3OSUA

Crystal structure of the 3-oxoacyl-acyl carrier protein reductase, fabg, from staphylococcus aureus
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
246
structure length
246
Chain Sequence
MKMTKSALVTGASRGIGRSIALQLAEEGYNVAVNYAGSKEKAEAVVEEIKAKGVDSFAIQANVADADEVKAMIKEVVSQFGSLDVLVNNAGITRDNLLMRMKEQEWDDVIDTNLKGVFNCIQKATPQMLRQRSGAIINLSSVVGAVGNPGQANYVATKAGVIGLTKSAARELASRGITVNAVAPGFIVSDMTDALSDELKEQMLTQIPLARFGQDTDIANTVAFLASDKAKYITGQTIHVNGGMYM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the 3-oxoacyl-acyl carrier protein reductase, FabG, from Staphylococcus aureus
rcsb
source organism Staphylococcus aureus subsp. aureus mu50
molecule tags Oxidoreductase
molecule keywords 3-oxoacyl-[acyl-carrier-protein] reductase
total genus 81
structure length 246
sequence length 246
chains with identical sequence B
ec nomenclature ec 1.1.1.100: 3-oxoacyl-[acyl-carrier-protein] reductase.
pdb deposition date 2010-09-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3osuA00
1D1SA 2DFDA 4E5MA 3PI7A 4OQZA 3JQ9C 3FNGA 3RBZA 4PVCA 2VN8A 1I24A 2DPHA 2P9CA 4ND4A 3JQDA 4Q3DA 4PRKA 1ZIDA 3NDIA 4Y6PA 1R4MB 4FB5A 5CP8A 2GO1A 1PEDA 4E32A 2D3TA 4OOFA 4KMSA 3WFJA 3JD3A 3RD5A 3R1IA 2PWZA 3HDYA 4NDNE 4EJ0A 1PR9A 3COSA 4Z3KA 1EE2A 1CYDA 3KETA 4U6QA 4PVDA 4JNKA 3TN7A 4TSKA 3JD0A 2AEFA 1VJ1A 2EJWA 4KUEA 4AJOA 1WAMA 5IJZA 1P77A 3TNLA 5BSGA 2GRAA 3UN1A 3PP8A 3W8DA 1MC5A 2FPPA 5JAIA 3OFSA 5IDQA 4CM8A 4CMHA 2CVOA 3E9QA 1PS8A 3GMSA 2X58A 2GNAA 5AXAA 1A27A 2AA3A 1BXGB 3DHNA 4KWIA 1W0CA 3JYLA 3JQ9A 1B26A 1FMCA 4CM7A 3SX2A 4DBZA 3RQSA 1JQBA 3OA0A 3OJLA 3G17A 4IGFA 3RC2A 3WIDA 4D44A 2VWHA 4CLRA 2PR2A 5L7TA 3E5MA 2G5CA 3WWYA 4MKZA 2YHUA 3MOIA 5JDCA 3BZUA 1PTJA 3DONA 4WNCA 2DU8A 3ZV4A 5CDSA 1N9GA 5CAEA 4K1LA 4MINA 1HT0A 4QQRA 4UUOA 1U5AA 4DC1A 4HNHA 4XGKA 1TT5B 4YAIA 1U28A 4II2A 3WOHA 3OICA 2P9GA 1HDRA 1E3WB 1NR1A 3GDFA 1JW9B 4R5HA 1ONNA 5JO9A 1JA9A 3C85A 4L9RA 4CM4B 1S7CA 4PLZA 4YAEA 4IMRA 1IULA 3K2EA 2GN9A 2X9VA 3MTGA 1P3DA 4I9HA 1KEPA 4K6CA 2I6TA 4W7IA 1JDJA 1VSVA 5FI3A 2FOIA 4UVIA 4I5EA 1QRRA 2IYOA 2ZK7A 1KS9A 2V6FA 1EBFA 1DBVO 4PFJA 5EQFA 3S2IA 5ENVA 2NWQA 2GGSA 2B69A 4R9SA 1SOVA 2NACA 1FF9A 4F6LA 3CIFA 3GZNB 4BV8A 1RM4A 2I65A 1NAIA 3WIEA 4AJ1A 2RH8A 1R37A 3Q0EA 4M1QA 3GC6A 5TGDA 3VH2A 4U7WA 3I9MA 3HJAA 4J6FA 5T8KC 3HUDA 4K28A 3RFVA 4A7PA 4I9UA 1K89A 3NV9A 4RVUA 2BH9A 5GY7A 1EUZA 1LTHR 1YL7A 1WMAA 2W2KB 3U49A 4UEOA 3Q9UA 1ZVMA 4BMSA 2C29D 3QWIA 3RC9A 1LRLA 3WYCA 1X7GA 2FR0A 2O48X 3EMKA 1R0KA 3IS3A 2E37A 1KVSA 3TZQA 3SJUA 1E6WA 1PL8A 1DHRA 5G0UA 2B5VA 5HM8A 1Y5RA 1YS4A 5THQA 3KSDO 3U5TA 3ZV6A 4BO3A 2H1SA 3C7AA 3MZ0A 4RF5A 3F3SA 3RAJA 5DBGA 3V2HA 1M67A 2C07A 4XIYA 4S3MA 3VPSA 4M87A 1WWKA 1HWYA 2QHXA 3KSZO 3Q2KA 3QWBA 5FWNA 3TL3A 1P1FA 5IAAA 2YW9A 3F6YA 3ROKA 4CUKA 3TL2A 4CMAA 1YB5A 2JD1A 4UVEA 3WBBA 4CM9D 4AJ2A 4R1NA 3PQFA 4E5NA 2VZ8A 3OSUA 2FN7A 2P4QA 4B4WA 1VJTA 2GF2A 2Y66A 4JIGA 2VT3A 1AXGA 3E82A 3VOSA 1UP4A 1YJQA 4FD3A 4TWRA 2ZQZA 1SC6A 1KVTA 1I10A 2OOSA 4G81A 1J49A 1PZEA 3E48A 3RC7A 4E2ZA 5JAZA 1E3EA 3INTA 4RF2A 2EEZA 1HZZA 4MP8A 1CQJA 1I5RA 1NBOA 4XB2A 1DIGA 1LDBA 2VHVA 1JWBB 4OKIA 2WD7B 4MJLA 1V6AA 1RKXA 4FBGA 1NFFA 2J3KA 4NI5A 4ND5A 4XRGA 3GOHA 4JJFA 3RUEA 2EERA 3H5RA 1UAGA 2I9PA 3GEGA 4MP3A 2XAAA 2HJRA 4E12A 3G1TA 1Q7BA 5G2OA 1CJCA 4J91A 3I9LA 3UCXA 4HXYA 3L4BC 2OBNA 3CTMA 1YQGA 5JMWA 2EJVA 5ITWA 1PJCA 1BGVA 1AE1A 5COAA 1XHLA 3RVDA 3QIVA 1PJQA 3OJOA 1GAEO 2UUPA 3ASVA 4U8GA 1EE9A 2B83A 3AW9A 1WDMA 3K5PA 4UVGA 3GEMA 3IJRA 1PZHA 1DPGA 1O89A 2BFPA 4J9UE 4RF3A 4C7KA 3PIDA 3HWRA 3I9OA 5I8WA 4L0QA 1BWSA 3PDUA 2CF6A 4CQMD 4IDDA 1M2WA 3D4OA 2A92A 1I2CA 4ZU3A 1R12A 4BNXA 2AEJA 4BGVA 3WYEA 3IKTA 1JKIA 3ADPA 1F12A 3CXRA 3GH3A 1H6CA 1I32A 5IDYA 2X5OA 1R4NB 1DSSG 4ZICA 1ZEJA 1ZSVA 4CQLB 2X5JO 1GUYA 4FFNA 4ZQFA 1E6UA 3W8EA 1PJ2A 1ZO8A 4R68A 1E7MA 3O38A 3O8QB 3MWEB 4A73A 3ZDFA 4BGUA 1YQXA 4Z9XA 3BMNB 4NK5A 3P7MA 3ZGYA 4GX5A 1LJ8A 1XLTA 2AQ8A 3G49A 3EDMA 4XQ9A 3L6EA 2NU7A 3DMYA 3JYNA 4GWGA 4YTEA 1IY8A 3WQQA 3BAZA 4ROSA 4CPDA 5IZCA 3IDSA 1KBZA 4TVBA 5DOZA 4ZJUA 4NFHA 3U4CA 4BO9A 4IINA 1CWUA 1GY8A 3AI1A 1G0OA 1IYZA 2EV9A 1HDOA 2H5LA 1YONA 4J0FA 1TA4A 1YH3A 5F5LA 5EMHA 4DXHA 3LF1A 3X2EA 1DC6A 1OAAA 2EGGA 1QYVA 3DAFA 5T67A 4BGIA 4DL9A 2VYNA 2WD7A 4KP7A 4RV9A 1ZKMA 5JAMA 4NBWA 3GHYA 2VT2A 2UUOA 3PQDA 5JBIA 1ZK4A 1K2WA 3B20A 3V2GA 4FFRA 2J3JA 3HB4X 4DRYA 1EMDA 2PD4A 1J5PA 3BXXA 4TZKA 2AEMA 1HKUA 2GERA 5MDHA 2FSVA 2I76A 3H3FA 4JCOA 1YBAA 2HK8A 1NWHA 2W90A 3GVHA 1TVEA 3KRTA 1R4NA 1ID1A 1T2DA 4Y67A 3QVOA 2V6BA 4BIIA 4UUNA 4BNKA 3WSVA 1VLLA 1XQ1A 4CM4A 2B0JA 4WLOA 1B0AA 4CL8A 5I7FA 1EDOA 3HNPA 3WGGA 1ULSA 5FF9A 1B14A 2RBEA 3FSRA 4J1TA 1K6JA 1LC0A 3GVXA 4BO1A 4YQZA 3RUDA 1GYQA 4FN4A 3DB2A 2JAPA 3GNTA 1X1EA 3DL2A 4EBFA 3DBVO 2B5WA 4HFNA 1LDEA 2EG9A 3DZGA 3K30A 3PHJA 1WMBA 3S2FA 2QW8A 1R6DA 4FFOA 1KIFA 1P1KA 3D3WB 1BXKA 4IGEA 4R9RA 4NBUA 1NXQA 3LYLA 5I9NA 3PJGA 5I7VA 5GZ3A 3D4NA 2YZ7A 4DPKA 2ZYAA 4ZGWA 5KVQA 2PGJA 3U9LA 4BO5A 4BQPA 3F1KA 4LK3A 2Q4EA 4NQZA 4CUZA 4N5NA 4Y6RA 3PIIA 1NAHA 4OGWA 4D41A 4AJHA 4HP8A 1JN0A 1UXJA 4DQXA 1ADBA 2W8ZA 2WEKA 4WNIA 5DCUA 3NJ4A 1HRDA 4GX1A 5IG2A 3FN4A 5KKAA 3ZHBA 5IXSA 1YRLA 4FGWA 1LDGA 1PL6A 3CZRA 4TRRA 4XQEA 2WSBA 3CPSA 4ESOA 4BOYA 4EUFA 1YQDA 1I01A 1ZK1A 2BKAA 4RQTA 3TWOA 4BO6A 3VH3A 4BO7A 3K73O 1ISMA 1U3VA 3AU8A 4L4XA 1R16A 3LQFA 2BGLA 4IJKA 3PZRA 3QVWA 4G2NA 2O4UX 3NT2A 1LI4A 3CE6A 1E3LA 4XIJA 4ALIA 4DREA 1C1XA 2O3TA 3AM3A 1HDXA 2RHRA 4J4HA 5A9RA 4PLPA 1GADO 3FD8A 4X54A 4CLDA 3N7UA 1HSZA 4RPJA 4RPKA 3GDOA 2PKRA 1B16A 3H3JA 3UUWA 1X7HA 2B36A 1UZMA 3CH6A 4RGBA 4OXKA 3BMCB 1GEEA 1HDYA 1VM6A 5F1PA 4CV0A 3R6DA 2EKLA 2OZPA 3K8ZA 5DN9A 3HSKA 2JFGA 3GRPA 3MEQA 2GLXA 2AQHA 2UDPA 3ZCXA 5L40A 1HL3A 1ZMTA 5TNXA 2IDZA 4J1SA 3SLKA 1DFIA 3WWZA 4R01A 4NU6A 3QQPA 3KLPX 2EP7A 4F6CA 1NWCA 2GN4A 2BFMA 4AJKA 4NU5A 4GPD1 1OOEA 5F3RA 1UXKA 4ND3A 3HB5X 1N2SA 3B70A 3UKOA 1EBUA 2CY0A 4GWKA 4QX6A 1DXYA 3NAQA 1WXDA 2OFPA 2Q2QA 5AVOA 1A9YA 4LCJA 3PEFA 4BO0A 2CSUA 5KCZA 4YPOA 3GN1A 1E3WA 1U8FO 4AJPA 4FOSA 3M2TA 5TIIA 5CG1A 1OI7A 4Y98A 3GF4A 4CV3A 3F4LA 4BO2A 2OMEA 1GEGA 2IZZA 4D3DA 3RFXA 3GMDA 4J3FA 3W6UA 2P5UA 1P45A 2CVQA 4PLWA 1ZEMA 3FNEA 5AXCA 3ICPA 2IEBA 3C1AA 2DM6A 3DBLB 4KTTE 2B35A 3WSWA 4BV9A 2J6IA 3KUXA 3H5AA 2C54A 5AXDA 3M1LA 4L74A 5DNAA 1YWGO 3UF0A 2E48A 3HN2A 4Y9DA 4GLLA 1E1KA 4L8VA 5JY6A 4E31A 1N5DA 1EFLA 3ZHYA 3D5TA 2NU9A 5JO0A 1KERA 2C0CA 1EK6A 2RH4A 3MJEA 3ON5A 5K6AC 1PJBA 5HTOA 1QLHA 3B1JA 1QORA 1PWZA 1GQ2A 4FIZA 4A2CA 2JAHA 3NTOA 2PD6A 1RM3A 1RYEA 2GCGA 4UEJA 4LRSB 3PQEA 1V9LA 3IJPA 1PWXA 1LUAA 1V8BA 2Z95A 3BMCA 4BNTA 2VRBA 4CMEA 1YOVA 5KJ6A 1P1HA 2WJPA 2HK9A 1MG0A 1H0KA 4MVJP 1GPJA 5T8KA 3WS7A 4QSMA 3KYBA 5BSEA 3ADOA 2WD8A 4CM5A 2GD1O 1MFPA 3ZWYA 4ALJA 3AK4A 5CG2A 4IIVA 4AICA 1C0KA 3ROMA 4CL3A 4J43A 1GYRA 2BD0A 4J0EA 5JC1A 1UXIA 5K6AA 4AJEA 5A9SB 1Z74A 4CLOA 1KEVA 2VHWA 2AHRA 3NRCA 4WPGA 3FBGA 3I1JA 3W8FA 3HG7A 3VDRA 5L4NA 1RM5A 4ZA2A 3HN7A 1C1DA 4EGFA 2X4GA 3GNSA 4R1TA 4GL4A 2NVUB 1ZXLA 3E18A 2PD3A 3JQ8A 3OJFA 3NKLA 5U1PA 1BXGA 1VC2A 4ZQGA 1BDBA 2PNFA 1LSJA 1MV8A 1U7TA 4H16A 1QMGA 3AOEA 1BMDA 4XYBA 4CM1A 2D1YA 5ADHA 4ZRNA 3P2OA 3DBLA 3R3SA 1LLUA 3ZNPA 2V6MA 4NIMA 3FNFA 1YDEA 3WQSB 4ALLA 1HE5A 3NT5A 1IL0A 1W6UA 4JBIA 5L4SA 1NPTO 3LC7O 1HDZA 2VYND 4A27A 1XELA 4CV2A 4E2WA 4EW6A 2Q2VA 1U4OA 2WE8A 2BFOA 2GASA 1IUKA 4FW8A 1B3RA 5HA5A 2E6UX 3F1LA 1CDOA 1QLJA 4RVHA 4DTIA 3UCEA 3ZNOA 4RVGA 1VL8A 1GYPA 1E7QA 5C5IA 4R41A 3PJDA 3DZBA 4YT2A 2XXJA 5TLSA 4AJNA 1AUPA 1D1TA 3HDHA 4DYDA 4XR9A 5JC8A 3WLFA 3FHLA 2HU2A 2VOEA 5BR7A 4KDEA 1DO8A 2GYYA 2VHZA 3T7CA 2WM3A 3WNVA 3L4BA 4BNIA 1GV0A 5A3JA 3H6KA 4PZEA 4XJSA 4KWHA 4CMBA 2CFCA 3L9XA 1VL0A 2J3HA 1BTOA 1PJ4A 4NR0A 1E7RA 3JYOA 4XYEA 4B4OA 1DHTA 2NUAA 3GHHA 3LVFO 4IBOA 1DDOA 1RYDA 3QWFA 5T64A 4AVYA 3ANLA 1A9ZA 1H6DA 4LCEA 3RCBA 4I8XA 4GGPA 3U0BA 3JD2A 5L3ZA 3O8QA 2FHSA 3DOCA 5T6BA 3ZU2A 1M76A 1T25A 3G1UA 3KTDA 3ZI0A 4BNLA 1E7YA 4RLHA 3DC2A 1EDZA 3H9UA 3IMFA 3KYDB 3JQ7B 1Z82A 3BTOA 4UVHA 3EUWA 1P1IA 3TOXA 3U4DA 1ENPA 4HKTA 2HRBA 4CMJA 1LRKA 1LSOA 4ILKA 2W2KA 4NBRA 4N54A 1WLYA 3PTZA 2VTEA 3TPCA 3U09A 1R15A 5JCJD 2C20A 3NGXA 2FR1A 3UH1A 3IOYA 1LDYA 5A1TA 4CODB 1LRJA 4YCAA 5AYVA 3WGZA 2VRCD 1DC3A 3GA0A 5A4DA 1E5QA 1T2AA 3EGOA 4H3VA 1ADGA 3EK2A 1MA0A 5DP1A 5ICMA 5I7EA 2R2GA 3PYLA 1NP3A 2DTXA 4F45A 4ZQBA 2JD2A 2YHIB 1LA2A 1O0SA 3CMCO 4IDFA 3I4CA 1SEPA 8ADHA 1BXZA 1MUUA 2NQ8A 5DT9A 5HRUA 1I30A 5JNLA 3WGYA 1ZXBA 3PGJA 4GX0A 4YR9A 3TFQA 1A7KA 1NX6A 1YJ8A 5BT9A 4MIYA 4XDZA 1YL5A 4WEQA 3ZWVA 1VL6A 1KEUA 3G0OA 1E1NA 3WFIA 1K6XA 5ES3A 1NQOA 4IJWA 2BELA 3OA2A 4E4YA 4JJGA 3U4HA 1SCUA 3Q1LA 4WCFB 1YB4A 3P19A 4RORA 5C37A 2HQ1A 2Q45A 3S8MA 1Q0QA 3JCZA 2I3AA 2IEDA 5JFOA 2YQ5A 2O3UA 4NK4A 2P2SA 2WTBA 1DOHA 1G0NA 2I67A 2YJZA 3IP3A 4AG3A 3CKYA 1JVBA 2OORA 3E8XA 4L75A 3JYPA 1IE3A 2UVDA 4E3ZA 1XGKA 1T2CA 3CUKA 4N7RA 5JLAA 5KJ1A 2FWMX 2Y0DA 1MG5A 2NLOA 4OSOA 5F1KA 3KHUA 1IZ0A 1FDVA 2I99A 2HRZA 2RCYA 3C3XA 4P38A 5TF4A 3ZNQA 4S1VA 4XB1A 2AQIA 4JBHA 5TT0A 4MVJD 4IM7A 4G65A 4FDAA 3LT4A 3F5SA 4NH4A 3RFTA 1ZCJA 3EC7A 1IB6A 1MXFA 3VPXA 1R0LA 1MGOA 3KXDA 3PHGA 5B37A 2EKPA 1F0YA 5THKA 1DRVA 4KQWA 3JQBC 2RHCA 3SBOA 4MOWA 5EJ2A 2CMDA 3FPCA 4IS2A 2JCXA 3KZVA 3PK0A 4MVJF 1DFHA 3AOEC 3I3OA 1DAPA 1KETA 2V65A 3ANNA 1P74A 5B12A 1E3IA 4J49A 1QV7A 2NVBA 5JW6A 3RBVA 3U62A 4GKBA 5A06A 2YYYA 1B15A 1OC2A 4A03A 4LSWA 1F06A 3GRKA 3LK7A 4GI2A 2CZCA 1W8DA 2HKIA 3ABIA 1GR0A 2IYPA 3B1KA 3JQAD 4OXYA 3E6AA 1NQ5A 1U4SA 2HMUA 5U9CA 3JQFA 5DOVA 4B8WA 3QHAA 1T2FA 3PWZA 3PVZA 4K26A 5EPOA 3JQBA 1GCOA 3RROA 2EW2A 2HMTA 5T5QA 2QX7A 4OH1A 1PJLA 4XGNA 2O7SA 3GUCA 4XQCA 3PYMA 3I6QA 3H9JA 1Q1NA 3ZWBA 3OHSX 4A0SA 2P91A 4PN3A 4XKJA 4MVJH 3FTPA 3ETEA 2V7PA 2CD9A 4FS3A 2X0IA 1V35A 2ZYGA 3JV7A 1H94A 3NTRA 2IXBA 2AE1A 3DOJA 4UREA 1SB9A 3TJRA 4GLOA 5L9AA 1CERA 5C3MA 3R3JA 1F17A 1MLDA 1X13A 5BNIA 4J7XA 2VHXA 1E5LA 4Q9NA 4NJOA 4W4TA 3X2FA 3Q11A 3IAHA 4PLVA 4YDRA 1Q2XA 2YDYA 4LRTB 4TRMA 3PJEA 3O4RA 5G4KA 2EWMA 4GQAA 5TJHA 3WICA 3ZN2A 1CRWG 1JKFA 2D5AA 4GVLA 3CSDA 3KSUA 3FCOA 1JU9A 4Z9FA 3WMWA 2PA3A 4O6VA 5U4QA 5C7IO 3NUGA 2Y0EA 2YDXA 4IY1A 3VPFA 4GBJA 4BNHA 1PJSA 3GK3A 1GFSA 2W4QA 3HFSA 1YDWA 2ZYDA 4E13A 2BI8A 3WGIA 4J7CA 5TQVA 3WGQA 4XEHA 2VUUA 1EUDA 1VI2A 3VVBA 2GSDA 1P0CA 2CDCA 2H63A 1I33A 1MX3A 4P8RA 4RJTA 4CMKA 5I9LA 1T26A 2QZ9A 4HY3A 1LLCA 1ADFA 3WNQA 5L51A 1X14A 2D59A 5I8ZA 1B7GO 4D45A 2C5EA 4PIVA 2PK3A 3AUAA 4IZHA 5G0TA 3INGA 4KUHA 2OL4A 1I3LA 2F00A 4ZQEA 2EW8A 2VTDA 1A5ZA 3AM4A 5HBRA 4IDAA 2HMVA 4FJ1A 5CHEA 4P22A 1U3UA 1YO6A 3QY9A 3LC1O 5EESA 2E49A 1EVJA 2W2LD 4OSPA 3LT2A 1HE4A 3PRJA 4YJDA 1LNQA 5A03A 1I2BA 2CDAA 1UUFA 1P1JA 2O3RA 3F47A 3GFGA 4W99A 4CLRB 1LLQA 1UXHA 2I66A 4NFSA 2FP4A 4DQUA 1EQ2A 1T24A 4PG4A 2UYYA 1O94A 5G0WA 3RJ9A 3UW3A 1NVGA 1EK5A 1YB1A 1W73A 4TVOA 1XA0A 1KY4A 2OP0A 2JFFA 4PLHA 4OJNA 3RWBA 2ZIZA 2Y99A 4P4NA 4CM9A 1T1RA 4TQGA 2RAFA 3A1NA 1Q7CA 4IS3A 3V5NA 4GH5A 3PZBA 1U5CA 2EHDA 3VZRA 2DBRA 3INRA 1IZ9A 4HBGA 2Z1MA 3E1KA 2Y0CA 3OQ1A 3ZW8A 4BS9A 1UR5A 4RPHA 5CDUA 5EERA 8LDHA 1MFZA 2O4CA 5ENDA 3JQGA 4K6FA 4BNMA 4MIEA 2XPCA 3TSCA 4PG6A 5TS3A 3BIOA 2DC1A 3L0DA 1M6WA 2P5YA 3GG9A 4DGSA 3FI9A 4E21A 3ZHXA 4QECA 1PQUA 1U7HA 3JQAB 3TZ6A 1JAXA 4OAQA 2C7GA 3OECA 3PFFA 2YV3A 3E9NA 2JJYA 5CDYA 1GCUA 1VKNA 3AUTA 4DLBA 5JYDA 4BQRA 2B37A 4DYVA 4YJHB 2AE2A 1GPDG 4WLFA 3ENNA 4QFCA 3AUSA 2I3GA 5H82A 4B4VA 1SB8A 1VJ0A 4CJXA 3WR5A 4QO7A 3M1AA 1UDCA 1H5QA 5KIAA 4RDHA 1B8VA 1HXHA 3JQEA 3DAPA 2NSDA 1DLJA 3JQ6A 1ONOA 3WG9A 4IIUA 5B4TA 3KYDA 1Y8QA 2Q1UA 2X86A 1LU9A 5TRTA 3AUUA 1UDAA 4IJVA 3H7AA 4NHEA 5DCWA 1X7DA 1Z45A 4DLAA 5IZCC 3GFBA 3Q9NA 4JROA 4OL9A 5AOVA 1UZNA 5AXBA 1HZJA 1LBEA 3H2SA 1FDWA 2YY7A 1H9BA 5IF3A 1JVSA 2P4HX 2F1KA 1FDUA 2JHGA 4Z0TA 3D3WA 1KY5A 4Y6SA 1HYHA 2R6JA 3NEPX 2G0TA 4LMPA 3OP4A 3QWHA 3FNHA 4FC7A 5H83A 5CDGA 2HLPA 2VWQA 4PLCA 1Z7EA 2RIRA 3OEWA 4N5LA 4JGBA 1DFGA 2VHYA 2PGLA 1PS0A 1ARZA 5IXYA 1OC4A 3O03A 4DA9A 2PH3A 4ONEA 4HUJA 3AFMA 5A02A 4YEDA 4GKVA 1U2GA 1NASA 1N1GA 2W2LA 3GAZA 1P1RA 4TRJA 1IPEA 1DJQA 5IN5A 2GN6A 4MKXA 2Q1SA 2X0NA 4TKLA 2BHLA 1KOLA 3WXBA 2Q50A 1ZJYA 5F21A 1U9JA 1EZ4A 1SOWA 1WW8A 2JL1A 3ETDA 4M54A 4M86A 4XWYA 1QYDA 2QRKA 1KEWA 3FTNA 2ZKLA 4HADA 1O8CA 3QLJA 2O50A 4OOEA 4RVSA 4BKQA 4E2XA 4OHUA 3TF5A 1QYWA 4MKRA 3ZWPA 3H5NA 1Y5MA 3CMMA 4XYMA 4EJ6A 1T1SA 3RIHA 1HE2A 1YKFA 2R00C 5JCJA 4Z3DA 1ISIA 3BMOA 4KOAA 2J8ZA 3NYWA 1SO8A 3ASUA 3ORFA 4J4BA 4EEZA 3UHAA 1Y81A 2DBQA 4EUHA 2FY8A 4MVJG 5JXWA 5EQDA 5EINA 2E82A 1GZ4A 1QKIA 4MIOA 2DUUA 2HCTA 1I8TA 1ONPA 3S2GA 5C7LO 1U8XX 1P9LA 4LVUA 2O3QA 5GZ6A 4E33A 4QXMA 3MJCA 4BNVA 5L4LA 2Y67A 3RBXA 3TFOA 3DMTA 4RZIA 3VHRA 1WP4A 3ZW9A 4A5OA 1J4AA 4BHTA 5A5FA 3QVTA 1KVUA 3ANMA 1ZSYA 3V1YA 3C1TA 3VH4A 9LDTA 1PL7A 3DZKA 1HLDA 2PH5A 3ST7A 2D8AA 4WOKA 5BNTA 2A35A 3PDJA 4IXWA 2Y68A 1BRMA 3RUCA 1I0ZA 3F5QA 4WCDA 4BB5A 3LT0A 1FK8A 3EVTA 5TX7A 3TZHA 4CMIA 5KOIA 3GQVA 2H6EA 3Q6IA 3STHA 5CDTA 1LDNA 3RJ5A 3W4JA 3DBRB 4Y8VA 4WLEA 4IMPA 4BNNA 3AWDA 1Z7BA 3D64A 2VRCA 3C24A 5G0SA 3RKRA 3TZCA 3VZPA 4D3FA 4BNGA 4R4JA 1E92A 1SZJG 4J2OA 1AXEA 4R54A 2LDXA 4YWJA 2VCYA 1X0XA 3TOZA 3CINA 5CEJA 4EITA 3U4IA 3KOUA 3S55A 2QQ5A 1XG5A 4Z0HO 3P2YA 2NNLD 4BNWA 3I4FA 3QA9A 1HSOA 2HAEA 3DQPA 3A28A 4IDCA 3MOGA 1O95A 2DKNA 4M55A 1AGNA 3EY4A 4C7JA 1SNYA 6ADHA 3GG2A 2D0IA 1Y1PA 4EDFA 3PPIA 4FFPA 4NZ9A 3WB9A 1LQUA 2VZ9A 2VUSA 2LDBA 5A5EA 3EW7A 5ER9A 3DAGA 2NTVA 1H6BA 3GZ4A 4YA6A 3AI2A 1BHSA 4XDYA 4E2YA 5JSFA 1AN9A 4XZ3A 4JXKA 5HS6A 1PGOA 4W7HA 1DB3A 1U2DA 3JQAA 4PCVA 1MC4A 3GVIA 3DO5A 2VWGA 3DTTA 3JYQA 4RVFA 5CPFA 3TRIA 2GUGA 2NU6A 4UULA 4R16A 4B4UA 3A06A 2ZJ0A 4OQYA 1NHWA 4YT8A 3GY0A 1O9BA 3LDHA 3LC2O 1JKJA 1VKOA 2ZCVA 4CQLA 1O6ZA 3K6JA 3LZ6A 1ZUD1 1TXGA 3BMQA 3D4PA 3C1OA 2ZB4A 3E03A 4B7UA 2B4QA 4DUPA 3HE3A 3GVPA 5KVSA 3JQFC 3DOOA 2O3JA 4CR7A 2OO5A 3SJ7A 3QE3A 1F8GA 3UVEA 1WZEA 1C0PA 5B4UA 4U0JA 4NPCA 3GUYA 3ONEA 1N7GA 4Q3EA 2AG8A 3OEYA 4I08A 1JAYA 5ER6A 4CQMB 2R00A 2VOJA 3DWFA 1HF3A 2NVUA 2YV2A 2O23A 3AU9A 4BO8A 4WLNA 1BW9A 4FSHA 1NTOA 4PRLA 4O0LA 5LDGA 3ICCA 1HETA 5L53A 3HADA 2J5QA 2O3SA 2ZTVA 4U0KA 1HDGO 1Y9EA 2FSSA 5BSHA 4QFDA 2EXXA 3K2BA 3QWAA 4ZVVA 5TSDA 3ZWMA 3DHEA 5CEEA 5J23A 4E0BA 5A05A 3HDJA 1QP8A 2XOXA 3DMTC 3NGLA 5GZ1A 2O2SA 2P9EA 2X8LA 5BQFA 5I9MA 3GPDG 3VKVA 1FDTA 4ZRMA 3K9QO 5T57A 3K31A 5EL0A 3SC6A 2CDBA 2HMWA 3RUAA 4BKOA 5B4VA 1Z6ZA 4RLSA 3WTBA 3G3EA 2WDZA 4GX2A 1ZSNA 5G4LA 2JCYA 1KVQA 1SBYA 1GD1O 1J6UA 4CQMA 2BGKA 1ML3A 2G82A 3WMXA 3LT1A 1PSDA 1ZW1A 3AI3A 4A10A 1PX0A 5H81A 1YXMA 1UP6A 3W4IA 1OMOA 1ISHA 1H9AA 1ZBQA 3D5QA 2Q46A 1DRWA 4YAGA 4WUVA 2GR9A 1ZK3A 3DBHA 3ROPA 4XQGA 1O5IA 4KDFA 1HTBA 3NT4A 5JDCC 2WE7A 3WQRA 1I3KA 2GDZA 1BW9B 3KVOA 1IPFA 1QYCA 3KV3O 3NTQA 3DFUA 1B8UA 2ZTMA 5L45A 1N92A 4HWKA 4D79A 4F46A 4B3JA 2BLLA 1MB4A 1F14A 1W4ZA 3RI3A 9LDBA 5K0ZA 5KVCA 1ZZEA 3I5MA 2ZB3A 2X0JA 3OIFA 5KNLA 3KYCA 4UAGA 2FPIA 4ALKA 3ETGA 3W6ZA 3B1FA 4IZIA 1KVRA 3D0OA 4MVJI 2D5CA 2CVZA 2YHIA 4RO0A 3ZV3A 4E5KA 4OXNA 1GUZA 4ALNA 5GMOA 4WE3A 1KC1A 5JYEA 2P68A 2VUTA 4BGEA 1WVGA 3Q3CA 4Z6KA 3D1LA 4E6PA 4JK3A 4ND1A 4DPLA 1PQPA 5CFZA 1VE9A 4LISA 4YAKA 1QYXA 4G5HA 4YRDA 3ZWAA 1I36A 3BMOB 3IUSA 4OMUA 4DWVA 3JQ8B 3VVCA 2PTGA 3GNQA 1PS9A 3C7CB 4ITUA 4NBTA 1QR6A 2Y1CA 5FYDA 4FQ8A 2ZCUA 2EIHA 3CEAA 3FWNA 2C59A 2DVMA 3ENKA 4FR5A 3UXYA 1RPNA 2PZKA 3AY6A 4XCVA 2WWRA 5JDIA 7ADHA 3PFWO 4R3NA 1B3BA 1WPQA 3C7DB 3PYXA 4B79A 5CPBA 1CEQA 3DEYX 1CETA 2DBVO 3DZFA 3FRJA 4YRAA 3L07A 4B7XA 3OIDA 4BNZA 1BVRA 2I5PO 2OUIA 4J16A 2AMFA 3HHPA 4MDHA 1G1AA 4URFA 4IQ8A 5KJEA 3WDSA 1C14A 4BMNA 3DBRA 4CLHA 1FXSA 3KLMX 3PLRA 1C1XB 1JTVA 2QRLA 1UDBA 4FGSA 3MJSA 4I9NA 4D0RA 5L7YA 2X0RA 5KVVA 5LDHA 3IL2A 5G4KB 4XX0A 1E3SA 4N18A 1L1FA 3BMNA 1XR3A 1ZH8A 3WLEA 3FF4A 1HE3A 2YV1A 3AM5A 4D42A 1V3TA 1SAYA 4QUKA 1P44A 1XIVA 3F4BA 1D8AA 1DEHA 4KUGA 4RQUA 3RU9A 1DIAA 5L7WA 5JDIC 3PXXA 2D4AA 1XEAA 4XGIA 4J9VA 2J5RA 2Y1GA 3IIEA 4RL6A 1TI7A 3L6DA 3DXFA 1HYGA 2G1UA 5IFLA 1VPDA 2OGUA 5FFFA 2UV8A 4XYLA 3GPIA 3ZU4A 1B2LA 2DAPA 3WJ7A 1EFKA 1LSSA 1EVIA 2G76A 1ZK0A 1K6IA 1T4DA 2Z1NA 3QSGA 4NFYA 3T7EA 2GN8A 3AFNA 4BKRA 5DDIP 4CR6A 3L4SO 3PHLA 1ZK2A 1PQWA 4OYRA 1DIHA 3JTMA 4Z9YA 4IQ0A 4TKMA 3O9ZA 3M6IA 1MXHA 2IODA 1K0UA 4R51A 4B7CA 1YE3A 1NQTA 1PGQA 2B4TO 1GZ6A 2VYVD 4BNJA 1NM5A 1DJNA 4GSLA 3OBBA 2ZTUA 1FJHA 4J1QA 4JP3A 1CQIA 5JS6A 4Q3CA 4PLFA 1T4BA 4PLTA 2X7HA 3LF2A 2FMUA 4GMGA 4QEDA 1V0JA 4XJTA 3H9EO 4LN1A 3FR7A 5G0VA 3BA1A 2JCVA 2Y1EA 3H8VA 2ZB8A 1TT5A 3P5SA 5DZSA 4ZN6A 3ONDA 2JFHA 1P31A 3Q2IA 3VAZA 1PR3A 4LGVA 4NG5A 3T4EA 1EUCA 3B6ZA 3OF2A 5IDXA 4FCCA 4WOJA 4U5QA 1Y8RA 4LW8A 2HDHA 2WMDA 4PGFA 5TT1A 1HLPA 3OETA 2YFQA 1SEVA 3V1TC 3AJRA 3QP9A 1U3TA 4YT4A 4O63O 5KWEA 5A3VA 2OP1A 1ISFA 3H9GA 1I2ZA 4NJMB 2ZB7A 4D7AA 1QG6A 4P4GA 1TEHA 2DT5A 4AJJA 3ROQA 2A94A 3ITKA 1DRUA 1C3VA 5JCXA 1HEUA 1LC3A 2IXAA 4CMIB 2XXBA 2Z5LA 4I5FA 5DBFA 4UUPA 1DLIA 1PIWA 2HMSA 1WNTA 3I83A 1N9GB 4L4RA 4AFNA 3EZLA 2JKVA 3FWZA 1X15A 3CZMA 3T4XA 1E1LA 4W82A 1YL6A 3NDRA 4OIMA 4CLOB 3IQDB 2NTNA 2FRDA 4O5OA 1IHXA 1LDMA 4KZPA 2HO5A 4JX8A 4L4SA 1WDLA 3FR8A 4GVXA 3RKUA 3UICA 3H9QA 2FZEA 4C4OA 4WLUA 4YJGA 3LLVA 2DLDA 1GUFA 1A72A 1KYQA 1L7DA 3MJVA 3OMLA 5C7OO 3L6OO 1ENOA 2GPTA 1A4IA 2QYTA 1EEHA 4H7PA 2X23A 2Y05A 1GL3A 3L77A 4M49A 2C7VA 4II3A 3C8MA 4UEKA 3UFXA 4TMFA 3WGHA 1XYGA 3BTVA 4R69A 1NQAO 2GZ1A 2X22A 3QVXA 1Q0HA 4D0SA 2B4RO 3ITDA 1L7EA 3GGGA 3S2EA 4FJ0A 4YRBA 1UAYA 2E4AA 2EF1A 4EUEA 4B3HA 4DMLA 2Q1TA 2BF7A 4YT5A 1N7HA 2C82A 4XYGA 4MPDA 1Y6JA 4TZTA 4W9NA 1GV1A 4BMVA 2Q4BA 4NBVA 1NHGA 1YBMA 3ZWOA 3ZWNA 2NVWA 3GVCA 3SC4A 3WX0A 2J5KA 1D4FA 1KC3A 1YBVA 5DP2A 1NPDA 3VTFA 3GLQA 4A26A 3R0IA 1PJTA 4LSMA 1S6YA 4DQVA 5ILGA 3MJTA 1GU7A 4BKPA 1WZIA 4P4LA 1E7WA 2BMAA 2YQ4A 3VPHA 3HFGA 4M89A 2V6GA 4DVJA 1UP7A 1XSEA 4LMRA 4HX5A 3M2PA 1ENZA 4IDBA 4XR4A 5A9TA 3TDKA 3IP1A 4DLLA 4WK6A 3BHMA 4ALMA 1P0FA 3JQ7A 3W1VA 1LSUA 4Q3BA 4CR8A 6LDHA 3IKVA 2Q2WA 2NM0A 4J90A 3TQHA 1XU7A 4NNJA 1MP0A 1ZJZA 1FDSA 3ZWWA 3V8BA 4MP6A 4Z0PA 2IRWA 3QRWA 2X1HA 2CUKA 3V2UA 5KKCA 2BI7A 4QTZA 1NYTA 5F1OA 3ZWCA 1BDMA 1ISGA 3I23A 1YOVB 4I5DA 1U3WA 2VQ3A 3BYZA 3ZNNA 3JQCA 2G17A 1BSVA 4WASA 2HK7A 4EYEA 4DIFA 1N8KA 2Q99A 4RPGA 2PKQO 3NDJA 1M75A 4TRNA 3KO8A 3RUIA 4EZBA 3PGXA 4WCFC 3FBTA 2PLAA 2BRUA 3GDGA 2A9FA 2ILTA 3TZKA 2FPGA 3S1LA 3I6IA 3VKUA 2PFGA 5F5NA 4JLWA 3RSHA 2GZ2A 3NJ8A 2PKQP 5BNFA 1Z75A 4WJZA 4CM6A 3SXPA 1NFQA 5FI5A 4B8ZA 1UXGA 2AQKA 4PG5A 5A04A 2OHXA 4U6SA 4EI2A 3QV1A 1E77A 1I3MA 2BGMA 3DBHB 4IPTA 1VRWA 3EZYA 1NVMB 2NQTA 1GQYA 5A9SA 3WBFA 4IDGA 1ULUA 3PJFA 5COBA 1PZFA 4HFMA 4HFRA 4IXTA 1V3UA 3KBOA 3VPGA 1E7SA 5FEUA 4WCFA 1GTMA 4YJHA 5LC1A 3F46A 1J0XO 2NADA 4MO2A 1K3TA 2VYVA 2DPGA 4CLEA 4WKGA 4B3IA 1ZMOA 1DIBA 5EN4A 4CV1A 2C2XA 2PV7A 4CUJA 2QYSA 3AOGA 3ZV5A 4L73A 4YQYA 1Y8QB 4N5MA 4YJFB 4YVFA 4DC0A 2W98A 3AY3A 1YGYA 3HQ4O 1XU9A 4OM8A 2XF8A 2TMGA 3GZNA 4GMFA 4INAA 4EEXA 3I9JA 3GGOA 4ID9A 4RVDA 5IN4A 4BNUA 4I5GA 4CLXA 3DTYA 1UJMA 4RPLA 4RZHA 4WLVA 1PZGA 1DC4A 2J3IA 7MDHA 1P33A 4BUCA 4E30A 4AL4A 2ZTLA 5JY1A 4RF4A 3MWDB 4ND2A 1QSGA 2NTJA 3BMQB 3A14A 4UVDA 2Q1WA 3KYCB 5I7SA 1H6AA 1T2EA 4XRRA 1EQUA 2VNSA 3RC1A 1PGNA 3OIGA 1ZNQO 1RWBA 3DZIA 2X9NA 3QVSA 4FJ2A 3N58A 4MVJA 2CNBA 2C2YA 2HUNA 4PLGA 3UAGA 1OBFO 2H9IA 1EVZA 5JE8A 1F8FA 1TLTA 3KEQA 4HFJA 1XDWA 3QJ5A 1XCBA 4HNGA 4PG7A 1XQ6A 2X5KO 5BSFA 1XKQA 4JBGA 3OJ0A 1OZAA 1R0SA 3E5RA 1GQQA 2DFVA 1QV6A 1R4MA 5ILOA 3JD1A 4YXFA 3SVTA 3D7LA 1K5HA 1IHYA 4AJIA 5DCYA 3ZU3A 4CMGA 1VSUA 1PU2A 2QG4A 4IJUA 4J7UA 1A71A 4CMEC 4AJ4A 1YVEI 4BVAA 2Q3EA 4DIBA 3PHHA 1D7OA 3OM9A 3KEOA 4RDIA 4L76A 1DAOA 3I52A 2VNAA 3H4VA 3I9KA 3EAGA 1DIRA 3KM0A 5DBIA 3WTCA 4EJMA 1IOLA 3UCFA 1WDKA 3BHIA 1X0VA 3K92A 4QT0A 5HS4A 3HZZA 3KB6A 4BNYA 3DR3A 2X9GA 4I1IA 4K9DA 2Y1OA 3HDQA 3UGKA 4DBVO 2WYVA 1GDHA 3VZQA 3EVNA 3QW2A 2Q49A 4CMCA 4GGOA 2YUTA 1AHHA 2EKQA 4GSKA 1U1IA 3N74A 3JSAA 2PZMA 3V1UA 3GN2A 1ENYA 1R66A 4DMMA 2PZLA 4XA8A 1A7AA 4D46A 5KJFA 4XD2A 1LXCA 2EGHA 1PJ3A 2ET6A 3VZSA 2IZ0A 1LQTA 2QIOA 2Y1FA 4MVJM 2OXIA 4O59O 1A4UA 3JQGB 1H2HA 4YB8A 1EVYA 4NMHA 1D3AA 3PLNA 1JWAB 4FFLA 2QRJA 3L9WA 2DQ4A 3WYBA 3GAFA 2QZZA 4PZDA 4YBZA 2O7QA 5JAQA 3G79A 2PY6A 3A4VA 2SCUA 1RJWA 3OQBA 4JQCA 2TMDA 5COQA 3ULKA 4BL5A 1TT7A 2IE0A 3K96A 5ITVA 1XWFA 3WGOA 1AHIA 2CF5A 1SPXA 2ZATA 4YACA 3VC7A 4FPXA 4J4TA 4BO4A 1SMKA 4JP2A 3RUHA 1TB4A 4MVJE 3DZHA 3H65A 5JMPA 2X6TA 4FC6A 4W6ZA 4ZD6A 3RU7A 1LLDA 3IUPA 3JD4A 3LLSA 3OQ6A 2HSDA 4R3WA 1NPYA 3MTJA 5K9ZA 1N1EA 4FFMA 3VTZA 3ZWXA 3IC5A 3O26A 3BTUA 4NJMA 2WYWA 4KQXA 4WECA 3RUFA 3VDQA 1GZ3A 3ONFA 1NVTA 5TC4A 1C1DB 4BKUA 5AQ1A 2PZJA 5IDWA 4JJIA 5DULA 3PWKA 1Y8RB 2ZQYA 5ICSA 1B8PA 2PGDA 3F9IA 4J2HA 1H2BA 3ZU5A 3EHEA 3BHJA 4E5YA 2DUWA 2O2YA 3D3EA 1DC5A 4WGGA 1V3VA 4E5PA 1C0LA 1C0IA 4HV4A 2AXQA 3PHIA 3WGTA 3OH8A 2IZ1A 2VWPA 3U3XA 3ZHZA 1E0DA 4ZQHA 4D43A 5IZ4A 3DFZA 3DZJA 3FPLA 3A9WA 1QXSA 1X1TA 1HDCA 2A4KA 2FZWA 3NX4A 4M8SA 2DTEA 1ZFNA 3GGPA 4BNFA 4O1MA 2Y93A 4JN6B 4FOOA 4D3SA 3RASA 2JD0A 5HWSA 5MGBA 4YYZA 1PGJA 2UAGA 4Q3NA 4TROA 4PZCA 4DIOA 1RM0A 1CIVA 4R1UA 4YJFA 3W4KA 1CF2O 1E6EA 4CM3A 1BVUA 1Q0LA 1ADCA 5KJCA 2HJSA 2OBYA 2D2IA 1HYEA 4CM8B 5DF1A 1JLLA 4PLYA 3LU1A 1UZLA 3SLGA 3ZZNA 4IUYA 1M6HA 1BG6A 2JHFA 4GAEA 3BTSA 5B1YA 4W9NC 5JPIA 5KTKA 1Z73A 2DBZA 3E9MA 1OFGA 4OO3A 3MCVA 1LEHA 1NR7A 4IDEA 4KTVE 2FR8A 4ZHSA 2DTDA 3EYWA 1NFRA 2BFAA 1Y9AA 3PWSA 4BB6A 4AJLA 1PGPA 2VZ0A 3GR6A 4UUMA 4OKNA 5L95A 5EIOA 3GEDA 2EP5A 1Q7GA 4LVCA 1H93A 3UOGA 4YJGB 2NV6A 4J1NA 1E1MA 4R5MA 3H2ZA 1ORRA 4Q39A 1Y7TA 3I9NA 3DDNA 4H15A 3SEFA 5CEFA 2YFHA 1LX6A 4WEOA 2Y1DA 4F3YA 1ISJA 1M66A 4IQGA 2WYUA 1G6KA 4Q3AA 4DPMA 3AY7A 5LCXA 1E3JA 2POQX 3ZH2A 4R1SA 5TJ9A 2ZJ1A 3VH1A 2C5AA 1I3NA 2AW5A 4RCVA 3LSYA 3DHYA 3GT0A 4YAJA 3WJAA 2GZ3A 1NNUA 1UH5A 2AG5A 3OJEA 2NU8A 4QO8A 3MJ4A 4PG8A
chains in the Genus database with same CATH superfamily
1D1SA 1E5TA 4X1YA 4DC9A 5CH8A 1XYYA 4QPCA 4MUMA 3FNGA 1NXXA 2FPKA 2EIXA 3WJ1A 4CIBA 1VB3A 1GGEA 2DPHA 2VPXA 3G2IA 3Q41A 1UANA 4LQCA 1HNZB 2RKBA 4Y2SA 4Q3DA 3K72B 5KTPA 5ESWA 2LGJA 4G4GA 2GO1A 1NRXA 1ZCZA 3QPUA 4HAUA 4BFZA 2Q5OA 3WBKA 1L5MA 3AP2A 2VG8A 4DDHA 3R1IA 4KMMA 5KTNA 3HDYA 2PL3A 2FXVA 1E2UA 2CKMA 3ENZA 1WHSB 4LWZA 4AYXA 3DKPA 2HA0A 3COSA 4YROA 2BFFB 4YP5A 2G9VA 2RB4A 4U6QA 2JCBA 2OBXA 3AVOA 3JD0A 1BFUA 1ATIA 1Y6QA 1U0RA 3UGTA 3OQHA 2NZUG 5HFJA 3O2NA 5BSGA 1KS2A 4P34A 4OXQA 3W8DA 4FGJA 2WNHA 2XRZA 3DT9A 2FPPA 3BILA 2O5RA 2Q6LA 3D59A 2DPXA 2CVOA 2X3FA 1MB0A 1PS8A 2YN4A 2QN7A 3E9QA 4NYJQ 4HSEA 4Q24A 1NXOA 3KKNA 3MQ4A 3U7JA 1U3DA 3DHNA 3G59A 3L7JA 5AIBA 4LJRA 3THYA 4LZWA 4AZVA 2PLWA 3JYLA 1PVVA 2GUWA 5ECDA 1ZNZA 3O8LA 5EWJA 5E6UB 3EMVA 4D9GA 2HA5A 3HKCA 4BVLA 2GBIA 3PEEA 5TPWA 1K86A 3ICOA 1RLOA 3OJLA 5E3JA 1RC1A 2P9ZA 3IQGX 4TMXA 3E5MA 2OCYC 4TGLA 5DNDA 1EFCA 3KPJA 1UINA 4FYWA 3MOIA 5JDCA 4TXMA 3BZUA 1PTJA 1JR3D 1C4WA 4OUDA 1NVXQ 3LRXA 2XDYA 1OCEA 2ZUFA 1N0UA 3A6KA 5CAEA 3KE9A 4PBSA 4L5AA 3MCTA 5D01A 5K3FA 3R7NA 4XGKA 3C14C 3GNLA 2FDRA 1QVVA 4JU9A 3SK0A 2AV6A 3ZQ4A 1NW7A 1DCTA 4Q12A 1ONNA 1U0SY 1JA9A 4U7FA 2GN0A 4JWKA 5CU7A 4YAEA 3U2QA 1IULA 2FPPB 1T29A 3MAJA 4NSNA 5CD1A 1W47A 5KTSA 2ESRA 5FOVA 5K6RA 2ZT7A 2AG0A 2I6TA 3KQNA 2Z58A 4KYUA 3GUVA 4I1OA 2QZPA 4PX2A 1NN0A 1DP4A 3U7FB 4KVFA 5JCOA 3I42A 2ZK7A 1GARA 2KLBA 2BDTA 1MMFB 3LCUA 2V6FA 2D0PB 2FE1A 4FNAA 1UPBA 2FWNA 4DVGA 1WBBA 5EJFA 4RIGA 3GXBA 1T9HA 3CLRC 4LDJA 4MGKR 2I3ZA 2QUJA 2ZR7A 1ZD1A 2I65A 1ODFA 1NMXA 4UFPA 2JLZA 3R3WA 2REBA 1R37A 2RH8A 3Q0EA 2SICE 4MUXA 4G8CA 1VLQA 3I9MA 5KC9A 3NBMA 2LTAA 1L9XA 3CZ9A 2AYYA 3RFVA 4K28A 1ZAYA 3UUEA 2F8SA 3E9DA 2QTLA 3NV9A 3VNSA 1AS0A 3S29A 1LTHR 4E14A 4MR7A 2YOGA 1CQPA 3OF5A 4FKZA 4BZWA 1XDGA 1ZKDA 2CDNA 3FDZB 4OKSA 4Q4DA 1HOXA 3Q9UA 1ZNXA 1ZVMA 2C29D 3E27A 3QWIA 4UEOA 3WYCA 1X7GA 2N3ZA 2D0DA 2CLSA 2J6HA 1ZAKA 2E37A 1KVSA 2QD1A 3USES 3ZDXB 4CIWA 4KR2A 2XBMA 4QHTA 3SJUA 3KCQA 1BS2A 4LWPA 5JAOA 3IUQA 1DHRA 3Q3IA 5LFAA 1NIJA 1YZQA 1XJ5A 2XUIA 3O1LA 3MQFA 1XZKA 1ICEA 3DGFC 4EAAA 1REQA 1MO2A 4CYMA 1N25A 2ISQA 4I4TF 4LHSA 4AU1A 1ECPA 2H1SA 1CB7A 5TMPA 2RE8A 2DULA 1I0LA 5DBGA 2TECE 5DTMA 1M67A 1ZD3A 2HSEA 2MSWA 3PUHA 2QMHA 4CTKA 1ODIA 1PBTA 2J08A 2AG1A 2IXDA 2QDXA 2OCPA 2QHXA 2V1XA 3L7DA 3P9SA 4LQ4A 5J2UB 1P1FA 2W7TA 3R5TA 5IAAA 1ZMXA 1KQGA 1IH8A 2DUNA 1ZWLA 4O4JA 4CUKA 1OBCA 4CMAA 2SBTA 1YB5A 2JD1A 5AVZA 2R8EA 4KDCA 2R6HA 1MENA 4Z7NB 1OYOA 1W36C 3WGLA 3LX8A 4E5NA 4UUBA 3VYRB 3ZVKA 1EJ2A 4M22A 1RJFA 1QIHA 4B4WA 2GF2A 2R4UA 2Y66A 1I4TD 4MLZA 5FA6A 3O1JC 3VOSA 3LWZA 3ER6A 2Q3LA 2GLUA 4PPFA 1PQYA 2ZQZA 4C08A 1J8YF 1GILA 2YYAA 1KVTA 3G5MA 1L9KA 1TUEA 2C2GA 3PGMA 5D2CA 5AJZA 2H9YA 2WHPB 3EULA 3Q6MA 5JAZA 2R65A 2DWQA 3INTA 3ZN2A 3GAMA 5ICEA 4Y3UA 3HXOA 1A9QA 5CK4A 2XD9A 3SSMA 1ACJA 4I55B 4JYBA 5DK4A 1K9SA 2QJWA 3C8UA 3S68A 3X1ZA 2XE7A 1GZSA 2Z3ZA 1Q14A 3GOHA 3I2GA 2GCNA 3P32A 2P2GA 2EERA 3HP1A 1TMGE 3H5RA 3JATB 3K94A 4QXAA 2I9PA 1C9YA 4FYIA 3GEGA 4HDAA 2HJRA 4B2PA 1UJ2A 4ZEXA 2P0YA 1P1CA 3L7KA 3O0DA 2NMVA 4XX1A 4DV2B 1D1QA 2C1XA 3KYIB 3L4BC 3NIDB 2OBNA 4MLPA 3CWCA 3SNKA 1YQGA 3UCXA 4B3TB 1XWWA 2EJVA 5ITWA 2ECPA 1BFKA 3QVMA 3EASA 5DYWA 1KAEA 2ABWA 4EYQA 2XXAB 3OJOA 4UTXA 3NNSA 1GAEO 4RU1A 3NEAA 1ZBDA 1QGOA 3WK5A 4HR7A 1N1DA 3SM9A 4U8GA 4LOAA 4H1VA 4ENRA 2PQ6A 5KQRA 3B8HA 2GF0A 2HPHA 3KEFA 4IMJB 2WTUA 2A0YA 2AFIE 3RM3A 3LUKA 4RIEA 4ZQIA 4GW3A 4UVGA 2JVJA 3GEMA 1VB5A 2A1IA 3PNKA 5LYJB 2QYOA 2WM8A 1O89A 1KMHA 1LK5A 3JWEA 5ARDA 1UC9A 1XRNA 2YWHA 4J9UE 3RFUA 3SC2B 3ZD7A 4C7KA 4XTRA 2Y9MB 1EZZA 2YVAA 3HLTA 3M81A 4I55A 3G2QA 4GYYA 4LJKA 2AZMA 2ZIVB 4L0QA 1BWSA 1AHNA 4NMXB 5I8WA 4G24A 3E84A 2C1ZA 1KDRA 3B85A 4ZI7A 2CF6A 3GLTA 4ZU3A 4IAOA 2ECFA 5KMGA 3P1JA 4Q3OA 2B1RA 2C61A 3ADPA 3BFPA 1Z2PX 1U0LA 1H6CA 2B25A 4Y1FA 4EB8A 2X5OA 4I3FA 4QTTB 4F7DA 3A2KA 2RG1A 1R4NB 4O4JF 1RRCA 4ZICA 2FUEA 4B2LA 3A7EA 3TTTA 3B9BA 4WACA 4EUSA 1C4XA 1PF7E 3NALA 1P2BA 1CEYA 1VQ1A 1PJ2A 1UJBA 2ZSJA 4H2DA 3KZ1E 4MUIA 3O8QB 4QDKA 3MWEB 4ZVOA 3ZJUA 4BU0A 1UEIA 1XTTA 3HJBA 4U5XA 4BUZA 1C41A 2QM7A 4DV1B 3CX4A 1HUQA 3GRFA 1JHQA 2WU1A 2X8AA 2OZLA 3OM8A 4HNAA 2ONZA 4HG2A 4N0DA 5EJ5A 1ESZA 2VP5A 2R7MA 5HIIA 1LJ8A 2AQ8A 3G49A 1FFSA 4F97A 2YYSA 2ADOA 4HJRA 2NU7A 4RELA 2AMVA 1OH8A 3N2EA 4KQEA 1IY8A 4ROSA 4CPDA 2YICA 4TT3A 1QVZA 4M8NE 3U4CA 4BO9A 2PUTA 1ELOA 4WH0A 2QVLA 3TGPA 2OCLA 2X3YA 2I2XB 2W70A 4W8HA 1XQWA 4K0RA 2EV9A 2FE4A 2MSEB 2NO9A 2ZZMA 3JWJA 1CY4A 2A5JA 3DXYA 5EMHA 4LRQA 2UXBB 3GROA 3X2EA 1NU8A 1ZGHA 4HS4A 3DAFA 1QYVA 1YJ5A 3U7IA 1KY2A 4Q7MB 2WD7A 4N01A 4KP7A 3CZ5A 3RRXA 4DDKA 2NO0A 1F51E 3E3NA 4NBWA 5BOSA 3B52X 3GRVA 1QOPB 3GLFB 2UUOA 3AW8A 1F0NA 1VE1A 1HFKA 1LWNA 5TQJA 3C5WP 4DRYA 3I0MA 3LCCA 2R97A 9MHTA 4FZJA 1N3YA 1XVUA 2AEMA 4PHHA 3AFHA 2DG2A 5AKJA 5MDHA 1RXVA 2PGAA 2QRZA 4HDSB 3GVHA 1LTKA 3KRTA 4N5HX 1R0BA 4FYVA 2W2PA 4GM0A 4P83A 5EIFA 4EQZA 2FEPA 1CK4A 4CFYA 3M6WA 5BYAA 3QVOA 1S2MA 2VPPA 4BIIA 4XOIA 4BNKA 5ELXA 3WSVA 5JPCA 3D8SA 1OHHA 1A82A 4CM4A 4AMBA 4NCKA 3DMGA 4BX0A 4N8DA 2CXHA 4WLOA 1CLUA 2JGNA 3URKA 3HNPA 5EEGA 3WGGA 4B6FA 3LW7A 3G0IA 4Z4CA 3EEIA 3NETA 4B71A 1PD1A 3FZGA 4RKQA 1V16A 3B8EA 4BECA 1AA6A 1H1LA 3L4KA 5D8DA 4U7PB 3FRHA 1T36B 3GVXA 3K9LA 4B43A 3RUDA 3AERB 4KZKA 4IWXA 3C41J 1Y4UA 4KH0A 4ZAZA 2JAPA 3COYA 1X1EA 2VH2A 3DL2A 4GXRA 2WI8A 3ZDQA 4YIHA 3N39C 4HFNA 2BY4A 1RTTA 1GGMA 1LDEA 1JDBC 2JGJA 3DZGA 3UMYA 2WJ6A 4ZEWA 3B7GA 4LMBA 2PIDA 5KX5A 4MV4A 4GNRA 5BN3A 1XZAA 5LOVF 3VM6A 3EVCA 5JT1A 4YMSA 4NBUA 4YP1A 1NNI1 1CT9A 3LYLA 4RD6A 3U4AA 5I9NA 3KG2A 3HK2A 5GZ3A 4DPKA 4YIKA 4R7ZA 4CVNA 3ENVA 4CTJA 3E9YA 4ZTZB 3CEMA 3F1KA 4V0OA 1A8IA 1TYAE 5JOQA 3FDFA 3PIIA 4OYYA 1IPHA 1P2SA 1BA3A 2GS9A 4ZFNA 4D41A 1KZ6A 2WEKA 3GEHA 4LOHA 5DCUA 3NJ4A 2XKKA 5DB4A 1HRDA 4PXAA 3HYTA 1QHEA 4WXPA 2F4VB 4UBKA 5KKAA 3HTXA 3F3KA 1I4OA 1QCCA 4EO9A 3I0ZA 3SYMA 4G9GA 1YRLA 4FGWA 1L4BA 4P32A 4KJXA 1D5CA 1QO0D 1D6SA 4YCLA 4GQIA 5ALWA 5SY6A 4UE2A 4BLQA 2BKAA 1Y1RA 4LXTA 4RQTA 3M3DA 1JT2A 2A14A 5F7XA 4RULA 2HBZA 1A1SA 1Q3HA 2WYOA 4D8WA 2P6OA 1ISMA 5TGZA 3A1TA 3E3AA 1CQXA 3HVHA 4A0HA 3TO5A 4IJKA 3IQZA 3OP1A 2O4UX 3NS7A 4D74A 2GZDA 3NT2A 1E3LA 4FMCF 5AM0A 2DHRA 1WBDA 4KR7A 1JQEA 4GSYA 1C1XA 4WA7A 1C7FA 3AM3A 2RHRA 5ERGB 1XDBA 3VSCA 1Z7YA 3WLJA 4IJQA 4O4HF 4X54A 1RQ7A 4N7JA 4CLDA 2O8DB 3DS8A 1HSZA 4RPKA 3PSAA 1O97D 4IVPA 3SR4A 4HLUA 1NW6A 2IU3A 2B36A 4EG5A 1UZMA 4RGBA 3BMCB 3F9RA 3SYNA 2ADFA 4CV0A 4XDGA 2I1QA 2G5GX 3HB1A 4FWBA 2OZPA 4OG2A 5JXGA 3T5PA 4OXXA 3HCEA 2QPOA 3N9IA 3ND5A 1L5RA 1U0HC 4L85A 4CE6A 4JKIA 5TNXA 1FRNA 3ZXYA 4J1SA 3SLKA 2M6SA 3I04M 1FP1D 2QMOA 1G8AA 3QQPA 3TUJC 3EPRA 2HA7A 3WYNA 4ZCMA 1PL0A 1TCBA 4MS1A 5BQPA 1CZLA 4WY5A 2JIRA 4V03A 4Y2VA 4AJKA 3AJDA 3KB1A 1WVIA 5L3SA 4RSMA 1UXKA 5JG7A 3HB5X 1DWOA 4UPVA 1GA4A 4CF3A 5AM4A 4GDMA 3Q3EA 4LDAA 5IUNC 2IA5A 1EE1A 3EARA 3PEFA 3D6VA 3CVVA 2CVHA 3RABA 2E6KA 1VHWA 3AL2A 2I87A 2A5DA 3GN1A 1NVEA 1VSQA 3A8TA 3NHJA 4HLUC 1OFHA 4FYMA 5TIIA 1RXCA 1BC5A 5HRAA 1OI7A 4L5BA 2AFHA 4JYCA 5EFOA 3AF6A 1WO8A 4BRZA 4C0JA 1R8QA 2CLHB 2J4FA 5AW4A 4ZALA 3F4LA 2Z8XA 4C7VA 1FJXA 3MTAA 3U37A 4F7WA 4PC6A 4J3FA 1UBEA 2JGKA 2ZT8A 3QBJA 4MKFA 2W5UA 3FGZA 4L2IA 2AR9A 1ECGA 2CVQA 2WC1A 1TVMA 3FIUA 1EBBA 3ICPA 1OILA 3JZIA 2XNSA 3FNRA 4PAWA 1EUCB 2BEUB 2LKCA 4RKYA 1E9AA 1COZA 4JI5B 2FMTA 5AXDA 3ZIAA 2ZKIA 3UMJA 4YMHA 2ZS9A 3D6JA 3QI7A 3T34A 1E32A 1QH8A 1EWRA 1QFSA 3MN1A 1OBOA 2DERA 3O1HB 4EZEA 2ON6A 4GLLA 3RYTC 2QXTA 4Y2GA 4GPAA 4G1CA 3TIGA 4E31A 4MRMB 4XVRA 3VDNB 5K09A 5KQPA 5JO0A 1DAHA 5K6AC 1D1PA 1USIA 3RREA 1GA6A 1C7IA 4IHJB 2ZIXB 4C04A 4F06A 2FLVA 4DB4A 1GKUB 5KDLA 1XVAA 3KAKA 4EL5A 3UMVA 4KRGA 2V54A 4EM6A 1WCIB 1RM3A 3K32A 3IDZA 4PWYA 2GCGA 3PQEA 2AZTA 3CIOA 1V9LA 5M04A 1LUAA 2QMZA 3RUPA 1U0OC 2AR0A 1MIHA 1J06A 2B4YA 1QHNA 2VRBA 4CMEA 1JBQA 3OWXA 2YTZA 1GQRA 1IEWA 4D8UA 3RHTA 2AI1A 2UZ1B 3S99A 3PFBA 4AKEA 1KHHA 1GPJA 3PUYA 1J2JA 3CN7A 1AZLA 4RFSB 4C43A 4CM5A 4RHYA 3WFZA 2H07A 2GD1O 3EFHA 3LDAA 4ENUA 2XTJA 3CU5A 3QEKA 1XD9A 3NVAA 1QPGA 2J09A 5CG2A 1EZ1A 1ZHFA 1FTQA 1LCIA 2B8EA 4CL3A 4M1OA 2BPOA 3DTVD 4J43A 4NCNA 5K6AA 1M33A 1UXIA 3H87A 4YGXB 4EFMA 2BL4A 1QFYA 3I72A 4CLOA 2VHWA 4JBXA 5IBPA 2B2CA 1HFEL 1BIFA 1UOQA 4WPGA 4IUCS 5DHQA 3HG7A 5C1DA 3NEJA 4K1XA 5L4NA 1OKKD 2J4CA 4L02A 2BBOA 2DR2A 3S1SA 3N8GA 4QE3A 3HVIA 4QNMA 1TK3A 4S0ZA 3RS0A 3SKVA 3AEZA 4RNDB 3LZCA 1R9GA 3CLKA 2NVUB 3NYQA 5EKXA 2CHFA 4QAJA 5DBOA 3JQ8A 3OJFA 1M34A 2ISCA 4K9MA 2XVYA 4YC7A 3H4IA 3MCWA 5MN6A 2P5TB 1LSJA 4EI8A 4HUQA 1UK7A 4CNBA 3AOEA 2ZJ6A 2X8JA 2UKDA 1BMDA 4XYBA 1O0BA 3IIMA 3ZK7A 4YREA 2I3DA 4BLOA 4K9PA 1W6RA 1L4UA 3LAWA 5ADHA 2FPSA 1T4CB 1MQ9A 2PQMA 4BQNA 4PZ0A 1VCOA 4QUGA 5HW0A 1RRGA 5A2GA 3OCXA 3P9PA 1HE5A 1IL0A 4PIMA 4JBIA 4RY8A 3L8CA 4UEWA 5L4SA 1NPTO 5CM8B 3RS5A 1SC1A 1QBKC 2VYQA 1U3GA 1XELA 4Q4AA 4UCFA 4B3MB 5H9WA 1M0TA 3EGIA 2ATXA 5HA5A 5HJ2A 3PQ6A 4HLNA 4Q4CA 3KXLA 5EGSA 5BW4A 3DCNA 1XA4A 2BGUA 3UUFA 3KT3A 4JLBA 1GYPA 1I51A 4V3CA 5B3JA 1AX9A 1TAQA 3DZBA 1N5LA 4MRVA 4O2AA 1N3IA 3NYIA 3OG9A 1K08A 1D1TA 3HDHA 5CH5A 4XR9A 3T5CA 4DYDA 3AVQA 4RKWA 3WLFA 3REOA 4YV1A 3FHLA 1F38A 2HSGA 2VOEA 3K71B 1V8OA 4M88A 3W6NA 4YMGA 3T94A 1DO8A 3HXQA 4LXIA 1X8JA 1RKBA 3CLTC 1AUVA 3CUWA 3FUUA 3IPRA 4AX4A 2WM3A 1KL7A 3QEBZ 3FKSD 2HPVA 3IKJA 3JRXA 4UW9A 4BNIA 4TZ6A 2UYQA 2ZGVA 1KO4A 2P3SA 3CSUA 5LJIA 5A3JA 1NRIA 3H6KA 4PZEA 4XJSA 3ZPXA 4KWHA 2QG6A 3UJ9A 3LTEA 2CFCA 2Z3VA 2OQVA 3IA7A 1ZU5A 3RNLA 4UBLA 2O8BB 1G42A 3TQQA 2CXSA 1DHTA 3QHQA 2NUAA 5BW5A 2G80A 4CWAA 2A5LA 3UWKA 1F9AA 3H9CA 4AKGA 3IOCA 1Y37A 1U2PA 1NT4A 1IM5A 1CJVC 2HREA 1V2HE 2XLCA 5MFPA 4ZOAA 3TBFA 4GGPA 2PWAA 1RMYA 1IM2A 2AZDA 2LXNA 3JD2A 4PU0A 1SCIA 2ZCJA 5JJLA 2R6ZA 2J9RA 4URXR 3DOCA 4FFWA 3DDZX 3P45A 5FRDA 3ORRA 2P6NA 4REMA 2AOWA 2FVYA 1XALA 1DEOA 1VMEA 3GPBA 2FX3A 5K0CA 1EDZA 1FNDA 1HKHA 1N0IA 1TK2A 1Z82A 3A6GA 4LI0A 3EUWA 5G1OA 1NF9A 1YZVA 1ENPA 1YB2A 4HKTA 4P84A 3VHXB 2F6RA 1IXZA 3I45A 1RCFA 2W2KA 3NIWA 4KGDA 4NBRA 3DLHA 2GWRA 2QX4A 3TPCA 2HSWA 1K75A 4JKYA 1U5BA 3KQYA 3EC2A 1QF6A 5JCJD 2CLOB 4J6EA 2JZCA 1XTKA 4KC0A 4BFUA 3UH1A 4L8GA 1LDYA 2WIKA 5JMOA 3IFSA 1LRJA 1JHVA 4G1VA 4XCXA 2VKQA 4YCAA 4MITA 4HMPA 1VE6A 5AYVA 4YCDA 1U1GA 3K5IA 3O92A 4Q1CA 2F90A 1F9EA 1JXOA 2Y4OA 4DJAA 2IWRA 1L7OA 1AKQA 2X76A 3EK2A 2V5VA 4IVQA 4R0VA 4Y1RB 4BZQA 3L7BA 5FBQB 3RFCA 4B48A 1M1NB 5ICMA 5G3YA 3PYLA 1E9DA 1GT6A 3IAM1 4F45A 1QU3A 1H85A 1OXMA 3GJQA 2EW1A 2WV9A 3QKSA 1SUFA 2I34A 1HURA 2J7PD 1FYFA 5F76A 3DC7A 3QFTA 1D7AA 1P18A 1VI6A 1T3TA 1BXZA 1MUUA 5B2ZA 3KAPA 4KO2S 1YD7A 5HRUA 1GTG1 2WKWA 1WKCA 4ZAWA 3WGYA 1ZXBA 2RKWA 1NUSA 1D6MA 1A7KA 2BMWA 1W2WB 3UK6A 3T9EA 4XPIB 1II9A 1VYHA 3L05A 1YL5A 5ALOA 3ZWVA 5IDXA 4H4CA 3AWIA 4ER7A 1OXVA 1PFUA 1KEUA 4LXQA 3RRNA 3LUHA 5ES3A 1NQOA 3H2IA 5DXAA 1N2CB 5AT1A 4ZVQA 4U2FA 4JJGA 5DW0A 2DQKA 3ESDA 3OX3A 3DMHA 3Q1LA 4KCGA 1YB4A 4EFDA 5ADVA 4KQGA 4ML3A 5K0NA 5C37A 5KOJA 1G21A 2JFUA 1W0KA 1Q0QA 1CE8A 3VPBA 4NULA 1H2AS 5AUNB 4L5CA 1ILWA 3USZA 3HO8A 4NK4A 2WTBA 1G0NA 3M6XA 5IT9A 1AG9A 2YJZA 1NDQA 4HWRA 3U7RA 3SKYA 1FB5A 3IP3A 3JYHA 4B3JA 2WR8A 1Z6AA 5SZKB 3JYPA 1IE3A 2Y0PA 3ZCSA 1VKZA 4Q47A 3IIKA 1SG6A 3ESBA 2H5IA 3MTEA 4N7RA 1SHZA 4XPIA 1KH3A 1YZNA 4JB3A 4OHCA 4ZTBA 5LMZA 1EP1B 2HPZA 1MG5A 3W2IA 2QLLA 3NHRA 3WZ2A 1FQOA 2I99A 3C3XA 5K3FB 5GADl 5BRNA 5FWXB 1KZ4A 1B93A 4LHVA 2WLSA 2MYUA 5KPJA 3G8CA 3MWDA 3I8OA 5ALLA 4G1MB 3JAWA 3F5SA 1ZCJA 3W3ZB 2JJMA 1MNAA 1SVWA 1U6IA 1P9RA 2JFNA 1PEKE 1U99A 4ZMRA 3D0KA 2IS2A 1CXZA 1X7YA 2R6CA 1ZNYA 1MAAA 2FPLA 2E21A 1F0YA 3K1AA 1DRVA 1X9IA 4FLMA 1ECLA 2WAMA 3JQBC 1FP6A 2J3LA 3SU8A 1WV0A 4GS5A 2CMDA 2YOHA 1G98A 4IS2A 5ICGA 4IIXA 5K45A 2Z8YA 1K06A 3PK0A 5DLYA 1Y4SA 5EHXA 2X8JB 3I6YA 4G26A 3I3OA 4CI0B 1LPAB 1T1IA 5GOZA 2YCLA 1V11B 2V65A 1U6KA 5H4GA 5K8JB 3P9ZA 5AH0A 3N0XA 1JFLA 3U62A 4HXEB 3AEUB 1C9EA 5A06A 1Q0TA 4ZAFA 2RBGA 3JASB 2IGBA 4LSWA 4MWTA 1F06A 3GRKA 2XVMA 3MVEA 3V1KA 2VK1A 4RX1A 4GUAA 5I9TA 1ORIA 3ZHSA 2PAAA 4NZNA 3ABIA 3TB6A 2CC2A 5TMDA 3EC1A 4A82A 4B3GA 3B1KA 2Q4OA 1PFKA 2BTQA 3TQCA 3ESAA 3P2EA 4EA7A 4RTPA 2HMUA 1SVUA 2WWTA 1WLSA 4ZXPA 1LBSA 2VBIA 1P39A 3L02A 5ANRB 4L4ZA 3TTSA 4BFSA 4B8WA 3OZSA 5C8YF 1MGPA 2YJNA 1T2FA 3NVKI 4YBRA 1TQ6A 4WBSA 2AMLA 3JQBA 1U0TA 4HX2A 2HMTA 1BJRE 2YY6A 4NMLA 2KMLA 2CT8A 2QX7A 1SVMA 4OH1A 4XGNA 8ATCA 3PT5A 4GMHA 3IV7A 4NE9A 1ZH2A 2DLCX 3ABQB 3BGOS 3R3XA 5CFMA 1PG0A 4S35A 5EMMA 3R7LA 5DNUA 2FH5B 3FCXA 1SD2A 3MCAA 2P91A 3LY5A 3KPUA 3BK2A 4XKJA 3INYA 4D9BA 1Y1QA 4JODA 2GAJA 4DV0B 3YASA 4ON9A 1V35A 5EJIA 2IOQA 2EFCB 1GIAA 2P65A 2ZYGA 3JV7A 1P29A 4GHWA 2HWWA 4LHZA 1Y33E 3REQB 3ZD9A 5DM70 1S8OA 2IXBA 3DOJA 4L07A 5EUBA 3ROFA 3SIRA 4IOLA 2YX1A 3JQQA 1KSGA 5DU2A 5A4IS 1JTEA 3QH4A 4N03A 1N36B 4XUDA 3R3JA 2G36A 4JT2A 3IT2A 3W7BA 1QIKA 3PHCA 5GTDA 3WYDA 1E5LA 2B6NA 3D7NA 2IH4A 5EKSA 3HM9A 3C4JA 3ND6A 3X2FA 5BORA 3THSA 1ZJJA 2MDTA 2Q6VA 2XIQA 1U2DC 4Z4QA 3J7AC 3WLHA 5KVAA 1Q2XA 1PVDA 1ZX1A 4QJ4A 4TRMA 1YZGA 2RARA 2P4EA 3EFBA 4JLJA 5TJHA 4YAKA 2EWWA 3T4PA 1KO1A 2D5AA 3PC7A 1H4TA 1MOSA 1Y1LA 4M9ZA 3EDYA 3KSUA 4MS3A 1MQSA 3FCOA 1JU9A 1XRSB 2PGXA 1RXUA 4O6VA 3QU2A 3N0RA 3NHPA 5LP6F 3SZMA 2Y0EA 2BBTA 1Z4NA 2VDLB 3NQ41 1FNCA 4PAGA 4DR6B 2RJOA 1GFSA 2W4QA 4OYHA 4WWHA 1CNFA 1DXQA 1SHTX 4JU8A 4L8YA 4E13A 3OTOB 3DEJA 4J7CA 4DT1B 4OGLA 4WBNB 2IVZA 2ZRGA 4I4LA 4CKXA 1RXYA 1V4VA 5JBNA 3R3ZA 1DQPA 1P3Y1 2G71A 4RMIA 2GSDA 4Y2RA 1EGAA 1Z12A 5CB8A 2RAUA 3IV6A 3M7IA 4S05A 2QLMA 4UPEA 1P0CA 1BHO1 3A6DA 3C6ZA 3KLOA 2CDCA 2H63A 3QUAA 4GZ6A 1T91A 4HDKB 4MWEA 4KNWA 2GFIA 3LPLA 2XQFA 5EHGA 3R8XA 1SA0A 4YJ2F 4CMKA 1AQNA 1XN4A 4I2NA 5L51A 3DMFA 2D59A 2CHVA 2HDNB 2W6ZA 3H11A 3P0FA 1B7GO 2QTGA 3IUNA 2C5EA 3L7IA 2JFYA 4NICA 4PIVA 5TS3A 4H1WA 1FTNA 1EJ0A 1OJLA 3BOSA 2PK3A 1UOEA 3HVRA 4IXDA 2H85A 4FNMA 1DZ3A 1TA9A 3VR3D 1JFSA 4BVKA 1GZ7A 2DJIA 2F00A 1OGYA 2W6MA 4YPFA 5A4MS 1UXOA 1A5ZA 5FLYA 5AM3A 1KJWA 4IIJF 5HBRA 2CXNA 4E1BA 3GJ8A 3EZ7A 1ZICA 2HMVA 4ZGBA 2IF2A 1Z0UA 4P22A 1NJ8A 2IIBA 2F3PA 1BE6A 1T6ZA 5FI5A 3SJCA 4CIAA 2JH9A 1ZM7A 1M0EA 2PXXA 3QKSB 4UKDA 3LC1O 4ER3A 2G08A 2HL6A 4WZAB 2E49A 1R0RE 3ND9A 4OSPA 3LT2A 2NX2A 1TVKA 2IY8A 4RGVA 5DEOA 3UTCA 4GRDA 5IABA 3AXSA 1OF1A 1MX9A 4ZU1X 3F47A 1W94A 4FGUA 3EJ6A 1XMPA 3AKEA 4DQUA 5EJ6A 3AF4A 3DVLA 3COWA 5FUVA 4L50A 3CO0S 3U9SA 2V3CC 4OBBA 2JAOA 4DA8A 2CZQA 4B6RA 4KAJA 5ELLA 2PSEA 3QU9A 2VJLA 4J0DA 5EJ8A 3HKEA 4F4IA 1MPTA 2C7PA 1RPZA 1KFBB 1OW3B 4HMQA 4M0PA 5L3QA 1YB1A 3VHQA 1OV4A 3N8IA 4M7PA 4KWEA 1N6LA 1VCNA 2XAUA 3PF8A 3DOUA 3SNHA 4OJNA 1JEQB 3JZFA 2YZ2A 3P4YA 3LPMA 3HDGA 3ETNA 4IS3A 3UMRA 3F2VA 1KZGB 2BZSA 3W1EA 3T7KA 1CDZA 1QK3A 2EJTA 1IZ9A 3ETHA 3KT6A 2ZUEA 2RHHA 2Y0CA 3OQ1A 4U2BA 4Y2JA 4BS9A 4RPHA 4YX9A 5JNWA 2G04A 5AM2A 5AVVA 1THZA 2B8JA 2O4CA 4ZVKA 3GCWA 2JB9A 5FFMA 3WIUA 1WXGA 5FAKA 1XI2A 5IC6A 4K6FA 1T3GA 4OJKA 1GJRA 1CY8A 4XSHA 5CFPA 3CRQA 3A4TA 1RQXA 1YB6A 1TRHA 3IVAA 1DT3A 1N5RA 3TW4A 3EVDA 1EU1A 2BFCA 4UTVA 1T4MA 2JASA 3FI9A 4KXFB 5IYZB 1FP7A 2QK4A 2IKSA 5FPSA 1JXAA 1U7HA 3PTLA 4PGGA 3TZ6A 3L49A 1JAXA 7REQB 1WOYA 1KGSA 1FX0B 4KFRA 1NI4B 1W1WA 3TM4A 2OLJA 2VSXA 2JLSA 1GCGA 2JFPA 2ZJ2A 3D8UA 3SIWA 3AUTA 1PKEA 1ZVQA 2I6SA 3HI4A 1CIJA 1NN5A 3BJMA 5JYDA 3TIVA 3NIFB 2JPDA 1D4OA 1E89A 3LGSA 4E11A 1SCJA 1J21A 5FWYA 6ABPA 3WKEA 3FOZA 1AUXA 3TX2A 1SB8A 2ZFUA 3ILVA 1VJ0A 4CJXA 4OQDA 2XQKA 3DE5X 1CJBA 3ESZA 3M1AA 2CNLA 1QO9A 3SHTA 3SYRA 1URPA 1U02A 2F1RA 2VI5A 3JQEA 1V9CA 4QBIA 1G63A 3DAPA 1QH1B 3K16A 4WZBA 2AI2A 4C2TA 5F9MA 5HF9A 3Q9SA 1ONOA 4JL6A 4D02A 2Z57A 3TEJA 1R0CA 1Y8QA 1I6MA 3KYDA 2X86A 2XRMA 2GM4A 1ZRSA 2PKYX 4PSKA 3WWCA 1OKKA 1UDAA 4ITVA 2CWDA 1X7DA 2C2WA 1PT8A 2TRSB 4OHOA 2O9JA 3BH0A 4D4HA 4QTYA 1GPBA 2NXEA 2HNBA 5AXBA 1HZJA 4OUDB 1HH4A 2IU4A 2YY7A 3H2SA 4E07A 3HXPA 2P4HX 2F1KA 2E5WA 1K3FA 4Z0TA 5CVJA 1OPXA 4UZSA 5CIYA 1KY5A 4UAVA 1RQGA 1RWKA 2UZ1A 4EJ2A 4GG1A 3QMVA 3O94A 4DUYB 1OE0A 2F8TA 3ILSA 4HDNB 2R6JA 4R7TA 3NEPX 3UMFA 5BVHA 5HE8A 2QM0A 3K1TA 3QWHA 3AEQA 2VXBA 3QUCA 4FCVA 3DH0A 5AVKA 2HLPA 1OGJA 4JUBA 5CDGA 1IB0A 2RIRA 3RS9A 2VDRB 1TTPB 2AKEA 2D6FA 1TF7A 3O03A 5BPHA 4ONEA 1Z3IX 1LZKA 4F85A 4CEIA 4D9KA 4EGJA 1GITA 2F1JA 3NP9A 5E9JA 4GKVA 4YPOA 1NASA 1N1GA 2Y1LA 4YP9A 2QENA 2C5BA 5HOEA 3IRUA 2H0QA 2SHKA 3KVRA 4TRJA 3KQKA 5AW3A 3OTHA 4AJOA 3P4XA 1AK1A 1QZUA 1V48A 3WV4A 3HYNA 5G02A 2QEQA 3A1VA 4BQSA 1J99A 3TIFA 1ZH0A 1YCHA 3EF0A 1OA1A 1U7PA 2IQIA 2O2JA 3ZYCA 2OBFA 4WX2B 3T3MB 4DDMA 5F21A 4DJEC 1TJ5A 1U9JA 3EMBA 3VR3A 1QRAA 2JS7A 2BKEA 4DSAA 1WB6A 5KYUB 1CQZA 1ORTA 3GFTA 1I1HA 2B21A 4UU8A 4CZ2A 1CY0A 3GLSA 3LX5A 2XUQA 5D7NA 2XCLA 5DYIA 2O50A 3G85A 1NVKA 3ICVA 5CYFA 4RVSA 4E2XA 1QM5A 3TF5A 5EKUA 3IRVA 2XODA 2I2DA 4IIBA 1A76A 4LTMA 1ZLXA 3CX7A 4Z3DA 2QRVB 4LBVA 3Q8MA 1OT3A 2J8ZA 3GUZA 4J4BA 1Q0SA 4ENTA 1Y81A 4X7BA 4EUHA 3HA3A 1G8HA 3BDVA 4MVJG 3HB9A 4HDQB 1Y9DA 1QKIA 1AZTA 3FVVA 4FEYA 4U39A 4UEQA 1FDRA 5IWAB 5FTMA 5C7LO 3EIEA 3PFGA 5FLKA 2WSYB 1NBIA 5DVZA 4N8SA 2GD6A 1DXOA 1W4LA 5CJJA 2Y67A 3R74A 4BVFA 1V26A 5JZSA 5PNTA 2LCFA 2WSSD 3SR3A 3NC0C 4XWTA 3UT5A 1GNTA 1WP4A 5C1IA 3ZW9A 1J4AA 4N6GA 2GM3A 1KVUA 5KYNA 4FDUA 1X7WA 4CCAA 5KSWB 4MVWA 3RHFA 5FV4A 3D2BA 2Q5HA 3OTIA 3C1TA 3H5OA 3VH4A 1PFVA 2NZJA 9LDTA 3Q8XB 3CRMA 5HE9A 4IEEA 2H4YA 5B7QA 3EPKA 1FW8A 2D8AA 4XPZA 4WOKA 2ACVA 1QH9A 2VDNB 1BRMA 4QXQA 3SHOA 1XO1A 2B9EA 1JPJA 1FK8A 3GFRA 5JQWA 5KOIA 1N0WA 1O6CA 2BDEA 3IVGA 2EDAA 2XDQA 4MW4A 3M3HA 3WBJA 4RTNA 5I6DA 3M4JA 3SAJA 4YONB 2R5NA 3U5ZB 2FRXA 3H0KA 4BMYA 1QU2A 4MW9A 4A8TA 3OCJA 3QKRB 5M5BA 1ZISA 2F8MA 5FBWB 3VX4A 1FTWA 2XWQA 3GH1A 3C24A 2C4MA 3KXKA 3LE8A 4ZC8A 2IP4A 3SQOA 4YP7A 4C0WA 1C7JA 1ECJA 4UFNA 1X8KA 1Z13A 4IIFA 4M1KA 5FLEX 2VSYA 1P81A 3FM9A 5FO1A 4MV6A 1E92A 3W2GA 2WK1A 4IRUB 4KH1A 2PSHA 4R54A 1QKKA 4I9FA 3HI6A 4FEEA 1KSHA 1P19A 2LIPA 4EITA 2ZVDA 2GFHA 3QKIA 2H2WA 5LKAA 3ASZA 1NW4A 3BMXA 3H5LA 5EE0A 3WYGA 2BCGY 3IOMA 4WMLA 1XRLA 4G8BA 1YHNA 2NNLD 4HEA1 3NFRA 3TG8A 3QA9A 4HB3A 1HSOA 4PR3A 2HAEA 4ER5A 4IDCA 4BRUA 4I1VA 4Q3LA 2ZIUB 1EP2B 4C7JA 1SNYA 4JQZA 2D0IA 2QLNA 2O0HA 2ZIFA 3ZLJA 4EDFA 4JOSA 4Z4IA 3AZQA 4IR7A 1OAKA 4UASA 5H70A 1DVRA 4BLPA 5LXTB 3ZJ5A 2ZBVA 2OB2A 3QVLA 3DFMA 5HGXA 2DZDA 5HXAA 4O2BA 4GNKA 2HNKA 1C2TA 4GVPA 4UHHA 5ER9A 1E6LA 1NUQA 2NTVA 3RS4A 3N8NA 2B94A 1DKPA 2BSXA 1H66A 4CIYA 3O21A 4BN5A 1C7ZA 3EQ9A 3K6SB 3ZE8A 4PYIA 2B8WA 3TVYA 4DCVA 4EMTA 1Q5PA 5CT8A 2HIMA 1PGOA 2J5XA 4LX0A 2EU8A 3EPPA 3JQAA 4PCVA 1NSTA 3THYB 4FOTA 3JYQA 1P7YA 1OWPA 3EWAA 3TQSA 2Z9DA 3OO0A 4B4UA 4UD6A 4N65A 4TXLA 4P4UA 1G2IA 2BYTA 3LVRE 1LJLA 3V00A 2FR8C 5D6OA 3LC2O 3VGJA 2DPMA 3GLIA 3S2ZA 1ZGBA 4BWYA 4YV2A 1B43A 1WSAA 4OGFA 3PDHA 4GOKA 3E03A 4R2JA 2C97A 5DWQA 3MSXA 4C7XA 4DUPA 4US2R 1DKMA 2ZRBA 5K0LA 3DOOA 4NOKA 4W6QA 4CR7A 4CGZA 2JGIA 3WB1A 3QE3A 1F8GA 3UVEA 1C0PA 2JZNA 4DABA 3GUYA 2XCTB 3ROTA 1SZDA 4D82A 5FWYB 4M8KA 4Q3EA 3T3OA 3TZLA 3R6TA 4JSTA 1KARA 2J0EA 2D0OB 1JAYA 1QMPA 1U9IA 4RBNA 5ER6A 4ARBA 3AR7A 1EGMB 2VOJA 2IUUA 3DWFA 4PSAA 4E22A 1HF3A 2NVUA 1OX4A 4Q9LA 2HLDD 2PZBA 4HTFB 1CD5A 3TLZA 4AMZA 3AB3A 1L3BA 2MIIA 3M82A 2VP0A 5BY2A 5EVCA 1NTOA 1P3JA 1G7SA 5LDGA 2P69A 5CITA 1STOA 2C8LA 3F78A 3SHFA 1W5AA 2DOKA 3EZGA 5K8CA 5JSQA 1SUAA 2O3SA 5L53A 1HDGO 1Y9EA 4LDNA 4QFDA 1WMSA 4A23A 4ZCQA 2VUIB 2ZG6A 5ALZA 5D5PA