  4M75 D;  3PIP A;  3CBM A;  3S6W A;  4DA4 A;  4HA8 A;  3TU4 K;  1XTD A;  4M77 F;  3OYF A;  3OMC A;  3SWN C;  3DKM A;  4PJO A;  2EQJ A;  3FIF A;  4BI4 A;  1ZHI A;  2E10 A;  5HY6 A;  3V8K A;  4OB0 B;  2MAM A;  1VQ6 A;  4WF2 A;  3P8H A;  4GLK A;  1K8A U;  2IG0 A;  2R58 A;  3JCM h;  2YLB A;  4IUQ A;  4C8Q E;  2G3R A;  5GAM d;  3S3M A;  2P4T A;  3UT1 A;  3OW2 S;  1R8O B;  4KBM B;  5LJ3 d;  2V8K A;  2ZGW A;  5D6X A;  1W2B S;  3MEU A;  3OYM A;  2DXC A;  1QVF S;  2CZ7 B;  4FSX A;  3JCM c;  2Y4X A;  4II1 A;  3JB9 F;  1G3W A;  4E7H A;  4IUV A;  1K9M C;  2FL7 A;  3KUF A;  1IRE B;  2ZPF B;  4BY6 B;  1K73 U;  2E6Z A;  4MML A;  3CCM A;  1W2B A;  4M78 C;  2M9U A;  1QVF A;  3LH0 A;  5CKE A;  3DB3 A;  5I2S A;  5GAM h;  4BI3 A;  4BE0 A;  1ZQ1 A;  3JCM d;  2RHI A;  3CCE A;  2RK1 A;  3OYB A;  2I2L A;  2DO3 A;  4QQD A;  2HBP A;  4LDX A;  4M7A C;  2OTL T;  1WJS A;  4JLG A;  5LJ5 j;  2XI9 A;  2HQE A;  4YTL A;  2JTF A;  2DEQ A;  5GAN f;  1WQ7 A;  2D9T A;  2LNV A;  2PVD B;  1I5L A;  2RI2 A;  2F5K A;  2BIV A;  3OA6 A;  3M4G A;  4XTU A;  5LL6 S;  2QI2 A;  4M77 D;  3CC2 T;  3OYL A;  3J7A F;  1YJN A;  2KK4 A;  5LJ3 j;  5GMK j;  1N8R C;  4E7L A;  2L89 A;  3OS5 A;  2Y4Y A;  1XNI A;  3FJP A;  3TCJ A;  2QXF A;  4J8O A;  3CCL A;  2V8I A;  4EMK A;  4HT9 A;  1K73 C;  5FLX E;  1YBY A;  4FL6 A;  3VUZ A;  3JCM Q;  2LCC A;  3CPW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...