3OSVA

The crytsal structure of flgd from p. aeruginosa
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
134
structure length
131
Chain Sequence
SSLVGRKVIVATDKSVVDTKDTFKASLNLPVSSSNVWVNVYDDKGTVVNRINLGQQAAGSVSFMWDGKDSSGNIMPPGTYKFEAQTSIDGKTYGLQTYLPANVDSVTLGQELMLNLAGLGSIALSKVQIIG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein
molecule keywords Flagellar basal-body rod modification protein FlgD
publication title Crystal structure of a novel dimer form of FlgD from P. aeruginosa PAO1
pubmed doi rcsb
source organism Pseudomonas aeruginosa
total genus 21
structure length 131
sequence length 134
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13860 FlgD_ig FlgD Ig-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.910 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3osvA01
2.60.40.4070 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3osvA02
3C12A 3OSVA 4ZZKA 4ZZFA 5K5YA
chains in the Genus database with same CATH superfamily
1R5VB 3TNNB 5J11B 4I9WE 3QARA 3LRSB 3QPQC 1D3BA 1I5OB 2MIOA 2BJMH 5IHZA 3QUYD 1BYNA 1ZSDA 2DK3A 2E27L 2GUOB 3FC3A 3CFQA 5ALCH 3J81E 4HBQA 2FJSA 1HL9A 3H3PH 3LKSA 3LS5L 3QH3B 3HE7B 1NL0H 4JO4H 4X9GA 3OM3B 4HF5L 3F7VB 4YXLH 2HBWA 3R06B 3KWXA 3T2NH 3G9AB 4L3ED 4IBSA 4WK4B 4J7FA 4K8RH 1UJ3A 2A73A 2CUMA 1UOKA 3L3OA 3FF7A 4MZTA 4GOSA 3IU3A 4MAYC 3HHTB 3S88H 1ID2A 1TJHH 5DMGC 1EHXA 2RPNA 1RZPA 2WN3A 1NEGA 5KS9E 1FNEB 2BHZA 3C60B 1OI1A 3QJ6A 2OMXA 1NM9A 1BQUA 5HHVH 1MFEH 4OCYH 4OD3H 1JMZA 5HGDA 1TEFA 4M8VA 1E2ZA 1S5IL 3SB2A 3UO1H 2I60L 5HGGS 1Q1JH 3VGDA 1ZA3A 1N0LA 2ZUYA 3DUSA 1EX4A 3KCPB 1MKFA 4JQVA 4ZDHB 3ZDWA 4U0RB 2PR4L 3WTUA 1TFHA 3SFMA 4K94H 4JFEB 3ABMB 3IDNA 2C3XA 1M9SA 4QHUA 2X4PA 4AVIA 4ZZFA 3U0WH 1CD1B 4YDVA 2XQBL 2X89D 3U7YL 3TBTA 4GG6F 4HJGB 3FDRA 5I17B 1GSKA 3KXFA 3OVUB 1QKZL 2K9GA 5A0LA 3JTSB 4G6KL 4CC7A 4K3DL 4DN3H 4HVBA 1T7ZA 4J8RB 4JLGA 2HSPA 4E9QA 5F7HA 1DQVA 1NBVH 3LNEA 1TTFA 3A4AA 2XG4B 5I5JA 1EHNA 2WUCH 4K7PH 3N2JA 3EJUA 5DD6B 5I0VA 5D2NE 5TQ0H 2X6VA 4OBSA 4OCMC 4QQ6A 3IDMA 3REVA 4IBVA 1U8NB 1ZANL 1FJ1A 1LK2A 4WDIA 4DKTA 2DRUA 1JPSH 5CZVH 1B2WL 4IBZA 1I9EA 3W0WE 1BIHA 3B2MA 4BXSV 5SV4A 2YSSB 3ZSSA 3GSNB 5GIRB 4X7FC 3VTMA 3ZT5A 4LSVH 5CGMA 3D34A 2YD9A 5AKRA 5KVDL 4JG1L 3V4UH 1CGWA 3O2VH 4XP9L 4GMTL 5IW1B 3CC2T 1CJYA 4P2OA 1LE5B 1R4XA 5GSRA 2J5LC 5F9JB 1JK8A 1EX0A 4L4VA 5I6PA 2WOYA 3ZZLA 3KVDD 3MOAL 1KB9J 5EFIA 2OSXA 5EEZA 4NN7C 4NQDE 1KBVA 5DJYA 2DQUH 3U36B 4PCYA 1CIDA 5DJ6A 4K5OA 2UZIL 2VW4A 7PCYA 3GNML 1L6XA 4F7CA 2ZWLT 5EN2A 2GI0A 2W1NA 3PWUA 3QXAA 1E6GA 5LWYH 3F7YA 1ZSZA 5IVXE 1W70A 1TXKA 2VDMH 2UXGA 5JW3H 2E7BA 2QEJA 5ENWB 3QUKB 3VFPA 4JVUA 3LZFH 3QEUB 4NL2A 1EHLH 3BVTA 4FQQA 2ZKYA 5HP5A 2OMWA 1U93A 5DHYA 4ZSOB 1OW0C 4UMGA 3H42H 4XXWC 4RFOH 4EXKA 3FQRA 4L8BA 3V55A 5CN1A 2E64A 1YMHA 1NCAL 2HPOA 4XNQA 5L7XL 3MODH 4IU2A 1E0OB 4DP6X 1QEWA 4U6YB 1SXZA 3BGMB 4ONOA 2DYIA 5GISH 5I5IA 5GMKl 4HK3N 4FG0A 3HAEG 2YLBA 3FU7A 5BXFB 2WY3B 4EN2A 3VXSD 1CLCA 4KRMB 4UTBA 4YSRA 1SQ2N 3CXCS 4Y2OA 3VXQA 2GTZA 5H35B 3OAYH 4GBQA 1M6OB 2VN4A 2XVLA 3QI9A 5F6HJ 3CCUT 3VTTA 1KXQA 2EDEA 2ITCB 2LTOA 4M5TA 3PMTA 3MRFB 5DYOB 2HWZH 4HIJB 2JKNA 5E08L 3GGWA 2O5XH 4P46A 2P5WE 2QI2A 3VD2A 2NY1D 4L18A 4AYGA 4P2OD 1HIMH 1L9OA 2E8ZA 1TT6A 2PXYC 2YWYA 3KLQA 5D2NB 4L4VD 3KWWA 3EOBB 4GSXA 2K79A 4RMVA 1ETB1 5K59F 3W0WD 3LNDA 1DCLA 1NLDL 2XZCH 3COOA 3WXWL 1GIGL 4TNVK 4E47A 4R0LC 4YX2L 2R69L 4NZUH 5LAPA 1Z3GL 43CAB 3OPZL 4FA8A 2JM8A 4FFZL 4ELKB 1F00I 1D5ZA 3FYEB 2YXMA 3MXWL 1FFNA 3QK0A 4HLEA 4HCKA 2AXGB 3PWLB 4OCWL 3W0WB 5M7QA 2F8IA 3S98A 1X6BA 3OKOB 5D1XC 1P5UA 1XIWC 2DIAA 4AUUA 2VOTA 5L6YH 4I7ZC 1LLAA 3SDCA 2D9TA 4N8VA 1OO2A 1AXIB 5AAPA 5FEBA 4WI4A 4DOHB 2ODHA 1FGNL 2F2HA 5LJ3g 5JR1L 1QX1A 4JHWL 4XMXA 3PGCA 4W6YB 5FA3A 5HHOB 3BUYA 3D06A 4HP5A 3U6RA 3FT0A 4M75F 3K46A 3ZL1A 2XKOC 4ADJA 1IZKA 2E4FA 1AYRA 3TIEB 3EDFA 1AQ8A 1L4IA 3ENEA 1XX9C 3DRQA 4KQ4L 1I8MB 5LQBL 3N5BB 5IVXB 1VZIA 4PJLA 4TQPA 1DBML 4PCTA 5CIPA 3P4MA 4AMCA 2NR6C 1E5UI 2VXTH 3MYJA 3QIBC 5EIQA 3QI9D 3H54A 5GMKm 3EFSA 4FQ1H 2D0QB 3QQDA 3AVEA 7CGTA 4P06A 4P46D 4DZBB 4WU7A 5EU5A 1MNDA 3ZE1E 5T3ZD 1ZS8B 3O3UN 1YEGH 4M5YL 1F4XL 3OJ2C 3THMH 5IHKA 4PI2A 3V7CA 1U95B 3MUUA 3DJ9A 1MRCH 3SCMB 4UB0L 2BH0A 4JX0A 2VXFA 4ZPVA 4BWWA 3V0WL 3TYFA 4KK5C 3ARBC 3PABB 3V8CA 2COWA 2CZ0B 5DZPA 4OGXL 5F8QC 3B3BA 4DBFA 4KC3B 3GYRA 1CC3A 1TZOA 2F08A 2OXHA 5FO8A 1XCQA 4R7NB 4Q6IA 1G6RL 3BT2H 5CKFA 4NENA 3VI3E 4J28A 1A25A 1T2QL 1UB5A 2BVYA 1JXKA 2LU7A 3L5WB 3NYKA 3O8XA 1S7VA 3T6WA 7FABH 3JWOL 1GCFA 3L42A 4WTOB 2MYSA 2J1KA 3Q8CA 3QIUC 1X6GA 4JFDA 4P3WA 4P9HH 4YDKH 5L4FA 1OZ2A 4L37B 5F3HB 4PJ9C 4MXVE 5KZCB 2EDXA 3WFEH 1E3XA 3CMEQ 4GPVA 1WIUA 2HQHA 3HL8A 1UD4A 1X5AA 3MKDA 4J23A 2XX0A 2R4SL 1E30A 1HSAB 5I15H 4NKMA 4JAMA 2ICES 1C5CH 1E9QA 3CN1A 4NO3A 5DU7A 2PCFA 1ZT4B 2ZKWA 2W60B 5FYJH 4BCYA 1X2KA 3BWUC 4MVBC 5KSBF 4XK8E 1KYDA 4QXTA 4MJ6B 5F7DA 4KJWD 5K69A 2WBWB 4FQXB 4H25A 4ZBJA 5C0EA 1JWMA 4FFVD 1DBBL 5F7UA 5I74C 2ICEA 1T1WB 3EJSA 3S97C 1SXBA 3RVVD 4E9XA 3US1A 2ZD0A 3WY4A 4EI5B 2OR8A 2VXUL 3GFUA 2DL2A 4WI0B 4Z8AA 5HJDA 1HI6A 8FABB 1YN7B 3HHSA 1OGTA 1TTRA 1XTDA 1KD1C 4DGWC 3BOVA 4W9DC 5I2IB 1SFDA 4C8QF 2B39A 2WPGA 4MDXA 1L0PA 1B0RB 3WEMA 4GW1A 2HFEA 3CDCA 1ZUUA 1JFQL 4CBPA 3W11D 3CVIH 4G6AC 1GGYA 5D5MF 5I71C 2FIKA 3IKKA 4QHMA 5A2QE 4XBMA 4WRLA 5E03A 1BEYH 4QDGA 5CEZH 2Y2YA 4M48L 1SJHB 4F7KA 5KBLA 4MQXD 1A7QH 2Y07H 4HS3A 1PZUB 4KHXL 3T08A 5KBMA 1V55B 1IREB 5KVEE 2QEXT 3K8KA 3L95A 5DHXB 4K71B 1GKEA 2LT4A 3LN4B 3O8XD 5AAMA 1MHNA 3ZE1B 4L4JA 2OULB 4JFDD 1ZX6A 4U1NA 1WK0A 3EDDA 4UT9H 3NZ8B 4XPTL 5ECJE 3WEOA 1GGCL 2P52A 1FV1B 2AKRB 4PV8B 3DYPA 4Z3EA 2MCMA 2WVTA 3EGDA 2ZPKH 1DUZA 4G11A 2PLTA 5D7JC 1AMYA 1HL4A 3BSGA 5F1NA 1DJHA 4QNPF 3F5WA 2FD6H 3NCYP 4RMWA 2DVJA 3L4XA 3OYEA 2CUDA 3RHWF 2H26B 3IMUA 3D09A 5DC4B 5ALBH 1FPTH 1IGCL 1IGTB 4BH7A 1GXEA 3FFDB 2CG9X 1LO0H 3PHOB 3MC0A 3CMAA 2UY7A 3VXSB 1KY6A 3QG6B 2X40A 1BLNB 4FC3E 2DW5A 2W91A 1HYSD 3K2KA 5D1XE 3ROOA 1NDGB 3L2MA 4TVUA 3GK8L 3RMSA 2QKIA 2IDUA 1F97A 1BBDL 3TFKC 3P0YL 4NGHH 4KH0B 4LIQE 3H6ZA 1DN2A 1AHWA 1QATA 2EE2A 2Z0UA 4TUUA 4AQ1B 4FD0A 4F9PC 1DL7L 2J5LB 5D7LE 1T2XA 2OJEA 1Z9OA 3N9GL 2COYA 3ZKND 2GT9B 4JM4L 4DP0X 1XF4B 3KWVA 5DZLA 1FLTX 1XMEB 2NY0D 1LWHA 3ULVC 1CD0A 4PGEB 1R75A 3DJSA 4N1EA 1M3IA 2DLFL 1AFVH 4DTGL 5E6YA 1N70A 5EOCH 1DE4A 1H3UA 4WGVB 3F7QA 2AHIA 3CPLB 3D39A 3FTGB 3MUZ1 1P6AB 4N9GB 3NEOA 2QA4A 3E8VA 4GQPH 5IVNA 3IDIA 1WA0X 1R0BG 3V4PH 1JRIA 2KYMA 4IBQA 3UERA 2BOBB 2JCCF 1SHXA 2ZZUT 2K2MA 2HFFB 2XACC 5FDWB 1EAJA 5HSFA 1H5BB 1ERNA 3HPWA 3B2VH 2PVGB 1JCVA 4OQTH 3JUYA 3PFQA 1FLRL 2YLHA 1QBLL 1FYTE 5BMFH 1USZA 4TTDC 2Q2EB 2OMTB 5KBKA 1AP2B 2CO3A 4AUJA 5TH2A 4Z77A 2OSLB 1BQHB 4MASA 3ALXA 2K4AA 4Y9EA 3WEBA 1Y1UA 2EIZB 3O11B 1S7QB 4TLSA 5HGAB 2NYYD 5K9QI 3FN0L 1NPNA 2HLAA 1J10A 3D0LA 5DHVB 2XPZA 4C4BA 4FG6D 2DD8H 2V17H 5GZNC 5CP7A 2MMPA 2F5BL 3M8OL 2WZAA 5D7KD 2FRGP 1HOEA 1I8IA 2OA9A 2W0LA 1MNEA 2YWZA 4F7PA 3CFJB 1IBBA 5KYYB 2C06A 2A9MH 4BD4A 4UM8A 5B22A 3WMPA 4G82A 1QLRB 4MCZA 4OD2A 1XGTA 3O45A 4HWZA 4AIEA 4DEUA 4WNQB 4PS4H 1U2YA 3EF4A 5E7BA 3U2SA 5IHIA 4OM0L 5GRJL 4YJZL 1WHJA 1VAHA 2EDRA 2EDWA 3ESNA 2WQWA 4XGZA 4BCXA 4UQDA 3W9DA 3OKKB 4XNUL 2OTUB 1RZ7H 1CI5A 3R7RA 2B8AA 5H94A 3MO1A 1U92B 3FT1A 2QV2A 2KDYA 4KDWA 3LD8B 3G5ZA 1IFRA 2EYTB 4FQIL 3D39D 4OT1H 5FA4A 1BWMA 4NNXA 4AQZA 4DKFL 1BI2A 4M29A 3GP8A 2JKWA 3SO5A 4KNUA 4QRPE 2RK1A 4PJEB 3ARRA 5D7LB 1J05B 4A1RA 1TVDA 4WW1B 3OSVA 4XTXA 3LV3A 3MVSA 1KLFB 5CWSB 4ZTPH 5IEKB 4NO2A 4Z6AT 2O30A 5TJWK 2EDNA 5K9KB 3BUPA 3MROA 3Q44A 4J3OG 4G8GA 4J2QA 1CI3M 1I8LC 3IRPX 4HUWA 4D9LL 5ANME 3SDDB 5E9DE 4X8XA 4YXHL 2DPKA 5KVGE 4NWTL 4AIZA 5HJGA 2HZHA 1FZMB 2CGRH 2HVKA 4IIZA 4J6RH 3VFRB 3ZKQD 3T4AA 3UTSE 3KJ6L 1RVFL 4IBYA 4ENZA 5B3JE 4HKXB 1Y18A 3CMAQ 5HY9B 4NHUB 1MFVA 2Z35B 3L3JB 3TH4T 3V4LA 3ARDB 2G9KA 4KVCH 4FX5A 2EO7A 2ABLA 5FYLH 3RNQA 3AW5A 5HI5D 4MA8L 4Q97A 1VIFA 2AK1L 2OTWA 3GSNH 2IMMA 4DKEH 2DJSA 3EFFB 2FECI 3UBXB 2MK5A 1FYTB 3QR0A 5GQBA 3BE1L 1O9SA 2K78A 5HYQA 2DEWX 4BUQA 1ZA1B 4IKLA 1VOMA 3D08A 1FUNA 3TJEL 3AWEA 2EXWC 4XMVA 1VGKA 5J0BA 1R6VA 3JT2A 3RX5A 3HI6L 1YMMA 3PP4L 1CFSB 5DWUL 4D9RE 3LW5E 4HC1L 2DYBA 4LP8A 5FWQA 1JS4A 1KXTB 4EI6B 2R1XB 2CIKA 1C7TA 1U33A 3S5LB 5KSBB 2H1PH 3ULSB 4PJ9B 5IFJA 2QA4Q 1WC7B 3L3GA 3S8GB 1AGCA 4X6DA 1RUQH 2XXFA 1T5KA 4HISA 1MNNA 3S7GA 4A4HA 4F2FA 4UTBL 3UACA 1NBYA 2P8PA 5D93B 1AR1C 3ZZQA 2Z7YA 4RISL 3K4ZA 4BCZA 1OAUL 4MNQE 2ZXBA 1KPUB 1ZVHA 4R2GB 3VSTA 4LRNL 2OL3L 2Q5BA 3ULVE 3UYRL 5I1HH 1BW8A 3UGEA 2AZAA 3WHXA 1HH6A 2VLLB 2XG8D 2BHFA 4R96A 3GNFB 1F56A 1FFPA 3RIFF 3PVQA 4M5ZH 1KENH 3VYOA 1OSZB 4LSPH 4BFRA 1M3BA 4KNTA 1KGCD 2EACA 3SYCA 4QRPB 4LVOB 4IRJA 1E8XA 1IC5H 2BZDA 2QQAA 1YPZE 3WO4B 2IFFH 1AJ7H 3TBYB 1BA9A 1J1OL 4H8WC 1GS7A 2VSDA 2QPUA 2RJDA 1SYSA 2WHVA 1B4TA 2E86A 2VXSH 4YSOA 2WNGA 4JR9L 4PRBB 2WWOA 2WBJA 4F8PA 3O6FA 2O5NA 5I1DA 5E9DB 4DOVA 1IGIH 2I9TB 3WELA 2VC8A 1RK0B 4J3XA 4EIUA 2WANA 3M7OA 1QPKA 1RMFH 4W4OC 5BQDA 4B5EA 1A2YB 5HD8C 3WMQA 3LLRA 2J25A 2LLNA 3DX4A 2Y22A 3KYKL 1B34A 4NI3A 4CSSA 1ODAA 5CJXC 1YMMD 5HGBB 1GCYA 4YK4C 4L8DA 4PLIA 3DTUB 3ARUA 3QR1A 5IK3A 1LDPH 3JAME 2VQ1B 3P11H 2BKDN 3ZGHA 2VZTA 5CP3H 3OJDA 4NJAL 4ZMAT 4DPBX 3RPIB 2A0LD 4WENB 5KVFE 2L04A 3BUQA 3GLZA 2F5AL 1XR8B 4JANA 3RHWK 1LE9A 4MKMA 1AXSA 4EKXA 1ZEAH 5E4AA 5IXFA 4E9YA 3JV4B 3PNRB 1JTTA 1K8DB 5FU6C 2NPLX 2G75B 2MNWA 3MJ9L 1QFPA 5AD0A 4B6MA 3MRDA 1A9BA 4FP8H 1YEDA 5GAOq 4DCQA 2D9QB 5A2JH 1WI7A 5JHDE 1R0AH 3D69A 3D6GA 4J8QA 3MRKB 1XAKA 3OYFA 3VYNA 4RDQF 1VQPQ 4U31A 3W39A 4HULB 4NPYB 2YD4A 4Z3FA 5BRQA 3DETC 5C0JB 3ZT6A 1X9RA 2YUWA 1DLHB 4Q0XH 1HWWA 3RY6A 3ESMA 4IRJD 5I19L 2APWA 3UP1A 4P5MB 5L4MA 1NSNH 1CDGA 1HINH 2WO3B 1VQ5A 4HJ1A 4W9HC 4YBHA 5DO2D 3O9WA 3B9KB 5CILL 3U82B 4TSBH 1T6BX 1CWVA 5EEVA 2WBJD 3BUBA 4X5RA 3X11A 3O6FD 3TOPA 2K57A 5DJZA 4WHCA 1IKNA 2O4XA 4MNQB 5IB3A 5JHLL 3IE9A 3VXPB 1RAHB 3BH4A 4X7SL 4PRAB 2FPEA 2LU3A 1PKQE 5CZXC 1XZWA 2MOQA 3I50L 2OMYA 3UZEC 2OX5A 3FXIC 2PYEB 2E4HA 3X12A 1OPGL 1XR9B 3TVMC 1K9AA 2B86A 2JQAA 3HCVB 1RZ8B 1PX8A 3KUFA 2HJKB 1SPKA 3RMQA 4BE0A 3ASNB 9ATCB 1OT4A 4X5QA 3IAPA 1YPZB 4PJCE 1RFDH 4Z7UF 3FJ5A 4UTAA 4LDLB 4XP5L 3QNFA 3BLKA 2P43B 3TBSA 3MOBL 3AT0A 2IH1A 2LTQC 4DT2A 4Y16B 4S2SB 2ZWNA 4YPJA 1D09B 4AXWA 1M1SA 1R5WB 3X3GH 4N2HA 1DR9A 5HGHA 2A5UA 1UEBA 5JQ6L 2ATPB 5T8IA 4GUPA 4ECNA 4FEMA 1SEQL 2AJUH 4D2NA 1G7HA 5D6CA 2AXFA 1QVGS 4MS8D 4XAKE 1H3PH 2IAMD 2NNXA 2GHWB 4JMXA 4KUCD 1TTGA 1ZTMA 2ADGB 4PLKC 4WUUA 3WJLC 5FGSA 3C5JA 3G6EA 1DLFL 1S7SB 2GIMA 2H1XA 4G9FB 1H3WM 3DECA 3L4TA 5EO1B 1JD7A 4X9CA 3RKDD 1DFXA 4FYVB 3BWSA 2I85A 2EIJB 1QVGA 1GKOA 2L7QA 3TLRA 4YSUA 5JW4M 4FQCL 5AW4B 3QHFH 2EDLA 1G1CA 4HV8B 4EEEA 3NCYS 3EO1A 2XXMB 4MJ4A 4UF7C 3WKYA 4PJHF 2HNIA 2XPYA 1A1MA 3HAEB 4X0KB 1PG7X 3QNXA 1OIOA 2YMOA 4GQQA 2E1HA 4MDJA 4OD1H 3QE5A 4LVEA 3GJEB 4IKNA 1NLBH 1GZQA 3G5XA 4FYTA 3A4EA 1UM6L 3WJJC 2EYXA 1GHFH 4QPEA 2RHXA 1YJ9A 3VXNB 4EQ2A 5JHDB 4PJJA 3QEQB 4L5GA 3U6XS 3DXAA 2YUPA 3AXLA 2ROLA 3JYCA 2C7UB 2B08A 5D8JL 5EF1A 3W38A 4M78A 4RETB 1R3JA 1VQ9T 2YUOA 2Z31B 4P5KA 6PCYA 4JPKL 1M90R 5KSUB 3CPFA 1UECA 2DWXA 2OAUA 2VDRB 1NWOA 4X9IA 4UINH 4BK8A 1K3ZA 5FW8A 3WE1A 3DOSB 4JUSA 3U6XA 4YQXH 4X6BB 2A4ZA 2A6IA 3ECBB 3MEAA 4B9JA 1AVZC 1FC2D 5E2VL 5FWCA 5FK9B 1U8PA 3QULB 5KUKA 1OWRM 1JGVL 2DKUA 2NY2D 4IIOA 1AO7A 4OCRH 5DHMC 3Q1SL 2J7IA 2VDPL 4QD2E 1FO0B 3UP6A 1YJNA 3FUMA 4GO9A 3BFOA 5ADPL 4PJNA 4ZNCD 4NQCB 2EIBA 4WUUD 1X69A 4I3SL 1XDTT 5AUMB 4AEHL 2FZ3B 3BCDA 2GEEA 2X4QB 3FSOA 2CR0A 2P4AB 4ODUB 2XUWA 4Y2DC 1JGEB 2GTWB 4MD5A 2V7NA 4PJGF 1GRWA 4PJCB 1PZ5A 1Z5HA 2BK8A 4YH6A 4UC4A 3HHMA 5E6IA 2KYIA 1IZ6A 2CALA 2WXQA 5EZIH 4NXKA 4DP8X 1SUHA 1BPLB 2OYLA 3FRPG 3NCXA 1ODUA 3GJFB 4HCGA 2O01E 4E36A 2EH7H 5A3ID 5FO7A 1Q9WA 3EYFA 1NJ9B 4YFEA 2JJTA 2YQ3A 4LQFH 4OI9A 1RZJC 4NCC1 4NKDB 4LUEA 4UQ9A 4J3OF 2EXYC 3IMBA 4UBDD 4H26A 2DBKA 4HT8A 5GGRB 3VXMA 1J0JA 4JY5L 1SHSA 1UTDA 3DXAD 3Q48A 1M1FA 3UL4A 4M78D 2AERT 2C1OA 4Y0GA 1EXUA 4XPHL 5C1MB 4H8VA 4IU3B 5AFAA 1FE8L 3LQMA 2LCLA 2DQDH 4OV5B 2F5KA 4FE9A 1ZOXA 2J57A 4PWGA 4CC1A 2FB4L 3QRGH 4O5VA 2HXAA 3BQUA 1YLBB 4I48A 3UZQA 2LX7A 3I5SA 2A74C 4DAGL 3MRLB 3L3DB 1AO7D 3RY4A 4N3TA 3UTTA 2I07B 1II4E 4PJ8A 5E6RB 5IVOA 4LCWE 3TZVB 3FQXA 2VITB 4LPWA 2D73A 4QOKA 1JP5A 1T83C 1SQMA 1FNAA 4PJFB 1W72B 2AQNA 4FNQA 1PZSA 2GSIA 1W0VB 4E7KA 5K39A 5IJKC 3QJYA 4FKHA 2BSRB 4TTGA 4IGBA 5C9JB 2WLJA 1EHKB 2X0UA 2CDEB 4ZMTA 1Y0LA 4HGKC 3FONB 3SPIA 2CM5A 3PV6A 1F6LL 4G8EA 1FMVA 4JFFA 4OZ4A 4PJDE 4KTGA 3ZOAA 3GDCA 4NHCL 1MF2L 4PH8A 3E80A 3G6EQ 3L17A 1A4JB 4QXWA 1XSOA 4U1IB 2HKNA 5FU7B 5E6ID 2BMKA 1EEQA 4WV1B 5F9DC 4JJCA 1PX3A 4Z0XA 5I1EL 1T20A 3AREC 3IPEA 1F3JB 2J6OA 3DMMC 4JPIA 1CLZH 2YXFA 3H9ZA 5A43C 3LRHA 3E6HB 1I0CA 3I6GB 4OZGB 2DWYA 3WFDL 5EBWA 2DXTA 3WSQL 4E9SA 4I2XB 3JWDL 1LMIA 1A1OA 1OGAA 2EICA 3UC0H 3N5AA 5IWLA 3VXMD 4RGNC 1PU0A 3IXTB 1QASA 2C4XA 3HI1A 4YO0B 3NJNA 5ABAA 5GS2H 3WFBH 1WICA 1AIFA 4LLMB 3DGCR 3JV6B 2E75C 2GNCA 5IG7B 1P84K 1YJ9Q 1NGPH 4ONHB 4PSRA 4JRFA 3QYGB 4K7FA 4TL4A 2CSQA 4PG9B 1J1XL 1N5YH 3FL7A 4R4BB 2A6JB 4Y5XC 5FCUH 3NCJL 4TPRH 1TUCA 1M6UA 5C07E 1YEIL 4KJQD 2FO0A 5ICXA 4G9DA 2R58A 1LWRA 1MUJA 3DVNB 3FN3A 1YSOA 3VACA 3CHRA 1T7VA 3CMGA 3BQUD 1B0GA 1S9VA 2DLEA 4OLYH 4X5XA 3IGLA 2BVTA 15C8L 2NY3D 3UTTD 3WIHH 3V52L 2J8UF 4PJ8D 3M56A 2B2XL 2DQEL 1KELH 4PJMA 4QOKD 1NKOA 3OMZA 3LWHA 4XCYB 1EO8H 5DJAB 2ZYSA 1EJ8A 4KXZI 5CD5D 2AABL 5EOTA 3TCLB 1WJSA 1HCYA 4OLEA 4IGBD 3QIWC 4Q9QL 2VDKB 2J4WH 3P8BB 3ZHNA 4RGMB 3HPLB 3MNVB 2JE8A 2AXJA 4MMXB 2FRWA 1OX9A 4X8CA 5AZEH 2QG9B 4O6JA 1TETH 2VO8A 4JFFD 4UV4H 2CP3A 1YQVL 1OCRB 4L5FL 1WYXA 3DUUB 4DO4A 3QAQA 1QKXA 5GMKj 1Z9LA 4GLMA 3D18B 3PPSA 5F0LB 5B1KA 1N5ZA 1R1CA 4Y2NA 5J6GA 3F3HA 4QO1B 3FB6B 3QDGE 5AAWA 4KOCA 2Q8BH 1S78C 5D2LE 3X17A 1AGDB 5E8EA 1P2CA 4AY0A 2ZCLL 2PTUA 2XY1A 4FQ2L 5ABZA 3VFVA 3F8UB 5AVXB 3ZBDA 4O5LH 5L4JA 2QGFB 3I9PA 2AF2A 2MPAH 1HKLH 4X4KA 4UOZA 1OGAD 4N2AA 1E27A 2XTSA 4FAAB 3MO8A 4NUGL 2RIKA 1BVNT 4F7UG 4PUBL 3TVMB 5BW7C 3OB0H 4TXVB 3ZHKA 5H4ZA 1NJIR 1K8AR 1U3JA 4BQCA 4PVMA 1FBIL 3EHBB 2KLTA 2YOCA 4MZ2A 2XV2A 4Z7WF 3EJZC 4JPSA 5TDOA 1UH2A 3MP1A 4MZ3A 1A21A 3MNWB 5AKSA 4X5WA 2PCPA 3EYUL 2ORBL 1BZQK 2XQYA 1B4RA 2JKIS 4JZJA 4OIIH 5CQYA 1UM4H 5IR1A 5JA9A 2CGHA 3HG1E 3CBKB 4HIQA 5HYJA 1F1BB 1R3HB 2YMTA 1NZRA 1I7UB 2XJKA 3VB9A 3L7EA 4PGDA 1P7BA 2F74A 1FXXA 3FU5A 3W82A 1NCBH 1H3ZA 3NCBB 2P26A 3RWGB 3PXHA 1HESA 4PJHB 3S34H 4PJAF 1QRNA 5IMOA 3V10A 2B4CL 4A2EA 2R27A 1YEEH 4BDVA 5EORL 4FHBD 1T21B 3NIFF 3O6MH 4CI0C 1UACL 3PHQB 5HDBE 2QADC 4K23H 5C6SA 4K3EH 1E28A 1RABB 4G59C 2R0KH 1FZOB 4P0DA 4I4WB 2PCYA 3HRPA 3FCTB 3I2CL 1FP5A 1QABA 1YG9A 5JOPE 3WXVL 3Q05A 2FYKA 3HNTH 5C0RL 3Q8AA 1ZHNA 1A6ZB 2D0FA 2DKMA 3AM8A 4CILA 3TWCH 1BI1A 5IQ9A 2NZ9D 5GRUH 4IUTA 4NN6C 3CZLA 3U2JA 4B9YA 5HHNA 4DVBA 1E9PA 3M0PA 1GOFA 2P7TB 4Z7VE 3VRIA 3L9EA 4MYPA 5DRZA 1QBAA 4QRRA 3WIFB 5KEZA 1L0QA 2IG2H 1DN0B 3CMAT 3QQ9D 2TSAA 1VESA 3TT1H 4BUGA 2X2IA 1KQ1A 3WS3A 4PW9A 5FC9A 1W6WA 2MH4A 2EYQA 1JHLH 5HY6A 1IGYA 5TF1L 1YWPA 1KWKA 1BYOA 1HK6A 3L7FA 4Q4IA 4XCNB 2B5IC 4RKUE 3QDGB 1OTSD 1E8WA 1SOKA 4XH2A 2O6CA 4HIHB 1TQSA 4PJBE 3WIIH 1JK9A 2CCWA 2OXGA 4LCVA 4E41A 1MDTA 4NUJB 3ARGA 2CT3A 4M7KL 4MQSB 3KZ8A 1DEEA 5CO7A 1SYVA 5HYJD 2EC9U 3I55A 4JE0A 4B9PA 4PJGB 4TSCL 3NDZE 1T3LA 1S9XB 3L3KA 1FH2A 1NC2B 2L0AA 3GI8L 4HK0A 5J3HC 3PFSA 1E9OA 4RGNE 2G4EA 4GG8A 3LEXB 3MJ8A 1V3KA 3R18A 1QRND 2DIQA 2PW1B 2QSCL 3P30H 4Y2DB 4TNEA 1EHAA 3MRPA 4K8RD 4PJ7F 4ZUWB 1NA8A 2HUEA 2QA4T 4O51A 3EHRA 4J6WA 4LGPB 3CH1B 3QUXB 5FLXE 1BV8A 1Q9LA 4KGLA 2A4CA 3BT0A 2XJLA 5IHWA 2J6WA 3U9PL 3JB9G 2WLYA 2XRAL 2KLSA 4B7IA 1LL1A 3RKYA 3OKMB 3P54A 2E7LC 1FWZA 4LSRH 5BO1H 3Q8FA 3ULUF 4Y4FC 1MY7A 2FX8H 5DEGB 1MCOH 5I6MA 3L1OH 3U9WA 4NWUL 5HHXH 1CDJA 2NY7L 4NPKA 3RPBA 3IVKB 3APDA 2V2TB 2ENYA 5F7KC 1X4YA 1DO6A 4DP9X 1P9MC 3HBQA 1X7QB 4Z78A 2Y5QA 1N18A 4QRRD 5CCGE 5IESH 5C0IA 5KS9F 5JW5B 2UXTA 4XAWH 4D8PA 4EDUA 2VZUA 1YN8A 2DBLL 4IMLA 3SY0A 1R5IB 1AZBA 3BUIA 3ZBMA 2QGEA 5HDBB 2YUQA 1OTUD 2NXYB 3NSJA 3WBDA 4XTVA 3CLFH 5KAQG 3NT0A 2Y5TB 3GI9H 2HD0A 2VTFA 5LJ5d 3U4KA 3ARPA 3IFOA 4R0KA 4IKFA 1ZLWK 3KBEA 5EC2B 1GJIA 3DJTA 4E41D 4HBCL 3GZKA 1G94A 1I3GH 2AZSA 2LHAA 3I3BA 1MQKH 4MA7L 3AT9A 4WW2A 5EH1A 1OEBA 4IIMA 3EUUA 4PJOA 4O2FB 3WUZA 1LCKA 1VADA 2G0LA 4M7AA 1KCVL 3CC5B 4M02A 4FF9A 4PP1D 4OM1H 4BK5C 1I7TA 3S96A 3MV7A 5E24E 3ZLQC 1BI0A 1TJMA 5D7IE 3QBYA 4G6FB 4NLAA 3O4LE 5DRXA 3W9EA 1AZEA 5DR5L 4KGZB 4VUBA 3EFDL 5ICZA 4OB2B 2IPUG 3QDJA 1VFUA 1NLOC 1G9NL 1CZ8L 1YY9D 3UJJL 3TCTA 2A1WL 1HFUA 2EQUA 2E76C 3N43F 4P57A 1I85C 3BAYA 3AREB 1UT2A 2VRAA 1OV3A 1I7RA 3DMMB 4NO0A 5GGUA 1LNXA 3M1BA 3TA3A 1H6TA 2L3PA 2K70A 3PFUA 1ORSB 3NUKA 1BQLH 1UFGA 1WBZB 1C16B 1YJDH 4XMPH 4YZFF 1F2QA 2IALA 5AZUA 5GANd 3D25A 4UOW1 4XE5B 4ZOEA 4KU1A 2V2WB 3BLPX 2ZQKA 3RI5F 5ISZB 4JLIA 3FN9A 1PFOA 1J9TA 3HMWL 4NQXB 2MHAB 3H9SB 4QXUH 3N41B 1U06A 2XDPA 1ZLVH 3UC2A 3U1PA 2EDKA 5AW5B 5ANHA 2BINA 2RM4A 2WTRA 1ZV5A 4HEPG 4MD4A 5C0BA 3U1SH 1QPPA 5FYKH 3WN5A 4YFDB 1CICC 1BD2D 4LSUH 1QR4A 2PWDA 5CGYC 1LHZA 1MHHB 5D6XA 3UG4A 1W9XA 3TM6A 4MB3A 1QNZH 4WJ5B 3ZR5A 3KCWA 4ZQTA 3WLBA 1NAMB 1NKRA 2OMNA 3WL9B 5IFAH 4AYSA 3WVEB 2BWQA 3L3HA 3Q3GA 5ITBL 2VDRH 3VMPA 3QSUA 3HZKA 5D4HA 5IJCC 1JXGA 4PJOD 2P4TA 1BZEA 2YA0A 1TKWB 3RZCD 4JFOA 1UXWB 3DC0A 3MRMB 1XB6A 3MV7D 2JMRA 4QCIA 5L2JA 1BMGA 1G6VK 3G6AA 4X83A 4B0MM 4JFZH 3SDAB 4Z3TA 1F6FB 2CUBA 3RA7H 1B3JA 4C56D 2HLEB 1KCSH 3VXUE 4EMGA 5C2BL 5JNYB 4OGYL 5C0FA 3D85A 2F58L 2NT1A 3MXVH 4KQ0A 1OKEA 4FL6A 3CPUA 3QDJD 1ND0A 3NFNA 4YPGA 4WU5B 4XXCC 3PUUA 3DSNB 4D8KA 4NNYA 5DJ0A 2ITDB 5F9OL 1Z7JA 2EDFA 4WFEE 3C12A 2UWEE 4N0UA 1QR1B 2ZSVB 2BE7D 4NO0D 5DDHA 5HVGB 3TA3D 5CKAA 2UZXA 5IKCB 3M57A 3EYQD 3M88A 4IOSD 5EUOA 3NESA 4KZDL 3MJXA 5TGBA 1UKSA 5LJ5f 4L6V5 3X1EA 2BDNH 2D8JA 2QV4A 2DB8A 3CFNA 5C0DB 1MEXL 5D1QC 5D7IB 2PVOB 3QZMA 3M58A 3EO0B 4HWNA 1JD9A 3RIKA 4HLZG 2VYTA 4Z7WB 4ZX3A 2DYRB 2VW7A 2ZX7A 4Y9FA 4BE6A 3EH1A 3LB6D 1QYGH 5K1JA 1AI1H 1KCRL 4P48A 4M9OA 1VZGA 4PD4J 1GC1H 1Y6KR 1M4ZA 4JE4B 3GWJA 1AKJA 3QZPA 5C0BD 4N4YB 2SEBA 2B3RA 4BFNA 4NXSA 1PYWB 5ACZA 3L9BA 1QUNB 1K72A 3VWJA 1RQ5A 3BP5A 5JXEA 2NY4B 4PRNB 4NM8H 1IT9L 3DYMA 5DUMH 3MV11 2R23A 2WVVB 1B9KA 2X4NB 3K6IA 1XGUA 1DZBA 4M9PA 4WTWA 1JZDC 1Q0EA 3CZJA 2GJ6E 4QRUA 4UIKL 5HDRA 1KBGH 4YUEL 2YHGA 1QZ1A 4H7VA 3X14A 3L6FB 3A67H 3UYOD 3VFUB 2P5EE 1NPPA 4EMKC 2NW2A 3BWZA 3GLEA 3O0RL 4XO5A 5HYSG 5KWYC 4XPAH 1CR9H 4M4PA 5GANf 4CC4C 4LFHD 2CDFA 3AY2A 3D85D 3GNGA 2XIBA 4LLVA 1J48A 2YD5A 1BXAA 3HFFA 3JWOC 4L29B 3VI4A 1U5SA 2EJGA 4WFGE 5FV1L 4OZIF 2L7JA 4HUVA 2G5UA 5GMKh 3ET9F 4ODHL 3QRFM 4NLHA 1UDLA 3ILQC 5KVDE 3A8OB 3H2PA 4A7TA 4WHYG 5ERWA 3ZTNL 4HD9A 2YHTA 5FGCE 2DICA 4NKQB 1EEZA 4FZ8L 3UDCA 2XTJB 2XWRA 2PUOB 3M17B 5SX4I 2ADJA 1G7QB 3IJ8A 1T7WA 4DP4X 2DWTA 2YAPA 3EYVB 3JWNG 4LLAA 2Z91A 3VRJB 4ODWB 3RLSA 1F4YL 3SKNB 3TEEA 3L2QA 1H3VA 4BA8A 3VXUB 2PTVA 2G6FX 3EO9L 4JUTA 2W0KA 5D4JA 3V0FA 2P84A 1I07A 4ACTA 2AEOA 4M62L 3K71B 4KXZH 2M83A 4KK6C 4NS0A 3O4OB 4GIPD 1TJGL 1AKJD 1S7XB 4RSYA 4UT9A 5EF0A 2B5IB 1WDXA 4ZFQA 3T5WA 3WFZA 5L2KE 2FQFA 1KBBA 3G5WA 2YEZB 4HK3J 3VWJD 5JXED 5HKCA 3SE6A 4WI9A 4N8VG 3UYPA 1BREA 3E3QC 1IGMH 1ZTXL 4DBRA 1VQ5T 3PL6A 4ZS6D 1VQKA 3NZHH 3VI3F 3I9GH 4KI1A 4Z76A 1AOZA 5I1AB 4UNTA 3DO7A 4OJEH 1UB6A 1LYQA 5FYJD 2DI8A 4RTWA 4CSPA 1CLOH 1NCNA 2P46B 4P4KC 2FO4A 3BW9A 4PJ7B 4PG2A 2KE9A 1C7SA 3HR5B 3RGVA 2IGTA 1PIGA 2BVPA 4MXVF 2AZUA 2ZX9A 4U1JA 3SWNA 1F4WH 4QQDA 1KF9B 3WI9A 4E42B 1FG9C 4BZ1H 1PJWA 2CSIA 4HWUA 1JXMA 1ZJAA 2DL8A 1MLCB 2EO9A 4ZJ9A 2R2BA 2A7BA 2A0FB 2ZF9A 4W9FC 4XO4A 2GK0B 4DQOH 3EOTH 2AXHA 3FH7A 2FWSA 1ACMB 2JTMA 4RNRB 2YFNA 4LDUA 4LVNC 4ZT1A 1XSIA 4APQB 1IILE 4WIQA 2GJ6B 3GZQA 1TQCB 2APVA 3QUYC 2WYTA 1MVFA 1W6LA 2QQQA 2R4RL 3G5VA 2XWDA 5CEZD 3KS0H 3FT9A 5AW9B 2A6KB 4KTEL 1D5RA 3ZZ1A 2ZAIA 4LCYB 1T03H 4PIBA 4NQEA 1OF2B 4HMCA 4GBXC 2JXMA 2QKSA 2PTTB 1OAXL 3G6ET 1GFDA 3FRPB 3GB7A 4B9WA 2XVGA 3O3BA 4FYRA 3VUAA 1M1GA 1C5BH 1HQRB 5HHMD 1ID5I 1V7MH 1RY7B 3L5HA 3V4PA 2DLPA 4HX1B 5FGCB 2FR4A 3IJEA 4PRIA 4M61B 5EU4A 4DEPC 3TVTA 5I1LA 1T5XB 1BAFL 1QBBA 2DYPA 4PRDB 3JB9F 2BJML 3FBKA 3K6NA 3PL6D 4JGMA 3ZY7A 3MREA 4ODVL 5DHEA 2OSYA 3RWEA 3V6OA 4HDIB 4LBAA 4OQTA 5ALCL 2W07B 1VQ7T 2LC4A 3H3PL 2CXGA 2GG1A 4L2YA 1OK8A 3RGVD 1YITA 1YJ9T 3IXAA 4JO4L 4X4MA 4HCZA 1CO1A 5D1QE 4YXLL 4R90L 3T2NL 5I6LA 3JCMJ 3RKPA 3H0HA 1CGTA 1ZVNA 4K8RL 4IOIB 3TNNA 5CCKH 3NJKA 3HN8A 3TF4A 1MCBA 4H4NA 3LRSA 5T1LA 1UGPB 1YNZA 3ZT7A 3S88L 4RBPK 1TJHL 4UQ3B 5AZ2H 5IB4A 2E7DA 5DGRA 2JF1A 2NX5B 2ZYIA 2VB5A 1Z32X 3VS1A 3TNMB 5KAQF 5HHVL 2AEQL 5DQ9B 1YZZA 1I1YA 1FG2B 1MFEL 3LKOB 4OCYL 4UZGA 5F7NC 3SDXA 5KBPA 4WI8A 4AKQA 4EE2A 5DMIH 2OI9C 2EQJA 1AHKA 2CLRA 2X7LB 2EKOA 1Q1JL 1PPIA 2Y7QA 3RJQB 3UO1L 1T5WB 3F7VA 3R06A 4YHZH 4MZPA 2Q86B 1QZNA 4DH2A 1YJNT 4F7UE 4K94L 2UX7A 3BVDB 3EJYD 3RAJH 3U0WL 1FORH 4XCCH 3QWOB 4M8QB 2HBPA 3MDJA 4NQED 1N6AA 3J80E 2BP8B 4EMHA 4JFWA 1KC8U 1M90C 3MR9B 3NCMA 3C60A 4DN3L 3A5VA 2AKKA 1TCRA 1S46A 2FLBT 1UJ3C 3BD4A 1AWWA 3TH2T 2BXZA 3QG1A 4NUQA 3L3OC 1NPJA 2LQRA 2WUCL 3AS2A 3QFJE 3BP7B 4K7PL 2HCZX 4QRAA 3OAZH 5GAN8 1CICB 4F7TA 1ACYH 4JFEA 4L4TB 4PRID 2GYSA 3M0SA 1OB1A 4G5AA 5IBTH 1DEDA 2DYPD 5GRVL 1Z1WA 4HJGA 5I17A 1FZKA 4IUUA 4IUVA 4LAQH 3BI9X 2GEQA 1U41A 4KKQA 1IL1A 2HDAA 3OQ5A 3JTSA 3HIZA 1HT6A 1JPSL 4JQVC 1VQKQ 5AL0A 3RX7A 5MENB 1AZRA 1KBPA 5GGSB 4J8RA 3ZN6A 4BSWB 1WHMA 2X38A 3AC0A 2H6OA 1MCEA 1DSFH 5AWNH 2XG4A 3DX8B 4KKPA 1SJEA 4GB9A 4LSVL 5D71H 2HPTA 4JKPH 3V4UL 4B9FA 4CC0A 3C0CA 2JKRM 5DD6A 5IV2B 1KHCA 5T1LD 5A2BA 2IPTH 1ACXA 3MEVA 4ZOAA 3MBEB 3L2NA 4R7DB 3MRQA 1FN4B 4QR7A 2QGGA 3GIVA 3GMMB 4Y4HB 4U1LB 5K9OB 4HJSA 3QCTH 2VSMB 5IMKB 3P69A 1MMAA 3A6BH 3X1BA 1UJYA 2DQUL 1U8LB 3MGOA 2HRGA 4HUUB 4XMUA 4Q9CA 1LPLA 2YSSA 3E3QE 2CH4A 4YLCA 5GIRA 2ATKB 3CBOA 3B1TA 4GRWF 2GI7A 2KYBA 3D2UB 2Z92B 5LWYL 3SGJC 5IP4A 3ZDXF 4JFXB 5JO5A 1AOHA 2ROXA 2VDML 5IW1A 5KSVA 1TUPA 1U3YA 3ESPA 5D1QB 4J3OH 1LE5A 1ZGLM 2ZJSH 4WTXA 1H0DB 3CFKB 3UG3A 2OP4H 2WQVA 5JDSB 1ZBJA 2CJTA 2ZXCA 3H4HA 1XHHA 2QGDA 4KKZA 3P73A 3PV7A 4BQ8A 1I9RH 2DPPB 1MFCH 3KAAA 1KULA 1BG1A 2PPEA 3H42L 3U36A 1AQDA 4RFOL 4OCNC 5IHHA 1H3GA 1RK1B 2BXYA 4P2OC 2CGZA 1AZVA 4PJ5E 5BRZA 4GLRI 3BWUF 3MODL 3PGFL 1U8JA 1GPOH 2KXDA 2RHYA 5GISL 1BVKB 4KRNA 3LPOA 5A0GA 1IFHL 1NGQH 2ZYHA 2DAQA 5ENWA 4F7UB 4JCLA 1R24A 4J9IA 3S8WA 3HS0B 2JW4A 3E8UH 1CCZA 5E8OB 4A63B 2E74C 3NGBB 5GAMd 3U30C 3VJPA 4ZSOA 2V1QA 2DEXX 1ZSZC 3QQ3B 4ZO9A 4R7LA 1I75A 2YJQA 2MEJB 5E8NB 1BIAA 2HWZL 2O5XL 2NUPB 3II3A 3WNJA 1MCKA 1YITQ 1M1KU 2NUTB 1G6RB 4UT6H 2VWFA 1IBFA 4U6YA 1F41A 3QFJB 2O9VA 3BGMA 1HIML 3RWFB 5ID0B 3TS8A 2EKHA 4RTVA 3KD4A 3L5JA 4FN0A 4MLIA 4IRSB 2L3RA 5IB5A 1CFQA 2OI3A 1A4KB 3P0VH 3U4AA 2BNUB 5BXFA 5E6UB 4KV5F 5F1KC 1Q38A 1QLEH 4XT1C 3BEWB 1JWUB 2BIVA 2G0KA 2W92A 1UM5H 2BY2A 1M6OA 2GIYA 3QEGH 4NZUL 2AANA 2PO6D 2VKNA 2ITCA 4YVUA 3MRFA 1ZAGA 2J43A 2VJXA 3Q0HA 4KK8C 4ZXBB 2OYKA 1MFAL 2APXA 4LPTA 3NJVA 5E7FA 4C54A 5IM7A 2FHFA 1TXQA 1OP9A 3PE0A 2UYLA 3DBXB 1DJWA 3QYCA 1I1AB 1OEZW 4RX4A 1EAOA 1Q9OA 1O6SB 2VISB 3QI9C 4XHJD 4A4KA 1E42A 3NPSC 4WHTB 4JJOA 4P46C 4RIRA 3GKZA 5E9NA 2W0FB 3LNHA 3VNZA 4F2MA 4QXGH 1XGZA 4EIZC 4ELKA 3IETA 3FRNA 5CP3A 5BRZD 4QJ3B 4F57L 5J06A 1YUHB 2AXGA 3PWLA 1JE6A 4XPGH 3VX1A 3JWNC 1KLUB 3AAZB 4GJTB 2DQMA 3L16A 1EBAA 3CSYB 1EDQA 2EC8A 4PJIF 3ZU8A 4CU8A 3JCMc 2M02A 1CLYH 1A7PH 5TE7L 5HVHC 1B7TA 5AVYB 1KGWA 3KGSA 4W9CC 4Y5VA 3LKPB 5I1GH 2TAAA 1WISA 2VXTL 2AJSH 5M94B 1BQ5A 4P9MH 2Z1KA 5ESQB 1JZEA 3DIVA 5IQMA 4U2ZA 1P5UC 1K4CA 4FQ1L 5CSZB 1ZLMA 5K33A 1AHMA 4LPXA 5HHOA 4R4FH 3SDCC 3K8LA 4UUJB 1YEGL 3THML 3GIZH 4K3JH 4JFTA 3BIBX 1ULVA 3D3VA 2JQZA 1I8MA 4FABL 1WFJA 3EDJA 5DEFB 3R7QA 4K5PA 1ICTA 4N28A 4CVZB 2EVJA 4Q58C 2ZNXA 3V6FB 4IIQA 4I3GA 1W4SA 1LNUB 3VAEA 1NGYB 3DKMA 4HQQH 2H0JA 1UASA 4TRPH 1CD8A 3BZEB 3VXTB 3QUYB 1R46A 2LNVA 4KJWC 4PN6A 3ZKSD 1E6HA 3TCJA 5LJ3e 3RU8H 1NZ9A 2FK9A 1ZS8A 2WW8A 1OTTC 1SJMA 1TPXC 1D5XB 1VA9A 3BT2L 3FCBA 4POYA 1QMCA 2A08A 1SN2A 1WD8A 2ICWB 7FABL 1XAUA 1NJIC 4P9HL 1P1VA 2X2YA 4LSQH 1E7VA 3FSAA 3T0VA 5GAMf 4POZD 4YDKL 5C8JA 2Z4QB 4NRZB 3HRUA 4L3EB 1UA6H 2ED8A 1YEJH 3KXFE 3POHA 4JBSA 4XU0A 1GY2A 2DERA 4M56A 4PLJD 4YSSA 4C0GA 3OS0A 3B2UD 3ZQWA 1N8OE 1OPKA 1NGWA 5I15L 3ZZSA 1FNHA 3V0VB 1GXIE 5FYJL 3RE0A 2XU8A 3QZLA 5D6DA 3L5WA 3AWGA 3QEHA 1GZHA 5MERB 1ZHBB 4YLQT 4ZMPA 3BDUA 1KHIA 1ONQA 4KKBC 2BRRH 3KDPB 1FL5B 4JZOA 5MEOA 1TDQA 5INCB 4Q6IC 4DEWA 3GEFA 4DO6A 3AG3B 4XC3H 5SX4H 1MW1A 4U3CA 4O4YL 5FX3A 1QPXA 2DWSA 3O8XC 3I5RA 1AD9B 5CVIA 1N8RR 4HEMA 5I23A 2JWYA 2GVYA 1IBDA 2ICWI 2VW6A 3H7BB 1M7UA 1MZYA 3JVFC 2ZE0A 1C0MA 3SDZA 4X42A 5DUPH 1A6UH 1HHKB 5IT9E 2QELA 5MEPB 4DNLA 2WNKA 3D3VD 4MJ6A 1F4HA 4FQXA 3JB9I 3CVIL 2D0GA 4N0CC 5GGSY 3CCSA 4N87A 1P7HL 4NQVA 1EDHA 3MV9B 4X6FB 1CDCA 2OI9B 2E6QA 2EVGA 1NIFA 3H8NA 4EI5A 5LJYH 5TFSL 1D3BB 1UUNA 3JZYA 1A65A 2Y07L 3STLB 2X3CA 5IHZB 3GTTA 2VZ1A 1RH8A 1ZSDB 1DQMH 5DUBA 1HOCB 8FABA 2HRHA 5F7AA 3NRPA 2FZGB 5FWBA 3I55T 4EN3A 3CFUA 2ICEC 2CLZB 1JPST 1IC4L 3IS0X 1X4XA 4UT9L 2AFNA 2HFTA 4O2CA 4F8OA 4GG6A 2E7MA 3K6SA 1P7KA 2A73B 1MWOA 2C8NA 2ZPKL 5IUCA 1SJHA 1C1EH 4RWHA 5I11A 3IU3B 4ZRGA 2BSBA 1WA1X 1OQKA 2FD6L 1MLBA 5CCAA 3FAWA 4XNYL 1L5GA 5HGDB 3LS5H 4YGVB 1FPTL 4ZMYA 1LD9A 5DS8A 5I26A 1LO0L 1RJCA 1S72A 1N0LB 1ZA3B 2EJ1A 3DUSB 4IJ3B 4QY8A 4JJ5A 2CBTA 3E9UA 1JOIA 3J07A 1GCQA 3BLBA 2X4PB 3PP3K 1RUMH 3ESVF 4YDVB 2Q7YA 4AVKA 5FYJU 3TBTB 2ATCB 3I3DA 3HRTA 5AAMC 3H2WA 3AB0C 4NGHL 4ZUSB 2C9SA 4GW5A 1OT2A 5ECGA 1KXQE 3VFMA 5LAXA 2AJVL 3JV3A 2JXBA 2D3VA 4XC1H 1M2VA 4B3EA 3MRCB 5HDWA 5T3ZE 4S1SH 1IGTA 2ED1A 1BECA 1Y6NR 1TH7A 2EXTA 2OCCB 2Y36H 2J88H 3K5SA 3ML9A 4FQXD 3ZDXB 5JHMA 5EEWA 4XBGB 3EFOB 3JWNE 1MY5A 4EI5D 1NDGA 3IDMB 3CDZB 5F7BA 3U7YH 3ULUH 2DXUA 4NCC2 4ANVA 1GGBH 2KH2B 4PREB 1AFVL 1JI1A 1QKZH 1Y6MR 3NSFA 4M43H 4WDIB 5EOCL 4K3DH 4G6KH 4AQ1A 2HX8A 4EN3D 5G4MA 3WJMA 3V8OA 3L9YA 4XMZA 1Q82C 3RWIA 4RMBA 5EOCJ 3UMNA 3QR2A 2NYYC 1W2BP 1LILA 1HL5A 2IIJA 3HTLX 3LMJH 5E2JA 1AMXA 2QKIC 4PB9L 5I2MA 4WKZB 3V4PL 2ZXEB 2NY1B 3QAZC 1JYXA 5HK3A 2VLJB 4GSQA 4PGEA 4P2OB 5L8LB 5GSRB 1G4RA 3H9HA 1JK8B 4HG4J 4L4VB 3EGXB 4E7JA 3V6ZA 3IM1A 2DD5A 3X1NA 2JLPA 5EFIB 6FABL 3V7AG 2CO4A 1A7RL 2WC7A 2QFPA 1QSEB 2QVTA 5BMFL 3M9QA 1OSPH 3CPLA 5DJYB 5DJ6B 2DMKA 2BVOB 4N9GA 3MLSL 4F7CB 3MPCA 4JG1H 4IW4C 2H2PD 3DX2A 3NIGE 3PWUB 3QXAB 4JREC 4ZN1A 3F7YB 4XODA 1ZSZB 4GS7C 4CN6A 2BOBA 1BLIA 3ATDA 3CSBA 4PWFA 4TKWA 2DD8L 2V17L 1J5HA 2ZWZA 1L9PA 4AC2A 1JN6B 3G6JB 3S36H 5EEUA 1IE4A 4OIBA 1WEJL 3BGFC 4LNRB 2QPSA 3FQRB 4YBLC 1AP2A 1KLGB 2HQEA 2OSLA 4LMQE 4OJFH 5D4QA 5J26A 2HG0A 4IU2B 1LP9F 4TULH 4PS4L 3O11A 1EJ6A 1QEWB 1S7QA 4EIGB 3VXOA 3CCSQ 2IPOB 2PWEA 5GJSH 4FW1A 5HYSB 1MMNA 3QZNA 1U8IB 4MMZA 4B9KC 3FU7B 3B56A 4LK4A 4L1BA 4I88A 3O6LH 4Y2OB 3L45A 4YVNA 2GTZB 1U4FA 4OT1L 1MV0B 2I32A 3CFBA 2OL3B 3HBZA 3TA4D 3QI9B 3T0BA 4HPYL 3GPEA 2VT0A 3VS4A 2VZVA 2IH8A 2AQ1A 1F6AA 1E8YA 1MXDA 2ZCKH 3GGWB 5DD0H 1NCAH 1QLRA 4P46B 1ARKA 2V8MA 5EZJB 5DEZA 4JFDE 2Z1PA 3IDJB 4ZTPL 4RMRA 1J9CT 4J7IA 1IEBB 4JRPA 2Q10A 2OTUA 4OB0B 4NQSB 3SIKA 3FH8A 1BAGA 1U3NA 3L48A 2CCVA 3WIHA 2QFRA 4FG4A 1T6VN 5HVHB 1GTNA 4JB9L 4M75A 4P2AA 4WO4C 4XMTA 1D5ZB 1BOYA 1FIEA 1BCIA 5E08H 2H3JA 1NKGA 35C8H 4J6RL 1AKPA 3E9GA 3FT2B 4PJEA 5IQNA 4TM9A 4UAOB 3RUGF 3RRQA 4S1DD 4WW1A 1KLFA 2DJUA 3REWB 4K55A 4J4PA 5K9KA 4N8VB 2M0OA 1I4FA 1ZT1A 5B4MD 1E3ZA 4KVCL 3GLDA 4LASL 4J6XA 4XB8A 3O2WL 4TYUA 2EDHA 1H8SA 4YX2H 1HYRC 2MOGA 2KQMA 1L0XA 1Z3GH 3F2LA 3PGCB 1NFKA 4DKEL 4BH8B 3VS2A 1WCBB 1FZMA 3MXWH 3BUYB 4YDNA 4OCWH 5KH6A 4L9LC 4PRPB 4JDSA 5HY9A 4NHUA 1P0SE 4GLRH 2WLLA 3KL0A 3DRQB 3BVUA 2HMID 5FLUA 3L3JA 3NIGB 4WEBL 1K9MC 1LDSA 3D30A 1CVSC 4YDJA 1U8CB 1FDLH 2WKOA 3ARDA 3OV6A 3MA9H 5CIPB 4GY5A 5CJOL 1J5CA 3T4AC 1VQNA 2Y7MA 1NBQA 1QW9A 1M56B 4M7LL 3HA0A 3EFFA 3S5YA 2H1PL 5EU5B 5KOMC 2DY2A 2JOYA 1I8FA 2R2HB 1D6VH 1I8KA 1UVQA 1TEYA 3R1GH 3PAZA 3BUDA 3G04A 3LPPA 3P1VA 2FZKB 5D96C 2H3NB 1XQHA 1K8AU 4F16A 3TYFB 5FR3A 4DGIL 3OYCA 4XB3A 1BXVA 1CFSA 1X2QA 2V9TA 4M75D 1UB4A 2DI9A 1YP5A 4EI6A 5FO2A 4DSYA 2JIXA 3T77B 2CMRH 4GP4B 3ZYOA 1XCQB 5FO8B 2J20A 5KSBA 3VM7A 3FO9A 1ES0A 4M5ZL 1KENL 3ULSA 4LSPL 3MKGA 4M5YH 1F4XH 3D4GA 3M55A 1SRLA 5HK0A 4HOZA 1GGIH 4UOW0 4J4PD 5FM8A 3MRHA 1CQKA 4UB0H 1IC5L 2IFFL 1AJ7L 3MCKB 3RB5A 1KPUA 4HCCA 2A0LC 2JJUA 4LGRB 2VXSL 1LK3L 4OGXH 1KK7A 5D7KE 3PWVA 1IE5A 2VLLA 2CREA 5LGHH 2WJ7A 4C8QA 2PNDA 4JAMB 4NKMB 4X6CF 1E9QB 4NO3B 1IGIL 2PCFB 1QWFA 4NQQA 4KH1B 1NCDL 1QVFP 1RMFL 3MJWA 5D5MA 4J3SA 3QWQB 4YTLA 4H25B 2X2UA 4ZTJA 3EGSA 2EIEA 3U23A 3ARDD 3ME0B 5D1ZI 5EA0L 4N0YH 4LLDA 3FHQA 3BYTA 3JCMb 5CUSH 2HFGH 3ALPA 2AITA 1LDPL 3OAUH 3P11L 3DNKA 4X2UA 2Q8AH 4FA6A 1RZKH 2ECZA 1HH9A 2FVUA 4IRJC 3GMRA 1SLVA 4RQQB 3KPNA 3X3FH 4ANXA 2I9TA 2DEUA 3LYIA 1RK0A 5EPMA 3RVXC 2LLLA 4EZMA 2ODIA 3C5ZC 4YHYB 1GYAA 1WE5A 4GW1B 2HFEB 5J12C 3HC2A 2X4YA 2CA3A 4B97A 1IZJA 1DBBH 2WBJC 4M6AA 3O6FC 3KWTA 5A2CA 2FIKB 2MSPA 2X1PA 5A1AA 2NY0B 3BISA 5HGBA 1SVZA 1OCWH 3B9DA 4FP8L 4GQRA 4Z5RB 2AC0A 5ABDE 3U1QA 2YZ8A 2ZX8A 2E3IA 2JIXD 2IV9A 2JKTM 2VQ1A 3GJFK 3GXPA 5HJ3A 1L9TA 3OZ9H 4U3HA 3RPKA 3ZE2E 3C09C 4MSWB 4K5MA 5FUZL 3L95B 4EXPX 5IJDC 2XWEA 1CS6A 1XR8A 2G30A 1RAIB 3DDGA 1AGFB 4U1NB 2G75A 1NSNL 4P59H 1HINL 3GSRB 1KYOJ 5JZ7D 2Y6TE 4R2GD 4TSBL 3V5DB 4C58B 5J7CC 3DX0A 4LUDA 1A6PA 3BDXA 5F1NB 3QB7C 3MRKA 2KL6A 4C8QD 1AS6A 4NPYA 3X28B 1URLA 5C0JA 3TURA 5DD3H 1DLHA 3S2AA 3RWDA 4GKSA 2H7WA 3PG2A 4P5MA 2GGRA 4Q52A 2UY7B 4IS6B 1P5VA 3PQYB 2Y0SA 2XLLA 4G43B 5DRWB 3RKDC 1M2OA 4MNGE 1QQJA 3B9KA 5I1KH 5EU7C 3PXLA 3BAJA 3DPDA 1RFDL 4D9QD 1J11A 1FRGH 3RY6C 2K0RA 3TJPA 1BQKA 4X9YA 3SKOB 3VXPA 3AG2B 3GMOA 3QAZB 4TNGA 1AHWB 5SWZA 3GUTB 1CYGA 4Z7VF 3O9WC 2C9UA 2OJEB 4NZTH 3X3GL 3LN5B 3FJTA 3TBBA 2WZ6A 4MZIA 2JCCA 2VH5H 4HFUH 2HJFA 2AJUL 1IKNC 2M8XA 3B37A 2E6ZA 2HX9A 2ZXQA 3JB9H 3QJHB 5GS1A 3DI3B 1BF2A 1H3PL 3NMZC 1JPFA 4G8GE 3IRCA 2FEIA 1JBMA 2AVFA 1QP2A 1J7VR 2AQPA 1ZA6A 2EECA 1BBDH 2R51A 4FXGA 4PJBF 3P0YH 1A0QH 2WP3O 2WV3A 3LJ3A 4GS7B 4KULA 4JFHD 5CKBA 4KMLB 1H15A 4FFTA 4Y16A 4FYSA 3MMEB 3D39B 3U4BH 1SLWA 4Z7IA 1M5Q1 2ZP0T 3HFOA 2IF7A 4HKBA 3ZXAC 3GSOA 3K81A 2ATPA 4JM4H 4N2IA 2YDLA 1LO4H 4KQ3H 3BGFB 4JY4B 4OD1L 2GAZA 2NY2C 1NLBL 5J3BA 2ADGA 5FF6A 5JTWA 1KACB 1U4EA 1OSEA 3WDHA 4G9FA 2DMBA 1KJVA 2DYSB 4YE4H 2J71A 1OAZH 2LGNA 1EERB 5CBEA 3AS3A 4I13B 2ZAHA 3QZWA 3HE6D 2QHRL 4HV8A 5TH2B 3D12B 3OB9A 4PU2A 4XNBA 3EH5B 4ZUUB 2Y1AA 5CLTA 4UINL 1JGIA 2BFVH 2G2PA 3LWIA 3GJEA 2YD1A 3URGA 1YMME 3D0LB 2ZUQC 3GBEA 3D0VA 4PJXF 3NSYA 5CP7B 3CC7A 5SWZD 3VXNA 4R55A 4JO5A 4OCRL 1G9NC 1AWXA 5LJ5g 3QEQA 2Z8RA 1Q86U 2IH3B 4ZTFA 3K5RA 1VGEH 5GS0C 3UMTA 2C7UA 4X6DE 2R8SH 1IM9A 4D94A 2RQUA 1N12A 2Z31A 4MCZB 4OD2B 1XGTB 5KSUA 3O45B 5CNHA 5GXBB 4UBDC 4AJ0A 3T2LA 2CKKA 3U2SB 3DOSA 1W2BS 2XYBA 1E4KC 3LQAH 5HTSA 3WMSA 3CCRA 2UUDH 3ECBA 4XGZB 1Y7VA 4LOUD 3VS5A 4LHJB 5FK9A 3QULA 3PREA 4K73A 4M78C 1VYTA 1X7SA 3M8OH 1T7YA 3RNKB 4P99A 4Y16D 4XZ4A 5AENA 5FA4B 3ARZA 1O0VA 4AE0A 3E9FA 3OSSC 1N7MH 2XWZA 4IMKC 3P4OA 1QKWA 2EH7L 4ALAL 3LV3B 4FGMA 4JMNA 4OM0H 4RCCA 4LQFL 5C08A 4JFUA 4NQCA 3HFMH 1UD6A 2OTLT 4NO2B 1HEJC 2BIMA 5KE3A 2FZ3A 1FVCB 2X4QA 3MROB 3V8JA 4G9FD 1D1BA 3CD6A 3MJ7B 4HW6A 3A1PA 1JGEA 3GSQB 2WQ8A 4CU6A 2GTWA 5DZJA 2ZX5A 4UIMB 5GANg 5E2UH 1PFCA 4GRWH 1ZHKA 1MCLA 1JV5B 3V6BR 1G7LA 2VUYA 3UAJC 2VJ0A 2ZXDA 4FHJA 5I0ZA 2ZZDA 3T4AB 3ZL4H 1F3RB 4X9FA 1OV8A 2PPFA 1ZIAA 1KB5H 1N59B 1Y18B 4ZNEA 4OU3A 3QRGL 1NAKH 5DJCA 4R7VA 5BRPA 5E6IC 1ZUYA 4NKDA 5FYKD 4OKDA 1PCSA 2K8MA 3IBEA 3VW3H 1A6TB 2LFEA 1EAQA 5LKNA 3SSGA 1WFOA 4D9LH 3K6FA 4A04A 2LW3A 2OTWB 2RD0A 4PAZA 1IUZA 2DM3A 5BOJA 1FCGA 1R47A 2JJTC 5D96B 5C6WH 1IM9D 4ZFFA 2Z31D 3KBPA 3WNOA 2XXCB 3EKCA 3I75A 4IU3A 4RA0C 3EH3B 5HYQB 3PWJB 5B1JA 1JYWA 2Q3AA 1CGUA 3Q8EA 3AZUA 2EZ0D 1T80A 3GTVA 1BKBA 1CB4A 4HVUA 1VGKB 1AS7A 2CLVA 1SUJA 2J8OA 4PJOG 3OPUA 3L3DA 1EH9A 1YMMB 1ZDQA 2R9HD 2I07A 3UATA 4N5EC 3A98A 1SLUA 3FTYA 4HLZH 4MA8H 4BFKA 1S7TA 4CAGA 2AK1H 2VITA 3EIFA 4KJQC 4WWKD 3BD3A 1UA3A 2XVBA 2DM4A 2BNQA 2CNYA 2Y7NA 1W0VA 1T04B 3BQUC 3CBRA 4AE1A 1CLZL 1MFBH 5L88L 2BSRA 3GSWA 5IFJB 4IBWA 3UPUA 2YKKA 1GL5A 1AGCB 5C08D 2CDEA 5JXAH 3CH8A 3TJEH 3FONA 2V0AA 3C8KA 1XTLA 3LX9A 1NBYB 2P8PB 5F96H 1IBZA 1RJYA 4X7EC 3SBPA 3BMWA 1RERA 2IDCA 1A4JA 1F3DH 2DTMH 4U1IA 2ESWA 3WFBL 5D72H 4WV1A 4HC1H 4IGBC 1CKAA 3FW6A 4YHLH 1NGPL 1E7UA 3WHXB 3KXTA 1HH6B 3FHAA 4R96B 1FFPB 4FNUA 1N5YL 2UWEF 4JHZA 2F7RA 5JLZA 4J7RA 4NCDA 4TPRL 3E6HA 1CGYA 3ASWA 4R97B 3I6GA 4OZGA 3U4EA 2EADA 1OWWA 2FYVA 2DVEA 3BC9A 4NDMB 1JJUA 1S3KL 4PSPA 1N5AA 4I2XA 4HSQA 3V7AE 3KW7A 4LRIA 4OLYL 4PWJA 1P4BL 1VEMA 1HAWA 4YO0A 2HSEB 4S0TD 3WIHL 1T1ZA 3RUXA 1SYSB 3O3EB 3CC7Q 1KELL 2OL3H 3JV6A 3UYRH 4TL5A 5IG7A 4AIOA 3F65A 5F0JB 4ONHA 5BVJA 1EO8L 1RU9H 1Y71A 5GAOp 2IOOA 4WHYH 5FKPB 4PG9A 3ZTCC 3GBMH 4BQ6A 2R0ZH 5IWLC 1BZ9A 3A8GB 2J4WL 5CSBA 2FECL 5FS5A 5H2BA 4YZWA 3SPGA 1GYWA 5F93C 2JVVA 3C09B 3DOIA 4XBPA 4XI5D 5AZEL 1TETL 4UV4L 4RZKA 4BZ1A 1JNHA 1QFWM 1B34B 3CCRQ 1J8HD 4WUUE 1A1NB 1J1OH 3MHXA 2E65A 2AEPL 4L8DB 3SEPA 1PEZA 4DFHA 5IK3B 4MQTB 2F8VA 4JR9H 4BZ2L 3MLPA 3ATBA 2BNQD 3OJDB 3ETBF 1TCMA 1LE9B 1X5HA 1AXSB 1D9KC 5F7FA 2X87A 3FTZA 3LXAA 2MPAL 1N6QL 1HKLL 1M7XA 1PTZA 2AIRB 5CJ5A 5E1GA 2XHNA 2F1AA 1JQQA 4GO6B 5AD0B 3GTNA 3D18A 3G9VA 2DF3A 1WBYA 1YEDB 1X6OA 1IB5A 2IAMB 4DCQB 3GPSA 3WO3B 4M7DC 1N2RA 3UTOA 1FYHB 3D69B 1AGDA 1G0YR 3SQRA 1UGRB 1E3FA 2C3VA 4PTUA 4O58H 3W39B 4M78E 4DKDC 4E9VA 2F5AH 4D0DA 3RIAK 4P5TA 3WFCH 1OAKH 5AAWC 1N8ZB 3HRZA 3CCJT 3MJ9H 4Z7UA 1QVFS 2EINB 1LXMA 4OIIL 3ZPDA 4F1ZA 1WITA 2D4DA 3ZR6A 4J5VA 1AO7E 3BVWA 4KY2A 2NZ9C 1KC8C 3E1F1 2IBZY 2MWPA 2FO1A 3OLGA 1BQSA 1QG3A 1QVFA 1FA4A 1NINA 5KOVC 2YBRA 1VRSA 3MA7B 2WYZA 3BPOB 3S34L 2J1WA 3X12B 3QQ9C 3MNWA 4DWHA 5L8KB 5AKTA 3OYMA 4IKIA 2CWRA 1A22B 1YEEL 3KVQA 2B9AA 3V0AC 4YSAA 1S1NA 3O6ML 2HTLC 3M1CA 1ABOA 3ESOA 4G7VL 4K23L 4K3EL 5JW4N 4AOFA 4AKOA 2R0KL 4MMYB 1R3HA 3I6LD 1OU9A 2LVCA 3KHQA 1H8NA 1I7UA 3RYMA 3F70A 1MXGA 5JHLH 4N2EA 2RGSA 4X8JA 3TBSB 2DQCL 3VS7A 2IH1B 3QG7H 1BGXH 3IGAA 2XY2A 1DVTA 3TWCL 4FEIA 4DFIA 4PJHA 4ZAKA 4JK0D 1KCUL 5HGHB 1DJYA 4BY6C 3GBDA 4GUPB 2DL3A 1GMIA 4NAJA 4O2EB 4AH2A 3PHQA 2IG2L 5D6CB 1S72T 1SFHA 2RMNA 3ZDYE 1K73U 2K3YA 4PJXB 1TZ8A 4XVTH 3A4FA 3VXME 1OQXA 4WUUB 5K5YA 1Q90A 1JHLL 1WCQA 3LRMA 4M93B 3MOBH 1A6ZA 2J7LA 32C2B 4K8RC 4TQ8A 4AKPA 1Z9QA 4LP5A 3WIIL 2XU9A 4P5TD 1B4JH 5ILTL 1OD7A 2OR9H 3D4ZA 3EO1B 5JQ6H 1MJUH 3BP6A 4BZYA 3CN0A 3QNXB 4MDJB 5CJBA 1DN0A 4YWGH 1HSBB 2YFOA 3AM8C 4JO3H 3HSBA 4R3SA 4FFWD 3G5XB 3UTTE 4D0CB 3NAAL 1ET8A 1DLFH 3X13B 4WJG3 3P40A 1I31A 1LQSR 4K94C 1AQHA 1RLBA 1DCEA 2WZ5A 3CQQA 3DXAB 3AXLB 4N0AA 3P30L 3ZE0F 4A6YA 3BFQG 3BUTA 2D8HA 4U6HA 4HOXA 2D0HA 1U1SA 1VDGA 4P5KB 5TF0A 5TPWL 4JFFE 1PQZB 3B9VA 3LS4L 3NJLA 2GFAA 3LKRB 3MRGA 1QCNA 4PJGA 2ESVB 1JVLA 2XTLA 3TEXA 1BFSA 1S9XA 1U8PB 4XN1A 2OYMA 3JT0A 2P5PA 3CZGA 2FX8L 2V8IA 3ARGC 3GZOA 1MCOL 2GBTA 3PJNA 4N4HA 1AO7B 1L7TH 4IEFA 1Z9NA 4L1LA 2D7MA 4LKCA 2JELL 1TENA 4ZAKD 5HHXL 2O9SA 4WI7A 4CSTA 1I1RA 4FMKA 4KMTH 5IESL 4W9GC 5AVRB 4ZUWA 4JPKH 4PP1C 5AOIA 4Y8DC 1A5FH 4L8SC 3WKQA 3CH1A 3QUXA 4XAWL 3MN8A 3BPLB 5HI4D 3CCEA 2EJFA 2MPXC 4XO8A 5FXCH 2OSWA 5E2VH 1JTPA 1KTBA 4KRPD 1WXUA 4JLRA 3U7WL 4MD5B 3GI9L 1JSYA 2V7NB 5DEGA 1PZ5B 2OLDA 4Y9CA 5E6IB 1YY9C 1AGEA 4HS8H 3IVKA 3KH4A 4LF3B 1JFHA 2N7AA 2V2TA 1D6EA 1MQKL 2ZWYA 3DK0A 1H6EA 1OVZA 3EYFB 4IBLT 3FFCA 4BD3A 4Y7OC 5JW5A 1HZLA 3AGWA 4F5CA 1OGPA 4OM1L 2DRMA 1VKXB 2DIBA 3ZDYB 4H26B 1T0JA 1KCBA 4IK7A 4CJ0A 5A6IA 1GCPA 4ZMLA 4F15B 1ZGLB 5ID1A 1WFMA 2K7PA 5EC2A 5FGRA 1A3LH 2D9CA 4UT6A 3VGFA 1TU0B 2F53A 5HXMA 3NHNA 1T0OA 2RH0A 3N1FC 4MS6A 5DSCB 3GXNA 2L2PA 3UX9B 5D9SB 5I24A 4MB5A 2HL3A 3ZRFC 4TQEL 3B2XA 1HE7A 3UZQB 4JQXC 4QVDA 3BZ5A 3FCGA 4AT6A 1TU2B 2P9RA 1YJDL 3V4VA 4LPYA 2NY3B 4WW2C 2ZICA 3UTTB 4GUQA 4PJ8B 2IDQA 1J9SA 2Y69B 2DZCA 4QOKB 3K4AA 2JKLA 3SOBH 3HG5A 2EGEA 1WIPA 4L9DA 3RZCC 4M7AC 3SE9L 3QXWA 4XPHH 4QXUL 5ACLA 2O2OA 2AVGA 4IGBB 3QUXD 4J3OD 1Y0LB 5CKGA 1UWGL 3PV6B 3U1SL 3WFHA 4JZNB 4G8EB 4JFFB 2AV1B 4OZ4B 4R8WH 4H5SA 3HNVH 4C5HA 5FYKL 1BJ8A 4DAGH 2HTKC 4WGWB 4LSUL 4N90D 1C16A 2MI6A 3VSQA 4HSCX 1GW0A 4GRLD 2BMKB 4KITB 3VSVA 1QNZL 5FW6A 2V2WA 2EDDA 5ISZA 1I1JA 3TA3C 4UNVA 5IFAL 4ANUA 4NQXA 2EEXA 1E6OL 2MHAA 3FNKA 2CP6A 3H6JA 3EYQC 2VDRL 3SODB 5IZ7A 5LJ3j 3FFCD 3IAQA 4XWGH 4QRSB 3FQ2A 4FYXB 1HXKA 1UWXK 3FSVA 4MJ2A 5DFAA 1X5KA 1NICA 5HYJE 1OGAB 2HN7B 3ECQA 5GAMg 1EO5A 1KJ2L 4XTWA 3FAXA 3LOWA 3KVPA 3CCQA 4FLQA 4JFZL 4X50A 3RA7L 1XH0A 4QMEA 1AIFB 4BQ9A 4YHPB 3CUPA 2L8AA 3IK2A 1VQNT 5FOJA 2APFA 4OUOA 1ZJBA 5IQLA 3WL9A 5B7FA 1QRNE 2FQGA 5D7SH 2F53D 3VD5A 3WN5C 1PSEA 3M46A 4HKZB 4G9DB 3KBGA 4KKCC 2MPVA 3VXRA 4PY8I 1UXWA 5KBDA 3CCMA 3JWDH 1AZNA 4N86A 1B0GB 1S9VB 4K2UH 1OOAA 4G6FD 4J9FA 3OG6B 3SDAA 3I56A 1XCTA 2N01B 2PWGA 2A28A 3EJTA 2BDNL 4FCHA 1Q7YU 4YC2C 3UIZA 1VHPA 4OVAA 4Z7AA 1INEH 1CTNA 1A64A 4LVHB 2WNWA 1QYGL 2FIRT 2XYCA 3OYYA 3IJ7A 3NCJH 4FLRA 1NMBH 1KB9K 1AI1L 1YEIH 2CUAA 2G5BB 4E9RA 2YIHA 2EDMA 3EOAA 4N0RA 4QRRE 1GC1L 3E19A 5IAYA 1E50A 2N3JA 2PPAA 2Q6WA 3QZ9B 3CCEQ 2O6FA 3J8F7 2X3AA 3WTXA 2WQUA 2B2XH 2DQEH 3CV5A 4L48A 4NM8L 5DGQA 5DUML 5J6GB 5LVEA 3LAFA 4Z7WA 5E8EB 4IK6A 2V3FA 1SHWA 2R29L 4E41E 5FYKU 3C08L 3MI6A 1KBGL 4Q9QH 5E8DL 1BZOA 2PABA 3LZQA 2WLIA 4B50A 1U8QA 4YL9A 1IEHA 1SOQA 5E4IA 2CA4A 1E27B 3PAYA 4XPAL 1CR9L 4L5FH 1IQDB 4UQIM 2RALA 4PRNA 4Z89A 1XZ0B 4HA1A 1U36A 1QI5A 2YRDA 4XE0A 4PJAA 1F2XK 3OYIA 1NCUA 2IBBA 3OS2A 1ED3A 3EJPA 5TDOB 2D31B 3VXRD 3VWJC 1PGRB 5JXEC 2DXCA 4DHLA 3N40P 4X5WB 2PCPB 2GITB 4ERSH 1CTOA 2E9IA 3MRBB 2EYRB 4J27A 2ALAA 4JZJB 4PUBH 3SE8L 1MPAH 4WQOA 5IY5B 2CR6A 2QQNL 5SX5H 2ITEA 2WGNB 2E10A 5HYJB 2ZPHB 1ZLUH 2NYKA 2YGVA 1IM3B 4ESRA 3RR6A 3KPSA 2F74B 1SXAA 2I25N 1AC0A 3E1ZA 1SDAB 2QDWA 2QVMA 4FZEL 3N55A 1AXTH 2C4FT 3MEUA 4E6RA 4NN5C 4L8CB 1QRNB 4CGTA 3VE0A 5IMOB 4C0DC 2WTOA 3VRLE 3M17A 4BDVB 1DP0A 2DL4A 1G7QA 2ORBH 3L2LA 3JTBA 3S3NA 3G71A 2J6EH 1J5OL 2AJZB 3RDTB 1IGML 3SGKA 4JJHA 3VRJA 1NGZB 2PN5A 1K2DB 3NZHL 3I9GL 3OLDA 3SKNA 5J1TC 1QCOA 2XCMC 3OYAA 1U30A 3EH2A 3RVWD 1BAWA 1ZHNB 1ETZA 3TJHD 3ZE0B 5CAYB 2QDYB 2IPKB 3KPLA 4OJDH 4AQ8A 5BZDB 4F8LA 3K71A 5IQ9B 4UQCA 1TTBA 2QBWA 3KYOB 1S7XA 4AGLA 3ZTDC 4DVBB 4PJOE 1F4WL 2MCPH 3D1MC 5GJTH 3VRIB 4BZ1L 4M7AE 5ADOH 2R15A 2OMVA 4PMEA 4QRRB 1E5CA 1KD1R 3MV7E 4HCRL 2ENJA 4LSDA 1KIQA 2CKBL 3WS3B 3CCQQ 3I2CH 4DQOL 4NJ9L 3WXVH 1IGYB 5I1AA 3U0PA 5MHSE 2MNUA 4C92G 5IBUG 4Q6YA 1CIUA 2ZAGA 3QDJE 4TLUA 2X3XD 4PJ7A 4GLKA 2P47B 2YD0A 1QLFB 2OXGB 3HR5A 1O6TA 5BJTB 2D7PA 5KE2A 1NDTA 2DFUA 3PL6C 1KFGA 4E42A 1WZ1H 5C0AD 3IDGA 1WXTA 1MLCA 3T0AA 5EG2A 1DEEB 1SYVB 1T03L 3KS0J 2GK0A 1RPKA 2UXVA 2X9YA 1DANT 3KPSD 4YDLC 3L3KB 1Z5LB 4HK0B 1MHPH 3M5AA 3V0HA 4EQ3A 1QSFA 4GG8B 3E2HC 3PNWA 4APQA 2YSQA 2XTJD 2YRCA 1C5BL 4EUPG 4ODTH 3MRNB 1HEZA 2R1WA 3VDCA 1R3LB 4JQIH 4QLWA 2VAAB 2HT4D 3HJ0A 5C0BE 3TT3H 2D03H 2A6KA 1NIBA 5AW6B 4LCYA 4FULA 4OF0A 2ZPGB 3PY9A 1D3CA 1OF2A 2JH2A 4TSCH 1G7JA 1VUBA 4NOYA 1NE8A 4N85A 3GI8H 2E5KA 4OLWH 1YUKB 3HLKA 3H0TA 5ITFB 4M1CC 4E7SA 1TF4A 4YBQD 3CDFA 3WS6A 2RAMA 2R39A 3GMLA 2WKGA 1O9ZA 2VDMB 4R56A 3C6LA 4M61A 4QRTB 5T1MA 4BKTC 5C0IB 2OQJB 1T5XA 1KGJA 4GAAA 4L3CB 4D8PB 2L3BA 4IMLB 3TN0D 2RHUA 4OFIA 8CGTA 5BS0A 2W07A 4I85A 3S37H 2P0QA 3CIQA 2J73A 1BD2B 3IJSB 3TXAA 3CC7T 5FIEA 3IFOB 3PU7A 4PJ6A 1PSFA 2NY7H 1J5DA 1E4JA 1PSKH 2UY6B 4BSVB 2XN9B 1JZHA 2I26N 4N0UE 3V6OC 1MELA 4YHZL 3M1OA 4WW2B 4XO3A 3T3PF 3RAJL 2G2RB 1FORL 1SZNA 4Q14A 4XCCL 5EUOE 3ULUD 4PJOB 2VDLH 4P2RB 4BBWA 1WYJA 2DLHA 4KT0E 1I7TB 3MV7B 3S96B 3CCRT 2E70A 2ZSWA 4WAFA 1QSFD 1ASQA 5DQ9A 1FG2A 2ZG2A 3K2IA 3LKOA 2IV8A 4C56B 2V3DA 1IBHA 2OCFD 4G3YL 5D4IA 5DRXB 3W9EB 3V8LA 4APQD 1NYGA 4UDUA 1JZIA 5ICZB 2C9AA 3QPXH 2IIMA 5I2SA 2Q86A 2LJ0A 3LZPA 2KPNA 4HD5A 1ACYL 5IBTL 3SE4A 4C57C 4LSSL 2RI5A 2RQ8A 4A54A 4KKAD 3CEYA 5HJBA 3RJDA 4M8QA 5FHBH 1I7RB 4NO0B 4LAQL 3G71Q 2PWHA 5GGUB 4J5YA 5LXGL 3CZKA 3GMPB 3AFLA 2IALB 3CD6T 4YLBA 1FAIH 3CZSA 3OGOE 1T2JA 1DSFL 1WTGT 5AWNL 5FYJE 5DR5H 5I8EB 5LDUA 3EFDH 1NBZB 2WMPA 4A6YL 3GDBA 5D71L 4PGJA 5DLQE 4Y5YA 1IJ9A 4L4TA 1KPVB 3C6LD 2XI9A 3ISWA 3C60C 2IPTL 5BUPA 1S9WA 2WQAA 1RJLB 2WTRB 2YQGA 4MD4B 3KLHD 5C0BB 2HG5A 3QCTL 4LCIH 3RL2A 5BS0D 1M57B 5MENA 3A6BL 4I77H 3VI4E 4BSWA 3BMVA 3LEVH 3DVGA 3KPOA 5CU9A 3BE3A 2QMKA 2Z9TA 3PE9A 4Q8BA 4ABWA 2WLHA 3DX8A 4ILDA 4K5LA 3CFTA 3L4WA 1KV7A 5E6ZA 3IFNH 3WLBB 4YMPA 3L3HB 1O5DT 3UXFA 3VTAA 4PKCC 4YC2B 3HZKB 3MBEA 4OCLC 3ZRCC 1K76A 5CEZE 3CC4A 4R7DA 4JRKA 4F27A 2OP4L 1SOXA 1OCCB 3GMMA 2P5WA 4GP5B 4QCIB 1UXSA 3J2PA 3B43A 3G6AB 3FHEA 1MFCL 4FQLH 3KFVA 4QKTA 4ZO6A 5IIEA 3CCVA 2YEVB 2C0IA 4HUUA 1JZGA 3VUBA 1U8MA 1ZVYA 2BZCA 3D85B 2APTA 5LCVH 5C0GA 1QVPA 1FHNA 3WE6A 4PFZA 1Q95G 1ND0B 3B9AA 3NFNB 5AYUH 1GPOL 5K1NA 1IQWH 2COQA 2M26A 4JFXA 4KX7A 2VB6A 4NNYB 5DJ0B 3GPLA 2YAFA 3RFZB 1U3ZA 4EF3A 1EQWA 3C9NB 5I16A 1LMKA 3E8UL 5EUOB 2WQSA