3OSUA

Crystal structure of the 3-oxoacyl-acyl carrier protein reductase, fabg, from staphylococcus aureus
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
246
structure length
246
Chain Sequence
MKMTKSALVTGASRGIGRSIALQLAEEGYNVAVNYAGSKEKAEAVVEEIKAKGVDSFAIQANVADADEVKAMIKEVVSQFGSLDVLVNNAGITRDNLLMRMKEQEWDDVIDTNLKGVFNCIQKATPQMLRQRSGAIINLSSVVGAVGNPGQANYVATKAGVIGLTKSAARELASRGITVNAVAPGFIVSDMTDALSDELKEQMLTQIPLARFGQDTDIANTVAFLASDKAKYITGQTIHVNGGMYM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3-oxoacyl-[acyl-carrier-protein] reductase
publication title Crystal structure of the 3-oxoacyl-acyl carrier protein reductase, FabG, from Staphylococcus aureus
rcsb
source organism Staphylococcus aureus subsp. aureus mu50
molecule tags Oxidoreductase
total genus 81
structure length 246
sequence length 246
chains with identical sequence B
ec nomenclature ec 1.1.1.100: 3-oxoacyl-[acyl-carrier-protein] reductase.
pdb deposition date 2010-09-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3osuA00
1GY8A 1I2ZA 4CV2A 4YCAA 1Q2XA 3B1JA 3TDKA 5CEFA 2I76A 3GGPA 4XQEA 2RIRA 1SBYA 1GUYA 3NDJA 1X15A 4BNXA 4MP6A 3PYLA 3DTTA 3RASA 1PS8A 5THQA 1M76A 4YAJA 4P38A 4R69A 3FTPA 1VJ1A 2OZPA 1YQXA 1K6XA 2X5OA 3KOUA 4BB6A 2YW9A 5COQA 4Y98A 2E82A 1ML3A 3VZSA 2PKRA 4CM9D 1LU9A 3HADA 3I1JA 3ST7A 4U6SA 3FTNA 1EUZA 3VKUA 4RVUA 4J4BA 1R12A 1RYDA 2X0IA 4IQGA 3JYQA 4ZA2A 4B7CA 1SEPA 3CZMA 4HNGA 3KVOA 1YQGA 1YL7A 5HWSA 4NBRA 3AOGA 3HJAA 1RM0A 4Q9NA 5G0WA 3HN7A 4RVSA 4WLVA 4BO0A 1DO8A 3EZLA 3LSYA 2P2SA 3MWDB 3UF0A 3VH3A 1ISFA 1UH5A 1H9AA 1BXKA 3L9WA 4O63O 1T26A 5JMPA 2YHUA 5JCJD 2CUKA 4ZD6A 1ZXLA 4KUHA 3H2ZA 3C8MA 3S2GA 4MINA 5IZCC 1PZFA 4RZHA 1IYZA 5AVOA 3VPXA 1HEUA 3VH2A 4XYLA 1ZEJA 5IDXA 1YQDA 5JC8A 2X4GA 4GLLA 1K6IA 2PA3A 2EV9A 3Q6IA 2DBZA 4BIIA 3AU8A 1ISIA 1VL0A 1E7QA 3DTYA 4D45A 5F21A 3AUSA 2NQTA 3TFQA 4WECA 4LVUA 3ZHYA 1BXGB 3VVCA 1Y9EA 3TZCA 1O0SA 4OO3A 1PTJA 4HX5A 3WDSA 5B4UA 4XJTA 1B3BA 1UZNA 2GZ3A 4BS9A 4A73A 4P4LA 1C14A 1XSEA 2ZJ1A 3K92A 1Y8RA 4Z3DA 4CM8B 3A28A 1DC6A 1MXFA 4IUYA 4XKJA 5LDHA 3K6JA 3UXYA 3EY4A 4OSPA 4JBIA 3KRTA 3CINA 1SAYA 2UV8A 3JQFC 4XA8A 1EFKA 5JDCC 3LQFA 5EJ2A 3JQ8A 3HDYA 2VRBA 4YBZA 2E48A 5K6AA 5U1PA 3QIVA 3GRKA 4EW6A 3I4CA 3RIHA 3WS7A 1N1EA 2OBYA 3PWSA 4KQXA 1G6KA 4WLUA 3RVDA 5LCXA 4MIYA 4G65A 1Z82A 2DAPA 3U62A 4IGEA 1BMDA 4NHEA 4GGOA 1C3VA 4U0JA 5TT0A 3U4HA 2PZJA 3AI3A 1U7HA 2VWHA 1YBVA 3L9XA 4D3SA 4A10A 4B7XA 1T2DA 1HTBA 3QRWA 4MIOA 4RCVA 1LJ8A 4PLPA 4ILKA 3AOEA 4I08A 1D7OA 4BMSA 1R0LA 2Z1NA 4J1QA 4YEDA 5DP1A 1ZFNA 3IKTA 4RGBA 1YH3A 3BMNA 3TZ6A 2VTDA 1Y7TA 4Z0PA 4Q3BA 2AEFA 1HDOA 2NWQA 4MVJD 3H9QA 2GGSA 3JV7A 4RLHA 5T8KC 3RKRA 4YRDA 1ORRA 3UCXA 1HE5A 1PL8A 3ADOA 4BGEA 3G49A 2PLAA 1NVGA 4BKPA 2EW8A 1EDOA 1O5IA 2Z5LA 3BYZA 3GFGA 4KTTE 4F3YA 4OXKA 5GZ3A 2QYTA 3I6QA 5L4LA 4A27A 4A26A 2VYVD 1D4FA 3QJ5A 1JW9B 4PLGA 3GC6A 5I7FA 4UUNA 4E5NA 2IYPA 1K5HA 2PTGA 3FPLA 5L9AA 1IZ9A 4G2NA 4WEQA 4E6PA 3I9MA 4LCJA 4R68A 3WGIA 4BO8A 4Z3KA 1TXGA 4GX2A 4GX5A 4WCFB 4G81A 4WLOA 5IDQA 1E1KA 2Q1SA 3A4VA 4AVYA 2VUTA 4WOJA 5KNLA 2C20A 3M6IA 4FD3A 2CZCA 2OGUA 4TZTA 5I9NA 1GQYA 3S55A 3ZU4A 2Q2VA 4CL8A 1X1EA 3PXXA 2JL1A 4O5OA 3BTVA 2FZEA 4GVXA 1Z6ZA 1KVTA 3ZU5A 1DDOA 1ZH8A 2BI7A 3V5NA 4BO2A 4YT2A 2DBQA 1X7HA 3DZGA 4YQZA 2A92A 4NBVA 2B37A 4Q39A 5C7IO 4QTZA 2WYUA 1KEWA 2YV3A 3RI3A 9LDTA 1QORA 2X58A 1PGPA 4E30A 1ZMTA 3EDMA 4PZCA 4CM4A 4K6CA 4BO3A 1TB4A 4E21A 3GHYA 1V9LA 1ADFA 1OBFO 1WZIA 3GVCA 3IIEA 3OJ0A 3GEGA 2PKQO 4B3IA 4WK6A 1U3UA 2FSVA 5ER6A 2Q1TA 3RFVA 1C0IA 2YZ7A 1ULSA 4NIMA 5I9LA 1GCUA 2O3SA 1RYEA 1E3SA 3ZWXA 2GO1A 2XAAA 1D1SA 3G1TA 5HRUA 1NQAO 1Y8QA 1ZNQO 4OIMA 5A04A 4JJIA 4HUJA 4MVJI 1T2CA 1TEHA 1RM5A 4JXKA 5JW6A 2IRWA 4YRBA 1ZSVA 3F46A 3LF2A 3KYDA 4J2HA 3I23A 5G4KA 4M55A 2C2XA 4JBHA 1I8TA 3V2UA 3NYWA 5FYDA 4B3JA 1I32A 4J91A 3NKLA 4CQLA 4CMCA 4CMBA 3K2EA 1T4DA 5F1KA 4NMHA 1JVBA 3H7AA 1DFHA 1KYQA 3ZNQA 2CVZA 1LDBA 1NX6A 4D41A 1OOEA 2EJWA 1SNYA 3ZWPA 4BGIA 1BDBA 1KVQA 3PHIA 3FNFA 1LRKA 3I5MA 2SCUA 2HMSA 3IJPA 1FMCA 3ZW8A 3LC1O 2IXAA 4Z0TA 1NASA 4D0SA 5BQFA 1H5QA 3PK0A 4A7PA 1XELA 5G0TA 2X86A 4R01A 5F5NA 1ZJZA 4C7JA 2EWMA 3DBLB 5DNAA 2FPPA 3UAGA 1GYPA 4J0EA 4E5PA 4OH1A 3QA9A 4E31A 1AHHA 2R00C 4FB5A 5F1PA 2QW8A 4DLBA 1NAHA 3AY6A 5KVVA 3NT4A 1T1SA 3FBGA 1NFFA 2F1KA 3LT0A 3OA0A 3GNTA 1YL5A 4QX6A 1I5RA 2DFDA 1BW9A 3JQAB 1WWKA 3WX0A 1R4NA 1QYDA 2YHIA 2YY7A 1WZEA 5L7YA 3DAFA 2VYNA 3LC2O 4M54A 5F1OA 2YFHA 1T24A 4HBGA 5IDWA 3QLJA 4ZQFA 5T57A 4WGGA 3VTZA 3ZHXA 4E3ZA 1Q7BA 3DFZA 2CNBA 3AWDA 4J90A 3DZBA 4DC0A 1MFZA 4RJTA 3HDQA 4J7UA 3H2SA 5HS4A 4DA9A 3GPDG 1ENPA 1E7SA 4OQZA 1I2CA 5BSEA 2I99A 2QRLA 2DPGA 2AQIA 2IZ1A 4M89A 5G4LA 2HUNA 4R5HA 3WGTA 3TFOA 4CMEC 4AJEA 1KEVA 4CR7A 1KC1A 1KOLA 3UCEA 4GSLA 2JD0A 2GN4A 1GUFA 4FJ1A 1KVRA 2GZ2A 1E3IA 1LBEA 1RJWA 2C5AA 3HB5X 3OEYA 3DXFA 4JJGA 4MKZA 4RPHA 1QYXA 1BDMA 1MP0A 4P8RA 2Y1DA 1UXJA 1NVMB 2AHRA 4IM7A 1W73A 3H3JA 3VZPA 3AJRA 4M86A 1PGOA 1XU9A 2CF6A 4L74A 5AXAA 3ZH2A 4OOFA 2B69A 2JD2A 2PKQP 2Y1EA 3D0OA 2Q50A 3GEDA 2D4AA 1EK5A 2VRCA 4RPKA 3ONEA 5JS6A 2D0IA 3VVBA 2WD8A 2CSUA 2CDCA 4R1UA 4IBOA 3KYCA 1BHSA 3DHEA 1B15A 1EK6A 3V2HA 1P1HA 2C82A 2PFGA 1U8XX 2WM3A 2NNLD 2X9VA 1N9GB 4TMFA 1A9YA 2X1HA 1H2HA 3H5RA 4P4NA 5EL0A 2I3AA 4BO5A 3GAZA 4BOYA 2IZ0A 2Z1MA 4U5QA 4ALLA 3JQBC 2DBRA 2CVOA 1JQBA 3RC9A 1YONA 3ASUA 3JD2A 4XB1A 1PIWA 3AUAA 4WNCA 4JROA 3DEYX 4B8ZA 1NPDA 2FR8A 5IG2A 4ND1A 3BTOA 5ENVA 2BELA 1E3JA 1EQ2A 4B7UA 1PJ3A 2EHDA 1LX6A 1LQTA 3UICA 3E18A 5CDYA 4GL4A 5BSHA 5FWNA 4XQCA 2B4QA 2BF7A 5LC1A 1JWBB 2P5UA 1FDUA 4XRGA 1R37A 2NTNA 3BZUA 3VAZA 3VPGA 1K0UA 2VNAA 3PHJA 2NVUB 4MP8A 3D4PA 1DAPA 5ILGA 1MXHA 1B8PA 1DFIA 5JAZA 3SVTA 1YBMA 1UR5A 5JO9A 3FNEA 3HQ4O 5TT1A 1E1MA 1P1RA 1UXKA 3MEQA 4RORA 3SJ7A 5JSFA 4E2WA 4CQMA 1CRWG 1ZK3A 2DQ4A 4CM5A 4AL4A 2O3QA 1HF3A 3GG2A 1GYRA 2JAHA 2FRDA 3ITDA 5I7VA 2WWRA 4PFJA 4BNUA 3QE3A 4M49A 3HSKA 5A02A 2NVWA 1DHTA 4LSWA 3NTRA 4HKTA 1NM5A 3BMQA 3K5PA 2X9NA 4FGSA 3LT2A 4ZICA 1V8BA 3B1FA 1QMGA 3WGQA 3FR7A 4KMSA 3WIEA 3C1TA 2P9GA 5T5QA 2HU2A 1E6WA 4CMHA 1LLCA 3PLRA 4W4TA 2HJSA 3FNGA 2RHCA 3H5NA 5AOVA 2Q49A 3ZW9A 1KC3A 5ER9A 2D59A 3OIFA 2C7VA 1DC5A 3FCOA 1XU7A 2UVDA 2J3JA 3AUTA 3DZJA 3PI7A 4JX8A 3MJ4A 1NTOA 3QWIA 1OI7A 1IL0A 3DONA 5IXSA 3E6AA 4TZKA 3R0IA 2C07A 4MO2A 1ZMOA 4J4HA 3AI1A 2AG5A 1YWGO 3JYPA 2VUSA 3KUXA 4RDHA 4CMGA 1Y1PA 1PS0A 3GT0A 1IULA 2VUUA 3DO5A 1PEDA 3I9NA 3GUCA 3SC6A 1P74A 3QVXA 4BMVA 1JKIA 3ZZNA 4RF4A 3ZU3A 1RM4A 2NU7A 1C1XA 2G17A 1LSJA 1GPDG 1KETA 4DC1A 5KOIA 1Z74A 3DBVO 1R6DA 3AM4A 5KKCA 2PGDA 2W2KA 2Q1WA 1G0OA 4CV0A 3V1TC 3PZRA 3ZV3A 4NK5A 1DHRA 5EQDA 3HG7A 1P1JA 4Y6PA 4NBTA 4NFSA 2A94A 5ICMA 4IY1A 3EMKA 4TKMA 3ABIA 4CV3A 3C1AA 2EP7A 2GLXA 3ZHZA 3RJ9A 3O26A 4OXNA 1XR3A 1WPQA 3DL2A 2GN6A 3JQ7A 1M6HA 5L40A 3DMTA 5TIIA 3ITKA 3WYEA 4TWRA 1I3LA 4CODB 5CFZA 5B37A 4QFCA 1I3NA 2E6UX 2HO5A 3JQGA 3K2BA 1M6WA 5KJ1A 1SB9A 3OBBA 3ZWMA 2D2IA 1D1TA 4IXTA 2GNAA 4MIEA 4RF5A 1F0YA 4EEZA 1I30A 1MGOA 3F5QA 2VOEA 2AQHA 3JYOA 3QVOA 3N7UA 2WMDA 3BMNB 4RQUA 4DREA 2FHSA 1DIBA 4NBWA 2AE1A 4RPLA 5AQ1A 2AEJA 1W4ZA 1HLDA 2R6JA 1LSUA 1V6AA 3MJEA 3SJUA 4ROSA 1Q0LA 4R3WA 5HBRA 1DFGA 5CDUA 1DRWA 1K3TA 4S1VA 5DOZA 1V3TA 2GCGA 4Z6KA 1F17A 2UUPA 5L95A 4PLYA 1EVZA 1U3TA 1MC5A 3M1AA 4YJFB 2BFAA 3Q9NA 1DLJA 3HNPA 4FBGA 2G1UA 5JYEA 2WYVA 5THKA 3GZNA 2DUUA 1E1LA 4NJOA 3L4BA 3QVSA 5JBIA 1P33A 1HDYA 2Y0EA 4UAGA 3QVTA 2VHZA 3CTMA 2GF2A 4IQ8A 1EUDA 1ZSYA 4EBFA 1H93A 2J6IA 4K26A 2FPIA 3O03A 3ZWVA 4E13A 3KSDO 5A06A 3W8EA 4LGVA 1BVRA 3GMSA 1PJQA 5KIAA 1JDJA 1J4AA 4S3MA 3BMOA 1J5PA 3PHLA 1EBFA 2PY6A 2PGLA 3OEWA 4NH4A 1G1AA 3JSAA 1GDHA 1WW8A 5HS6A 3OICA 3PDJA 1V3UA 1ONOA 5KJFA 5L4NA 3LZ6A 1NAIA 4CM4B 3KXDA 4GAEA 1B0AA 2YJZA 5DDIP 4YTEA 2R2GA 2EF1A 4MKXA 3OSUA 1ENOA 3ICCA 4AG3A 2GRAA 2XXJA 3TRIA 3L77A 1R0KA 3KHUA 2NTVA 4N54A 4NQZA 3G3EA 2OO5A 4R54A 4CMAA 1O89A 4HXYA 3JQ6A 1X0XA 4IIUA 5TNXA 4TRMA 1Y8QB 1OC2A 1FK8A 4Q3AA 2EKQA 3QQPA 5CEEA 3DC2A 2PGJA 2WYWA 5G4KB 5TQVA 4BKQA 3MCVA 4I8XA 4XYGA 2CVQA 1Z45A 4J0FA 5EMHA 3EW7A 3INGA 1YB1A 1B2LA 5IAAA 4MVJE 3ZWNA 1C0LA 1VL6A 4YPOA 2LDXA 3RROA 3NTOA 2X7HA 1HDRA 3ZWWA 5JDIC 1KVUA 4AJ4A 4AJNA 2OFPA 4B4VA 4QXMA 3COSA 4CMIB 3ICPA 2I6TA 3INTA 1QV6A 1PJ4A 4NR0A 1WNTA 1DIAA 3DZKA 3GVHA 4G5HA 1KIFA 4HFJA 3TSCA 3RC1A 4RVDA 1ADCA 5FEUA 1NQTA 4ZRNA 3ZN2A 3OJFA 5CHEA 3DBRA 1E7RA 2Q4BA 4J4TA 3OJEA 2X6TA 5TSDA 2VHWA 3ZHBA 2RH8A 2BH9A 1ULUA 2RH4A 3X2FA 3L0DA 4U8GA 4EYEA 3WMWA 2ZB3A 1XQ1A 1N2SA 2HRZA 1OZAA 3Q11A 4PLFA 2X5JO 3JD1A 1H6DA 2HMTA 4Z9YA 2FOIA 4ZQEA 1YDEA 5JDIA 3PGXA 4FPXA 5CG1A 3CEAA 2GN9A 5CG2A 5AXDA 3KYBA 2YHIB 3KBOA 1WXDA 3HZZA 4GLOA 1PZHA 1KEUA 4IDGA 4GWKA 5JMWA 5A9SA 2WE8A 2NTJA 1P45A 1GFSA 1X14A 3H9EO 4II2A 4I1IA 5K6AC 1GL3A 3ADPA 3N58A 4IDCA 2DTXA 4IJKA 1NXQA 2Q4EA 4YA6A 3RBZA 1Q0QA 3GMDA 1BTOA 1HE2A 4L9RA 3KSZO 3DAPA 2X5KO 3GDGA 3SBOA 2B4RO 4EJ6A 2FPGA 1GADO 3O4RA 4RF2A 1MV8A 4ZQGA 1HDGO 1ONNA 4MKRA 3WGOA 2GD1O 1L7DA 3HN2A 2EXXA 3NX4A 4HFMA 1WDKA 3AOEC 1XEAA 1I2BA 1UDAA 2YQ4A 1M66A 3ZV6A 1I0ZA 3TQHA 4W9NA 3RD5A 4W82A 1PQUA 3PQEA 3TN7A 3KO8A 3RUAA 1CERA 3HB4X 1IE3A 3HFSA 4BNGA 4B4WA 5AXBA 4NI5A 1IUKA 3Q0EA 4PCVA 2VHXA 1ONPA 2UYYA 5EN4A 1R4MA 3D4NA 2G82A 4BNTA 1YKFA 1U3WA 1PJLA 5ITVA 2B83A 1Z75A 2BKAA 3UGKA 5I7EA 1DOHA 2H9IA 1DPGA 1UXGA 1UXIA 2BFPA 2G5CA 4BO4A 2NQ8A 4OKIA 2NUAA 3CIFA 1JLLA 1YE3A 5C7OO 4XYBA 4BNLA 1FDVA 4QEDA 3RBVA 1UDCA 4RL6A 8LDHA 1R66A 4BNIA 2ZQYA 1DAOA 4CLRB 3F4LA 5KVSA 3P2YA 4J49A 2Z95A 1A71A 1CWUA 1Q7CA 1LSSA 3S8MA 3NDIA 3T4XA 1H2BA 3O8QA 5L7TA 3PFFA 5T64A 1L7EA 3P7MA 4ZHSA 1TT5A 1DJQA 4XR9A 2EGGA 5JLAA 4D0RA 3DAGA 4YAGA 1ADBA 1HZZA 1N8KA 1PX0A 3FNHA 3PGJA 3JD0A 1BG6A 1AGNA 5KJEA 4PGFA 3MJCA 2JFFA 4B8WA 2O48X 4INAA 3PRJA 3RBXA 3BXXA 1GZ4A 3QV1A 1IZ0A 1ZXBA 4LRTB 1BVUA 4H15A 1OMOA 1PQPA 4YR9A 1VE9A 4RPGA 1CQJA 3OIDA 1B3RA 4R9RA 3F3SA 1O9BA 4IDAA 4DMMA 3B70A 5BT9A 1GV0A 4KWIA 2YV2A 4CM6A 4XGNA 1QLHA 1NPYA 3IP1A 1E6UA 2C29D 1HLPA 1U1IA 2PZMA 4L4SA 3FHLA 1XGKA 4UVDA 1X7GA 3RUCA 3NUGA 2WTBA 3BHMA 2QRJA 2FMUA 1HL3A 3V1UA 2H5LA 3ETEA 4D3FA 1LA2A 2PR2A 1TA4A 2BMAA 3SLKA 5I9MA 5TRTA 3ONFA 3BMCA 1LC3A 4CM7A 3G1UA 3W6ZA 4BNHA 2YDXA 4GX0A 5JAIA 1LTHR 1B7GO 1QYVA 2DC1A 2ZYGA 3V1YA 4BL5A 3KB6A 3PTZA 1UZMA 4FFNA 1AXGA 5C37A 5COBA 1NR7A 2AEMA 5DCYA 2EKPA 5CDGA 2FN7A 4XIJA 1A72A 5H83A 4BNNA 1HSZA 2VZ8A 4IJWA 1KY4A 1WP4A 4DGSA 5K0ZA 3OJLA 3TOXA 3OECA 4NU6A 1AUPA 2IODA 3E5RA 3NJ8A 4TRJA 3GN2A 3VPHA 2PNFA 2VHVA 5DCUA 1SCUA 1EBUA 1C1XB 4RZIA 3JYNA 5JY6A 3WSWA 1QRRA 2ZQZA 2ILTA 5DBGA 3D64A 4OQYA 3PWZA 4DLLA 2BGKA 1QKIA 3JTMA 1IHYA 3E82A 2HK8A 4PLWA 2OL4A 3E9MA 1LRLA 3BAZA 2P9CA 1BWSA 3PVZA 5JE8A 4UULA 3WXBA 4BO9A 3LF1A 5BNTA 1X1TA 3OQ6A 3V2GA 1NQOA 1O6ZA 4J2OA 2TMDA 1YS4A 1HYGA 3GHHA 2IZZA 4ALJA 5AYVA 4UVEA 4B79A 4PG8A 1LDEA 3R1IA 5ES3A 3JQ7B 4BO6A 4QECA 3IQDB 1RM3A 4QFDA 3G79A 3AK4A 3PHHA 4GKBA 2FR0A 5MGBA 4GWGA 1Y5MA 3TPCA 3NEPX 4K28A 1O95A 5JAQA 5IF3A 1EZ4A 1M2WA 4AICA 4J6FA 2AMFA 3EUWA 4KUEA 4BO1A 4O1MA 1NPTO 4R16A 2EEZA 4KOAA 3W4IA 3RSHA 1N7HA 1YDWA 2QYSA 2VT2A 4DRYA 2EGHA 1U28A 4EUFA 5L53A 3U5TA 4YAKA 1RKXA 2FSSA 3WYCA 2O3TA 3GH3A 5IXYA 4H7PA 1XDWA 1I24A 1E7WA 3UVEA 3WJ7A 4YXFA 4RQTA 4AJPA 1YB4A 2Y68A 5A9RA 4W99A 3MJVA 3KM0A 5DCWA 4ZVVA 3AM5A 4E2YA 4KP7A 1F8FA 4KQWA 3WGHA 2HSDA 5F3RA 1X7DA 4XYMA 2O23A 4K9DA 1HKUA 2E49A 4PRKA 1VC2A 1E3WA 3ANLA 4OMUA 4YB8A 4EITA 2IE0A 1MFPA 1P9LA 5GZ6A 4I5GA 3TZKA 1TLTA 2Q2WA 2ZB4A 2BLLA 3RUDA 3M1LA 3CPSA 3EGOA 4E5YA 1ISGA 3GZNB 2BGLA 5A5EA 1PJTA 1HE4A 3UHAA 9LDBA 4IS3A 4BV9A 3TL3A 1GPJA 3RU7A 3ROMA 3U3XA 1TI7A 4IZHA 2JD1A 2P68A 3Q2KA 2VYND 3U4CA 2NU6A 4F6CA 1DLIA 4BMNA 1JA9A 4CUKA 2VZ9A 4E33A 1P31A 3GNSA 4CPDA 2GERA 5KJ6A 3B1KA 1CYDA 4J43A 1A27A 5AXCA 7MDHA 4ZJUA 3F1KA 3HFGA 2GDZA 5DT9A 5FI5A 1XKQA 3IP3A 2JCYA 1P0CA 4HP8A 4F45A 2B0JA 4IMPA 4WPGA 4UVIA 2E37A 2VWGA 1PZEA 4LISA 2AQ8A 3VOSA 4CLEA 3FF4A 2HK7A 3RUFA 4F6LA 1FJHA 1YOVB 1ZK0A 3WTCA 2Y05A 2BHLA 1P77A 4D7AA 4OJNA 4WJZA 5IZ4A 1N92A 2X9GA 2YFQA 5KVQA 1OC4A 2VCYA 2VT3A 2V7PA 5A05A 2CDBA 5TC4A 3DWFA 3GR6A 2W8ZA 4PG7A 5FF9A 4DPLA 4ZRMA 3PJDA 4A03A 4B4UA 1UXHA 3I9JA 3WOHA 2W2LA 5ITWA 5KKAA 3GLQA 3WNVA 2HAEA 1Y9AA 2CDAA 2Y1OA 3IJRA 2RHRA 4CV1A 2VRCD 5L51A 4NJMA 3D7LA 5LDGA 5A03A 3KETA 4IDFA 5T67A 3PZBA 3RAJA 4AJIA 2WE7A 1MX3A 3DR3A 3WQQA 1NHWA 2ZCVA 3QY9A 2OP0A 2PV7A 1ENZA 2QQ5A 1EE2A 2B5VA 2FR1A 3AY3A 3U9LA 1HE3A 1PQWA 1U3VA 3DB2A 2HLPA 3ZWCA 3WLFA 1ENYA 4BVAA 2V65A 4PLZA 3LK7A 2AW5A 1PGQA 2JFHA 4XQGA 4ZQHA 3W4JA 4WCFA 1NVTA 1T25A 4PN3A 4L4RA 4DIOA 2Y1CA 1U4OA 1I10A 3OIGA 3G17A 3ON5A 3OMLA 3IL2A 5EQFA 1FXSA 2NSDA 4FC7A 4PG4A 3NT2A 5C7LO 4DQVA 4ND5A 2DT5A 4D46A 5JFOA 4GMFA 3H9JA 3ROKA 5IDYA 5G0UA 1XYGA 3U09A 4CQMD 4BNMA 4GH5A 1ZW1A 3AFMA 2XXBA 3ZNNA 4EGFA 4DVJA 3ZDFA 5GZ1A 3QWBA 2ZB7A 4XQ9A 4JLWA 3D3EA 4WEOA 5A9SB 3LVFO 3H4VA 2D8AA 2NVBA 2W4QA 1AXEA 5GY7A 1A4IA 4I9UA 4BHTA 4URFA 4YJGA 2IXBA 3DMTC 5B1YA 4MVJM 1EQUA 2JHFA 3UN1A 4U6QA 5KWEA 4EZBA 1Y6JA 4HY3A 3RKUA 1U9JA 4IMRA 3ROQA 1U8FO 4MVJG 3ZU2A 2PD4A 3PPIA 2V6BA 4GGPA 4R4JA 5DN9A 1QG6A 4L73A 1Y8RB 5I8ZA 1EVYA 4ZQBA 5L4SA 1E1NA 4J9UE 3BTUA 2W90A 4YYZA 4YAIA 1E77A 2LDBA 5CDSA 1A4UA 3H65A 3JQ8B 4IDDA 1W6UA 1UP4A 3GF4A 4PVDA 3QWFA 1DXYA 2J3IA 5U4QA 4DBZA 3D5QA 1WVGA 4AJKA 4DUPA 2B36A 1UUFA 3E8XA 3STHA 2VHYA 3K73O 4GI2A 5ICSA 3MZ0A 1VKOA 4Q3EA 3E03A 3F5SA 2H63A 4GQAA 2O4UX 3PP8A 1DC4A 4TRRA 5EPOA 4BNKA 3WLEA 1P1FA 4HNHA 3QW2A 1F8GA 3PLNA 2GZ1A 4NDNE 3WQRA 1F12A 1K89A 2Q3EA 4FFPA 2FZWA 2ZTLA 4NNJA 3BHIA 3W4KA 3K31A 1NFRA 4ALMA 5BR7A 2VWQA 4Y6RA 1LI4A 1T2FA 1X13A 4IGFA 1NNUA 4W7IA 1PS9A 3DBLA 2AQKA 4B4OA 4TRNA 3BIOA 4HWKA 4UUMA 3TZQA 3L4BC 3HDHA 1GQQA 5FI3A 1MG5A 4LN1A 4M87A 4DL9A 4PLCA 1SMKA 3DBHA 3OF2A 2H6EA 3PJFA 4OGWA 3WNQA 3H6KA 1Y5RA 4ID9A 1DIRA 1W0CA 1PR9A 3GDFA 3GFBA 4JGBA 2WEKA 2Q1UA 3O8QB 1GQ2A 3JQAA 3WBFA 1TT5B 4WLNA 4DLAA 1ZKMA 4JK3A 3I3OA 3FRJA 1EMDA 4M8SA 1IPFA 3ZWAA 1P0FA 4XGIA 3VPSA 4XZ3A 4WASA 2DKNA 4R41A 2IDZA 4WOKA 3INRA 4LSMA 3GG9A 2VNSA 3PIDA 2V6MA 3DMYA 2QZ9A 3RQSA 3UFXA 1KY5A 2DTDA 3EC7A 1XG5A 4N5NA 3H5AA 1XCBA 3LDHA 3WWZA 3BA1A 3QSGA 2WSBA 1VRWA 1XQ6A 2GPTA 2D1YA 4J9VA 4CLOA 5ADHA 1PWZA 3H3FA 2YV1A 3WG9A 2WD7A 1PWXA 4O59O 3MJTA 3RFXA 3E48A 1SO8A 1S7CA 1LDGA 3DZIA 2CY0A 3GDOA 2Y93A 4UUPA 3RC7A 2PD3A 4TROA 2Y99A 1YBAA 4RVFA 4BKOA 4F46A 1HDXA 1LNQA 4C7KA 2D5AA 2JCXA 3F6YA 3MWEB 1U4SA 2PH3A 1Z7BA 3CMCO 3ZGYA 2HRBA 2C7GA 2YDYA 3GPIA 4AFNA 1FDTA 3ZWBA 4R9SA 4DBVO 3RU9A 1XWFA 1GD1O 4Y8VA 5F5LA 3NT5A 1PL7A 2G76A 3K30A 3B20A 3CE6A 4CR8A 3KYDB 1OAAA 2AG8A 4YWJA 2Y1GA 1PJSA 4J3FA 1HDCA 3TWOA 1ZEMA 1UP6A 3NJ4A 4BKRA 4CLHA 3MTGA 1GV1A 4CQLB 4CL3A 3AUUA 3GGGA 1E5LA 1K2WA 4PVCA 1LRJA 3QVWA 3DZHA 1YXMA 1ZK1A 1F14A 1YGYA 1WMAA 3ZNPA 2OHXA 4QO7A 3WJAA 2DFVA 1HETA 5L3ZA 1YVEI 3AM3A 2B35A 4DTIA 2NVUA 4IDBA 4IJVA 4L76A 1KVSA 2ZATA 2EP5A 4ZU3A 3SC4A 1HYHA 4O0LA 2C54A 4YDRA 2J5QA 5JCJA 4OL9A 3ETGA 4BNWA 3ZWOA 2GN8A 2J3KA 2O2YA 3EZYA 1K6JA 3BHJA 3GZ4A 3UCFA 1QXSA 1R0SA 1AN9A 4P22A 1H6CA 3PEFA 1QR6A 5U9CA 1E3LA 3GUYA 3IUPA 1H6AA 4HFNA 1GUZA 3C7AA 1YJQA 1QLJA 1VM6A 1UZLA 1PJBA 4LW8A 3MTJA 1GEEA 2HJRA 1JKJA 3S2FA 2VWPA 2HMUA 4Y67A 2O3RA 3WGGA 4IDEA 4DQXA 5C5IA 1BW9B 1X0VA 4AJ1A 1ADGA 5KJCA 1R4NB 2OORA 5COAA 3L6DA 1YL6A 4W9NC 2I3GA 1LDMA 2QIOA 3ENKA 3SX2A 2Y67A 4TQGA 5EINA 1VL8A 4LK3A 3ONDA 1YO6A 5A3JA 2F00A 4AJ2A 4DPMA 4JP3A 3K9QO 2WDZA 1I33A 4FN4A 1S6YA 1ZBQA 3GQVA 1GYQA 1E3EA 1GEGA 2O3UA 4BV8A 1T2AA 1SOWA 1NWCA 1NQ5A 3IKVA 3KLMX 3VZRA 3ROPA 4CM1A 2H1SA 2NU9A 1F06A 1P44A 1E3WB 2FP4A 1NFQA 3E9NA 1ID1A 4E12A 1ZIDA 4NFYA 4ALKA 1DEHA 3HWRA 2XOXA 2P5YA 1PZGA 2I9PA 2Q46A 3AY7A 2HCTA 1CEQA 2J5KA 4MPDA 2ZTUA 3TOZA 2XF8A 1ZCJA 1U7TA 4QUKA 1YRLA 1D8AA 1BXZA 4CUJA 1PU2A 1B8VA 4LVCA 2Y1FA 4R5MA 3UH1A 4QO8A 3UUWA 1MG0A 1YJ8A 5CAEA 2EG9A 3KZVA 4XIYA 4II3A 4L8VA 1OFGA 3HUDA 3OQBA 3P2OA 4E2ZA 3WB9A 1ZK2A 5CPBA 5A4DA 4Z9XA 1HSOA 3WICA 4U7WA 1PSDA 1AHIA 4R1TA 3KV3O 3NDRA 4E5KA 4GKVA 4MVJA 5IZCA 2OUIA 1CF2O 3L07A 2P4QA 5ILOA 4RVHA 2GSDA 3KYCB 3VDRA 5KVCA 3NGXA 3CXRA 1B14A 4XDYA 3EK2A 3LLSA 2ZYAA 3CSDA 1TVEA 3GRPA 3Q2IA 4E5MA 4BUCA 4RPJA 1MC4A 1P3DA 5T6BA 3WGZA 2VYVA 3QWHA 1Q0HA 4ZN6A 3TL2A 3ZCXA 4FJ2A 4MJLA 1UAGA 4IJUA 5JNLA 3WWYA 1J49A 2CMDA 3SLGA 4YT8A 2HK9A 2TMGA 4BO7A 4NFHA 4Z0HO 3I9KA 4Z9FA 3Q9UA 3IOYA 1EDZA 1VJTA 3EVTA 1TT7A 5HTOA 5DBFA 4J7XA 3NTQA 1BRMA 3DZFA 4GMGA 4JP2A 2NADA 3KEQA 1VI2A 4R51A 3S2IA 2DPHA 4PIVA 1DBVO 1ZO8A 2O2SA 3JQFA 3K8ZA 4W6ZA 5JDCA 1VKNA 1JKFA 3BTSA 4A2CA 4MVJP 4YJDA 4NJMB 2OMEA 1T4BA 4CLDA 4JQCA 4EJMA 5BSGA 2CFCA 1XLTA 1FDWA 2Y66A 2NU8A 4CQMB 2OBNA 2B4TO 4ALNA 5I7SA 4KZPA 5JXWA 4I9NA 1O94A 1C1DA 4FDAA 3PQFA 2UAGA 4UVHA 1KS9A 4PG5A 2A9FA 5BNIA 5DP2A 4UUOA 1EE9A 2BFOA 3KSUA 4YJFA 5TGDA 3DHYA 3A1NA 3T4EA 3D4OA 3IMFA 2J5RA 2X0NA 2EERA 3JQEA 1DIGA 3BMQB 2VQ3A 3I9OA 4GSKA 1ZUD1 2JHGA 4L75A 1DRVA 4RO0A 3OFSA 2ZKLA 2O50A 1PR3A 2HKIA 4IINA 5ENDA 4YJHA 5TX7A 3PYXA 1CDOA 4IQ0A 5T8KA 4DMLA 4WLFA 2ZIZA 3I6IA 4D43A 4YT5A 1JN0A 3I4FA 4EDFA 1LDYA 2JCVA 3D3WA 5HM8A 3FWZA 3O38A 5BNFA 3JQCA 4UEJA 2UDPA 4H16A 4DYDA 1ZJYA 1U2DA 1V3VA 3R6DA 4CJXA 3C7CB 4YT4A 3ZV5A 2DBVO 4FR5A 3HHPA 3VPFA 1ISJA 1Q1NA 4XDZA 3DDNA 3GEMA 3TF5A 1L1FA 3ZWYA 4DIFA 2HQ1A 2UUOA 4YACA 1QYCA 4YJGB 3GNQA 4J1SA 4UREA 3ANNA 3S2EA 3W8DA 1W8DA 4P4GA 1E7YA 4FW8A 1FF9A 3LT4A 3N74A 4NBUA 1CJCA 2DU8A 4FFRA 4Y9DA 4U0KA 3WSVA 4ITUA 1O8CA 1Y81A 5JPIA 2W2KB 2WJPA 2Y0CA 3F1LA 3NV9A 2IEDA 3PFWO 4CR6A 2ZJ0A 3S1LA 4MVJH 4QT0A 3PJEA 4BKUA 4OAQA 3AI2A 3EHEA 1M67A 3ZV4A 4CLXA 1DB3A 7ADHA 2X0RA 2Q99A 1EEHA 1I3KA 3KLPX 3WR5A 4A5OA 4BB5A 3CZRA 5TJHA 4FFOA 2VOJA 1LC0A 3ENNA 3WMXA 1IB6A 1J6UA 4RDIA 4Q3DA 1VJ0A 3SXPA 4AJHA 2C0CA 3I9LA 5KCZA 2O7QA 2D5CA 3QWAA 5B4TA 4XR4A 3UKOA 1ZSNA 4LMPA 4E2XA 2VN8A 4TSKA 3AU9A 4C4OA 2I66A 4KTVE 3TZHA 4CMIA 3MOGA 1Z73A 4WCDA 3JQGB 2V6FA 1ZK4A 4FFLA 1A9ZA 5EESA 4ALIA 1CIVA 2YQ5A 4ND4A 1IHXA 4WNIA 5MDHA 4R3NA 1QSGA 3TNLA 4PLVA 2IYOA 4FCCA 5A3VA 2DUWA 3PJGA 4XEHA 2OXIA 4FOSA 5A5FA 4NK4A 5JCXA 3VC7A 3DBHB 3FR8A 2QHXA 1JU9A 1LDNA 3L4SO 3ZI0A 4IIVA 2QZZA 2ZYDA 4RF3A 1LLDA 2GASA 1EUCA 5J23A 1U5CA 5CP8A 4ND2A 4KWHA 3OQ1A 4N5LA 4NZ9A 1DJNA 4QQRA 1KEPA 4NG5A 4WE3A 2W98A 3PIIA 3OETA 1IY8A 1V35A 2RAFA 4L0QA 4RLSA 3VH4A 1E92A 2PK3A 2ZCUA 2JAPA 4FGWA 3E5MA 2C59A 3K96A 3LYLA 3KEOA 5DULA 1HRDA 2JKVA 2P91A 5K9ZA 2V6GA 5TS3A 3VH1A 2P9EA 1HDZA 3RUHA 3KTDA 2FWMX 2R00A 3LU1A 1H6BA 4XD2A 1BXGA 1JWAB 4GPD1 1GZ6A 1MUUA 4FFMA 5L45A 4XCVA 2IEBA 1B8UA 3LT1A 1PJCA 1SPXA 3E1KA 5H81A 5JY1A 2X22A 4I5FA 3FN4A 3GOHA 4FJ0A 4CLOB 3UOGA 4CM8A 1I01A 5IJZA 4I5EA 2WD7B 1G0NA 1DRUA 2AA3A 3BMOB 4M1QA 1NWHA 4H3VA 4XGKA 2O4CA 2GYYA 3JQ9C 3L6OO 2OOSA 1BGVA 3CH6A 1JTVA 1V0JA 4AJOA 1XHLA 1E6EA 1B26A 2A4KA 3DOJA 3U49A 2HMWA 3C85A 4O6VA 3GAFA 1T1RA 4JN6B 3T7CA 4QSMA 3ANMA 1A5ZA 1N1GA 2B5WA 3U4DA 2GUGA 3FI9A 2PWZA 4IPTA 4NPCA 3P19A 3ULKA 2PZLA 3OJOA 3EVNA 2QX7A 4AJLA 3GA0A 1IPEA 3QHAA 1H0KA 3RCBA 4CMEA 4WKGA 3D5TA 2A35A 3IC5A 1E0DA 3JYLA 1R15A 5H82A 4IZIA 4IXWA 1EVJA 4WCFC 4N5MA 1PJ2A 4DWVA 2DVMA 3GN1A 2NLOA 4IS2A 1B16A 3JQ9A 3JD4A 1NP3A 4OOEA 4CLRA 2QRKA 1LLUA 3LC7O 1N7GA 4BGUA 4CMKA 5JYDA 4Y6SA 2EW2A 3GGOA 3FSRA 1GAEO 4FC6A 5G2OA 2D3TA 3FWNA 4PLHA 3CUKA 4BNJA 3B6ZA 3DFUA 3WBBA 4I5DA 4YVFA 4JBGA 3M2PA 4KDEA 4JNKA 1HXHA 2CF5A 4PZDA 1WMBA 4XWYA 2BD0A 3GK3A 3GY0A 1ISMA 2ZTMA 3ETDA 3F47A 4TKLA 3DBRB 3I52A 4PRLA 4D79A 1U2GA 2DTEA 2XPCA 4E0BA 2HDHA 3VHRA 2EIHA 2J3HA 5A9TA 4YAEA 5DBIA 3P5SA 5DOVA 3JQBA 4FS3A 3A9WA 2W2LD 5A1TA 3DHNA 2NV6A 2VTEA 5BSFA 3JCZA 1SEVA 2YYYA 4OSOA 1DSSG 5G0VA 1ARZA 1GZ3A 1H9BA 1WDLA 1RPNA 2ZB8A 4WUVA 1DIHA 3U0BA 5JO0A 4XB2A 3CKYA 3Q1LA 1E5QA 1P1KA 5IFLA 3IS3A 4Q3NA 1ZZEA 3L6EA 3R3SA 4FIZA 4J1NA 1MLDA 2AXQA 3WIDA 4E4YA 4R1SA 3I83A 1GTMA 3T7EA 5JC1A 4DPKA 3C3XA 3NRCA 4MDHA 3HE3A 1AE1A 3EAGA 4KDFA 4OM8A 3F4BA 1HWYA 4FSHA 2C5EA 3U4IA 4XJSA 1VPDA 1SB8A 1SC6A 2P4HX 2Q45A 2YUTA 1KBZA 2PH5A 2ET6A 1KERA 3IDSA 1LXCA 2EKLA 1RWBA 1WAMA 3C7DB 4J1TA 5B12A 4DXHA 1WLYA 4RV9A 1LLQA 3GVXA 2C2YA 4CUZA 1UP7A 3IAHA 4LCEA 4MOWA 4CMJA 4MP3A 2QG4A 4GX1A 2VZ0A 2GR9A 2JJYA 1SZJG 3EYWA 1P1IA 3RJ5A 3SEFA 1MA0A 5IN4A 1VSUA 1FDSA 3OP4A 1M75A 3GVIA 4A0SA 4BQPA 3C1OA 4XYEA 2BRUA 1U5AA 3RFTA 4KUGA 4BNFA 3M2TA 4EUHA 1LQUA 1E7MA 3AW9A 6LDHA 3ASVA 1UJMA 2PD6A 4TVOA 1I3MA 3A14A 3LLVA 4BNVA 2G0TA 3IUSA 4EUEA 1NBOA 1R4MB 2I5PO 4UEKA 5I8WA 1T2EA 3AFNA 3O9ZA 1NYTA 1BSVA 1XA0A 4UVGA 5FFFA 5TLSA 4NU5A 4EEXA 2O3JA 3W8FA 1A7KA 1Q7GA 4GVLA 4EI2A 3H9UA 3ZNOA 1EFLA 4WLEA 5TF4A 3MJSA 4LMRA 3ORFA 4CM3A 5CEJA 1CQIA 1LSOA 3OM9A 4J16A 2ZTVA 4XX0A 1HZJA 4OYRA 1D3AA 4PG6A 8ADHA 6ADHA 3WYBA 1JAYA 1UDBA 2I65A 4JIGA 5IN5A 4Q3CA 4EJ0A 2NM0A 3X2EA 1CETA 3PHGA 4AJJA 5EERA 1JAXA 1YB5A 3F9IA 3RUIA 4MVJF 3H9GA 4BNYA 2I67A 3A06A 3OHSX 4LRSB 3E9QA 1R16A 3DOCA 4YRAA 2BGMA 3WTBA 3JQDA 3DQPA 1JVSA 4OXYA 4JJFA 3RC2A 1C0PA 4N18A 5EIOA 3G0OA 1WDMA 4E32A 4ESOA 1GU7A 3RUEA 4BNZA 4DQUA 1NR1A 2E4AA 3MOIA 4HADA 3W6UA 1QYWA 2X8LA 3NGLA 5GMOA 5KTKA 2Q2QA 3UW3A 1QP8A 2DLDA 1N5DA 1HYEA 2BFMA 5DZSA 3VTFA 4BGVA 4W7HA 3Q3CA 1C1DB 5HA5A 1UAYA 2CD9A 4OHUA 3R3JA 3PYMA 2EJVA 4ONEA 3TJRA 2O7SA 2HMVA 3VDQA 4B3HA 4UEOA 3HDJA 3RWBA 3OH8A 1VSVA 1LEHA 4K1LA 1LUAA 1XIVA 1H94A 2X23A 4PZEA 3D1LA 5L7WA 3CMMA 3V8BA 3JQAD 1VLLA 3WFIA 4BQRA 4FQ8A 4PLTA 5JAMA 4DIBA 1NHGA 1EVIA 3DOOA 3GVPA 4YJHB 2ZK7A 2Y0DA 2AE2A 4D44A 4HV4A 5C3MA 1IOLA 5CPFA 3VZQA 3D3WB 2FY8A 3BMCB 2RBEA 3PWKA 3JD3A 4XRRA 3C24A 4ZGWA 3W1VA 3OA2A 3QP9A 2BI8A 3FBTA 5CDTA 1I36A 1J0XO 4GBJA 2JFGA 4R1NA 1PL6A 4RVGA 4YQYA 2PZKA 4D3DA 3PDUA 5TJ9A 3FD8A 3H8VA 4D42A 1N9GA 3FPCA 1ZVMA 2X0JA 2RCYA 4FOOA 4TVBA 2NACA 1QV7A 1MB4A 1PGJA 4HFRA 1ISHA 5G0SA 1YOVA 4K6FA 4CM9A 4OKNA 3WGYA 2J8ZA 1DC3A 1GCOA 4DYVA 2POQX 3VKVA 2OP1A 3WFJA 4X54A 4N7RA 3PQDA 4L4XA 3WQSB 1Z7EA 4I9HA 1C0KA 3NAQA 1SOVA 1PGNA 5DF1A 1GR0A 1A7AA 4ND3A 4JCOA 5B4VA 2DM6A 1HT0A 4J7CA
chains in the Genus database with same CATH superfamily
1GY8A 1I2ZA 3D2LA 4RGQA 5B1SA 1UJ6A 2CVHA 4AP9A 4CV2A 3CR3C 4KITB 4PZ0A 2QS9A 4YCAA 1L4EA 1SIBE 2BEKA 2I76A 4G89A 3NP7A 4OLFA 5BMVF 2RIRA 2ZVJA 1P80A 1SBYA 3R6WA 4D3XA 2A58A 4BNXA 4JB0A 5KTPA 3RASA 4EKYA 4Z7JA 1PS8A 2ATXA 2H2GA 1M76A 4OPMA 2IDJA 1LPPA 5BSVA 5C31A 1JEQA 2GD0A 2NXEA 3OZFA 2XUAA 4DR7B 1VJ1A 1W96A 5WRFA 1K6XA 3IAFA 2BZ0A 1SY7A 1GTG1 1ML3A 4CM9D 3ZG6A 1RWXA 3C2QA 2WM2A 4A1FA 2XCLA 3FTNA 4FMDF 4GOKA 2GJ4A 1A8IA 2HXYA 4RVUA 2X0IA 4B7CA 1D5WA 2FEXA 4EA7A 5KOJB 1YQGA 1W5EA 2VQDA 2F1HA 1J56A 1G1MA 4LFCB 5A3QA 3GGDA 5BV0A 5C8VA 4NBRA 3AOGA 5TVGA 4Q9NA 1RWQA 1W8IA 4MCIA 3EZLA 3ND8A 4PYKA 3PD7A 1H3FA 2YWBA 3LCUA 4HB3A 5H02A 2YRFA 2NTEA 1N7IA 3AW8A 5D5HA 2JLAA 2ZU0C 3L9WA 2ODEA 1FC0A 4TXMA 3RVLA 4ZD6A 4FCVA 4KUHA 2A88A 4JU8A 1SXJC 2TS1A 5JCOA 4RTMA 3E0XA 3WE7A 3C8MA 4DV6B 5KTRA 1P9NA 3S2GA 4MINA 4WN9A 5FWYB 1M73E 3VPXA 1HEUA 3VH2A 4UW9A 3ZKWA 5HYVA 3LBIA 1CQPA 1UJCA 4V2UA 1G7TA 1ZEJA 4XYLA 1PKEA 2BKVA 1OFUA 1N5LA 5IM5A 2DRIA 3PL1A 1BDJA 2NZUG 2X4GA 1K6IA 1W5TA 2PA3A 4C3OB 2VTVA 2CJWB 1AMNA 3AU8A 4Q19A 3DKKA 1E79D 2HJGA 1E7QA 1MIOA 4UQPA 4UZSA 3AUSA 1A7JA 2E5LB 1JT2A 2OO3A 4WECA 1EP1B 1BXGB 4BTEA 2CKMA 4CKCA 1D2CA 3A9TA 5KYXA 3CJRA 3OUUA 1OX4B 2PLRA 1TGYA 2COUA 4QBGB 3WDSA 4GO1A 1MO5A 3Q3VA 5DIZA 1RLTA 4XJTA 1B3BA 4YRGA 2NU6B 1WEHA 1Y6QA 2QTNA 3F3YA 1C14A 1K5DA 3IBFA 5LQSA 1N32B 2YUIA 3QMVA 2H17A 3NAMA 4IUYA 3BRQA 4XKJA 3K6SB 3P0EA 3UXYA 1G5RA 3EY4A 3ZHCA 2P6RA 3WKEA 3I2GA 4U3JA 1XCMA 3IODA 4ZAZA 1MQ8B 5ALOA 3LQFA 2DXIA 2Z0MA 4MB2A 4NEGA 3OCCA 3T7JA 5C5DA 2MYTA 4FE7A 1DBPA 1LB1B 4KPEC 3P4YA 1MB3A 4KPUA 2JCBA 3BE6A 1Z35A 2YMPA 2KYRA 4L1KA 5U1PA 5K6AA 2DSNA 4M46A 4RTJA 3E8SA 2JJMA 1YCGA 3B7GA 5REQA 1N1EA 3HCRA 3QXHA 3VOBA 1D4ZA 2BTOA 4WLUA 3L7YA 4IP0A 1Z5WA 4EYQA 3SD7A 1Z82A 3A04A 4MS3B 3U62A 4EG0A 5A2GA 4TM7A 4IGEA 5D3KA 1RP1A 5AW9A 3D5EA 4MW7A 3EWNA 5AM1A 3FMPB 2DJ5A 2Q1XA 4BBPA 4RCVA 4ZVKA 3H42B 5E7JA 3LXUX 3CNBA 3GWGA 4BMSA 4P7KA 2XQJA 2DWUA 1JJBA 4IMJB 2XNDA 1F38A 1ZFNA 4MMXB 1N2EA 3MYRA 3R75A 3VJMA 1U7XA 3SZ3A 1YH3A 5F5XA 4Z0PA 4ZQIA 2A84A 2AEFA 1IDN1 2O6LA 2NWQA 4TN5A 2C88A 3JV7A 3M5PA 2C2HA 4CEIB 1RCTE 1IY2A 4I1RA 2J08A 1ORRA 3SEAA 3JZDA 2ZI4A 1BN6A 2XJ4A 3UCXA 4Z9BA 3G49A 2PLAA 1NVGA 2EW8A 3NPAA 3BYZA 2FPMA 4F3YA 4JBWA 4IH9A 3KKLA 1X7ZB 3SZMA 4A27A 3CJTA 3SQNA 4A26A 1RXIA 4D4LA 5KSOA 1JG1A 4PZ9A 4L08A 3WGLA 1IFXA 3L7DA 3QJ5A 4XCXA 4ZPXA 5J3JA 1IPHA 1JW9B 1ABEA 1WXGA 1XTPA 3CRMA 2XSZA 4O4LB 1TYEB 3KJZA 4PAWA 2ZYVX 3FYUB 2W6IA 4YRNA 1SXQA 1QGDA 4GPEA 1WUTA 4LCJA 3MS2A 3SXUA 4R68A 2LCQA 1FZQA 4G5RA 4YRJA 5BVGB 1H22A 1JDSA 1P2UA 1TXGA 2GS9A 4WCFB 4WLOA 3RS2A 4ER0A 3CCFA 2Q1SA 3BOSA 3N75A 5DT2A 5LQNA 4OX9Y 2ETVA 1CZKA 1TYCA 2IXFA 4N5HX 2XNDD 3DUFA 4QUIA 4WOJA 5FH9A 5KNLA 2ID8A 2CE2X 1G9XA 5I9NA 1N9KA 2YY6A 4YUVA 5CXUA 4RH3A 1J1IA 2ORVA 3JQPA 4UDYX 3TNJA 3ZDZB 1DBQA 3AONB 3MUOA 1KH1A 4KH1A 1X1EA 2CLCX 4L95C 4GVXA 4I66A 5FJJA 1G2OA 4IYJA 2QMZA 2YWRA 4YT2A 4BZXA 2I6QA 4UOQA 1X7HA 4FZJA 4PIMA 4DOMA 4MHTA 2G6TA 3HM2A 1R6XA 5GTDA 1TYAE 2B37A 4Q4LA 5C7IO 3DO6A 4RU1A 4DJEC 4QJ5A 1PGPA 2YN0A 4PZCA 5FR2A 3NHRA 4POAA 4X66B 3A1CA 4QDKA 1LBHA 3EBPA 4BJ5A 3FAZA 3GUHA 3KP1A 4MEAA 4N7BA 1ADFA 1T36B 5K0GA 4EG4A 3AR8A 2XKKA 1R10A 3GEGA 2ENUA 4CTOA 1F0NA 4NABA 5AUOB 5LP6A 4WK6A 1GPBA 5ER6A 4DM3A 1CUWA 1V6SA 1RJFA 1ZGJA 2GK4A 2YZ7A 4ZT5A 3WMRA 2PWYA 4ZEOA 4MUGA 4MR9B 1W36D 2FXIA 3GH1A 1QF6A 1KA9H 3S4YA 5FOWA 3HZOA 4MQEA 2B9VA 4A6EA 2YJ4A 4MVJI 3LYUA 4YUZA 1TEHA 1RM5A 1PR5A 1LWNA 1V16B 5K5EA 3LF2A 9ATCA 4ND8B 3ZS8A 2CW5A 3I23A 3QLTA 3MG9A 4U39A 5EJ7A 1XPUA 1EFRA 4L3OA 3V2UA 4MWSA 4R71A 2PTHA 3H5LA 4HAXA 5IBRA 2W42A 2DOKA 2X7JA 5FYDA 4J91A 1U9YA 1RHRA 3WGJA 4CQLA 4CMBA 1T4DA 2WWXA 1SHKA 3H2HA 4KQ9A 4NMHA 1G8AA 1KYQA 2BEWB 5BOSA 1BXRA 1ZM9A 2CVZA 3LCMA 3O8BA 4PSCA 2EJWA 5K6TA 1U0BB 1BDBA 3M89A 3FNFA 3KKPA 3TUZC 1NOJA 1LRKA 1BZYA 2YVAA 3NXKA 3NANA 3E3MA 3ESRA 2QD3A 4HAIA 1FMCA 4ESEA 2QLFA 3PCRB 4WQMA 4V1CI 1LV7A 2Z58A 1GUAA 4D0SA 1H5QA 4WXRA 2NO5A 1E18A 4M22A 3QLUC 3OZ7A 1DQNA 2WJIA 4UUQA 1X1QA 4ERNA 3U26A 2JG3A 4ERXA 1J2EA 1P0PA 4HPWA 4BAGA 5DGHA 2Q8PA 3T41A 5KTSA 2I71A 1SKAA 2WJAA 2I34A 3MNFA 1N36B 2R00C 5BWLA 2ZZNA 4GIBA 4GZLA 2QW8A 3L0IB 2F1RA 2BKEA 4CEHB 3L7IA 3AY6A 2KB0A 1T1SA 3AXTA 2VEDA 1NFFA 4IKPA 3VKFA 1XJ0A 4TTRA 5HHTA 1RP7A 4HMQA 1YCFA 1HDIA 3OA0A 2QQEA 3SHQA 2G83A 4HN4B 1VG1A 2EFGA 3RIXA 4QX6A 4BCBA 1U2TA 4GYKA 2QTBA 2WU0A 4F91B 5LIPA 1HR0B 1MVLA 3DMRA 1R5JA 3H13A 3JQAB 1WWKA 2C0QA 3N5KA 2PUEA 4BX8A 1DWPA 5AIAA 5AT1A 1NJ1A 1UZAA 2YHIA 4G23A 4MLZA 5LZ2A 4AB1A 4QEKA 3AFHA 4RZ3A 5L7YA 4C6SA 4L0DA 3VNUA 3DAFA 5HGXA 3DDCA 2XTAA 1EJ2A 4O4JB 4M54A 4W5HA 5F1OA 1KOJA 2YFHA 4OBEA 3M4XA 2AF4C 4HBGA 3FKQA 2D7JA 4WGGA 4JL5A 3IAS1 1AKTA 1W87A 4N82A 3L8GA 3KIPA 3DFZA 5ALLA 2J9RA 1UIRA 3QPWA 3CV3A 3L84A 3CNNA 3N7AA 5C0OE 1JMKC 5KNCH 5LXTA 5FJIA 1ZD5A 3UFXB 1O0BA 1UKAA 3H2SA 4RMIA 4DA9A 3JZIA 2H1OA 2CV2A 4ZVTA 3JVEA 3FPGA 1RAAA 5BSEA 1GFIA 1U04A 4G4SP 4QPZA 1PFVA 4YJ3A 3A37A 3WYGA 4I55A 4M89A 5J2UA 2HUNA 3G2JA 2GYVA 1H69A 1X1SA 2A5YB 3WGTA 1POXA 1FLVA 2GAJA 4X84A 5AK3A 3SEZA 1CVLA 1PT7A 3CZAA 3TTSA 2I7TA 1KC1A 3UCEA 3Q15C 2ZJ6A 4GSLA 2C31A 1GUFA 2AG6A 4OHFA 2JZNA 5FTKA 1U31A 1ATZA 1E3IA 3HB5X 4DLRA 1O1YA 1OFTA 1QYXA 3GO4A 1DQRA 3QKIA 4P31A 1UXJA 5DH9A 3TNDA 2AHRA 4HNAA 3P9KA 1N4AA 4IM7A 4IEEA 3KOZA 4ZOBA 4DA7A 2YVQA 2P1RA 2Y1LA 4MS1B 1NBAA 1PGOA 4RY0A 4V0RA 5E7QA 3ZH2A 1MQAA 4OOFA 3FRHA 4ZEVA 3U4MA 4B44A 1GAXA 1FSPA 4G9EA 5AKZA 2Y8EA 2PKQP 5LYJB 1QLWA 2Y1EA 3T1YB 2Q50A 2B7LA 3GEDA 2FUEA 2IHUA 2I54A 3V3KA 5CTAA 3PC7A 3VVBA 1C30A 2CDCA 1QVVA 1NURA 4K9SA 1PK7A 1XD2A 3B5IA 4KXXA 3TOVA 4CKBB 3PLAE 2R1UA 3TTXA 1X19A 3V2HA 1EB9A 3WFZA 4O4IB 4G8JA 3A1SA 4MUYA 4PGGA 3IE1A 1RJGA 1OAOA 4TMFA 1A9YA 1QB8A 1H2HA 5EIBD 4BO5A 5F2EA 2I3AA 4EBBA 4ZOCA 3GAZA 1KRHA 2FW7A 2IZ0A 3JZFA 4LXXA 4DJAA 1CK4A 2DBRA 2X4DA 3EXG1 3GJTA 4PICA 3AUAA 3FROA 1U1GA 3OX4A 3ET5A 4ZU6X 2Z6AA 1JSCA 3K5IA 3N2GA 3HCNA 5A4AA 1EQ2A 2M98A 4NBLA 1GNPA 3K2QA 4FEEA 4B7UA 4M8LA 4YV0A 2ZB2A 3E58A 3OQIB 1QV9A 1RPJA 1QU2A 1A50B 1LX6A 3UICA 5AM3A 2O06A 5C7YA 3E18A 2P65A 1D4OA 2A14A 2BF7A 4JYPA 1A95A 3D6MA 4DG8A 3ZZMA 1JFSA 4D82A 3NUZA 5EE5B 1UBOS 1KFEB 1KYVA 2VDWA 5ILGA 1P29A 3ZCPA 1MXHA 2Y0BA 1OV6A 5JAZA 5B3JC 1UR5A 5CFOA 4QRDA 2DT8A 1L4GA 3U4AA 1Z0JA 4OXIA 3UK1A 1IEWA 1NT4A 1XEXB 1KY2A 3MEQA 3QU2A 5BSTA 4QDXA 4QOIA 1GRVA 3DEIA 2R1VA 1DINA 1G8KA 4P6VF 4RXMA 1NXSA 2I8CA 1A9RA 2OLKA 1FOEB 3EZ9A 4MA5A 2C4HA 1T3ZA 1XXHA 2PMWB 4RZQA 4A1OA 1Z3IX 1SVWA 2CEAA 1NVUQ 1DWOA 3GG2A 1SKQA 1P4AA 2EARA 2GBPA 4UQLA 2IYZA 1YS7A 1FFCA 2PL5A 5FPSA 1I4OA 1AKUA 3ITDA 3VNQA 4DLNA 4YQFA 3B3FA 4WKOA 3E70C 4PFJA 5BR1A 4BNUA 5FIUA 2NVWA 3EXHC 3DAHA 3NTRA 4BP9A 1W19A 3DNPA 5TQ0A 2X9NA 5K1ZA 3UXMA 4QM7A 1V8BA 4JI5B 2VAPA 1QMGA 4KMSA 3P0JA 5KC8A 1R8QA 1W93A 4ARSA 4G97A 2WNIA 3UJ9A 1OB2A 1E6WA 5F33A 4CMHA 1LLCA 1THZA 3PLRA 2HJSA 2OV2A 2XBLA 2RHCA 1L9KA 2ID7A 4LYFA 3JWIA 1JU4A 3FDFA 1Q12A 4A3SA 4EGQA 4CETA 2CCKA 3GT4A 1VB3A 5ER9A 2D59A 5BWBA 5KHLB 3AYZB 3OIFA 4E88A 4N8DA 5CVCA 2P3SA 2UVDA 2J3JA 6REQA 1BE8A 3FJOA 3QWIA 4F8YA 4BRSA 3QYAA 2VS1A 1X8LA 2C1EA 1RRKA 4RCZA 2NU9B 1IL0A 5FBQB 1TC2A 5IS2A 4TZKA 1SD2A 3R0IA 2C07A 3ZZ0A 1MZVA 2XNCA 4TWAA 5EC8A 4DG9A 4RTLA 4POOA 2LNDA 3KUXA 3ZJ5A 5TDHA 4P7FA 3FKSA 4UHDA 3FYDA 4AYWA 2BTQA 1V1RB 2VUUA 3BPSA 4ENQA 4LFAB 1KI1A 1DAFA 5IH7A 5EIXA 3GUCA 4QIHA 2B1GA 3DLIA 5CAEB 4J16C 4B48A 4EB0A 4B46A 1FU7A 3QVXA 3ZZNA 2PAFA 1W2WB 3OEED 4NQRA 2VSQA 4G63A 3JZAA 3ZU3A 3UWOA 2RGUA 2GB4A 2G17A 3E9RA 3ILXA 1GPDG 3AB7A 1H05A 1KETA 2P6PA 4DC1A 1UADA 3LUGA 1BHQ1 5D3QA 1ZBDA 4EHLA 2JJ8A 4GI5A 4R8KA 4B73A 3ZWQA 1Z56C 2Q1WA 1JHAA 4LWZA 4RCYA 5L3VA 4G0XA 1IQ0A 3ESQA 4YAWA 4FKMA 2FJ0A 1DHRA 5HMLA 2WMOB 1SOAA 2PZGA 1OYYA 4EJSA 4Y6PA 3SS9X 1WUYA 1EWYA 2A94A 3QBJA 1BE6A 3AUKA 3EIQA 4Y9SA 4WCVA 1UWCA 3HUTA 1Y4UA 2RIPA 2XQKA 1KQOA 4GZ3A 3RJ9A 4C3ZA 5E9QA 2O8EB 4J8PA 4EGJA 2O07A 4E08A 1YC5A 3R3WA 4OFZA 3DL2A 4QNMA 2QPAA 4ZO7A 2EHJA 4Q01A 3B5JA 4V2IA 4N47A 4A8TA 2P11A 3WDMA 1FYVA 4TWRA 2G4VA 3FKSD 4LCBA 3EVCA 4MV5A 4CU2A 3RDPA 3S0JA 2QQGA 2AVDA 2PN1A 3FPSA 3CN7A 3E81A 4PCUA 1I3NA 4TLAA 2FG5A 4UCFA 3O90A 4MRMB 2CXUA 1RWOA 5KJ1A 1SB9A 1T10A 2F7SA 3OBBA 1XLVA 2FQXA 1RJ9A 3TDMA 3UPDA 4V1CB 2O8BA 4IXTA 1ORWA 2GN1A 5JZSA 4RF5A 2M9MA 1F0YA 5DE3A 3FPBA 3QUQA 1LBQA 2IPOA 3VTAA 2AQHA 1N5KA 2QB5A 3MXTA 1JHRA 3QVOA 4N6NA 3N7UA 1RE0A 4GOLD 3BMNB 3P26A 4WY2A 1DIBA 5H80A 3SR4A 2PRJA 2XOEA 1K8YB 1N6OA 5AQ1A 4E5PA 3EFHA 1M0EA 3ICVA 5ALMA 3OFND 1NDUA 4KYVA 1H5NA 2R6JA 1V8OA 2V55B 4TS3A 3RS9A 1NUTA 3BILA 2VPPA 4R3WA 2GILA 4HZGA 3T5DA 1YZTA 2R79A 3MN1A 2BMEA 2BMJA 1ZRHA 2ZDQA 3P8ZA 1VDZA 1T3TA 2QG9A 2BM0A 4QBKA 3T4UA 4ZTBA 1ZM7A 4O2BF 4Z6KA 1T6BY 4ZOEA 1KQFA 5L95A 4PLYA 1EVZA 1YDMA 2WA2A 4YJFB 1TCUA 2CXTA 1OU4A 4LOLA 5KPJA 2Q21A 3A2KA 3FZEA 2VF7A 3GLHB 2P6UA 3RTDA 2JC3A 1GN8A 5THKA 4MV4A 4RVNA 1DAGA 2GYUA 3W05A 3UUEA 1ZPDA 2V4ZA 5BN1A 3L4BA 1OJ7A 4QJBA 3VYSB 1AKMA 3R0JA 3TZ6A 3KQYA 4AY4A 2IHJA 3AVUA 2D13A 1INLA 3N8DA 4K9MA 2ONKA 2VHZA 4Q16A 2R4TA 1T0HB 1H93A 1XRPA 2CXHA 2W2XA 2ZWMA 4QA9A 4XLZA 1LNZA 4UAVA 4E13A 1T5LA 2Z2YA 2JAXA 1NKTA 4YMLA 1JSZA 3D7KA 4B84A 4HAVA 2HHHB 1K8XB 2O1XA 5KIAA 3EOZA 3T38A 4S3MA 3BMOA 1NIJA 2R7NA 3DBOB 1VBNA 3JSAA 1JDVA 1Z2PX 4RXTA 5ALNA 3PNVA 4NJEA 1DZ3A 1V3UA 3CW8X 4LOIA 4PBRA 5D00A 4BECA 4BJ6A 3BD6A 1LPNA 1IJEA 4N76A 1NAIA 4MQFA 2F55A 3NGMA 5DWDA 4GZ6A 4UEWA 2V7EA 1SXGA 3OSUA 1T0BA 4TX1A 2E9SA 4AG3A 4DN6A 1L5ZA 3KXKA 5D01A 1L5QA 1AKEA 2WLSA 3K4PA 3KHUA 3OMXA 4N54A 4Q4AA 3RREA 5CD1A 2OO5A 5EZYA 3THXA 1EHYA 1N6RA 2ZJOA 3JQ6A 3KVNA 4HXYA 3EN0A 3Q87B 5TNXA 1QG2A 5LJIA 4JJ4A 1KYZA 3QQPA 2ERCA 4N0EA 5CEEA 3OIWA 5ALHA 4LFBB 4D8UA 2PT5A 3FJYA 2BMFA 1JYSA 3C43A 2D74A 4V02A 1ZJWA 4F84A 3BJMA 2RK4A 13PKA 1VL5A 5FOQA 1QHSA 1ZY2A 2DR0A 3EW7A 1FRZA 1YB1A 3D6JA 4MVJE 2OILA 3H1BA 4ZGBA 3HA3A 3ZWWA 1G6OA 2NNWB 2J09A 1YFJA 1YNOA 4AJ4A 1NMXA 4U7DA 3PDHA 1AKYA 4B4VA 5JCOC 2IL1A 1M7HA 1U3FA 4QXMA 1L4FA 4OVKA 4YONB 3WRYA 2Z08A 1EFUA 1A8PA 1PJ4A 1QAOA 3KOMA 3OFKA 1RVDA 3BWDD 1WNTA 4LNUA 4MROA 1Y9JA 4NE2A 2FEMA 2R85A 3V6LA 1G16A 1Y1QA 1CU1A 3RC1A 1ADCA 1NU6A 1JLKA 2M2IA 1RZVA 5ES4B 4ZRNA 3GCXA 3QOFA 2OUKA 3BH0A 3FWYA 3OJFA 4L5IA 1E7RA 2Q4BA 4PXAA 5EMLA 4E2ZA 2O0MA 3GBSA 2BEUB 1GO2A 2X6TA 3IXQA 2YZGA 3ZHBA 3EPLA 6NULA 2RH8A 3R7NA 1Z4JA 1Y0BA 1DBWA 2PWPA 2WSSD 3I0ZA 3FHCB 3L0DA 2OHFA 2PRKA 3RHTA 2YYSA 5HDQA 3AGPA 3S7TA 4EYSA 2EZUA 1QUEA 2HRZA 2YWJA 1OZAA 3IPLA 3Q11A 4PLFA 2JFOA 1K0FA 2P41A 3V8RA 3MRVA 1L9XA 2AL7A 3C70A 1DKNA 3P9XA 4DAEA 2IFTA 2B34A 3FFXA 3CZ5A 4TV8A 4ENTA 2ORYA 1H0RA 3TCKA 5CB6A 1Z4KA 5KYUB 4OHCA 2RGBA 1HX7A 3GGJA 5CG2A 3DLPX 1C3LA 4RGVA 3KBOA 2JJQA 1KJWA 1XJCA 1U0NA 3AIMA 1PZHA 3KR1A 1L5VA 4GWKA 1USIA 3QNUA 2UXCB 5K0NA 5IULC 3ZE8A 4P4TA 1GFSA 1PLLA 3HYLA 1CY0A 4D9GA 3NTLA 1BD3A 5K6AC 1E6MA 1RS0A 1P5JA 1FL9A 3ADPA 2RGWA 4IDCA 2EKBA 4DZZA 5K0FA 5LQMA 5AICA 2NAPA 4U7PB 4BFLA 2B1RA 4IJKA 4HD8A 4RADA 5AVYA 2HJVA 4YA6A 1OXMA 1MO3A 2NT3A 5KYYB 1L4MA 2B9EA 2XYPA 3GLHE 4F06A 3K0EA 1U0OC 4L9RA 3KSZO 3TOSA 3DAPA 2X5KO 4OIFA 3GDGA 2B4RO 4I1YA 2QROA 1GADO 3O4RA 1JLSA 3HY3A 4OI0A 4RF2A 1HDGO 3T3OA 3UW1A 1CEXA 1RLMA 1Z0KA 3CRW1 3KR2A 3EXFB 5DM2A 1Q77A 4EHIA 1VBMA 4HFMA 1I2BA 3NCTA 1D2GA 3CURA 1NZJA 1QWSA 2YCLA 3E4DA 1QVZA 3PHCA 2H2DA 3M3HA 2PE5A 1ZI9A 2Y76A 3RD5A 2BV3A 2BI4A 1QK5A 3VR2D 3C7KA 2XITA 3FA2A 4HAZA 1XAIA 4Z54A 1Q83A 1G8MA 2IJGX 2QNBA 3KUUA 3O4VA 4FS8A 3RUAA 1YDGA 4JYMA 2PL1A 1GL9B 4EG1A 1U9CA 1TZJA 4TSFA 4B4WA 4BNGA 5KWSA 1K88A 1PLJA 3HU5A 5AXBA 2NXWA 3F6EX 4KKVA 3LKVA 3KL4A 4PCVA 1TNDA 3I1YA 3HXKA 5CT9A 1ONPA 1YZYA 1RZUA 2WICA 1EFVA 3D4NA 3HBLA 1U8CB 2GQ0A 4A91A 1T6ZA 2C2BA 4EHDA 5ITVA 1MVNA 5E3JA 1DOZA 2BKAA 3A2LA 4X7BA 3WHKA 2PUDA 4MUMA 2I4OA 4M99A 1DOHA 1QS0A 2AJBA 4W6QA 5D86A 1FU8A 1ORTA 2GKSA 1QH0A 1QH1A 2JLUA 3ZZUA 3AVXA 3PDCA 1T8PA 2BFPA 4JJ8A 4B2IA 3SZOA 5I3CA 4YRRA 5CT8A 3JTEA 5LQRA 4XYBA 4BNLA 1FDVA 1RHQA 4ARAA 4FI3C 5DGCA 2A5JA 4RMHA 3L1VA 3OKFA 3W3ZB 1UBKS 4IJMA 3TL6A 4BNIA 2NUBA 3ZV7A 1MABB 4J0KA 4RMNA 3P2YA 4J49A 2PWBA 2JBWA 1EGVB 1T1IA 4TKUB 1JDNA 5EUMA 5KS2A 1DCFA 1LSSA 1BQ3A 1WOYA 3S8MA 2Q5CA 3V00A 2V5VA 4HB4A 1UBMS 1UOQA 1H2BA 2FUNB 5TMBA 4TSFD 3PFFA 1L4YA 1N2XA 3P7MA 2I22A 4ZHSA 8GPBA 1TT5A 2HTEA 1ZP6A 2WUDA 4XR9A 2FWIA 1V8ZA 4Q7MB 5JLAA 1EX9A 4EQ6B 3DAGA 1Q20A 1QR2A 2C98A 3HC7A 1GT6A 2Q5OA 1J8VA 4ZCRA 2QLMA 3BSFA 2D54A 1IUPA 2JA2A 3W6NA 3GJRA 2RH9B 2JFFA 1XXLA 3MJCA 1ZINA 2RGXA 3QG5A 1B8OA 4HEA6 4OLJA 4GZMA 3AHFA 4PC3A 3RBXA 1QNFA 5C18A 4QSMA 2CHVA 4ZARA 5LP6C 3K20A 4NV1A 4ZHQB 2ZULA 4LSZA 3DVQX 1Y4ZA 4MX8A 2VUHB 5BN5A 5CLJA 1DARA 3ICEA 3OIDA 4UZFA 1CZNA 2FPOA 1O9BA 1SM4A 3H8WA 4MGKR 4Q12A 1XA4A 1N5IA 1G291 2AX3A 3RF7A 2O5EA 2QYHA 3M34A 4OJMX 1CE8B 4GXRA 4V0QA 2R1TA 4LDRA 1SUFA 2L17A 3F4KA 3IP1A 2C29D 2WABA 2IS1A 1O7JA 2F9FA 4L4SA 1L5HA 4C7OB 3ZY4A 1XGKA 2EZ8A 2CNWD 1X7GA 2P7HA 3RJMA 4RFLA 3OLCX 3RUCA 4B40A 2A3NA 4B3DA 1Q3HA 2FMUA 3U2QA 1HL3A 3AF5A 3LX8A 1LQ2A 4OFWA 2J4DA 3DAOA 4B3RB 4L28A 4RAOA 1OHHD 1GG2A 1TA4A 1L7BA 1P3JA 3FLAA 4HWPA 3O1JC 2PS0A 3QMPA 1F2UB 4PHHA 3ELWA 1LPMA 4B81A 3P4UA 3G8BA 2NUPA 4HH1A 3W6ZA 3MBIA 1U99A 2XB2A 1RQRA 4Q3OA 2C5SA 5F9HA 3MWLA 5DN6A 3OJXA 2IS6A 4MWEA 5IC5A 1B7GO 1YB2A 4W5JA 1LLFA 2BFFA 3SSAA 4FFNA 1HRKA 1TQ8A 1AXGA 5AJHA 4F1WA 4RMJA 1NR7A 5COBA 3NWJA 5FNZA 4HXFB 621PA 5JSUA 3H4MA 3QEMB 4G0MA 2YIVX 4PAMA 4PBTA 1GXSB 2FN7A 4IXNA 1A72A 1P2FA 1WBJB 1HSZA 3I58A 4BNNA 4WZBA 1WP4A 4CXMA 3BVPA 1PFUA 4UNNA 3OECA 2B92A 4I4TF 3CCBA 3NJ8A 4PZZA 3RRBA 3JR7A 2O8DA 2B2CA 1C1XB 4RZIA 2V5UA 5JY6A 4F8EA 5GGXA 4EJFA 2TMYA 3K8QA 2PFSA 3HXQA 4WBXC 1HEIA 2VDLB 3NU1A 3SSMA 2HA2A 4CQJA 1I5OA 5DBGA 2ZE5A 3PWZA 4BFWA 1AQ6A 1GCAA 4PLWA 2B99A 3DDZX 1VHQA 3WL7A 1YASA 4EUHA 2H1RA 5JATA 4Q7JB 3PVZA 2MSDB 2W6OA 2G1JA 4JB3A 4BO9A 3LF1A 2HF9A 1W0KA 1QPGA 2OMKA 3T5GA 4KXVA 5BQ5A 1X1TA 3NHJA 3OQ6A 2UYCA 1VHJA 3C16C 3NVDA 1V7PC 2J3EA 4GC9A 4KK3A 5AESA 3AJAA 3QHPA 1OGYA 2O1SA 4NOMA 4B79A 4NZZA 3NB0A 1Y98A 1PK8A 1VI5A 2DSTA 2DGDA 3JQ7B 3DWIA 3MPOA 3MTAA 1P5RA 3KK0A 1U7WA 2JDIA 4QFDA 4UNPA 2P4UA 2WVAA 4JGIA 4GI1A 1UDXA 3FDZB 1F48A 2O7NA 3EEQA 3RYCB 3HPRA 1OXVA 4R9UC 4JKYA 2RJ3A 2QT9A 3EUWA 4OQPA 5BNWA 4D57A 1HQDA 3D02A 1VJRA 1UOEA 1NPTO 2PVPA 1DKOA 2QLJA 3NM5A 1R3DA 1CBUA 2VKQA 2WU4A 4KR0A 2VPYA 3RC3A 5C81A 2VT2A 5I4KA 1NJGA 1AZSC 1KJYA 4JLJA 1U3DA 5FA8A 2GEKA 2OQVA 4I8IA 2BGNA 2FSSA 2VQ6A 2W6ZA 5FQNA 5IXYA 3Q88A 4O33A 1M6VB 2EJTA 1W0KD 5AVXA 4RQTA 3OBIA 1JR4A 3F6PA 3ZOZA 1GA4A 1IWPB 1I7PA 5DXFA 4JLAA 1GM5A 1F1JA 3EIWA 2AT1A 4JLVA 1XWIA 4RM3A 4URVR 1X7DA 4PHCA 5FBRB 3CLRD 4PFQA 4PRKA 1VC2A 1E3WA 4MRNA 1KI9A 2RGGA 2YYAA 2RCNA 4X65B 4QXAA 4EY7A 3N6VA 1QDEA 1P9LA 1Z2CA 3O75A 2GXAA 4ZO9A 3RUDA 5JH7F 3BWYA 3M1LA 3X1YA 3ZJUA 1OAOC 3CPSA 2QU8A 3DYIA 2ZJ5A 1C8BA 4E5YA 4Q1VA 3CNLA 3TIGA 3I1IA 1PJTA 3EZ2A 4LG1A 5C37A 3FGPA 1ZUNB 4IS3A 4UNRA 4X45A 2B4KA 4D8VA 3Q7IA 1WQ3A 4YP9A 3WAKA 2ZE7A 3C98A 2VHEA 4K9QA 4TXLA 3PR3A 3AHIA 4PV7A 4KR9A 2O19A 2VYND 4DBLC 3VNBA 3ZK8A 1DLIA 4M0UA 1JPVA 5A4KA 1DKUA 4OHRA 3TSYA 2FPIB 5HJ7A 2GBCA 4GKAA 2HRCA 2OD7A 2QVCA 3GNSA 4CPDA 5KJ6A 2IU0A 4BWFB 3IVCA 2AJTA 4MYHA 3U1TA 1A27A 5AXCA 5HZGA 5IUNC 3TRDA 3HFGA 4RA9A 2HHJA 1XKQA 1N75A 3R7WA 4UD2A 1WO8A 2IIQA 5LPNA 3FMFA 3SFVA 5JBNA 4G5GA 1YVDA 1AA9A 2DJIA 4IMPA 5BUSA 4WPGA 3U5ZB 5B1DA 2E37A 2VWGA 2X7XA 3IOEA 4Y2JA 4UATA 2C3YA 4L07A 3I0NA 4M7RA 4PSDA 3DVRX 3EC2A 4X60A 3TTUA 4CLEA 4QGSA 5FBVB 5JZBA 3HTXA 2YBEA 3HWX1 2Y05A 1L8OA 2FP3A 2G07A 2FG6C 2NO6A 1LF0A 4RD1A 3L7NA 4BP3A 1W4LA 6Q21A 3ONVA 3ECSA 5BW6B 1N2HA 3G85A 1TAQA 2ZYHA 5JOQA 4QUAA 1G59A 5FWXA 4P0QB 1OC4A 5L6LB 1UT6A 2VT3A 4DF3A 5TC4A 3PV0A 2V7QD 1Q0RA 1QE3A 2QX6A 2W8ZA 2IPNA 3DWFA 4MB0A 3SIRA 4DPLA 1C3OA 3A6ZA 4EYOA 4H7JA 2VAXA 4C89A 5M04A 2BHTA 3FOBA 1WG8A 1HI9A 5CJJA 1H4QA 1XTJA 5ELXA 2CDAA 5KX5A 2Y1OA 3IJRA 4HQLA 2BDTA 2VRWA 2ABWA 1P4RA 4CV1A 2VRCD 3R3XA 1NQUA 4RDXA 2H85A 4EIWA 5LQJA 4NJMA 3A4TA 3G0CA 3D7LA 4M0FA 1T5TA 4UDNA 4BFUA 1XZCA 5HQ3B 4DLUA 1NVWQ 2QA5A 1L5YA 1MX3A 1EG7A 2C9BA 3RSSA 2IU3A 4IFBA 1WHTA 2R8RA 3GRAA 3TRFA 2ANCA 3T1HB 3T6KA 3IOBA 1MD9A 4UAJA 2OECA 2LIVA 2JEYA 1AXRA 2ZM5A 1K66A 4MYRA 2DECA 4J7AA 4LXQA 3M4JA 4CTNA 2PZ8A 1UC5B 5IVKA 5EZQA 4DHEA 4Q9HA 4F6RB 3DMGA 3MMZA 2V65A 3WRXA 4X6LA 1DO0A 4XQGA 4K9PA 4G1VA 4C9BA 3ZY5A 3PUHA 4K6KA 1JXQA 5B30A 4PO9A 1Q3KA 1ML4A 4PN3A 4L4RA 3UMVA 4Z4FA 1YRYE 1BWPA 2FZGA 4UZEA 3RG2A 4BZZA 3G17A 3LGXA 3VR0A 4LNAA 5H16A 3CVYA 2B21A 4EMBA 4H7IA 3BJEA 3T0FA 3VO9A 3HR8A 3AFIA 4PG4A 2Q6OA 3NLLA 1AHNA 2ZDHA 2BKLA 3HV2A 5JFOA 4GMFA 1KFCB 3H9JA 3S2YA 2J9GA 3DDWA 3LQ4A 1P6XA 4N8SA 4QOGA 5G0UA 2XWPA 4AECA 4EKNB 1JGTA 4GVPA 3JAWA 5ALIA 4LF4B 3VZDA 1ZW1A 3AFMA 4EGFA 3LRPA 1Y48E 4DVJA 3HKBB 5BYKA 5GZ1A 4WEOA 3KVYA 2BHNA 3H4VA 1ULAA 2NVBA 1OIWA 2CUZA 1EM8A 3P96A 1OWPA 2YWGA 1GNQA 3A31A 4L22A 5H3HA 1XTKA 1AXEA 3VHRA 4F7DA 4YMUA 4RHEA 3QU7A 2CHQA 4BYGA 1JSXA 3TAUA 4KPGA 1HKHA 4GQBA 4URFA 4CIAA 2IXBA 1EP3B 1E0KA 2BBSA 2NIPA 1S2MA 4KN8A 4MVJM 2EW1A 4ZCQA 2JHFA 3E1SA 3SZUA 1BVYF 3FJ1A 3R0XA 2A7XA 4O3FA 4OI2A 2N75A 4R83A 1RFLA 3SYRA 3TIVA 3TGWA 2XCSB 1H23A 3P20A 4IMRA 4P58A 2R7LA 4HYQA 4MKIA 1E4EB 4ARCA 2BR5A 2V97A 2V8OA 2OT3B 4PGHA 3EGIA 4U9UA 1JYEA 2JGJA 4KLNA 4RJJA 2GKOA 4R4JA 1QG6A 1UBUS 3JS5A 5KCMA 4G86A 5I8ZA 3OQJA 3O84A 2HY7A 2D06A 3GJSA 4P5EA 1JPUA 2IP1A 5L4SA 5GJCA 1E1NA 2JGNA 1GPUA 3BTUA 1P7WA 2R6DA 3C74A 4PNPA 2PLWA 4NR0A 4X1IA 1UBHS 1P0MA 5H7XA 5HQTA 1W6UA 1XT6A 4PVDA 1AQUA 3D8RA 3QWFA 2J3IA 4O08A 5U4QA 1RPAA 2VATA 2BEVB 3D5QA 3LFHA 3P71T 3VR5H 3F74A 4QREA 2YXEA 3H2JA 4C30A 4AWBA 1P2TA 2B36A 2CNDA 2ODPA 3ZH9B 3E8XA 3CKMA 3I2JA 4QJ4A 5FOTA 4BFYA 1QX3A 1WXEA 1WXXA 2PS1A 2V59A 3DE0X 3FNQA 3KR9A 1A8SA 2H63A 1ILWA 2YFKA 3QKUA 4TRRA 1DC4A 2RKBA 5FWDA 2DWPA 2FMHA 1PR4A 5AJVB 1FIUA 3WLEA 4ZVMA 3DOFA 2ZRKA 4DRXB 1FTWA 1KZ1A 3V8QA 1FFAA 2PGNA 2Q3EA 2BM8A 5NULA 5K8CA 1QAMA 1CPYA 3HU3A 1TK3A 2OV4A 3K31A 1MAVA 1NFRA 4Q6WA 3HJNA 2VWQA 1T2FA 1X13A 2JGIA 5FOVA 1X8KA 3VR4A 3X2SA 4BVJA 1NNUA 3MSXA 3CG4A 2A3RA 4AX8A 5TXGA 1HUQA 2PGXA 3I92A 3JATB 4DGQA 4EPXA 2AR9A 4JI4B 4WZAA 1YAHA 2PYZA 4OGFA 3FCSB 3TZQA 1W35A 1P2SA 2A8YA 1GQQA 3L4BC 3GRZA 3EIEA 4PLCA 1X9IA 3TQRA 5HZHA 1IBKB 3D6AA 4QHSA 2CLHB 1L7AA 4G56A 1OBHA 3IHWA 1KSFX 2P4SA 5AW6A 3TQTA 1Z15A 2IEGA 3GDFA 1LS6A 4BQEA 2WEKA 2Q1UA 1SVLA 1HV8A 3DKVA 3KG2A 3QU4A 3EGWA 2P69A 4R8VA 3WBFA 4C1BA 5JEEA 1US8B 5IAGA 4JI8B 3U7QA 1GZHB 4JUFA 2A6PA 4J29A 2OCKA 3S40A 1N57A 3K0AB 3I3OA 3ZWAA 1M8GA 4IOJA 5ECYA 4XGIA 1II8B 4WASA 5HUQA 1GNLA 1ZL0A 4BBZA 1M8FA 2LV8A 4HX9A 4LE1A 2C83A 5DX0A 2DKNA 3DLTA 3JYHA 1VIAA 1L5SA 2H57A 3DEAA 4XWKA 2EQ5A 4QFMA 1SC3A 5BQXA 3UA3A 3I9FA 3EWAA 3H7IA 1BFUA 4C0SA 3DMYA 4DQ0A 4K1XA 5CK4A 3LLUA 1ST2A 1NXPA 1NNI1 1B42A 1RMYA 4IH4A 3EVZA 5DFAA 1CQJB 4DA8A 1RXYA 4DWWA 3MWGA 2OO5C 4N5NA 2WTAA 5SICE 4JASB 3BA1A 4CIXA 1JDPA 2WSBA 3P2MA 821PA 1FMLA 1XQ6A 4HL6A 3ZKAA 2NOAA 5JJIA 1SK8A 5ADHA 1UPBA 3ZXUB 3H6GA 4D4MA 3VX3A 2FN9A 2YV1A 3GFVA 1PWXA 1PWEA 3MJTA 1T1JA 3FUTA 1Z4NA 2QY6A 4KQMA 5I9IA 2YWXA 3OM0A 1QIIA 1LDGA 1SUSA 1TK2A 4DLSA 5GIPE 2Y93A 4GXNA 5CDGA 2FWRA 3MINA 2UVPB 2ZRNA 4IIJF 4TROA 4UXHA 1AS0A 1YBAA 3HWWA 3NM4A 3Q72A 4A2WA 2P9YA 1HDXA 3T3PB 2XQGA 1Y3FE 4RACA 4R2WA