3OSVA

The crytsal structure of flgd from p. aeruginosa
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
134
structure length
131
Chain Sequence
SSLVGRKVIVATDKSVVDTKDTFKASLNLPVSSSNVWVNVYDDKGTVVNRINLGQQAAGSVSFMWDGKDSSGNIMPPGTYKFEAQTSIDGKTYGLQTYLPANVDSVTLGQELMLNLAGLGSIALSKVQIIG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Flagellar basal-body rod modification protein FlgD
publication title Crystal structure of a novel dimer form of FlgD from P. aeruginosa PAO1
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Structural protein
total genus 21
structure length 131
sequence length 134
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13860 FlgD_ig FlgD Ig-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.910 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3osvA01
2.60.40.4070 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3osvA02
4ZZFA 4ZZKA 3OSVA 5K5YA 3C12A
chains in the Genus database with same CATH superfamily
2BRRL 2GTOA 1T7VA 4DCQB 5CP3A 1XZ0B 2WP3T 3FONB 2YS4A 3NMZC 1RPQA 5GRUL 5KH6A 2Z31D 3Q5TA 1KT2A 2YUZA 2YXMA 3K5SA 3MNDA 5EA0L 3K5RA 2KXDA 1A9VA 2PO6B 4ONHA 2ZYHA 2F1EA 3QIUA 1ZVSB 2FLRT 3B37A 3ZHNA 4M75D 4LBAA 4V11A 4N5UA 2WJ5A 3HFOA 4LEEA 3E9FA 2YGVA 3MUY1 2LC4A 5AKTA 4WNJA 4I9XA 1HE8A 4AQ1A 4OD3H 5HGBB 1GMEA 3MR9B 4Y2DB 2ZOKA 5F7FA 4MAUL 1TEGA 5I6PA 4BFEA 1VQ4Q 1CLYH 2CUHA 4KH9A 4AIXA 4XP5H 5EPMA 3UX9B 2K79A 2CJ3A 4OZIA 4XXDB 1WS8A 4EDUA 1QPKA 1QVFP 4AMCA 2OMTA 1S7WA 4MMZB 2HCZX 5I8CB 2CZ1B 1FQ9C 1CS6A 3K2UH 4UTCA 5D72H 1JJ2A 3T2NH 2EC9U 1S5HB 2P5WD 1QTYT 2HJFB 3OR7B 3QO0A 4QY8A 4Y4KA 4I18B 2XFGB 1LNUB 1SXNA 3QFJD 1G6RH 2WW8A 3QAQA 3WN5A 1XBDA 1CJYA 3FUIA 4U6TA 5E5UB 3LIZH 5BS0B 1KC5H 3G6EQ 3WEBA 4E9QA 4BHUA 3N41F 5JZ7D 3BPLB 1VESA 1WIPA 3UFIA 4H0IA 2ZG3A 3MRJA 2K6WA 1NGXA 3MMEB 4CW1A 3RL1B 2ZSWB 1O75A 5HPMB 4OZGF 4J3OF 4N28A 3DYOA 3Q1SL 2YFNA 3NFPA 4X5PA 5LVEA 5CJXC 4LRIC 1MY5A 6PCYA 1XF3B 2RQUA 3CFEA 3T0DA 3G6JF 3JTTA 3QEQD 5GGQL 1JSYA 1XFPA 4AGMA 1C08A 1NEZB 3UO1H 3O0RH 2H0JA 3M9QA 4PJDB 1Y18B 1B0GB 1A6VH 3B7SA 3CXDL 4IEFB 4NAQA 5GRWA 2F68X 2R15A 4JRXE 5BVJB 5JA8B 2XHCA 1KJ2B 3MACL 4G80A 4AE1A 3IGKA 1T7XA 4XP6L 1TJGL 2BP0A 3NCFB 4JQIH 1Z9SA 4LEXL 2GK0B 1KBVA 1KCUL 2ZXEB 5HI5C 4JRYB 2CHDA 1WFOA 1BD2E 4EMHA 3EYFA 1OIOA 3V0FA 2HFFA 3VFRB 3BAWA 5GMKl 4DPBX 3SDAA 3FU3A 2DQ6A 2WLKA 4NGHL 1SQ2N 3Q8EA 3LV3B 4P49A 2DTML 3JUZA 1Y0MA 3EYQD 1M42A 2OW6A 3ZZSA 5IEKA 2PTVA 1JHKL 4OIAA 3PUUA 4U1JB 5DZOA 4LEOB 3W39B 4ZUSB 3ZK0A 2XN9A 4O2CA 3KGTA 1W2BS 1E8ZA 4X99B 3MA7A 3UTSA 4OMLA 3J8F7 4YUEH 1KC8C 1RZJC 2Y36H 1P7QD 3TSZA 3GBEA 4PU2A 2X4OA 2X6BA 4N2IA 4RCBA 1ZLSH 2D8JA 4QGYA 1QQDB 5GANg 3LWHA 5IG7B 3JB9H 2X89A 4XGZB 3KPTA 1RAFB 1CT8B 1TLKA 2VAJA 3QCTH 4GO8A 5KYXB 2I9LA 3CVIH 3PWJB 4N8PA 1I7UB 5IW6B 4P2QD 4ORZA 4L4TB 4ANXA 3ELAT 3FFCD 3DB4A 4OJAA 5MP6L 2WWKT 1FV1A 3ARDC 4MJ6B 4LDOB 3MDJA 1D0YA 2DQCL 3SQOH 4YHKL 4XWOD 5GZOD 1TJXA 4Z23A 4JFZL 3QGVA 1BGXH 3DUHA 3VH8G 3U6RA 4HK0B 5AG8A 4NKIL 3VTAA 5CFHA 5J0BA 1KDJA 1NJIU 1BG9A 3H6AA 3Q05A 2OCFD 2A6DA 5DZPA 1SUHA 3EG2A 2GJ6D 3D69A 1RABB 4M77F 2NY6D 3IFPB 2IBZX 3L3GA 1AP2B 3S4SB 4UTAL 4WHDA 4N2LA 4PJIB 5CBAA 1FZMA 2R4RL 2RN8A 1QNZL 4X8GA 2NY4B 4IU2A 4S11A 3VG9C 1S3KH 1I7TA 3CC5A 5DT1H 2DRUA 1V3KA 4JGMA 3PS6A 2RM4A 3GIBA 3H8NA 2OQJA 3HN3A 4FQPA 2I69A 2K7QA 1QP1A 4ZTEA 2DEXX 2Y3AA 1S72T 1W9XA 3EHBB 5D7IA 5AQ0A 3IS1X 5AW9B 1TCRB 4N2DA 2XWJA 3BEVB 4JFFD 1Q81R 2D6FA 1LEKB 4GP4B 5BNXD 1QWFA 5IROA 3RUXA 3VXUB 5DUBA 3I3EA 4P5KA 3HZKA 2NY3B 4ANVA 4HT8A 2OXHB 2XG5A 3OZKA 3QQ4B 5C0RH 2CHWA 2FT8A 5TFSH 3SDXB 3VGAC 1QASA 2GTZB 3LOWA 1KCWA 1QYGH 1IBDA 5LDUA 1E9QB 1HXMA 4J9DA 4N2MA 1SG5A 3B9EA 3QS3A 4OZFH 1OCRB 4UANA 3KGSA 2Z7WA 3KLHD 3LZNA 3BO8A 1YEGL 3ESOA 3N44F 3EYVA 3QUXD 3UAJA 1S78D 5EOCH 3EGUA 3LX9A 2B59A 3CNKA 4PGBA 5F96H 4M7DG 3O3EB 3U4EA 1O7DC 1W0VA 4TSAH 4UT7L 4M48L 2JIXB 1INEH 4KROC 1GPOL 2ZT9C 4U1GC 2LNHB 4M4RA 1ZSDB 1BVKB 1S7QB 1AGEB 1LXMA 1T0MB 1TNNA 1IZJA 2EYRA 2IH1A 4XCEB 4Y5VB 1AWJA 4JUVA 5DM7R 1WBYA 2FD6H 4QRRD 4DK5A 2EGEA 5T3ZD 3QJHB 3P69A 4LKCA 1FP5A 1E6GA 12E8H 5D1XD 1OM9A 2VWFA 4U2ZA 1UFUA 1JG9A 3E9GA 3GF5A 2H3NA 3LZRA 2GFUA 4PW3A 1C7SA 5LBSH 4RZCB 3F6LA 1QX1A 3ILQC 4G7SB 1UXSB 3BMWA 1FPTH 5CJQL 4DEUA 2X4JA 2DI9A 4KDVA 2DXBA 1KB5L 2RD1A 4OFPA 2P5PA 2BSTA 1E4WL 1SJEB 4QQ6A 1JRHI 2R2EB 1PG7W 3DO3A 3P9MA 5EU6B 5JNYB 3ZRCC 5CM1A 4HZ1A 5CWSB 4WI3A 2JXBA 1KC8R 5ESQB 1ORSB 3O9WA 4NHUB 4YSUA 2DM2A 3BEWA 3MAWA 1J88A 2OR9L 2QHRL 4FTVD 3EH5B 3RY4A 2LRQA 3D52A 4F57H 5B8CC 4UUJB 2F58H 1W0YT 3JVFC 4R90L 3LH9A 4K23H 3T6WA 2P1YA 2DOCA 3MCLH 2KDGA 2BVOA 3FW6A 3ISYA 4LDEB 3NN8A 1IKFH 2LP5A 4NN7B 4OZGB 2KVQG 4NJ9H 4XBPA 1XJWB 5ECGA 3I84A 5T1MA 4BUQA 3EG1A 3JCMJ 4OZHA 4RG2A 5I30L 3FF8A 5F72S 1EUUA 2FHBA 4KZDL 4E7JA 5L88H 4J6RL 1ZTXH 3S5LB 2CIIB 2WWMC 4ZUVA 4BV1A 1D1BA 4N24A 1NANH 1BMZA 2OMVA 4XC3L 4JDZB 2EIZA 2VLMD 3Q44A 4XPTL 2X12A 3D30A 4TVPE 3T1FA 4ZAKA 1M7XA 1SHMA 4TQHA 5DVPA 2WMPB 4R9HA 1BIHA 3CHPA 2GB2A 4XN1A 2QPUA 3TA3C 3ZE1E 5A2BA 4X9BA 2ROXA 2Z9TA 2OBGA 1AIFA 3LKRB 5F0JB 1MAMH 3EGDB 4AGOA 2X7LB 1FFRA 4FX5A 4XU0A 1NKRA 1N68A 2A7BA 4WO4D 1URLA 1MCJA 4JHAH 4OZIE 2QGGA 4AJWA 3TEWA 2PPAA 5DMJB 5KVFE 1IAKA 4G7YL 2J6OA 2A9CA 3CFBA 4QHKI 1M57B 2CGZA 2OSYA 5SWSA 5EORH 3EJPA 4FXKA 2PXYC 2FSDA 3FPYA 4HJTA 4MLIA 1TEYA 4UIKL 4DZ8A 1S72A 2YQ2A 3UPRB 1SOXA 1W2BP 4FFYH 5GSRB 1CFSB 5DEGB 4P23C 3PGFL 5EC2B 3T65A 4KTEL 3ZZLA 1QCFA 4X6DB 4Z8FH 5DD5L 2NLJA 1V7NH 4D9QE 2EDBA 1MHNA 1Z5HA 3TN0C 3OSVA 4D7PA 2IOIA 3NIFF 2OJEB 4K11A 5HPOA 4CVXA 1WHJA 3T8VA 1JYVA 2NT1A 3B7TA 1KD1U 3BSHA 3ZR6A 3OKLA 4RWYH 5T3ZL 1G3WA 4NQDD 3FJPA 5GRVK 5H4YA 2JS2A 4NYLA 4YLCA 4WY7H 4Z7OF 4ZMPA 3ATFA 1R3IH 1C8PA 1N8RC 1I8MA 1ZHBA 2J5LC 2WKGA 3CN4A 4LDVA 4PY7A 4L4JA 4EMGA 3IF1A 5GZNA 3CXCS 3CCLQ 3X17A 1KDIA 1KTBA 4LSPL 4E2OA 3PT9A 1S9KC 2K4WA 3O2VL 1L9MA 4JL1A 1GFDA 1VPOH 2BY0A 2JXMB 2Q76B 4OLXH 1MVUA 3UT1A 3JB9G 2B1HH 4W81A 4GG6F 2H9GA 2P47B 1A7QH 3TF4A 4OLYH 3DGGB 2Z4TA 3CDGA 4K7PL 1AR1B 3RVVD 2TSAA 1D6EB 4E68A 2H8PA 1MRFH 3UJTH 3FQRB 3ZZ1A 4PBDA 4L8DA 4QF1A 4EMKB 2QQ9A 3OAUH 4YSAA 4XCCL 4PWIA 3NJHA 4JFQA 4J5YA 1KG1A 2Y5TB 1YYLH 4FQXB 4UOQA 4MA3A 3V6OC 4DGYL 3D39B 4GYBA 3PE0A 1OZTG 1EXHA 2DEQA 4PJ5A 4HOWA 4HUVB 2CLZB 1J5OH 2BRRH 3MV7D 3LKNB 4X6BA 4KXZH 3B9VA 2D4DA 5HHMD 2CALA 3E38A 2PUKB 2XN9E 3COOA 5GRUH 3WS6A 4K9EC 3HVDA 2UZIL 2IAMB 5EA0H 3UTSE 2VM4A 1BXAA 1O6SB 1WZAA 3PGGA 5JDSB 2C8NA 1PY4A 4H20L 2K2VA 3GRWL 2EDFA 2BE9B 3O4LA 5I1JL 1A1MA 5DMYA 2AABL 4WGWB 4Y9CA 2YT6A 3JYCA 2E7MA 1D7DA 1MDTA 3L1GA 1N9PA 1RACB 4MAUH 5C09D 3NFSL 3ZE0E 2EDQA 3BGAA 3UGUA 1L6PA 5G4NA 2GFBA 5HVHB 1FNFA 1X9RA 4KK8D 2V8JA 4U1HB 3SCMC 1BZQK 5T5FA 5JTWA 4HEPA 2XXMB 1W15A 2PKDA 3PU7A 5JIHA 3F58H 4NKMB 4JVUA 3QIBA 1EAJA 5ALCL 3BISA 2V2WA 3FT2B 3PPSA 3OG6B 4DVRL 3CVHA 4JW3A 3NACL 5I66B 2VSKB 5KYNA 4Y4HC 1P92A 2VWEC 1ET7A 1V5JA 1DQJB 4NQEB 3RU8L 5KBDA 3CEYA 3O5ZA 1B7TA 5E6IA 2MCPL 4KZ0A 3VM7A 4U6XA 1GGTA 5DEFA 1OAUL 2DERA 4YX2L 1NMCB 4OZFG 2IOOA 5JW4N 2K5LA 4ERSL 5I0YA 5EZPA 1VQLQ 3Q1SH 1JHTB 2ID5A 2H3EB 4WU5A 3L1OL 3VG0L 2WXKA 2WC7A 2WQRA 2XKNA 4UYQA 4OUUA 1S7XA 5GGQH 5HYQA 5E00A 3M7FB 5I71B 3WUZA 4UTBA 3ALWA 3WYRA 1K4DA 1WBXB 4C54A 4PQXA 5D7IE 2IEPA 2R2CA 1I3VA 4POZD 3MACH 2X41A 1EAOA 2WLMA 3CX5J 5CEZE 4XP6H 1TJGH 4WKZA 3UEZA 1DZ0A 4CDGC 5H4ZA 5KVDL 1GHFL 4N5ED 4LEXH 2OX5A 2J1ZA 1KPUA 1CDHA 1KCUH 4FXGB 2N59A 1ECYA 3WFHB 4ZN1A 3IDGA 3QJRB 4CILA 3KAAA 2VLLB 1LWHA 1FG2A 4F93B 1M71B 3IAGC 3QISA 1NUDA 1SF5A 4MB1A 1U95B 1HL5A 1NC2B 3LDBB 4IIQC 3ZDYF 3CXHK 4KDWA 4M7ZB 1T1YA 4NGHH 3PGCA 3IFOB 1C9SA 1KLGA 2DTMH 2YUVA 5BUAA 4F7PB 4M7AA 3DV6B 1D5ZB 1JWSA 1XCTB 4S1DC 2EW3A 3CCMT 1JHKH 2NYZA 2BFVH 3AB0C 2QASA 4LDUA 3H53A 4XCYA 5LNEA 4BRVA 2W88A 3B3IB 1T21A 3N1PC 4K2UL 4YHNB 4G43A 2QVMA 1T22A 2CO7A 3F85A 4C56B 2BZXA 2IG0A 1WZKA 4KITB 3SZ6A 2WXLA 1MCWW 3MRCA 3KPRB 4UZUA 3BUBA 5T8IA 4H1LB 3U4BL 2O61B 4MWFB 3B43A 4X9IA 4NHCL 5LQBL 1SRLA 4Z3EA 5JDJA 2GNCA 8ATCB 1XR8B 4LAJH 1NBZA 2DLFL 5D7UA 1D5BA 1OB1B 2XVLA 2B20A 3MEUA 5EU7C 5DFVD 1M3AA 3EBAA 4QOKB 3G5VA 4QUOA 1OY3B 1KB9K 5MP6H 3MBEB 5L4FA 2KT1A 4Z7NE 2DQCH 1V55B 2UXTA 4XH2A 2DLTA 4YHKH 2HJKB 4JFZH 5FA4A 4WI2A 5HDBB 2VOTA 3NIFB 4NKIH 1DANT 2LCCA 4HZLB 2B14A 1EEQA 5E0QA 2X2HA 3SPCA 3AU0A 4IUPA 1U8PA 2DH3A 1VCBC 3PL6B 2CKKA 2KYMA 4UTAH 2YSSB 1BU1A 1T6WA 3KH3A 5KANG 1S7UA 1E4JA 2QVTA 4GKLA 4Y9FA 4MCMA 4UZSA 4DQ2A 2R4RH 4OZHE 4EI5A 1P6WA 3CXCP 1NC4B 3RWHA 1QNZH 4LHJB 2VERN 1IILE 2XQYA 4QRTB 3KD4A 1JP5A 5AOIA 1NCWL 5HJDA 2Q2LA 5F6HI 5LG6A 1FFNB 3H4FA 4LOUD 1NFAA 1VENA 2R1WB 3L7FB 3S96A 3FRUB 4XBGB 1AEYA 2E9GA 2KUTA 4L1DA 3RBGA 3M1CA 4M7LL 4TSBL 4GG6B 2OMYB 1X69A 3V4VA 3VAEA 5B3SB 4XMXA 1G9HA 2CJSA 2NY5H 1ZA3B 2E47A 2DL7A 3DUUB 2WBJA 1R1CA 3WIFA 3NBNA 2JI1A 1LE9A 4Y2OA 2HG5A 4HULB 3TLRA 5DJ2B 3MRBA 1XEUA 5BUGA 1BM7A 4L4VD 5C0DA 2K7AA 4KJPD 5SWSE 1N3NA 2HP4A 3P73A 4N0AC 4A54A 1XGTB 1XGZA 2ENJA 4KULA 2XV2A 3ZE2E 4BELD 4KHXL 2VXQA 1PWTA 1VQ6A 3CZGA 5ANMB 1LTXA 1R24B 2AK4A 3BQUA 1A6AB 2CKBA 2Y2TA 4ZD3L 5T1LD 1YEGH 4W1TA 4APQD 1G3YA 5I1AA 1A21A 2WP3O 5JZ7C 1RZKC 3ZUNC 4F7UB 4N22A 4W9ZA 2OLDA 4UT7H 1WQVT 4M48H 4PJBF 1GPOH 3MPCA 4FLOA 3V7CA 1VQNT 1TTAA 3AY2A 5IQ9A 3GGWB 3HZYA 3BKML 4OGEA 1WGSA 4ALAL 3L08A 4PI0A 3CCMA 3F6JA 3FQUB 2ICEB 5LJ3j 4GKSB 2AF2A 3N43F 1WVZA 3QRLA 2OTJT 5CJQH 5EN2A 2ZUWA 5L4JA 1GKEA 1KB5H 1JV5A 3BW1A 1U8QB 4IRJA 3T8MA 1E4WH 2FYYB 2YRZA 3J2PA 4YGVB 1JU5C 1KXQA 2F53B 4Y19A 5EULV 2NY5C 3H6ZA 3C09C 5F3HB 1X6GA 3ZHFA 1K5WA 3CFCL 1QA9B 1IEAB 5AVYB 3ZN6A 4OFVA 4UQCA 4AMWA 5GANf 2G3RA 2OR9H 1JAEA 2J20A 2QHRH 3P4OA 3US9A 4KAQL 1LJOA 1MN4A 3C5SA 5ALBL 2DF3A 4R90H 3MNWB 1I85A 2AQRA 1IGQA 3PV6B 2XRAH 5HBBA 3ETBF 4B6MA 3QZWB 4LLMB 4NENA 4A7GF 4NBZB 4PJ5E 4PJXF 3G08B 3FB9A 1UM5L 5I30H 4QRFA 1MJ8L 4HDIB 4KZDH 2GCXA 3C60B 4J6RH 4M8UA 3OB0K 4FC3E 3PNWC 4L29B 4RTYA 2BSCA 4H0GA 3B83A 4XC3H 4KKLD 5EBWA 1W2KT 2DFUA 4HX1A 4XPTH 2VZ3A 3M58A 5GGSB 1GS7A 3O4LE 4MDIA 3CZEA 1BI3A 3PAYA 1JUFB 3T2PA 2WTOA 2XN1A 2IAND 3HZVA 1MLBA 3FCTB 2EE9A 2NY2B 1UJ3A 5CBEB 3NT0A 3WV0A 4YMPA 4YHPA 4F33A 4RMBA 4E5XB 2J88L 2YRDA 5ELIA 5K69A 3JV0A 3NGBC 3TBCA 3A5VA 1TQTA 4K4KA 4WDIB 4G7YH 4B9GA 2GQIA 2QR0B 5GZOC 4J6XA 4UQDA 2UX6A 5D7HA 4AVJA 2VMCA 3MJGX 5E7BA 2OJZL 5T1KB 4C8QA 4UIKH 1ZVSA 3MFFB 5A6LA 4PCTA 3PGFH 1TXQA 4GLMA 1MCBA 2C7UB 4KTEH 3P54A 4WHCA 1F02I 2EINB 2QXFA 3C2AL 5DD5H 3HAEB 2V5MA 4MDJA 3JBG7 2KXCA 2NY6C 3M8OL 3HN8A 2OTUB 2IWFA 3RHWK 5EOQL 3BUYA 3IGUA 4RGOL 2YPVL 3WSQL 3Q6GL 5E4EB 3WOVA 2L04A 4MYWB 4GJTB 4H44C 4NO0D 5T3ZH 4RZKA 3URGA 4XXDA 5JPNA 2VDQL 4Z8AA 3IE9A 5LN8A 2APXA 4WI0B 1AQ8A 1HHHA 4AJVA 1OHZA 1X6LA 2AZUA 2XTSA 3E8UL 4DKDC 4TQIA 2X2IA 2CHXA 1S9WA 4HJUA 2ED6A 4E36A 3W5NA 4M75G 2DBKA 1LNUA 3ZYZA 2AAVA 4LSPH 2W0ZA 4DP2X 2P3YA 5AG9A 1VJSA 2RB8A 2I2LA 4LKXA 5INDB 5BS0A 3W0WD 1X01A 1MCEA 4ZXBD 3QJFB 1T89A 5GS0C 2HBWA 2CP6A 3GSWA 2DYBA 3UA6A 2XWTB 1VQNA 4ONFL 4XN8A 1NCTA 4U1KA 3F5WB 3IXTB 5F9OL 4D3CL 3MMEA 1QLEL 1U8MA 1CR9L 4K7PH 4OM0L 1WE5A 2G2RA 3UO8B 5I6LA 5L9DL 4P4KC 2BY1A 5F7AA 4PRID 3HS9A 5F0LB 4KRMB 3BQVA 4DGUA 2OTJA 5DK0A 3NJVA 4XCCH 5GS2H 1J8HA 3JZ7A 4YSOA 3BZDA 1JWMB 4DGYH 2EDYA 3WTTA 3HB3D 2D0QB 4GG8B 1IAIL 2RHEA 3BUPA 4IEFA 3QUXC 3GWJA 5CHNB 3SJVB 3I9GL 1S78C 2F8IA 5AOJA 4Y5YC 3QYMA 4PM1A 3OKEA 2BOBB 3Q8CA 4AL8L 5JHDD 2CJTA 2UZIH 1TTBA 1ZQ1A 2RIKA 1DJSA 2UZYA 5IFAL 4H20H 5IOKA 2V2TA 3BP4B 3GRWH 4JY5L 3VFRA 2VIRB 1BM3L 4V2BA 1OL0A 2O6PA 4P2YA 3UBXI 3QORC 1CIUA 4ZMZA 2AABH 3MGOA 5I1JH 3OHXB 3KXFA 5C6WH 4D0DA 1DE4B 3EFSA 3NFSH 5GGSY 3SPHA 2C06A 4I87A 5IHLB 3EJTA 4JPIA 5FM5O 3H42L 4XQ3A 5FYKE 4LEOA 3PMIA 2AZAA 3AWEA 4MJ5A 3GZKA 3V10A 3ZOAA 4ZUSA 5FO8A 1HN1A 2ILLA 1UC6A 2A83B 5L0QC 3R4RA 1F1AA 4MAYA 4LVOC 4EN2A 1A65A 3D0VA 5DQ9B 4LP4A 4AQAA 2E3IA 2HFTA 1D5MB 2YUNA 3HW7A 3I74A 2EXTA 5ALCH 4DT2A 5EFIB 3WTWA 2X38A 3BIKB 4HH9A 1JCVA 4DVRH 3KVPA 3FRPA 1R6VA 4HKBA 4LHUG 43C9B 3NACH 1VKXA 4L48A 3LKQA 1IC7L 3I85A 3CPLB 1CT8A 5E94A 3ZTEA 3RU8H 2MAMA 2C3XA 3PWJA 2MCPH 3NOIA 5IW6A 1OAUH 4YX2H 5I16B 1F3JB 3G6AA 1CXFA 4PP2A 4PJ6A 3S36L 4MJ6A 4XNZC 5K9OB 4ERSH 3GKWL 2MSPA 3OTTA 4BZYA 1Z9QA 1NAMA 3VG0H 3DK0A 3L1OH 3QHZL 3WFBH 5L8RE 1X75C 4HT1L 2R7EB 1WC7B 3KHQA 3S35L 1FZKA 3CMAT 4E7SA 5DYFA 5FYLE 5DHVB 4OMMA 4AK1A 2XA8L 3IFPA 3IQLA 3O41A 3PJLA 4KKBC 4KXAA 4OF6A 5E4AA 5KVDH 1GHFH 2OMUA 2WYHA 4PRPD 3SPJA 1WHKA 1URIA 4A2LA 1U8LB 4JKMA 3N91A 3UBHA 1E90A 4NLAA 1GS6X 2IWKA 4LAQL 5HJBA 5EIIA 1D0XA 1PD0A 2CGHA 4EUPA 1T6VN 1N12A 3VUAA 1A22B 1KJMB 3D3VA 3KLAB 3OLIA 5JW4Q 2AK4E 4Z7UE 3SGEH 2J06A 4PJ9D 1NZ9A 5IV2B 4DKAA 5C8JA 3N55A 4NRXA 2OR7A 1G7PB 5IWLA 1HNFA 2FT7A 1N5ZA 4TQEL 1LEKA 3MX0B 4K2UH 4QYOB 3TZVA 2NQDA 4UV7H 4J3WA 4A7QA 2F7QA 3V55A 5BOZG 4K15A 4OMQA 4KX8A 5DY9A 4MVBC 5DYOA 4LSDA 2IWEA 3QQ3A 5B21A 3C5ZD 4AGLA 5GAMg 3CD6Q 2ITDB 2RFXB 1I1YB 1AMYA 1ZVYA 5FK9B 3U4BH 2WCGA 4F7KA 4NHCH 4PJOG 4WAFA 2Q2EB 5DQJB 5EIQA 3LRKA 4WWKD 4R0LA 1MV0B 3MO8A 4B7IA 2XACC 1UXWB 4PV9A 3K1KC 2DLFH 2XV0A 3TVTA 5HHPA 3B5HA 3KW8A 3CGTA 3HRZA 3S6WA 4Y19E 5FX3A 4BHUI 3EJCA 4PKCC 2PW1B 3ABMB 3OGCA 2CRZA 3RVVC 4FYSA 1AGEA 4JNXA 4JE4B 4L5GA 5H94A 2K2MA 1TZGL 1U33A 3NCMA 2P9RA 5IJKA 3APCA 1FYTA 2FWOB 3NP3A 1J7VR 1QFWM 2X9WA 3W81A 2LAGB 3V7AG 3BGMB 1BZEA 4UCFA 4F3FB 2IIJA 3I50L 3DRQB 2LU3A 3LRLA 4LGSB 2P0KA 3ROOB 1PCSA 4RZCA 3WL9B 4P5MA 4WW1B 3QW9A 3WVEB 2NMSA 3W9DA 1E2WA 3CJJA 3APFA 2GCYA 1CBJA 4FQQA 2BO0A 2J8OA 2VGNA 1NCWH 2NSMA 2R2HB 2HAZA 3GTTA 4PD4K 5EU6A 5JNYA 1T03L 5CWSA 3BH8A 3JWNC 3CFJB 4KK5D 1CXLA 3KBPA 4TSBH 3CFDB 3SE4A 2A6KA 4V1DD 1CGWA 1A3LL 4F1ZA 4M78E 1XHHA 1VGEL 1OV3A 1YPZB 1CICA 4OZGA 2ZPEB 3T0EB 3HPWA 1RJZB 4MHHI 4YZWA 3UDWA 3HCVB 4YVUA 2JVVA 2J05A 3IXAA 3ARGC 3G6JA 4Q8BA 5ERWA 3QWRD 4KK8C 2NW3A 3S5LA 5DA4A 4B53A 3D1MC 1IM9D 4FXLA 4PRAB 2HPOA 2EQUA 2E5EA 3CMAA 5J6GA 4ZW7A 1IV8A 1UOKA 2VZVA 2H6PB 4C8QE 1CYWA 1X44A 5F1SA 4GLRH 1EO8L 1JCKA 4Y1AB 2EUXA 2NUTB 1VQ4T 4U3XA 3JCMW 2CNYA 3GTNA 1HKFA 3WIHL 4ZD3H 3OKYA 3B9KA 4L3CB 3VO0A 1T3FB 5CLZA 5FHAL 2WZ6A 2X7LA 4ZW8A 5AUMA 1R3LA 3D2TA 1OOAA 3PUCA 2B3RA 2NY0D 3ESNA 2XK0A 1NDMB 5C70A 1MOEA 1I3RA 3WNMA 2Y4XA 3CLWA 2WZAA 1WF5A 1CO1A 1UWGL 1U06A 1K76A 3DVNA 1IZ6A 2WO2B 3A21A 4GINA 1NJIR 4FLSA 2HKAA 2D2OA 4P2OC 4BUHA 3ZYJA 3BKMH 1CQKA 4ALAH 4BDVB 1IU1A 1VACA 2XTJE 1PQZA 2HDAA 3NDZE 4W9DC 5FUZL 3ZKQD 2LCSA 1F8TH 1W72B 5TQ2L 2K45A 4POZC 2ADFL 4JHZA 4TNVF 3OYYA 5DJ6A 3FOMA 3RIAK 1JL8A 4GBXA 4N5EC 4ZOAA 3C6LB 1GC1L 3I56Q 3HI1B 1WA7A 1T1XB 3GMMA 3CFCH 2GIMA 3N06B 5IB5B 2V9UA 4B27A 1ZSGA 3PY9A 4L8BA 1N5AB 4POUB 2CSQA 1NCDL 3QDMA 2V7HA 4KAQH 5DHYB 2ZPFB 3M4GA 5IMMB 4XTVA 2ZCZA 4GQZA 5ALBH 1QSED 5HD8D 4G42B 3L9RB 4KJWD 4IBQA 4JZOA 1J8HE 4K3HA 5FYKU 2QFPA 1XZWA 5I74C 2KL6A 2NXYD 7CGTA 4HS3B 1V54B 1ARKA 3U30B 2O5ZL 3WTYA 5EEYA 3RVTD 1MJ8H 2W9DL 5DLQE 3E7JA 2ZWKA 3BAJA 4H8HA 4OCWL 4A2EA 2Z4QB 1PZ5B 4WQOA 5D7JC 5KS9B 2C3WA 2ODIA 1Q90A 3VFNB 4XU2A 1Z6JT 4M77A 2I9TA 4TV3A 3NMEA 5IM7A 1QKXA 3DHUA 3H9HA 4UOJA 4C5EA 2FZ3A 1GYAA 2VN6A 1T66D 3II1A 4UILL 1Q0YH 3VS1A 2W0KA 3QUML 5FGSA 3VXMB 5BO0D 1HTYA 4FYRA 4PMEA 2LX7A 5FLUA 2NX5B 4EMKA 3KXFE 2QTVA 1DBML 2ODHA 3ECVA 3G6DL 5JHLL 3KLQA 3RGBA 3TTYA 3RWFA 2HFEA 1LVKA 2MOGA 2QSQA 1DVQA 1HH9B 2J88H 4AFSC 3QC6X 2CLZA 4NT6B 4AWJC 4B6ZA 4NIYE 1BSIA 1OEZW 1F6LL 2H7WA 5HJ3B 1F97A 5DFVC 3LNEA 5KSAC 2QMJA 2P84A 5CEYA 2OI9B 2DDQL 4BEIA 1LYQA 2ZJSL 4PJLA 1IB5A 1PKTA 4M6NL 4F24A 2OJZH 5L4IA 3ZO9A 2F8XC 4FFZA 3I75A 4TM9A 2VLJD 1TUCA 1WZMA 1QUNB 5E8NB 3N2JA 2EQKA 4NFBA 3C2AH 4KUZL 3PXHA 4HIHA 3M8OH 2DYIA 2X3WD 3RFZC 1SSHA 4RGOH 5AZ2L 1PZSA 3QI9C 5CD5D 4OJYA 2YPVH 5ACMA 3V52L 2FSEA 3Q6GH 3VXSA 3WSQH 2GBAA 3CBKB 2L3QA 2VAAA 5I75B 3BSZL 2VDQH 4DAGL 3OKNB 3PTAA 2HH0H 4LOUC 3UTTD 1VQ4A 3MOAL 3BVWA 2VV5A 3E8UH 2AXFA 2WYIA 4B9YA 1NCCL 3E3QE 4YDIL 4HFUL 5FGRA 2R27A 4ZUUB 5IHKA 1WD9A 2LFEA 3M59A 3U0WL 3TWYA 4N26A 1TJMA 4DKFL 4OFYA 4OIBA 1U5SA 3CN2A 1AACA 2R29L 3QUYD 4B9JA 4I13B 1DQJA 1XH0A 4NQEA 4RRPM 5I17B 1HNGA 4ONFH 5GJSL 1N6UA 5BOPA 2DL8A 4QIRA 1AHKA 1CDIA 5F9OH 3UIYA 2OMWA 4D3CH 3G6EA 2DKGA 1QLEH 1RHHB 2EQDA 1CR9H 3AACA 3QUKB 3BVDB 4OM0H 5L9DH 2RJFA 1P7BA 2FECI 4MB5A 1Q9KB 2YHGA 4KJPC 1EXUB 1QRNA 5I76B 3BE1H 4F7MA 1H0DB 3D3VE 1FWXA 2CUIA 3NZ8A 4OY9A 3U4KA 2RHZA 1WBXA 4KUCF 1M3JA 1IAIH 4UQBA 2FYKA 3I9GH 2ADYA 3BPCB 5T3XL 5CGYD 1IT9L 4M4ZA 4NFDA 5FXCH 4MJJA 4AL8H 2CZ6B 4L59A 1IREB 1M05A 3TYFA 3BMVA 1M3CA 1S8DA 3X3GL 2E6JA 2LGNA 5IFAH 5C0FA 1R3HB 4JY5H 3RZCB 4ADJA 1BM3H 4JFWA 1BI2A 1C5CL 3NVQA 4TUOB 1MI5B 4JJNK 4G8FB 1JOIA 4MCZA 3MUHL 3DMMA 3WY2A 3KE0A 3CVCA 5JHBA 1DANU 1I1RA 4QRPA 3N0AA 4YDMA 1KD1R 2ZIDA 3Q6FA 4F7PA 1QFPA 3QR2A 5INCA 2NSXA 2F1LA 1AXTL 4A4GA 2XX1A 3H42H 1KFGA 1YWOA 3EOTL 5HGAA 3OAYH 2GI0A 1D5RA 1QNIA 1IAOA 3VXOA 4JREB 3RG1C 2Y7MA 4NZ8A 1OGAB 4KOBA 1LHZA 1S1NA 2RF0A 2G4GA 3MODL 1AZCA 4B60A 3FMGL 3GSNA 5ISZD 1Y1DA 1L5GB 3EYOB 3N40P 1BYMA 1FYTE 4JUSA 4DP1X 2E4TA 4WKXA 3V0DA 2YD4A 2DWTA 2JQAA 5DLML 3T77A 1IC7H 4OW6A 4P3WA 2WXIA 4U33A 2F5TX 3SGKC 2JWYA 3LN5B 4EJ1C 4UBDD 1VYVA 5DURD 1IE5A 3S36H 2EJ9A 5MEOB 4LT7A 4LB8A 3GKWH 1NGYA 3TQ7P 1UZGA 5GXBB 4KKLC 4FFWD 4DOHB 3AU1B 3Q1JA 3QHZH 2QI2A 1N64L 1JF5A 3EDJA 4HT1H 1F45A 4ZMOA 3ZW3A 3S35H 4HZLA 3M1OA 1LK2B 3GSVA 4AV4A 3X1EA 5JXEC 2XA8H 1NGPL 5F70A 3NCEB 1FO0B 5FO7B 3G6JE 4HIXL 1NC4A 2JN0A 3VWKD 4N2OA 1FSKB 4PB9L 3DC0A 4QRTA 2RCSL 4L0ZA 5C0AB 4GY4A 4LAQH 5GS1A 2E6QA 2J25A 3GMNB 4RKUE 2EIKB 4P99A 1CVRA 3IN2A 5MEPA 4Y4FD 2QGCA 5C0BA 1ZV9A 1VQOQ 4MD4B 5SWZB 4JDEB 3OBYA 4OU3A 2EECA 5DK2B 9CGTA 3VH8B 1A4JA 4G9DA 3V6BR 3OQ3B 4UAHA 3F7VB 3N50A 2R0ZL 3CH1B 4ZFOL 5E5LA 1ZA3A 3NPSC 5BRPA 2E65A 4Y9GA 3DUUA 1J1XL 1ZD6A 3HN5A 4TQEH 1SVBA 4HKXB 4LQ1A 3S88L 1UUEA 1O6TA 1S7RA 3ME0B 2YAPA 4BFJA 1GKOA 2FUTA 1DJYA 2IGTA 1XMEB 3WGVB 3I6LE 4NP4L 1YO4A 4Y16D 3NG5A 5CN2A 4EVNA 4X83A 3WFCL 5J11C 4WIQA 3V4UL 2IC2A 5D1QB 4JHVA 2EKSB 2NSQA 1R24A 3HOGA 4GS7C 1PLAA 3NSXA 2EQIA 1CFTA 2VMJA 4WW2C 1OW0A 4AKQA 2AQTA 4DH2A 2BCKB 4ZXBC 4OF3A 1UWFA 4XNMB 3TGXA 2Z91A 4WTQA 2OCCB 4H8WC 5FKPB 5I73B 2FIKB 2EKHA 4N2FA 3CCLT 3PHAA 1EJFA 3QDME 4GMTL 1U3YA 4X5XA 1OTTD 2C9QA 4XPFL 3DO7B 1J8KA 3TCLA 1CFQB 3CD4A 1DN0B 3G5WA 1TZGH 3QJYA 4XO9A 4YDJB 3ZU8A 5C07D 3HG1B 4J27A 4FABH 5FRNA 3OS0A 3I50H 4MJIA 2X88A 1G5VA 3HB3C 4GKSA 2Q86A 3WXVL 2MOQA 5GIRA 4MA1C 1AH1A 1KTLA 1NUNB 2JLPA 1U8QA 4IJ3B 3EAEA 1D9KB 1R47A 4N1CA 4XNAA 4LDWA 2ADIB 2ED7A 2IH3B 1T03H 1E3ZA 1EFNA 1J8RA 4R96B 4BSVB 5F3HA 4Y28E 5CLTA 4M77E 3QNZA 3U7YL 2HBPA 5KVEE 4G7VL 4M7DB 1J86A 3BUIA 3ZKMC 5LCVA 5EO0B 3SE6A 3T2QA 1G1YA 3NRQA 1J5CA 4FG0A 3RMSA 1A3LH 1HSAA 1VGEH 1XR9A 4XTXA 3PWVA 1V3JA 4GO6B 3QZWA 5I6MA 2JJVA 3S9DB 2QKIA 5KJ7E 5I21A 1ZVHA 4ODUA 4CC1A 1NLBL 1E5AA 1JVLA 3TH4T 1ED3A 3HE6D 3V6ZB 3CQQA 1Z5LA 3D85D 1HJBC 4JZJB 5I8EA 5TE6L 2KPNA 1VOMA 1J0IA 4JN2B 4PJCF 1EO8H 3QJTB 4CJ1A 3F64A 5FS5A 1GYUA 3WS3B 2DIBA 3WIHH 1AQDB 3IJYB 2FG0A 2FEEI 1HXKA 5FHAH 5C0JB 1F3DH 3GK8L 3RL2A 3A8MB 3I9QA 1IC1A 5LAXB 3JUYA 2RQEA 4E5XA 3VXSE 1IEHA 1IQDB 3MJ8B 5E2UL 4U6HA 3OJ2C 1UEBA 5D55A 2MEJB 4Y2DD 3KWVA 5KYYB 1UWGH 3M17B 4MRBA 3F2LA 1G6RB 5F7NC 4MLSA 3PIPA 5AYTA 5HHOA 4YTLA 1CYGA 4IURA 3WLWD 5AW1B 2DEUA 1X5GA 1TQVA 4QKXB 4F15B 4WK2B 2EKJA 5CR1A 5KBNC 5FUZH 2VLRA 1TQBC 2X4NB 4KWUA 3LYIA 4X7EC 5TQ2H 1H3PL 2ADFH 2ZICA 4Z0XB 1VQLT 3WIAA 5EO9B 1RZ8A 3WN6A 4BFKA 4ANJA 5I8KL 1OT4A 1GC1H 4LRNL 5C0IA 4X5WA 1IVTA 1IIKA 3MJ7A 4XRCA 5GAMf 2ED1A 3JV5A 1Z32X 1H9VA 1QRNE 2WLIB 3DNKA 4KJYA 3EDKA 2V3FA 3IDYC 4XVJL 2OZ4A 1CN4A 1JRHL 3GSQA 4LLWB 5CSGA 1WHMA 2FRWA 4QCIA 3DI2B 5EU3B 1ZGLB 3U36B 3SPGA 4PJ9C 2VQ4A 1BAFL 5KBMA 3HFFA 4G8GE 2O5ZH 1WAAF 1DUYB 3CCSQ 3CCLA 2W9DH 1TZAA 3RNKB 4OCWH 1LNXA 2IH8A 2XWTA 2VR8A 3NDYE 3E6HB 1U3OA 2H3JA 2XIDA 3T2LA 2YA2A 5DS8B 2NCEA 5E1GA 4DZBA 4BKSC 3MRMB 3LEVL 3MZTA 3LD8B 2CGYA 2AANA 2DD4A 1FVDA 3C5ZC 3QUMH 4GRWH 4UILH 4WJG3 1I9RL 3IK2A 4IS6A 1DBMH 1TKWA 3G6DH 3P4MB 2DAQA 1DSWA 1A1OB 4QRPE 5JHLH 1JWMA 2EQMA 3O8VA 3QDGB 1FMWA 3CFQA 1NEPA 1IGYB 3CZFA 4RTUA 3DVGA 1S7VB 2GFAA 4GG8A 4JGJA 1T0JA 1CD1B 4FI6A 4N2GA 1SN2A 3ATAA 4P5TD 5DRWB 3VSVA 3QIWB 1OVZA 1M9SA 3IJHB 4JO5A 3QC5X 5AL8A 3VFTB 2DDQH 3RX5A 2ZJSH 1PVHA 4M6NH 2DTOA 1UVQA 2NTSP 3ZDXE 3ATBA 4HQQL 4RGNB 2CDFA 2ICWA 4TRPL 3U46A 3PXLA 2A4ZA 3CPWS 1A0QL 2ESWA 3OB0H 1ID2A 4YBQD 3UTOA 4KUZH 2EABA 2JTEA 5D1ZB 1KWGA 4B9WA 4AUUA 2NUPA 2E86A 2XI9A 1DE4A 2AJXL 2VCOA 3WY1A 2DL5A 4FSXA 2FEDD 4KO6A 2WD0A 5AZ2H 3OXRA 3EO1B 4Q6YA 3V52H 3BVVA 3QUZA 2EJ1A 3B8SA 3BSZH 1XH1A 2H1PL 3EGSA 5AD0B 3L3OC 4DAGH 2O6DA 4HUXA 4W4OC 3MOAH 1ZLWK 3BKYL 3B2UC 1NCCH 4L4TD 4YDIH 1FJ1B 4HFUH 2WSDA 4KK5C 4G70B 5I2MA 2HA1A 3IPFA 4FQLL 1BBDL 3WHXB 3U0WH 5IR1B 4DKFH 3BIKA 4PJBA 3R6OA 3EG9B 1P4UA 3HPJA 5IK3A 2VO8A 2E8ZA 2XBZA 2RJMA 4P46D 4Z7OE 3L5HA 2R29H 2JH2A 3CPLA 1D5IL 4FNLL 2ZXQA 1GXIE 3GPSA 3FUDA 5GJSH 1RAAB 1OP4A 3VMNA 1BLNA 5D7LD 1ADQL 1SYVB 3LPOA 1D3BB 3KBGA 3FC8A 3N5AA 2JSFA 5K9OA 3APNA 1JVOA 1CZ8L 3RNQB 3BDUA 4UINL 2UYLB 2FRYA 4P57B 2LOEA 3WXWL 2HTLD 4Z7IA 2K70A 4ICXA 2R7EA 1AJ7L 5C0BE 4X4XA 1R5IA 2YRVA 4DOWA 1VQLA 2DNUA 3TBBA 3TC9A 2VW4A 1VAHA 2JW4A 4AZ8A 4W70A 1YEJL 3LH0A 4N4GA 5T3XH 3UTPD 1IT9H 2EYSA 3DXAA 2XU8A 4IGBC 4PJEF 4ZFGL 5I6OA 2NY0C 1ZHIA 3VXQB 4C83B 3X3GH 3EHBD 4LPTA 3OMZA 2N3JA 1A47A 3X12B 3ETBJ 4A7GA 3ZL4L 1YEFL 1N8OE 1RK7A 4PJXA 1EHLL 1UQSB 2V17H 4ELKB 1C5CH 3VXUD 2C4FT 4OZFB 5C08D 1K2DA 4IOIA 1MRCL 3KLAA 5CSZB 2ARJQ 1U3NA 3INZA 1IGIL 5IB3B 2VISB 2WO4A 4WFFE 3T4AB 5TTRA 2XETA 1Q94A 3U0TA 2AMGA 1ZWIA 1SEBA 4PJCB 2UX7A 2D9QB 1AXTH 2DM1A 2KPWA 3CUPA 1B34B 1INQB 1KCRL 3EOTH 3P9LB 1FNLA 2HLFD 3NTCL 3MRFB 4I0PB 4BDYA 4M6ML 4NJAL 4Z7VF 2DF6A 5E8PB 5LJ5j 5L7XL 4LK4A 3FB7A 5AAMC 2JJUA 2GEQA 2QPDB 4N6RB 1KTRL 2PWGA 3VFOB 5DRXA 4RESB 3IB4A 3MODH 3FMGH 1UGRB 4Z89A 4GEJA 2VL5A 5IJVA 2JIXD 4KJWC 1GCQA 3BFOA 1Q4NX 1QP2A 3KYOB 5DLMH 4MJIE 3EJQA 1A1NA 3IKCA 2J73A 3HTRA 2NXYC 3P2DA 4KH1B 1UXWA 1U42A 4ZYKB 2APBA 3KJ4C 3TNMB 4DUVA 2GAZB 3L3HA 4ZFFA 4X6CF 2E7LC 3ABLB 3X1GA 3DURB 4KRPB 1N64H 4A6YA 2ZQKA 1BOGB 2EEBA 2J57A 3GEWB 2BZCA 3CBMA 3GMPA 4XVUD 3ZSSA 5F7UA 4LXFA 4QVDA 3ECBA 35C8L 2E5QA 1FNHA 1M6OB 1AKJA 3OXSB 5AOLA 5AVZB 4PVBA 1J5IA 1NGPH 5HYEA 1KEML 2YSTA 4ZOCA 5DJDB 3TFKC 2ZAGA 3P9WB 3TNNA 2HUEA 1KTKE 1OGPA 2Y7QB 3VE0B 1XBRA 1TFHA 1T5WB 3ZFJA 3MCYA 3RDTB 4HIXH 5TF0A 1OLZA 2I60L 4PB9H 2Y5EA 3FU5A 4HK3N 1H8OA 2A28A 4PFPA 2WIIB 4HIEA 2WZPD 4LEBA 1T04B 5DQDL 3J7HA 1TTFA 4JFPB 4HS6A 3K2IA 1P5UC 3TBTA 3PG2A 4A7TA 1RADB 4JJOA 4X8JB 1B9KA 4LLDB 1FFOB 1JN6A 2EO9A 3FQ1A 2R0ZH 1IGTA 4A7VA 5A3ID 3T0EA 1WISA 3VRZA 3T0BA 4XMKH 5FLVA 2EBPA 1C5BL 1J1XH 5CD5C 1T4WA 5AALA 3NPFA 4FL4C 4GP5B 3ZDYE 3S88H 5KN5B 1HWGB 2Y1VA 1SOSA 4ZO8A 3RWIB 1X4YA 3D4CA 5F7DB 1KXVC 4NP4H 1DJIA 2Z8RA 5HHOE 3V4UH 1U8OA 3O6FD 2P45B 2PPCA 5DTFB 2K3TA 1SDYA 1U2HA 3P3SA 2F9BT 1I81A 3UOAB 1R46A 2VLRE 1KFAL 1QBAA 5E1IA 5TE4L 1PNCA 1EZUA 3QUYC 3CTTA 5FU7C 5CU9A 1J10A 5D8JL 2KQNA 3RY5A 2MQ0A 1NCOA 2DQUL 1F4WL 2FEJA 1AXSA 2ZX7A 4J3UA 1RL1A 4K3GA 4XPFH 1DFBL 2IDUA 4RAVB 5I5IA 1KBKA 1SEQL 1I1FB 2DD8H 4B9FA 2HN7B 4BCYA 2FWLB 3KPMA 5DVOA 1UKQA 3PWPB 3WXVH 5F9AC 5A2CA 3VQMA 2EH8L 3K3QA 1BFOB 5LAPA 1V10A 3C9NB 5JIPA 2ESVB 2JV6A 5HYJB 1G2BA 1XF5B 4JFDB 5LGYA 4ABVA 4S10A 4E41B 5IB5A 5C0CA 1OEBA 1SDDA 1N5AA 3CQTA 2OK0L 2XSKA 2HMID 5C2UB 5IW1B 4YFDB 1GFCA 1GZQA 5DHYA 3A0OA 3NJKA 3SKNB 4Q6IC 4ZI8A 1WG3A 1E4HA 3L9RA 1HFUA 2O72A 2ZXCA 1AR1D 1CPUA 3CDZB 3BWZA 4AIEA 1T83C 1N7ML 4JRXD 4M1GL 4XK8E 1ND0A 2Q20A 1IUZA 4DVBB 3E6FB 4JLIA 4AFUC 3QWOB 3WNNA 1NLBH 1T5XB 2B5IC 3KM2A 4FQXD 4F92B 3FUFA 4MX7A 3D39D 2N0MA 3DGCR 3I9AA 4N8VA 5TE6H 2HKFL 2WXQA 2IJ0C 1EGJA 3DV4A 1KNOA 3NH7L 3BN3B 2ZWYA 3HHSB 3LQAC 2IAMD 4GQ9L 1KYAA 2B3IA 2VMEA 3GK8H 5BCAA 4BFOA 1EJ8A 2SEMA 3OAZH 4IBUA 2X70A 3HRTA 3V4PB 3I6KA 5B38G 4NT6A 4UBDC 3MLTA 4D94A 5E2UH 4JCWA 3HNTL 2AERT 4YDZA 4FYVB 4VUBA 1MFDL 4CC4A 3CV5A 3MYJB 3AG3B 2XOTA 3AM8A 4NPJA 2AJYL 1QACA 4QRSB 3RDVA 3O3BA 2QQKL 3WFZA 3QR0A 3DYMA 2F6AA 3RVUD 2EWNA 1QW8A 2OTWA 4CN4A 4P3DA 4PJBE 3Q0HA 1HH6B 2VR5A 3PDGA 2BSRB 3RGVB 5F0MB 1H3PH 1MWAL 3DETD 3V0GA 5DHEA 1C7TA 4JO4L 4JBSA 5EZOL 4OCMC 2DQIL 1DN2A 3QJUB 5I8KH 4HOMA 4MRCA 1JYXA 4LRNH 4C92G 4AFZC 4O02L 1FL3A 3VS2A 1E8XA 2P48B 5EBGA 4CL7A 2IPKB 2ZPGB 3Q9QA 3RTQD 3KPQB 3OKNA 4KXBA 1QLYA 1T0PB 3E2UA 3ARSA 1JRHH 4XVJH 5DDHB 5BPPA 5F7KC 4Y4FC 1BBJB 4HV8A 3A1PA 1H5BC 4MQ7A 4APXB 2XKUA 1VQKQ 1YI2Q 2BP3A 4R8WL 1BAFH 4NI6A 1EZZB 2MPVA 3OYGA 5GISL 4JPQA 3I55Q 3DXAE 4LCUB 4HCKA 2Q8AL 3H4HA 2BSED 4R7LA 2UXVA 5I17A 5E2WL 1YEDA 5IKCA 4BI3A 1MJJA 2CQVA 4BXVA 4I9WE 1YNZA 3FO2A 4PJXE 3LEVH 1MCOL 4Y16C 2WNXA 5L2KA 1I9RH 1E8YA 1UEMA 4LL1A 1CCZA 2Y2WA 3CK0L 1AOHA 4X0NA 3VRYA 5AW6B 1I7RB 2Z31B 3PRZA 4U6YB 1NGZB 1KIUB 2KYIA 2O30A 3W2DL 1NJ9B 1U2YA 3W9EB 3D4GA 4WUUA 5CZKA 3JTSB 1U8JA 2XDHA 3BD3A 3VD3A 1A0NB 2K3BA 1TH7A 1G87A 5IZ7A 2BZ8A 4M75B 1IGJA 1NC2D 2DLGA 3BPCA 4G5ZL 3SOTA 2E6ZA 2L89A 2FH6A 4XODA 4BK4A 1BX2A 1XTLA 3CD6T 1UGSB 4Q9RL 3D7PA 3OPZL 2MCG1 1TVBA 4I2XB 3UXFA 1JXMA 1X5YA 4HQQH 2FVUA 4NN6C 1OTTC 4TRPH 2X4QA 1M1KU 2BHFA 3RZCA 2VLKA 3PDOB 1A0QH 4HCGA 1TZHB 4FI8A 4PG9B 4EAEA 4H5SB 1JZ7A 1DFXA 2LT9A 3REBB 4KK6C 5DMKA 1JWUB 3SHSA 3ORJA 4W9IC 3KWWB 1J9CT 1HHKA 3MLZL 4EXKA 1T0HA 2PTKA 1E9OA 3UTQA 5IY5B 5JOFB 2P5WB 3ZKXC 3L2RA 4NZUL 1RUQH 1WFUA 3G5YB 3GHEL 4EQ3A 3QFJB 3DDGA 3H3BC 1IC0A 4YDKL 2H1PH 4X6FB 3FL7A 3GS4A 4Z7AA 1YN7B 4NWTL 3BKYH 3IETA 4KOCA 4PRDB 2VR6A 1AZZC 4E7HA 4QOKD 4ZS6C 1J05B 3MBED 4FQLH 1BBDH 1SZNA 3P3RA 4YXKL 5K9KB 1I9JL 3EFOA 5K39B 1KQ2A 1RK0B 1DVUA 4I7ZC 1DO5A 2VC2L 4Z1PA 4XU1A 1NMBL 1JJUA 1HILB 5ID0B 5M7QA 2R83A 3CCJQ 1D5IH 4FNLH 2WTRB 1UM4H 4GAGL 3LN5A 3TU4K 1GY1A 3QEQB 1ADQH 4LLVB 4IHOA 3L2UA 4HUNB 4J6YA 3OYBA 1N59B 5IOPB 5DI8B 4TSCL 1MHCB 4NZJA 2LT1A 2I5YL 1CZ8H 1D7CA 3CFKA 4UINH 1AZVA 4U31A 3WXWH 1R5WA 4BZ2L 1AJ7H 1EMTL 1ZBXA 5AZEL 4Q2ZB 2JNZA 3OVUB 5CINL 4MFHA 3BRDA 1NUFA 1A7NH 4CVZB 3F62A 1ZT1B 5DCCA 3VCLA 3SB2A 3ARQA 2PO6C 4NIKB 4W9FC 2V1QA 3C95A 2ZX5A 3ZRFC 1OPGL 1G9EA 1FHNA 4OF5A 4D8OA 3CSBA 3I9IA 4ZFGH 1RFDL 3GDBA 3GS7A 2RBLA 1IBYA 3V0HA 2PU9B 4JO8A 1H9DA 2NXZD 3LRGA 4Y2DC 1YEFH 1LDPL 3NCCB 3QG7L 1EHLH 3FC3A 3QIUD 4TVPD 1RJYA 3S5ZA 1PZAA 1QCOA 5F0PB 2Q9OA 1DUZB 3WLWC 3L7EB 1MRCH 4ZMVA 2G3XA 3PNWB 5IGXL 4PJ8A 2V5YA 3L45A 2VNCA 1IGIH 4MMZC 4OT1H 5SWZA 4JDEA 1O5PA 1UT1A 5DK2A 4GSDL 3IVKA 1KPRB 2RHYA 1J5DA 1P7QB 1YCSB 4AEEA 1DVFA 4KVCL 4I18C 1KSWA 5DRZB 4CNIB 4LDLB 2OJ2A 2B2XL 1KCRH 3AXLB 4NJAH 3KLLA 4M6MH 3A6OA 2XFXA 4WLCA 3TPKA 4HKXA 1UT2A 5L7XH 4PI2A 5LB1A 1SN0A 4WFEE 4EI6B 3WVDB 1VYUA 4J1UB 1CGSL 3BPLC 3S7GA 4P2QB 4Y4KD 1UHFA 1I8KB 4M1CD 2NYYD 1CFNA 3CU1A 4Z6AT 3BWSA 4M4PA 1M7DA 3ERXA 1AO7B 2FO8A 3I56T 4D9QD 1KB5B 1RZGB 3L1AA 1B2WL 4FZ8L 3CD6A 1JYNA 1PZUB 1YJDC 2L3BA 4WFHE 1JPFA 1X9QA 2VDPL 3EH4B 1U0QA 1K4CB 2GJ6B 3IJSB 4MCYA 3FQWB 2ZX6A 5C0CE 3BZFB 4NQXB 4XU3A 2YPKB 2ZOLB 1M2VA 4FA8A 2WXOA 5FEBA 2YFOA 35C8H 2CT4A 4ZZKA 2F53D 3QDJA 4PJHB 4YDJA 1B0RA 2XUWA 1KIQA 1X5AA 1X5JA 3UPUA 2EP6A 4MZIA 1JNNL 5BVPL 4AXWB 2J6WA 2KZWA 2DIGA 3PWNA 3TJHC 1OT1A 2Y7SA 4HS8H 2I60H 4PJOB 4FT4A 2COZA 4GKNA 1LQSR 3HG3A 1GOHA 3P11L 4HKEA 2IH3A 4L5FE 1SHSA 4BSVA 3FN9A 5DQDH 5CKGA 2WN2A 3SB3A 1QO3A 1N19A 4AE0A 2XU9A 4IBTA 1U8KA 3C60D 4B3EA 4YZFF 3BY7A 1VFAA 3C6SB 1TSHA 3J27A 1EH9A 3DX8B 3OF6A 5DR5L 3SDAD 4IBVA 3FB6B 4YBQC 1ITCA 2F7IA 5CZXD 5C1MB 2JF1A 2FL5A 4OKVB 4NUPA 3TH3T 1MCNA 1C5BH 4LRIA 1M1XB 1WIOA 2NR6C 3MRNB 1TZOA 2Q8BL 3V6FB 5LWYL 2NY2D 3UPAA 3KEHA 5H35B 1VYTA 2EYQA 4GRLB 3TIEA 2JJSC 1PRMC 1CKAA 2A6JB 3V0IA 4CU6A 4AOFA 1I5OB 3K80A 4DSYA 1ZT4A 3N1QC 3SDCD 1BZ9B 3QRFM 5IB4A 4A7SA 4F8PA 5L8JB 1AQDA 1KFAH 5J5EA 3BFMA 3RKYA 4FJ6A 2KKQA 5TE4H 4YAQA 5C0JA 5KVFL 1BIIB 3ZHKA 5D1XB 3ASNB 2ZWLT 5D8JH 1BI1A 2DQUH 1F4WH 3MV8A 3V5DB 3QNFA 5D6CA 4PTUB 1MMDA 1DFBH 4V33A 1W70A 6FABL 1VQ9Q 4GEIA 1FAIL 3MV9E 1SEQH 1A6ZB 4GAJL 4LSQL 4YDVA 2G0LA 5CLWA 3IGAA 3TT3L 3F6IA 1JGEB 2Z1KA 1MNUL 3K6NA 2OTLQ 3FTUA 1KUMA 2X3BA 4ABQA 3LS4H 3U48A 1HQ4B 2X4NA 3FUKA 1KMGA 5J1AA 1KPVB 2EH8H 4RMOA 1MWOA 3JV4A 3QT2A 4BWUA 5FFLA 2GHWB 3RWDB 1LO5B 4LOFA 4F2MB 4WNSA 5F9WB 3UGXA 5BZDA 4X98B 2LVEA 3Q5YA 3EHBC 3MCAB 1AT1B 2HUHA 2FAUA 4MQXD 3D4YA 1S9YB 4OR1A 2OK0H 1QG3A 2WAHA 4JFEB 5AYFA 5L2KE 3I56A 1GY2A 2QQLL 1IQWL 3V0VA 1URZA 1CUOA 2BNUA 2CRYA 3ARDA 2CLRB 3D18B 2WXRA 1R5VB 4DKTA 4JJHA 1ML0A 2CO6A 1NLPC 1N7MH 2NY3C 4WUUE 1UKTA 4XI5D 4M1GH 1MFCL 1DQKA 4E9TA 4KKZA 5CEZD 5DGQA 1PJ9A 4G7QB 3VFGL 3WG7B 5AB9A 3U1QA 4N2BA 3UH8A 4I5BB 5JO5B 3R0NA 4G72B 2HKFH 3SJVD 2ED0A 2MTPA 1UB6A 4K0OA 1XL4A 2XXFA 2CP7A 3EDEA 2FZCB 4PIRF 3NH7H 4RBPK 3TO4B 3MLPA 3MRMA 4WO4B 2KHAA 4CC3A 1MZYA 1OOWA 2VLKE 2ZKHL 4NNXA 4P59L 4PWEA 4WV1B 3TBWB 4GQ9H 3VFWA 2PCFA 2MRYA 1F18A 3VM5A 4Y5VC 5EV7A 4JLRA 1U8HB 2HKHL 5T5NF 1I53A 2ZNXA 2LCLA 2A74B 3OKDB 3AT0A 1PSKL 2AKRB 3K8MA 2DQHL 5PCYA 5DRNA 3T04D 5IW3A 3L6FA 4U1LB 1CD1A 1G9MC 3V0AC 3FF7A 4U1NA 3HNTH 5TDNB 1SVCP 5I2SA 2W1NA 5IMKA 1MFDH 4MXVF 1MW1A 4XB7A 3MXVH 2NNAB 1PKQA 2AJYH 2AKLA 3TVMD 2XQYK 4PFZA 1OGTA 1OAKL 3B8YA 4XVUC 3WGUB 2I7OA 2QQKH 4R7XA 1HEZB 3ES6B 1PAZA 2DQDL 3MV01 4JHWH 4AQEA 3TPUB 3JCMc 3KG5A 4WI6A 3K1DA 4NQDB 3T8XB 2MPXC 4Z7QB 1MWAH 4P5RA 2OAAA 2A4CA 1RUML 5JQIB 4JO4H 5EZOH 1DTUA 2VT0A 5IBTL 1AXIB 1M3BA 2DZEA 2DQIH 1RQ5A 1OYXA 1KY7A 2FWUA 2H1LM 3KS0H 4FG4A 1BQHG 5B39G 2LQ8A 4O02H 3AW5A 3EO1A 2JM9A 4A66A 4NCC2 1EEZB 3F7QA 3V5HB 4J3OC 3WDIA 4NN7C 4WTZA 5D6DC 1EHXA 2WOBA 3ZYOA 2OCJA 3GM0A 4YOKA 2D8KA 4PJNA 1EBAA 5AL0A 2PP9A 2FJSA 1JFHA 2HLAB 1I1AB 1KV3A 3FN0L 4A4FA 4XP9L 1BPVA 3EGXB 1MJUL 3MLVL 4R8WH 4YXLL 3I3BA 3GQFA 3QXTA 2JB6B 5GISH 1TXKA 1MCSA 3A6BL 1KCBA 4A2GA 4FFVD 5A3IC 2QYZA 2F7RA 2X4SB 3H9YA 4TNWF 4E9YA 2Q8AH 5J3HC 3VDBA 1PEZA 2VN4A 2KH2B 5E2WH 1FL5B 1EEYA 3H2PA 3OYLA 5FF6A 1VQOT 3H2WA 3FUNA 4JJ5A 3MRQA 1MCOH 4J9BA 4ZAKD 1CXIA 3H0TB 2UYLA 4JFXA 4LDYA 4LASL 3EOBB 4NQTA 5F7WC 3CK0H 4K7PY 1AMXA 4M61B 5CEZL 3HHRB 3W2DH 5IESL 2AJ3B 5SWZE 3ME9A 2ZCFB 4J4PD 4Z18A 2DE0X 3FB5A 1HL8A 1SM3L 2F2XA 3CZNA 4G5ZH 5B8CA 3QIIA 1T1ZB 3NUKA 4Q9RH 3VTTA 3OYKA 3OPZH 3QEHA 1W80A 2BVPA 2YR3A 3Q2VA 4JAMA 2HLEB 3K71B 2WKOF 1UGKA 5C09B 3R4DA 1WYJA 3FYEB 2DRMA 2B15A 2VE6B 1WA0X 4Z3TA 4UZGA 4R55A 2CJUL 3ZL7C 2JM8A 2WSFE 2BOCB 2MQ3A 3MLZH 4UV4L 3NJLA 4GQRA 5IVZB 3LHPL 3VFMA 3T4AA 2F5BH 3II2A 4NZUH 4Z95L 4PJCA 2ATPB 3GHEH 3FU0A 3OM3B 4NPKA 5F7EL 1YEIL 3MRLB 1QEWB 1E27B 1FZJA 4D6WA 1B34A 4WJ5B 1Z3GL 4YDKH 4YHYB 3TA3A 2Z93A 4NWTH 1JK8B 1VFBB 3VFOA 2MHAA 1JJ2P 3DLQR 3DWTA 4K3EL 1JD9A 2IV9A 2HMIC 3HP9A 2D9TA 1FIGL 1P53A 4YXKH 3QDJE 3ZQWA 1I9JH 2ZG2A 4AG2C 3ATDA 2VC2H 1NMAL 1JZHA 4J9FA 4LN2A 1NMBH 4GFXA 4U7SA 1AC6A 5A2IH 5FW7A 1AR1C 3KH4A 3KYOA 1JNJA 4JRWA 4JM2D 1LL1A 4S1SL 4JKPL 2PXYA 4GAGH 2DWDB 4FOMA 4ZBJA 2LR4A 2QBWA 4M5YL 2BRQA 1JXKA 4MJ2A 4P23A 4FQXC 3OBAA 4M3KB 4XAWH 4TSCH 2O9SA 2I5YH 3RWJB 1JZ8A 1ID5I 2LHAA 2OXGB 1KF9B 3OR6B 4RTTA 3DYPA 3K2KA 3OV6A 3TN0A 4BZ2H 1BOGA 3S34L 1WXUA 1TVDA 2YBRA 3BRFA 1EMTH 4UM8A 2ZCHL 5AZEH 1UE9A 3IKKA 5FB8A 4J3SA 2GT9A 1MMGA 4HA8A 2DLPA 2IAMC 1BJ1J 2FECL 5CINH 1AD9B 3NRFA 3VXRA 4AGQA 2R57A 1SRMA 3HMXA 3K7UA 4J12A 5GRYA 3C6EA 1RFDH 2JTDA 1DVTA 5ES4B 3RDTA 3K81A 1TTUA 1DHKA 2DL9A 4J83A 1LDPH 3EBIA 3QG7H 4ZPVA 2LU4A 4UM9A 1WAPA 5TJWK 1WAAA 5HVHC 3WKPA 3RB5A 2EAYA 1NE8A 3EHQA 1SOKA 2X1XR 1IRAY 1QHPA 2ICWI 2PWDA 4GSDH 4LLDA 1CSKA 1FFOA 3UEQA 1F11B 3GSOA 4FKEA 4KVCH 1L9PA 4Y1AD 2A3LA 4C55A 1VQOA 1A4BA 2B2XH 1QSFA 1OLLA 4L37B 4R7NB 2GGRA 1NEBA 5EOTB 5KN5A 5AW3B 3MV8E 1DEEA 3V6OA 4PCSA 1WZ1L 1HYOA 3LN4A 4BFRA 3RTQC 1CGSH 2MCNA 4WI7A 3S98A 3QIBD 4YC2B 3WO4B 1NMCC 5IJBC 1K3ZA 4BQ9A 3WXMB 3MRDB 5EEUA 2LQRA 5F1KC 1B2WH 2X0UA 2XJKA 4FZ8H 4WW2F 3WDHA 3GBML 2A73A 4Z88A 1ZV2A 4AVHA 4HVWA 2VDPH 1FL6A 1XD1A 5I71C 5FWQA 4PJ7F 3REVB 3GMLB 3QJ6A 1ABOA 4U4IA 1TT6A 3GO1L 3FZUD 1PZCA 1LEGB 1K73R 5GSVA 3JCMQ 1WEJL 3AQZA 5GAN3 3C6LD 3GF8A 2MI6A 4FXGC 3K6OA 3CCST 4DA4A 4GXUM 5FU6B 3QWYA 1YAZA 1JNNH 4L9LB 5BVPH 4ZSOB 2E12A 2F7OA 4HPHA 3OX8A 3P8DA 4X9FA 3LDBC 3SPVA 1GGUA 3BWAB 4J2XA 1BYNA 4KI5D 3NCBB 4M7ZC 4GFTB 1JQQA 2P26A 3KLKA 4NL2A 3P11H 4QXUL 4JG1H 3C9NA 3U1SL 5BJTA 1UG9A 2A9BA 1YMHB 4Y4HA 2LTOA 3IE4A 1MLCA 5AW2B 1MQ8A 3OMIB 4H88L 5DR5H 5ADOL 1WGVA 4GT0A 1OGSA 4K94L 5JW5A 5CGBA 4AKPA 4LHQB 5CP3H 5IMLB 2G5RA 4HFWB 2CAKA 4L4VB 3DX9B 2XG4B 5GQBA 5A2LH 5E2VL 2SRCA 4JG9A 1RMFL 1PG5B 3QFGA 3R19A 3RVWC 4PWHA 5FWBA 5I23A 2UUDH 1L9NA 4MCNA 4O00A 3FYIB 4MNQB 4F8QA 3KPOB 4NNYB 5BZWA 4JY6B 2Q8BH 5LWYH 3QWOA 2KE9A 4TVPH 5D2LB 2PUOB 1A4CA 5JIIA 3G5ZB 5T1LB 2P0PA 3LKSA 1PKQE 1XQ4A 3EZ8A 1G3SA 4APQB 1WHPA 4FM4B 1NFKA 3DOSA 1AD0A 3D08A 3MBEC 1UA7A 3D09A 4PJEA 3H54A 1P6AB 2HZYA 3SGJA 4OLZL 3PLYA 1XH3B 5D7KD 3IJEA 1PFCA 1TITA 4FZEL 1KJVA 4M6AA 1BZ8A 1V05A 2EZ0C 2OW7A 4XPGL 5FUOL 5KVFH 4AYDC 4LCCC 4RX4A 5T5FL 3TIDA 1CLVA 2VDQB 5GAMh 3V4PA 4LFHD 3PL6C 4IIQA 1LP9B 3MEVA 4J8RA 1HYSC 1IL1B 5D93B 4FP8L 1T20A 1BWMA 6FABH 3MYJA 4PV8A 1FAIH 5E0FA 2COVD 3CVHL 4GAJH 1YEEL 3BWUC 1N8ZA 3GZQA 4LSQH 5EC1B 3RQ3A 4L3EA 3TT3H 1O7DE 1K8AU 3RUGB 3T9WA 4Z7VA 1MNUH 2AC0A 4AEIH 2BSRA 4PFOA 2K4AA 4EI5D 2K6YA 3ZX1A 1EFXD 4Q9CA 1QLEB 4GW1A 1ODAA 5IMOB 4JJBA 1HINL 4GIOA 1OP5H 2EYYA 3MRKB 1ECZA 4PCKA 4FQIL 3QPQD 3C5JB 4UTBL 1BAWA 3VI4B 1R0AL 1I8IA 3WKYA 2FATL 2F2VA 3CBJB 3UZEC 4MB3A 3QHTC 5KTEH 2A4EA 1IQWH 2QQLH 4RDQF 5DDHA 1Z3RA 4NZRL 4R4ND 2X28A 4XCFL 3CCEQ 1HT6A 4M93B 1K85A 3H56A 1P0SE 3MRIA 4NO5A 2ZPKL 4APXA 1E8WA 1T1WB 5KSUB 4X6CA 4ZQKB 4XTUA 1MFCH 1AANA 3JCMP 1YEHL 1A2YA 2QZQA 1NBQA 2DIJA 3VFGH 1W6XA 5CQXA 4G9FB 3T2OA 1H3UA 5GAOl 2IANB 3OZ9L 3I02B 2NQ3A 3LN9A 5CJOL 1U1TA 3B5GA 2EDKA 1FI8C 2EDRA 3CCSA 1RAMA 1RJLA 1OPOA 3BPNB 2ZKHH 4P59H 4M1CC 4NRZA 4UNTA 2L3PA 2AK4D 3UL4A 4XX1E 1ODUA 5DJAA 2EDDA 4FABL 4U6YA 2YD1A 3W9EA 3MRPA 3CE1A 3PJSB 1PSKH 2OR8A 2DQHH 3HLAB 2VGMA 1N6QH 2W91A 3TCXA 2FUQA 2OI3A 2FEEL 4C59B 5LGKA 4N4HA 5K59F 2ICEC 5DUPL 4G6KL 3M1BA 3FQXA 1OAKH 1RAHB 5LHDA 3X20B 1ICTA 3QNYA 2DQDH 2DWEB 3IDMA 2A0FB 3OBWA 2BSDA 1KTDB 1TZHA 1ZMYA 5FLXE 4FNUA 2BNQB 3O3DB 1RUMH 5FYKL 3QNXB 4RFEA 5GGTA 5IBTH 3PHOA 5JIQA 4N0AA 2W60A 4IRJD 4NQQA 2QLYA 2EYTB 3G5YA 4H2AA 2VITB 3QFJA 5MERB 5JLZA 1L0YA 1T2QL 2VABB 4PGCB 2ZOUA 4UQ2B 1Q7YC 3LS5L 3UBXG 2VC8A 1K8IA 3MGTB 3T6QC 1M4KA 3W0WB 1KQSA 3K0WA 4B5ZA 4GP8B 4PRDA 1FN4B 3UTZB 2Z35A 2L2PA 3C60C 1BV8A 4D9RE 4GT7A 3B2XA 3FN0H 4PJ7B 4XP9H 4FAAB 1MJUH 3MLVH 3QXUA 3OGOE 4HJGA 4YXLH 3VXRE 3ZHLA 4BH8B 1EZVY 2OMXA 2C5DC 1L9OA 3FQNA 2XPGB 4P2RB 3A6BH 2QTEA 3TF7C 1TQCB 3BP6A 1A6UH 3J81E 3GRGA 3QULB 3S3JA 1UGNA 1SHXA 3ARVA 3ZDZF 2BVQB 3WLBB 4KH0B 3V8KA 5B1CA 3DHMA 3QSKB 2NY2C 5HJGA 3VSUA 2N01B 5EU4B 5FM5M 3PAZA 4ZGEB 4C0DB 1D2PA 3Q9PA 1MHCA 5CCAA 5FGCE 5FYLL 3LW5E 3V4VL 1VIWA 3L54A 1U2CA 1KC8U 1JF6A 2AJVL 2ED9A 4FERA 4MA8L 5D4JA 4LASH 1OO2A 1WAAE 3UDCA 1M2OA 2C9AA 4Z3JA 1A64A 1JTPA 3VSQA 5JHDB 2Z0WA 4AM0Q 3L2WA 4RMWA 5CEZH 4M78D 5IESH 2KDYA 4FHBD 4KX9A 4U49A 2W0FB 4NEHB 5HTSA 4CVZA 2DQEL 5ICXA 1AS6A 1BI0A 4PLLA 1U91A 2YWWA 2NYSA 1E28A 2J8UB 1SM3H 1MFVA 2CT3A 2UXGA 4HLJA 4N0CC 5AVVB 1QSFE 4KUIA 4HCIA 4YO0B 1E7OA 4HBQA 3V6OE 3FAXA 2VXQL 4YLQT 2CKBL 3L4UA 4XX5A 4C8QD 2TRHA 2NPLX 2WBXA 3OAWA 1MNNA 4M8VA 1M8VA 1TZIA 3BZ4B 5E4EC 1QI4A 1GAFL 2CJUH 4FYWB 4ME7A 4LCYA 4IJTA 1MFNA 4KHTH 2WQVA 1L9RA 3ETSA 3PNWA 1PIGA 4DBFA 3LKPB 3LRSB 3QA3A 4UV4H 4X0KA 5DMIL 1MIML 3LHPH 4ZX4A 3CPWA 3MREB 4GH7B 1EXGA 4CVWA 4Z95H 5LJ3e 1CE6A 1YCSA 4OTXL 5GRJL 2ARJA 4WRLA 5F7EH 1YEIH 5AW7B 2J12B 1Z3GH 3ULVD 3L48A 1Z1WA 1D5XA 2LW3A 3IDNB 1TNMA 4X7TA 2DQTL 3IEAA 5FDWB 4MMLA 4MQXC 1OTSD 4K3EH 4U1MB 1BZOA 4J1UA 4CN1A 5K5YA 1FIGH 1GBQA 4P2QA 5ESVB 5HSFA 4OUOA 1UH2A 3S3SA 3FFCA 1FVEA 1NMAH 1VRSA 2XTJD 3PWLB 1ANUA 4S1RL 5TF1L 1EUTA 5E6RB 5GZOA 5JOPE 1WIEA 1HE7A 1BFSA 2DEYX 4MD5B 4JKPH 4S1SH 2A6IA 4XI5C 1B3IA 4ZX5A 3VXPB 3VVWA 3GKZA 4J39A 5I9QB 4M5YH 1FGVL 4ETQB 4DNLA 1BREA 3CCVQ 2HL5C 1JXOA 4MMYB 1K4CA 1SKUB 1MFEL 2EICA 2GJ6A 4F58L 2OX7A 4KKCC 4CAGA 3HC2A 4W6XB 3U0PA 2VWEE 3BZFA 4TUJB 4YPJA 1EZSA 2ZOLA 3S34H 2O31A 2B0SL 3X14B 2AT1B 4CADA 2ZCHH 2CIKA 3MJ9A 4PRPB 1U3JA 4P3CL 3WEAA 1M90C 2PVOB 1J8HD 2R69A 2I85A 2VB6A 2R59A 4B9CA 5E9AA 4KUDK 5ITFA 2ADJA 2HD0A 5I19L 2XQBL 1W6LA 2DICA 4WZ9A 2X44D 4D0CB 3OHXC 5E8EA 5DJ0B 3B56A 4PTTB 2KLTA 4L8SB 1Q7YR 2R2BB 1M1KR 2KI7A 4PH8A 5LBGA 2HSIA 3CAFA 4N90E 2VUKA 4OJCA 3TVMC 4QQDA 1F0LA 2KGTA 3M55A 2AMUA 2FJFB 2ECZA 1ETA1 5GAN2 1SXAA 3LNFA 4JFFA 4PJAB 4PJEE 3WBDA 2XWRA 3MJXA 1GCFA 3STBA 4OQTA 3OW2A 1YNLL 5ICUA 4BFIA 5JMOC 1CGYA 4LF3A 4X5LA 2XZZA 2CA4A 3ZTNL 4KGZB 4DESA 2FO4A 3APMA 4P4KA 5J57B 3AUVA 3C5ZB 4PYHA 3EOAA 1OK0A 5DC4B 1JIBA 2X05A 2L7EA 5AENA 1WZ1H 3LY6A 2ZOTA 3MO1B 3BT2L 2B7DT 4WWKB 2GC4C 3QUXA 4DK6A 3NIDF 4Y5YA 2PYEA 3A8HB 4L3EE 4HWEH 4YDLB 2YSQA 4MZRA 4MHHG 4Z7VE 2UWEB 1UUNA 1BZ9A 1ZY9A 2O6FA 3FOLA 4GOSA 5HHXL 1KZYA 3GBMH 4IDLA 1KJWA 4FFVC 4HHAA 4QRRA 1CL7I 4YE0A 4YN3A 3S37X 1EDHA 1AR2A 3QORA 2H3KA 1A3QA 1TS9A 4BE1A 2Z64C 3GO1H 1ZE3H 4HXBL 2DQGL 1EV2E 3A4FA 7PCYA 3WJMA 3AUWB 1TO4A 2DYSB 5AW8B 2RK1A 1YI2T 4PGEA 3T3PE 3GINA 5IF0B 1WEJH 3SO5A 4WHYH 2BDNL 2VSDA 4DP0X 3I55T 5EU7E 4P4RB 3LKOB 3S8GB 4U2YA 2MH4A 2UZPA 1X7TA 1HDMB 3S8WA 2X9YA 1FH5L 2X4RA 2D3VA 4X6CE 3HUJB 2EIBA 3M88A 1PX8A 4IIZA 4J4PC 2B4CL 1HQ4A 4FTVA 4YPGB 1YN6A 4DFHA 3IBEA 5J89A 3UJIH 1BLIA 1OSZB 4V1DB 1ES0A 4QXUH 5BMFL 2BNRB 2BSSB 1NOFA 4HWZB 3U1SH 4O2EB 2EXWD 4P05A 4GRWB 2APVA 3OB8A 4QHUB 1XX9C 3W11D 1XO8A 4H88H 2P8MB 4FYYB 5EIVA 3ZDZB 1LEIB 2RQRA 5ADOH 4JJDA 5HDOA 4K94H 4CA4A 5KSBB 1F4AA 2CLRA 2CLVA 1RMFH 2LLLA 2DWYA 4GXVL 2J44A 5HYSA 4JY4B 3BD5A 2Q6WB 5C3IA 2CO1A 4UQ3B 3VFUA 1FZOA 1JXDA 5GGRB 3MHXA 1ASOA 1F41A 2UY7B 3V7SA 3CZJA 4HKJA 1G7QA 4I4WB 3KWXA 4N0FB 3TZVD 4YSDA 4QJ4B 4H26B 3QDGD 3OJDA 3SE9L 1HI6B 1ACYL 3S3BB 3SODB 2KQMA 3T0AA 5E1AA 4S0HA 2DM7A 1M27C 4XPBL 3QIWD 2AV7B 3FTVA 3GUTB 1N8RU 3E9UA 3ESVF 4WO4A 2YUWA 1UD8A 3QXVA 4OLZH 4UQAA 5C92A 5J06A 3IU3B 3FQTA 3GI9L 8PAZA 3TBWA 1A02N 5E5MA 4FZEH 4ZMNA 5J4MA 4MNGE 2YXYA 1R3KB 1ZA6B 1WFIA 4XPGH 5FUOH 1U8HA 4Y2NA 3JB9D 4IOSD 1YITQ 1C16A 4EKJA 5T5FH 4CVUA 4IBZA 1GGCL 1PM3A 2CO4A 5ENWB 3KBEA 3WEXA 1ITBB 2I27N 3EKCA 4KV5F 3ZMNA 4FP8H 2VDMH 3VRIB 1AYOA 1Q9LA 3CVHH 4ONOA 1YEEH 3CCJT 1XTMA 2CBTA 3T0XA 4OVVA 1ZIBA 2ROTA 3LEYL 2E27L 1FYTD 3HMWL 1ZLUK 4UIMA 2CNZA 4MQSB 5CVIA 2AAAA 3PIQB 4FJYA 4JANA 2R39A 2OSLA 3BN9C 5FCSH 1NCAL 3UAEA 1B6DA 4EZKA 4BKLB 2YRLA 4PJGE 1NAML 1QSEB 5DJYA 1KOAA 1HINH 4LSUL 3HE7D 2VXVL 3BW9B 4FQIH 1DSYA 4YL9A 3JWDL 3V5HA 1Q86C 3FHEA 2A99A 4IU3B 4UTBH 3T0EC 2NXYB 5LJ3d 4GY5A 1R0AH 2FATH 5B38B 4AG1C 4WEUD 1ZUYA 4NQSA 4NZRH 3NJMA 3BH9A 3Q3GB 4XCFH 4FCHA 5CIUA 1INDL 4OMNA 3JCMb 2KROA 2ZPKH 1CICD 4NC1C 4J6WA 5CIPA 5K1NA 2D0GA 2NY1D 3QDHA 4ZMQA 2E74C 1YEHH 3ZMRA 3ABGA 1BXXA 3D0LA 5GAN8 1S46A 2L7QA 2JUFA 1VQKA 1YI2A 2ZKYA 3LXCA 4KRNA 4NN5B 3OZ9H 4JFHE 2X51A 5CJOH 3I55A 2GKIA 5JORB 3BP7A 2MF2A 4M7KH 1J0HA 1EERB 1U93A 3FO1B 3LH2L 2IBZY 3MV7A 4C92B 2IADB 3H0TA 4PWKA 5D5MF 3RIRA 5ICYB 2FIRT 1E5CA 3SKMA 2DETA 3EOBA 4W9HC 2XNAB 5F9JA 2E7BA 4PIBA 5B1JC 2NW2A 1COBA 3S2CA 3B9KD 1XGQB 3IDIA 2FHFA 2HRGA 3EXLA 1WT5C 3RWCA 2OMZB 2Y7LA 3LRMA 3K4ZA 4I1NB 1OE3A 2VLJB 1W0WB 1PFOA 2NY7L 1BF2A 1H15B 1ULVA 2D7NA 4D0BB 2Q3XA 1YN8A 3TESA 5DUPH 3HZMB 3FZUC 5C9JB 4G6KH 3WY4A 4BQBA 5F88A 3MFGB 1JGDB 2E5KA 32C2A 3K71A 1LWRA 4S2SB 2TRYA 4N0UA 4A04A 1S2EA 5FWRA 4O5LL 5GGRY 2XZCL 3C6LC 2P8PA 2VE6A 3GP8A 3FFCE 3ARGA 4A2MA 3BHBA 5LLIC 5GJWB 2HJLB 1QLRB 2VN7A 3A24A 4AIZB 4BY6B 5FYKH 3UTTB 2G5BB 3GT6A 2CDTA 2HNIA 3HKZA 3L5WB 2AEOA 3PHQA 1IAMA 3F12B 2C1PB 4GQQA 4FQ2L 3RVXD 2JJWA 4GBXD 4HGKC 4LNRB 4KI5C 1T2QH 4NWUL 3BH4A 1XNIA 1QFOA 2D03L 3LS5H 2GJ6E 4H2CA 8FABB 1YHPA 3QDMD 3U30C 3FTZA 3P2TA 5F1NB 2HSEB 2EDTA 3OS2A 1O9WA 2WCPA 5FU7B 1DLFL 2BMKB 5I6KA 1BXVA 4ODXA 2ZWNA 2NNRA 2YLKA 3TBVA 4FXTA 5TDPB 4DPCX 2EDMA 3C08L 43CAB 1ZJBA 2BS71 1WJSA 1OCZB 2HT4D 3RPIA 3SE3C 4P2OA 2HVJA 1UDLA 1PZ2A 1AGDB 3GJFH 1S4IA 2XIBA 3HC3L 3Q7JA 3CCJA 5I22A 2WLJA 4MB4A 5FYLH 3GJEB 3V4VH 3X3FL 5E9DB 3KLDA 3ABKB 4MA8H 1U36A 2AJVH 5DUJA 4BKTC 2DXUA 4JFFE 1R33A 5F89A 4ISVA 2NRDA 4ELMB 2OI9C 5IB2A 1Q9WA 1Z7JA 4ZFOB 4DPAX 1SY6A 3WKQA 1X7SA 4WU7B 2DQEH 1AD9A 3EJZC 1EIFA 4BD4A 1UD4A 3FFDB 5CEXA 2QDYB 2EUZA 4WHYG 4AM0B 2UZXA 5CXPA 1PTZA 3CMGA 4JDSA 1SF3A 2ITCA 1QKWA 2NZ9D 2E64A 3ZZQA 5H37A 3U79A 4QTFA 3WNKA 1VQPQ 4E7IA 1S9XB 4U0RB 3X13A 2EO1A 2VXQH 2X2UA 4WI8A 4HJEA 5BV7H 2FVNA 2CKBH 5FOJA 5HI3C 2IVFC 2YC1A 4TXVB 4AMKL 2PTTA 2IGFL 2PYEE 4GAYA 1GAFH 1NBVL 1YY9D 3D4ZA 1G7LA 5EZJB 3TBYA 3ZBMA 1DVZA 5I75C 3U7YH 5DMIH 1QR4A 5D7JA 3F04A 4BGDA 5TDOB 3UZVA 1MIMH 5EEWA 4XMTA 1CMOA 5A40E 4OTXH 1HHIB 5GRJH 1VQ9T 4N85A 1OKEA 4QRRE 2VGLM 2JZ2A 5ISZB 1XB6A 1OE1A 1I7ZB 1NA8A 2V2XB 3PHSA 4R7NA 1JZ4A 1UHCA 4G6FD 2DQTH 2WSKA 3A67L 3ETTA 2QQQA 3QAZB 3ULUC 4OV5B 3MRHB 1VEPA 2CBQA 2J6FA 1NM9A 3G04B 5KSAA 3I6GB 4AV0A 2W80C 4F14A 3L9YA 4S1RH 5ANHA 5TF1H 4C58B 4O2FB 4X4YB 3UYPA 4PJFE 4R7DB 3BX7C 4FTVE 4GXUN 1BB9A 3O3UN 3X11B 2VQ1A 2HB0A 1FGVH 2GG1A 4Y2LA 4ESRA 4NSKA 4PNOA 2Q7AA 2Q10A 3JWOC 1PMYA 3BYYA 3FB8B 4PJDF 1MFEH 2J1WA 3RWEB 4F58H 4L18A 3HFMH 4XAKE 4LCWB 4QGTA 4HEPG 1Z9LA 2R1XA <