3OSUA

Crystal structure of the 3-oxoacyl-acyl carrier protein reductase, fabg, from staphylococcus aureus
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
246
structure length
246
Chain Sequence
MKMTKSALVTGASRGIGRSIALQLAEEGYNVAVNYAGSKEKAEAVVEEIKAKGVDSFAIQANVADADEVKAMIKEVVSQFGSLDVLVNNAGITRDNLLMRMKEQEWDDVIDTNLKGVFNCIQKATPQMLRQRSGAIINLSSVVGAVGNPGQANYVATKAGVIGLTKSAARELASRGITVNAVAPGFIVSDMTDALSDELKEQMLTQIPLARFGQDTDIANTVAFLASDKAKYITGQTIHVNGGMYM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the 3-oxoacyl-acyl carrier protein reductase, FabG, from Staphylococcus aureus
rcsb
source organism Staphylococcus aureus subsp. aureus mu50
molecule tags Oxidoreductase
molecule keywords 3-oxoacyl-[acyl-carrier-protein] reductase
total genus 81
structure length 246
sequence length 246
chains with identical sequence B
ec nomenclature ec 1.1.1.100: 3-oxoacyl-[acyl-carrier-protein] reductase.
pdb deposition date 2010-09-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3osuA00
4JP2A 1MV8A 1ZNQO 4OL9A 4D0SA 4NHEA 1TXGA 1V6AA 1JVSA 4KQWA 1A27A 1KVUA 2POQX 2EXXA 3ANMA 1JWAB 1M6HA 4DQXA 1C1XA 4BNWA 4H16A 3PJGA 1FDUA 5JFOA 2DTXA 1A72A 2GUGA 2VWQA 1UP7A 3RUCA 4GX0A 4CR8A 5T8KA 1CJCA 3HNPA 3NRCA 1IYZA 1LSSA 4OGWA 4J49A 2W4QA 4CUKA 1P1RA 3MTGA 4R01A 5TT1A 2NWQA 2PH5A 2HRZA 3IQDB 2VUSA 3ASVA 3COSA 3K30A 2Y0CA 4L4SA 4PVDA 1SNYA 5DNAA 4BV8A 5KVQA 4BL5A 5I9LA 1DFIA 4QXMA 3PDJA 2Q2WA 3GT0A 3AUSA 5CDGA 2TMGA 5COQA 3SJ7A 1DB3A 4R4JA 4ND4A 5ITVA 1BDBA 3NYWA 3OQ6A 4DRYA 4E2XA 2PLAA 1MUUA 4GGPA 4HFMA 4BQRA 3WTCA 5U4QA 3B6ZA 3OICA 4ZRMA 1GUYA 1U28A 1KVTA 5T57A 1Y8QB 1Q1NA 2YHIA 3WYCA 2ZB4A 3DMTA 4PLZA 3GEGA 1H6BA 2OO5A 4CM6A 3H7AA 4YR9A 3RKRA 4ZA2A 3Q2IA 5DBGA 1UP4A 1T1SA 5B1YA 4HBGA 2HO5A 1R6DA 2O3TA 2CVZA 4FFRA 1JTVA 2VRCA 3OFSA 4OXYA 3WR5A 3PZBA 8LDHA 3E1KA 1NM5A 4U8GA 3C3XA 2VTEA 4J7XA 2J5KA 4DREA 4Y6RA 1HE4A 4NDNE 3VPGA 4E5YA 4IGFA 3CXRA 1I5RA 4R1SA 4ZICA 1NAIA 1E1NA 2BMAA 3DBHA 3PZRA 3EW7A 1N1EA 3NDIA 5KJEA 4CMJA 5KJ1A 2EEZA 3RU7A 4Z9XA 3U49A 3NT4A 4XZ3A 2O3SA 3FPLA 2EV9A 3ICPA 4XEHA 3RC2A 2O4CA 4D46A 2Z95A 1WNTA 1KEVA 4WLUA 3TJRA 3PWSA 4YVFA 4R1NA 5TX7A 2V65A 4WK6A 5BNIA 3JQ7B 1EVYA 2PZMA 2OXIA 1G0NA 5FEUA 4YJGA 4UVIA 4Y6SA 1EE2A 3TPCA 5I8ZA 1LC3A 1Y9EA 4CQLA 3CIFA 4JBGA 2RBEA 1X1TA 4IQ0A 1FDTA 1IHYA 3MTJA 2D5CA 1DLJA 1HYGA 4KDEA 1I32A 1QYCA 4B8ZA 2AQIA 1XELA 1Q0HA 2NTJA 2B35A 3G49A 3WGOA 3INRA 2FSVA 2QW8A 4D3SA 1ULUA 4FPXA 4FBGA 3VH3A 1H6CA 1U8FO 5B37A 4K26A 2QHXA 1DAOA 4AJOA 1QYDA 3UCEA 3WMWA 3H9UA 5I7VA 2D3TA 1WDKA 2A9FA 4ALMA 5BT9A 1ZEMA 3PI7A 3T4EA 1X7GA 4DIOA 4BIIA 3FD8A 4U0JA 3L9XA 1LUAA 4IXTA 5DBIA 4FS3A 1UP6A 2EG9A 3W4JA 3NEPX 2DFDA 4CV3A 3KOUA 5L9AA 1EBUA 3H8VA 5JC8A 1MLDA 2BH9A 2HUNA 1DRUA 4GVLA 3LDHA 3NDRA 2OUIA 1QKIA 1HSOA 1K3TA 1DIGA 4WGGA 4ND5A 3WQRA 2SCUA 1M75A 3I9NA 3MWEB 3KSUA 2BFOA 4J4TA 3GVHA 4Q3DA 5KVSA 2PY6A 4CLRA 4KMSA 4M54A 1H2BA 4J90A 3DHNA 3GGGA 4IIVA 3WYBA 3PWZA 4AJIA 3CH6A 3D0OA 3JYPA 4AL4A 1K6XA 1GZ3A 4YT2A 4ZU3A 1Y6JA 1GZ4A 1ONOA 2W8ZA 1H9AA 1BSVA 4CM1A 4EI2A 4BO8A 2VHYA 4WE3A 1QORA 3ROMA 3PIIA 5JPIA 1YOVA 3I3OA 3SLGA 3E6AA 1FDSA 1T2CA 1DRWA 4YAIA 4WJZA 4GLOA 2WJPA 2VQ3A 4WPGA 5BSFA 4RVGA 3S2EA 4JX8A 2PZKA 3PRJA 1DDOA 4MP3A 2GN8A 2GZ3A 3WGHA 5AXBA 3LYLA 2B5WA 4QO7A 1U5AA 4BO1A 3R0IA 5A05A 1RYDA 3T7EA 1PJQA 1N9GA 3C1OA 2ZTUA 2FR1A 1CIVA 5CDTA 1ZZEA 2ZTLA 4ZQBA 3VC7A 3QW2A 3GZ4A 4RDIA 1DLIA 1X7DA 1DSSG 3EMKA 1HDRA 2ZJ0A 3PHLA 5MDHA 4I08A 3TOXA 4CLEA 3FWNA 3GUCA 1PGNA 3JV7A 3ICCA 1T24A 1D1TA 2EHDA 2ZTVA 1F12A 2P9CA 3TL3A 3WJAA 3I83A 3OA2A 4IJVA 1Q7GA 4BNIA 4DL9A 3V2UA 5JY6A 4TKMA 1PZGA 5JE8A 4NBVA 5JDCC 2B0JA 4PLVA 4K6CA 2YHUA 3BIOA 3F46A 2EP5A 4NNJA 4B7UA 4G2NA 4QEDA 2FWMX 4MP8A 3ETEA 3L4BC 3OF2A 1SBYA 4R3WA 3WWZA 4WLVA 3PYLA 2FPGA 2O2YA 2JD2A 3RJ5A 3RCBA 4MIYA 4QECA 5KKCA 2PV7A 4RVUA 4RVFA 5GZ3A 4GPD1 3GVCA 2VOJA 2ZJ1A 1GQ2A 2X58A 1E3EA 1BW9B 4FFMA 3RFXA 4OQZA 3ZWXA 1PS8A 1I8TA 4AJ1A 4CR7A 4LMRA 4PN3A 4F6LA 5L4SA 1PGJA 2RCYA 2ZKLA 3FNEA 5DOZA 3GR6A 3PIDA 3LZ6A 2PGLA 5GZ1A 4GMGA 3T4XA 1R4MA 3QSGA 3KSDO 3GPIA 4XJTA 4EZBA 4BKRA 3N7UA 3DBRA 4XB1A 1U3VA 1CF2O 2V6BA 3VTFA 3WFJA 1U1IA 3QWIA 3AM3A 1OOEA 4IMRA 4W7IA 4P4LA 4DPLA 4CLOA 5KVCA 1HTBA 3V5NA 3RSHA 1U2DA 1XYGA 3FNHA 2DLDA 3FTPA 3I4FA 3ETGA 1E3WB 2DC1A 1YJQA 1VJ1A 3HDJA 3MJVA 3Q2KA 5FFFA 5JAQA 4IS2A 3EUWA 3LQFA 3DTTA 2WSBA 5AXAA 5JBIA 1CQJA 3QE3A 3DR3A 3ONFA 4BGIA 2IEDA 1ONNA 2A4KA 3DQPA 2Y1FA 4MKRA 3OIFA 4GL4A 2LDBA 2GN9A 1NQAO 3FNGA 5I9MA 4RF5A 1BGVA 5DOVA 1XQ1A 5KIAA 2H63A 3STHA 4L75A 3UW3A 3I9JA 2YJZA 4LK3A 4OQYA 1O9BA 4PLGA 4PG4A 2Q46A 5TT0A 4RVHA 2O3RA 3GUYA 3H3FA 4E32A 4WLEA 3DZHA 5G0SA 8ADHA 4NBTA 3AU8A 1MGOA 3VZRA 2DBQA 1K6JA 3M6IA 2UUOA 5FI5A 2R00C 4WLFA 3VAZA 1JVBA 2H5LA 3ZWNA 4EUHA 1ZK1A 1O89A 4IIUA 5BSHA 3SJUA 4DLLA 1GPJA 1I30A 2B36A 3PLNA 1YDEA 1EZ4A 4CMIB 4ROSA 3A14A 1F17A 4KWHA 2QG4A 4BO9A 3ZHYA 3LF2A 5T5QA 1E7YA 2I99A 3ANNA 2RHRA 2I9PA 3Q9UA 3VOSA 5ITWA 4ALIA 3RASA 1ISMA 1D7OA 3UFXA 3OQ1A 1YB1A 4EJMA 1IZ9A 4GH5A 1PJ3A 3RUFA 3ZHXA 5L7YA 3WSVA 1Q0QA 3V2HA 2W2LD 2YYYA 2YY7A 3LT1A 3WQSB 1JAXA 4J4BA 2HDHA 1GV1A 1UZLA 5L7TA 3GMDA 5JAIA 3S55A 4UEOA 4CLXA 3I1JA 3D3EA 4E33A 1EUCA 3OJOA 1E6EA 1E1LA 1OFGA 4W6ZA 1M6WA 1EDZA 5IZCA 4N54A 1CEQA 2NVWA 5CPBA 1B14A 1TEHA 3G1TA 4CUZA 5C7OO 3AY7A 1MXFA 4TRJA 4CM3A 4JJFA 1BXGB 3HN7A 3DAGA 2Q2VA 1VSVA 5JYDA 3ZWMA 1LSJA 3IC5A 4MVJE 3JQAB 3W4KA 1MFZA 3PHJA 5C3MA 3EHEA 4UULA 2FMUA 1PGOA 1HL3A 3VPFA 3U4DA 3TDKA 4CL3A 3ZU4A 2D0IA 5AYVA 3HFSA 3JYOA 4ZRNA 4QTZA 4XYBA 3C1AA 5G0TA 5DF1A 3SBOA 1TA4A 3GQVA 5CFZA 3JQFC 3PYXA 4ZQGA 2HK8A 4MIOA 2FR0A 4AJ4A 3WBBA 3FI9A 4C7KA 2P4HX 3WGGA 4HX5A 4LCJA 2IZ0A 3TL2A 3WLEA 3OIDA 4RDHA 2NVUB 3DMYA 1HYHA 3H9JA 1Z73A 4GWKA 3G1UA 1HZJA 4OO3A 1PJBA 4GSLA 4RL6A 1SCUA 4XDZA 4HUJA 1PL6A 4BNHA 3HDQA 5DP1A 3EGOA 1X15A 2B69A 3HQ4O 3FRJA 4ALJA 3UOGA 1R37A 1KVQA 2VWPA 5EQFA 1V9LA 1GUFA 4UAGA 3TRIA 2J5QA 1J5PA 4A26A 3AUTA 4U5QA 5H82A 4UUNA 4BNZA 3FNFA 2DPHA 3KSZO 1LDBA 2VWGA 1XGKA 1NPDA 3JQBC 1Y81A 1ZK2A 3P7MA 2P4QA 4XR4A 3HG7A 5DULA 1CDOA 2JD0A 4BKOA 2B83A 4NI5A 2EP7A 4TRNA 1Y5RA 3IP1A 4GX1A 2QZZA 5ICMA 3B20A 2HMUA 1QYVA 4I1IA 5L95A 5ILGA 5IN4A 4HY3A 3HHPA 2D2IA 2OOSA 5IAAA 2X0JA 3W8EA 3OBBA 4B4OA 4BO4A 1ID1A 4P4GA 3AI3A 4N5LA 4EJ6A 1W4ZA 5BNTA 3QLJA 2OZPA 3EDMA 1C0IA 1IPFA 2PGDA 4H15A 2WWRA 4YJFA 4XX0A 1A7KA 2FOIA 2QX7A 3R6DA 4MVJG 4N18A 4PG8A 1PZHA 3DO5A 4J6FA 4RF2A 1C0KA 1VL6A 1X7HA 1Z75A 2YFHA 2PKQO 3H9QA 2I3GA 3PQDA 1P1FA 1HRDA 5JAZA 3LC7O 4HXYA 2AEFA 3P2YA 3Q9NA 1KEWA 4E13A 1I2ZA 3KYCB 1GADO 2LDXA 4GX5A 4QQRA 3AUAA 2YQ4A 5COBA 5G2OA 1ZIDA 2G1UA 4O59O 1UXGA 4DVJA 3PEFA 4E0BA 3GEDA 2VT3A 3DBVO 1PJ2A 2O23A 1OC4A 2XPCA 1KOLA 3QVXA 1CQIA 4TRMA 4D7AA 2UUPA 3ZU2A 4Z3DA 1SOWA 4I9NA 3PJEA 1C3VA 4R5MA 3H2SA 3PDUA 2PK3A 1RM4A 2RAFA 4NBRA 1V0JA 1W6UA 5JCJD 2Q4EA 1CWUA 2AXQA 4CMEA 1RM3A 4DXHA 3ZN2A 5IJZA 3PGXA 4ONEA 2Y05A 4XA8A 2C2YA 4L74A 4JROA 3OEWA 3ZV6A 3ZI0A 1R4NB 1PJCA 1T4DA 4N5NA 3RAJA 3AM4A 2WDZA 1I36A 1NQOA 4IGEA 1ADCA 5JC1A 3U4IA 3ZW8A 4YJDA 3S8MA 3BHIA 5A1TA 3VPXA 2IRWA 2PWZA 3QY9A 3O9ZA 4GX2A 1GY8A 3DBLA 3GAFA 4BGVA 1YL5A 5A5EA 1PJ4A 3O03A 3EZLA 3GVIA 2PNFA 1O8CA 3IDSA 2H9IA 4LVCA 4YRBA 1P9LA 3TF5A 3DOJA 2BGMA 4B3IA 1V8BA 1JKIA 1E5QA 3SX2A 1BXGA 1J49A 2YV2A 1I0ZA 3QWBA 4LMPA 2GSDA 2BHLA 3UVEA 2IYOA 3DL2A 1EFLA 2J3IA 4J3FA 4A5OA 2PD4A 1T26A 1TT7A 2E48A 3BMOB 4ITUA 5TNXA 4FOSA 3FR8A 3WDSA 4B79A 2EF1A 3RI3A 2C54A 1FMCA 2YDYA 2C5AA 3GHYA 3RUIA 1DC5A 5T67A 3PJFA 3GVPA 3ON5A 3TFOA 1R0KA 1TLTA 1V3UA 3E03A 3NDJA 4GWGA 3D4PA 4M86A 3FR7A 5JMWA 1IZ0A 4JIGA 3LT4A 5JO9A 3DBHB 3F1KA 3QRWA 4HADA 4MPDA 2XXBA 3UKOA 6ADHA 2G76A 2JFFA 2VN8A 1LDYA 3EVNA 1ZEJA 2O3UA 2VUUA 3HSKA 5I7SA 1E7QA 1GV0A 2Y1CA 3LU1A 3TOZA 4J2HA 4YPOA 2OBNA 4FIZA 3H4VA 1ONPA 1LLCA 3HDYA 3JQGB 2D8AA 4LGVA 4LRSB 4UREA 1DAPA 3GHHA 2QYSA 1LRKA 3D3WB 3HFGA 4IY1A 1RWBA 4EW6A 1R4NA 4B3HA 1LC0A 2Y67A 3JQ7A 5KVVA 1PL8A 2CFCA 4L0QA 4L4XA 3JD3A 2X0NA 3PJDA 1KETA 1UAYA 1YS4A 2Y1GA 1DFGA 4ZHSA 4WNIA 2ZYDA 4BNKA 3OQBA 4S3MA 1Q7CA 1WMBA 3JQBA 1U2GA 2C7VA 4ZJUA 2W2LA 2W2KB 1I10A 5L45A 4Y9DA 3TFQA 4EBFA 4EUEA 4AG3A 4IM7A 2ZIZA 3R3JA 2J5RA 4GI2A 3V1UA 5I8WA 2UDPA 3LLSA 4J9UE 4CMGA 1NHGA 1YBAA 4J0EA 1WZIA 3WTBA 3F5SA 3NV9A 4KWIA 4AJPA 4M49A 1QV7A 1U5CA 3DZIA 4FFPA 1R0SA 1P1HA 1ZUD1 2HMVA 2WD8A 3JQ9A 4WASA 5H81A 2PZLA 1H0KA 1P1JA 4TVOA 5A9SA 3CZMA 1KYQA 3BTVA 1GL3A 1RYEA 3AUUA 3S1LA 2GZ2A 3GG2A 3PP8A 3VKVA 4O1MA 3B70A 1BTOA 2E37A 1QV6A 2AA3A 1PSDA 2YHIB 4TVBA 1A7AA 3WB9A 5LDHA 4PLHA 2GYYA 2Z1MA 4PVCA 3JQAA 3K9QO 4Q3BA 1PS9A 4BNNA 3L77A 4Z0TA 2DFVA 2CDBA 3FSRA 1K6IA 3PHHA 2EJWA 4ZGWA 4MIEA 1R4MB 1O5IA 4M8SA 4DMMA 1K5HA 4PLPA 5DP2A 3RC7A 5L53A 2WEKA 4LRTB 3D4NA 4E2WA 1H2HA 1G0OA 3WGYA 2WD7A 2PR2A 4H7PA 5DCUA 4BHTA 5F1OA 4W4TA 5DDIP 2WYWA 4DWVA 2X86A 5EN4A 2JAHA 3MOGA 2YDXA 1CERA 1HE3A 5G4KA 2NUAA 4A10A 5A5FA 1WWKA 3C24A 4P8RA 1O6ZA 1T25A 2BFPA 4URFA 3I6IA 1QP8A 3RVDA 1Z6ZA 1NWHA 2R2GA 2GPTA 3HZZA 1E6WA 2JCVA 4CMEC 1DRVA 2EW8A 2C07A 2J8ZA 1CYDA 4S1VA 4FC6A 4FGSA 1PTJA 2DBZA 3FPCA 4BNLA 2BELA 3AOEC 1A9YA 2DPGA 1W0CA 1T4BA 3OMLA 2Z5LA 1VPDA 3CEAA 3HUDA 4MVJM 1HWYA 4XRRA 5C5IA 3EAGA 1TT5B 5L4LA 2P5YA 2ZYAA 1N92A 1TVEA 2GNAA 3LT0A 2O7SA 3JCZA 3ZW9A 4XKJA 3ZH2A 4PG7A 1AN9A 4Q3AA 3W6UA 3GNQA 3Q1LA 4TQGA 1PGQA 1O0SA 4OH1A 2I65A 2DTEA 1E7WA 7ADHA 3ZWAA 4GMFA 2HAEA 1LLDA 3H3JA 4KUHA 2H1SA 2G0TA 3TWOA 5LC1A 2B4RO 4CODB 1XQ6A 2B5VA 4WCFA 4YB8A 2Y93A 2XOXA 1LRLA 2EIHA 5EESA 1O94A 4NH4A 3MCVA 1F8GA 4CM8A 4CJXA 3OJLA 1M67A 4XIYA 1L1FA 3DAFA 2UAGA 3ZHZA 1P77A 3KYDB 3RFTA 4DC1A 2YV1A 5EPOA 5J23A 1EVIA 3UUWA 5JLAA 3DAPA 4E30A 3KLMX 3NUGA 1OBFO 1X0XA 3GDGA 3BXXA 5CG1A 4FFLA 5F5NA 4BKUA 3CPSA 1X14A 1DPGA 1GPDG 2NLOA 4IZHA 2YUTA 3LK7A 3CMCO 5BNFA 3VZSA 5DBFA 3UICA 4YRAA 2F00A 2FRDA 3GZNA 2RHCA 3H6KA 4YT4A 1NPTO 3HB4X 2BFMA 1YQGA 1GEGA 3CZRA 2BI8A 3BMQB 2HU2A 2FP4A 2VHXA 5JO0A 2I3AA 4FGWA 3WNQA 2C82A 1UUFA 3DZFA 4Q3EA 4IUYA 4D0RA 2UV8A 2QZ9A 1ZSVA 2Z1NA 2Q45A 3RU9A 3OM9A 4PG5A 4UUMA 4RO0A 3UH1A 3C7CB 2EGHA 3CINA 3AY3A 1DIAA 1KERA 2J3JA 3M1LA 1VJ0A 3VVCA 1C0PA 4WECA 4AJJA 1T2AA 1JU9A 2X9NA 5F1PA 1YONA 4CM4A 1P44A 3WJ7A 1D3AA 1AGNA 2JHGA 2V6MA 2NSDA 1DC4A 3L0DA 3VH1A 1U7TA 1I2CA 1XDWA 4U6SA 3RUHA 3SC4A 3U5TA 2CMDA 1I33A 3GRPA 4WOJA 3DZJA 1UXJA 4EDFA 9LDBA 3ZNOA 1MB4A 5A9TA 3B1JA 4II3A 3E9QA 3ZGYA 1QLHA 1C1DB 1CRWG 1F14A 2B4QA 4RPGA 5JY1A 5AVOA 1PQPA 4BNVA 4BMVA 2DQ4A 4CR6A 3VDQA 1R15A 1ZK3A 3EZYA 3ASUA 3QIVA 1T2EA 1YL7A 5BSEA 5I9NA 1SC6A 1UDAA 2DBRA 3NGXA 3UXYA 4LN1A 3FHLA 5CDSA 3PFFA 3D3WA 2IXBA 3QVOA 5FF9A 3FTNA 3ITDA 1ZO8A 2IE0A 4PLTA 2P9EA 1SMKA 4A7PA 1YBVA 3G79A 1C1XB 3E5MA 3KO8A 1S7CA 4YYZA 3WOHA 1FF9A 3LVFO 2JKVA 1GZ6A 1K2WA 5ENDA 2G82A 3W1VA 3P19A 2CVOA 5G0WA 1KBZA 3MJTA 3OJ0A 4GLLA 1T2FA 1SEVA 2ZB8A 3K96A 4MOWA 1NFFA 1YJ8A 1GU7A 3O8QB 4YJGB 4RJTA 1X13A 4QSMA 4IDFA 2X6TA 2VOEA 2CF5A 4RV9A 3DZKA 2IDZA 1P45A 3BTSA 2VYNA 2W98A 2X9VA 3H5RA 3GA0A 3KTDA 1GYQA 2DM6A 4FSHA 1ULSA 4G65A 3IUSA 1M2WA 3SXPA 1B15A 1HLPA 1KEUA 2NTNA 4HFRA 3ZHBA 4MKXA 5B12A 2Q1SA 4ILKA 1XR3A 2Q1WA 4RQTA 2X0RA 4Z6KA 3GAZA 4YT8A 1Y8RA 3U09A 3HB5X 1DJNA 3BZUA 3OA0A 4E2YA 3N58A 4J4HA 1HETA 4XQ9A 4CLRB 1F0YA 1VLLA 3JSAA 3ITKA 5TS3A 1Z7BA 1IULA 2ZB7A 1BHSA 4CQMA 3MOIA 3JTMA 2EKQA 4CV1A 3KEOA 3FN4A 1LXCA 1R12A 2CUKA 3ABIA 2UVDA 3H2ZA 3OHSX 5JNLA 3BA1A 4XGKA 1KEPA 3BHJA 3ZNPA 1EEHA 3O26A 3PQFA 3X2EA 4DIFA 1E77A 1PR9A 3TQHA 5TQVA 5EJ2A 4PFJA 5KNLA 1Y9AA 3IS3A 4IMPA 2HCTA 1FDVA 2OP1A 4I5GA 2HK7A 2VZ9A 2Q1TA 1IB6A 3MZ0A 5JAMA 3QWFA 3JD0A 1XU7A 4FN4A 5A06A 1PX0A 3OECA 1MA0A 4MP6A 1M76A 3ADOA 3H65A 2DTDA 4JQCA 5A9RA 1JKFA 1QYXA 1D4FA 1VJTA 2NM0A 4XRGA 1A9ZA 1UR5A 4L73A 3UCXA 4DA9A 4BB5A 1QR6A 1C0LA 4JBHA 4JP3A 5KKAA 4JBIA 4NFSA 1U8XX 3H5AA 5CDYA 2V6FA 4JLWA 4TKLA 3AU9A 5TF4A 5MGBA 2C2XA 1B8UA 2OORA 4WOKA 1Y5MA 4YAJA 2QRKA 4CQLB 2O50A 5ER6A 3DBLB 4RORA 1KVSA 4XQGA 4KUGA 4PZEA 3TZQA 4OJNA 2PD6A 1UDBA 4IJKA 1HZZA 5A03A 3GN1A 4QFCA 4L9RA 1LDEA 1EVZA 2BI7A 3AI1A 3JQ9C 3PFWO 3EY4A 4ALNA 4J0FA 3D64A 4KZPA 1DOHA 1QG6A 4ND2A 3H9EO 1QYWA 2VRCD 1EQUA 1DO8A 3ONEA 2NVUA 3IKVA 4MVJD 1R0LA 1P33A 1T1RA 5HBRA 2PKRA 1PR3A 1RM0A 4FJ0A 4G5HA 1U3WA 2JL1A 3R3SA 3DZGA 1PIWA 1ZK0A 4R3NA 3OH8A 1ZKMA 4FC7A 3ROKA 4CMHA 2RIRA 2ZQYA 3NAQA 4IQ8A 1U4SA 4R41A 4W99A 5DCWA 4B4UA 1KY5A 5IXYA 1LSOA 3DFZA 3IAHA 3N74A 5A3JA 4TRRA 1ENYA 3I9MA 3KUXA 2PA3A 4IQGA 4KP7A 1FXSA 3U3XA 2AQ8A 4CL8A 4HV4A 4L8VA 4Z3KA 1LBEA 3LC2O 4PZDA 4OXNA 1O95A 3GEMA 1N7HA 1U4OA 5FYDA 5G4KB 3ZCXA 1I3KA 1WW8A 4HP8A 3L4BA 4QX6A 4XDYA 1JW9B 1DJQA 4JJIA 4X54A 1EDOA 5LDGA 3NT2A 5CEEA 3M1AA 1OAAA 3SC6A 2GGSA 3E5RA 3KRTA 5LCXA 1NYTA 4CV2A 1S6YA 1ZW1A 3AOEA 2NU7A 5JSFA 5KJ6A 1ENZA 1PQUA 5EIOA 5JDIC 5TRTA 4CM5A 4E12A 3VKUA 4ZD6A 2A94A 4J91A 2DUWA 3Q11A 1LDMA 1V35A 1ZXLA 1LA2A 3FWZA 4FQ8A 2HQ1A 3AWDA 3VH4A 2CF6A 3L6EA 1AHHA 2V6GA 4J1NA 4Z0PA 4BKQA 2OMEA 1DC6A 1VL0A 2C5EA 1E5LA 4LW8A 2F1KA 4NMHA 4Q39A 2AEMA 3O38A 4Z0HO 4EEZA 3TZHA 4PRLA 3ONDA 1MXHA 5GMOA 2X0IA 3NJ8A 4JXKA 3PXXA 2ET6A 1PWZA 4WCFC 3RC1A 2QIOA 4E31A 1Z82A 4BNJA 4CQMD 3CE6A 1IOLA 3G0OA 4M89A 1DHRA 3WG9A 3U0BA 1E6UA 4AJHA 4UVDA 3HJAA 1XKQA 4CM8B 2FZWA 5IXSA 2WM3A 5F1KA 3D4OA 3MJ4A 1E7MA 3ROQA 2WMDA 4YEDA 4UUOA 3M2TA 1N9GB 1WXDA 3Q3CA 5A02A 2C29D 1PGPA 1UDCA 4ND3A 4YAKA 1EQ2A 4K1LA 1GCOA 3WLFA 1U3UA 5CG2A 1B0AA 3INGA 4WEQA 4M87A 2H6EA 1VI2A 1GFSA 4Y98A 1YH3A 5L40A 2E49A 2WE7A 2DAPA 2D5AA 3C7DB 4MVJP 3EK2A 1H5QA 4A27A 1ZJYA 1GYPA 2HRBA 2VYND 1N8KA 2IZZA 4BNYA 2FSSA 4A73A 4D44A 5IDQA 4E21A 4RLSA 4R54A 3GVXA 4R1UA 1Y7TA 3ZWOA 4ZN6A 3WGIA 1QSGA 3TZKA 1IUKA 1G6KA 1DIHA 1E1MA 2FN7A 2AE2A 2IODA 5EQDA 4XD2A 4AFNA 4E4YA 1IE3A 3I9OA 4I9HA 3RROA 3HWRA 2RH8A 4E2ZA 2X22A 1PJLA 4HKTA 3NKLA 5U1PA 4W9NC 3ZWWA 2EERA 4AJ2A 1F06A 5F21A 3UHAA 3ZWYA 1PZFA 1MX3A 3KM0A 1JWBB 4AJLA 2EW2A 2NNLD 4BS9A 2EJVA 3JQ8B 4E6PA 2IZ1A 2C7GA 1UH5A 1AXEA 2R00A 3E8XA 3V2GA 4TWRA 3EVTA 4G81A 3B1FA 3UN1A 1JQBA 4JCOA 3BTOA 2ZATA 2CDAA 4BO7A 2VRBA 3RC9A 3S2FA 1DFHA 1P74A 2GD1O 4QT0A 2I5PO 3RBVA 4D3FA 1ZVMA 3IIEA 5U9CA 3VZPA 3AW9A 3RBZA 3DXFA 1W8DA 4BNTA 4R68A 1YVEI 1ZH8A 4XYGA 3ZNQA 1YBMA 4J1TA 3DBRB 1YRLA 3R1IA 3F4LA 3JD4A 1Z45A 4IINA 1VRWA 5ICSA 3K8ZA 1AE1A 3GC6A 5TSDA 5H83A 3VZQA 4FD3A 5A4DA 5A9SB 4YCAA 1GCUA 1LX6A 4CM7A 1NTOA 3GFGA 4JN6B 4XGNA 1P1IA 3JQGA 4E5PA 1BMDA 1E3WA 5K9ZA 2ZYGA 3UGKA 2RH4A 1NR7A 1I3MA 3AY6A 3DB2A 3D7LA 1OI7A 1PU2A 1GEEA 1GYRA 4OOFA 5EERA 2NU9A 3ETDA 3GH3A 4MDHA 3MJEA 3QVTA 4I9UA 3NT5A 4J7UA 4II2A 3HE3A 4HWKA 3S2GA 3PTZA 2HLPA 4XYMA 1YKFA 3AFNA 5IDXA 5L3ZA 2X8LA 1M66A 2GR9A 4F3YA 3NTOA 1WP4A 1ENPA 3GF4A 3GNTA 4XYLA 4IXWA 5JDIA 1LU9A 2BFAA 2JCYA 2Y0EA 1NFQA 4DBVO 3BTUA 3DTYA 4XR9A 4WCDA 4E5NA 3L9WA 3L07A 3A28A 4XIJA 4O63O 1A4IA 4YJFB 1E7SA 3LLVA 2E4AA 3KXDA 4NJMA 5ER9A 1VKOA 3OSUA 2GERA 1GD1O 3K73O 2VCYA 3VTZA 4OKIA 1D8AA 2NV6A 1MG0A 5DZSA 1NFRA 2BGLA 5TIIA 4XGIA 4U0KA 4KQXA 1JDJA 4DQVA 2X5JO 2X23A 3QQPA 3IL2A 1Y8QA 3EYWA 4OKNA 4N7RA 4NK5A 1GUZA 1UAGA 1HT0A 3JYLA 2Y99A 4YA6A 3SEFA 3DEYX 4OSPA 1KS9A 1B8PA 2HMSA 3WFIA 1LI4A 4NU6A 3QHAA 4XQCA 4YAEA 2WD7B 1YB5A 1BWSA 2ZB3A 1BDMA 4EEXA 2I66A 5THQA 3I6QA 1QMGA 1LQTA 3WIEA 2NQTA 1TB4A 3BYZA 5T8KC 3PYMA 1DC3A 4N5MA 4BGEA 4B7CA 1N5DA 1SZJG 2DUUA 3ZWBA 5B4TA 4PG6A 4RF3A 3A4VA 1HYEA 3BHMA 1QRRA 4Z9YA 1MC4A 2E82A 3UCFA 1L7DA 1G1AA 2PGJA 1YWGO 4NFHA 5KJCA 1E0DA 2AW5A 1XA0A 4TZKA 1I3LA 1UJMA 3F9IA 3BMCA 1NQ5A 3JQEA 3Q0EA 4Q9NA 4NZ9A 1ISGA 5EMHA 4CUJA 1LLUA 3WXBA 1A5ZA 1RPNA 4Q3NA 2D4AA 3A06A 1J6UA 1ZSYA 4KTTE 1VSUA 4W9NA 2PKQP 5TC4A 2VHVA 2X1HA 4EJ0A 4BNMA 3K2EA 3WGZA 1P0FA 4GQAA 5ES3A 3GPDG 3JQAD 4E5MA 2YV3A 3JQ8A 3W6ZA 1P3DA 3TN7A 5KTKA 5CHEA 5JS6A 3QWHA 4RPKA 1ENOA 1U7HA 5HS6A 4WCFB 4O5OA 3CUKA 4NR0A 3PPIA 4IBOA 5AXCA 4I5FA 3QP9A 2NU8A 4IDEA 4XWYA 1UZMA 2BLLA 5KJFA 3GY0A 3IMFA 3IJRA 2BRUA 4YWJA 4BOYA 4HFNA 4PLWA 1KY4A 2ZK7A 5G0VA 2Y68A 1UXHA 4UVGA 3F47A 4D41A 3GOHA 2I6TA 3ENKA 4UEJA 4CLOB 3RUEA 2WYVA 4D3DA 3AOGA 1HDOA 2WE8A 1P31A 4NJOA 3C85A 2HJRA 2IYPA 3GN2A 4MO2A 1VC2A 3D1LA 1NNUA 3BMOA 1WLYA 2NTVA 5CPFA 1PEDA 1K0UA 4ALKA 2W90A 2YFQA 1PWXA 3MWDB 1GQYA 1WPQA 4FJ2A 4CMBA 3BMCB 3WQQA 1BVUA 2GZ1A 3RJ9A 4YXFA 3CTMA 4BQPA 1HF3A 2AEJA 4QFDA 3PWKA 4CM9A 1PJTA 2E6UX 5DN9A 5JDCA 1JN0A 2ILTA 4TMFA 4J1QA 4AJEA 3WGTA 3G17A 1V3TA 4AJNA 4DPMA 3PLRA 3DOCA 4OMUA 2NU6A 4MVJA 4YBZA 3FCOA 3E9NA 1AUPA 1GDHA 2OHXA 4CQMB 3GFBA 1HLDA 2O48X 3L6DA 3I9KA 3PQEA 3A1NA 4OHUA 4TSKA 4WUVA 2JHFA 4RZHA 4BV9A 2VYVD 1EUDA 1LJ8A 1R66A 1TT5A 3K2BA 4B8WA 2JJYA 4PLYA 4D45A 5T6BA 4DIBA 5K6AA 5KWEA 3AI2A 2TMDA 1LNQA 1UXKA 1B3RA 3BMNB 3NJ4A 5DCYA 1Q7BA 4GBJA 2G5CA 1ZCJA 4RPHA 1I24A 3D5QA 4KUEA 3DFUA 4R5HA 4R9RA 4NQZA 2HK9A 3KZVA 1RJWA 1HDYA 1NVGA 5CP8A 1LLQA 2AE1A 1WVGA 3QVSA 2X5KO 4EITA 4J2OA 2Y1DA 2J6IA 3WGQA 5EL0A 1FK8A 3MEQA 2JFGA 4WKGA 1XLTA 4YJHA 2GDZA 1W73A 2BKAA 3WSWA 1JKJA 5TLSA 3GGPA 4PIVA 2P9GA 3DONA 1KC1A 4BNFA 2ZQZA 3O4RA 4MVJI 1FJHA 3TZ6A 2DVMA 3QVWA 2BGKA 4GKVA 4FFNA 3BMNA 3QV1A 3W8DA 2W2KA 1KVRA 1YL6A 2B37A 4DGSA 3OP4A 4DLBA 4M1QA 3ZV4A 4NIMA 2JD1A 5HWSA 2JFHA 1E1KA 1T2DA 2A92A 2GN6A 3IP3A 2CY0A 4RPLA 3ZDFA 2DKNA 4YT5A 3JD2A 2VT2A 4R1TA 4B4WA 3VH2A 1A71A 4D79A 4OAQA 4LSWA 4YQZA 5HRUA 1GQQA 1P1KA 1FDWA 1UZNA 4WEOA 2NADA 4NBUA 2GRAA 4CMIA 5JCJA 2Y1EA 1UXIA 4YACA 2I76A 2X5OA 3H5NA 4I5EA 4Z9FA 2VUTA 2WTBA 1B16A 4JGBA 2Y1OA 1H6AA 4GKBA 4RCVA 1RKXA 2VHWA 3KYDA 3GLQA 1VE9A 1B8VA 3ROPA 1ORRA 4PLFA 2Q50A 4QO8A 4C4OA 5CAEA 3KB6A 4BKPA 5B4UA 1TI7A 4YDRA 3WYEA 1B7GO 1IL0A 3L4SO 3ANLA 4UEKA 4BB6A 3L6OO 3RQSA 3ZU3A 1IHXA 3C1TA 1ZJZA 4ZQEA 3P2OA 1NR1A 2X7HA 4Y67A 3M2PA 1ZXBA 4BNXA 4OXKA 1ARZA 1HDXA 4O0LA 5B4VA 5EINA 2CSUA 3JQCA 3F4BA 1SO8A 4J9VA 4JK3A 3ZU5A 1Q0LA 2Q2QA 1LSUA 3ADPA 1N1GA 6LDHA 2EWMA 1C1DA 4RVDA 2XF8A 4C7JA 5BSGA 1I01A 2DU8A 4QUKA 4Y6PA 3U4CA 3DZBA 1EUZA 4RPJA 4IZIA 4J16A 1JAYA 5THKA 1OZAA 5I7FA 1QLJA 4FJ1A 2OFPA 3GZNB 3RFVA 4B7XA 5IFLA 1OMOA 2EGGA 1E92A 1HDGO 1KIFA 1XG5A 2HSDA 2PH3A 1HE2A 1AHIA 1YE3A 5HTOA 3AFMA 3BAZA 4F46A 1WDMA 4K28A 1HXHA 5TJ9A 4KTVE 1NVTA 4BNUA 5A3VA 3ZV5A 2BF7A 1BXKA 1AXGA 5T64A 4FW8A 2JCXA 4K9DA 3NGLA 4FR5A 1LTHR 1BXZA 1WZEA 1Y1PA 4NG5A 4ZQFA 4XCVA 4FDAA 3UF0A 4DTIA 2GF2A 4TZTA 3KBOA 4YTEA 4ZVVA 4NBWA 1XSEA 3VPHA 1H6DA 1YB4A 1X0VA 1MG5A 4LSMA 3V8BA 4GSKA 3T7CA 4MVJH 4RQUA 1J0XO 2GN4A 5G0UA 4KDFA 5IG2A 3KVOA 4WLNA 2P91A 5F5LA 1VL8A 5CEFA 1IY8A 3O8QA 5K6AC 3ULKA 2GCGA 3LC1O 3K31A 2FPIA 3LF1A 4J43A 4OM8A 2C20A 4BO5A 1LQUA 2Q3EA 1SPXA 2NQ8A 4L4RA 4Q3CA 3GRKA 1L7EA 3W4IA 1VKNA 3E18A 1ISIA 4I5DA 1HKUA 1WMAA 4IJUA 1XU9A 1XCBA 4YRDA 3IJPA 1K89A 4W82A 3ZWCA 1B26A 5GY7A 5AXDA 2YQ5A 1V3VA 5G4LA 3AM5A 1E3SA 3RKUA 4NK4A 4IPTA 4F45A 1IPEA 4EGFA 5ENVA 3K5PA 4IDBA 2V7PA 3CMMA 2VYVA 1ISHA 1H9BA 4XJSA 3VDRA 3X2FA 3Q6IA 3SVTA 4NJMB 1SEPA 3KEQA 3RWBA 1NP3A 4PLCA 3TNLA 2C0CA 4NPCA 2QYTA 1VM6A 2AG8A 4UUPA 4BMNA 4BUCA 3I4CA 4WLOA 1A4UA 2Q1UA 4IJWA 3TSCA 3WWYA 4CM9D 4LCEA 4K6FA 3OEYA 3GMSA 1BG6A 3I5MA 3LT2A 1DIBA 4XB2A 1N7GA 1X1EA 1MFPA 2CVQA 3G3EA 2XAAA 3I9LA 4CPDA 2VTDA 4MJLA 3TZCA 2PTGA 5KOIA 4LISA 3I23A 3ZWPA 5HM8A 3DDNA 1BVRA 1N2SA 1LEHA 1YQXA 1I3NA 2GASA 1EMDA 5A04A 5CEJA 4YJHB 2Q49A 2VNAA 2Q4BA 5C7IO 1E3LA 3F1LA 3E9MA 4JJGA 2O4UX 1YXMA 3RD5A 4CLHA 2EKPA 1PQWA 3WIDA 2PZJA 1DHTA 4BO2A 2QRLA 2YZ7A 1HDZA 2AMFA 3DC2A 4IDGA 4DLAA 1ZK4A 1SAYA 5IF3A 4AVYA 2R6JA 4IS3A 9LDTA 3NX4A 3SLKA 1WDLA 4H3VA 4DYVA 3PHIA 2QRJA 5ADHA 4Y8VA 3WBFA 4A0SA 2O3JA 1B3BA 1OC2A 5F3RA 3IKTA 2NACA 5HS4A 2I67A 1SB9A 1NHWA 2D59A 4ALLA 4DPKA 3IOYA 3ENNA 3F6YA 2WYUA 3MJCA 2P68A 3OIGA 1ZMOA 2G17A 3DHYA 4CM4B 4DC0A 2AHRA 3MJSA 1YQDA 5C37A 1BRMA 2PFGA 4RVSA 1EK5A 3KV3O 4J7CA 1F8FA 4EYEA 2HJSA 4IDAA 4RF4A 4HNGA 2XXJA 1NAHA 3E82A 1QXSA 3RUAA 4OYRA 3ZV3A 4IDDA 4A03A 4FFOA 1GAEO 4OIMA 4OSOA 1YGYA 1XEAA 3PHGA 2O3QA 1E7RA 1NVMB 4UVHA 2O7QA 4MVJF 4CLDA 5JCXA 4U7WA 3CSDA 1WAMA 2OP0A 5IDWA 1ADBA 5IN5A 4A2CA 5AQ1A 1XWFA 2HKIA 4P4NA 4ZQHA 3DOOA 2IXAA 2JAPA 3OJEA 3V1YA 5IZCC 4JNKA 3VVBA 3IUPA 3FBGA 5L7WA 2NVBA 1PZEA 2PD3A 4EUFA 2VHZA 2FPPA 5C7LO 2FY8A 4RGBA 1HDCA 3JYQA 4KOAA 7MDHA 1NWCA 2VNSA 3C7AA 4BO0A 5TGDA 2HMTA 4YQYA 3HDHA 3ST7A 1HEUA 3WNVA 4DBZA 4DYDA 5COAA 4YAGA 1NX6A 3GGOA 3JQFA 4TROA 5AOVA 3RBXA 1R16A 1ZBQA 2UYYA 3JQDA 4E5KA 3FBTA 4FCCA 3GNSA 4GAEA 4CMCA 4ND1A 1KC3A 4ID9A 2P2SA 2FZEA 4D42A 3FF4A 1EFKA 4UVEA 1ZSNA 1ZFNA 3AJRA 1J4AA 1EVJA 2CZCA 4L76A 3W8FA 2EKLA 4HFJA 3E48A 3HN2A 1HE5A 3OETA 2HMWA 1XIVA 1I2BA 3RIHA 1H93A 2Y0DA 3PGJA 1LRJA 1EE9A 1PS0A 3P5SA 5TJHA 2J3HA 2J3KA 2ZCUA 4R16A 3NTRA 3KYBA 3GK3A 5JXWA 3GG9A 4XQEA 5DT9A 5L4NA 4HNHA 3KHUA 1GR0A 1B2LA 1C14A 1LDNA 3S2IA 1JLLA 2AQKA 1U9JA 5KCZA 2FHSA 4GGOA 2CNBA 2X4GA 2OGUA 1P0CA 5BR7A 1MP0A 5ILOA 2DBVO 2VWHA 4F6CA 4DMLA 1BW9A 1Z74A 3U4HA 3KETA 4RLHA 1XHLA 3ZNNA 1E3JA 1SB8A 4BGUA 5IDYA 1U3TA 5JW6A 1YOVB 3DHEA 4B4VA 3DMTC 5FI3A 2O2SA 3DWFA 3GDFA 4CMKA 3A9WA 1CETA 3V1TC 4LVUA 2AQHA 1SOVA 2GO1A 2QQ5A 3NTQA 2OBYA 4R69A 1NBOA 4NU5A 1Y8RB 4FB5A 2P5UA 1YDWA 2FR8A 3OJFA 1MC5A 2VZ8A 4IDCA 3ZZNA 1ISJA 3U9LA 1NXQA 1ML3A 4CV0A 3KYCA 5FWNA 2IEBA 3JYNA 3VPSA 3EC7A 1DBVO 3F5QA 1DIRA 4J1SA 2Q99A 4U6QA 4P38A 5JMPA 2X9GA 2CDCA 2ZCVA 4RZIA 1EBFA 4PZCA 3ORFA 3WICA 2ZTMA 2YW9A 4NFYA 3F3SA 3WMXA 3WX0A 5GZ6A 1NASA 1DXYA 4AJKA 1Z7EA 2VZ0A 3KLPX 3QA9A 3PVZA 4AICA 4PCVA 4WNCA 1ISFA 1HSZA 2GLXA 4INAA 4DUPA 4PRKA 3BMQA 1PL7A 2AG5A 5JYEA 3ZWVA 2Y66A 5CDUA 3HADA 3PK0A 3LSYA 4I8XA 4BO3A 2D1YA 1JA9A 4B3JA 3K6JA 2A35A 1YO6A 3AK4A 1NQTA 1E3IA 2BD0A 2DT5A 4CMAA 3CKYA 3WS7A 4GVXA 5K0ZA 3H9GA 4MINA 2C59A 3K92A 3RUDA 1RM5A 1PJSA 3VHRA 1ADGA 1H94A 1ADFA 3D5TA 5L51A 4BNGA 3I52A 4M55A 3QJ5A 4R51A 1ZMTA 4D43A 3B1KA 4BO6A 1DEHA 4BMSA 3INTA 1D1SA 4MKZA 4XYEA 3U62A 4R9SA 2OL4A 4FOOA 4OOEA 3GDOA 4W7HA 4P22A 4PGFA 3QWAA 1Q2XA 3UAGA 4ESOA 1LDGA 4E3ZA 5I7EA 5HA5A 4BVAA 5IZ4A 1NPYA 3JQ6A 2B4TO 2CD9A 3JD1A 4O6VA 3C8MA 4DQUA 1EK6A 5BQFA 1GTMA
chains in the Genus database with same CATH superfamily
4YAUA 1H2WA 1LBQA 1AQIA 4P0TA 1MV8A 2XZPA 3ZXUB 2DLCX 3FA2A 4ZV4A 5CFMA 2XYVA 3LHIA 3E7DA 1J99A 1OF1A 3N9IA 3PENA 3V9AA 1KRHA 2Q6OA 3CZPA 4KQWA 3QELB 4EFKA 3EUFA 1MB9A 2JATA 5JJKA 4WZAA 1BD3A 4DQXA 4F1WA 3SM9A 3DKPA 1XTJA 2GD2A 3QLUA 4S1WA 1XEXB 2VK1A 3KZOA 4CR8A 4FXPA 1TZKA 1MO3A 2O8VA 2VCEA 4FDLA 3L05A 3FETA 1P1RA 1PR6A 3FDXA 3G9QA 2PH5A 1JFVA 4YPFA 3KR2A 5ULLA 3PDCA 4JUFA 2OHGA 1UK9A 2YWHA 4PX5A 4KGZA 5E38A 5LNK6 5E6SB 3SYMA 4UQLA 1E5XA 1FMJA 3VU0A 4CCYA 1U0LA 1KQNA 2W42A 1HPLA 4B6JA 1SNYA 4A0FA 3CC8A 3IAAA 2RKBA 2D5IA 1W5BA 3B38A 3TAHA 3ZK7A 4BL5A 4CKEA 5I9LA 1DFIA 3T5PA 3ZXXA 3PDJA 1AQNA 3N8HA 1NKSA 4RTJA 1Z26A 2HDOA 5E1MA 1EX7A 5D3ZA 4AD8A 4R4JA 3OQ6A 1NW3A 4IV5A 4KV9A 5SZKB 4OLBA 3DV0A 4HFMA 2VYQA 4OI0A 1K8ZB 3LK6A 2NV0A 5A2QA 2R8YA 5D86A 1KVTA 5EIBC 4KFTA 1V7QA 3GZTB 2CNLA 4X91A 2J0UA 1ISRA 1FUEA 1V5WA 1Z88A 2OO5A 1ILWA 1DTEA 2P2YA 3M70A 3UHFA 3UPTA 1I94B 3Q2IA 3QPUA 1TUBA 3QKUA 4X63A 1S01A 5G40A 1UP4A 3OUZA 5B1YA 2B9VA 5KC8A 3IQZA 1SC1A 2BJHA 4OXYA 1JTVA 1IN8A 2VRCA 3WR5A 1J23A 3PZBA 2DB3A 2ZEJA 1O6FA 3E1KA 4CIWA 5D5PA 3THOA 2OD2A 5K3AA 3F6PA 2VTEA 1WD7A 5JCZA 2J5KA 1HOXA 2YN2A 2VDOB 2O2DA 3K5IA 3KU1A 5FLYA 4Y6RA 1AKWA 1HE4A 1RC8A 2W2QA 4PO1A 2QW0X 4IW3B 2PS3A 4K40A 5K8VA 2HZBA 4HGNA 3GCWA 2ES4A 4S04A 2PUDA 1NAIA 2BMAA 3DBHA 2JLXA 3EW7A 1X7ZB 3KC2A 3NDIA 3CKKA 1Y42X 4P3NA 3VGJA 4C3VA 4LF5B 3NT4A 3GGCA 5BWOA 4RY9A 3VPXA 2G8NA 1XZBA 2XQFA 5D3QA 2EV9A 3NCTA 1LFDB 2ZRFA 3ZIAA 1X80B 2FPRA 1OTXA 4GOOD 4M0KA 5CA1B 4GQIA 4KSYA 4NMLA 1ETHA 3S2UA 4D46A 2JFNA 2PMBA 3HRIA 1J0DA 1UC4B 2FX3A 2BEVB 4R7GA 1WNTA 2QTZA 4UU8A 1WF3A 1FB5A 1XT6A 2YOGA 3UGQA 5GJBA 4YVFA 5I48A 2VXCA 4R1NA 3NPMA 3IP8A 4LPKA 4WK6A 3U9TA 1OZHA 2J41A 1BMFD 4HDSB 1AKTA 1ANKA 3RIMA 2VJKA 1G98A 2OXIA 2JKYA 1G0NA 3B3AA 2PA0A 2XT9A 5LN1A 1QE0A 1SURA 2EZ8A 3ONVA 4UVIA 3TPCA 1Y9EA 3W9YA 3ZGVA 4CFSA 4CEHB 4JBGA 3HTXA 2AFHA 3CF6R 1K66A 1X1TA 4L5JA 3NWBA 1O57A 2ZSJA 4GEGA 3MTJA 2D5CA 1DLJA 1ZESA 3WZMA 4AC9A 5A3QA 2XCTB 1FNBA 3EXHB 4MI6A 4NSNA 3PA6A 1K7XB 1M6YA 2HYDA 3SJAA 5HZMA 1D07A 3OMWA 4ND8A 1R0WA 1TKCA 3EBPA 5LXTF 4YCCA 2AQIA 3PFHA 1XELA 1Q0HA 4PPGA 3N7AA 4YALA 5DH9A 2ZIWB 4PX2A 3C3PA 3QQ5A 3Q41A 3PCTA 1OU4A 2Z4SA 3LCCA 3HS3A 2QW8A 1ZITA 4E4RA 5FUQA 1U0OC 1ULUA 2BIFA 2WVHA 1VLJA 3STVA 1QZTA 1I5OA 1VJGA 1CUSA 1PEKE 4RM3A 5JNTA 3DOUA 3ND5A 2JLAA 4PTZA 1SVLA 1W87A 1O97D 1NMXA 3IJ5A 1BX3A 1Z5GA 3V3KA 3WMWA 4EJSB 2R1VA 3PICA 4LFAB 3H9UA 2O57A 5I7VA 3BFXA 2JCSA 1WDKA 4F56A 3O93A 3S8YA 4ALMA 1VXOA 3L0SA 5EJ6A 1GPBA 3L43A 4G5QA 4U0JA 5KCMA 3DAOA 1VHQA 2ZETA 3PC4A 5DBIA 4FS3A 4OIFA 3A4NA 4IZ6A 4XWGA 5FTMA 3SX4A 3TB4A 4YRIA 5HIIA 4QZVA 2HBRA 2IYSA 3O4IA 1FRFS 4HDKA 3IB3A 3KOUA 4M9XA 1T3TA 4YRJA 1TGYA 3PCRB 2QUBA 4PZAA 5JC8A 5L9AA 2UVQA 1DRUA 4F8JA 2D1RA 4GVLA 4DIUA 4DS3A 3LDHA 3TRJA 4E11A 3NDRA 1NL3A 1ETUA 4J03A 2OUIA 5DXFA 2C0QA 1G8AA 1XZ8A 1HSOA 2WPNA 3A9TA 3QLVA 3T5DA 1UK7A 2RHWA 4CI9A 2SCUA 5AW1A 2HIMA 1L8AA 4LXIA 3BCSA 2BFOA 1ZHHA 5A5GA 2IHBA 4V0SA 4B83A 3G2JA 1X7XB 4OJQA 1CQXA 2H3HA 2X8WA 3N76A 4KMSA 4LNHA 2A8YA 1IZ7A 1TQ6A 3IBCA 5FWXB 1GGVA 4UD6A 4OFZA 2AI2A 1XNGA 2V4ZA 3EGVA 3HYCA 1IC6A 1T8YA 3M5PA 2W8ZA 3QUQA 1H9AA 1BSVA 2OWEA 4EQ6B 8ATCA 1E4EB 2C5HA 3CYFA 4D25A 1J97A 1QORA 1NXXA 1YOVA 4TKUA 1I1OA 3IVMA 1EHIA 4U2EA 3LFUA 1T2CA 2F7SA 1DRWA 2FPIB 2Y77A 4GLOA 1UK8A 3M6FA 3H2HA 4KQJA 4QAJA 5AUQA 3X1JA 2A84A 2CHUA 3NHZA 3RIYA 4ZGGA 4YY3B 3QPVA 1Y48E 4WPGA 3IQWA 5AKHA 3ZBUA 3S2EA 1PKXA 3Q3JB 4JX8A 4X41A 3B52X 4FYHA 4D57A 3X3HA 4L6AA 3ASZA 1CRPA 2JLCA 4KXWA 3PEUA 4ZAYA 3HVUA 2GZ3A 2XKAA 3NIFB 5EOVA 3RVPA 3WRXA 3EF1A 2B5WA 1VLMA 4EYKA 6REQA 4YHBA 4DLPA 4C1NA 1C1HA 1FMLA 1YI8A 3J80A 3FM9A 1N9GA 5JFGA 3BHNA 3H5LA 3BZWA 2W4IA 1N8NA 1CIVA 2A59A 2GPNA 3CNHA 4NG4A 1KSHA 4FK8A 3L1JA 3UG7A 3QW2A 4RD1A 3GZ4A 4LWOA 4XFJA 2C3MA 1DLIA 3L4JA 2PMFA 4IIGA 1QHXA 2ZJ0A 2IOHA 2I8LA 2IYQA 1Q20A 2CBGA 3GUCA 3DNMA 3JV7A 3W5IA 3ZE2B 1AK1A 1TCCA 3THYA 2PANA 3PLAE 3E2IA 4NYIQ 2FG7C 3X1DA 4JBXA 1J5XA 4EDHA 3FCEA 2QN8A 2BMEA 4BNIA 3TRFA 1T1EA 1ND6A 1N1MA 5CFOA 2W83A 3TKAA 5JDCC 2H3EA 1H8HD 5E1DA 2CXQA 1RLMA 1Z07A 4GNRA 2HDNB 2QR2A 4K6CA 4PLVA 5KYGA 4JL8A 3M6VA 4B7UA 5MN4A 4MP8A 1SBYA 4R3WA 2RIPA 2UZ1B 3FOEC 4BPBA 1NBMD 3L0YA 4YMGA 1E1RA 1X3LA 5EKTA 3RJ5A 3RCBA 4AF8A 4L8GA 4QECA 1YE5A 1PR1A 1POWA 3AJ9A 4LZLA 1PQYA 2JRLA 2HQBA 3QYAA 1ZM2A 1CG6A 2D8MA 4JSRA 1TKAA 5TQ2A 2X58A 2WINI 2FN9A 4URVR 1CIJA 2Q0QA 1KEZA 1N1DA 4KV7A 1PBNA 2AOUA 3EASA 2I7XA 3HBNA 4LMRA 4TZ0A 1UKEA 1Z6AA 2X6QA 2JFVA 2Q9CA 2H85A 3BH6A 4BU1A 2YYAA 3EA5A 4BTVA 4F3RA 3ZDAA 3QVJA 1Z3CA 1RAAA 3SY8A 2XHZA 3GR6A 1NI5A 3PIDA 3UUEA 5B6PA 3BFVA 1BKDR 1K4KA 3DPUA 4DM3A 1KY2A 1QU2A 2PGLA 3PGLA 5JXHA 5GZ1A 2RGXA 4GMGA 2ODBA 1GUAA 2H31A 1QPGA 3KD3A 4K87A 4LTMA 3QXSA 4A92A 1DO0A 1RC1A 1WCYA 3DT6A 1XVVA 2IT1A 3CX8A 1EBBA 1KZGB 3K9GA 3DBRA 3IR7A 4MIKA 4XB1A 4YCSA 5JPCA 3JVIA 1CF2O 3Q3EA 2NSLA 1U81A 4N7JA 4RNDB 5EMNA 2VC2B 5AW0A 3U4QB 2R751 4PW0A 1QX4A 4IMRA 3LHFA 4EHKA 1FMTA 1EXWA 2IHNA 3GLIE 3CN7A 4PZUA 4OQEA 1HQKA 2P8SA 1HTBA 4GI7A 3N2KA 5BT8A 2VR1A 5SYNA 4EB0A 3I4FA 4ZOBA 4ETIA 5ERGB 1IN6A 2DC1A 2I29A 1CD5A 2BGRA 4O4LF 4S2EA 3HEAA 2CUNA 3NHLA 2A9OA 2VL7A 5DHFA 2GPAA 4DE5A 4BECA 4IS2A 1UJ6A 1Y89A 3DTTA 4RTKA 4GOMD 1WOYA 2I2BA 5AXAA 1AKUA 3WADA 2ONZA 1W0JA 2WZDA 2Y8EA 4TL8A 1FTNA 1Z37A 2REXB 2KHZA 5AI0A 4S24A 4EG3A 2UZ3A 5J2UF 1JE1A 1KQPA 3BK1A 5B58T 2I6QA 4NP6A 1BFUA 5DSTA 1DKUA 3SZRA 2EFJA 2I1QA 1C7FA 2I6SA 2Z9BA 3G82C 2Y1FA 4LV6A 5CYPA 1JTFA 1L5KA 4JWTA 2AG6A 3AKEA 3OIFA 4XE5A 2LDBA 3GLHE 1KU6A 2PT9A 3ZX4A 4HD8A 1NQAO 3EXIB 3I0MA 3HBLA 3CLTC 4WNAA 4RF5A 2G67A 4A0QA 1X7XA 4GS5A 5LD2C 1DWOA 3U37A 3FYUC 3A4LA 3I9JA 2YJZA 5ELMA 2F4VB 3H04A 2F64A 4RVHA 3H3FA 4LJLA 4B71A 1ESDA 3IT3A 4R7TA 2JLBA 5D6OA 5DX0A 4TYNA 5G0SA 2E5LB 1RW4A 1H05A 2XGMA 2YXNA 3MT9A 4IJ6A 5IAOA 3VZRA 4XJVA 3L41A 3M6IA 2G9VA 4PBTA 1UK6A 1UJCA 2R60A 2R00C 4WLFA 3UOAB 2ZRHA 3GUUA 4F4JA 4Y2JA 3HXMA 3EXEA 5NLLA 3TW0A 1WHSB 2DFNA 2AWNA 3CX6A 1NW5A 2XGSA 1RJ9B 3PLNA 4UTPA 5AI9A 1JNYA 4ZQCB 3V4FA 1EZ4A 1JE0A 1DG1G 1BN6A 1V4VA 2JGIA 1DTSA 4TTPA 1MO2A 1UFKA 2O5RA 2ZJ2A 2C92A 3A14A 4UCWA 3DEIA 1SOMA 3RSQA 2ONJA 1JMKC 4TL7A 3LF2A 5T5QA 4LY6A 5JFTA 3WP1B 4PINA 3V4OA 3ROTA 3ROGA 2OAP1 5BSTA 3AUXA 3B3JA 2RHRA 4Q3OA 3U31A 1GLVA 3UV7A 3VOSA 5ITWA 3HDGA 2AN5A 4YX9A 1WZNA 1O95D 3UFXA 1PVVA 2AS0A 3DZDA 4YDSA 1YB1A 5CU7A 2JLZA 1GGJA 1K86A 4AY6A 1AUXA 1IZ9A 1PJ3A 4P82A 4PSAA 1B0UA 3R75A 4Y1FA 4QUGA 1GTSA 1QH1B 5ICEA 1N5RA 2R8BA 2X13A 1JGTA 1J8FA 2ST1A 4HQNA 4PYKA 1V41E 3QE4A 1Q0QA 2Y4OA 1WS6A 4EMSA 3U60B 3M4YA 1FRVA 4RTSA 3JATB 3HSSA 3TGPA 1Z08A 3IDZA 3S55A 1YB7A 3WOVA 4ERXA 4W7SA 2JS7A 2J7KA 3FB1A 3EDCA 3VZCA 3OLCX 3RE1A 3KEGA 4TLDA 1R88A 3OJOA 5D5HA 1MRNA 2G7MC 1E6EA 3BXOA 4RTQA 5DYYA 1QJ4A 1XDUA 4KXFB 4N54A 2GAIA 3VR5A 2R66A 3WGNA 4HH3C 5IZCA 1B14A 4KNYA 2WJGA 1TEHA 2WWWA 3IBTA 4CUZA 2ZUTA 3ENVA 2YMMA 4CM3A 1GSHA 2PT5A 1BXGB 3U3ZA 2JI4A 5F2NA 4MVJE 3DE4X 2ASEA 3OM1A 1I14A 1YIDA 3U3JA 4D9EA 1HL3A 4QDKA 2NZ8A 3VPFA 1C8VB 1ND5A 3G9TA 4CL3A 1KAEA 1SC4A 1SVUA 4XYBA 4EVSA 4UOEA 2Q0HA 4BFWA 4G1FA 1L7OA 1UJ5A 1XEXA 3F2IA 1EX1A 3GQVA 4KFCA 5CFZA 2FJUA 3PYXA 4JYCA 2ORVA 4UATA 5CFLA 3ILYA 1GG2A 2G7ZA 2C4UA 1N0HA 2ZRLA 4MUFA 4B8YA 1PO7A 2B8WA 4Q7EA 1CB7A 5BRJA 3ELUA 4RDHA 3AEZA 1C4WA 1XBTA 2X77A 1V96A 3M1YA 5HJEA 2YX1A 2JDID 4OHKA 5B3KA 4D74A 3WLSA 4XDZA 1L8OA 4HUJA 4B43A 2V98A 3V1NA 2B78A 5I45A 4YI3A 3GRYA 5ITZA 1Y9DA 5CCDA 3GJSA 3MERA 1X15A 2WILA 3U1BA 5FUVA 4DXAA 4RAQA 3T3NA 2OM2A 1KVQA 1V9LA 3I32A 3QXJA 2YYZA 4RA9B 3WWDA 2RE8A 2LGJA 1M0WA 4J0CA 3REQB 2ASVA 3R0QA 4Z1OA 3BGWA 3HCPA 3GFTA 1I2AA 4FQ5A 5MN5A 5DSZA 1VJRA 2QV0A 1YZUA 2Q5EA 3PQ4A 4FT2A 4LYDA 4FYKA 5A4FS 3O1IC 4Q7KA 4POOA 1FFWA 1VGVA 2BTQB 3OO0A 1Z0JA 2FRDC 4I55B 1TF7A 5C5DA 5AJWA 5G41A 3E9DA 2OM6A 3A3YA 3CU5A 4DGQA 5KYWB 4P0QB 1I4WA 1CDOA 1QG2A 3BWEA 4BKOA 1CR4A 3SIRA 1ZR4A 2DQZA 4TRNA 3KVNA 1Y5RA 2P9TA 3VSDA 1IB0A 4JB3A 4GX1A 1FFXA 5MGNA 4S1TA 1TZMA 2QZZA 2XRFA 3FW1A 5E6UB 3W5UA 2A4MA 4LI3X 2WFLB 2QD1A 3WJ2A 3ZG6A 2HSJA 5L95A 1JDPA 2R1TB 1M8FA 1M2VA 2XMPA 5IN4A 5IAAA 1NVAA 2WU8A 4IDHA 5JSZA 2WIJA 3W8EA 4K9NA 4GYYA 1KJZA 4LNUB 4EKGA 1MABA 4JVOA 1H5NA 2QTAA 5JQGB 5IASA 3OEHD 1U3DA 2ZJOA 3I2HA 4KBYA 4KPGA 4LKOA 4XSGA 1RRVA 5AK3A 3AIIA 3A4MA 4H15A 4ZO9A 4MULA 1Z13A 2JFUA 4XX0A 1A7KA 2Q6IA 2H4FA 3E5HA 3K6RA 4MA0A 5LP6B 1VMAA 4DJEC 4RFSA 4HN2A 3H84A 4J6FA 1SHJA 1U2PA 2QW1A 1VL6A 3Q8WA 4RF2A 3H9QA 1H2FA 4ZTUB 2I3GA 1E32A 2NYRA 1P1FA 1HRDA 1KDTA 2I9KA 5JAZA 4B5LA 2ZUWA 4AMYA 5DBHX 4Q05A 3G7SA 4EGSA 4C4XA 5FQOA 1I2ZA 4GX5A 4QQRA 4FNMA 1UBFA 5K8IA 3OEHA 2FRVA 2JIRA 2V54A 4L0CA 1RRPA 4DVJA 1JHVA 4O1IA 5HDQA 3GEDA 2E4VA 3DBVO 3KQLA 1PJ2A 4EHHA 1U65A 4W1RA 3HVJA 3IHWA 1KOLA 3QVXA 4X0EA 4CDMA 4DIEA 3WLKX 1KQGA 2CNOA 3WLLA 3KFVA 3DW1X 2VZEA 1FL9A 3VSBA 3TKYA 3PUYA 1A1SA 2XUZA 2QTHA 4Z3DA 2E6KA 2YC2C 4Z4QA 4C6SA 4XM1A 3ZH9B 1QHNA 2WB2A 3D3NA 3K20A 3UJAA 1VG8A 1E66A 1II0A 4NBRA 1Z8FA 2F1IA 5KTYA 1H4VB 2DWUA 3Q4GA 1KYVA 1T15A 1XMPA 3QJGA 4CMEA 1RM3A 3DEAA 4DNXA 5KNDH 5SV2A 3UK6A 2IVZA 4ONEA 4WXMA 2CBXA 2J09A 3ZKWA 5HVNA 4XOUA 2PX4A 2WTEA 2C2YA 3UPDA 2QM3A 4JROA 3OEWA 3K35A 3TG8A 4Z3OA 3BMXA 3U4QA 1T4DA 3RAJA 3C3MA 3O94A 3ZBQA 1I36A 3C70A 2CKMA 2O8BB 4IGEA 2HLNA 1ADCA 3NANA 5EXTA 1ECCA 4I66A 4EABA 5DHAA 3KU4A 1L1EA 5CCXA 3MINA 4Q37A 5A1TA 1JIXA 3NKVA 4Q12A 1QHFA 1V39A 1VYVA 3O9ZA 4K7JA 3K4PA 1Y7PA 1RMYA 4I19A 1ZC3A 3JZFA 1KFBB 3EZLA 4L0DA 4LVCA 1O8CA 3SHOA 2H9IA 3TL6A 4US1R 1L8XA 1P9LA 3HU2A 3ZDZB 5JZBA 5KYNA 1JKIA 2YIVX 1XZFA 1BXGA 4V03A 1J49A 1CR0A 1Q3TA 2J45A 4GI3A 4LMPA 3U7QB 1XZCA 3HXTA 5J58A 1RD4A 1I7LA 1EFLA 3G2LA 3EC2A 3R6LA 1U94A 4GUAA 4A5OA 1CDEA 2QROA 4CDGA 4YJ3A 5TNXA 3CA8A 5D7BA 2OC4A 1Y5LA 3O90A 3WDSA 1GVNB 2A3RA 4LJAA 1O94C 3GGDA 3RI3A 2E5WA 4GGMX 4N9WA 3FTQA 3HA5A 3VHXA 2YCBA 5CX4A 1DZ3A 2RKOA 4QVIA 5T67A 3PJFA 3GVPA 2JC3A 3FI0A 4MPTA 2HJHA 4C0QC 4OLFA 4MLZA 2JGJA 1NQXA 3JZMA 5C1IA 2NYAA 4K6KA 3HZHA 4BX2A 4QVKA 1II8B 1IZ0A 4BMXA 5AM5A 4DWOA 4MPDA 2XXBA 1HOTA 1YZQA 1U63A 1NQVA 1LDYA 1CUBA 3EVNA 4XXHA 2VUUA 5JARA 5HF8A 3DM5A 4JLVA 3W04A 2B61A 2CB0A 5J5AA 1SU6A 2ISCA 3FDIA 2GPSA 2JASA 2Z30A 3DUFA 3RPEA 4BVBA 5CLFA 1XFAA 1OXVA 2FWIA 1UANA 1PZMA 2WU1A 3JQGB 4HDRB 4HWRA 4YAFA 1Q57A 4ZOAA 4Q7QA 3EARA 4IY1A 5CX1A 1R4NA 4EW6A 4B3HA 2Q62A 4B7ZA 2ZBFA 3JALB 1AGXA 2Y67A 4DG5A 3V8MA 1E1YA 1KK1A 2CFCA 2J3DA 1F5SA 2WC1A 1TRKA 4L0QA 1L4FA 4L4XA 3RV3A 2CZGA 2X0NA 3PJDA 1UAYA 4IQFA 4LUCA 4CQJA 1O97C 1DFGA 2Q8QA 3M9LA 4BVKA 2SKEA 4ZHSA 3NH6A 1P1BA 4H0CA 1P0PA 3TIFA 3JQBA 1PJZA 2CCJA 2W43A 2W2KB 3H2KA 2Z09A 1N5JA 5GJVC 4WESA 1G2PA 2A5JA 5L45A 2VTVA 1FQKA 1Z7GA 4DMFA 4AG3A 3C16C 4PYIA 5K3SA 3Q5DA 1Z2DA 4EFDA 1MVLA 5HZGA 2J5RA 3RV4A 1FQWA 2HZ7A 3MGBA 1C4OA 4RKQA 3VUFA 1BWRA 4FCWA 4CMGA 4RMNA 4EB3A 4DZRA 1Y8ZA 4IVPA 1G8PA 4PPNA 5IU6A 3CKMA 1F2TA 1NOKA 3EE6A 3F5SA 4KWIA 4BVJA 4IOKA 4NYJQ 1EK2A 1YMVA 3MUOA 1L0BA 1N6RA 4LQ4A 2QP9X 4GXRA 3U3RA 4CF3A 3FDJA 1GNQA 1L7XA 1J42A 4HLQB 1U5CA 1A9XA 3JZIA 3QOFA 4FFPA 5EMLA 2PH1A 1Z6PA 4C0WA 4FLMA 3AB3A 3DL4A 3GLGA 1Y5IA 1P1HA 4WASA 3PXUA 5AK4A 3CRNA 5BQ3A 1H0KA 1P1JA 4EL0A 4REOA 3EZ9A 5CNKA 4CCSA 5D2CA 3S1LA 3AUUA 4FYPA 2GZ2A 5TS2A 2QLBA 3BF7A 5CIYA 3PP8A 3FSEA 2QDKA 2PWYA 4YNBA 3B70A 3F6RA 5KREA 4G8DA 1QDEA 4DJDC 4PLHA 2W2VA 4PVCA 3K9QO 1PS9A 4BNNA 3KXIA 4GZ6A 1PJRA 4H7EA 2IHKA 4CGZA 2DUJA 4DYHA 1TAQA 4MIEA 4ES6A 4IHAA 1JU4A 4KLCA 1XROA 2XA2A 5CHYA 4RCYA 3DDWA 3O21A 4DMMA 2WEKA 2ZRGA 3DZCA 5EXXA 5L53A 3ZCQA 4ARUA 1QRUA 2WD7A 3DS8A 1SGWA 2AK3A 5F1OA 4BRWA 1N0UA 4BYGA 4Q4AA 5DK4A 1RU3A 2AKAB 2M98A 2ZS9A 2JAHA 4QATA 3OSZA 2CMGA 3ABQB 1EIZA 4QELA 2GAFA 1B2RA 5G4KA 5A5FA 2H1IA 2A9QA 3I01A 4P8RA 3IKLA 3PIRA 3SF8A 3RVDA 5IVPA 1O95C 2RKWA 2R2GA 5REQB 2V5VA 3E70C 3RT7A 2GPTA 4R2KA 1E6WA 2JCVA 2MJLA 2EW8A 1XK7A 2C07A 2DWCA 2XCQA 1IU9A 1XHEA 4F6RA 1HM5A 4DLYA 2JGLA 3IE2A 3LUBA 3FPCA 4JVNA 4BNLA 4N4AA 2Z2KA 2XX3A 1T4BA 4OMFG 1RPTA 1WXEA 3CEAA 3ZYZA 3EAGA 5L4LA 1SRQA 2IJGX 5E4TA 4KCGA 1N92A 1TVEA 4WGFA 3VR1A 2O7SA 3JCZA 3DPIA 5AHWA 1TZBA 4ZAVA 5A4JA 4PG7A 4Q3AA 3Q1LA 1J0AA 2F17A 3D0QA 4WBSA 1S8FA 5KZMB 1HI9A 1U9CA 2DTEA 4TYQA 1ZH6A 2O52A 3KLBA 1GNSA 2A5LA 3PXBA 2HAEA 2P5SA 3H3JA 4JSYA 4OQMA 1UPBA 3NIBA 1RE1A 1KMHA 1P4RA 3QKIA 2G4LA 4C2TA 1A8UA 5BR4A 1O6BA 5EVCA 1XQ6A 4FE7A 1LRLA 1BMTA 5EESA 4NH4A 5DWDA 2IEGA 3PPYA 1F8GA 1N32B 3B2NA 4OHPA 4UPDA 3RYCB 2GM9A 2SKCA 1E3DA 1O96A 1L1FA 1VDZA 3L7LA 2W70A 2JLYA 1TMYA 4EJSA 3BK7A 3KYDB 3RFTA 4DC1A 2VJAA 2YV1A 3KJZA 1E9DA 2VRWA 2CVFA 2W93A 4TYMA 4R1OA 5EPOA 4U7TB 2XUQA 1CX9B 3DAPA 1RP1A 5E4YA 3TRDA 3THWB 1DBSA 2EYUA 2XUJA 1X0XA 3T3GA 4TS9A 1O4VA 3E5NA 5CG1A 1NVEA 1UQUA 3WL6A 3SAJA 2B1IA 1E9SA 2ETXA 1F2TB 2NYVA 4FFLA 3ML1A 5ARDA 3G9UA 1X14A 3E4DA 2BSAA 4MPPA 3C87A 1XXLA 4XFDA 2ODQA 1DPGA 1KZ7B 5BV2P 2PPVA 4UM7A 3LK7A 3VZSA 1QAQA 2C2OA 3PFBA 4AK9A 2FSIA 1KKUA 3C98A 3EOBI 1E1RD 1ZYUA 2HRCA 2CFIA 2J0EA 3AUFA 3GZNA 2RHCA 2C42A 3H6KA 1MORA 1W88B 1NPTO 3ND9A 1W85B 3TLYA 3L92A 2HU2A 1ZD5A 3OPXA 2FP4A 1U0HC 3SIPA 5JO0A 4FGWA 4OHMA 3WNQA 1QVZA 1H66A 3CVUA 2QZ9A 4UHKA 2C03A 2NT4A 2FWJA 1OKKD 5ALWA 5E2BA 5DTIA 3OM9A 1RKBA 2QRZA 3AXTA 4PFSA 2I1VB 1WZUA 2ZG6A 3C7CB 2EGHA 4N3BA 4EMBA 4F97A 3NHSA 1DIAA 4DLUA 4ZMSA 5T7BA 1ZVVA 3CZAA 5TEVA 4WECA 4AJJA 2BM1A 2YZKA 1RI4A 5FIUA 5J1SB 5F1PA 4UAUA 5A4IS 2X15A 1BQ4A 2HI0A 2XECA 4GKAA 4JX9A 1KXZA 1C50A 5CIWA 3WJ7A 1AGNA 1QOZA 3ZS8A 5EYPA 3L0DA 4UMDA 1WRBA 2EDAA 4MYSA 4MWSA 1IONA 1XDWA 5DPMA 4EAAA 2VDWA 1PLLA 2DQKA 4FFWA 1I33A 5D1HA 1E63A 5REQA 4EDFA 1G7CA 1TU4A 3ZNOA 3CXUA 1X7ZA 4RKWA 5A9TA 1IM8A 3B1JA 621PA 4Q9DA 5J1TB 3OPNA 1GQOA 1WTAA 3ZGYA 1QLHA 3QHPA 4ARZB 1CRWG 1AF7A 5JY1A 1PQPA 2DQ4A 3BXGA 1DQPA 1JHPA 3HCCA 1QIIA 1CS0A 1X70A 2ZUUA 1TJ5A 1YZKA 3EXG2 1JQKA 3ASUA 3PC8C 4N0EA 5T4BA 5BSEA 3SS8A 3NM4A 2AJCA 2BFDB 3FHJA 4DLRA 3NVMB 4HZUB 4I4CA 4F7WA 2VP9A 1PR4A 2IXBA 3SNKA 3H86A 3TTVA 1BFDA 3K8QA 3ITDA 1OBHA 4FDUA 5FF9A 5K0BA 4UFOA 4FMDF 4ZREA 3BKWA 3IAXA 4K03A 3FFTA 3OVMA 3VDXA 2NSJA 1YHYA 4FW9A 3O8CA 4A7PA 3EAFA 5KINB 1AMOA 1YBVA 3G79A 1ZHOA 3IVXA 2OESA 4IJ5A 3W2TA 2VDRB 3L1KA 4C1BA 1S7CA 4KR2A 3R41A 4YYZA 1B6SA 3VHXB 1TO6A 1FF9A 2GJSA 3LVFO 2XCOA 4QYMA 2YJ3A 2OQIA 2RGNA 4G24A 3QMVA 3KJQA 1WB6A 2OEPA 3KVRA 4WK2B 4YFYA 5K03A 2GVNA 3W1VA 4B6QA 1QFSA 1R8JA 2CLMB 4DILA 4MR8A 1HFJA 2XCUA 3CO5A 4GLLA 1QUFA 1EK1A 2AG1A 2ZB8A 2NZXA 3GEEA 4A0GA 2JG3A 1NFFA 1XWWA 1GU7A 1YJ8A 2PVCA 3U61B 1NKVA 2R1ZA 4GPAA 2OXRA 3MGAA 4Z9AA 4RV9A 2JBWA 2B30A 3LCVB 2G4VA 1Q84A 1KE2A 2YN0A 2A1IA 4FSHA 3T3PB 4DLZA 1AVTA 3CFYA 1O6CA 1M2WA 1B15A 2FP3A 2NTNA 3GJ6A 2B9EA 2PQ0A 5EJEA 1H3EA 2WTXA 1JBEA 1XR3A 2NZYA 2XE7A 3GGSA 3IMGA 4P4TA 2X0RA 4RQTA 3EXEB 5L6LB 3MJFA 1WF6A 4Q0MA 4RACA 2EF0A 3SDSA 1FSZA 2XDWA 2AJ8A 1JBQA 3U4AA 2XUGA 2Q3FA 3NONA 3IPCA 3T9BA 1VL5A 1TFRA 2Y1LA 4YQEA 3RSZA 3V46A 1KEEA 2JLQA 4J4HA 1CUVA 2B4KA 4XQ9A 5A0FA 1D2EA 2WHYA 1RRGA 4ABYA 1F0YA 1C3JA 4NL4H 1PV1A 2CE7A 3LQQA 3IUBA 1A96A 1I4LD 3A6ZA 5TS3A 2HHLA 1NJ5A 1RHMA 1LD3A 3T95A 1IULA 2ZB7A 1BHSA 1N3YA 2BGJA 4CV1A 1O6GA 1A3CA 2Q4RA 2D54A 3BX1A 3KEOA 1ZWKA 1GL6A 5CVVA 5L3QA 4E1BA 3OHSX 2WQ7A 1Z36A 5DNDA 4IYJA 2HLHA 4ZZ0A 2XKJE 2Q6LA 3EXIA 4Q48A 4UHCA 3SKVA 1J0EA 1JR6A 1CU1A 3KQYA 3T1OA 4KW7A 5LSAA 5TQVA 4R9NA 1BWPA 1JLSA 1EHCA 2OWDA 2WUEA 1RXSA 1S0UA 2EFDB 2XSZA 3IS3A 5FR1A 1EM8B 1Y1QA 5J4LA 3L1VA 4HDAA 4PWZA 1R3DA 1WDTA 2C4TA 1IB6A 5B3AA 1QK5A 3GLKA 3RHZA 1X2BA 3QWFA 3ZCVA 4CTMA 5FWXA 5CTAA 1NXVA 3OECA 1MA0A 4MP6A 3JZAA 3ADOA 2KMLA 3ETCA 4R9VA 3T38A 4CTJA 2VKTA 4INJA 5FJJA 2IFTA 1R50A 3A4TA 5DRYA 4XSVA 1P73A 4PQGA 3BXHA 2PV0A 1UC9A 2WYOA 1Y7LA 4BB5A 1QHEA 1C0LA 4D96A 1K9SA 4AG6A 2RGGA 5CDYA 2A88A 3HP1A 5TF4A 4RH1A 2UZAA 3ZCPA 2AJBA 4JXJA 1SXJC 2V74B 3B85A 1E79A 4DFDA 3KOOA 4QDZA 4KEAA 1CUCA 1TYCA 3BL5A 5KNBH 3DBLB 4G25A 4D4MA 2PZ8A 4W5TA 3AP3A 2ZBUA 1Q7RA 2MSKA 4M8KA 4RULA 3TS1A 1G2OA 2PCLA 3PFNA 4ZYVA 4DV7B 2WA2A 5AW6A 5I8PA 3JAMA 3I37X 1QGUB 4QNRA 3HI4A 3T7TA 3RIXA 3WWCA 3ZWQA 3R0JA 4L9RA 5FWYA 2RI1A 2BI7A 3JPYA 1WETA 4LF9B 1GL9B 2ZJZA 4PPFA 2PN1A 3U3DA 4KZPA 3D64A 4F1JA 1DOHA 1W49A 2ATVA 4ND2A 4Q82A 3WK6A 4BLQA 4PN7A 1Y5NA 1A04A 1WU8A 3NVKI 3I04A 1CE8B 1N5IA 4MVJD 3CLRC 4GO1A 2COEA 2OV1A 3PNVA 4KXNA 5DBOA 3P45A 5CD1A 1QAMA 1T1RA 2ZRJA 2ATCA 3HKCB 5DVZA 1D03A 1Z5WA 2P6OA 3OX1A 4G5HA 4RY2A 4BFTA 3RJZA 3UM9A 3PGVA 2HJVA 4JZYA 3RIGA 1GILA 3JAWA 4CN9A 4IH1A 4NAVA 4FC7A 4O8CA 3ROKA 2C84A 4BAUA 1U3GA 3FKQA 4Y6QA 3PR3A 1D2AA 4PC3A 4W99A 1KY5A 1TM1E 3QLTA 5DCWA 3SX0A 1IY0A 1LSOA 2WAOA 3IAHA 5A3JA 2PUEA 1WXHA 1Y1LA 1PK7A 4QA9A 1A2KC 2C58A 5DNEA 4HV4A 5GONA 5EIAA 3ZCXA 2ID8A 4OXNA 4X64B 1F2DA 1T8WA 1WW8A 3RABA 4JR2A 3TLGA 4IVNA 4AYXA 1M0SA 3D3KA 3GI1A 3PC7A 3NT2A 3M1AA 3EMBA 1OAAA 4LDPA 3PFIA 4WY2A 3UNXA 1S6YA 3KCQA 2VQSA 4WBXC 1VKJA 2KSQA 4D8WA 5JDIC 5KTTA 3PITA 3P2KA 4CM5A 3VKUA 4I5IA 2AJDA 3JASA 5EQJB 4ZD6A 3EXAA 3QG5A 3ZHQA 3FWZA 5HCNA 2XGGA 4DCUA 3U7RA 2CF6A 4EFMA 1II8A 3L6EA 4MPRA 5F76A 1VBFA 4DSUA 4XIFA 2DJ5A 2I4RA 2OMEA 4IFBA 3RAEC 1KBQA 4Q1CA 3AWIA 2IE8A 4JHLA 1VL0A 3V4SA 1XEWY 4LW8A 1FUYB 3DP7A 3K0SA 1PZNA 2V7UA 2VPZA 3C4JA 4H7IA 2NVOA 1P9RA 2IYZA 3PPXA 2CXPA 4EEZA 5IM4F 3RYIA 2R6GA 1T3HA 3LY7A 2EG5A 3LIPA 3WL3A 4RHTA 3D6MA 3HV0A 3WLNA 2ET6A 1Q0TA 5TPZD 2OG2A 1U8YA 5AHOA 4MUKA 1CEEA 4BNJA 1RJFA 4C0XA 1SQSA 3FX2A 1CBUA 4M89A 3FGZA 4RGQA 2WM2A 1QFJA 4Y2GA 1YZHA 2FZWA 1JT2A 4DEXA 2CW5A 3R8CA 4AO7A 1JHOA 3E3LA 2Q3CA 1UEJA 4PZ0A 1WEHA 2B1JA 2AFIE 1E20A 5DXAA 4UUOA 3ROQA 2JH3A 2DFLA 3M2TA 2ZU0C 2Z3VA 1EP2B 1UDCA 2C29D 3MWLA 4OGGA 7GPBA 4YAKA 3TAUA 1EQ2A 1RQXA 4J0GA 4LC0A 4K1LA 3F98A 5LOVB 3WLFA 3OCWA 1U02A 1EJBA 1N6KA 3DLPX 3FBWA 4WEQA 2VNJA 2H6EA 5F23A 1GFSA 1W0JD 2OR3A 3FAKA 3GFQA 2E49A 2B25A 1Z06A 2ZSDA 1SCJA 2DAPA 2WE7A 2RB5A 4G1CA 2HWXA 1ZJWA 1ZJYA 3P5BA 1CPYA 4EB6A 8GPBA 5JNWA 5B6IA 1ZZGA 1L1QA 2VJDA 1Y8CA 2P7HA 2VYND 4NCKA 3KUKA 2M1ZA 4QYXA 2WJHA 4ZQIA 5T4EA 2IZZA 4J0KA 2FSSA 5IDQA 2FDXA 4LJ5A 4RLSA 2XUHA 1MN6A 4R54A 4YJKA 3UJBA 4DQDA 4MUIA 2AXNA 3NBUA 2XNHA 5IBQA 3I30X 1KO4A 4NY1A 4EGCB 4JJ8A 1FYXA 4CCAA 4U4AA 3R4VA 4XD2A 2DRIA 2DFPA 2FEPA 2JI9A 2IOFA 1R2QA 4K46A 3I9OA 4DA7A 3KKPA 4ZYXA 3NHUA 2FCRA 1VP9A 2X22A 3BGVA 3ES9A 1R9MA 1SY7A 4FFBB 1ISPA 1GCGA 4HKTA 2OLKA 4JDUA 2G09A 4MRRA 1A97A 4W9NC 1N5OX 4GRDA 2EERA 3L46A 1C7QA 5HQJA 3L0OA 3UHAA 4I1YA 4X66B 2CFTA 4AJLA 3KAKA 1TEZA 5BN1A 1AQJA 2C8KA 1P1CA 3PFCA 3JQ8B 2BGGA 2XH8A 2V7EA 4G0UA 2JIOA 1BE1A 2CVPA 2E3JA 2VYFA 1S2OA 3MPUA 4KPUA 1ZQ9A 5EI5A 4TWRA 3V2GA 4D4JA 3FRIA 1Z5PA 3AZQA 4I8IA 4B9AA 2B5OA 3SS9X 1CQWA 3BTOA 3S2FA 1MDBA 4LYGA 2R1UA 4FI3F 2QXYA 1G8FA 1BRTA 1KJYA 4HQRA 1JIJA 1L5VA 1G4HA 4IVRA 4LY9A 3AW9A 3C8ZA 4MVYA 5U9CA 1R0XA 1PYGA 1T6ZA 2QVXX 1FYDA 1MH9A 1QCDA 2JJ1D 2ZRNA 4Y1EA 3UMFA 1JEYA 2Y1XA 2R7NA 4M7WA 3COWA 4EQ6A 5EIXA 5C35A 3ZUPA 2RMKA 1W4LA 2PS9A 2GTPA 3VOBA 5JS7A 1Z45A 1CVRA 3N87A 2I4OA 4IINA 3UMBA 1T5TA 4CWAA 5ICSA 1KOJA 5ERXA 3ED1A 3OCJA 1PSZA 3E3OA 1D0IA 1G1MA 3DJFA 1GCUA 4B47A 1LPMA 2M6KA 1K3UB 2ZE7A 3II6X 3TDMA 4CG0A 1DKQA 1YRAA 3FGNA 1P9WA 5AJHA 4XGNA 5AO9A 5AW9A 1XD2B 2OV6A 3D7SA 4RE6A 3Q12A 3JQGA 4HBZA 3NGMA 4AU1A 1YCFA 1MAHA 3L5OA 4BUJA 3NALA 4E5PA 1E3WA 1SUBA 3TMKA 3ZGZA 3UGKA 2HFKA 5AJYA 2AUNA 3JRNA 4JU9A 5CLGA 1I3MA 3AY6A 3E1GA