3OSUA

Crystal structure of the 3-oxoacyl-acyl carrier protein reductase, fabg, from staphylococcus aureus
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
246
structure length
246
Chain Sequence
b'MKMTKSALVTGASRGIGRSIALQLAEEGYNVAVNYAGSKEKAEAVVEEIKAKGVDSFAIQANVADADEVKAMIKEVVSQFGSLDVLVNNAGITRDNLLMRMKEQEWDDVIDTNLKGVFNCIQKATPQMLRQRSGAIINLSSVVGAVGNPGQANYVATKAGVIGLTKSAARELASRGITVNAVAPGFIVSDMTDALSDELKEQMLTQIPLARFGQDTDIANTVAFLASDKAKYITGQTIHVNGGMYM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3-oxoacyl-[acyl-carrier-protein] reductase
publication title Crystal structure of the 3-oxoacyl-acyl carrier protein reductase, FabG, from Staphylococcus aureus
rcsb
source organism Staphylococcus aureus subsp. aureus mu50
molecule tags Oxidoreductase
total genus 81
structure length 246
sequence length 246
chains with identical sequence B
ec nomenclature ec 1.1.1.100: 3-oxoacyl-[acyl-carrier-protein] reductase.
pdb deposition date 2010-09-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3osuA00
4FFNA 3D1LA 3ETDA 4RVHA 4P38A 2FMUA 4J9UE 3D3WA 3LT1A 1D1SA 2OBYA 1YBAA 3C3XA 1NTOA 5CG2A 1CIVA 1WPQA 4CM6A 3WGGA 4GH5A 1Q0QA 4FQ8A 4YT2A 4IDFA 3VH1A 4MIOA 3LF1A 4X54A 1WDMA 2YDXA 4PG8A 3MJSA 1KC3A 3ASVA 1ISMA 3LC2O 2Y1FA 3BZUA 2HUNA 4ZICA 1I5RA 2RBEA 3SJ7A 4YWJA 3PXXA 3F5QA 3KYDA 3SX2A 5DN9A 3FTPA 1E3WB 1MX3A 2BI7A 4EEZA 2BFOA 2JD1A 3DL2A 2Z5LA 4WLEA 3DHYA 2ZB3A 4JJFA 5DULA 4ALLA 4BNLA 5DCUA 2ZYGA 3PGJA 4OKIA 1BWSA 2EKPA 1R12A 2C29D 1ORRA 1OFGA 2ILTA 3OA0A 1HETA 3DZGA 1OZAA 2X1HA 1T1SA 5KVQA 2O2SA 5ER9A 1OAAA 4GKBA 4Y67A 1R4NA 1Y8QB 1PJQA 3IJRA 3LYLA 2E48A 1B8VA 3ITDA 2WDZA 3WGQA 3ASUA 4I9UA 2VN8A 1ZKMA 3DZHA 4HNGA 1IOLA 4P4LA 3U09A 4XR9A 1NWHA 1UXGA 2ZTVA 2IRWA 2WD7A 3JD2A 3UUWA 5JCJD 1E1MA 1QV6A 1ZSYA 1I2BA 2FR0A 3AY7A 1LI4A 3BMNA 3EY4A 1ZO8A 4HX5A 4CQMD 2R00A 4MVJH 3TDKA 4AJ1A 4S1VA 3DOCA 3DBHB 4FJ2A 3PJFA 3RIHA 3KSZO 2PZKA 3BAZA 3JQFC 5A5EA 3JQGB 4J49A 4E0BA 3O8QA 3OA2A 1PJLA 1N92A 2GZ2A 5IN4A 5JY1A 1ZK1A 5L9AA 3AFNA 5C37A 1T2CA 4A0SA 3GVHA 4NIMA 1VKNA 2OOSA 1V3VA 2OORA 2A92A 2J8ZA 5KJEA 4DRYA 3ZHYA 1ONNA 3PPIA 4RPHA 4C4OA 2PGDA 1Y9AA 4OKNA 1GYPA 3QE3A 2NSDA 2WYWA 4WCFB 4NK4A 4R51A 1D8AA 3B20A 1XDWA 1HRDA 3EZYA 1VL8A 4IDCA 5GY7A 6ADHA 1JW9B 5HWSA 3GN2A 4Z9XA 1BVUA 2DT5A 4GX0A 3TFOA 5A02A 4IMPA 4R3WA 5KKCA 2RHCA 3MJTA 2R2GA 4HXYA 2I6TA 5FYDA 2Y1CA 4XYLA 4EJMA 2OMEA 1ENYA 3WBFA 2O4UX 4CM4A 4WASA 5A9TA 3GDFA 3ZN2A 1FF9A 1F8FA 1ML3A 2GASA 3KO8A 1VSUA 3FNFA 2Q1SA 1M66A 2ZQZA 2EP7A 4F46A 4GQAA 4TSKA 4AICA 3WXBA 1PJSA 4KUEA 4RDIA 2HK8A 2DLDA 3PK0A 3RJ9A 3X2FA 3QVWA 2Q46A 3GPDG 4MVJM 4WEOA 3RSHA 4R1TA 3PWZA 1M6WA 1PJBA 5JDIA 2OUIA 3IL2A 4CL3A 4NFHA 3TJRA 4AJHA 3IKVA 2QZZA 1J4AA 1E7QA 4NJOA 3ZI0A 2Y67A 3OECA 4W9NC 5U9CA 1LDNA 2D0IA 4HNHA 4J90A 1S7CA 4CQMB 1YS4A 3E48A 4LRSB 2NQ8A 1LDEA 1RM4A 4YDRA 1PZHA 1GPJA 1LLDA 5DP1A 1VPDA 4N18A 4MVJG 1P77A 3KSUA 3OIFA 2HK9A 5I9NA 4IZIA 4TMFA 3NT4A 5A9RA 3WTBA 3U4CA 4TRNA 1FDWA 4GMGA 1GFSA 1X1EA 2D2IA 4NG5A 2V6GA 2VQ3A 4A73A 1XQ6A 5I7VA 1MA0A 2V7PA 1B15A 2VYND 1N2SA 4PLFA 3RUHA 1E3IA 3FTNA 2ZTLA 4IJWA 4DIFA 4TZTA 2VWGA 1PJCA 4PZEA 1KY5A 4O6VA 2HMWA 5IDYA 1YH3A 1T24A 5AXBA 2P5YA 1LDYA 4LW8A 4D42A 3KETA 3D7LA 1FDVA 4W4TA 3K9QO 4RL6A 3LU1A 2D5AA 3ICCA 5ITWA 2XAAA 2O3UA 1MXFA 3IMFA 3VH4A 3FNGA 3HN7A 4HADA 4Y6SA 1Z82A 2WMDA 5JMWA 4KUGA 4IPTA 4ZQHA 2VRBA 4EW6A 4GPD1 2W8ZA 3GH3A 5EPOA 1H2BA 2Q1WA 5LC1A 4CM8A 4EJ0A 1ARZA 1HDOA 4M8SA 3HNPA 4CLRB 4RPGA 1OMOA 3AUTA 3ETGA 3GVCA 1VC2A 1WDKA 2J3IA 4UEOA 1PTJA 3K2BA 4E30A 2QRJA 1U3UA 1AHHA 3D64A 3DFZA 3ROPA 4RCVA 3ZU2A 4XEHA 4IXTA 3AM4A 4JBHA 3P2OA 3OFSA 1YE3A 5L40A 3ZV3A 1HYHA 1ISFA 1EQ2A 1SO8A 1W8DA 2B5WA 3E5RA 3I23A 4QUKA 5JDCC 1E5LA 3RUAA 3ONFA 2D3TA 4JJGA 1C1XA 2CFCA 3W8EA 1P0CA 2YV1A 3ZWPA 1DIGA 1VJTA 1VJ0A 4R68A 2IZ1A 4EEXA 2P5UA 2PR2A 3BMOA 4R41A 2D4AA 3LC7O 3DOJA 2HMUA 4DQUA 5A3VA 2CMDA 3DWFA 4K26A 4PLGA 4IZHA 3WGHA 2RHRA 2AQHA 4PVCA 1PGPA 4KTTE 1NM5A 3WWZA 2FPGA 1KEPA 3OIDA 4ZN6A 4II3A 2OGUA 1SOVA 3M1LA 1E7SA 3C7AA 4W82A 4CMKA 3S55A 2QRLA 5DZSA 1H2HA 2VUSA 2Q2QA 1DC6A 2YZ7A 4BS9A 3KEQA 5G4KB 4CM7A 3F3SA 2EW2A 5IDWA 1GQQA 2DAPA 4DREA 4NHEA 1ZVMA 4GLOA 3C85A 4D3SA 1ZXLA 2W2KB 4IDEA 1ADBA 4BGIA 4CV0A 1ONPA 1QLJA 1J49A 1SEPA 1AE1A 1ZEJA 4BNYA 5COBA 2EJVA 2HMVA 4WCFC 4XB1A 4BNKA 3WQSB 4ZJUA 3CEAA 3R3SA 4PCVA 1BXZA 3CTMA 4BO2A 4P22A 3WIEA 2X58A 4D0RA 1KVSA 3JYNA 4GLLA 3PWSA 5G0SA 3F47A 5BSFA 4E5PA 1H93A 4YRDA 4CMIB 1FJHA 5KWEA 1B8PA 1ZK2A 3LDHA 4YBZA 3VZQA 3DQPA 4E5KA 1OC2A 3BYZA 3ITKA 1VLLA 2W98A 3WGOA 4BNIA 3DTYA 2JHGA 2DTXA 3QVTA 3L4SO 2V6BA 1DO8A 1KVRA 4J7XA 5EL0A 1BHSA 1ZFNA 4P4NA 1O5IA 3JQAB 1NAIA 2X9VA 4OSOA 3K31A 4W7IA 4LK3A 4PLCA 4OHUA 4B8WA 5U4QA 5IFLA 3AOEC 2IZZA 2DBRA 3DBRB 1SZJG 4E6PA 4JX8A 4DXHA 4IDGA 3D4PA 4XDYA 1RJWA 2C5AA 2I99A 1NPDA 1PGJA 3GPIA 4WPGA 2HJSA 3JQ8A 5ES3A 4RPLA 5L4NA 3DZFA 3HQ4O 4K9DA 4NI5A 2VHWA 4AJOA 1X13A 3H9JA 3RQSA 3WLFA 4E13A 3ZWMA 1YQGA 4BNZA 1QLHA 1DPGA 3GEGA 5TSDA 3QHAA 3K96A 2VT3A 1DC5A 2C82A 1U3TA 3HN2A 1DB3A 3IC5A 2LDBA 1LSSA 4YAGA 2PNFA 2BFAA 1M67A 3ADPA 4XX0A 3E8XA 1AN9A 1T2DA 1KYQA 3GT0A 3JYQA 2VNAA 4CJXA 3GY0A 1L7EA 1GZ3A 1BTOA 4FBGA 4MDHA 2HSDA 3GVPA 3H9GA 3O03A 1A9ZA 4QX6A 4ZRNA 5U1PA 3HDHA 4OSPA 1N9GA 2ZB8A 4PGFA 3SVTA 1ZW1A 4BGUA 3JCZA 2O48X 1LSUA 2YHIB 2FPIA 3BHJA 2DQ4A 4AL4A 3RU9A 1GADO 3RFTA 2GN9A 3JQ7A 3UGKA 3N74A 3PQDA 2AE1A 3ZWXA 4FB5A 3MJCA 4UEJA 4QO7A 2NTVA 2FHSA 2RAFA 4TZKA 3D5QA 3JTMA 1NXQA 2VYVD 4FFLA 4WGGA 4CMJA 3WGYA 4QXMA 1N1GA 1VL6A 3QVSA 4QTZA 2X0JA 1ZSNA 4EZBA 2PD6A 2J3HA 4J1TA 2PY6A 3NUGA 4YA6A 4NR0A 2I3AA 3G1TA 2C0CA 3NDIA 2DBVO 3ROQA 4Q3EA 3VTZA 4BV9A 2P9GA 2GN6A 2RIRA 1LDBA 1XCBA 2H63A 3WB9A 3E5MA 5L53A 1UZMA 4XDZA 3VKVA 2FP4A 3L07A 2EGGA 1T1RA 1PR3A 3I9LA 4UUNA 4ALIA 3LQFA 3RC7A 1SBYA 4GWGA 3HDQA 4UEKA 4XQ9A 1NNUA 4GVLA 1EE2A 3C8MA 2WTBA 2Y1EA 5EIOA 3FRJA 1IUKA 1VI2A 2GDZA 1Y1PA 2X6TA 4OOEA 4Q39A 1MXHA 5GZ6A 3UN1A 4CR7A 4CMGA 4O0LA 4B4WA 4AFNA 3JV7A 3JQ9C 4HP8A 5C7LO 3IP3A 3W4JA 5LCXA 4GAEA 1DOHA 4FS3A 4FGSA 4ZQGA 2UDPA 3B1KA 2JL1A 3L9WA 2HCTA 3I3OA 1AXEA 3BXXA 1JLLA 2PGLA 2J3JA 1K5HA 1B3RA 1KIFA 1CERA 1N1EA 5T67A 5B4UA 3WDSA 3Q2IA 4JNKA 4ZU3A 4BO9A 4G65A 3D4OA 3DHNA 2ZJ0A 3GNSA 3PLNA 1B0AA 3PRJA 2B35A 3GG9A 3AM5A 4J16A 1HZJA 1Z7EA 3T7EA 1U3VA 4BQRA 1BW9A 2IYPA 1EDZA 3SC4A 4BNVA 2JFHA 3FHLA 3BTVA 4ND2A 4HBGA 4YJHB 4DMLA 4RQUA 1K6XA 2O3RA 2VOEA 4RF2A 3MWEB 3QRWA 4UVDA 5DOZA 2E4AA 3DBLA 3PIIA 4L76A 3X2EA 1RWBA 2GD1O 4H16A 3WNQA 3NTRA 3ZU3A 1V0JA 1A4IA 4FJ0A 4RZHA 3CUKA 3CSDA 1BSVA 2FR8A 3DZIA 3EVTA 1OI7A 3PZRA 5DF1A 3F1KA 3PGXA 2Q50A 1BXGB 1F17A 4J1SA 3EHEA 4G2NA 3AY6A 1IHYA 1G0NA 4QT0A 5F5LA 1G0OA 1RM0A 2OZPA 3PHIA 2C7VA 3HDJA 2YUTA 1NHGA 1YXMA 1UP4A 1T4BA 5TS3A 3ZWVA 2WEKA 1K3TA 3HFGA 4U6SA 3UVEA 5FEUA 1B3BA 1Y5RA 1MG0A 3AU8A 3FN4A 1JTVA 3HJAA 2BGKA 4NU5A 1VKOA 3GK3A 3WGIA 3UOGA 4E3ZA 4LCEA 1DRWA 1U2GA 4HY3A 5ICSA 4IUYA 4U6QA 1YL7A 3BMQA 3EK2A 5BT9A 2HAEA 2DTDA 1NR1A 2G82A 1Y81A 4BKOA 1DRVA 4ALJA 3TSCA 2AMFA 4B7XA 3CXRA 4FN4A 5FI5A 4IGEA 5B12A 4AJKA 3OP4A 1VM6A 4NFYA 1L7DA 1D1TA 4MVJA 4RF5A 3ST7A 1HYEA 2VHXA 1TB4A 1E92A 1HE2A 5AVOA 3EUWA 1DHTA 3H3FA 3O9ZA 3JD1A 3NT5A 2DPGA 5F1KA 3PVZA 3O26A 1HDXA 3GGGA 4TWRA 4ZA2A 3U62A 2X22A 5A9SB 1GUFA 3NJ4A 4I8XA 2AG8A 4E5YA 5HM8A 1NASA 1TT5A 1P45A 2H5LA 2HMSA 1GEGA 1IPFA 5ADHA 1YQXA 2BFPA 3DR3A 4IS3A 4HKTA 3VZRA 4JBIA 1GUYA 3ZHXA 4TVOA 1XGKA 1CRWG 4L74A 1E1LA 1NFQA 1M75A 3RC1A 3FNEA 3ZGYA 1C0PA 1MGOA 1UXIA 3VPSA 3GC6A 1XEAA 2IXBA 1XWFA 3DZBA 2FZWA 5IXYA 1P0FA 3PTZA 4LSMA 4CQLB 5BR7A 2G17A 3UH1A 1EK5A 4R16A 5L51A 3KBOA 1VJ1A 2VZ8A 5F1OA 3WFIA 1DLIA 3QQPA 4IJVA 5H83A 4ZD6A 3F9IA 4BNJA 1YGYA 4B4UA 1LNQA 1C1DA 2NV6A 3NX4A 6LDHA 2GNAA 3VPHA 3QIVA 2QW8A 3RUFA 2JCVA 1WZEA 4J2OA 2X8LA 3S2IA 1IZ0A 2BF7A 3JD0A 1V3TA 1T2AA 2FZEA 3FWZA 4RPKA 4BNXA 2QX7A 3GNQA 5JS6A 4FOSA 2V6MA 4A10A 1GD1O 1PWZA 4CLOB 3L9XA 1ENPA 2EHDA 1GZ6A 3ANNA 3E82A 4MOWA 4XYGA 3KSDO 2V65A 5K0ZA 5L3ZA 3OEWA 4D3DA 2B5VA 4FFMA 2VCYA 1B14A 1P3DA 2O7SA 3GMDA 1MG5A 2VTDA 1R0KA 1HDRA 2P9EA 2PZMA 3RC2A 2ZCVA 2ZYAA 3WLEA 4JK3A 4CLDA 2PFGA 1QV7A 4WLOA 1RYDA 4II2A 2SCUA 2Y1OA 3QWHA 3VOSA 3I9KA 4ONEA 2C5EA 3OICA 1GUZA 3C1OA 1GTMA 3PHJA 2Y0DA 2VNSA 1IHXA 1P74A 1XELA 4YJDA 4M49A 2OFPA 3JQFA 4JIGA 4A26A 3E9MA 3GZNB 1LQUA 1EUCA 1CETA 1NFRA 4NZ9A 1ZXBA 3HWRA 4LGVA 3T7CA 4J6FA 4MP8A 3Q3CA 4NH4A 5AXCA 4BGEA 5TX7A 4YT4A 3P2YA 4KTVE 3WNVA 3W6ZA 1H9AA 4M89A 5EINA 4CM5A 3JQBC 2CSUA 4D0SA 1ISGA 4TVBA 4NPCA 1NPTO 1PL8A 4DLBA 4EGFA 3A9WA 3PHLA 3D0OA 1TXGA 3DOOA 4BVAA 1I30A 4ILKA 1XYGA 2UUOA 5KVSA 3VTFA 5TJ9A 2O50A 5G0UA 4BNTA 2YV3A 4XD2A 3M1AA 5DBIA 4ZVVA 4EITA 3H3JA 2GUGA 4PG6A 4WUVA 4NBUA 5A9SA 4NBTA 4YTEA 4Z0TA 1MP0A 5K6AC 2RH8A 4I1IA 4DIBA 4F3YA 4FD3A 4MP6A 3UXYA 3ZW8A 2POQX 5CEFA 5EJ2A 4PG5A 5DBFA 2IODA 4MVJE 4FC6A 1DFHA 3UCXA 3RCBA 1HDYA 2PKRA 2GLXA 1IZ9A 1E7MA 3KYBA 2UAGA 4B7CA 2AEJA 3VAZA 3FNHA 4CUKA 3W6UA 4UVEA 3VH3A 1JWBB 3GVXA 1TI7A 3H5NA 4U7WA 1PS0A 1NQAO 1HYGA 3DXFA 1TVEA 4KWHA 3WMXA 4DYVA 1GCUA 3BA1A 2DKNA 2CDAA 3VVBA 3TZKA 3DZJA 2ZATA 1I32A 3K6JA 1E7WA 1N7GA 4O59O 4LCJA 4W9NA 5KJ1A 4K28A 3RUIA 3TOXA 3GDOA 1XQ1A 1PX0A 3ZU5A 4BHTA 4E2XA 4ND5A 4ROSA 2D1YA 3AM3A 2NVUA 4IDAA 2DC1A 4CM3A 4IJKA 1GPDG 3ROMA 1CEQA 3ZW9A 4A03A 1BVRA 2QHXA 1XSEA 5JAQA 5TC4A 1PU2A 3NJ8A 4J2HA 3IP1A 3KLMX 1HEUA 5JY6A 1CWUA 3O38A 2EEZA 3CZRA 2Y0EA 1DIBA 5JC8A 4E2YA 4JLWA 5ILGA 4CUZA 2VWHA 1B8UA 4L9RA 2QZ9A 3RUEA 1KERA 1HSOA 4CMBA 1R66A 4D46A 3FI9A 3L0DA 4L75A 2AHRA 2O7QA 5THKA 4R1UA 3I4FA 1B7GO 3DC2A 4Z3KA 4J4BA 3KV3O 3NDJA 3I4CA 1KC1A 5DOVA 5JNLA 2PV7A 2V6FA 2BLLA 3MOIA 1XU9A 1EQUA 3ULKA 5ICMA 4FC7A 4PLWA 3H7AA 4AJPA 3ZWWA 4BGVA 4J1QA 1E3WA 1YONA 3PFWO 4J0FA 2NTNA 1UZLA 4RLHA 1K0UA 2UUPA 5T5QA 1HE3A 3PYLA 3V2HA 4FGWA 3VZSA 1C0IA 5CEJA 3CMCO 5IZCC 4J7UA 4Z0PA 4E2ZA 2O2YA 1O89A 4MJLA 2NU8A 1IB6A 4IM7A 3U9LA 1ISIA 1YQDA 4IDBA 5L95A 2JFFA 4LMRA 4XR4A 1A4UA 3TQHA 2DM6A 2HO5A 3BTOA 1WP4A 1IY8A 1EBFA 5JDCA 5J23A 1Y8QA 1I01A 4R4JA 2AXQA 5LDGA 3H5AA 3K2EA 1Z6ZA 3HADA 1ENOA 2NTJA 3QLJA 2AQKA 4I9HA 5DCYA 3NKLA 5CFZA 1BDBA 4HFRA 4B8ZA 2O3JA 1AXGA 4LMPA 2PLAA 1MFPA 3IS3A 4U0JA 3V1UA 4BO8A 3L6OO 3VPFA 1KETA 4CV3A 4GSKA 1DLJA 1FDSA 1UXHA 3DBHA 2X7HA 4XYMA 3F6YA 3MJVA 3F1LA 4BKPA 4AG3A 5TLSA 3HFSA 4QECA 4Q3DA 1UUFA 2C7GA 3T4XA 3JQGA 4BO0A 4NBWA 2FSVA 4DVJA 3TWOA 4E12A 1UZNA 5JSFA 4RV9A 3FR8A 1DIRA 4RVUA 5FFFA 4YAEA 3ZNOA 3OJ0A 4D44A 2PKQO 1HLDA 1SOWA 1XG5A 2HJRA 2IZ0A 3LT2A 4I08A 3WMWA 4BO4A 4UAGA 4J9VA 3AUUA 3TZQA 4AJJA 4WCFA 2YQ4A 3FPCA 3VPGA 5JPIA 1CDOA 3RU7A 4IXWA 2O4CA 3AWDA 1QYXA 4R9RA 1E3JA 1KBZA 3OJOA 3WR5A 4YQYA 1R15A 1U7HA 1PGOA 4EUFA 4CODB 3ZWCA 4D79A 1FDTA 2B37A 2OP1A 4O63O 4TROA 4XJTA 4E5NA 3H9QA 5EQFA 5T8KA 1XIVA 3IOYA 5TRTA 1GQ2A 1QKIA 4AJLA 2AG5A 2I3GA 3KYCB 1ZEMA 1DFGA 5ENDA 3TOZA 1H6AA 4DPMA 2YW9A 1W73A 3F5SA 5KTKA 1SPXA 4ID9A 3FCOA 3QV1A 4L73A 4BQPA 4MKZA 5KVCA 4NU6A 1T26A 4NJMB 3Q0EA 3VDRA 1O0SA 3AFMA 5GZ3A 1E1KA 4OYRA 1RPNA 3Q6IA 4ND1A 3AOEA 1H5QA 3B6ZA 2AA3A 5KNLA 5CDSA 3EMKA 3RUCA 1KVUA 4MVJI 4OXNA 3RKUA 4CQMA 3HE3A 1K2WA 2Y93A 1P44A 1E3LA 3GEMA 4HFMA 4R1SA 5B4VA 5CEEA 9LDTA 3ZV6A 2W90A 1ZNQO 4IQ8A 4RF3A 3T4EA 3E6AA 3DAPA 3K5PA 5CAEA 5T8KC 3W4IA 3SXPA 4OAQA 1HZZA 4XQGA 1F12A 4IY1A 2VT2A 3PDUA 4TRRA 2QIOA 4A5OA 2FWMX 3ZWAA 4W99A 3AJRA 2O3SA 3ENNA 1Y7TA 3STHA 3KOUA 3U49A 4JQCA 1PZEA 1ZUD1 3LT4A 5JAMA 3IUSA 5B4TA 2IEDA 4EUEA 3GRPA 3PLRA 4H7PA 4N5MA 4JP3A 3TZ6A 1KY4A 4BV8A 1PL6A 4OM8A 3N7UA 3VZPA 3A28A 3WOHA 1T2EA 1RYEA 1ZJZA 3BHIA 1PGNA 3DMTA 4EDFA 2GERA 4D45A 3NEPX 4BMNA 1A7KA 4OO3A 1CJCA 1Z7BA 4Y98A 4J4TA 3ZU4A 1ZBQA 1JVSA 2CD9A 1I0ZA 1B26A 3WSWA 4CLRA 4LSWA 2AEMA 2NLOA 1P1RA 1UH5A 1X1TA 3H2ZA 2YDYA 3PFFA 1QXSA 1YBMA 3HB5X 5DNAA 5DCWA 1Q0HA 3KVOA 1LTHR 3GAZA 3TL3A 3U4IA 1XU7A 4GGPA 1EE9A 2EGHA 4NMHA 1EVJA 2G5CA 2FPPA 2OL4A 1Y8RB 3KXDA 5BNTA 4K6CA 3DAFA 1BGVA 1E6WA 4F45A 4MVJD 1Z73A 4GVXA 1SCUA 3GRKA 3GN1A 4YAIA 1I2CA 1DAOA 3H2SA 2HLPA 4BUCA 3MOGA 3ROKA 1YDWA 4PG7A 1N5DA 3Q2KA 3ZDFA 5COAA 3PIDA 4J0EA 3SBOA 3INRA 2EV9A 4DQXA 3DMTC 5A5FA 3CIFA 3ENKA 3G1UA 3LF2A 1U5AA 3ONEA 2FY8A 1DC3A 3DHEA 3I6QA 1PZFA 4ITUA 3DTTA 3UAGA 2I67A 3PJDA 3WS7A 4WK6A 1WDLA 3KRTA 3A4VA 1CQJA 2UVDA 5H82A 2X0RA 4ZHSA 3AW9A 1E7RA 4L8VA 3D4NA 3ORFA 5G4KA 2YYYA 5I7SA 1CF2O 4EBFA 3JD3A 1ISJA 1Q1NA 1JN0A 3JQ9A 3GZ4A 4DL9A 2W2KA 2Q2WA 4XRGA 2HRBA 2YJZA 4OQYA 1NBOA 3PHHA 2CVZA 4J1NA 4UVHA 3IJPA 4M54A 3GAFA 3WICA 4DIOA 3H9EO 4KUHA 5TGDA 3K8ZA 8LDHA 2CZCA 4NDNE 2DVMA 5IJZA 1A9YA 2BFMA 3RASA 3TFQA 1HKUA 2E6UX 2JCXA 2R6JA 4PRLA 4BO3A 4CMHA 1PS9A 1V9LA 5L4LA 5L7WA 1EFKA 4PLPA 4IMRA 3WJAA 2P4HX 1HT0A 2GN4A 1WMAA 5G0WA 4CMIA 1LQTA 3GHHA 3V2GA 3G0OA 4CPDA 1YDEA 4KZPA 3QVOA 1JWAB 1YL6A 4PZDA 1QRRA 4JP2A 4YJGB 3ZNQA 1EUDA 4OXKA 1LEHA 4DLAA 4Q3BA 1GV0A 3Q9UA 2WYUA 1R4MB 3ONDA 2PD4A 4KMSA 1KOLA 3JQAA 3ICPA 1SAYA 4DPLA 2Q99A 2J6IA 5IXSA 3QWIA 4BKUA 3ADOA 3BMCB 3KTDA 3GR6A 4CR6A 5B37A 2B36A 1P33A 5T64A 3H4VA 1YWGO 3DBRA 4KOAA 2JAHA 4CMCA 4RZIA 4DC0A 5JAIA 2EG9A 3N58A 3UF0A 3E9NA 2VOJA 4WLFA 4EJ6A 1RM5A 4IIUA 4BO1A 3S2EA 3GMSA 4FPXA 1UJMA 3GFGA 4OXYA 2BMAA 4EYEA 4B4OA 1YVEI 1P9LA 4CM9A 4IIVA 3HB4X 1M76A 3NTQA 3ZWYA 3JQCA 1T2FA 4O5OA 1Z74A 4ALKA 4RPJA 2I76A 3A06A 4KDFA 4D7AA 4YRAA 1HTBA 3KLPX 3ZHBA 3PZBA 2ZTUA 1FMCA 4GWKA 3V5NA 2B4QA 3ZZNA 3OM9A 3WYEA 4IBOA 3AY3A 2PKQP 5TT0A 5I7EA 2Q1TA 2FRDA 2D59A 4YQZA 4FDAA 2QYSA 5GMOA 1YOVB 4YEDA 2X9NA 2X5KO 3U5TA 1HLPA 1X14A 1GDHA 2I5PO 3OQBA 3LLSA 4YJFB 1P31A 5F1PA 3ZHZA 4OQZA 4MKXA 3B1JA 2DBZA 5ENVA 2OO5A 1Q7CA 1NAHA 3GVIA 4IGFA 1Q7GA 2YHIA 1D7OA 4GX1A 4NFSA 3WYCA 1J6UA 1O8CA 2JHFA 5JC1A 1PS8A 1ADGA 1GZ4A 2EERA 3SLGA 4BO6A 4BO5A 1NFFA 2VRCA 1HWYA 3GUYA 3VDQA 3WTCA 3M2TA 3OMLA 4R5HA 1DFIA 4WLVA 4N54A 2O3QA 3P19A 3FWNA 4Z9YA 1U28A 1FDUA 2P4QA 2Y1DA 1SB8A 3C24A 3V2UA 5JXWA 1E5QA 2JAPA 1TLTA 4M86A 2ZYDA 1UDCA 1U4OA 4XYBA 4RLSA 1MV8A 2B4RO 3NAQA 4MP3A 4P4GA 5CHEA 3K92A 4UUPA 2FR1A 5EN4A 5JO0A 1GAEO 1J0XO 3KYDB 1YB1A 2G1UA 2JKVA 2GGSA 1NVTA 4HFJA 2A94A 4J7CA 1PQWA 3OSUA 2O23A 4BNNA 4MIEA 3UCFA 4YRBA 2EKQA 3JYLA 2NM0A 3WFJA 3H8VA 4CMEA 5IZ4A 1IULA 1I3NA 3EGOA 3IUPA 3H5RA 2NQTA 3GFBA 5JCXA 3H65A 3QWAA 2HMTA 3DO5A 4XCVA 3NV9A 5CDGA 3E1KA 2H9IA 2EWMA 3QWBA 4FW8A 4CLEA 5I8WA 3QW2A 3VH2A 1C3VA 2GZ1A 3C1AA 1R4NB 3IIEA 3WWYA 2YQ5A 3SJUA 4AJEA 1WW8A 5AOVA 4DTIA 3L77A 2HDHA 2DTEA 2GN8A 3PP8A 4BL5A 2HK7A 2ZQYA 1YJ8A 4I5FA 1ULUA 2NACA 2E49A 3ETEA 1ZK4A 4LVCA 1EK6A 3I5MA 1E1NA 1I3LA 2WE8A 2WD7B 3FSRA 1EFLA 2W2LA 1LA2A 2C20A 4FCCA 3BMNB 5BQFA 1LRKA 2FOIA 4N5LA 1DAPA 1V8BA 4PIVA 1MUUA 1LC0A 4DPKA 1ENZA 3I6IA 1NVMB 3DMYA 3DB2A 5DP2A 3ZV5A 1Z75A 1GCOA 1LLQA 2DUUA 3BTSA 4WECA 4YXFA 3LLVA 3LC1O 2AQ8A 1HDZA 1MC4A 2AW5A 2Q3EA 3I52A 1Y6JA 2TMDA 4CMEC 2GF2A 4FFOA 4MINA 3O8QB 4WJZA 1UDAA 4DUPA 3GGPA 4GX5A 4BMVA 4L4XA 4UULA 3VPXA 1BMDA 3GG2A 4YJHA 3FD8A 1K89A 1G1AA 1QYWA 1ZIDA 1HE4A 3WJ7A 1MC5A 1EVIA 4IQGA 1TT7A 2B69A 1WZIA 4F6LA 1P1IA 1KVQA 3JQBA 4PRKA 1I2ZA 3Q1LA 4JGBA 3UKOA 5BSEA 4L4SA 3L4BA 1BXGA 2B0JA 1LX6A 2HU2A 4RGBA 7ADHA 2NWQA 4RDHA 3AI1A 1EUZA 2NUAA 4OH1A 1QYVA 3HZZA 1TA4A 4CM4B 3QWFA 2JD2A 1QYDA 1PQPA 3Q9NA 5JE8A 1DXYA 4NBVA 1PGQA 1PJTA 4MVJF 2RCYA 1H6BA 4YAJA 5K6AA 5EMHA 3OETA 4IINA 3PJGA 1MLDA 4BKQA 1EEHA 1ONOA 4MVJP 5A1TA 1EMDA 2XPCA 5KKAA 3PJEA 1NP3A 1OOEA 2PD3A 4E33A 2E37A 4RJTA 2VUUA 1YO6A 1W0CA 1ID1A 4RORA 2C59A 4TRMA 3ZNNA 1AUPA 1R37A 3D5TA 3K73O 1WLYA 3F46A 4BO7A 3AI3A 5A4DA 1EDOA 1M2WA 2VUTA 2I9PA 3HSKA 5IDQA 1BG6A 1VRWA 3RI3A 4BNUA 2OP0A 5JMPA 4U0KA 4DC1A 4H3VA 1DDOA 3OJFA 3RROA 3L4BC 2Z1NA 4A2CA 1U1IA 3UCEA 5GZ1A 5FWNA 2PA3A 1D3AA 5DT9A 3HHPA 3C1TA 2IE0A 3R1IA 3M2PA 3V1YA 1NVGA 3FPLA 5JFOA 2EKLA 1I10A 4P8RA 2ZIZA 5AXAA 4MO2A 4XGNA 4QFDA 1WVGA 2P91A 4AVYA 1DIAA 2J3KA 3UHAA 3MTGA 3PQEA 1ADCA 4C7JA 2BGLA 4G81A 1E0DA 3PWKA 5LDHA 2NU9A 2CUKA 1I33A 1GEEA 1ZK3A 4RO0A 4PLYA 5TJHA 4I9NA 1LU9A 4MPDA 2YFQA 2D8AA 2I65A 1H6CA 3OJLA 3RVDA 1NYTA 1WNTA 4CQLA 5CPBA 2NVWA 1E6UA 1JAYA 3B1FA 4J3FA 2BKAA 4CM8B 2BI8A 5DDIP 2Z1MA 4TKLA 3W4KA 1D4FA 1ULSA 3U4DA 3I9OA 2NNLD 2UYYA 3CZMA 5A04A 2DPHA 1N7HA 2P9CA 3H6KA 1RM3A 3PI7A 4MIYA 1GYQA 1T25A 3HG7A 4Y6RA 4RVGA 3EDMA 2YV2A 5HRUA 5IZCA 4XYEA 4PVDA 1OBFO 3MJEA 4B79A 1YBVA 3JQ6A 1R16A 1PJ2A 3EAGA 2YFHA 1C1XB 2J5QA 3GA0A 4L4RA 4JN6B 3COSA 3BMOB 4ALNA 4J91A 5JYEA 4E5MA 1I3KA 4CLOA 1DJNA 1QMGA 3RUDA 4YACA 3WQQA 4FFRA 3TPCA 1E77A 2VWPA 2JCYA 3NYWA 3RJ5A 2R00C 2Y1GA 4PLHA 4J43A 4XKJA 3C7DB 3NGXA 3AOGA 1X0XA 5H81A 3EW7A 1QYCA 1H6DA 3EVNA 4IQ0A 3I9NA 3MTJA 1LRJA 1RKXA 3CINA 4CUJA 1JA9A 3MJ4A 2DFVA 3P7MA 1X7DA 4TKMA 1BXKA 4XRRA 4RVDA 3VHRA 5T57A 5ITVA 3GZNA 2WYVA 2AQIA 1UDBA 4K1LA 2GCGA 4IS2A 2BHLA 2B83A 4ZQFA 3OHSX 4XIJA 1JKFA 2Y68A 1B2LA 1W6UA 5MGBA 5EERA 3DAGA 3OQ1A 1LUAA 1P1KA 3NT2A 1NQOA 1PL7A 3O4RA 4B3IA 2LDXA 1GY8A 3EYWA 3FBTA 1H0KA 1HDCA 4XQEA 5JYDA 4XJSA 1HSZA 3IAHA 4AJ4A 3LVFO 1FK8A 2Q4EA 1YL5A 5F21A 2Y05A 2Q1UA 3ZCXA 1KEUA 1EBUA 2BGMA 1X0VA 2EJWA 1DSSG 3GHYA 4RQTA 4GBJA 4JJIA 3IKTA 4ZQEA 4R01A 5G0VA 5COQA 2EIHA 4O1MA 4K6FA 2RH4A 2VHZA 5BSHA 2CVQA 2GSDA 1LLCA 1DRUA 4E31A 3FBGA 5IN5A 4B4VA 5JDIC 4AJIA 1B16A 3TRIA 1GYRA 5TF4A 3I83A 4D3FA 3ON5A 3INTA 2Z95A 5HS6A 4Y6PA 3OBBA 2DFDA 4ND4A 2BELA 8ADHA 4S3MA 2Y99A 3D3EA 1U9JA 3Q11A 3EC7A 4M55A 3B70A 1XLTA 3G3EA 4WLUA 5A03A 3BIOA 5BNFA 3L6DA 5C5IA 1ZJYA 2G0TA 4B3HA 1J5PA 4E21A 1E3EA 2VTEA 3JQ8B 3UICA 3V1TC 4Z6KA 3AU9A 1AGNA 4DLLA 4C7KA 4H15A 4LVUA 1GL3A 2EXXA 3QA9A 3GLQA 2Q2VA 4FOOA 4J4HA 4D41A 1CYDA 3ANLA 1YB4A 1T4DA 3S2FA 1H9BA 3RD5A 2GR9A 2GZ3A 3ABIA 3JQAD 4JXKA 1L1FA 5CG1A 2HRZA 4KP7A 4TRJA 1LSJA 4AJNA 4CV1A 3A1NA 4W7HA 4W6ZA 5F3RA 1LDMA 5AQ1A 5A3JA 4YYZA 4XGIA 2IDZA 4OMUA 2Q45A 4BKRA 4INAA 1N8KA 1I36A 4LISA 3LSYA 2X9GA 3AI2A 1N9GB 1U4SA 4XZ3A 2ZTMA 4WEQA 5JCJA 5EQDA 1VL0A 3KZVA 1ADFA 4YB8A 4EI2A 1VSVA 3TF5A 2TMGA 2QG4A 3AUSA 2XF8A 3TL2A 3JQ7B 5I8ZA 2Q49A 3GDGA 4WNCA 4CM9D 1A72A 3GQVA 3OEYA 3VVCA 3WBBA 4DQVA 1A27A 1EVZA 4EUHA 5C3MA 5FF9A 2UV8A 4GKVA 3F4LA 2PZJA 1HDGO 1ZMOA 1LBEA 2PTGA 3AK4A 3SLKA 4UVIA 2WM3A 3FR7A 4M1QA 7MDHA 1K6JA 1PR9A 1MB4A 2FN7A 1HL3A 1SB9A 3ZWBA 4R54A 1QR6A 1XKQA 1U3WA 1EZ4A 1I3MA 2C07A 4KWIA 4YT8A 2BH9A 3DEYX 2A35A 4OJNA 4Q3AA 4U8GA 1GQYA 3ZNPA 1U8FO 5K9ZA 2PZLA 3JYPA 1R0LA 4WKGA 2Q4BA 3TZHA 2DUWA 4Q3NA 4FR5A 1NQTA 3JSAA 4BOYA 3EZLA 5C7IO 3QJ5A 1DBVO 2C54A 3G79A 4RF4A 4QSMA 1SMKA 4WNIA 1R6DA 1P1HA 4KDEA 1X7GA 2XOXA 2VRCD 5G2OA 4I5GA 2VHYA 3HDYA 3DBVO 4R5MA 5CP8A 3U4HA 1JKIA 5KJ6A 1E3SA 2FSSA 1KS9A 4HWKA 4GMFA 4YVFA 5EESA 5THQA 4NNJA 1LDGA 4BB6A 4PLVA 2ZB7A 1LSOA 3CE6A 3JYOA 5KJFA 1PQUA 4QQRA 1JDJA 3G49A 4WOKA 4A7PA 2E82A 3E9QA 2JFGA 3QSGA 4TQGA 3SEFA 3DDNA 3MWDB 3OIGA 3WGTA 3WSVA 3FF4A 3TZCA 1DIHA 2CVOA 1LLUA 2GRAA 5CDUA 2AE2A 2ZK7A 4R9SA 3RAJA 3VC7A 1HF3A 5HTOA 4G5HA 4Y8VA 2P2SA 5JLAA 1A71A 3GUCA 1BW9B 1HXHA 1PWXA 3PHGA 2O3TA 2WE7A 1AHIA 3NRCA 4WOJA 3UW3A 4QFCA 4KQWA 4Q9NA 5IAAA 3G17A 1NX6A 4WCDA 3JQDA 1Q2XA 1LJ8A 2J5KA 3W8FA 4GI2A 1QP8A 3WG9A 4DMMA 3DBLB 3HUDA 4CLXA 3BTUA 3NGLA 3RFVA 4CV2A 1O95A 4ESOA 4CR8A 4QEDA 2Y0CA 1OC4A 1JKJA 2VYNA 3KYCA 1U8XX 1E6EA 3I1JA 5F5NA 4OL9A 4IJUA 4A27A 2ZJ1A 3GNTA 1GR0A 1YJQA 3QP9A 1DJQA 1NWCA 3CMMA 1Z45A 2X0NA 3RBVA 2W2LD 4JROA 1KEVA 4R3NA 5FI3A 2WWRA 1JVBA 2CF5A 4PG4A 5TT1A 9LDBA 5ER6A 2G76A 5CDYA 3OJEA 5JW6A 3PYMA 1UP6A 1KEWA 1K6IA 4MKRA 4NJMA 3A14A 3W8DA 2XXJA 4XIYA 4FIZA 1LXCA 4JCOA 5AYVA 2X5JO 3MEQA 3RKRA 4E32A 5G4LA 1JAXA 2H6EA 3K30A 3NDRA 4PLZA 4RVFA 4N7RA 1LRLA 2B4TO 3KM0A 1KVTA 4FJ1A 1F8GA 4I5DA 2GO1A 2GPTA 4HUJA 2OXIA 4DGSA 3BMQB 4XB2A 1F0YA 4BB5A 1JU9A 4FSHA 4YCAA 4M87A 2YY7A 4XGKA 5BSGA 4UVGA 4D43A 1MFZA 2NVBA 2ET6A 1R0SA 4URFA 5TQVA 2F1KA 1QG6A 1IPEA 2GYYA 1P1JA 1XA0A 4DBZA 1JQBA 2X5OA 2PH5A 2XXBA 4NK5A 3KUXA 5IDXA 4BNFA 2VZ9A 2NU7A 1UP7A 2WD8A 1A5ZA 3KHUA 2AEFA 1NQ5A 1QSGA 1XHLA 2IEBA 3GGOA 3RFXA 5JAZA 3U0BA 1TT5B 5HBRA 1UAYA 2PGJA 1Q0LA 1WAMA 1O6ZA 2DBQA 2IXAA 4LRTB 3ZWOA 3RBZA 2Y66A 2X23A 4CM1A 1SEVA 3NTOA 1LC3A 3DFUA 5C7OO 5KOIA 1YB5A 4RVSA 1M6HA 1UR5A 4CMAA 4Z9FA 2OBNA 1NHWA 3S8MA 3CH6A 3PYXA 5A06A 5I9LA 3GF4A 4KQXA 1Y8RA 4OOFA 1DHRA 1VE9A 5DBGA 3UFXA 1W4ZA 3H9UA 4Z0HO 3CKYA 4XQCA 1F14A 2IYOA 3ZV4A 3SC6A 2PH3A 2OHXA 1U2DA 3W1VA 3OH8A 3L6EA 3KB6A 3WX0A 4ND3A 4GGOA 4BIIA 3QVXA 1Y5MA 3OQ6A 5IG2A 4IDDA 1C1DB 1GU7A 2X4GA 1YKFA 4NQZA 3C7CB 1PSDA 2QQ5A 4E2WA 4ZGWA 1C14A 1ZZEA 5G0TA 4Y9DA 2VWQA 1ZH8A 3IDSA 2JD0A 2EW8A 1IL0A 1TEHA 2ZCUA 3D3WB 1SC6A 2H1SA 3CPSA 3I9MA 1NR7A 1CQIA 3BHMA 2VZ0A 1Q7BA 1DEHA 4YPOA 3I9JA 1BDMA 2W4QA 3LK7A 2C2XA 1Y9EA 1WWKA 3R3JA 1X7HA 4JBGA 5I9MA 1QORA 4WLNA 5L7TA 3F4BA 3GEDA 5I7FA 2CY0A 3DONA 4HFNA 2EP5A 4OIMA 3ZWNA 4ALMA 1UXKA 2CDCA 2WJPA 3LT0A 4CL8A 4BNHA 5ILOA 1PEDA 1U5CA 5KIAA 1G6KA 2D5CA 1ZK0A 3R6DA 3VKUA 3DZKA 3MZ0A 4FFPA 5TNXA 2F00A 2C2YA 1ZMTA 4OGWA 2JJYA 1U7TA 5AXDA 4BNMA 3INGA 4XWYA 4DWVA 1X15A 3TN7A 4ZQBA 4XA8A 4ZRMA 4GSLA 1EVYA 5JO9A 4NBRA 1I8TA 4PLTA 5L45A 2P68A 4DYDA 4PFJA 4BMSA 3JD4A 1ZCJA 4PN3A 1ISHA 3LZ6A 3WGZA 5L4SA 2ZB4A 3R0IA 5IF3A 5T6BA 4DBVO 1BRMA 2HQ1A 4QO8A 3OF2A 2NADA 2PWZA 4YJGA 1I24A 3S1LA 2WSBA 3AUAA 1R4MA 2X86A 4UREA 2BRUA 2NU6A 3RBXA 3RC9A 1GV1A 3WQRA 4BNWA 5B1YA 1FXSA 2ZKLA 3MCVA 1WMBA 2QYTA 1HE5A 3BMCA 4UUOA 3JQEA 3IQDB 4DA9A 2I66A 3PDJA 1PJ3A 2VHVA 4YT5A 3GOHA 4AJ2A 2DU8A 4I5EA 4R1NA 4B7UA 1F06A 5MDHA 1C0KA 1S6YA 5JBIA 3PEFA 5KVVA 4HV4A 4CLHA 1UAGA 1IE3A 1YRLA 4L0QA 4Q3CA 5BNIA 2YHUA 5A05A 1ZSVA 3ANMA 3E18A 5CPFA 5HS4A 3S2GA 3KEOA 4B3JA 1PJ4A 1PZGA 2BD0A 2HKIA 3WYBA 2A4KA 5HA5A 5CDTA 2CNBA 3V8BA 3TNLA 2VYVA 1C0LA 3E03A 1V6AA 3M6IA 3WIDA 2A9FA 2QRKA 3PQFA 1XR3A 4R69A 1IYZA 2CDBA 2EF1A 1WXDA 2X0IA 3U3XA 1UXJA 1NPYA 4GL4A 1A7AA 2J5RA 4U5QA 1H94A 4BNGA 3RWBA 5L7YA 4YAKA 5KCZA 1YOVA 4LN1A 2PK3A 1DC4A 1SNYA 1P1FA 5KJCA 2CF6A 1O9BA 4UUMA 2NVUB 1PIWA 3QY9A 4YJFA 1V35A 1O94A 4N5NA 4F6CA 4Z3DA 4GX2A 3P5SA 3ZH2A 4E4YA 4PZCA 1E7YA 4YR9A 5TIIA 1V3UA 4WE3A
chains in the Genus database with same CATH superfamily
3JARB 1SELA 1VJ5A 1U0BB 1D1SA 4TLDA 1K5PA 2OBYA 1ADYA 1ZVQA 2ZS8A 4G9BA 3C3XA 4TS3A 1NTOA 4OAOA 1U3FA 1GGNA 1L4FA 2HFJA 1P7ZA 1WPQA 2WRZA 3AEXA 3DWIA 3WGGA 4CM6A 3EUEA 3QEOA 2OD2A 4RTJA 1C3OA 4YT2A 1MJGA 1G8YA 4IDFA 2HJWA 4BBJA 1TRHA 4RMNA 1VA5A 3LF1A 1QIKA 4P53A 4C04A 1RWVA 3HYRA 4FWIB 2YDXA 1U7UA 4KRGA 4MITA 3GLTA 2H1FA 1TMOA 4LPKA 4PXSA 4D9CA 1UOEA 3SC2A 4EHIA 3LC2O 3QITA 1J33A 3ODGA 3WHIA 4FWTA 2BBTA 3GPBA 2HUNA 2VK1A 3VZBA 2V3VA 2QE6A 4BASA 3T5GA 4KACA 3ODPA 3ZDQA 3ILVA 3F5QA 3WL8A 5DN9A 3FTPA 2GBGA 3MGAA 2HJGA 4ZFNA 1UC5B 2H3HA 2QSYA 2BFOA 4MVXA 3LKBA 3K8OE 3D8UA 5BWBA 2JASA 4CETA 1Q2UA 4LYJA 2IHVA 2B2CA 4BNLA 4RQAA 1NXXA 5DCUA 2ACVA 2I3ZA 5A6SB 2CUTA 4QOEA 5EIFA 4OKIA 1KSFX 2WB4A 2NO1A 5J2TF 1K3FA 2EKPA 3LNCA 1R12A 1KO4A 3DFKA 3OA0A 1FFGA 5BR8B 2XD4A 1T1SA 1VKJA 1W7AA 1F8XA 1OF1A 4P36A 4WZAB 1IBSA 2D13A 4EI9A 5DH9A 1W4RA 3ZLBA 3C6KA 2FPLA 2W6MA 3CWCA 4NX2A 2JJ8A 2VP9A 2P41A 3E61A 3IJRA 3LYLA 1FFCA 1PR4A 4IP0A 4HNGA 1IOLA 4MI9A 2ILVA 3BSSA 4P4LA 3U09A 1T9DA 3EXAA 2OSVA 3MWFA 3CX7A 5IJAA 2E4ZA 4LX8A 1CY6A 1NWHA 2YJ3A 2IRWA 2Q8PA 2W5UA 4ZREA 5JUWA 5K8TA 3E81A 1KF0A 1I2BA 1LI4A 3BK7A 1NY6A 1NW9B 1MPTA 1XZNA 2R00A 3TDKA 4E09A 3AR6A 4CEJB 4QGGA 2IJGX 3DBHB 3VPCA 1XPUA 1QK3A 4C5BA 5BQPA 4JOSA 3KSZO 4BEBA 4F11A 3ACCA 4G0MA 4YIKA 1FMFA 3BAZA 4GKAA 1GXSA 5EP4A 3EW9A 4I2NA 3P0RA 1IMOA 4J49A 4R9VA 1KE1A 1GKKA 1NVEA 2AG0A 2K5UA 3ZTWA 4D82A 1CUBA 2BHNA 3OA2A 3TSWA 1G18A 1TUIA 3W06A 3R0QA 4QLBA 5LP6A 3R5XA 3KFVA 1UOQA 3AILA 5AIAA 5JY1A 4N8EA 2OHFA 4TZ6A 1O6CA 1LCIA 1VKNA 1F2TB 2C9ZA 1I2MA 2OOSA 5D3ZA 1O4VA 2H1HA 4DRYA 2JH3A 1KOJA 3R8FA 2VJQA 4RPHA 3PPIA 3QTLA 4EZEA 4M98A 2DPYA 4F0JA 4IIEA 2NSDA 2WYWA 4AN4A 2PE5A 3B20A 2PUCA 1VL8A 4DMGA 5HWSA 2BP7B 5HMMA 1A0OA 3DKPA 4Z9XA 3V8EA 1GZ5A 2DT5A 4GX0A 2XB9A 4IMPA 2I1LA 3IPCA 1MO4A 1XU4A 3U37A 5FYDA 4XYLA 2W6CX 1XE3A 2OMEA 1ENYA 4LYGA 4F91B 4OLJA 1A97A 1L1RA 3RC8A 2ZJ6A 5A9TA 1H8HD 4NFLA 3L8HA 5EZSA 1FF9A 1U1GA 2A14A 3D8HA 1W87A 1N3LA 4GR4A 4CQNA 1E1CA 1BE1A 3T7SA 2Q1SA 3P4YA 4JWKA 3NIGB 4FKMA 2XWSA 1MO6A 4P7JA 4PQYA 3WISA 3WNZA 1DC8A 1NUQA 2QMEA 5BN4B 3PLAE 3DPIA 2PO7A 4PPNA 4KUEA 3WXBA 1QFMA 2DLDA 1FU8A 1XMSA 3JALA 3QVWA 1VJCA 2Q46A 1QUEA 4GM4A 4UNSA 4WEOA 1S1MA 3RSHA 4QBFA 3UHPA 4D0GA 1KDOA 4K9SA 3KKKA 1MOSA 5CYOA 4G41A 1F48A 4NFHA 1P1BA 3ZGZA 4ZCTA 4MRVA 4OX9Y 2V7BA 1IUPA 1J4AA 3QVMA 1XT6A 1E7QA 3TKLA 3ZI0A 5DNUA 4XTCS 2VPWA 1FP2A 1TQ2A 2W6PA 4W9NC 5U9CA 2D6FA 4C2AA 2ZSEA 4J90A 4UCFA 1VGVA 1RPTA 3LX5A 2HPHA 3RK4A 4LRSB 3E48A 1CIJA 1S89A 2L42A 4ZI7B 5FR2A 2UUBB 4NLLA 4MS1B 4EGJA 5DT2A 1KMCA 3X1YA 2HIGA 5IT0A 4KVZA 4MVJG 1P77A 3AR2A 5BN5B 3UWOA 1XFAA 3BRCA 2CSXA 4YI5A 3NT4A 3QFCA 1Y8CA 2JIZD 2OBBA 5ECYA 1M7HA 4TKUA 2OCGA 1X1EA 4BYGA 5F9HA 4NG5A 5HF9A 2UZ0A 3W2EA 1HFKA 4A73A 1XQ6A 5I7VA 2ZYRA 4L4UA 1Z3CA 5BV0A 1M5UA 4HGNA 4FP9A 3Q15C 4ZCIA 1N2SA 3N0RA 5AICA 3O1HB 1JPNA 4ID3A 3PGVA 3TBHA 3KPVA 1KY5A 4PZEA 3A10A 4JUCA 4O4IF 4O6VA 2QOEA 3O74A 2HMWA 1QP4A 1T2UA 3AHGA 4WXMA 5AFSA 4QATA 3KETA 1NSYA 3DTVA 5AXBA 4MW4A 5KX5B 2IHZA 2Q0QA 3DE2X 4MV8A 4QAJA 3K9QO 4RHTA 3RT7A 4RL6A 4JUFA 2XAAA 4U00A 1TFUA 4KKXB 4GPTA 3BF7A 3ZBTA 4DB2A 3TLBA 3K9FC 4MGEA 1GT91 1Z82A 2RAUA 3SU8A 4ZQHA 2VRBA 3IOEA 4EW6A 2NUBA 2VQ6A 3C41J 3V1KA 4GPD1 3R9WA 2L0XA 1H2BA 4CM8A 2DH6A 1RLIA 1KI8A 1HDOA 1NC1A 4R2LA 2GUWA 2I7CA 1XRLA 2AV6A 3K35A 4DRZA 3KHSA 1VC2A 2ETVA 2PZ8A 4KN5A 4O2AA 2Z09A 1RYMA 3M6MD 3OF5A 4E30A 2QRJA 3IPAA 1YCHA 1TUGA 2QV7A 3Q8LA 5C1BA 4S0XA 3P2OA 1BVYF 3NXSA 1U9CA 2OZLB 3OFSA 4X20B 4RC9A 1IN4A 1TMKA 1YVUA 2QE7A 1JIUA 4D8XA 1D4ZA 2GBLC 3RLFA 1SO8A 1EQ2A 1W8DA 5H9VA 5JTTA 1SXJD 2W43A 3QEAZ 4JJGA 3C7TA 4C43A 4BN0A 4EPVA 2K87A 2JIOA 2YV1A 3I5YA 1DIGA 1VJTA 1IU9A 2ETXA 2J32A 3NUQA 3ZXIA 10MHA 3BMOA 1S8OA 3SP1A 2A0WA 3F3MA 3HB1A 1YJCA 4EYOA 3W5IA 1GGVA 5JAPA 3FB1A 2WA1A 3FKQA 1MA3A 1QDUA 3DWFA 1QIGA 2GN1A 3CVWA 4XIIA 4PLGA 2CXOA 1QQ5A 2JFZA 5DM2A 5A7HA 3WGHA 2IHBA 4TLLB 1WTCA 1PGPA 1NJFA 2HADA 4F60A 3WWZA 3WLIA 1D7AA 4X3OA 5B36A 1MQ9A 3OIDA 1X9HA 3KD2A 3ZDYB 4ZN6A 2OGUA 1SOVA 2HZ7A 2P1ZA 3NNNA 4IXNA 1E7SA 3BKWA 3C7AA 1C9DB 4REQB 3TZEA 4LHEA 2ZLBA 2RH9B 2JIMA 3FZYA 3ONNA 2E89A 3PGLA 5DZSA 5I7OA 2G77B 2IOYA 4RKWA 3KEQA 3ZDEA 2FSVC 3BMXA 1RMQA 5AVUA 1JFFB 3LLCA 4CRWB 1G8SA 1CW2B 1GQQA 1RT9A 2PWPA 4QLOA 4JJ4A 3U7IA 3UA3A 1CUVA 4NAHA 2VTBA 2IH2A 2ODQA 1VA4A 4LYDA 5AW6A 2D2XA 2R4UA 4LZPA 1EGHA 5EEHA 2GM3A 1SCJA 1X8JA 1J49A 4UFPA 4BNYA 2J4DA 1MW8X 1NVWQ 4HNAA 3KT3A 1XCPA 3K1AA 1JEQB 3B3GA 1M9NA 1SUBA 1EHIA 4R2WA 2UZ3A 4NC9A 3VVLA 3C6YA 3DYIA 2ZJZA 1FRQA 1NJGA 2BFDB 4PCVA 1COWA 2KJQA 2XAUA 2JZOA 3WIEA 2IGTA 1ABEA 2YYSA 4FDLA 2QVCA 4JU9A 4LF5B 3T3MB 4MRPA 3MG9A 3JYNA 3KEGA 4HAVA 4E5PA 3JASA 1H93A 4YRDA 1NU6A 2C0QA 1H4VB 4B5LA 4UXHA 5I4IA 1MH1A 5IS2A 3LDHA 4YBZA 3AO0B 4LJLA 3BWEA 3BYZA 1J9GA 1PAUA 2CNDA 4MVWA 3I2GA 2OWDA 5EG5A 2F9FA 3RTAA 3GFVA 4OD0A 3DTYA 5E6RA 4Z4GA 2DTXA 3KL2A 2V6BA 2JB9A 1LPNA 2WFMA 1ZFNA 1XMVA 2RHGB 2XJ9A 3MT8A 3VR4A 4EG8A 4HWSA 4G2TA 2GETA 3A7EA 1VKZA 1PFWA 3A4YA 5IC6A 3K0EA 4PHGA 3QX3A 2J45A 1JHMA 4R7GA 4RTRA 3PXBA 1XDBA 3SDSA 3P20A 1OLXA 2JI6A 2XA9A 2OKCA 3AOEC 2DBRA 3DBRB 4F2PA 3ZDDA 1PG0A 2OD9A 4RKEA 3OC0A 4Z1OA 2QMOA 5ERGB 1SQ6A 3FLAA 2QR2A 1RJWA 2O1SA 3NIWA 3P94A 3T7TA 2C5AA 4IWYA 4TXHA 3GLFA 4UM8B 2DF8A 3SJZA 3FDXA 4Z53A 1PGJA 3OC6A 2M1XA 4XVQA 4MGHA 3CJTA 4WPGA 2WP8J 4YPFA 4G1EB 3JQ8A 2X0DA 4UUBA 1JJBA 4YCBA 4K9DA 3R2JA 4KI7A 4DJJA 4NI5A 3WQBA 3I2IA 2VHWA 2XZOA 4HL6A 1X13A 1CBUA 1T1EA 2CNKA 3IDZA 3L7DA 4DC9A 3WLFA 3ZWMA 2CB0A 4PAGA 3BGIA 4AKGA 1IVNA 4MQ4A 3BIJA 1R9JA 4MZXA 2P6RA 1DC5A 2O5RA 2C82A 5L3QB 3FUXA 3QKSA 1YB6A 4EHJA 5AOAA 1DB3A 3IC5A 1TPYA 1LSSA 1XZPA 2XT0A 3M6XA 3SHQA 4YAGA 2H4FA 1M67A 1M7BA 3EIXA 4DCMA 2QJOA 4O4HF 1FY2A 5BWMA 1R6TA 1M74A 3E8XA 3ESYA 4UUAA 4V0LA 1X1SA 5ALUA 1V1RA 2BT4A 4MS4A 4C2BA 1Q3KA 2WAXA 3HK2A 4B3RB 3IPRA 2AIRA 5F7JA 2UXDB 2GWHA 1L7EA 5F9FA 1GZ3A 3LCJA 2EFHB 1E98A 4GRAA 1J0CA 2KLHA 4MDHA 4MRRA 5JJ5A 1EUQA 3N2IA 5LYJB 4UQOA 4OSPA 1PFVA 3AEQB 3F71A 3P0EA 1NV8A 3O84A 3NP7A 3IKJA 2WWWA 3I04M 1S3SA 2QDKA 5DLYA 4ZT5A 1AB5A 4BGUA 4ARIA 2O48X 2B9VA 4ZZ1A 4EHLA 5BV2P 4QHTA 1KR2A 3BHJA 5EZYA 2XWJI 1CUFA 1BEZA 3RU9A 4OY3A 1J7JA 1Y1LA 2H0RA 2H9AA 3G0DA 5AK0A 1LNZA 3QUCA 2C7BA 2GN9A 3RFTA 5IRCD 2AE1A 3ZWXA 1U3DA 5GM2A 3S70A 4KSCA 3CLSC 5K8IA 3FHOA 3WWPA 2C2WA 2CJPA 2CL6X 3D5QA 2XGOA 3JTMA 3NNDA 1G20A 1F9EA 4B87A 1N36B 1AURA 3JVIA 1XNJA 3TGWA 1VL6A 3EQ6A 3WYGA 1EB9A 4QTZA 5BR4A 3GQBA 5AVVA 1ZSNA 1X1DA 3R5FA 4N4AA 5IT9A 4RE6A 2FNAA 2FFAA 5TQ0B 2ZPAA 3PPWA 4D25A 1V7QA 1IG0A 2I3AA 3OWXA 5HIJA 4C2UA 2YIJA 3CEMA 1ECJA 3LOUA 4KU4A 3T54A 1KHTA 2BEKA 2IUSA 5JJLA 1QVRA 2WV7A 3IPXA 3LYUA 4AO6A 3LUHA 1XZIA 4PW0A 3IRUA 3JAMA 1KNXA 3EEOA 1R00A 1GUBA 2RIRA 3ZY3A 1QCYA 2CV1A 1CR2A 5EWLA 4KAAA 2QGNA 1T1RA 1PR3A 2ORYA 3I9LA 3EN0A 3NKVA 1L4UA 4LXXA 1SR8A 2GB4A 3CNNA 3RC7A 4PZUA 1NBMD 2F64A 2WF5A 4CGZA 5GV7A 4GVLA 5BOSB 4B2YA 1I3OA 3IIMA 3VV2A 2WJVA 1CK4A 1UDWA 3F8SA 3SBEA 5H3CA 1W4CA 1GNTA 3H87A 4OOEA 3A2LA 1MXHA 2C0PA 4GI5A 1JG2A 4F3RA 2VPXA 4CG1A 2PSJA 4IX1A 2RHTA 3CN7A 2PX8A 3DMNA 2DFLA 3MFQA 721PA 4TQUS 1IM2A 4MEAA 4NMXB 4YQEA 3I2HA 3IP3A 3U7QA 5LCXA 1YK1A 4GAEA 3VC2A 1U98A 1PT8A 1USVA 3Q7EA 4KE9A 1BJTA 4FGSA 5HDBB 5A6VA 2BZSA 3B1KA 4FXPA 4DW8A 3T1VA 3RE1A 2ISCA 3BB3A 1YRAA 2A2ZA 2I2WA 2BMFA 3ZEIA 1RDFA 3DJYA 4GPAA 3OTHA 3PDIB 4QOJA 3I53A 5JT1A 4JXJA 1CERA 1N1EA 1YR3A 4X8LA 4QOHA 5T67A 7REQA 5CB0A 1GWNA 1QF9A 1XK6A 1YUMA 4WT7A 4A0RA 1Z26A 1WB5A 2ZJ0A 1UJ4A 4PONA 2YCBA 3H7IA 4Q47A 2B7BA 3AEKA 4U02A 2DHCA 3GG9A 5CDFE 4J16A 1CUEA 1CY4A 1Z7EA 2V7TA 4Q7EA 4IO0A 3IQZA 5KPJA 3WAKA 1A82A 4RMIA 2IYPA 1QTIA 3ZCRA 1L4LA 3K0HA 1K63A 3QE4A 5DX1A 3U6KA 5KOJB 1RXYA 3M49A 2JFHA 3BTVA 3I2YX 4QPNA 3C4JA 4YJHB 5L3RA 1E2KA 3PR1A 4C05A 4ZYZA 4DMLA 2P9YA 4HWOA 4B85A 2VOEA 4UVDA 3QRWA 5DOZA 2G80A 4C7XA 2WVGA 3OWHA 4BXOB 3PIIA 1NBAA 4D8UA 3U4QB 1X1BA 2KHZA 3V4SA 5D1NA 3WGKA 4EPXA 3I8OA 1BWRA 3NTRA 4X6YA 3U2QA 2C04A 1FP7A 3VYRB 3DZIA 3QKTA 1JIJA 4IJQA 2QPOA 4NHOA 4ZVKA 4JLPA 1AQUA 3ZDZB 3PGXA 4XFDA 3VYTB 1Z5GA 1NRJB 3CT4A 4HDAA 4ZYYA 3C6MA 3SF0A 4J1SA 4JVOA 4UM9D 4Y9UA 1EP9A 1IHYA 4R7TA 2JK1A 1WSDA 2TMYA 2XKBA 2NUAB 2F3PA 2WHXA 2OZPA 3A4MA 4TN5A 2ZJ3A 1R8JA 3GFPA 3NDPA 4HDMA 1NHGA 3DDOA 2XMBA 3BZBA 4PO8A 1M2VB 5KI6A 2RI6A 2O8DB 2NPIA 2CFOA 3FPSA 3ZWVA 4Q4JA 2NPFA 4EL0A 3LUJA 4JQZA 1A88A 3IUMA 2CNNA 1RI2A 3DVAA 4K0RA 2E7ZA 4KFTA 3WXMA 1YACA 4WZZA 4C6TB 4DYHA 5CA1F 1PK7A 1UBNA 1KDPA 3Q72A 2VEDA 1JTVA 2P2GA 1SQ5A 1ZOOA 1JEJA 2BGKA 3ESAA 4I5IA 3GK3A 4NU5A 5DWDA 1TYEB 5KREA 1U2PA 3RR2A 1TLFA 1DRWA 4N0PA 4EAQA 3VR6D 3AKYA 1U2GA 4HY3A 1OE0A 4IUYA 5ICSA 1R5NA 2VRNA 1S4MA 1YTLA 3GJQA 1GSOA 2XUQA 3RANA 2QMHA 4V3BA 2EX0A 2HAEA 1YR7A 4H08A 2G82A 2VC2B 1Z39A 1Y81A 2OCPA 5HBGA 3VTAA 1B0UA 1DRVA 3MBOA 3ZY5A 2H31A 2W83A 3B36A 3MN1A 2B78A 2W2QA 5JCOC 5B12A 5FI5A 4FN4A 2R7MA 2G9QA 3KQPA 1SUEA 1YASA 3UJHA 4X94A 4AJKA 4AZ0B 3OCYA 1L7DA 4ZCMA 3PVCA 2V3CC 1QKKA 1HYEA 4C7MA 2HSEA 4DMUB 1GUAA 4FQ5A 4IFBA 3UKDA 2NUPA 2ACWA 2XE4A 2IDKA 5AVOA 3NXKA 2JFWA 1YR8A 5EE1A 2OO5C 3H3FA 3WLJA 1SC4A 5F1KA 3PVZA 1NIJA 1Z29A 3O26A 3GGGA 4ZA2A 2OESA 2DJ5A 4OFWA 1GUFA 3NJ4A 1GKUB 4E5YA 2OK8A 1NASA 1TT5A 2CHUA 3I0NA 3N76A 3BN3A 5CHYA 4WOBA 1Z88A 3PXAA 2PMFA 3JWHA 3OZBA 4IS3A 4M9QA 3VZRA 3NHWA 3FTDA 3JVVA 1U28C 4JBIA 4TVOA 1PR2A 1XGKA 4L74A 1E1LA 4OHMA 2Z57A 1M75A 2NAPA 4OLFA 3PFKA 3CN9A 5AKKA 4CT5A 4EATA 4F06A 3AF4A 1G55A 3I09A 2PPLA 3ZHVA 2HNBA 3EGXB 2F9LA 3MELA 2XGJA 1RAGA 5H4HA 2JIDA 3VPSA 3K09C 3GC6A 1UEIA 5LJLA 3VDMA 2IXBA 3HJTA 2FZWA 3W1EA 1P0FA 3PTZA 4CQLB 4L07A 2G17A 1EK5A 1WS6A 3G6KA 4EAAA 3TCKA 5AI5A 2VZ8A 2IIQA 2AF4C 3N70A 2GQ0A 5EYPB 3WFIA 1DLIA 4MQ5A 2WQ7A 4MLDA 2XNCA 3ZC3A 3G85A 2IS2A 2C42A 3MRTA 3AEZA 2AJ8A 3TZLA 1ZPDA 3A6EA 2XT9A 1TM7E 2FJUA 1YGYA 2AFHE 3D8TA 1LNQA 2F3TA 4OQEA 1V5WA 4BNJA 2X13A 4E6EA 4KH0A 1QAMA 4EG5A 2ZIUB 2R8OA 2IPMA 3VPHA 2B94A 1HT1E 2RGCA 4C5AA 3P0IA 3QIVA 1L2TA 5ED4A 1IHPA 2P0EA 2QB5A 4H31A 3GJ5A 1Z5VA 3L82B 2FWBA 4J2OA 4QM6A 4UNRA 5JZBA 3GLIB 1IBCA 2VJCA 3OZEA 4F4DA 3JD0A 2X0EA 4BX8A 2VHCA 2SICE 4N41A 4RPKA 3RVPA 2QX7A 3KT0A 1Q0TA 2I2CA 3HZHA 4FOSA 1HURA 4IG9A 5HFAA 1Z8FA 1P91A 1KYZA 1N6NA 3TUJC 1KBOA 1KJ8A 4Q03A 1PWZA 5TY0A 3TTYA 4W5JA 3EG9A 3MM4A 4Y2QA 1ZRSA 2TYSB 1RJ9B 4X41A 2EL9A 3PUKA 3KSDO 5CFNA 1TECE 3OEWA 4FLMA 2B5VA 3O91A 3UH0A 4XCQA 1OJ7A 2O7SA 2VTDA 1HDRA 3RC2A 2ZYAA 1NW5A 2P6PA 1VL1A 2OHVA 3BRQA 4OMFG 1EK1A 1YR2A 1LPBB 3MGCA 4II2A 4WLOA 1H2XA 1ODTC 2OV6A 3VOSA 5H0IA 3X1DA 5KYUB 3P71T 2C5EA 3OICA 4GQBA 1ZGHA 1ZL2A 1HA3A 3NAMA 4KIJA 4A2QA 2CYAA 4PSUA 1VRCA 5DCLA 3M6UA 3PHJA 2ZM5A 2WY2D 5FA8A 2VNSA 3RSFA 3KJIA 4HBZA 1XCJA 4YAUA 4HMQA 4C29A 2C1XA 4TOIA 4EHBA 1RLOA 2DUNA 1EVLA 3G2MA 4G5XA 4M7PA 3DJFA 4YMSA 3ABOB 1YZKA 1NP6A 3QY0A 2BM1A 5HP4A 5FJJA 4NZ9A 2QLNA 1ZXBA 4LGVA 4C0HA 4MP8A 4NH4A 3A9VA 2AR9A 1CUJA 2JGKA 3Q85A 4LDAA 4XTRA 4OP3A 1WF6A 4MQBA 4YYEA 4P81A 4YT4A 1UBSB 1H3NA 1OUMA 4R8MA 3W6ZA 1SVSA 5HQ3B 6Q21A 4AUEA 4KQ1A 3FHCB 4HAXA 2XIQA 1OX4B 3KB2A 4P84A 3TMAA 1E2LA 1WXQA 1IQ0A 2IIBA 3HS3A 4MR8A 5LU9A 1XCOA 2WJGA 1UM9B 2UUOA 2H4WA 2MYNA 4H1TA 4PINA 1T3TA 2QN6A 4C14A 1WCV1 4P4TA 3M1AA 4DIUA 5CD1A 2YS6A 5HF6A 1TX4B 4YXWD 3BCRA 4ZVVA 4EITA 3ORYA 2R6HA 1YR1A 4LZOA 4EMUA 4NBUA 3C2QA 4Z0TA 1MP0A 5H80A 1QUFA 2F17A 1ZLXA 2J0UA 4FD3A 4KPUB 5IVIA 5ECGC 3ZW8A 3KLBA 4AUMA 2IOFA 2Z8YA 3H2JA 4PG5A 3IQIX 2E5LB 2IODA 4MVJE 1QZUA 4P3NA 1KH2A 2PKRA 1CE8A 4AZTA 4BRSA 1SOUA 4QDOA 4P4SB 3PUIA 4TKVA 4OI4A 2UAGA 4KXVA 4B7CA 3R3YA 2PXAA 5DHUA 3VO8A 1QF6A 3KWLA 4O2BB 2OPHA 4CUKA 2UXCB 2PZFA 4KPYA 3MQFA 4B0PA 4BMPB 3A70A 4MI6A 3VH3A 3W6OA 1FQJA 3WGUA 3H5NA 1DG9A 3BD9A 5D01A 4A1OA 3NCTA 4MQEB 3NGMA 3E35A 2A6PA 1TVEA 1V1MA 4KWHA 4LOHA 1QK4A 3RS5A 3P9IA 5CBKA 3R3VA 4G1UC 2VDMB 3IUEA 4H2DA 4KAFA 3DZJA 3TZKA 5K6TA 1BA2A 4G3XA 1T2VA 3BJRA 1FQOA 1JG7A 2C95A 4OBBA 2FF5A 4I50B 4K28A 2R7KA 4YJ2F 1XQ1A 1PX0A 5IP5A 4TTIA 3W9BA 1GLGA 2D1YA 3AM3A 2A4MA 2QLFA 3N39C 2J6HA 2NVUA 3QUSA 4D92A 1RS0A 1L5KA 3URMA 2VH2A 2DC1A 1V11A 2D5LA 2PSFA 1BVRA 1XSEA 3KQWA 5JAQA 2B9EA 4PHFA 1EHYA 4LK2A 2IW3A 3ELWA 2OCDA 2V5VA 3EQZA 3I3SR 2O1WA 4FI3F 4FU0A 5FTLA 1HEUA 5JSUA 3SQOA 1DWUA 3MJRA 5JY6A 1CWUA 2QUJA 2EEZA 5FWYA 1ICEA 4K86A 4WUTA 5FBZA 1IY1A 1CS0B 3LPLA 5IEBA 1A8IA 2IP2A 3ANSA 2X8JA 3IDQA 5B5SA 4JX9A 3S1SA 3HSSA 3DO6A 1JHOA 1HSOA 4CMBA 1ZAYA 2HDNB 3FI9A 2AHRA 5A2QA 3I4FA 4XOIA 3SEQA 3OIUA 4V0SA 2VDQB 2ANCA 2ZCJA 1AUOA 3JZFA 4FUQA 5DM1A 5GOZA 1FUYB 1KI1A 5JNLA 4AKIA 2PV7A 1DCFA 1VG1A 4Y2YA 1EP2B 5KZMB 5BPFA 1DC7A 1K98A 4L1KA 5CX1A 3ULKA 1L5GB 4AD8A 1RHUA 4M1KA 2C03A 2Z6QA 4AJPA 1KFBB 4G9GA 3ZWWA 5BN3A 4GO1A 3L7CA 4YMIA 2BBOA 1U1EA 2BFBB 5TEWA 4RLHA 2YWGA 3EGEA 1HE3A 2AXEA 1I14A 5T5QA 5F4BA 3U16A 2VCHA 3E2PA 3EULA 4FGWA 3VZSA 1IEWA 3WKEA 1WPXA 3I04A 3ZTTA 1AD2A 4US2R 1J8FA 1T6XA 1SRQA 4Z0PA 3JWPA 2O2YA 5FPTA 2NU8A 1ANKA 4YMHA 1IB6A 1QH8B 1WLSA 3OBIA 3Q7QA 4IM7A 3U9LA 1ISIA 1E2UA 1K5DA 5B1IA 2Z3ZA 3AHFA 4MUIA 5CVTA 1L3BA 4LMRA 4DDVA 5FBHA 2WR8A 2QZSA 1CIPA 3OCUA 4WMLA 2ODBA 1SM4A 4N03A 4A15A 1VSQA 4EHFA 2G1AA 3MAGA 4F1KA 5TDHA 3C3CA 4D8YA 5DSZA 3LHFA 3QFHA 4IOMA 1MCZA 4R4JA 3NYRA 4NYIQ 1O03A 5ERXA 3UEOA 4ZGBA 4LJ8A 2ZXEA 3HY6A 2XCTB 3CKKA 3K2EA 4U3JB 5JROA 3P2MA 1AKRA 1QOQB 4PBRA 3HADA 2NTJA 4MHOA 5DCYA 1VCIA 4RFVA 1KH3A 1BDBA 4B8ZA 4I4TA 1N5LA 3VFDA 3QX7A 2QU7A 2EZUA 3QUTA 4FYWA 2WWIA 1C7ZA 5BMVA 3ECSA 4OGGA 1MFPA 3BPSA 3CRNA 4U0JA 3L6OO 3PEYA 4CV3A 1YFLA 2Y1XA 3I9V1 1FDSA 13PKA 1P6XA 3F6YA 4MUBA 4PX5A 2ZIGA 4MYRA 3MYYA 4DM3A 1UUFA 2WU3A 5LYYA 2C7GA 3M7IA 3AKEA 1ISPA 2XYPA 4A1FA 2C61A 4BO0A 4M4SA 2VXBA 2PH1A 2CNWA 4DVJA 1W6RA 5DYNA 2AH5A 3HXOA 4GL2A 1Z6YA 2VP0A 3IMCA 2FN8A 4LHSA 4I6GA 3LCCA 2PKQO 2R1UA 5J9FA 1HLDA 1Z5OA 4DNOA 2XGSA 4ZI2A 2CLFB 1SOWA 4MQMA 1VLVA 3G2KA 4BO4A 5AVTA 3KELA 1YS9A 3W2IA 1QRTA 2Q4RA 3TLGB 2Q21A 1LVUA 3CUTA 2C5HA 5JBQA 2YNMC 3EWAA 1L5HA 3SKYA 3KKQA 2O4CA 3BJZA 4Q4HA 1G9SA 2ZPTX 5TQJA 1ZWLA 3ZVLA 1ODFA 1YF3A 2HI0A 4CODB 4DA8A 2CC2A 3ZWCA 4D9BA 4OQXA 4R40A 4JL6A 1X80B 2O19A 2VT7A 3GXOA 4MHTA 2UZAA 4O63O 4OJTA 3B7GA 5JYBA 5ESWA 4JUIA 2NVOA 1U63A 1E3TA 1Z0DA 3IOYA 4GM0A 4UE6A 3VM6A 3H1TA 1TVKA 2ATCA 1IZZA 2P3SA 1FLAA 2I3GA 2R1TA 3KYCB 3G8YA 3FWPA 1ODSA 1KJNA 3P0HA 3FTEA 2PKXA 2GXSA 5LOVB 4NZOA 1N6IA 2C5SA 2YW9A 3Q3VA 2Q9BA 1RJDA 1SPXA 4Z4CA 2IPLA 3RSQA 1K7YA 1WKCA 3FCOA 3QV1A 3WJ2A 5FOUA 3WV4A 5K0FA 5JQGA 1DAIA 2X7XA 4JVLA 1Z28A 4NU6A 1N2JA 4NJMB 3VDRA 2VL7A 1KYVA 1BE6A 4N7BA 1R7RA 4JC0A 4JP5A 1E2FA 2AA3A 3MGGA 3ND9A 5D7NA 3RUCA 4D0NA 3HLKA 3E7XA 3Q6NA 3RKUA 2GBFA 1JTFA 4CQMA 2QQ0A 4KR9A 3ZVKA 2VP3A 4HLNA 4X84A 1E1YA 3L0CA 1E3LA 3KWJA 4WXEA 3RRFA 1MQSA 1KIMA 2IH4A 9LDTA 2GT1A 2BE7A 5KBYA 2C84A 4DLXA 3OKFA 4UBOA 5J1TB 3T4EA 4JJEA 4INPA 3SS9X 4D9GA 5CJPA 3R41A 2WJ3A 4TXLA 2WTAA 4FDVA 2JI9A 4RK1A 4RVOA 3C6ZA 1JEDA 3SIWA 5B3JC 1HZZA 2WMNB 3AVWA 1VE1A 3PDUA 4TRRA 3H11B 3OVMA 2AF3C 4IVNA 1NOIA 4KIGA 3VBCA 4H1WA 2R5NA 4L9AA 2XB2A 2XDQA 3CGWA 2VAMA 3ENNA 3C5EA 4URZR 3KOUA 1DX9A 2UZ1A 4X8OA 1NMQA 1PZEA 3LT4A 1Y3FE 1T1JA 3IUSA 3RSOA 1ITZA 2RBGA 2Z9CA 4PCLA 2GHRA 3FOZA 2QTTA 3SR3A 2B30A 3KJQA 4MEJA 4OM8A 1OYWA 3MERA 3B89A 5F73A 3VRHA 3WOHA 1M5RA 4EF5A 1Y1QA 1ZJZA 4LRYA 3DMTA 4JL8A 4EDFA 2GERA 4D45A 2VAXA 4XPIB 1WKVA 4EY6A 2PT5A 4YY3B 4J76A 3MUFA 5LMNB 1QIMA 3ECCA 1J06A 4B3BA 3ZU4A 4CCYA 3RT9A 4PS0A 5HHTA 1CUHA 1Q1AA 1I0ZA 2CD9A 3TQIA 2XZPA 3NBMA 3CPJB 3HPRA 5L3SB 1N5OX 3ETHA 1XP5A 4M1TA 5FEMA 3D8BA 4ZXPA 1P1RA 1NVXQ 1X1TA 2YDYA 3PFFA 1TC1A 1YBMA 5DNAA 1D09A 1UKAA 3N8DA 1W29A 3WGNA 1P39A 3K9BA 2XMRA 4RH1A 5ILQA 2VATA 1XU7A 5DX0A 2V7GA 5IBCA 1VHJA 2EGHA 5GPBA 4R8RA 3PTAA 3BBLA 2V45A 3NC4A 3V8VA 4NCAA 3K1JA 4GLJA 1TAHA 1L5YA 1JB1A 2ZYVX 5C4IA 4MVJD 1L8OA 1LS6A 3EBLA 3JATB 4KGXA 3ROZA 4BRZA 3F3KA 1N4AA 3A58B 1DAOA 2HLPA 3CNHA 1CKEA 1E5DA 1SG0A 1YDWA 3ROKA 4UCQA 3SN6A 5BW8A 3Q2KA 1R0BA 3PIDA 3C16C 4O4JF 1S2OA 3MBKA 4FHFA 3UV7A 4BWYA 4ED9A 1U0GA 2AJDA 4WBNB 4OLAA 1Y3CE 2ANBA 3TCNA 5A5FA 2WJHA 1M6VA 4D3YA 3CIFA 4INJA 4FZ3A 1Z4QA 3ONEA 4HRYA 5DK4A 2XX3A 1PZFA 4ITUA 5LKAA 1KQOA 1QZTA 1E79A 1WDLA 3KRTA 3L49A 4WK6A 2ONKA 4TLEA 4P54A 2UVDA 1VCMA 4L3VA 4A91A 4F3KA 1KAQA 5FTMA 3THYB 4BMZA 2ATXA 3D4NA 4DCPA 2XQGA 5LQJA 2AX4A 4ZIRB 1KXJA 1PFYA 2VYFA 2XUJA 5FORA 4AW9A 1WB9A 1NX9A 3G5LA 1ISJA 3SNKA 3A1CA 4RZSA 1JN0A 1G5PA 3EVAA 1L7AA 4GPBA 1P2VA 5C5DA 4AWBA 4TUYF 4B3MB 3SQDA 2QL5A 2HRRA 2W2KA 2R8XA 4M9CA 5F9MA 2YJZA 4NV0A 3BORA 4XRGA 1V4NA 2QP4A 1PDVA 3WSTA 3K8ZA 2CDNA 4GU5A 1IBLB 2CZCA 4W8HA 1RAIA 4EW2A 1S2NA 1F60A 3RASA 1BRTA 2HT6A 6REQB 5E1DA 2ZG6A 3E7PA 4LIPD 1IPHA 4PXYA 1RWKA 1VLQA 2R6JA 3PVSA 4WH0A 3SI7A 1W19A 3B3QA 2FTKE 2IPAB 2FWRA 3TKAA 1WPGA 3ILYA 5EKUA 4DEYA 5L4LA 5BVHA 2GAFA 4IMRA 3F90A 5FTWA 3WB2A 5DU2A 3FIJA 1HT0A 4X3CA 5TPWB 1P4GA 5LQMA 1MX1A 5G0WA 4CMIA 2VPQA 1M1XB 2XW6A 2JH8A 3O2QB 1JWAB 1YL6A 4JP2A 4YGYA 5IAGA 3DULA 1LEHA 3TLZA 1F0NA 2CMKA 3X1ZA 1SH7A 3JQAA 3ICPA 2VF5X 3P26A 5D3MB 2VLIA 2BJVA 3QEBZ 1BS2A 2Z04A 3KTDA 4GP6A 4WN3A 4HTFB 1VKRA 2AD1A 2A1UB 3AUYA 2HJVA 3H4VA 4FCVA 4PYNA 3BFJA 4KOAA 4M8KA 4CMCA 1G8JA 4ZVMA 4ZVQA 1U8UA 4H1HA 2BAGA 4DC0A 3PE6A 1FFXA 1RP1A 5A4IS 3PPXA 2BFCB 2IE8A 1XXHB 2Q6VA 4FBLA 3UF0A 2VOJA 5J2TB 1NNSA 3T9CA 1RM5A 1W9HA 4HEA1 2J09A 3RYIB 1FXWA 4O08A 4D8TA 1UJMA 3FYSA 3AW8A 4OXYA 5E4FA 4YWHA 1IQRA 5CT5A 1RP7A 1YVEI 4B4OA 4DY6A 3HVRA 1KFCB 2Z5FA 4V1CA 2EARA 4XVRA 4B8YA 4P33A 1RPAA 2V7UA 5TB5A 4O5OA 1T2FA 2IUFA 2O2JA 2WIBA 1RRVA 4ESEA 4WJLA 1Z74A 2WSLA 4ALKA 3BRWA 1MJNA 2I76A 3A06A 1R5JA 3HKEB 4EY7A 1OU0A 4PQEA 5EGSA 3RAEC 5ED0A 1FMCA 5GM1A 5D51S 2B4QA 1M1YA 2KBEA 3OURA 3OM9A 1CNMA 4CG2A 5EOVA 5KQLA 3AY3A 2LR0A 3J7AC 1XEFA 5TT0A 1SCDA 2FRDA 3IUQA 2CLEB 1QU3A 4WADA 3H5WA 2YN0A 4L9WA 1HEIA 4JSRA 2X5KO 4X6UA 1X14A 1Z12A 2GPSA 4DRXA 2I55A 2IHYA 4ARCA 4O33A 1QIFA 3LLSA 4I55F 1LTKA 4X5OA 3ZY4A 3VOAA 2YMMA 1VE3A 3CLRD 4UCXA 4X7RA 4MKXA 4ABTA 4FOPA 1XZHA 2DBZA 2BSQA 3O92A 3QMPA 4ARUA 1JT9A 1ZUNA 1NAHA 3I32A 3Q5DA 4B48A 3TIIA 1H2AS 1D7OA 2YHIA 4GX1A 3COPA 2XUOA 4NFSA 3WYCA 3RF7A 2Z2IA 2ZYHA 1C3XA 3EPRA 3QXSA 2VDNB 3U3KA 4BO6A 4BO5A 1NFFA 2A9VA 1HWYA 1YBHA 3GUYA 1MD9A 3EA5A 1JR3E 3M2TA 1J8QA 1GFZA 3OMLA 4YJ3A 4WLVA 3TMYA 1ZN8A 3PNBA 1C3OB 3P19A 1W9MA 2HPVA 3IQGX 1QFXA 3C6BA 5SYAA 5JXWA 1X19A 1FDUA 1D2HA 3C24A 1MRNA 4LMBA 4N5IX 1E5QA 5JECA 2O0MA 2NMVA 4ETIA 1GRQA 4J6EA 5C81A 1O3YA 2WOOA 3FMIA 5HTKA 2J7PA 2ZYDA 2AUMA 4XYBA 4YRFA 2Q5FA 1OY1A 5HNKA 3DMRA 4RMGA 1J0AA 5CHEA 2XYHA 3CS3A 1FYFA 4BDSA 7GPBA 4QA9A 1BQ4A 1BROA 4OJYA 4ZC1A 4IWNA 3HEMA 1JTEA 1IM8A 1KSHA 1JMVA 4ODIA 2CEAA 2ZRFA 3N2GA 1AK1A 3AHJA 4J7CA 1PQWA 2FFRA 2H7CA 2PUVA 4D9IA 4BNNA 1S5PA 2FN4A 3UCFA 3EGIA 2Z4RA 3KT6A 3JYLA 3P2EA 4C0KA 4W8GA 2AMLA 3CV3A 1UJ5A 3A9CA 4BFZA 2OHHA 3N2ZB 2NQTA 2YRFA 3GFBA 2EX4A 1FP4A 3LRTA 5EE9A 3E70C 4BV3A 4ZDKA 2Z2ZA 1CR0A 3QWBA 3WP0A 2GD6A 3QW2A 5B30A 3QPBA 1G59A 4NP6A 1UFOA 4LWOA 4F5ZA 2HF8A 3SJUA 2RK6A 1WW8A 5AOVA 3U4GA 4G09A 4ABYA 4I6EA 1G38A 1NNEA 3L77A 4BL5A 1A9TA 4R2MA 3TD9A 2HK7A 2ZUBA 1JEAA 2PCJA 3G9UA 4HNUA 1DX4A 4BP3A 3QNMA 2LW7A 1ZUIA 2HRDA 3HZRA 4JDUA 1SD5A 3I6ZA 1QG4A 2BKXA 3AP3A 2KSQA 2P9FA 2BW0A 1PJRA 1VMKA 3CKMA 4FCCA 3CWZA 2PMEA 1HG1A 1DAPA 1V8BA 1NZFA 1QHNA 3C3WA 3CBQA 3CCCA 3NW9A 1LC0A 2W70A