3OSVA

The crytsal structure of flgd from p. aeruginosa
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
134
structure length
131
Chain Sequence
b'SSLVGRKVIVATDKSVVDTKDTFKASLNLPVSSSNVWVNVYDDKGTVVNRINLGQQAAGSVSFMWDGKDSSGNIMPPGTYKFEAQTSIDGKTYGLQTYLPANVDSVTLGQELMLNLAGLGSIALSKVQIIG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Flagellar basal-body rod modification protein FlgD
molecule tags Structural protein
source organism Pseudomonas aeruginosa
publication title Crystal structure of a novel dimer form of FlgD from P. aeruginosa PAO1
pubmed doi rcsb
total genus 21
structure length 131
sequence length 134
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13860 FlgD_ig FlgD Ig-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.910 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3osvA01
2.60.40.4070 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3osvA02
3OSVA 4ZZFA 3C12A 4ZZKA 5K5YA
chains in the Genus database with same CATH superfamily
2IDFA 1XD0A 1Y18B 2LCLA 5IBLD 1Y1UA 3OA6A 1TENA 3KVQA 2IGLA 2JCCF 2WXNA 3FONA 4K3DL 1GRIA 1F6AA 35C8L 4YFLI 2GEQA 4PRIE 4UIMA 2DMBA 4NO3A 1T1ZB 3R6OA 4M75B 2VQ4A 1A3ZA 4WI8A 3ZT5A 4X7SH 5TK4A 5JXED 1FAIL 2KK4A 3CFDA 2FIRT 1DQJB 3GWJA 4GP8B 1QVFS 3OQ5A 4G9DB 4GAGH 2GABA 4GY4A 2NY7H 1MHEB 2H8PA 3PDOA 3CPWS 2BDNH 6CGTA 1U8HA 5D7EA 5AB9A 1WFUA 4G8EA 4MNGB 1ODUA 4BD3A 1EJ8A 4H0HB 4LLVB 2YWWA 4KKCD 2IV9A 3FQTA 1BWMA 4N0YH 4G83A 3VQ2C 2CMRL 2X9XA 2EYRA 2YAHA 4FMVA 3UADA 4AV4A 4F8OA 3BPCB 4Z7VF 2QSTA 3GS0A 2R9HC 3I35A 5CD3B 3FU5A 3GP8A 1L3NA 2AXFB 3B3BA 4IJ3C 4P23D 4MD5A 4E9LA 1MJJB 2EYTA 1GR7A 4IS6B 2DMGA 5TE6L 3W5NA 3MX0B 3BAEH 2F68X 1TIUA 4POZC 4WW1A 4OV5B 3REVA 2BERA 4KKQA 4WJ5B 1YI2T 1FAKT 4X6CA 4XNBA 5IJKA 2Y7SA 1HSBA 4M7LH 3MRIA 2VZTA 2CZ0B 1QEXA 3DPBB 2AJ3B 1W6LA 3KYKL 4H44C 1X5IA 3GLEA 4UU9A 3MJGX 4N0UB 3HRZB 3S9DB 1NLDL 4W9GC 1G9EA 1KTKE 3SGJA 2VDRH 2BINA 3P3TA 4P57A 5BOJA 2CH4A 1F4XL 3ROOA 5GS0C 3NACL 4R96B 5IVXE 4HETA 2YRLA 4KX7A 5CKBA 1KN2L 2XN9A 4Y19D 1E4WH 4GKNB 1ZSDA 4JJBA 1JK9A 4EO5A 1EHXA 3QP3A 4TUJB 5PCYA 4H1LH 5IOPB 3OKMB 4Z0XB 3WEBA 1M4KA 4C92C 4HS6A 1LHZA 2XN1A 1NDTA 2YJLA 4OKDA 4J6IA 4DOHE 1B6UA 1QVPA 4JS4A 3QIBD 2R69L 2MCMA 1QEWA 5EWIH 3QRFM 1AD9B 4ZOCA 3L9EA 5HDWA 2HCKA 1H6TA 3BVDB 1AGEA 3MRDA 2DERA 4L1TA 4E9TA 1OEZW 3FB8B 5IFAL 2QELA 4ZUSB 4DUXA 1QFPA 3Q06A 3M57A 3C5JA 3RI5F 1GS7A 1TZGL 1RD6A 1EJOL 1LK3H 3ARPA 3SKOB 3HCVB 1Z9QA 3META 4HOMA 3NEOA 1A47A 1CD0A 4KO9A 4HKXB 2G4EA 1KF9B 1ZS8A 3GMMB 4CMHB 4PY7B 5F21B 1FIGH 1HC1A 3LQAC 5D7JA 4M75G 2H3NA 2W9EL 4KFMA 2P42B 4TQEH 1G83A 3SJVA 4QHUA 2WNKA 4IRSA 3DETD 1VQMT 3QEUB 3X14B 1EJOH 1N26A 4YN3A 1BXUA 4M5SA 1YEEH 3KPSE 3G5YA 3T8XB 1YNTB 4E68A 2R8SH 4M4ZA 1NPJA 1JGEB 3B8YA 4L9DA 2ZWLT 4M56A 5FFOA 1QRND 4LDXA 2L5QA 1V3LA 3FCSB 2AVGA 3CVCA 4XC1L 3HE6A 4W9HC 1RIVH 3KPMA 5GZNC 2YUQA 4QTHA 4LOUC 3Q01A 5C0CA 4WEBH 1A3RL 3OMGA 5IMLB 1PLGH 2DQTH 4NWUH 2UX6A 5FYJU 1KYUA 2WXGA 3VXMD 2FT7A 2A1WL 5GS3A 3RVTD 1UM5H 1HJDA 2JXBA 2QV4A 3KLDA 5EUOF 3RGVB 4EIBA 1VQ6A 1AZEA 1DEDA 3HRPA 5LBGA 1XF3A 4GPVA 1E43A 4X5LA 5I16A 5EF0A 1IBBA 3GF8A 1FL5B 3GSNH 4WEUD 3G7TA 4ODVH 3TEXA 2HMIC 4Z77B 3V4VA 4IBSA 3UT1A 4Z8AA 5IQ9B 4HU2A 4PRPD 3QW9A 4M9PA 2QLVB 2KKQA 3PP3H 5DHVB 1U3NA 5I2IA 3WKPA 2Y1YA 3HB3B 5C2UB 4APQB 2ZUUA 2OULB 3DO3A 3A98A 2R2HA 3ULVL 2F61A 1MJ8H 4I8DA 3RP1A 1QP2A 2J5LB 3HMWH 1FL5A 3NABH 3VFTA 4KTYA 1CLOH 3A24A 3H9SB 5G5DB 1FVCA 2R1YB 3HZ3A 4H8QA 1U8KB 2EDNA 5G4MA 4P59L 3STLB 1WEJH 4N28A 4U6TA 1DFBL 2NNAA 3US1A 4NXKA 2DETA 3D05A 2BNRA 4PJEF 4CVUA 3QO1B 5KVDL 3MRHB 1VIWA 2OAAA 3TBSB 1U1TA 3A4EA 3MLTA 2EYWA 1W0WA 3CVHB 4I87A 4EPCA 2C3HA 4PRAB 4OCWL 3JB9D 3RRQA 1QZ1A 1Z3GL 2Y7LA 5B38A 3UTPE 2C7FA 3KH3A 1FMWA 3ILDA 2VN6A 3CCJT 1BFVL 2J3SA 5CZVL 2QK0A 1MCNA 4DCQA 2QVKA 1NA8A 4PGBB 5IQ7H 1AGBA 4IU2A 4LSPH 4N1HB 4ZFGL 1OV3A 1GGIL 2Q3ZA 1SKUB 2A3LA 3MOAL 2ED9A 4OVVA 4UDTA 5D7KE 5EEYA 4ODSH 2VDNB 1MAJA 1XSKA 3ZBDA 2DVJA 4OCWH 2ZPKH 4G6KH 2J20A 4Z95L 3MGOA 5J6SA 3T0EB 3V0HA 2AFNA 1T21B 4L1DA 3VD7A 1DBAL 3GXUB 4PREB 4ZTEA 3O3BA 5I8EB 5LG1A 3RWJB 1XH3A 4FQXB 5MP6H 1RURH 2IBGA 3K3QA 4MAYC 4P2CG 4FM4B 1JN6A 3CN2A 1KBBA 3KH4A 4WF7A 5AALA 4DO5A 4PJ7B 4ZMPA 1G9ML 1QSEE 4IDJH 3G1JA 5EU7E 4AM0A 1ZSHA 3O2DH 2NY5H 2XC8A 2XPYA 2RIKA 3JB9H 4K3JL 6FABH 3WAJA 1OV8A 1OULA 3EG3A 3CHSA 5KJRL 2YSTA 3GPEA 2VASA 3QHZL 2DEUA 1QLYA 2VQ1B 3OS5A 4UV4L 4MZ2A 4PMFA 1WDXA 4LD6A 1JP5A 1XTLA 3PIOA 2M1KA 3L4ZA 1OW0A 5I71B 1P4BL 5K9OA 5DFAA 3HC3H 5GAN7 3MREB 3KD4A 3QB7C 2ADGB 4J12A 1JPTL 3MU3A 1DQQB 4WO0A 3OKEA 1RI9A 5GRXG 1WXUA 5FHAH 4HDIA 2FWSA 5FW7A 5KANI 2PR4H 3TTSA 5GZOD 2KYIA 2VABA 4Y1SA 2CO2A 3OYMA 4PJGE 4M78F 4C0GA 4N0FB 1S5IH 2VYRE 3JBG7 4ZTPL 1KIQA 3FUJA 5E6ZA 1HQRB 1D9KB 1FVDA 2DY2A 4TVPE 4H2CA 4RZCA 4C8QD 1Q86C 3BPLC 1YPZA 4F24A 2WY3B 3K1DA 1TQCB 2X4XA 1ADQL 3DX9B 4PCKA 1NIBA 2KYBA 1VQ8T 1IGTB 4DGYH 3I3DA 5LCVH 4AM0B 2QLYA 5EPMB 4Y16B 1JHKH 4P4KB 2BOBA 5D1ZA 3T2LA 5CF3A 4HUVB 2ZOUA 1SN2A 4JRXA 3K6SA 4P5NA 4IGBB 3BFQG 1U3OA 5DEZA 4EN3B 1DTUA 5EU3B 4PJHF 2BSCA 5IB2A 5FM8A 3A5ZB 3P4MA 4UT9A 2KT1A 4YGAB 1IGQA 3IJYA 4NQSA 3BN3B 4M78B 1MVYA 1I0CA 4Y4FA 4DKEL 1UJ3B 1NJIU 2QR0B 2YMTA 4DQ2A 5EC2B 2BOBB 2VUBA 5AW6B 2DL4A 1P1VA 2Y9RT 3ZO0A 1D7BA 4AG1C 2HXAA 5DJ8A 4XPHH 5JW4Q 5JW5B 1UM6L 3M7OA 1J48A 2M9UA 4NRXA 1UJ0A 4OQTH 2VR3A 3PGDB 4E41B 1N8OE 4XMTA 2K2VA 1EX4A 4AMWA 3CDYA 1NEBA 2F1BA 4PS4H 4KK8D 1ACXA 4KRNA 3CPWA 1HQRA 1N9SA 4HBCH 5L8RE 2DAVA 2CK2A 2KMWA 2ZPFB 3MVSA 4RFEA 2ZGWA 2H3XC 5L0QC 3UA6A 4XPAL 3FCUB 4Z7UB 1EEYA 5HHOA 1YYMH 3QHFH 1NBEB 1S7TB 3DROA 3WIIL 4J5VA 1OP9A 1MFBH 4R8WL 1WG3A 4P5TA 4X4MA 5IJDC 5HK0A 4ZYKA 5C0JB 1DUZA 4WQOA 5EO1B 4MMZA 3IGFA 4YXKH 1SDDA 2OX5A 3ARQA 4PHXA 3SEMA 1JD7A 2ZCZA 3BEWA 2J7IA 5DR5H 3VI3F 1NCJA 5EN3A 3RY6C 4ORZA 4FYYB 4ZG1A 2MYSA 4FI7A 3SCMD 1I7UA 3VQMA 1QG3A 3MXWL 3N43F 4J3SA 4DN4L 3VMPA 5F7DA 1EERB 1GGCL 1EMTH 2RK1A 1U8NA 1KQ1A 5GRVL 5C0IB 3MRCB 3PMIA 2Z1PA 5DDHA 4OD1L 3CPFA 3T77A 1KGCD 2JCWA 2W80C 4JFWA 3QRLA 1KIKA 1BEYL 1CXEA 3HG4A 3GUTA 2HQXA 2EYSB 4PB0H 1F5WA 3FQ1A 2JLLA 5J12C 3RKYA 1URLA 1QFUL 1JPFB 2YRPA 1DUZB 2CKBL 5EO1A 4F7MB 2H6PA 3F62A 4XI5D 2W5PA 2YPVL 1TKWA 4HPOH 2XYBA 3VFOA 3ZR6A 4F5CA 4AYGA 3HFFA 3CC1A 1ZX6A 1I3RB 2O5YL 1EEYB 1AZNA 1CD9B 1G7QB 2CGHA 1I1AC 2FX7H 3OR7B 4GBXD 4OVUA 4F27A 1LMIA 3PYCA 4M93C 4FFYH 4GKOA 2Y4YA 1WV7T 3ZKQD 4G8IB 2X1PA 2NOYA 2PP7A 2AV1A 3HPJB 1P84K 2DM2A 3O41A 2YEZB 2Z91B 3NIDF 2PXYA 4HVVA 7FABH 1ZMYA 4E42B 1DJZA 3U2SA 3EYQD 3M0QA 4Q14A 4PJ9A 1J8RA 3EH2A 1W0WB 2O61A 1ZBXA 4YR6B 4G7VL 3FB9A 1I8IB 4PV8A 2HQEA 4OIIL 1JV5B 3X14A 3GIBA 4RTUA 2HT2C 3RKXA 3IS0X 4XVTL 5DMJB 1JYXA 1TPXC 4ZO6A 4G6AD 4NHCH 3CCHA 1NOFA 2N0MA 3FFCB 4JFEE 3O9WD 3WNPA 5D4JA 2CMRH 4ZNEA 3WHE0 2E8ZA 4XCNB 3RDTC 2EXYD 1CTNA 1EZVY 4DK5A 3DPDA 4N2GA 4UYQA 3VWKA 1U3HB 2HTKD 3QR2A 4Y4FB 5C0MA 5AOZA 2AANA 3ZZSA 2JQMA 4OCLC 5FW8A 5I24A 1R5WA 3FT3A 5IMMB 3DVNA 3PGFH 3S34L 1BBZA 2IAAC 1UYWH 4ZW7A 3F7YB 3EGSA 2TSAA 2PUQT 1UOVA 1AO7D 4NN6C 5D9SB 1LO4H 1C16A 2P8PA 1JMXA 5KSBF 2AERT 1R3JB 4ALAH 1K9MR 3U0PB 3KYNB 1C0MA 1L6PA 5AOIA 4Q89A 2YBGA 4HS6B 5ICXB 3HE6C 3BW9A 3BGMB 1OK8A 1KLGA 4R4BB 4W4NA 2HJFA 4N26A 1T5WB 1XHHA 4NQTA 3V55A 3ETTA 5H35A 1RIVL 2FX9H 4TUKH 2WN2A 5J5EA 1NYGA 4L37A 2JVVA 2GEEA 2NQ3A 4HUUB 2CSIA 2VGMA 3QNZA 1Q9LB 3WJMA 1FWZA 5D70L 1YMMD 3OYLA 4JY5L 4E7HA 1C1AA 2FO0A 1WFIA 4MJJA 2XG5B 3V6OE 3T04D 5FHBH 4M03A 2VZVA 4BY6B 1FC1A 3QEQE 3HFNA 3S3NA 2QMKA 1B0WA 4I0PA 1FFNA 1IC7H 5CP7A 1TSFA 3X3GL 4Y2DA 3U0WH 4GKZA 3MLYH 1MZZA 4ANKA 1RUML 3E1ZA 2E6ZA 1KPRB 3QYMA 4U31A 3B5HA 4ODVL 3BUIA 1PAMA 3RWDB 1H0DB 3TIEB 4X7TA 1KLUA 1P92A 4G6ML 3VNZA 5C0BE 3Q5YA 4PD4J 1NJ9A 4ZAKD 5LB1A 2ECZA 3D7PA 3MV9A 3DMMA 4M7DA 1CVRA 6PCYA 1KIRB 1HCVA 1KTDB 3EJZD 3WKQA 4XU3A 5IW6B 2Z7UA 2OMTA 1PZBA 3NJNA 1GZPB 4NNYB 4WI7A 4K71C 1RZIB 4FQCH 1N70A 4YUEH 2C4XA 1KBPA 1XGRB 3U46B 2OKMA 1JYNA 5CN2A 1YEIH 4PREA 5I8EA 2EABA 4HD5A 1FZJA 3FQYA 2K78A 4Y2DC 5D2NB 3LN4B 3VRJA 2OX5B 1HFUA 1SMOA 1Z5HA 3H2WA 4H25A 4X5WA 3EDEA 2B1AL 3FOMB 3KXFD 4KKLC 2VO5A 5ACZB 1ZHNB 3DROB 4FEIA 1M2VB 1UTDA 4N25A 3WN6A 5IQNA 3G6EQ 4EOWH 4BI4A 4FXKA 4NDMA 2G5BB 3VXNB 1TF4A 2VSMB 1RV6X 3VXSA 3QZPA 3CZJA 3MRBB 1EGJH 1ID2A 2EDHA 3C2SA 3QZLA 1A3RH 5L8JB 1SF9A 1QFWL 1OM3L 1RJLA 2NZ1A 1TCRA 2XICA 1LE5A 1GS6X 3HAEG 4DH2A 1KT2B 2YN5A 5I5JA 3FRPB 5CJOH 2AXJA 1MCSA 1A4CA 3UTOA 1A6VL 4X5PA 1CICB 1JWMA 4KJWC 3RX8A 1T66D 3V4VB 2TRHA 3EJQA 5E4IA 1PSFA 1JMZA 3NA9H 4AENB 4E5XG 1QO3A 3CCQT 5T3XE 1GPOL 3CCLT 3B3IA 2EH7H 3L3KB 4DPRA 1H3GA 2DM7A 2B3RA 2NXYB 4PV9B 4FIBA 1UURA 2Q8AH 2ARWA 4PJIE 4BCZA 4CBPA 4BSVA 2LQWA 1YECL 4UBDD 1T5XB 4GAFB 1XX9C 4AQ8A 3C5SA 1NCWH 5AVTB 4LESA 1QCFA 1MHPL 2A6JA 2PCPB 4OKVB 5BJTA 1DDHA 1A9EB 4AIEA 5CZXC 1GCPA 1HL4A 2WP3O 1C08A 1NLBH 3MCKA 3WFEL 1JGVH 1PG7W 4PJ9B 1JJ2P 1WFJA 4UQAA 4QKUA 4BCXA 4K5NA 3EGDA 5FK9A 3GMNB 3RTLA 3FB6B 4LXFA 1XD1A 3BH8B 4A53A 4D0BA 1QSEB 4NZDA 3BVWA 2L3RA 3ARXA 1X2QA 3LIUA 4DNLA 4DVBA 4PJ9C 4O9HL 2IANA 5EBGA 3ZMNA 5AB2A 2RK2A 1M1FA 3H41A 3BWAB 4NZUH 2F1AA 4QHKJ 1MJUH 2KY9A 4M75A 3CQPA 1QCNA 3IJSB 4ES8A 4ZN3A 1VJSA 2Y7NA 3NTCL 3QDHA 3TBVB 3RUGF 3VXME 1OI1A 5GIRA 5IJCC 2XHCA 4AGPA 1ACCA 3MREA 5KVMC 1HWWA 3UYOD 4LP4A 4U3HA 5HDQH 3G3LA 3G4SA 3FC8A 5LJ5h 2QVFB 3D18A 3PGFL 5CBEB 5TDOA 1OAYH 4M5ZH 4EXPX 4RRPA 1FYTE 3VD2A 4AYID 4CUCA 4BA8A 1AS8A 4HXAH 4DKAA 2Y5EA 2F74B 1KN4H 4OGAD 4L8SA 2GPZA 4TTDD 3A4AA 3HC2A 1LGVA 3LY6A 2XBTA 3ES6B 3ZTEA 2B8OT 1X69A 3MO8A 1OGSA 1BZ7A 3I6SA 2DYRB 4FNPA 2D4FA 4U1NA 3HRUA 1BVKB 4JRFA 5C0BB 5KWYC 1A8JH 3TX4A 2YQBA 3GB7B 4PYGA 5HP5A 1Y0LA 2J71A 2UZIH 1J0HA 1Q1PA 3CCSQ 2HKNA 1PRLC 2AMUA 4K15A 4QXVA 2ED7A 4DP4X 1CQKA 2LMJA 5TDNB 3CC4T 2P5EB 5AG8A 3CMOH 1YQVH 5I18H 3UAEA 3VI4E 3GSXA 4M00A 5FHBL 1QLEH 4MA8L 3C9NB 1CDCA 3FRNA 3UTSA 4U1MB 3EJCA 2WTRB 4DW2L 1ZTXE 2I07B 1Q1JH 3OW2P 3ARBA 4MAYB 5C6TL 4JUVA 4DSYA 1AZCA 4MZRA 4A2DA 4YIQB 4KJQC 3BQVA 1GBRA 2MPAH 4QPEA 4QEGA 4XODA 2XTLA 4PJOD 3VM7A 1JZFA 1IC4L 3MRIB 1OOAA 2ZAGA 2R1XA 5M95B 2XTJC 4QY8B 2CP6A 4XMUA 5GGRB 4NGHH 4Q56A 1AXSA 2XN2A 2LZ6B 5DY9A 3HE7A 5DUMH 5EA0L 3UTTB 3ESOA 4E5XB 2ID5A 5ILTL 3CU7A 2HVKB 3QI9C 2DJZA 3A6BH 5CIUA 4PRBA 5C0ND 2GC7C 5AD0A 1VQKT 3SYPA 2ZCFB 3TF4A 4JQIH 1MXGA 4NKOB 4LDYA 3N2JA 1WAAF 4HFWA 4YHNA 3MO1A 3ETSA 3ULUE 4GT7A 5D7IA 4EN3A 3EYVB 2VDKH 4N2HA 1E3XA 4APQA 1AC0A 1X43A 2WXOA 3FT0A 2PP8A 4P9HH 4IIZA 3QI9B 5HYEA 1F6FB 4LEOA 3EFDH 1VFBA 1YEHH 2NXYC 4L4TB 3S36H 5KVEE 3LPFA 4KNSA 3NUKA 2XVKA 3LZRA 1B7TA 2A9ML 2H9GB 3AU1B 5DUPH 5LGHL 4R2GD 2NX5E 2GJ6E 3K2MC 3KPLA 4S2SA 2H8PB 4IW4C 1DEEB 2J56A 5GSRB 2W60B 3RNQB 2RI3A 4PK4A 3NRPA 2BP3A 2OJEB 2B5IC 1F4YH 1GC1C 3ZLQC 3UBFA 2NY4C 3CSYA 4YDIL 2DI7A 1CMOA 1HHJA 3CIQA 5I1AA 4WEEA 2V17L 4NP9A 1M2VA 2NZ9D 4L29A 4ZGDB 3SDXF 4APQC 5ACLA 4OLVH 4NQEA 4LLUB 5TE7H 4M7ZC 4LP5A 1DQQA 1BVLA 1JDDA 4XWGH 5JPMC 3MLRL 1X5GA 2VGNA 2PYEA 4MMXA 1ZGLM 4WWKC 4WRLA 3UCQA 3Q6FA 1NCCH 4RNRB 1U92B 2GI0A 2LU7A 3GIVA 1ET7A 5DMGC 1NBZB 4JM2C 1UACH 1ZSZB 1OGPA 2P47B 4LVHB 4ZPVB 1OW0C 1NCDH 2O2OA 1DE4B 2WKGA 1I3RA 5F88A 4M5ZL 2NNCA 4OF5A 3SWNA 3NEEA 1M8VA 3FUHA 4R4FH 4HJUA 1ZUYA 5CFHA 3N1MC 2B1HL 2VQTA 1NCWL 2BH0A 3WTVA 3S96A 2LTQC 1EFXB 4A67A 3MV7A 5CUSH 3W0WE 2BY3A 3WLWD 3GI9H 1C5BH 4UMGA 2NUTB 1YP5A 4AQEB 2CCWA 4C4KO 2AKRA 1U2HA 2BIOA 3K46A 1QABA 3MYJB 1IGUA 4DHLA 1F13A 2I25N 4KGXB 2DOCA 4RFOH 1E27A 3ZR5A 1RPUA 1IUZA 3Q1SL 3GMPB 2KPWA 2XWZA 1A6ZA 5EOCJ 4QRSB 3BP5A 3NG5A 4AKOA 5FF6A 1D5ZB 3KDPB 3E2HB 4D8PA 5J8OA 1E2WA 1WHLA 5G4OA 3CCUT 5LUMA 2RO0A 4YWGL 4GEJA 5JO5A 4ODUA 2FEDC 4NCC1 4ONGL 4ZMVA 1I82A 5C92A 4GH7B 4XP4H 2UY6B 2OS7A 1AANA 1NEZB 2BZCA 2GNCA 3JCMX 4PJAE 1X5KA 5CD5D 3QDJD 1VQLQ 4F8TA 2FPDA 2VJXA 2W65A 1XF2B 2VXFA 4NC1E 3GSUA 3CFQA 4RTWA 2DIAA 3QPXH 1KFGA 4ELME 1XL4A 4PUBL 3L7FA 3IE9A 4PJFA 5HYIA 2ADFH 2D7NA 5EZIL 2ZAIA 3CNKA 3FH5A 1AZUA 3GXMA 3B2VH 5EFIA 1AJ7L 1UGVA 3AB0B 2WBJD 3DX1A 4L4VE 1NZ9A 3W37A 3JAME 1FVCB 2E4FA 2R1YA 3N3EA 4TULH 4CSPA 4NQXB 2B14A 4OJEH 4Z7IA 3O9WA 4HULB 4ZX4A 4C4UA 3L45A 2AJ3A 4HUWA 1NBQA 3AQXA 4G6FD 4ZTFA 2HG0A 3S4SG 1RLQC 3CDCA 3JB9J 5CKHA 2GAZA 2LLGA 5F7KC 4V1DA 3WY2A 1AGCB 2K8QA 3B9KA 2K5FA 3Q43A 2FRYA 3CXFA 3QCVH 3PAUA 1CICC 2Q5BA 3GTTA 1XEDA 1CKAA 3IJYB 1M6OA 4G1MA 4XO4A 2MFNA 1OSPH 4TVUA 2HA1A 1SFHA 3T3PB 1KULA 3DX0A 1S1NA 1IILE 5GAOr 4WU5A 1D7DA 1U3HC 3CVHL 3GI8L 2X1QA 4PGDB 3BCFA 4XAKE 1M1KC 3EHBD 4LAJH 1MCJA 1MN4A 2NCEA 3O11B 5ADPH 2VM3A 1MV0B 1Q94A 3PP4L 2MCAA 2PW2B 3FQUB 4BH8A 2H32H 1G9MH 4PJOG 2G60L 1J87A 1YPZB 4BV1A 3QXWA 1HYSD 2R29A 3CCVQ 2B4CL 1QBBA 1OLZA 1NBYB 3TL5A 3BP6B 1UCBL 3G4SQ 2B2XH 2WTRA 5SWZB 1YQVL 2X4PB 5EOQH 3DIFA 4DGUA 3GJFA 4KC3B 2X2YA 3ET9F 4OF7A 4NFDA 1XGTB 2BVPB 4QLRA 5DHYA 3D30A 3KDMA 3MLSH 4GRWB 5T3ZH 1P5UA 2WO2B 3L2RA 1QLFB 4IJ3B 3CCMT 2VABB 5A2KH 5ICYB 3ZL7C 3ZFJA 3MACL 1AQDA 2FHCA 4LU5L 3I5RA 4B9CA 5SWQA 4PJLA 3ARGA 4JB9H 4Z8FH 3BDLA 4MS8D 2ETWA 2CO4A 1W2BA 5L23A 4MAUH 5FYLE 4PAZA 2N7AA 5DJDB 1SJVA 4M4RA 2F7RA 4TOYL 5C07B 4MCYB 5GS2D 2J8UE 2ICWJ 3GHBL 4PLKC 1MVFA 1NAKH 1T5KA 2VITB 1M7DB 5DUPL 5LGHH 4EMKB 4DTGL 3AGVA 5CM1A 1A25A 3FT4B 4JFZH 4ORGB 3I02B 3MA9L 1SHSA 3DMMD 3QUMH 1BIAA 5DLOA 4PJXB 4PV9A 4XP6H 2VQUA 1QWFA 2EYSA 3P30L 5JQ6H 1BQLL 2APWA 4IGBD 4UQ2A 4PRHD 2QGFB 5LAXA 2YD0A 1EEQA 2A37A 5HHNB 5I6XC 2FIKA 4JY4A 4F04B 1S7RB 4HCIA 2DQIL 4JL1A 2FB4H 2G3RA 1HI6B 1JB0E 2YK1H 3UACA 4OCSL 4C8QF 3HFMH 5FA4B 5JW4R 3MGOB 3HTRA 5IVZB 4U1SA 3DUUA 3QIWD 4JHWL 3BVNB 5GS1A 1PQZA 1TUPA 5F0JB 2LDMA 2PNIA 1VQKQ 3ZMEA 3PAVA 4W9KC 1B3QA 1Q72H 2DIGA 4LSRL 5IMOA 5IW1B 1IIKA 4HCKA 1NCOA 2DTOA 4ZUUB 4O58L 2YGQA 2E7HA 5ICZA 3D0LB 3EOBA 5GRWA 4JZJC 1COBA 1HK9A 2CQVA 1MPAH 2E64A 2Y69B 3ILQD 3K6DA 5DS1A 3TN0A 3R7RA 2V3FA 3BQUD 3HI6H 2FO8A 1H6UA 3QXDB 3FFCE 3Q44A 5IF0A 4AK1A 5BW7C 3MLTB 5I1CL 1T4WA 2XZQH 4V1DE 2DQTL 3PQYB 2GFBB 4RGMB 1AGFB 1NAMH 4IUPA 3G5VB 3KWUA 3WEOA 4J4PD 2AKRB 1FDLL 2CP0A 3FQ2A 2HRPL 3QFJB 1BZ8A 3L1OH 1JCKA 3OKKB 1T20A 2AEOA 4ONFH 4XC3H 4G6JL 3SGKA 4M48L 4PRDB 4KXBA 4FI6A 5I6LA 1A6ZB 4JDZA 1P2CA 1GSMA 4E7JA 2KDYA 4NSKB 5EB9A 1HWGB 3VI3A 4XE0A 4K5PA 2WHVA 3T0AA 3J7AF 1ZKAA 3D3VE 4M3JA 3WS6A 1TS9A 4Y92A 1E30A 5CHNB 2QQLH 3JV4A 4NKDB 2XG8D 3BUDA 4XBPB 4L1LA 2EO7A 4PIRF 3VFMB 4AVHA 3UCRA 4YX2H 3EG9A 4MQTB 4HQQH 1SM3H 2XNAA 4FQ2L 2O6FA 4P46D 1EMTL 1RJYA 1XF5A 3BMVA 1BFTA 2E9IA 4EMKC 1Q0YH 1J9SA 2EDBA 2NNXA 3KCPA 4G9DA 4TL5A 1Q0EA 4HHGA 1KB3A 1REIA 1A21A 4JFHE 3CZFB 4XB8A 1UWFA 1R0AH 3OB9A 2E7CA 1BIIA 1OF2A 2WIIA 2PW1B 5JMRA 1Q9LA 3G6ET 1SM3L 1RJZA 2QV2A 2BNUA 3SZ6A 3CH1B 1N2RA 1JWSA 1Z9PA 2OMXA 2WQSA 3U30B 1IKFH 1UA6H 1OM9A 3PHQA 5D6CB 5ABDE 4JG0L 4N3TA 3NYKA 2X10A 1MW0A 1U8JB 3MCLL 1OTSD 4JPIB 2RI2A 5IXFA 3M5AA 1TUDA 4YFEA 3LIZH 1VEPA 3T6WA 5J13B 2GCXA 3EG9B 3UEZA 1OT2A 2F54B 2R23B 3KYOA 4JUSA 4L1SA 3X28B 3W39A 2PF6A 1HAUA 3CBRA 1I1YA 4LLDB 2FBJL 3GBNL 2Y2WA 2CHXA 1A7RH 4LE9A 4MJ6B 3HKFA 2YD4A 4Z7UE 4M6ML 1MQKL 5FUZH 1S4IA 4MBRA 5C9JB 2B59B 3LH2H 3QUZC 4HCBA 3QZWA 3NZUA 1QSFB 5LL6S 2O9VA 2GBUA 1K8IA 2N1TE 3FQWB 3UX9B 1KLUB 1P4LB 1EZZB 5JIKA 2ZXEB 1CE1H 3L2WA 3CCUA 3ULUF 4HIQA 4PJDB 3NBNA 5E2UH 1M1SA 3DX6B 3INUH 3AC0A 4G11A 4V11A 4M6NH 3UZQA 2JIXB 2ZSVB 5BRZB 3NCEB 1WHMA 4XMXA 1W0YT 3NCYS 1B0GA 2X89D 1LO2H 5JHLA 4R2GC 4OD3H 4PRBB 1JPGB 4QOKD 1AVZC 5B21A 5DHVH 3KUFA 2X87A 3RI5K 3FU7A 4PY8J 1MJ8L 1XEUA 4Y0GA 1PKTA 1DBMH 2HT4C 4XGZA 1C5CH 1URIA 3VG0H 3HC4H 3C5ZB 1BF8A 2J4WH 3D48R 2CJ3A 1J1PH 3DYMA 1MRDL 4HKZA 1OAKH 1BCOA 1P7KA 2BSED 3UPRB 2ZSWA 2OW6A 4M7AD 2EAEA 1W2BP 3WLBB 1YWOA 4X5RA 4G42B 4ONHA 4YNYA 1HKFA 4P5KB 4KQ4H 4HKBB 1UB6B 5I30H 4XP6L 1MMGA 3ZJAA 1A3QA 1MH5B 5LJ3h 2HKFH 2HZHA 2AW2A 5MERA 3N42F 3D7SB 1N64L 1FDLH 2DH3A 5DLLA 4WW2C 1RAGB 1DLFH 1S7SB 4KJYB 2O5ZL 5J89A 3QDME 4XTZA 2VXQA 3STLA 1HI6A 1T2QH 1NUFA 5EHFA 3QDJA 2Y4XA 3QXEB 3CD6A 2QT6A 3MBWB 3T2NL 2VM4A 3TYGL 2E7DA 2R0WL 3HG1D 4HT1H 4OCSH 4Y16C 4FZEL 2H5UA 4YSPA 3BVUA 1HZKA 5FLVA 3BKCH 4QD2E 5EIIB 1P9MC 5GS0L 1XGYH 1P1ZA 3BP4B 4G8AC 2W1NA 3ZDXB 4CDGC 2CP7A 2J06A 2KXCA 5I1LA 4WGWB 1OTTC 1U8NB 5CD3A 3I56A 4M4RB 5F6HJ 3NABL 2JV6A 2XIIA 3PFQA 1I8AA 1HESA 1UATA 3MJ7A 2BMKA 2R0WH 4HT1L 1D5BA 2DTSA 5TH2B 3ZMRA 5JZ7C 4N0CD 1ZGLP 1G1YA 3GBML 3BJ91 3UFIA 2C9AA 4PJEA 4YBHA 1DP0A 2HJKA 3N1GC 2G5UA 4F2MA 1E4HA 3N40F 5T1KD 4OCRL 3PFUA 5C08A 3RGVA 1G7PA 1CD1B 1GAFL 2XZQL 3AREB 3J07A 3LQZA 5EU4A 2P4AB 1F1GA 5H94A 2F5AL 4XN8A 1Y07A 1TO5A 4AG4L 2QZQA 4YDNA 3LEXA 3RL2B 2Q76A 2A08A 4ODWB 3FYIB 1EX0A 1KY6A 1T83C 4HWBL 3MBXH 1EIFA 1XBDA 2ERJC 4L4TD 2IWGA 4ONGH 1ANUA 1KYOJ 3JWNH 1FPTH 5DVKA 3T0EE 2ROTA 4WWKB 2ZXQA 4NUGH 1UASA 2LT4A 2QEXQ 5AQ0A 4IUVA 3L1FA 3VYOA 2X9WA 3SCMC 3EGUA 1Q9OA 4TNGA 4NUMA 5BRPA 4JG1H 3RIAF 4D8OA 3H54A 5BRQA 5FOBA 2J73A 2C3VA 1BM3L 2P5WB 1PW3A 2P8LB 3MRLA 5H2BA 1PSKH 3OB0H 4WUUE 4A7GA 2L04A 2I60H 1A9EA 3SE8H 5DURD 2FHFA 2JKSA 3ME9A 2VLKE 5IB3A 1I4K1 3ARTA 4TRPH 1WVZA 1MF2H 1UWXK 1JGLL 3DX8A 4QHUB 5CJQL 3X3FL 1BJ8A 5CCKL 3D06A 3FUNA 3OL2A 3E8VA 3P4NB 3OBYA 3PG2A 2VXUH 3S2CA 1FFQA 1WHKA 2QPEB 4LQFH 3I50L 2N0KA 4LRIA 5AKVA 2WV3A 1G7JA 3NFCA 4HUWB 4X4ME 5FIEA 3CMOL 5D93C 2HSIA 2UXVA 3LPWA 2J72A 2Q7NA 3ZHFA 1XJWB 2W91A 4L1HA 3IF1B 4ODHH 1QNIA 3E2HC 2QPFA 3E19A 1VFAB 4EBQH 3QIUD 2PCFB 1FL6B 4HPHA 4OW6A 1U4FA 3L7EA 4AQ1A 4UINH 5J06A 2K0RA 2AK4E 2VZ1A 3WFDL 4W6WB 2A1WH 3X17A 1QP3A 4PBXA 2FGWH 3CSTA 4G3YH 3QDGD 4PRHA 2V8JA 1UM6H 1XT5A 3BXNB 4N0UA 4HWNA 5IOPA 5DYOB 4Q9QL 1E8ZA 3UG3A 1WZMA 4WHYH 2EDRA 2FE0A 3ECBA 3LXBA 5EEZA 5C0AA 3ASOB 5JIQA 5FPIA 4FQHA 4KULA 2DL7A 2IDCA 5AW8B 4GUQA 3N40P 3GPLA 1KBVA 2YXVA 3QIWA 4P07A 4HVUA 1CB4A 1HHKB 1E9QA 1WAEA 3BO8B 5DMGD 2ICEC 1FQ9C 1X5XA 1A02N 2AV7A 1Y1DA 1LO3L 4AQEA 2EEBA 2F69A 2FJGB 2P7TA 5E2VL 1HTYA 1UXWB 3WIHA 3UTZA 1NFDE 2UVEA 1JO8A 4B97A 5KG9A 5CMAA 2JKTM 1WZLA 4OCXL 3RFRA 3TN0D 2QPDB 1C6VX 1G7MB 3UERA 1ORQB 1INEH 1LK2B 2GQIA 2V2XA 4UQIM 5HD8D 3UGUA 2BFVH 1QSFA 4GRWE 1AMYA 4HCZA 2AV7B 2FEJA 2AZVA 4ORZC 5SX4H 1IAKA 1YNKH 1WT5A 3EJUA 4XWGL 4X8JA 2WOBA 1MNDA 1WP6A 3SO5A 3QJYA 1NEUA 1RMFH 2NT0A 3FFDB 3QAZB 4JFHD 5BO1L 5IEKA 1T1ZA 4TSCH 5GZND 4GKZB 4TMPA 3TTYA 4IU2B 3TZVC 3ZE0E 1BU1A 3FL7A 4H26A 3MC0A 5EOQL 1MHEA 3M55A 2IH3A 4B50A 1OLLA 4H8UA 4DVRH 1P6WA 5EBLA 3JV5A 3OV6A 3PL6A 2GSGA 3V6FA 1PJWA 4JPBW 2AQ2A 3F7PC 2DYPD 3GHEL 4NM8H 4E6RA 1Z2KA 2EC9U 5IBTH 2JMCA 1B0RA 5JDSB 1M7IA 3WNOA 5GJTL 5IEKB 3MLWH 3KWTA 4G9FB 4M8RA 2OJEA 3AM8C 1AKJB 2DX1A 2BDNL 4PS4L 5HYJA 4G5AA 4MYWB 2NY7L 4RRPM 1HL5A 2Z8RA 3I6GB 5E9DB 1WA2X 1O75A 5TE7L 3KPLB 3CK0L 1J5OL 3J81E 4DBHA 1U2YA 4RAVA 4CJ0A 2Z7ZA 1CXFA 1UCTA 2I32A 3P4OB 5KVGH 5DFWH 2XWXA 3GJFK 1N19A 4W9ZA 3S37L 5DT1H 2DQFA 1PEZA 2GQVA 2VMFA 3SDCA 2O4EA 5L8KB 5E8OB 3FQNB 5SWZD 1I1FA 4J1UB 1CR9H 4I18B 1K8DA 1WA7A 1QP1A 4LCWD 1XH3B 3KXTA 3FQRA 3L3HA 5DLMH 4J3OH 4WUKH 3I56Q 3LHAA 3CD6Q 3LVEA 1WWCA 1GJIA 2IPUK 2P5PA 5KBKA 3SCMB 3C2AL 4U6XB 1L9MA 2VWEE 3BUBA 3DV6A 5CGYD 1OY3B 3JV6A 2DNUA 3IDYC 3VI3B 4YR6A 3QEGL 5ANHA 2C34A 2Z9TA 2EDFA 2HVKA 2X6BA 3OWRA 2Q1EA 1R3LB 4BFEA 5CO1A 3UO1H 5FGCE 1NLDH 4AY0A 2EDJA 4F7PA 4N22A 1WIUA 4JFFB 3ECQA 4LSSL 4JJNK 3APCA 5CZXD 5AYUL 1NZRA 5IW1A 4WWNA 3MJ9L 1WYJA 1CDIA 1AWJA 2DIQA 4GT0A 1EXGA 1NEZA 5EU6A 4POYA 3M4YA 1KYDA 1ZSZC 1K8AU 2CO6B 4TPRL 4TUOA 1VQ8A 2V7HB 5A0DA 3D33A 1VQ9T 1EO5A 2FATH 1JPFA 4TQHA 3QULA 3M17B 3LWHA 1HE8A 2R4RH 1OM3H 1J0KA 3QVAA 1YITA 2YAQA 3GUTB 5FW9A 2CKKA 1OGAE 1SJMA 2C3WA 2K70A 2BS9A 2IPTH 3DVGA 4G7QB 1E50A 4UOQA 4QHMB 2VDLL 2AGJH 1EDYA 1NGXA 3ULAB 5IJVA 3RVWC 1C7TA 1U9KA 3NH7H 6FABL 1JGDA 5KJ4A 4FYWB 2RJFA 3DHUA 5HD8C 1EV2E 4M1CC 1R77A 1JI1A 1L7IH 3LV3A 4EN3D 1G9NC 2CJTA 3QUYD 5F7HA 5IB3B 3QG1A 1XCWA 1SEQH 3EOAB 4B9XA 1FHNA 3VFWB 3ZKXB 2UX7A 4IMLA 2V0AA 4M8VA 1XF3B 5GAOp 43C9B 2VDLH 5I16B 1CBJA 1YQ2A 2CHDA 4NIYE 3SE9L 4W9CC 3ZHKA 1W72A 3QO0A 1BV8A 1CGUA 5C0AE 3V4PH 1R0CB 4GBXA 1S7SA 1U8OA 2FECL 4KJYA 1AOZA 4CNIB 3KLHD 2IF7A 1CLCA 5GMKl 1OTUC 2VDQB 4MWFB 3ARGC 4ZXBA 5LDSA 5J11B 3EYSH 3R19A 1HEZB 3WELA 5FO7A 2WYHA 1JZJA 2LP5A 3OYBA 1ZANL 4XC1H 3LRHA 4FNQA 1V7ML 3IU3B 2Z6FA 3A22A 3IBOA 1EAJA 3C2AH 3GPSA 2OYLA 3RPBA 2Y5TA 2GJ6B 4OI7A 4BDVA 4OGEA 5FGSA 4U3XA 4Y5YB 2H2PC 5INDA 2WZ0A 5EZJA 2I69A 3A47A 5D1ZI 1JHLH 2DBJA 3SKMB 3AM8A 1P5UB 1MCCA 3FSOA 5E0QA 1XCQB 3CHOA 2Y36H 3SY6A 3OS0A 2F15A 3HC4L 3NQIA 5C9KA 4XCCH 2BJMH 4XPBH 2XSKA 4HCRH 1LLAA 1D6EA 5D2LE 5DC9B 3EYQC 2ZCHH 2ZUWA 4XOEA 1XV8A 1RAAB 3P4MB 1FJ1A 4RIRA 3PNWA 2HFEB 5DJ8B 5JW5A 3C6LA 4HWZB 2OI9C 1W6WA 4ZUWB 4KJPC 4X6CB 1OGAD 1I8MA 1NYFA 2E75C 4U6YB 3DB3A 3U9WA 1PZUB 1WFMA 2F19L 1R5IB 1TZIA 2DS4A 1I9JL 4E0RB 3UBHA 2R0ZH 2DQDL 3JCMQ 2ESVA 4KJWD 3SDAA 2N7SA 3DX9A 4I88A 1KTBA 2N59A 3G6JE 3OHXB 2GTWB 2ESWA 1YJWT 4LOEA 1VQNT 2WVVB 1NCNA 5F7UA 2JKWA 2YAPA 1K0XA 2QFRA 4ZUTA 1R5VB 4QYOB 4X6BB 2IADB 2OL3L 5D71H 3D25B 4QNPE 1G84A 2QYZA 2OL3B 2ZONA 1K9MU 4OGXL 1JGUH 2X89A 1Z9LA 1DVXA 4OZFA 3LOWA 2R1XB 3DIDA 1GGUA 1L7IL 4QVZA 1UH3A 1ADQA 4LFHG 4CSTA 1PX4A 1TJHH 1PM3A 1N0LA 1U6AH 3T9NA 4JO1L 2DYBA 2COYA 1PZ2A 4JFQA 3I6GA 5E9DA 1VACB 3R18A 3P1VA 2MOXA 2MHAA 3VXUE 5BXFB 1WZAA 3TEWA 3P73A 1OL0A 2J4WL 3DX7B 3BISA 5KE3A 5GGUB 2ISDA 2DRMA 1EEUA 3M7FB 5JDSA 4NO3B 2N01B 3VNYA 2D7MA 3K6IA 1RIHL 1A7QL 1TVDA 3H42H 3FOMA 9CGTA 3CC5A 2FATL 2IH3B 4XP1L 1AFVH 1NKRA 4H7VA 2WW8A 2V2TB 3WFZA 1F58H 3HR6A 2EGAA 1YJNA 2J6EL 4FNSA 2X2HA 1GBQA 2IMMA 4I5BB 1ZAGA 3FRUB 3JCMb 2ZUTA 5DZNA 1CYWA 3NFSL 2ZF9A 4XTVA 2Q8BL 3APNA 1T4KB 3IN0A 2LTOA 2BVEA 5H37A 5B8CA 1ZEAL 3QPQC 1DSFL 3RY5A 1X3DA 5EF3A 1P4LA 3KPPB 2FWUA 1T2QL 3BT0A 4Z89A 1MELA 3L3OB 4PG2A 1BM7A 3AXIA 4QLWA 4RMWA 2AXFA 5CBAB 1SY6L 3JV4B 4NKDA 4BH7A 4YPGA 3V5DA 2XKNA 3GZQA 5C9JA 4KXZI 3BLKA 2Y1ZA 4CGTA 4HC1L 3I50H 3ZYZA 1YJDC 2OMNA 1MV3A 5I22A 1GHFL 1DVTA 3GBDA 3CN1A 4MQXC 2NY5L 3L54A 3VXRE 4L5FE 4NJAH 5DHMC 2DQCL 3S96B 1A64A 1JGLH 2W07A 1NJIR 2P5EE 4PRPE 3X3FH 1FC2D 5CCKH 3JCMd 4K2UH 3CBOA 3F7VA 1BG9A 4N2MA 3SKUD 5E99L 3BSHA 3ARUA 3COOA 4B9FA 4KMTL 3AZUA 5L7XL 2ZUSA 3IETB 4F7CA 4HF5H 1UJTA 1HH9B 3HC3L 3KAAA 4AL8H 4XVSH 2OPCA 1LL1A 2VN5A 2BNUB 3THMH 3R0MA 1FGVL 1HHGA 3ULRB 4FABH 4MKMA 4XX5A 1FYHB 2AQ1A 3ECWA 4N4GA 2I7OA 4GEIA 5BV7H 3BGMA 3RUGE 2DXBA 1Q95G 2A28A 1YJNT 2WVTA 1MCDA 2IWKA 4JM2D 4P2OA 3IDJB 5TGBB 5A1AA 5H35B 5CAYB 2RA1A 2D6FA 4G6MH 5D7IF 2FL5B 2OV0A 3NACH 2VB5A 4WGKA 3KVPA 4OKVA 3OJ2C 1G7HB 2BJML 1Q72L 5E00A 1PLCA 2AABL 2HLAB 3BWZA 4C83B 4UTBA 4ZQTA 1TVHB 2NNRA 3P54A 1KCWA 1EANA 4PJOC 2BS71 2QI2A 1UD4A 3GDCA 3PWPD 4R4ND 2VZOA 4D0CA 5HDBE 5T8IA 3WNIA 2XDHA 4ZMQA 1OOWA 3QS2A 5IQ9A 4MMKA 1DBAH 3OXSB 3HA0A 4GLMA 4GSDL 2RTTA 1NMBL 2DLGA 3LMJH 3ARED 1T6VN 1SRLA 1KXQE 1TNNA 4LSVH 1UWEL 1I5OB 1A7BA 1M6UA 2ZKHL 3RE0A 3VWKB 2YD6A 1TJIL 1FFPB 3O4LA 3CPLA 1R5WB 2DTML 3Q13A 4NCC2 1AXTL 2V1QA 1A6UH 1KCSL 3GGWA 4L3EE 1E6HA 1M7XA 5AZ2L 2BFVL 2GFUA 3KS0H 2LOEA 3G5VA 1GSKA 2IV8A 2XXCB 5B22A 1HT6A 1LCKA 4K9EH 3V4PL 3WFHA 1D0YA 2UZXA 2DMOA 3QHZH 1OQXA 2G60H 4Y9CA 3HB3D 4NKMB 4NQDA 4P46B 1FV1A 2WBJB 5HHXL 2LQRA 3NMEA 1GTNA 1CKBA 4BI3A 1JWUB 3GMLB 4BXVA 4XT1C 3UP1A 5BRZE 2CLZA 4HBCL 2MRYA 5EZJB 4CKVX 4QXTA 1RMFL 3RURA 4EUPH 4A37A 4JFDD 4H8WC 3VD9A 1F3DJ 2WBKA 1IHWA 4P2QE 2CO1A 3WNJA 3V6BR 4J6RH 3QQDA 4WEBL 3HZVA 1F45A 2JK5A 2OCFD 2WJ5A 2Q87A 5F1NB 5ECJE 3C9NA 3ARDD 4XO5A 2A99A 4Y19E 1W91A 3V4VL 2PABA 1ROCA 1E6OH 3AAZA 1KDJA 2ROXA 2WWKT 2JIXA 2WB7A 1NBCA 2DEYX 4WCYH 2EFIA 2VSKB 2CBQA 1O6SB 2OTJA 4XK8E 5AG9A 1UD2A 2F53E 5FYKD 5C0GA 1MGQA 3FJPA 1DVZA 1BFVH 3HHSB 4JJ5A 1KY7A 3KLSA 7PCYA 1SUHA 3QXVA 1KIPB 1MFAH 5IBUB 1B9ZA 3QEQB 3ISYA 2CALA 2IC2A 3CXHK 1FFOA 4M7LT 1ZV2A 4JFZL 5E6SB 4OJFH 5IKCB 2H32A 3WUWA 3QUXC 1SF3A 2J25A 5BZWA 2F2HA 5JHDA 2VYTA 1QSFD 3OBAA 3IVKA 1VQPT 2XZZA 4UT7H 3VGDA 1WJQA 1PZSA 4W6YB 5B39G 2X4OB 4GRLC 1Y57A 3O0RH 1C5CL 2HH0L 5D8JH 5T3XD 2R2EB 1M1XB 4X4XB 5ANME 3VG0L 1A7RL 3KYOB 1JG9A 2D8HA 3DVGB 1CE6B 3I9AA 3LQMA 5D1XA 3DA0A 3ZYOA 4ZYKB 1G3WA 1EO8H 1KGUA 1U3YA 3G6AA 1T0OA 4TSCL 3T5WA 2HTLC 2ED8A 2XXMB 3GEFA 3T0EC 2RHIA 3I75A 4XPFH 2QEXA 3UYRL 1BX2A 3HR5B 1BQSA 3Q1SH 1L5GB 1DR9A 2BE9B 4UNVA 1A1NA 4S0HA 1I9EA 4KROB 1BOGB 1PD0A 5EOTA 1ZLSH 3B43A 2X0WA 3HZMB 4ANXA 4RCCA 1A0NB 1OCWH 1TYJA 2Q2LA 5HGHA 2DJUA 3UC0L 1WFNA 3SQOL 3WY4A 3VX1A 1F56A 5DJXB 5F9WC 5C0RL 3OGOE 4J9FA 1RJYB 2YLKA 1BOYA 5EUKB 2BSSB 2TSBA 4ZPTB 3MPUB 3DX3A 4AG4H 3NSYA 5J6HA 5LNGA 1AO7B 3X1FA 4R6UA 4XBPA 1SMAA 3QUGA 1NBVL 4M93B 4B5ZA 2P48B 7TAAA 4PTTB 1UJ3A 5EC1B 1X4ZA 5F7WC 2XIBA 4FADA 4JO5A 4NFBA 2QTEA 5DMIL 4JKPH 5LXVA 2E9GA 3DBSA 4WJ5A 3JZYA 3JWOL 4V1DB 3KFVA 2CIKA 3NCJL 1JDCA 3BYTA 4JG1L 5K69A 2VN3A 1JQQA 4UV7L 4XCNA 4H1LB 2VW6A 2EP6A 2Y6TE 4MNQB 4B9YA 3D0VA 4NP4H 1VQMQ 1NBVH 1TFPA 3L1EA 1E7OA 5I8OL 2W59A 1R9FA 1D6EB 2RA2A 4Y1AA 2B1HH 3EJTA 3FU6A 4C56D 2P3YA 4AW7A 4FXTA 5ESVB 5GGSA 4UNUA 1AR1B 1ECZA 3FN0L 4Z7VE 2J8UA 3RZCC 2C5DC 2W81C 3D2TA 4LVNB 1E9PA 4NUQA 4WFHE 5IW3A 2NQCA 1Q7YC 2CDFA 3G9VA 4JFEA 3C8DA 1F4XH 3VU1A 3D09A 1QVFP 5IB1B 2CR3A 1JPST 4ZNEE 1L3WA 1BZOA 3QRGH 1BF2A 4IRJA 3ZQWA 1UEMA 3RGVC 1UD5A 2F53D 3FDWA 5FYKE 5DJ0B 1UZ6F 2JTFA 2BWDA 1LD9A 2NY4B 3PL6B 3U9PL 3V6FB 3WEMA 4P2OC 4YS4A 2CJUL 5I26A 5TFSH 5K9OB 3CZUB 4JDVB 4ZUVB 3UDWA 1AHWB 4ZXBB 4ZAKB 4N8UA 5FA3A 1NEGA 2A77H 4J7FA 2D7TL 2EJFA 2BIPA 2AHJB 1OF2B 2D2CC 4JCWA 4ZNCD 4CC7A 2BXYA 4G7SB 5FYJE 4BYHA 3VS4A 4E9SA 1MFEH 4BFFA 1PY9A 4QRTB 5JA9A 4WI2A 5D7HA 3QJHA 4Y5VA 4E47A 4A7SA 1RUKH 3FU9A 4GRWF 4X5XA 2H47C 4NQDE 2BRRL 2IPOB 1FCCA 2E76C 2V2WB 3NZHL 4R83A 3UATA 4ETYA 2X6VA 3D12B 1CFSB 5B38G 4GS7C 1RLBA 2DLTA 2WUBL 4RGOL 4E9XA 1RZIA 5C0FB 3ZSTA 3G6DH 5I5IA 3FU0A 4ZS7L 5JIPA 1YMME 2LVCA 4FT4A 2WXRA 5EBMB 5C7XH 5EG6C 3QDRB 4K7PH 2ZWNA 5BZZA 1H8OA 2XPZA 4G6FB 5E2UL 3IE4A 1TJXA 1F8TL 1U3JA 3ZKXC 2IG0A 4G82A 2UXTA 4A63A 2OAWA 4HKJB 3S3OA 1CDJA 2KT8A 1AOJA 5GRJL 4WHYG 3HE7B 2L89A 3QEHA 4F58L 3L9YA 3E9FA 1TOVA 1DQMH 4MS6A 4PLOB 3EFFB 2X4UB 3EW3B 3QIUB 5EU6B 3VI3E 2CKBB 2YUVA 3KBFA 3ZHLA 3HB3C 4YHYC 1JV2A 4C8QG 3T2QA 3BZEA 5HGAA 3UBGA 1QCOA 1IGJA 3RWHB 4F8PA 5JIIA 2NY0C 1ESOA 3IAQA 2RH0A 2UZPA 4HS8L 4PRHB 1OAZL 2WBJA 3T3PF 5KZCD 4NKQB 4BWWA 4UM8A 1QOKA 3MBED 1NBYA 4OZFH 2R29H 1N8ZA 3C8KB 3OYJA 3PGDA 2DWYA 4HSAC 5C6PB 2B16A 4JGNA 3OY9A 5LNDA 3RBGA 3GQFA 2LFGA 2VC2H 4NOBA 4QO1A 5JORB 4WK0B 1YSOA 4BCYA 1KQ2A 2NSMA 2WK2A 3DX6A 5I18L 1HILA 2GK2A 1KXHA 1ROWA 1ZLUK 3W81A 1HZHL 3NCXA 1AOHA 4ELKB 2OK0L 4NZRL 2OMVB 4KTDH 5GAMj 1DJIA 5I74C 1TQSA 3QBTB 2VAAA 1INQA 4NO0A 5KBNC 3ULVF 2EKSB 1DSFH 3O4OC 2WQWA 1O7VA 4JFSA 1EVTC 3SBRA 5JIDA 1O6VA 1K8DB 3D25A 3QJUB 1S7WB 5FYLH 1T03L 5FAAA 1N9PA 1G3YA 3VKIA 2WWMC 2GY5A 1B2YA 4G9FE 4LSQH 2K45A 1B4JL 4N1CA 3W56A 3HW7A 2NW2B 3VSUA 1UM5L 4Q9RL 3BDXA 2DXCA 4NNXB 1HH6B 5E1AB 5AOKA 3UH8A 5AUMA 1KIPA 3ULVH 2PWGA 5EG2A 2B20A 3M1BB 3I02A 5CCJA 1AQKL 1SQMA 5JHAA 3IN2A 1O6SA 1V3MA 3L16A 3D34A 4QDGA 4EZMA 4QO1B 2YPKB 3C94A 1UT9A 2CM5A 3UAJD 4C0DC 4OCNC 1LP9B 1T0HA 1NSNL 5B1JC 4BFNA 3WUWG 2GB2A 3WFEH 4EVNA 5EZLB 1N8ZB 1U6AL 3MSPA 4JO1H 3OKNA 5GIRB 3BOVA 3Q8AA 4JBSA 4ZAKA 1I8IA 4PV8B 4OF8A 1E2VA 3RR6A 4QTHB 4EEEA 1EJFA 1NCDL 1Z9SB 2IPTL 2RJDA 5LN4A 3NTCH 2UY6A 4C5HA 4Y5YA 1LWRA 2NYZA 3OSSC 3NP4A 4CC3A 3H55A 2BNRD 2BIVA 4AL8L 2MTAA 3J2PA 2BP8B 2R51A 2VTFA 3IDGB 4HS3A 1BLNA 2GCYA 4MZIA 1GCQA 2CG9X 1DANT 4G8IA 4RVBA 5IB1A 3N85H 3V8OA 4WLCA 5K9JH 5PAZA 2C9QA 2CREA 4YQXL 1VQOA 3TT1H 1RHFA 1BFOA 4YK4B 1EUUA 3FBQA 3VFNA 5I6OA 1G7QA 2FR4A 3D07A 4J8RB 4OGAC 4NPKA 4BINA 3RERA 2ZPEB 1KIUB 5FO9A 3TA3C 2LR4A 4QKXB 3X12A 3BH4A 4Y1AB 1PIFA 4YFDB 3P2DA 3KXFA 1WCBA 3CSGA 3AMKA 1W1FA 3LIZL 4KDWA 1I07A 1JJ2A 4QR7A 2DWSA 3KM2A 4HJSA 4H1LA 2EKOA 2ZIDA 3NCJH 3DDFA 4IKLA 5M94B 2D31B 1JSYA 1ZPLA 4XMWA 3ILPA 1MFDL 3NJHA 4ZOAA 4OFYA 3MRGA 1CGWA 1WICA 4MJ5A 1MY5A 4YZFF 2YRCA 4Z3EA 3RVUC 1OKEA 4DPCX 4DESA 1SY6A 1DVQA 2BVQB 3U9PH 1BMWA 3HNVH 2X35A 2WXIA 4NL2A 1CE1L 1QVGA 1VCAA 1BMGA 2EE6A 1OP5H 2OJZL 4KUDK 4CW1A 1S9VB 2L3BA 1B4RA 4KGVB 2DYSB 1PS3A 1HXKA 1AHWC 1CT8A 3X1BA 2I85A 2J1YA 1YVLA 2J1KA 2CO6A 3S3SA 5A2FA 1AGDA 1RUKL 3GSNA 2XBZA 2EYYA 1DN0A 3WNNA 4CSZA 2YEQA 3VE0B 2RHXA 1GOHA 2HAZA 3VFRA 4ZTOL 1U8CB 4Y5VC 1A3LL 4PJ8D 4Y4HC 2ZZDA 1Z9MA 1AACA 1SOKA 3AG4B 4RMVA 3ROOB 3WY3A 2AAVA 2ZJSH 2VR9A 4EKJA 4DGIH 4FFTA 5GANh 2DI9A 4F14A 4E9QA 3MN8A 3BQUC 4A6YA 3U7WH 4F1ZA 2C1PB 2LABA 3FNKA 4PJEE 1G4RA 3TGXA 4O2FB 3RA7H 3QK0A 1D5IL 3IXAA 1PG7L 2C3XA 1U95A 2IH9A 4J3OD 5DVMA 5HDOA 4KXAA 4PMEA 1NCTA 3TEYA 3HI1A 1NC4D 4PP2B 1ZA3B 2XFXA 2Z35B 4LHUB 4P4KA 1KENH 5D1ZB 5D6DC 3O4LD 2D3VA 4G7RB 4M78A 4J3OF 5J1AB 2R4RL 2ZJSL 3DMMB 3S36L 1MNUH 1XF4B 3W11C 4CADA 5JW4N 4PFPA 2DD5A 1U8MB 3G04B 4AKPA 5JNYA 4LCWA 2J12B 1J11A 3VH8G 1V3JA 3Q05A 2R56L 4X7TB 4PY8I 5I0YA 3H4FA 4E5XA 4BZYA 3HHSA 1I31A 1HYSC 5GJVB 1SHWA 2VR4A 1NC2B 4LLDA 3G71A 3HN3A 2Y06L 4J7IA 1MRFL 2PCYA 3MROB 4L3EB 4NJ9H 5KUMA 3ZIYA 1F4YL 2X4QB 4OGZA 5ICYA 3PIPA 1QZNA 4ZOBA 1ZHBA 1NM9A 3Q8BA 3OKEB 4KKAC 1RZGA 3ARBB 3JUYA 5IROA 3V9EA 5AEAA 5C0DB 4UB0L 2LAAA 1ZHNA 1ABOA 2OQJB 3L1GA 5ENWB 4FNRA 2R7EB 4PJIB 2LQKA 2XHNA 3HE6B 1R17A 3MRFA 5GAOn 4WVRA 1O7SA 5EU4B 5JHLH 1VGKB 4FLRA 1TTHB 1Q1JL 3P73B 5GGUA 3MLWL 2CHNA 2YWZA 5D2NA 3TWYA 3UTPD 3LEVH 3E1SA 2WNGA 3SYQA 4J2XA 2KRSA 1EFXD 4KROC 4QOKB 5IHBA 4HUNB 4HZLA 5ICXA 3ARWA 3DARA 1BK2A 1TQBC 3S6CA 4J9IA 3S6WA 4BWTA 2PTVA 1QVGS 1JU5C 1HHJB 2FECI 4DAGH 1IRAY 3S97C 5IHKA 5ILTH 4DP9X 1BZ7B 2AK4A 3X1NA 4M7DB 3K8KA 3TCXA 3AT0A 1XAKA 4Z5RA 5IFHL 1MRCH 4Z7WF 4JFVA 5JLZA 3MUHL 2F2VA 2XN9E 3AWFA 2P49B 2VDRB 2J6EH 5AOJA 2K79A 2EKSA 3CX5K 3DDGA 1T21A 3HG3A 4RGMC 5C8JA 4KK9D 4MLIA 2Y07H 2QADB 2VMEA 2I9TA 4D9LH 1QFWM 4ZDHB 2C0OA 3B83A 3JCMh 3A8GB 1RK1A 5E2JA 5A7BA 4MDIA 3C5XA 4LPWA 2DZCA 5CKDA 5A0LA 4ALAC 2JWYA 3GLXA 1SLWA 3BIKB 5FM5M 3SE4A 43CAA 3TFKD 1QA9A 3ARZA 1YN7B 3S35L 1FE8L 1A0QH 3VDBA 4G42A 1TZHA 4ONHB 2F1EA 4BACA 3C6SB 4G9FD 4FCAA 1DZ0A 5ACMA 1J8HE 1RI0A 3RWCA 1D09B 3EO1A 5JUEL 1IAIH 3SKJH 4ATOA 4D9QE 5IF0B 3I84A 5KSVB 3IXTB 3MKKA 4R84A 1FN4A 4RLDA 5DD3H 3CHXA 3CLEH 5IR1A 1P7BA 1OXYA 3IK2A 3ALXA 5AKTA 4JLIA 3CWGA 2PPCA 4FLSA 2RALA 4NJ9L 1D5ZA 3NJKA 2F5TX 1F2QA 3OB8A 4U1GC 4D8PB 5LJ5j 1S9KC 4HK0B 2BVTA 2JCCE 5IGXH 2LX7A 4M75C 3OB0K 3NTKA 5AW2B 3VMOA 1VQ6T 4KNUA 5DFVC 3BD5A 4JCMA 5E4OA 3ZPDA 3DJ9A 4BD4A 4CNIA 4HG4J 1QRNE 2HTKC 2Q9OA 3CLEL 2DJQA 1BF5A 8FABB 5I6NA 4KVNL 3PGCB 1BVNP 2KEAA 4U1GB 5KVEL 2I9TB 4QRUA 4D0DA 4MDIB 1MJJA 3OAYK 4OZIE 2ZOKA 1SZNA 4JUTA 3QJXA 2P28B 3SWNC 4ZMXA 1CBVH 4M6OH 4NC1C 4DBQA 1R3IH 3EAKA 3QYCA 3T4YB 2WXMA 4RDQG 4OJAA 4Y5VB 4B0MB 3T4AB 1D3BB 4OD2B 2E41A 4HIJB 3FRPA 1KGXA 2GTQA 2CK0L 2CO3A 4L2YA 1U5SA 1BD2D 3DTDA 4PBDA 3QDFA 3K2IA 2LVMA 3LRSA 5IMLA 2Y7QB 5T1KA 4P9HL 2RHYA 5FO2A 2NMSA 2VL4A 4LCCB 2QGEA 1C8PA 3QUZB 5F96L 4YWGH 3F3HA 2PO6A 3TVMC 3T71A 4BA0A 3FF7A 5I2MA 1ZBJA 3OYCA 3OPUA 2XDDA 3LX9A 4K94H 4RKUE 3OS1A 1QRKA 1T7ZA 4MVBD 5EBWB 4KTGA 4XOCA 1PKSA 3HG0A 2BLFA 4TM9A 2FEDD 1MFMA 5LJ3e 3AQDA 3H3PH 5DEJA 1UVQA 4K4KA 2X4WA 4P0DA 5IHZB 1H3HA 3NZ8A 5E6RB 4ALAL 2EQKA 5BCAA 1RU9L 2VE6A 4DEPC 4IRJC 1SHMA 4XBMA 2QGGA 5D2LB 2XY1A 4F7UB 5FYJD 5FECA 4K3EH 4MKTA 2OR8A 4Z0BH 3RTQB 1RSYA 4U6HB 4M78C 1LP9A 2VUOA 4LOUD 3P40A 3M54A 3SBWA 2VDPH 5D7JC 2FBRA 3MA7A 1LQSR 2ZWYA 3IJHB 1HSQA 3K7UA 2PP9A 4AMKL 3ENEA 4EN3C 1KTDA 4IGBC 3NJLA 4AM0Q 1CLZL 3UZVB 3VD0A 3FTUA 4YHIA 1R47A 4LE8A 2QDYB 2A9NL 3GMMA 1F3JA 2Y06H 5EU6E 4AVJA 5IWLC 3JCMW 4J1UA 4KHTH 4WKZA 2KH2B 2CBMA 2ZPHB 1SHFA 3SKOA 2E70A 2XWDA 1LVKA 1XOVA 2B1AH 1T03H 2YBRA 3FQ4A 1FFNB 4L9LC 4IRZH 5I11A 5I21A 1J8SA 5DJYA 4IIMA 3JT0A 4EAEA 2CWRA 5IBUG 4ME7A 3T3PE 1YWPA 2D9TA 1QW8A 3TN0B 5K59E 3ZZ1A 5C09A 5HXMA 3IU4H 4E2FB 1HCYA 2ZUQB 5BZDA 3RVXC 2JMAA 2Y6SC 3KCWA 5IQMA 2OCCB 3FPYA 4ZMAT 3MBEA 5HGHB 3IWVA 3UJTH 1T0NA 3F5WB 3GSQA 3SPVB 5E7FA 2VDPB 4X6DF 4FXKB 3FSZA 3NIFB 4Q8BA 1TTGA 1JOIA 4QHLA 1CE6A 5GAN4 1BOGA 1I8LA 3FTXA 3DO4A 3VQ1C 4EMHA 2B0SH 3ZE2B 4FG4A 4PJJA 4ELYC 4HX1A 5FA4A 3W3BA 2JKNA 1MRCL 3Q2NA 2DWEB 1O9ZA 2CAKA 2ENQA 4ECNA 4JFYA 2JNGA 3IKCB 4HUCA 5I5RA 2HRPH 3SE6A 4MRBA 4NO5B 4APXA 3QORD 5I76A 5IFJB 1NCUA 3K91A 4X6DA 2R5AA 5HBBA 5JIMA 3U4BH 4NL3A 3PWVA 5I74B 5E9NA 1JIBA 1RI8A 5CJXC 4ZFGH 3BVVA 3OD3A 4TXVB 5I1EL 3SKNB 1BSIA 5KH6A 3LNHA 1RAEB 2NUTA 1XZWA 2DD8H 2QPUA 2YKLH 4QRBA 3CEYA 4A2HA 1QAWA 2YLBA 2QDWA 2CJSA 2ZX5A 3K81A 4R9HA 4X4KA 3SE4C 5B1BB 5D6YA 1C1EL 2AEWA 2XWTB 3OQ3B 4JDEB 3FB5A 3S36X 4B27A 2YPLA 5JMOC 2VLJE 2D7QA 4PRID 1DQKA 5IJVB 2TAAA 4WSKA 1D9KA 1CIDA 1FVDB 1D5MA 1DHKA 3LZFH 5AVSB 5AYFA 3H0TB 1UVQB 4UDTB 1CS6A 3Q48A 1B07A 5LBSH 1P5VB 3FF8A 3DTXB 4HEPA 4KI5E 1HNGA 2B5IB 2D7OA 4XNXH 3CZKA 2CSQA 3GM8A 5DXWA 1CD1A 1QSEA 3D85A 3QDMD 4KPHL 1OP3H 2E65A 2N3JA 3VGHA 5FXCH 4D8KA 3L95B 3SDXE 1ZTXL 2APFA 4X0KB 4YLCA 4KK6C 3LQAH 3CFCH 3JCMg 3QZ9B 2V26A 5I1CH 3QRGL 1SJEA 2VUYA 2YUWA 4BSWB 3MV8E 1BYMA 2EH7L 1R0BG 3HLKA 5MHSE 2VC8A 2B77A 3EKCA 4AFUC 3JYCA 2WYTA 1X7QA 3T9WA 2K6YA 1JE6A 4M75D 3NIFE 1GOGA 2JIXD 3K71A 2JLPA 1ZVSB 2ZOLA 3IJ7A 1ZVHA 5T1LA 2GSIB 2YRBA 1F1DA 2AQPA 1QQJA 2SEBB 4TLKA 4XWOD 2WZAA 5D4QA 2BOLA 3W5MA 1N7ML 1PY4A 1ONQA 4XZUB 1JNNH 4RETB 1D3BA 3L9BA 2XWCA 3P2TA 4YHLH 1VQ5A 4B9PA 5A3ID 3T65B 2R0LL 3DVNB 3ZRCC 4O5LH 3M58A 4XCEA 3UG4A 3RDJA 1HD3A 2CLVA 5LWYH 3MNVB 2VXTL 4LCIL 3PWUB 2AJSH 2Z92A 4CBZA 4MMYB 5A2IH 4I9WD 5GS0D 2XBDA 3L6FA 3O8XB 3FMGL 5T3XL 4C54A 4XU1A 1FZMA 1JNHB 3UBXI 1EGJA 1WQWA 1RQ5A 3ULSB 3UPRA 4XNYH 1AD5A 1I7ZB 4H8VA 2DLFH 1NMCB 5HHXH 4ETQA 4H20H 3ULUH 1AP2A 1VA9A 2FH6A 5GZOA 1MCHA 1KJ3L 4GQQA 4DQOH 1UEYA 3TVMD 3C8KA 2E12A 4J9GA 5CCHE 5FX3A 1WZOA 5KSUB 4OB5H 3A8HB 3VRYA 3KPMB 4OUOA 3U1SL 1IGJB 3RWHA 5BUPA 5MEPA 1ZLMA 1L9TA 2Q3XA 2HT3D 2QQNL 2ILLA 4MSWB 2X6UA 4IOSD 3MOQA 4NO2B 4Z3GA 2KBTA 2NCMA 4PBVC 5EN2A 5D1QA 2Z92B 1OPOA 2R2BB 1L0XA 1AAJA 4GXFA 4ADIA 4TSAL 2QQKL 3D3VA 1S7UB 2YUXA 4A38A 3VSTA 2MOQA 1TTAA 3MOBL 4ZBJA 1JXOA 3VYHB 2B3IA 5DC0A 1WBXA 5IVXF 2DL2A 1YNZA 3ABLB 3ORJA 3AJ7A 4OFVA 1QKXA 4OZGA 3CTTA 4NC2B 4OZGF 5GRJH 4ZK8A 3UO1L 5E4EB 2X09A 4UQ2B 4XVUC 3IFNL 4IIQC 4KH1B 2JH2A 3D87B 12E8L 5DD1H 3MBWA 3BHBB 3LSOA 5IHWA 1MAMH 4JVPA 4WO4A 1ZJBA 1MHCB 2CA4A 4RMSA 1GCFA 1F1BB 4Q52A 1NGQH 2WBWB 1THAA 3MGTA 5ADOH 2LFEA 4Y4KD 3G6DL 3PHQB 5D6CA 2D03L 3FK3A 2GJPA 2F8XC 4IUTA 4ABWA 1YIJA 4MMXB 5DJZB 3QWQB 4OQ1A 1NC4B 1AQKH 4GW4A 1X9UA 1TEGA 1IARB 3S4SA 4OZIB 3HFML 3ABZA 3WS3A 2ZPKL 2MCPH 3RVXD 4F5CE 1TXQA 5DK0B 3VXRA 3CDGA 4AIZA 1L0YA 5DK2A 3ZDYF 3W1ZA 5L4JA 4YHZH 3F85A 4QXWA 1QRNB 4D9RD 1BD2A 2WVUA 3BVXA 4GUPA 2X9ZA 1DZBA 5CEYA 2W60A 3RNQA 2E3HA 1R3HA 1S7QB 2W9DH 3BP6A 4KNQA 2C9PA 3O5ZA 4JG9A 1NMCC 2AEQL 4DKFH 2WVVA 3EF4A 2OJ2A 3MNZB 2NXZD 1MMNA 3HIZA 5ID1B 2RMOA 1TQUA 3ZKMD 2FVNA 4Z3IA 1LQBC 3CXCS 3T3MF 3GF5A 4ADGA 1L9RA 1MFBL 4MXVE 4JKNA 4DPAX 3P8HA 5CO7A 1TTBA 2YAMA 1I75A 1LK3L 2NY5C 3BCDA 3M8OL 3RDTA 1MFAL 4EUPA 2EEXA 5KYUB 4RGND 3E9UA 4GRLD 3PWVB 2VDQH 1WD9A 5LJ3g 4Z7OB 4A6YL 4Q0XL 2ADJA 2UXGA 3V4PB 1JRHH 1VYVA 2VXTH 4LCIH 1JPTH 1AIFB 2P80D 2XX1A 3C6LC 4HQQL 2APBA 3ILEA 4K8RH 4ODXB 1KFAL 4X80H 3F6JA 1D5RA 3MCAB 1YYLL 2ZX7A 3MV7D 2DEXX 4CC0A 4YSQA 1KT2A 1PNDA 3KPSB 1JFHA 2XA8H 2PXYC 2Z8WC 4JHVA 3BZ5A 5CK9A 1RXLA 3QCUH 2J1ZA 1EXHA 4N2AA 5E6ID 5ID1A 1WA1X 2JJTA 2K3HA 3VVVA 2DYIA 2E8YA 4I1RA 4P46C 3ZEHA 4UOJA 4WAFA 1X4YA 4OGYL 1TCMA 3PABA 4F7UF 4DZBA 5MEQB 4GUPB 1E4WL 1ZLEA 3LDBB 2NY3C 2VE6B 2IWFA 5EFIB 1BX2B 1L5GA 3HR5A 1WUZA 1N2RB 4ZD3L 3FSWA 4R96A 2OYPA 4B0MM 4M7DE 2YARA 2OMBA 4PRNB 2DQMA 5TDNA 3INOA 1OCCB 4WHCA 5GISL 3EUDA 3FONB 2OR9H 5GANd 2YRDA 1FL6A 1UG9A 4ZQKA 3ROLB 4AUUA 1S9XB 4RCBA 3C08H 15C8H 1LM8V 1WQ7A 3OXRB 1ZA6B 2ICWB 5F9WB 1V76A 3CCJA 2KQNA 5CEZH 4O6JA 4XXWA 5E4EC 1KTCA 4HPYH 2EIFA 4OMQA 2DIEA 2OBGA 2ZCKL 3GMRB 3MHZA 4GS7B 4JN1L 2EUWA 2JE8A 2OZ4H 3SN6N 3V6OA 1YEFH 4M7KL 3FPXA 1AQHA 2COQA 2ZKMX 4OIIH 5EEUA 1I8LC 2OTLA 1MCWW 2XT1B 4TULL 5ICUA 3WYRA 3UROR 2G2PA 4OIAA 4AZUA 1GIGL 2FB7A 1OK0A 3FUIA 5AW5B 4AQ1C 4J8QA 3V0WL 5BV7B 5FYKU 4LEXH 3UDCA 1VQ5Q 3WO3B 2ITEA 4PQXA 4OJFL 4H8PA 3IWUA 2IOIA 3VWJB 1S7XA 5AENA 1FNEA 3EBGA 4JZOA 3UGEA 3MTXA 3S5LB 4G5ZH 2OX7A 2GSMB 2K6WA 3D50A 2V4LA 1HINH 4X2UA 2V2TA 4JB9L 1R3KA 2WINA 4FFWC 1EDHA 3RL2A 1HAWA 1CGTA 3OMZA 4JM2A 4F37K 2GY7B 2J43A 4WHDA 3RFZA 3F12B 4FLOA 2JTDA 1I7ZA 3QFJE 2IVWA 4KOBA 1OAUL 2Y1AA 1YYLH 3K0WA 1LDPL 1R75A 4Z7WE 1WBZB 4MA7L 2IH1B 5BXFA 1O6TA 5IESL 1T3SA 4RMQA 1DBML 4L4VD 4XPFL 3UYRH 1KB5A 4L5GA 5CGMA 3WBDA 1K4US 3CDFA 4XO9A 3SHWA 1TVBA 1QPXA 3TESA 4NKMA 4Z7VA 1WX6A 2NPLX 2WACA 1U4EA 1E4XH 4O2EB 2PUKB 2AP2A 5K39A 3EHRA 4I3SL 4AI7A 4YSDA 2LX9A 5KAQG 4N85A 3I55A 2BFGA 3DSNB 5G5DA 3I6LE 4URTB 3P8DA 3GIZL 3T4YA 5I1DB 1UEBA 1J9RA 1S7WA 1E6GA 3T0WA 3LGLA 4KI1A 4WFFE 2WQXA 3DV6B 2WLHA 2XQBL 2KMTA 5DYFA 1W72H 4AENA 4NHUA 1KGJA 4NFCA 5F9JA 3UF4A 1PKQB 1QBLL 1UGPB 2AEIT 5DJAB 4DOHB 4RZKA 5E1AA 3KPNB 4ZUSA 1SOSA 2FX7L 1IQWH 4TOYH 4JZ4A 2YZ8A 5DURB 3ETBJ 4N4HA 3OJDA 1SJEB 4Y16D 1YJ9T 2N56A 2NY6B 3RQ3A 1TTCA 1MH5A 1KXQA 3MV01 3MO1B 2PVGB 5IVXA 1FXXA 3EFOA 4M7KH 3B9DA 5EEXA 3NJJA 3GLDA 4PVMA 1Q9WA 4S1RH 5DK2B 5DQ9A 4Q58C 2AITA 3QCUL 4FL6A 4R3SB 3OMIB 4DWHA 2WANA 4NP4L 4TLTA 5EBLB 4ELKA 3EG1A 2OXGA 2BSBA 3DECA 3HI5H 4EQ2A 1JERA 3O0RL 3ESMA 5D8JL 3L2LA 3CCMQ 3VSQA 4PBWD 5I6MA 1JXKA 1HDMA 2X1XR 3RWGA 3SBQA 2PWFA 2LCCA 3L2ZA 5EORH 3HSBA 2CZNA 4H25B 5D96B 4PJIF 4QRQB 5HVHB 1CXKA 4MRCA 4UM8B 1GGBH 2NR6D 4P57B 4X0NA 4UT9L 5CZVH 2JKIS 5IQ7L 5C6TH 2CLRA 4XO3A 2EE3A 5DC2A 4B3VA 2WB1A 3C5ZC 5MEND 3C09B 1RK0A 3IYLW 3NMZC 5DJCA 3M8OH 1OX9A 4HC1H 4II1A 5HY9A 2HKAA 4JANB 4NRYA 3MDJA 1MJUL 2GTJA 1KBWA 1WWAX 4HHAB 4OLUL 4EF3A 5L9DH 4KDTC 4XMKH 1U8IB 4I77L 4U0RC 5B8CC 1S8DA 1HCFX 5L6YL 1UKSA 3QCVL 5AVWB 1DQTA 2WN3A 4K8RL 4Y19A 3GBQA 2EQIA 1C5BL 3F6LA 1RUAH 2R69A 2HLEB 4L3CB 1EZUA 1QPPA 1N0XH 3MJ8A 4MMLA 1ETA1 1H0DA 1WDAA 1YHPA 1ZCRA 3FZUD 5FGCB 2DO3A 3N55A 1ZRUA 3RZWA 5F7EH 3MLPA 4HJJH 3A21A 4N2LA 4PIBA 1SYSA 1FH2A 1NBZA 2J88H 2COVD 1BZ9B 4IBLT 4NZTH 5E5MB 4QI3A 3FTGA 2PWDA 1Z66A 3QFJA 3DXAA 4A6YB 2E3VA 2C7UA 3IAGC 4M6OL 4PJHA 1P4BH 1GCQC 2EINB 1S9YA 3OYDA 3QJHB 4K5MA 2XACC 2BW5A 5J11C 5JPNC 1IO4C 3B6SB 5BZDB 3VFUB 2QQBA 3OYFA 2PWHA 1F1AA 2WLYA 3KR3L 1N5ZA 1UKTA 3LXAA 1T5WA 4I0KA 3ZTCC 4UMSA 2CDFB 3MLVL 2VDLB 1OGAB 3KHQA 2Q7AA 4C4BA 1H6FA 4MXQD 4RSYA 1R1CA 5B1CA 4PW3A 4P5MB 4GJTB 4O2CB 3SDAC 4QMEA 4A1RA 2QQQA 4AGMA 3ARDB 3SQBA 3QUIA 2C0IA 3LN5A 4XCCL 1M1KR 3ZDZF 4MZPA 1T80A 3CCLA 2D7PA 2FJFB 4XE5B 4JFEB 5GMKh 2JT4A 3UPUA 1U58A 3D39A 1J1XL 2G0LA 1IJNA 3OHXA 4G6KL 4Z95H 2CDEA 4PGCB 3SD4A 2MPAL 4I89A 1EUTA 1H3PH 3SFMA 1R5VA 2AK4D 3CHRA 1VZIA 3EAEA 4AGLA 1SJHB 1BQLH 4TYUA 2ZUYA 3LS5H 4AGOA 4C0ZA 5A6IA 4MFHA 4ZUWA 4WF2A 1U95B 5K1VA 1OSZA 1BFSA 2KDSA 12E8H 4Z7WA 5DD1L 5FOBB 3HTLX 3OZ9L 2M83A 1TXKA 3EH3B 3QQNA 5D71L 2XA3A 3MV8B 3U0TA 4A7VA 2H8HA 2QDVA 3TM6A 3AHUA 2Z0WA 2ATCB 4B6MA 2JNZA 3BSGA 1DSWA 1D2OA 1J8HB 2VIRA 1S78C 4ZMZA 3MPCA 3MZGB 4L2LA 2HFEA 1ZLSL 3Q2WA 1A14L 3QDGE 4WTQA 3I5SA 3UMNA 3JXAA 4WDIB 1Q4NX 4XNYL 4OCMC 3OYYA 1RUQL 3UTSD 4HIHA 2JF1A 4PJ8B 4WTZG 4UQBA 3G7ZA 3PXLA 4KZCA 3WE1A 4G9FA 5T5FA 3WGVB 1GZHC 2VLKD 1U06A 1P69B 4YPJA 2H0EA 4K7FA 4GBXC 4O00A 3QUYA 3SY0A 2VR7A 1WI7A 1ID5I 1HVXA 4PJOA 1HNYA 5GGVY 5AVYB 1ZLVH 2G5BA 2PTUA 1ZIAA 4I7ZC 2AJZB 2HG5B 3HE7D 4AMKH 1LP9F 4QGYA 3JTSB 4OF1A 2H26A 4ZMLA 3CMAT 1PGRB 1SXAA 1BLIA 4P3DB 3SB3A 1V10A 2LU3A 5HSFA 3N5BB 1J9TA 3C12A 2BP5M 2VRAA 4NT6B 2DFUA 5C08B 4BQ9A 2FT6A 4LCUB 3U7AA 2MOGA 1CL7L 4JPVL 4F2FA 1FZJB 2QA4T 2BZDA 4XRCA 3DO7B 3CCVT 1YAZA 1DEEA 4J2QA 1DJSA 1ZTMA 1D5BB 2E9WA 3BGAA 3GUFA 5EH1A 4JE4B 3RIKA 4EI5D 5J39A 3CVIL 3GMOB 3AY2A 3FSAA 3P11H 1Q0XH 1IZKA 4BK5A 4D8DA 1XIWC 5ETUB 2A7YA 1E6OL 4N2KA 3OMNB 1TG0A 4OJCA 2R0ZL 2E5KA 1A4KA 1WC7A 5HY9B 1JZ2A 5HYSG 3DMMC 5CKGA 2FR4B 4APXB 3AY4A 4IYKA 1OT1A 4OFIA 1P7QD 2R56H 3MP6A 1VESA 2K4YA 2DQIH 2EKJA 2IQAB 2O5XH 1G9NL 1OIOA 1G9MC 4FQPA 3B4NA 1XAUA 4P3DA 3HVNA 3TBVA 2WGXA 4YSSA 1DANU 3ZYIA 4HPOL 4LF3A 5LN8A 4FSSA 3C6LD 2EDQA 4RFNC 3BE1H 1ILUA 1QWNA 2WTPA 1WQVT 3LIZA 4PGBA 3UDWC 3W0WB 2K6DA 4C92F 1CSKA 5KSVA 2PO6D 2WSPA 3L3JB 4P9MH 1VQ4T 3KG5A 3U6XA 2QL1A 1H8LA 4YDVB 4FJZA 4NZUL 3C6SA 2MNJB 4HJIA 1KOAA 1TFHA 4Z7AA 1YJWQ 4LOFA 1OAYL 3HNTL 1DBJL 3OAUH 4KK5C 4YBLB 2ED6A 3MLUH 2LU5A 2BIQA 3FUMA 4YVNA 3EFOB 1PKOA 4F7UG 1UQSB 3VWKD 3D6GA 4G7VH 4R4NC 4PJAA 3L7EB 4AQ1B 1IAOA 3CCVA 1D5XA 1WS7A 4FYVB 1NPNA 4N86A 2GHWB 2IOOA 3DRTB 3SD5A 3BZFA 3FOLA 1NGWB 2NZIA 4ELMA 3LPOA 4A4HA 4LPTA 3UYPB 3UAFA 3GMPA 1KZYA 3HEIB 4XMKL 1FZOB 3PV7A 1SVBA 2X05A 3EJPA 4QHPA 2OI9B 3D0AA 1VQNA 3FSVA 4QXGL 4Z3TA 5EEWA 2IQ9L 3IT8D 4FCHA 4L6V5 1IVLA 4F17A 3LS5L 4D0CB 1G6VK 1RZKH 3FTSA 1EIBA 2FEEI 4P23B 5FCUH 4ELMF 9PCYA 2Z31D 3MYZA 4TNVK 1WS8A 2CXKA 2L4OA 3REAB 2ZXCA 3RWFB 2P80A 4XPTL 4GRMB 2V9UA 4C83A 1CICD 1IBFA 3QZWB 4R4FL 4JLRB 3BIBX 4U6HA 3O3AA 1HE7A 1FRGH 5CWSA 4TRPL 1KBKA 2EVRA 4F7UE 1KV3A 2C3VB 3N41F 2NXZB 1G6RB 3V0EA 1T89A 1QD0A 1QFWI 5ELIA 3MMEA 1Q86R 4DP7X 1Q38A 4F2EA 1DJHA 4XI5C 5DK0A 5D1ZD 1T3LA 1NGZB 3ZDYE 1JV5A 1K3IA 2AJZA 2HG5A 2V33A 4ZO9A 5FYKL 4BE2A 4G8FB 4Y2DD 4HLJA 5C0CB 1FRGL 5H37G 2QQKH 3JCMV 3CLFL 2X4UA 3QIUA 4QAWA 4JZOB 3L5JA 4UNTA 1BQKA 3H0FA 2XZAL 3CN4A 4NQEB 1WHHA 2DL3A 3WG7B 1GOFA 3AFLA 3UBXB 4WWID 4FW1A 1WIEA