3OSVA

The crytsal structure of flgd from p. aeruginosa
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
134
structure length
131
Chain Sequence
b'SSLVGRKVIVATDKSVVDTKDTFKASLNLPVSSSNVWVNVYDDKGTVVNRINLGQQAAGSVSFMWDGKDSSGNIMPPGTYKFEAQTSIDGKTYGLQTYLPANVDSVTLGQELMLNLAGLGSIALSKVQIIG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Flagellar basal-body rod modification protein FlgD
publication title Crystal structure of a novel dimer form of FlgD from P. aeruginosa PAO1
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Structural protein
total genus 21
structure length 131
sequence length 134
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13860 FlgD_ig FlgD Ig-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.910 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3osvA01
2.60.40.4070 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3osvA02
3OSVA 4ZZFA 5K5YA 4ZZKA 3C12A
chains in the Genus database with same CATH superfamily
4PAZA 2Y5TA 1ZT4B 1YEKL 4OM0L 4OIFA 5F70A 3SDAD 1Q1JH 3HUJB 4XWOD 5F9OL 1RZIA 1PKSA 1Q95G 2OMWA 4FCAA 2HNIA 3N91A 3NTHA 3SQBB 3ERXA 3V6OA 2E9JA 2UWEB 5GZND 4F7CB 4L4TB 5JHMA 4RTYA 1Q4NX 2BCMA 3ECBA 3L4XA 3P4NA 2OP4L 2VLJD 2UX7A 2V6HA 4JW3A 5GRWA 3RWHB 1EGJA 3K6SB 4I3RL 4M75G 3U0TB 1UUNA 2FIKB 2OZ4H 4LCVA 5DQ9A 4M75B 4TTDC 3BISA 4WHDA 4OZIF 3QIWD 1M8MA 4MB5A 4HC1H 2ZWSA 2J88H 1IC4H 1HSBA 1G6RL 3ZE0B 4C56D 3DVNA 1IGIH 4MCNA 5LVEA 4JJHA 4NQDE 4JRWA 4AQZA 4M29A 2BZ8A 2NX5E 2X38A 3KPNB 2CP0A 2F9BT 2YFNA 4FP8L 3MNWB 4V2CB 2PPFA 5INDA 1EWHA 5DJ8B 3Q8AA 1L6XA 3LKOA 3GHPA 4HA8A 2OZ4L 3KPRB 4X6EA 3NT0A 2IXQB 2M1HA 3CUPB 4FULA 2XG4B 3CCVQ 4O2CB 2OTLA 2J88L 4OGEA 3QXUA 4S1QH 5FUCC 1E4KA 4X6DA 1WRFA 3SJVB 5HYJD 1AKPA 2X35A 1DJSA 3FF8A 2CGHA 3BP4A 1OI1A 1UT1A 4FFWC 3V4VB 3RX9A 2IQ9H 3DUUA 1QWHA 3GMQA 3TZVD 3N85H 2HB0A 1NMBH 4Z7UA 4P05A 3L7EB 3WN5B 4PGCA 1T89C 3OKEA 4MA1C 1JGIA 3ZTDC 3O3BA 2E76C 4MVBC 2ZCHH 2QZ5A 2XIIA 1T5XA 5KYNA 1NQBA 1YJDL 2VUOA 1DSYA 3Q0HA 4RBPH 4JM2B 1FNHA 3SZ6A 3HC0A 4FLOA 2P5EE 1NC2D 2C9UA 4AQEA 1DN0A 2IQ9L 3P30H 3ALWA 4ZMYA 4DZBB 5C1MB 1N6AA 3N85L 2HKAA 1NMBL 1KCRL 1ZOXA 4NRYB 4HFWA 4X5XB 3GSWA 3UG3A 3CE1A 1IMHC 1ET8A 3TONA 2GIXA 3V7SA 1A1MB 4KI5D 3N41B 3I02A 5JLZB 3HG1A 4MSWB 4DEXA 1M7DB 2CP3A 2ZCHL 1DANT 2V7HB 5LJ3g 1ZLWH 1E5AA 1HEZA 3DA0A 4N0FB 3IN0A 2VXUL 3IS0X 4WI5A 4HIJB 3FUFA 2VLRD 4RZCA 3QT2A 4CGUB 2K7QA 4CKVX 1MFVA 4K5LA 1QVFS 5CP7A 1B0GA 4GG8B 3OB9A 3FMGH 3KYAA 3KXFB 1E0OB 3CC4Q 2DQCH 3MUJA 1RUKL 3SBWC 2DRMA 1ZA6B 1CI3M 2G5UA 3PGCA 4M48H 5B7MA 1CBVH 4ODTH 4FW1A 4JFHD 4EBQH 1JBMA 4OCWL 2CR6A 4I2XE 3BSGA 3WNNA 4E7SA 2YMOA 1LO4L 3ESUF 2Z64C 1MAMH 1QBAA 3C8KB 3QPQD 4GI8A 5KBKA 3BIKA 3BMVA 1PHTA 1N12A 4IGBA 3KYMB 2F58H 5C0CD 4W9GC 2WTOA 3B56A 3FMGL 3IBOA 4OZHB 2DQCL 3DX0A 5C6PB 1WHOA 3GFUA 2H6OA 2P42B 3FQTB 3KR3H 4M48L 1CBVL 4JFFA 4ODTL 3QFJD 1AZVA 1NE8A 3JV4B 4MGXA 1WQ7A 1S72Q 3BZEB 3EHQA 1XGTA 4S10A 2AXFB 2YFOA 3VWKB 5HHMD 2YLHA 3PXHA 3T71A 2SEMA 3RURA 2E1HA 1TKWB 3H9SA 1C9SA 1S3KH 3JYCA 4WJKB 1M7UA 5CU9A 2KRNA 1QYGL 3TBVB 1W6XA 2H8PB 2HUEA 3V2AR 4F80A 4LLQA 2Z8VC 4H8QA 1SRDA 3KVPA 3LZOA 1SUJA 4OGXH 1IU1A 4KC3B 1TTAA 5L8JB 2AZSA 3ASNB 2VDOH 5J39A 3MV7A 1JTPA 3V4UH 3D51A 4EDWH 1Q9LA 2PUQT 4JRYA 3IDMA 3IDNA 3FOMA 4BFGA 2QG9B 1S3KL 3M86A 4I18C 3T2OA 1MCFA 3JV5A 1J86A 4I3SH 4BHUI 1DBBL 5KS9A 3EO1B 2G9HA 4J9GA 3JB9I 2N0MA 2JE8A 3ZFJA 2WXIA 4XAWL 1G7MB 2D8KA 3UZEA 1PNDA 5I8CA 2HT3D 3ABKB 4KH2A 5HY9A 4XC1L 5EEXA 3OR7A 3D39A 3RVWD 3S2AA 1MI5B 4HJJH 4OFVA 1HSAB 4OIAA 4S0HA 3VFPB 1ULVA 4I8DA 4LLWA 2MQ3A 2D4FA 3GWJA 5TDOB 2XDPA 3TYFB 3V4UL 4EDWL 4L1TA 5BZXA 4XO5A 3DDFA 4UQIM 1UH3A 3L42A 2QVKA 1OP3K 1JSYA 1AWJA 1NGPH 1HAUA 2CMRH 2L7JA 4I3SL 3V4PH 4D0BA 4FYTA 3D0VA 5C0BA 4DEWA 3ETBJ 3QQ4B 3VS4A 1AO7A 2F7RA 2ADGB 5AOLA 3KWTA 3P3UA 2PW2B 5AVQB 1WEJL 4Z95L 2XV2A 4B6MA 3BPNB 1KYUA 3EH5B 1L3NA 3WIHH 4U1MA 5KVFH 1LO0H 4PY7B 4KRPD 3TJHC 4FQJH 3UJTH 2FBJH 4YO0B 9PCYA 2JJTA 1W16A 1NGPL 3V4PL 1LP9B 3R19A 3F7PC 4XGZB 2XVLA 4K7FA 3TNMA 3T8XB 1QVOA 2LDMA 2VZOA 2M26A 4ZO8A 2DH2A 2AEOA 4YHYB 2NY3C 3KYNA 1L0QA 3VJ6B 3VXSD 3FYIB 3OSKA 3MP6A 3FB5B 2PTUA 4JZ3A 3V6OC 2CYZB 3ROOA 2GQHA 3WIHL 4AZ8B 3QBTB 3CCRQ 4R4BB 2EDYA 1WCBA 2AQSA 3VRJB 2KMTA 2Z91B 1LO0L 4CNIB 3NIDB 1L0PA 4FQJL 4PRIB 5FO8B 5KVFL 1C6VX 4DGVH 3UJTL 1NICA 3DGGB 5L4MA 3FOLA 3FQRB 2DQMA 2Y22A 1MJ7L 1I8KB 5ACZA 4H0LC 5E2TH 2PXYD 4QCIA 5MENB 4P46D 4HJGA 3CCMT 2BNQB 5D7IA 3UZQB 1RLPC 1FL5B 2VQ1A 4Z89A 2W07B 3CVCA 5M95B 3Q5OA 4JFOA 3OL2A 5FIEA 2ZIDA 5GAMg 2BFVH 5EU4B 3IU3A 3EYQD 3FSWA 1ZWIA 2YZ1A 2RI5A 4BDVA 5CD5D 4PFOA 1CTMA 1K8AR 4NQCD 3G08A 3CZFB 4XB8A 4DGVL 1O7SA 5ECGA 4A6YH 3HMXL 3GXMA 2KT1A 5CJBA 4WEEA 4EIGB 3MXWH 5E2TL 2J57A 1WD8A 1H5BB 2OMXB 4JLRA 2J8OA 4PWFA 3X25B 1UACH 3A0OA 2YC1A 3LV3B 3S4SG 2X88A 3AROA 3ZYIA 5CJ5A 4OFDA 3S4SB 3MA7A 1BI1A 7TAAA 1E4KC 4AJ0A 1KGCE 1E7OA 3HBGA 5AW6B 1DVFA 2BFVL 1CYWA 1KTJA 1W4SA 4UDUA 1M90R 4V33A 5DJZA 3GHEH 3QI9A 3FU8A 5EU6A 4F3FB 2HFEA 4XBPA 4A6YL 4OMLA 2ZXGA 3JWNG 4E41E 1CVSC 3O9WB 5BUPA 4L5GA 5AVTB 2X1QA 1XZWA 4DTGL 1UACL 2YPKB 2ZT9C 5KVDE 4NAJA 1QCFA 1ACYH 4HKZA 1MHPH 1DQVA 2NDFA 3EAKA 3X3GL 1ZA3A 1JVLA 3J7HA 1TLKA 2R2EA 5I1GH 3VRZA 4J8QA 2FRWA 2HJKB 1JF6A 3T0AA 4NQTA 3DARA 3FT4B 5K9JH 2XCMC 3PWPA 3U2SA 2R29A 3TWCL 2PP8A 3LXAA 1OZ2A 3CCET 3DJRA 3TVMD 4FCHA 5FA4B 4BJLA 2DVEA 3B2XA 4AIEA 1VPOH 1ACYL 1XL4A 2FQEA 4C92A 1MHPL 3N55A 2WYZA 1S7QA 4RMUA 5I1GL 3RKYA 1CFNA 1EAPA 2B5IC 4KFZC 3CH1A 1HDMB 4HIPA 4X2UA 4HZLA 2FPFA 2R57A 2CSIA 4J9HA 2FZGB 4E0RA 2RJCA 1KG1A 3V4PB 3OTTA 4JGMA 1BZEA 3OKNA 2LR4A 3UIZA 2DEQA 1CUOA 4PJ7A 1VPOL 3G5YB 4H8UA 4APQA 1BFSA 4Y8AA 2FVUA 1T3FA 3ZQWA 3WAJA 3IWUA 1O6SA 1EANA 2GFBA 2V4LA 4KJQC 4ZMQA 4AM0Q 3LNEA 2X10A 5ALCH 1UB4A 1T04B 3EH1A 1PD1A 2Y1YA 5GQBA 3EFOA 3NAAH 2XV6B 1U3ZA 4N1CA 5DRXA 2HJLB 3O6FB 1VQPQ 1B9ZA 4N1HB 4S0SD 3ARYA 3QDMD 4FXGA 4NFBA 5CBEB 1HHIA 3HC4H 1GOFA 5LJ5g 2OAAA 4Y5XA 1KCBA 5D96B 4DQOH 1WBZA 1PFOA 2XLLA 4NP9A 1MDTA 3MJ6A 4WK0B 2BZYA 1HH6A 2BNRE 5ALCL 1A1NB 2O1AA 3V8OA 1F56A 3Q1SH 2YLKA 4WGKA 4UIMA 3HAEA 2AVGA 1DJWA 1KPUA 1IM9D 2FX7H 4A68A 5BOZG 9ATCB 2P45B 3QXTA 2CDEA 3KVDD 5EUOA 4M4ZA 3E80A 1F3JB 1MFNA 3HC4L 2L3BA 4PL6A 4NP4H 5KVGH 1QO3A 4IKKA 3RMQA 1KPVA 1RPUA 1SKUB 1I3GH 4L1HA 4O2FA 1ZPUA 3TO4D 3UGXA 2BJMH 1I1CA 1LWJA 4UINH 4XU0A 4OZFA 1IL1B 3UZEC 2NXYD 3DX7B 2CUBA 2QDLA 2IPOB 3NQKA 2MH4A 4PCTA 1SVBA 3LPGA 1VQ7Q 2FT7A 4AYEC 1Q0XH 4RNRA 2ZUXA 5C0GB 5CFAA 5DJXB 1CGSH 1ACZA 1PZBA 4X1VA 5KVGL 4JO1H 1CSKA 5DJAA 5BS0A 4ETQA 1I3GL 3R8QA 3RDJA 2WSPA 4XBGA 5IOPB 5IROA 5J13B 4NL3A 2YA0A 2BJML 1J1OH 2NY5H 3MRMA 3P77A 1K9AA 4UINL 4CN4A 2YMTA 4FG4A 1EEYA 2FSDA 4OMMA 5FCSH 4LMQI 2B4CL 3C6SB 3CC1A 2J73A 1I1AB 4ACPA 3UWNA 1Q0XL 2CKBA 2OXGB 4O02B 4U1IA 2XFXB 4HMDA 4ZTOH 1CD1B 3ZZQA 5KJRH 1LK2B 3BH8A 4JO5A 2V9QA 1CGSL 3F7VA 3VSVA 3BQVA 4JO1L 2OL3A 3G5VB 3GSRA 5ITBL 2ICCA 4BSWB 5AVXB 2AMGA 4QEGA 1KGIA 4UQDA 1J1OL 2NY5L 4G71B 4LDOB 4QRRA 2WV3A 3B3IA 3MPCA 2XTLA 2E27H 3E8UH 1U8JB 4DHLA 1G9MC 2K4WA 3EOAB 3UTTD 4P4KC 4HOXA 4U1SB 2BSDA 3EJSA 4ZTOL 1WISA 3CFIC 5KJRL 3MBEA 1A6TA 5FDYA 5C0IB 4ZFOB 3DVFA 4MAUH 4AGNA 1D5IH 1DLHA 3KCPB 1M3JA 4EI5C 1VFUA 3EZ8A 5F3BB 3I84A 3ZE2B 3MEVA 1ZY9A 4ZS6C 3CCLA 2ZZDA 3N2JA 4UNTA 4DVRH 4CMMB 4WWPA 3NTIA 4PJ8B 3KFVA 4MQ7A 1ZVYA 4U6HB 3WJJA 2V8IA 3KJ4C 1G7LA 3FYEB 3HW7A 4CN1A 2H6PB 3GT6A 2X3BA 1XGQB 3LQAC 4HIQA 4ZO9A 2QQAA 5DGQA 2VXTL 5E2WH 2VE6A 3PNWB 2WKOF 2WWNA 3D8MA 1FCCA 4MAUL 2IDCA 1AVAA 4FSXA 1D5IL 1OHQA 1TQTA 3JTSA 4MD5B 2LV4A 1YYLH 4FABH 1RZFH 5DWUH 2E9IA 5CR8A 5FK9B 1WAAA 4G9FB 1QAWA 4YX2H 3ETBF 3D4CA 1Z9LA 2CBTA 1RVFL 3MUGA 2M0OA 1F90L 2A9DA 2X4PB 1U06A 1JK8B 4QO1A 4U3XA 2ZSVA 5D2NB 2HP4A 4EIKA 4CC1A 4DAGH 2F8IA 6PCYA 5E9AA 3EJQA 3VO0A 1YN6B 3MLTA 2EIJB 1BAGA 2GTWA 4F7MA 2HX9A 3QI9C 3UBGA 1X5KA 3A8MB 4TTDD 3E1F1 4FABL 3UBXA 3IGUA 2F74A 4YX2L 4DIXA 3ARGB 4FT2A 4YDKL 5HK3A 2OMUA 2A7BA 3O4OC 1BU1A 2X3AA 2R58A 1ARKA 2XPGB 5KVMC 1G3TA 1J0IA 4P2QA 4LKXA 4LOVA 2HVKB 4Y7MA 1SNRA 4XE0A 2W1NA 2G2NA 1IJNA 1VQMA 2ZONA 3G6AB 4IQHA 4W1TA 5CXPA 5LL6S 1XBDA 2XU9A 2ZGWA 2VXQA 4HPYH 5C07D 5IB5A 4FYVB 3QJZA 4KK6C 3QUYC 4KO5A 4JNXA 4QKUA 1LDSA 2VMEA 3CVHB 4HLJA 1MEXH 3ARFB 5IMLA 1SMAA 3WE1A 4I88A 4FFWD 4NN6B 4H26B 4XO8A 1OSPH 5E5RB 4UM9B 3JT0A 2EZ0C 1S5IL 2Q7YB 5KCHA 3TU4K 5DRZB 1MNEA 4KRNA 1KGWA 4TSAH 4N2KA 1O0VA 3T0EC 4J7RA 1HEJC 1OU9A 1AIFB 1A7RL 4C5EA 1KHIA 2NY4D 1K76A 1IGFH 1MEXL 2WWMD 2ZSWB 1QKZH 4PIRF 4APQC 2Z3FA 1W6WA 2DL7A 1XX9C 3M4GA 3QSUA 1KN2H 2AF2A 2OI9B 5IBTL 3GXPA 2DMGA 3MHZA 3L1OH 2NOYA 3EG9A 4JJ5B 4TSAL 5CEZH 1NMCB 3RVUC 1X5YA 5F7HA 4PP2B 4J3SA 2G3XA 5IB1A 4OB5H 4FQXA 2H32H 4PNOA 3BP5A 3EYOA 1MW0A 3QORC 1K5NA 2J1YA 1MXDA 5J1SC 1QKZL 4FXGC 1OGAA 1CO1A 2HMAA 2DF6A 1OF2B 2VM3A 5L6YH 1LEGA 1KFGA 5GS2D 3VMNA 5FYJH 3ZKXC 4Y5XC 2HRLA 2VL5B 3DGCR 2X1OA 1Q86C 4WO4B 3N1PC 2XG8D 5EEWA 4OCYH 1ZHBA 4GQ9L 1YHQQ 2FGWH 1KB3A 3GF5A 2FJHA 3OYMA 3KPQA 4CW1B 1OCOB 2W0ZA 5FA3A 1J5HA 5DVMA 3WIAA 4X4XA 1R1CA 2DZ9A 3MV9E 1YJWQ 3QW9A 3VFWB 3FQNB 3QDGD 1FHGA 2OMZA 5EIIB 2X41A 3V8JA 3LQMA 2HJFB 2GTJA 1J7VR 5E2JA 4AK1A 3ZPDA 2X6MA 4EMKB 1I9IH 2BVOB 1CBJA 3PL6C 4N5EC 5SX5H 2F54B 4QDGA 4YHNB 1OAJA 1E8XA 4QXGH 3RNJA 2JKTM 2EIEA 1KLFB 3HKZA 1DUYB 2DOCA 4N0AA 1YEEH 1ZIBA 2AJXH 2DYSB 2LC4A 3CMOH 1I8FA 1CL7I 5JDJA 3WNJA 5SWSE 1EJ8A 2OX5B 5IW1B 4XWGH 1M3IA 3AW5A 4ZPTB 3WFHA 3LNHA 1KMGA 1QA9B 1OPKA 2L0AA 3G7ZA 2P84A 3LWHA 1I9IL 1IAMA 3F70A 1UD2A 4GLMA 4HS3A 5IROC 4GXUM 3AGWA 5T1LA 4I77H 3D85D 3RUXA 2NW2B 5HI3C 1UGQB 2ECZA 3CHSA 4QXGL 4ZS7H 1KEGH 4KXCA 5F7DB 1UYWH 3M17A 1TIUA 1YEEL 4FI7A 2AJXL 1FQ9C 1UWYA 4H25A 5INCA 2AGJL 1YJ9Q 3MUZ1 4XWGL 5F0PB 2COYA 4OCSH 5AW2B 3VQ1C 4CC0A 5JORA 2G4GA 2MKWA 1YEJH 1JZ7A 2PCXA 3A8HB 1HINH 2CQVA 2GFUA 5IBUB 2IWEA 3KPMA 2IC2A 3W9EA 1KEGL 4LP5A 4ZS7L 3E2UA 3IKKA 3HEIB 1M1GA 2QSTA 3S3SA 3IJSA 4AYFA 1GH7A 3BRDA 1UXWA 4NKMB 5DJYB 3RGVB 3MBEC 3I5SA 3MA9H 5DY9A 4MAYC 3OKDB 4XT1C 2ENQA 3Q5YA 4MMZC 4PRPB 2BIVA 1IGTB 4EN3A 1FNFA 1GXIE 2W9DH 4LNRB 1HINL 2H9GB 3HUJE 1GL5A 1CFSB 1JJUA 1U8NB 1Z9PA 2DTSA 3UP1A 2H3KA 4NDMB 2DL9A 4LAQH 3WJJC 2UWEE 3ZT6A 3RTQA 2E6ZA 4ZMZA 3L7FB 4NQDD 1S9KC 1BBZA 4CBZA 5A2JH 4OIIH 2NX5D 3GBMH 4KROC 3TJHD 4JPIA 3RL2B 3ARBC 4OJYA 4I4WB 3MA9L 2ITCA 3EYVA 2X4YA 3HUJF 3PUCA 3X17A 3IDGB 4M4RB 1CT8B 2EQDA 4M75E 5BZDA 3TEUA 2R7EB 3MMEA 2UWEF 2YD7A 5EN2A 4HV8B 2W9DL 3UZVB 1D7BA 3ZE0E 1SJHA 2MF2A 4A7UA 2GITB 2NY3D 1FI8C 5I1LA 2NZ1A 4MKTA 3NZSA 3FTWA 3UCRA 4X7TA 5PAZA 1OM3H 3CEYA 2OSLB 4R4ND 3V0WH 3NA4A 4OIIL 1JGLL 3CCUA 1QACA 4RG2A 3EG3A 1CF8H 3GBML 5EBMB 4M75F 5LCVH 1LEIB 4ICWA 4B3VA 5I0VA 1R3JB 4MQSB 5GSVB 1E40A 5DZLA 3ZE0F 3KPRE 1JV2A 2HFFB 3MX0B 3RX7A 5AW7B 3WE6A 4TN9A 3BVWA 4JDTH 3QJYA 5E4OA 5EBGA 3S6CA 3PJSA 1KB5H 4ADJA 2ED1A 1CLCA 3F12B 3BJLA 5DS8B 3SJVE 3PAUA 3JCMX 5H4ZA 5I1KH 1OM3L 4R6UA 3OA6A 3V0WL 3VRLE 1HT6A 1CFTA 3E7JA 1CF8L 2CCWA 1E43A 2WCSA 5E5LA 5LCVL 1DP0A 1NC4B 2CDFB 5BMFL 5BVPH 5EZOH 2RIKA 2VDKB 3GMNB 3QEHB 5JMOC 1NCNA 4HSAC 5I6KA 4BZ2A 2FO4A 2R0WL 1KG0B 2JXBA 3FTYA 1T2QH 1HIMH 1KB5L 3VRLF 5DLQE 3UPUA 2BSRA 3VA2C 1RJYB 3Q44A 3R4DA 1BG1A 4EMGA 2VR9A 4BELD 4Q74A 4PJCB 1GSMA 4F91B 5D5MB 2KNBB 3C5XA 1KIUA 1W8OA 2FJGA 1BI2A 1SJEB 3IJEA 1ET5A 1QNZL 4TUJB 4WENB 5BVPL 3F7QA 5EZOL 5CS7A 2DD4A 2Y1VA 3P4OB 1WT5A 4ZUSB 3GBNH 4JM2F 1IKFL 1QW9A 1OZTG 3AG2B 3IETB 1C8QA 1HIML 4HT1H 3UPRB 5I0YA 5IH2A 3CZNA 4Z76A 3ESNA 2E4HA 1YUKB 4OCRH 4AT6B 5ESQA 3N41F 3LKSA 5GAN6 1QVGP 4AYMC 3KXFE 4KGVB 4DO6A 1M71A 1RACB 3O3DA 3SKNB 1NCOA 4MCZA 1AGFB 1D9KA 3OMNB 25C8H 4CC3A 3JV3A 3RP1A 4FQXC 5J11B 3QYCA 2QA4T 1L0YA 1W0VB 2OM5A 5AUMA 5A16A 4OCRL 4X8XA 3QQ9C 2MCMA 3TWYA 3VQLA 4EE2A 3DX4A 4OD2B 3KWXA 1MHHA 1GFDA 2WBJB 2VV5A 1J8HA 5BRQA 4EXPX 1MAKA 1YI2T 4OZHE 1ZT7A 3C9NA 4KTYA 5ICZA 2JM9A 1TU2A 4IOIB 2RA2A 3A6OA 1H8SA 5DJDB 1HHKB 2DI7A 2ITEA 5IQOA 3DVIA 3LEXA 1D5ZB 1T21B 4G7SB 4E9RA 1F18A 2GTZB 1VQLT 3NFCA 4IRJA 2NZ9C 4OZHF 2FHBA 2I69A 4WTZA 2X0VA 5KVEE 5HPMA 2OMVB 2DRUA 5EO9A 4YFLF 1Q86U 4AUJA 1UE9A 3C6LA 4QUOA 2DM2A 4YHOH 3V5KA 3B9DA 4CRIA 3MRLA 3MV8B 4FI6A 1IKOP 2XWJB 3MNDA 1CPUA 5JOFB 1DQTA 5DZVA 1NWPA 3OYYA 2VT0A 4H8WH 2RJDA 5GIRA 5KZCB 4XNMB 2QSVA 2NNXA 4OW6A 2IJ0C 4L05A 3VI3A 1QRNB 4FXKA 4YE4H 1S9VB 1TVHA 4FQ2H 5EU3A 1GZHC 4GP4B 3KNBA 3LRSA 2BOLA 1IGJA 2EDJA 4YHOL 1P0SE 3S6WA 2JIXA 4DCQA 2IPKB 4HGMA 2DNUA 1ZKAA 3C5JB 4OSUH 1YCSB 3EOBB 2E41A 2ISDA 4L4VD 4TRPH 3DV4B 1MI5E 1Z9ZA 3EG1A 4QI3A 4H8WL 1SLWA 2HXAA 5ANMB 2CUHA 5ABAA 3W82A 2PUOB 1P7QA 3FB6A 3GXFA 1P1ZB 4P4RA 1IQDA 3EXLA 5F6IB 4YE4L 1R0BG 3QARA 4FQ2L 5K9OA 15C8H 2BHYA 3ILEA 5C0AD 3PP3K 4A4GA 5GS0C 2ERJB 1NOAA 3TF4A 4BE2A 4YSOA 3FCGA 2ZJSH 4KOBA 2PWEA 4LN2A 4G72B 4EVNB 4OSUL 3Q6GH 4WHCA 5LJ5e 2EIZA 4NBZB 4R84A 4UTAL 1L6PA 1KIPB 4N8UA 2K7PA 2WIMA 2EDMA 2UXTA 2WD0A 2Z65C 5F96H 2HEQA 4LGSB 3QISA 3KLKA 15C8L 5C0RH 4K9EL 2P5PA 1E9QB 4XP6H 3HRUA 3I2CH 3O3EA 5DZAA 1J87A 1LP9E 3K5SA 3DIFA 2CO7A 1Z66A 3PUUA 4YXLL 5CD3B 3DXAB 3HRZA 5IHNA 4G7RB 5I1CH 4PJEB 1NPNA 5BZZA 1IAKA 3PGGA 3M1OA 3RVVD 3GMLA 5BRPA 4XR8C 4Q7DA 4WKZA 2DL4A 1IQWL 1CLYL 1FFNB 3NA9H 4DBFA 1D1BA 3RTQC 4HK3N 4UM8B 3F7YB 3GZKA 3FL7A 5F96L 4RDQG 1LP9F 1I4FA 3NIDE 4PRIE 1JZIA 2EDOA 1NCGA 3IF1B 3NEOA 4G11A 4R97B 4BSVA 3IPBA 5C0RL 1T22B 2RK1A 4XP6L 3GRBA 3I2CL 3WN5C 1BZ7A 2E3IA 1M4KA 2QVTA 3HS8A 2HTLC 5MENE 2QQLH 5D1XA 2P46B 3L9BA 4P4KD 3DUHA 2EICA 1GZQB 3NIDF 1LQBC 3WEBA 2VDRH 1KGCD 1OB1B 1C5DA 4JM2C 1X5MA 3FZUD 1RZGA 3LKNA 3IJHA 4EI5D 3JCMd 1K73R 2DM7A 5DM7R 1KTDA 1NFDA 1PF3A 1M3BA 4ZS6D 4HUWB 3DLMA 4E41D 3BAWA 4M7AA 1VFOA 5FLXE 1A6AB 1GC1L 2YHTA 5K9KB 4MNHA 1YJNQ 4Y8DC 1WFWA 2O2OA 1AACA 4R9HA 1MCRA 4RH4A 3EO9H 3PAVA 4ZYKA 3D18A 3CFKA 4JKPH 2YEZA 1UD5A 4HKBB 1WHLA 1NIEA 2JQAA 3QUZB 5EZJB 5GRUL 3U7WH 2Y25A 4CRPA 2GJ6B 3VH8G 3EGDA 1RAEB 1GYWA 3CFEA 2WXJA 3VH8B 4KGJA 1H641 3GBLA 5ID1B 4W6XB 5CP3A 1INDL 3QCUH 1MMDA 2CUDA 1XR8B 5KAQG 1YDPA 1HSQA 1ZSHA 1BVKB 2BW4A 3C4SA 5E2UH 5EF0A 3SD2A 3EO9L 3RI5K 3V5DA 4MDIA 4LEEA 3X12B 3ARDA 3P02A 3PFQA 4Y4HA 3U7WL 2EUVA 1X7SA 4P5TB 1AGCB 1BZ9B 2HD0A 3BSZH 4PJAA 3QI9D 1MVUB 3BKJH 3NSYA 5CINL 1QMUA 4HAFA 3ECUA 3PWNA 1U6AH 4L1BA 4YSPA 3G1JA 2BE7D 4QY8A 5BZWA 3LB6C 2VR6A 1MFBH 2ZOLB 2AJ3A 3DLLA 2BS71 3QCUL 1WT5C 1CZ8H 1XH3A 1U8MB 4OLWH 4YHKH 1XOVA 3TIDB 4RFEA 5LJ3j 2LCSA 3IDXH 3DO7A 5E2UL 3FT3A 2G2RB 1ZXQA 1TETH 3SKMB 3P2BA 2X7LA 4E5XG 3F3HA 2XNAA 2C7UA 1TNMA 2PCPA 3MODH 4I89A 4P5SA 3U48A 4FG2A 4E5XB 1XVSA 4DP9X 4OF8A 1AQ8A 3OAZK 2YLCA 3BKJL 4MRBA 4WEBH 3SGJC 1NL0H 2A08A 1U6AL 3TPUB 3VXOA 4KK6D 3QUYD 3QUIA 1WDXA 2Z93A 3DSFL 2X4NA 1DUZA 1XF3A 2BSED 3LEVL 4JN2B 5DD1H 4AXWB 1P5UA 3M6DA 2OTLQ 4QVZA 4YHKL 3KYKH 5E99H 4BK4A 1ADQL 2I9LB 4DEPC 4PS7A 1SFHA 2J21A 2V5RA 2MSPA 2OCCB 5L4FA 1UHCA 1TETL 2EIBA 3AWGA 3M55A 2EZ0D 1M8VA 4X6FB 5IG7A 3MODL 1R47A 5FGBA 3ASWA 3T08A 1PIGA 1HL8A 4Z7WE 4BK5C 2CSQA 3O3AA 2XYCA 1LE9B 5CKGA 4HF5H 2GSGB 4WEBL 5EBLB 3ML9A 4IBYA 3T0ED 3ESOA 1LGVA 3HRPA 2XQ0A 1Z5YD 3OLIA 2X4UB 5DZNA 5DD1L 5ADPL 3EYFB 1N10A 1E5CA 4MZRA 2NLJA 5E99L 4G6FD 4LHUB 3G4ST 2Y06H 3FB8B 1AR2A 4OFQA 1VKXB 4D8KA 1R3KB 3PDOB 1P1VA 4X8JA 3REVB 4EKJA 5FECB 1UWGH 4Y5YB 4G8GD 2OYMA 1ODAA 1YEFH 4IRJC 1EJOL 2O93L 4W9EC 3GLXA 2A3LA 4DN3H 1COBA 4HF5L 3FPYA 1JDDA 2K6WA 3C6LC 3QS2A 4PVMA 2IH1A 1WJSA 1L3WA 4ZBJA 1BREA 4MAZA 4M3JA 4JFYB 3QORD 2RGSA 4ALAC 2Y06L 4MA8H 4ZQKB 4JG9A 4F8NA 4QXUH 1TTGA 1UWGL 2WCGA 3FUDA 1M9SA 1YEFL 4FXKC 5E9NA 3UABA 4DN3L 4LCWD 1SN2A 1WDAA 3GS0A 1RAFB 1T6BX 2O5XL 2YRBA 3TH2T 3ZHDA 2EEAA 4L8CB 2E6QA 1L9SA 2QEXT 2XN1A 3LPPA 4MA8L 4YHYC 2NSMA 4NQVB 5FUOH 5GGUB 5GSRA 4NM8H 4JZJB 4QXUL 3SKOA 3UGEA 3QULA 1IC0A 1JV5B 1SLUA 2WLLA 2WOYA 2ZWLT 3KDMA 3PL6D 4LSRH 5E00A 4N5ED 2NY0D 4PM1A 2FWOB 3LN4B 1YWPA 3LRGA 3HNSH 4XHJD 4HT9A 2QQKL 2GQVA 1C12A 2I0NA 3HIZA 5FUOL 5FKPB 2VC8A 3LAFA 4BV1A 1FLTX 4NM8L 1R5VA 2Z31A 2Z4TA 1WA0X 2IV8A 4IRSB 3MRDA 5IQ9B 3REBB 2F5BH 3D2UD 2EKOA 1YMHB 3KVQA 3GUTA 1UASA 5HHQA 4GXUN 1SXZA 2EGAA 2QADB 3L9YA 2IADB 5HGBB 1GYAA 1H5BC 5HI3D 1YN7A 3HNSL 1BAWA 3AG3B 2JB5H 3IDUA 5BO0D 2A9MH 4MQXC 2DMBA 4WLCA 3ULSA 3DI2B 5LBSH 3RI5F 1RU9L 2E6NA 2AK4B 4S2SA 5E8EA 4PHXA 3RYMA 4XN1A 4ENEC 1MJ8H 5GMKm 4A67A 5JUEH 2B8OT 4IEFA 3ZE2E 3MJWA 1KIKA 4HGKC 2LNVA 4XVUD 1AC0A 2F5BL 5F9AC 3LDBB 5ETUB 4OCNC 4AQAB 1WQWA 2WYIA 4LDUA 4X9CA 4Z23A 4ZAKA 1USQA 2A6JB 3O9WC 2EAYA 4W9IC 2CR0A 5CO1A 4EAEA 1K8AC 1WG3A 2VYTA 1QSFB 3JWNC 5D1XC 4KZ0A 3RUGB 3CFCH 1DDHA 4WJ5A 3CWGA 1PIFA 1WFOA 2JB5L 1XZ0A 5DMKA 5I2MA 2A9ML 5J1AA 3ZE2F 2NYKA 4JRLA 4ZUWB 2IMNA 4WW2A 4Q56A 4LLVA 5LBSL 3ORJA 3MRQB 3F62A 3V6ZB 4MAYD 4W4OC 5JUEL 5I1JH 3QZOA 3WKNA 3QFDB 1XT5A 2ENPA 3K1KC 3IDYB 4LSPH 4M6ML 3ZYOA 5C0DB 3MLXH 4G9FE 3P2DA 3HI6H 4AQ1B 1CICB 3CFNA 2EKJA 3LNDA 4I0CC 3S3JA 5A2KH 3H54A 1G7JB 3FC8A 3DKHA 3MGTB 4FFYA 3KLSA 2NW3A 3ZBMA 1SRMA 4D3CH 3RWJB 3O6LH 1SYVA 3KJ6H 3ARBD 4RMWA 4KJYA 5A7EA 1FO0H 3AC0A 3QHTC 2J05A 4PTUA 4XBMA 3U36B 4LLUB 1F02I 5I1JL 1O9SA 1FJ1B 3MP8A 4AQ8A 4XO9A 4E7IA 2J8UA 1S5HB 2ESVD 2ITFA 3BH9B 5GPRA 1ED3B 1JZ6A 5I21A 3MLXL 3MUY1 3S96A 3HI6L 5TFSH 2BVPB 2ZG3A 3W5MA 4G42A 4OZGB 5G4NA 1GS6X 4D3CL 3MO8A 3O6LL 3URGA 3KJ6L 5GGSA 3ARDC 4RGNB 5J6SA 4Y4HC 1ASPA 1FO0L 3FFCB 1PX8A 4QAMB 3L2WA 3HZVB 4I9XA 4XZUB 5B3JE 4N0UB 4X9BA 5CLTA 1GKOA 1E8WA 3QDJB 5DR5H 2DWYA 1QSEB 3IS1X 4C5HA 2CPUA 3SHSA 3DSNB 4WJG3 4QRBA 3X28B 4KH1B 2HG5A 4CSPA 4DN4L 2C0OA 4Z7IA 3O6FC 3SDXB 4KGZB 4P2QD 5B3JF 1E9OA 2Q6WA 4BRJA 4WO0A 2OJZH 3VVWA 5BOPA 2YK1L 2X53A 4XCNB 3BVVA 2X70A 4XAKE 1MHCA 1UOKA 5FB8A 5GGQH 3CK0H 2VMCA 4E7KA 3S48A 1ZT1A 2X4XA 1CF1A 5DR5L 3T0DA 1HD3A 2JTFA 3JCMJ 1NCIA 2UXFA 3T0XA 2N3JA 2CO3A 4CVZA 3VFVA 1NDGB 5FKAB 3TBSB 4FJ6A 1YO4A 4UZGA 4BCYA 2OJZL 2FNBA 5LGHL 1QFHA 2AEWA 5I8EA 3ZE1E 5J5EA 4JO3H 1S7VA 2E9GA 4BZ1A 5DHVA 3CK0L 4LK4A 1KCVH 2KLRA 2IPUG 5F6HI 5ECAA 1OV8A 3DX2A 5I5RA 1TQBB 3PDDA 4PW4A 5IW3A 1AY1H 1PL3A 2Y7QA 1GGCH 2JKWA 3OKYA 5IFJA 3V52L 2AZVA 2FZ3B 3ZE1F 4LCIH 1DQIA 1UZGA 4HOMA 5MP6L 3NUKA 1NM7A 4F33B 4URTB 3WL9B 3WXWH 4AL8C 2Q10A 2OQJA 3AVEA 3MV9D 3O11A 1U4FA 4TNWK 5LJ5j 2YRLA 4JO3L 5D7EA 3RNQB 3W9DA 1H15B 1M53A 3ARVA 5AYTA 2HL3A 3N50A 4F8PA 1RCYA 3HR5A 5C92A 4W9ZA 1A2YA 2C9XA 2VDPH 4EMZA 1MCWM 1GYUA 2XZCH 4MDWA 4O6JA 4AYDC 4EJ1C 5F1IB 4LQ1A 2WLIB 1NBYA 1UD6A 5C6TH 5J13C 2WMPB 1R77A 4AFSC 1WFJA 1F2QA 1AGDA 5GAN8 3CDCA 4JUTA 5AENA 2FSEA 1M42A 2DQIL 3QQ9D 3WXWL 3UT1A 1I1AC 2BHUA 2KS0A 3FCUB 2VIRA 4OJEH 3RKDC 1KJMA 5GS1A 1IBHA 3VXPB 3ZIYA 5SWSD 3GYRA 1UJ3B 2ZG2A 3RJQB 4XTUA 2YAPA 4IBLT 1PZ5B 3MGOA 4AG1C 5DFVC 3X14B 5EHFA 1N5AB 2NUPA 4QIRA 3VUZA 2PQWA 2XZCL 4L3EA 2ICWI 5C6TL 1UUSA 3MRIA 4ZZKA 2F54E 1AXTH 1M6UA 4K7PH 3MNZB 5CSBA 1KN4H 4FHJA 4D8PA 4HCRH 3ISWA 1Y57A 2NZ9D 4LOEA 5D70L 2X51A 3QZ9B 2NYSA 1K8DA 5FFOA 3QWOB 3BVTA 2XA3A 5C9JB 5CCKH 4ZX5A 4Y16B 3KPTA 3APDA 3NACL 4JY6B 1JPSL 1D0ZA 2Q8BH 4YGVB 4IW4C 2QKIA 4AY0A 2H0FA 3W11C 4A4HA 3WSQH 1T5WA 1ETZA 1HYSC 2Y2YA 1JU5C 3LPOA 2BSSA 1AXTL 2JI3A 1U93A 2HBWA 4XOCA 3ZBDA 2PW1B 1KN4L 3FU6A 5I24A 4TSBH 4HCRL 1W91A 3OSSC 4F9LA 4ZPVA 4OV6F 3CXFA 1S6NA 3MV11 1TVBB 2DWDA 3BYYA 5I26A 4R3SA 3GPSA 3PNWC 1WQVT 3B4NA 3UFIA 4HPHA 2Q8BL 2X4QB 5DQDH 1OAYL 3V10A 5A7BA 1WC7B 1E5YA 2PO6A 2IIMA 4KRMB 3WSQL 3IDIB 4C83A 2E7BA 1HCFX 1TMQA 1AQHA 1HJDA 2Y7SA 1JNNH 2GAZB 4IBUA 1DBAL 3US0A 2X89D 3K6OA 5E1AB 5HYSA 5AW3B 4LIQH 5CHNA 1O5PA 2TAAA 4BEIA 4TSBL 4L4TD 5D2NC 1WFTA 1HQRA 4J3OH 4LCYA 5E5UB 2CK2A 3IYLW 5L2KA 3QHSA 4LVEA 3D50A 2XN9B 2GQIA 1KCUL 4MZ3A 1AHJB 3FFDA 5CJQL 3VFOB 4D0CB 1N9RA 4NCDA 1OLLA 4F7UG 4LUEA 3GMOB 4PRPE 4KXBA 4RAHA 4XRCB 5DVKA 4M75D 1C5BH 3RIKA 3DK0A 4JRIA 1J48A 4ORZC 4ZAKC 2GCYB 3RILA 1JNNL 4MX7B 2NTSP 2M02A 1RZJC 2I60H 1XR9B 4IU3A 5E9DB 4B0MM 2DM1A 5I5MA 1ZSZA 3V6BR 2FYYB 1MWAH 2VR5A 3PAZA 43C9A 2K6ZA 2VLKA 4PRAB 1SSHA 3RDVA 4WW2C 3UH8A 4J9DA 2BP3A 3QUMB 3TTYA 5FC9A 3V6FA 3O45B 1J05A 2LTOA 3UYPB 4N0RA 1UTDA 3HFMH 4K4KA 1WZLA 1C5BL 3X3FH 5LGKA 3ZTJH 1K8AU 3NGPA 2O72A 3CFQA 2I60L 3SJVD 2DWEA 2EUXA 1ZVNA 2EYZA 5E24E 1MWAL 3QDHA 2LQKA 1BP3B 3CZUB 1D9KB 3R6NA 4LLDB 3OJMB 3CDZB 3FCSA 3Q01A 4XBEL 4AENA 4CJ1A 4YWGH 3M7FB 4GBXA 5CLZA 1UWXH 2I5YH 4AQ8C 1HOEA 2HTLD 2HLAB 3HFML 1QLFA 4XTZA 1ZV5A 3RX5A 4C59B 1KBGL 4OZ4B 3PWLA 1BVOA 1S78C 4OQTA 3DX6B 4JM2D 3OG6B 2HKHL 2Y1ZA 3HN5A 2I7OA 4AC4A 1BJ1H 1CE1H 1VQ4T 3WIIH 4TNWF 4MNQB 3TPKA 4HULB 2HVJB 3CCLQ 2OI9C 4AFZC 3CC5B 3ELAT 4WUUA 5IVNA 2ATCB 1JPTL 1MCJA 2WSFE 2GBAA 5CEXA 2VZ1A 5F9JB 4NGHH 1FZJA 3D05A 3VRIB 1X6NA 5GS2H 4Y2DB 4CDGC 5JOPE 3QZ5B 3PVQA 3SN6N 4UZUA 4BQ8A 2VDLH 3QAQA 1U42A 5HDRA 1QR4A 4PJCE 3GEFA 1DQQB 4NNXB 1Q9WB 3P73A 1CE1L 2VXSL 1JWMA 3BGMB 3WIIL 2Q7NA 3KXFD 1WYXA 5SV3A 1E4XI 3QJHB 1RK1A 4M4PA 1KELH 5KYXA 4N2OA 4PJCF 5D5MF 1MIEH 3AFLA 2VDLL 2J2ZB 5HHOB 4O4YH 2XETA 5CK9A 3ATDA 3LH8A 2KQMA 1L7IL 3PHAA 1UOVA 2X4TB 1HXYB 5IW6B 4Q5WA 3LB6D 4ZFFA 4ZW5A 1A8ZA 2AABH 2Z9TA 1N19A 4EMKC 3CGTA 1VACA 5DURD 3QNXB 1TSFA 1B0WA 2YUZA 3BPOB 3MRNA 4HGWB 4JVPA 3EXJA 4HK0A 3LN5A 2AV7A 1U8PA 4WEMB 2DIJA 1MIEL 1PY4A 5LDSA 3VWKD 2JUFA 1TJIH 1NAMB 3TEYA 3GO1L 2A6KA 1QLRA 4KXZH 1PS3A 2P0KA 1VQMQ 4O51A 5F21B 2JB6A 2H0PA 3UJIH 1U58B 1I7UA 1WICA 3VI4A 3U2JA 5DJ0A 3KL0A 5DD6A 4DQAA 3FQXB 4NKIH 1JYWA 3OV6A 3OKOA 1SXCA 2ZPIB 4A7GA 4FTVB 3QH3B 1IC5H 3HTRA 1E2WA 2AABL 1VQ9T 4HUVB 1XF5B 1ZTMA 3GB7A 3KPLB 4N0CC 1T0MB 2QPUA 4ZI8A 3WFDH 4HEPG 1M2OA 5C0ND 2GEEA 5JQ6H 2GBQA 1CB4A 3UJIL 3OYGA 5GS1C 4DP7X 1BVNT 4BE1A 1EBAA 3ZGIA 4S1RH 4Z77B 2WZ6A 4NKIL 1N2RA 1DHKA 5EOCH 3WKMH 4PVBA 3MV8E 1IC5L 4HKJB 2VXVH 1QFWH 3WS3A 3U4EA 1J9QA 4NN7B 1KBWA 3ARWA 3L9RA 3H8ZA 4N0YH 3KXTA 2K5FA 3QO0A 3WFDL 4POUB 2W65A 5F89B 2LTQC 3AAZB 4N9GA 5JQ6L 2PYEB 1QRNE 4DZ8A 2CBMA 2D2CC 3GLZA 3RGVC 7CGTA 5E94A 3QJUB 5HJGA 4CI0C 4PVLA 3X11A 1JNLL 1KLUB 3DV6A 3FUIA 2YO3A 3MRFA 5F7MC 5HGHA 1NYFA 3VXUB 4AQOA 3BKYH 2D2OA 3WKML 1TUGB 1TTUA 4UAOC 1IV8A 1QFWL 1WBXA 3GSXB 5CILH 3U9WA 4JFVA 5T3ZE 4XC3H 4EF3A 1CCZA 3FB7A 4N0YL 2FX8H 5ANME 1EHLL 1VQOT 1K8IA 5TGBB 5H94A 4HWZB 5CZKA 2K45A 2RBLA 4NS0A 4B9GA 4F9LC 4UOJA 3QJRB 1AIZA 5DEGA 3LIZA 1DJGA 2WNGA 3OYBA 1H6EA 4M8UA 2EO7A 1VQNT 4WHTA 3CQPA 3PHQA 5E6IB 1DJZA 3PNRB 3UTOA 4RG8A 1JAEA 3QEUB 2QFRA 4NRZB 2WKGA 4O00A 5CGMA 3RWGB 4OAWB 5EU7C 1FLRL 1E65A 3T8MA 1KIRA 1JMZA 4HISA 1ZPLA 4PRID 2R23B 4PG9A 5AVYB 1V05A 4FG6C 2LFEA 4RISH 1GCQA 1MGQA 3CFMA 1QVGS 2UUDH 1MRDH 1BYNA 4FYQA 1YNTB 3CVDA 3DXAE 4X4YA 5LWYH 5MEND 4P06A 4PJEE 2BNQD 5HI5C 4J9FA 1QEWA 5D7LA 3EDEA 4QRSB 4BWWA 3BMWA 4OTXH 4Q9CA 2K3TA 2WXOA 3IVKA 2J6WA 3CD6A 4GY4A 3PP4L 4JAMB 3ZHNA 4M3HA 2A4ZA 2Q8AH 4LSTL 3KPPB 4KJPC 1E6GA 3CCHB 2CLRA 4PJEF 1T0HA 5T3XD 4U1HA 1MCOH 3VE0A 1BM3H 1ZE3C 4ZUUA 1RP8A 5L8KB 4RMBA 1FV1B 1WIOA 4MZ2A 3MAWA 4N2EA 2JSFA 4ZMWA 4CADB 4MQXD 3EUUA 3EBHA 3UO8B 1RL2A 2YN3A 3BAKA 2OZ4A 4RDQF 2EWNA 1E4WL 5DSCB 1AAJA 2A4EA 1I82A 4HC1A 2UXVA 2OAWA 5AD0B 2A73A 1F11A 2KBTA 2LU3A 4J3WA 1EVUA 4RGMB 1BM3L 2JKJA 5GGRA 3ME0B 2EKSA 2GY5A 2KLTA 3O9WD 3OJDB 4RWHA 4WSJA 4Y2OB 1CD0A 3VU3C 1DJXA 4BD3A 4GPVA 3VXMA 5JXAH 3V8LA 4HQQH 5E2VH 4ZX3A 3LKPA 4KGXB 1DBMH 5DF0A 5B8CB 4IBWA 5JW4M 4LSVL 3QDAA 1KNOB 1DANU 2GJ6E 5BW7A 1CFVL 1UGPB 4JJCA 1QLEH 3KPSA 4G8IA 4KNQA 1FN4A 3BHBB 4IMLB 1PU0A 4AEHH 2DLFH 2V33A 3WVDB 1MLBA 3A5VA 4LDEB 4DP6X 3WUZA 1E7UA 5D1ZA 2BY2A 5JXAL 4F04B 3QJOA 4HQQL 5HK0A 1P5VB 1DBML 3ENEA 3BUDA 4LPYA 2OW7A 1NJIR 3L3GA 4GP5B 3ULUE 3A6CL 4Y5VB 3Q3GA 2VN5A 1B0RB 2BC4B 3BW1A 3CC2T 3PQYB 3RDTA 4AEHL 2DLFL 3IJ8A 1TYEB 4H0HB 2WBJC 3OY9A 3UDWA 4M7LH 1SJVA 2P8LB 5KAQF 2PPAA 4ODVH 5E8NB 4TQEH 3Q1JA 1ERNA 1FYTA 1ZLEA 1R3HB 3MTXA 3LIUA 4PB9H 3ULUF 2X4JA 2YRDA 1KENH 1T1ZB 3CBRA 5CSZB 2NSQA 6TAAA 2GBTA 3CFUA 1UTIA 3CCUQ 4JZNB 1OW0C 5KG9A 1NKRA 3ISRA 3ZT5A 1AGEB 3MLSH 3V9CA 4JM4H 1A4AA 3EJTA 4XMLH 4M7LL 2GJJA 4QRPA 4UQ3B 4Y19B 2BM3A 4HAGA 2KLSA 3HBQA 2VGNA 2B14A 2ENYA 3O6FD 3STZB 3WY4A 3T4AA 4B9WA 2XKNB 1KENL 4J4PA 4XCCH 1KIQB 4J3UA 2Y24A 4PJHB 2R2HA 1PNCA 4JY5H 3FDRA 3NRFA 5DA0B 3QXAB 2ZUSA 3RIFK 4ODHH 4JM4L 4MBOA 1U8OA 4XMLL 4K5MA 4NI6A 1V7ML 4G8EA 1BECA 1KJWA 1X9QA 4Y1AB 5B39G 4X6BA 2GNCA 3STLA 5B39B 4XCCL 4LCCA 2WC7A 3T3PB 1D1AA 2E0PA 1A6ZA 4JY5L 4UF7C 1JF5A 4DETA 1JTTA 3MV01 1TQWA 2Q76A 3EJPA 3VD4A 2EQJA 5J1TC 5F6IC 2DL3A 4FFZH 1E8ZA 4JPQA 3MCLL 2JNGA 4ODHL 1KYAA 2A99A 1XD1A 4IKIA 2R2BB 4PS4H 3QHZH 2PTTA 4BFIB 3DKMA 3ZTCC 2RQWA 3FUKA 5LJ3h 1W0WA 1CDGA 1MFCH 1UB5B 3QJSB 1I4K1 1J1PH 2UV3A 3F04A 4JRFA 4HX1B 2ZNXA 2KXDA 1RP9A 2B16A 3ZK0A 4PGDA 1EUUA 3N44B 5CBAA 5MERA 2NR6A 3L3JB 4JPVL 1I8LA 4MYWB 5FROA 1FC1A 1HI6B 1LTXA 3CPLB 4LPXA 3SYOA 4PS4L 5CZVH 3D0LA 1G7IA 4I5BA 2WJ7A 1OEBA 2JW4A 2VLLB 3D34A 3FT9A 3HE6B 2Y0SA 2YOAA 1I1AD 4QWWD 5DDHB 3RKDD 1MFCL 2ZCLH 4XU1A 3GEWB 1J1PL 3SQRA 3EJZC 3MYZA 3T2LA 4D2NA 5JW4R 5DFVD 5SWZB 1G9MH 4R97C 4JRXA 1CXKA 2LT9A 2QSQA 3PF2A 1P7HL 2D9QB 1GZPB 5I6NA 1MJUL 4HDIA 1URLA 4PJOG 5IM7A 1Q94B 3SDDB 4QRUB 2WSDA 1K4US 1ORQB 4PJOB 2K3YA 4ZOAA 5IOKA 4DUWA 3NJIA 2K3HA 4KK8C 4RCAA 5I74B 2ZCLL 1A64A 2BY0A 3QEQA 3V4PA 2OTJT 3FRPB 2IPUK 5IVXA 4AJYV 5EZLA 5T1JA 4H1LG 3WENA 4VUBA 2O61B 4LDYA 4FIBA 5GANg 1G9ML 1SUHA 1QWUA 2CA4A 1DJIA 1R3IL 4H1LB 5ALBH 3W11D 4ABWA 5I6LA 1ZX6A 3G5WA 2GABA 5KVDH 1AKJA 4TF4A 3LQAH 4YDJB 3WIHA 3AY2A 4PJ8D 3ZZ1A 2P80A 4GMTH 1F5WA 1S9YA 4ZDHA 4HWEH 2DKUA 3OSVA 3WD5H 1J88A 4RDBA 3TN0B 3NTKA 1P4BH 2FBRA 2AK4E 5EG2A 1LEKB 4OLVL 4PWGA 3SDCA 3BEWA 3JAME 2H6UA 3C5SA 4I87A 4C47A 1A3LL 2RHZA 4TLUA 3G71T 3PVLA 5KVDL 3TV8A 1DFBH 1LDPH 3HKFA 4G9FD 3LQAL 4MMLA 1ZS8A 1LNXA 1WPCA 1HE8A 4WI2A 1K73C 1QSFE 2UY7B 3H85A 3BDLA 2EXTA 3CCJT 3RUGE 3W39B 5IMOB 4FNQA 1ROWA 4JUSA 4UMGA 1J5OL 3F83A 5JW5B 3Q2CA 1UJYA 4L0PB 4WTQA 2VKWA 4NYLB 2DIAA 2YRVA 5FS5A 5IQLA 3VB8A 1U8LB 4WK4B 4Y91A 1RLBA 3VACA 3ULUC 3GP8A 5DVLA 1OP3H 1H3VA 3H9NA 3RUGF 2Z7UA 2YAFA 1A8JH 2Q87A 1DFBL 1J9CT 3ARGD 3MBWA 3H0IA 4ZAKD 4C58B 2X2UA 4OFKA 4B9ZA 2D7TH 1IE5A 1CXHA 3AG1B 1E50A 3AXLA 4UDTB 2YPLA 1T4KA 3X13B 3EIFA 4KDWA 4FCYA 3CN0A 2X05A 4A6YA 1G4RA 5T5NG 3WEOA 2E10A 3ARPA 4MA3B 3CCQT 3A4EA 1DQML 2BH0A 4UT6H 2YXWA 3BZDA 2VAAB 4G6ML 4R55A 3T77B 3RIFF 1KJ3L 4PJDB 2XY1A 3ARZA 2OJEA 3QBYA 2OKMA 4J7FA 2IQAB 5D1ZC 4LEOA 2D7TL 2OCFD 4F37K 2CHDA 1JQQA 4OZGE 4Y4FA 2E7LA 1U3OA 3AM8A 3H1ZA 4H20L 3CBPA 1Y96B 3QWYA 4RGNE 4C4UA 5F1NB 4K23L 4UM9D 4HJUA 4XAKD 1A3QA 2QA4A 4UT6L 1HVXA 1AS8A 4LESA 1BMWA 3RBGA 4G83A 1CXFA 4UV7H 1TFPA 2VDQL 4OM1H 3QDJE 2W81C 3ZIMA 4OZGF 1QSEE 1U33A 2X3WD 4MJ5B 4GO8A 5JHDA 3SO5A 1YI2A 5E8PB 3BEVB 1G7HB 1S78D 2JJVA 3NCFB 3SDXE 2FJFA 1WPYA 1Z5LA 4WWOA 1EXUB 2Q86A 4JKWA 4QHUB 2CAKA 4NUGL 3EHRA 2ILLA 3VMPA 1F58H 2MQCA 3IQLA 5GAMh 4HD9A 3ZT7A 4U6XA 4XCYB 2B8AA 2V1RA 3KS0H 3D4ZA 4Z3IA 5D6YA 2W8CA 1VQLA 1EEZA 1D5XB 2J44A 1EXHA 4GS7B 2HLEB 4OM1L 3SDXF 2WLKA 4KKAC 2X2YA 5DVOA 2D7PA 2AXGA 2A7YA 4P5MA 2ZWZA 2IAMB 1LO5A 1R5WB 4XVTL 4PJFB 3EG2A 1RXLA 2DX1A 2FO8A 4AIZB 2GJZB 1JI1A 2FX9L 3QUKA 3C75A 1EK3A 3H9HA 4NKOA 1NZRA 2CR3A 4GIOA 4CILA 1IZKA 3JB9J 3UIYA 3FUNA 4XMZA 1S3RA 1U3HA 2Y6TE 4KKLC 4L3CA 4WO4D 3CPWP 3I9PA 3I50H 4QJ3B 1GW6A 4FLHA 2J43A 4Z7VA 3NZHL 4XX1E 3KW7A 1OAQH 3IRZA 2LP5A 3LPFA 5JIQA 1F42A 3OAYK 4KRLB 4AVIA 5D71L 5IHZA 4WZ9A 5TK2A 2Q1EA 1N5ZA 4AVKA 4TNGA 3FBKA 2LLGA 5J9PB 12E8H 1MWOA 3HJEA 1P4UA 1FYNA 3EH4B 3ME9A 4GRLA 4J8RB 5TE4L 5I1AB 1NLPC 5JPMA 5F7KC 2CZ1B 3NCYP 5CIPH 4EI6B 4FAAB 4MDJB 4PLJC 1OAQL 2F54D 3WKYA 1MH5A 3N1FC 4XH2A 3GIZH 5DD0H 3WNPA 1DBJH 4F7PA 3GSUA 3LVTA 4QF1B 4WU5B 5D7JB 2I24N 4PJIA 5I1IH 5KYUA 4FQLH 1TXKA 3FT2B 1X9LA 4FNRA 1EX4A 1NOFA 3T6XA 3ZZSA 2AJSH 1WAPA 3CQQA 2APTA 4LCUA 3NYKA 3CMAA 1JF1B 2X6UA 3P9MA 2AK1H 4IRSC 5C3LD 1GAFH 1LPLA 2JMAA 4XTWA 1QLYA 1BQLH 4ORGA 5FHAH 2JKXA 2JQMA 2QADC 1MW2A 3OS0A 32C2A 3PHOA 3DRTB 1C0MA 3GIZL 2GIYA 3QE5A 1DBJL 1N9SA 4G6JL 4L37A 5DD0L 3JSSA 3QQ3A 4JL2A 4TUOA 5I1IL 1SDDB 1XIWB 3KLAA 4RTXA 3CZLA 1FL3B 2X4SB 1PKOA 1RHHA 3ESVF 3IMTA 4PJ5A 2APSA 4ZO6A 2D31B 4JJOA 1Z9NA 1GAFL 2V0AA 3O2WH 1KB9J 1T1XA 4F7UA 1BQLL 1DYZA 2HSIA 1TITA 4Q97A 2PUKB 4M00A 1Q8MA 4MJ6A 1NGYA 2ZX9A 5E0QA 2DDQH 3L3KA 1NIFA 1MCSA 3DJTA 5DRNB 1B6UA 1CS6A 1B07A 5C0FB 1HZKA 5TPWL 3FU7B 3RNKB 5AB1A 3RGVD 2Q7AA 3QWRA 4NFDA 5F9WB 1SXSA 4JFXA 2C3VA 4M5YH 2VUBA 3K4ZA 1TFHA 3ULRB 1IKNC 3WJMA 1YNLH 3U46A 2P28B 1PGRB 4YZWA 4PRPD 5ICYB 2K8QA 3O2WL 3OAWA 2DK3A 5DRWA 1AD9A 2VN4A 4QOKA 3S5LG 3OWRA 4YXHL 2X4RA 1CICC 5AL0A 5ICXB 3K0YA 3S5LB 1AQKL 2DDQL 1WLHA 2HH0H 4LPWA 2VTFA 4F37F 2F6AA 3PABA 4LVOB 3FT0A 1TG8A 2ADJA 2Z35A 3B9KB 4JQVA 4L4JA 2XN9E 4RTZA 4J2XA 4J3BA 4OD1H 3SDCC 5EF3A 1KXTB 1PLGH 1FVEA 4M5YL 2AT1B 1YNLL 2H2PC 4IKFA 1OB0A 2DMOA 1ZAGA 4LOUC 1FFOA 3OF6A 5TQ2H 3DUSA 4TUKH 1YUHB 5EOTB 3PLYA 4GAYB 5E9DE 5AVWB 2JWYA 5T33L 2EBPA 3QIBB 1QHPA 1Z32X 3IMWA 3T65B 4QTIL 2EYTA 3RL1A 4LXCA 3QUXA 4RGNC 1Z6JT 3WI9A 4OD1L 2J5WA 4WSGA 5CJOL 1MVFA 2D0GA 1KZYA 2BK8A 5C08B 1KBPA 1K73U 5TQ2L 2X87A 4TUKL 2OR8A 3VFRA 4X34A 5HDQH 2KRMA 4IM8A 5LAXB 4KVNL 4WTXA 4HEMA 1S7WB 2VERN 2Y2TA 5AL8A 4CVWA 3E6FA 2VC2B 2EE0A 3Q6FB 2DYBA 4KJPD 1NC4D 3O3UN 4KZDH 8PAZA 2WQXA 5DK0B 3I56T 2OTWB 3SE4A 3KYOA 4ZN1A 1WITA 4LBEA 4AJVA 1TSRA 5HJ3B 3DBXA 2FHDA 1VZHA 2BOCA 1KT2A 4R7NB 5GAOq 2CJUH 1J8HE 1U92B 2MNJB 4GIPD 2V2TB 1VADB 3LKQA 4HCFA 1MFEL 3GMMA 1HHJB 1HOCB 2R4RH 4PRHA 1H92A 4X4MA 1DSFH 2VZVA 2VABA 2FLBT 4FA6A 5HDQL 4Y4FC 4KK9D 2E7LC 3MPUB 3LXCA 2VXQL 2WUBH 5J57B 5SWQA 3OPZH 3HHSB 2C7FA 3NP3A 3D1MC 2XKOC 3PJNA 4MNQE 1OOAA 2W80C 1XTMA 2XG5B 2BW5A 3SKJH 3BWAA 5FGCB 1XH1A 4PGBA 4HCKA 3U6RB 2MWOA 1H0DA 1YITT 4KY2A 4ILDA 2GY7B 4WHYG 5JW4N 3BVNB 2FBOJ 2R4RL 5JIIA 4HUMB 3U7AA 3S97C 3BPCB 1QTSA 2EYRB 2VB5A 3CIQA 4PP1D 1CXLA 2WUBL 4PCYA 2WTRA 2K70A 2KZKA 3OPZL 4HH9A 4P2AA 3LZQA 3B1TA 4OBRA 1UURA 1SF3A 3FN9A 4O58L 3SKJL 3VI3E 1HXKA 1J12A 1KB9K 5GISH 1ZS2A 1A25A 43CAA 2DQFA 4BGLA 1CTNA 1M7IA 3LN9A 3ZHKA 5IMMB 4YTLA 2IGFH 4BZYA 3T6ZA 3FHEA 3BLPX 3JCMV 1G7PA 2CLVB 2YUOA 3ILPB 5A2LH 1GBQA 4R96B 1OGTA 4HEPA 1IM3B 1ZSDA 1UM6L 3GD1C 1LO2H 5DUJA 2F19L 5KH6A 1IO6A 2BP8A 2WBJD 2ZOUA 4RSYA 3VFMB 4KHXH 5F88A 3BGFB 3LZNA 1ZVHA 1U3HC 3DPDA 3WUWA 4AMKH 1WA2X 1R4XA 5GISL 1QI3A 4ZTEA 4L1DA 5AYUH 1Y1UA 4MD4A 3IKCA 4AV4A 2QR0A 4DF9A 1KJ2H 4PCKA 2AHIA 4C0FA 4C8QG 4M9OA 1T0PB 2W10A 4C8QB 2CREA 2BUDA 3GINA 4RWYH 5DYOA 5DTFA 2H1PH 3MCKB 2QQSA 1LO2L 3NZ8A 4R4FH 4B6ZA 4Y16C 3QUGA 2D3LA 2H32A 3I6SA 4KHXL 4LSUL 4QTHA 3RPBA 1PFCA 1JHLL 4AMKL 3M46A 4PFZA 2VRQA 2F15A 2YXVA 4GRLC 3MV8D 4HIXH 3M4YA 2OMYB 5FWCA 3OKKB 4M77G 3UXFA 1KJ2L 3HLAB 4FQ1H 4Y9GA 4ZFQA 5K1NA 4KU1A 4HIEA 2LJ3A 4M77B 4F17A 4XCEB 5DJ2B 5KZCD 4RWYL 4OT1H 2RD0A 1TZ8A 2H1PL 2W60A 4XVJL 2ESWA 1QRND 3PE9A 4QYOA 4NQXB 5JHLH 3NBNA 1I1FB 2DQDL 3L2UA 5BJTA 3AREA 4HUNB 1R3LA 3H9ZA 4YDVB 1G6RB 4NO3B 4QXVA 3VX0A 4R7DA 3U9PH 5I2IA 5JHBA 1A4JA 1MJJA 4NENB 3ZU8A 2F53A 1QATA 2GUOB 2PYEE 5LJ5d 2A83B 4OT1L 5EU5B 1ZCRA 2D9TA 3QXDB 3ZL7C 4QXTA 4DUVA 4LLYA 5B1JA 5IF0A 2XWZA 5JHLL 3JB9F 2XVBA 2XY2A 3FTVA 4ODSL 3PRZA 1JGVH 4JREB 3VXUE 1ECYA 4OF5A 4HHAB 2A3TA 1PDKA 4HA1A 1AWOA 3HG5A 2EO1A 3DO3A 1SFDA 2IPTH 2E9WA 3CDGA 3HN8A 1A65A 4JFPA 4P2OA 4U6VH 3L3HA 3QC6X 3BUYB 4M7AE 1INQB 2DYPB 4GY5A 3JT2A 3MLZH 2P4RA 5GS0L 4ODUA 3VW3H 1UQSB 2ORBH 2PKDA 4HCGA 1IO4C 1XSKA 1VFMA 2ZE0A 4NQEB 5HVGB 5KBMA 2IO5A 4WSKA 3GJFB 4ZTPL 2AQRA 1JGVL 1FFPA 4QHNA 1ABQA 2P7TB 3DXAD 3T9NA 3L2LA 4PB0H 1X5XA 1A9BA 2X6CA 4HK3J 3V4VH 2DH3A 3II1A 4U6VL 2NNAA 5FW9A 1SYSA 1JGDB 1IAOB 2DEYX 2XWBA 3OXRA 4JG5A 3EJZD 4Q9RL 5HHNB 3VW3L 1IFRA 1NCDH 2B2XH 2ORBL 4JQVC 3RWEA 1X5IA 3S0PA 3S7GA 3VGDA 2CK0H 3TA3A 3SB3A 4Q6IB 3K2KA 1MCNA 3GJEB 4P59L 1DJHA 2AKRA 4PTTA 2JK5B 3D25B 4I0PB 5A0GA 2APVA 1RERA 4J5VA 4KK8D 4BA8A 3FU0A 2ADIA 3O6KH 2BKDN 1HN1A 2YSTA 2UZIH 2V5TA 4NHCH 1NCDL 1PEZA 1YNTF 2Y72A 1NCBL 3C09B 2DJQA 4HCBA 1NGZA 2CK0L 4XVSL 4NAMA 3VV0A 3K91A 1GJUA 3P4MA 1UA7A 5E4AA 3HZYB 1NBEB 2O6FA 4I3GA 3ZMEA 3MRCB 2WLNA 3PWVA 1DVZA 1EZSA 2H26B 4LF3A 3MO1A 5EWIL 4XOBA 3VFUA 1ZUUA 5D7LD 1BVLA 5GGVH 3B7SA 4F15B 2DAQA 3FNKA 4ANKA 3CFJA 1AGBB 1B2WH 3O6KL 3QUZD 3HZKB 3MLVH 2GJ6D 1NBQA 5AWNH 2UZIL 1D3BB 4NHCL 3JWDH 3AS3A 4L8SB 2TSAA 4YS4A 2CIIB 3L16A 2XXMB 2R2HB 1ZHNA 5F0MB 4J3OG 1VHPA 4WU7B 1I9RL 4O9HH 1MUJA 5IB4B 3NCMA 4B50A 2YUQA 3DI3B 1QFWM 1OZ3A 2ZP9A 1T7WA 2H7WA 5LCVA 1CDCA 1U5SA 2P8MA 2XX0A 2YD6A 4OCLC 3QIUA 3TV3H 3VYOA 3VSTA 3EUDA 4G8EB 4Z9KB 3WNIA 4FQHA 3WTSA 2ZOKA 3MLVL 2APWA 3I9AA 3ULUD 1TUPA 2BP0A 4LDXA 1Y6KR 3U23A 3W0WA 2R5AA 1KB5A 1U95B 2XBTA 4LNVA 2PNIA 2FL7A 2YUWA 2AHJB 1YYMH 4KTEH 4O9HL 2JH2A 2RFXB 4ZGDB 1M6OB 4NC1C 4WIQA 4FLSA 3TEEA 2BSTB 2DN7A 4AYGA 1QFOA 3VXMD 2EDTA 5KVEH 4B60A 1JZ8A 3TV3L 5FWQA 2O4XA 2OULB 2YARA 1KJVA 3BWSA 4PJGB 3GK8H 1IRXA 3F85A 3ZTJG 1RURH 5KBPA 2VM9A 1S7SA 3CHPA 2JCWA 3FONA 2AI0L 4GQZA 3PQYE 3WTVA 3LKRB 4QRAA 4YHLH 1ECZA 2BRRH 2WIIB 2XWXA 4LU5H 4NO0A 3DC0A 2MCPH 5AKSA 1YYML 3X2QB 4KTEL 5I17B 1JGUH 2IANB 2Z34A 3K6NA 2O5ZH 3V0VB 3U0PA 1KBKA 1N70A 3DMMA 3SCMB 3SY6A 1C5CH 1IGYA 5KVEL 4D6WA 3MRJB 1G6VK 1AG6A 3BZFA 4WI0B 5D72H 1ZHIA 2K9GA 1JZGA 3GK8L 4PUBH 5DK2B 1D5BA 1H9VA 1RURL 3JXAA 5JXEA 3PTAA 4WFED 2XWTB 3HNVH 4WV1A 4R2GB 3UATA 1EFXB 2FT6A 6AT1B 4YBHA 1QFWI 4YHLL 2BRRL 2V1QA 2ROYA 4LU5L 3VFSA 4Y19E 1JGUL 1ZK9A 1XXDC 2O5ZL 4H0IA 4EOWH 5F2FA 4IOSD 3POCA 4LHUD 3EO0A 1FE8H 4NN7C 2ZWKA 4UNIA 2ZYHA 3GBQA 3PPEA 3G04B 1FYHB 4PJHE 5IT2H 3CCVT 4DVBA 1JN6B 4PUBL 4Y1TA 3FT1A 1ZVSB 4WDIA 4WFGE 2EVJA 1R9FA 2ZXEB 2CDGB 1F6FB 2N4IA 3KLQA 1Y71A 2AIRB 4KKAD 5DS2A 5IJVB 1OU8A 4Y1AE 4N2IA 3GSVB 4PJHF 4PJJA 1ZDQA 3C60B 2VERA 4EOWL 2FLRT 4TSCH 3PV6B 1FE8L 2R83A 3DROA 1TENA 3T3PE 3MNMA 4M7DA 2KQWA 3NJLA 1MRFH 2LLLA 5TQ0L 1NEUA 4JZOA 4KKLD 5LJ3f 4NUJB 1E27A 2Y3AA 4ISVB 3G9VA 4ALAL 5E7BA 2N1TE 1IEBB 2VXEA 5D1QA 1QQDB 4JCWA 4L8BB 3I35A 3NCBB 3ARSA 1MFUA 4N6RB 3T3PF 1P6FA 3VQMA 4UYPA 1L5GB 3STBA 3PGFH 1RPQA 2AKLA 1FGNL 2BXYA 2WVVA 2Z92A 4TSCL 5DEJA 1ZLUK 1YECH 2GB2A 2DLIA 1EXGA 5LB1A 1XSIA 1BSIA 1KYOJ 1MRFL 2ZPFB 3HCVB 3IXTB 4JQXA 3O41A 1XSJA 1TZIB 3U6XA 2AJZB 3PPSA 1CE6B 5TE7H 4GG6A 1YEWA 1FNGA 2V9RA 4E2OA 1BXUA 3GZQA 5BRZB 3BUQA 4XMTA 1CFMA 1FRGL 3UTQA 5ESAB 5LGJA 3QKJA 3MRPA 5AW8B 5HJDA 1UT2A 3C2AL 5L9DH 3CC4T 3SDAA 3U6XS 4ZN3A 1YECL 1H8LA 5G5DA 5T3XH 4LMQE 1P6AB 3N44F 1AWWA 2EXYC 2JI2A 4UU9B 4YL4A 2J20A 5AZEL 4RA0C 5GZNA 2EW3A 1Y6MR 4GW1A 3B7RL 2ZUQB 4IRSD 1KTBA 3BD5A 3L95B 1UJ0A 4A4KA 2XZQH 4U1LA 4R5VA 1I5OB 3TTSA 3BP7B 3WY1A 4L18A 4U1JA 1OGSA 2APBA 2J8HA 2VLJA 2WXFA 4X5RA 5E03A 4F2MB 4CGTA 1X6LA 1FNAA 3FO9A 4L1LA 2QADD 1YCYA 3WNMA 5AQ0A 4FQQA 1BVZA 1GYVA 1REIA 4PJOE 1X7QB 3QIWA 1V3MA 4RRPM 1HCYA 1UKQA 4C56A 1MIML 5AVZB 1PG5B 2ED9A 5T3XL 2RCSH 3R06B 2AK4D 1CMOA 4XPAH 4M78B 1S72T 3CCST 1VFAB 4J3VA 2CCVA 3DOSA 2XDHA 3ZKMD 7FABH 4PJOF 1B4JH 1BIIB 3MNVB 2R1XB 4UB0L 5CSGA 5CKAA 2V2XA 2W0FA 1D6VH 4JFDB 3GQFA 3KBGA 3REWA 2KVQG 3VS6A 1QSFD 3Q8EA 3VWJB 1BLNA 3SGKA 4LVHB 3P8HA 4DFHA 4FKHA 5HYJA 2APXA 2RCSL 5B8CC 4OI7A 4XPAL 2PYFB 1URIA 1LD9A 3TGXA 5CFHA 4OGYL 1HHGB 1P2CB 1UGKA 3RTLA 1KCSH 3TZVA 7FABL 1VA7A 5IJCC 4XK8E 2W9EH 3ES6A 4G43A 1RZKC 1YQ2A 3UCQA 2BDNH 4R7LA 1CICD 2H8HA 1YPZB 1JPGA 2YEVB 3FH5A 3FTSA 3NESA 3TCXA 4AMWA 3BUPA 5FWRA 3B9EA 1VESA 1IVTA 4M5ZH 1OE2A 2V7NB 2IG2H 5CEYB 3H42H 4HKXA 4D94A 4RIRB 1NC2A 4YK4B 1H6FA 1KCSL 1S9WB 2H2PD 2LQRA 2E5KA 4IU2B 3PP3H 4DGIH 4Q2ZA 5D2LA 4AFUC 2V26A 2WYHA 3FCTB 2WWOA 3SPVA 2BDNL 4WGVB 5E6YA 3S34H 2JCCA 4ZTFA 1YEDA 4RQQA 4DPCX 4WWNA 2KDGA 1GY2A 1ZLSL 4XO4A 5GAN2 2IH9A 3QIUC 1I7ZA 5I28A 1VQPA 1LLAA 4RGND 4L3AA 1D0XA 3FFCD 5C3TA 2IG2L 4IIQA 5ERWB 5MEOA 2P5EB 2VLRA 4IRZH 4JHAH 3ROLB 3VKIA 1X5JA 2HRPH 4HT8A 3QDJD 4PJDE 4NO5B 3WLBB 1QSED 4JCLA 3TF7C 3VXRB 3MBXL 4ZT1A 3VQ2C 1XSOA 3S34L 3L2RA 5T5NF 1ZIAA 3CD6Q 1L9PA 4ZXBB 1KYOK 5DUBA 1YAIA 1X5GA 2C9AA 2QK0A 2AXWA 3JV6A 5KSBB 4PJDF 3T04D 2WO3B 4R5TA 4YR6B 2G75B 3CCRT 3EOYG 1T3LA 5GMKl 2WW8A 3FXIC 5C0CA 1W72B 2HRPL 5GAMf 3OS5A 4J6WA 3P9MB 4NJAH 1OAUL 3BSZA 3WS6C 3T3MB 1QUNA 1VFBB 2L2PA 3QFJA 3RWDA 1K2DA 1UEYA 4MJIB 3EHBB 4YUEH 4C8XA 4KXAA 3P0GB 1NCCH 1MLCA 4PLIA 4W9KC 5JXEC 3S8FB 4WV1C 3L6FB 5D6CB 2QDVA 4YPGA 3GSQB 3DTDA 3EGXA 3SWNA 4HOZA 1VUBA 3CXHK 4NJAL 2ARJA 4G80A 4ZSOB 3WEAA 1A3RH 4PJFE 1OQOA 1VSCA 3Q8BA 1M7XA 4EI0A 4X6CA 3BAEL 5E1QA 3QWXX 4QQ6A 3VJPA 4YUEL 5JZ7D 1HH9B 2AEPL 4P2YA 1NCCL 3LQZB 2KYIA 4P3DB 3WU1A 35C8H 2OSYA 4FJYA 1ZHLA 4YEEA 1Y18B 3MFFB 5KSUA 3UEQA 3FSZA 4PJFF 1U8QA 1VENA 3LHAA 5H37G 4O02H 3EJJX 3IAPA 5AAWC 3BSHA 4LSSL 5IHKA 3VUBA 4GKLA 1YQVH 2QV4A 3EKCA 5HPOA 5KTEL 1A3RL 3CG8A 2E3VA 2K7AA 2Y5EA 4UOZA 3HE6C 4PJXA 2DICA 4MHHG 4LARL 4YHIA 3RWFB 1VYVA 1PCSA 5GAOl 1BQHA 1NSNL 1JD7A 2KI7A 35C8L 5L88H 4XI5D 3U0WH 1YY8B 4FC3E 2VO5A 3GGWB 5EO0A 2R1YB 4O02L 4KT0E 4YAQA 1URZA 3RZWA 2ICWB 4RVBA 4YEFA 3AXHA 4QPEA 5CM1A 5CJXA 3P40A 1YQVL 4M1CC 4MWFB 4CMHC 2XRAL 4PJOC 4RTTA 3L4ZA 1CC3A 3TEZA 2PWHA 3C8DA 4WY7H 2BNUB 1UZ8B 3TIEA 3LRLA 1PQZB 4JQXC 2XVGA 3VFNB 2R0KH 2OV0A 3F65A 3MC0A 4Y16D 5J7CC 3VCLA 3D3VA 4PRBA 5GRVK 3IJ9A 5B1AB 3M0QA 3RVXC 4OKVA 1JERA 3U0WL 4OV5B 1TTFA 4W70A 3ESMA 3L5JA 3AG4B 2PN5A 3I6LE 4J39A 2VR4A 4GP8B 1AJ7L 5FU6B 4ZFOL 3LXUX 5CWSB 4ZFZB 4R0LB 4P49A 1CFQB 1T0NA 3MRRB 3JSCA 3UP6A 4QRQA 2FO1A 1NG2A 4WY7L 4EIZC 3AQZA 1YFNA 1D0YA 3VXSA 2KYMA 2E65A 1TZHA 4BFKA 5A2BA 4KDTA 1VYTA 2R0KL 5ENWB 3NH7H 5GZNC 1JVOA 4TL4A 3LX7A 1F86A 3I6KA 5C71A 3QYHB 1NTDA 4ZJ9A 3FTGA 3NJJA 2OZNA 1JHTA 2VGLM 4NL2A 3VG9B 4QRFA 2PXYA 1PJ9A 1JOIA 4P46A 3ZR5A 4XN8A 2E46A 1R75A 1QSVA 3P0VL 3ASKA 5KJ7E 4M5SA 4OB3B 2EVGA 2F0CA 2XN9D 4QGTA 1F00I 4PJ5D 3PG2A 1RJZA 4M6OH 1UFGA 5GANj 3G5ZB 5IEHA 1MNUL 1N0LA 4JJDA 3GNGA 3WHE1 3W38A 3RU8H 4HU8A 1I31A 4YSTA 2J6EH 3GRWH 2NXZB 3MLUH 1VRSA 5E9DD 3SY0B 4JDSA 2ATPA 1Z9SA 3GKWH 3FO1B 2EUWA 5TDNB 1LMKA 1FIEA 3SGKC 1HL9A 2XZAL 3IMUA 1CYGA 1I81A 3VU1A 1N18A 1RZ8B 2A6DB 1PJWA 1HILA 2NRDA 1RZJL 4FW2A 3CVHH 5T1MA 2KZ1B 3GTTA 1PKTA 1U8CA 3CPWS 3TZVC 2PMZA 3NVQA 4UQ2A 5LBSA 4H40A 2HT2C 4QOKD 3VXNA 4FYYB 1RUPH 2J6EL 5IREA 3GRWL 1YEIH 3MLUL 5CNHA 1QQJA 4X0NA 4AH2A 4TVPE 2Y36L 2H3NB 3FU9A 1HNFA 1U8HB 5IN1A 4G9DB 4PEEA 5D9SA 1DL7H 4XMPL 4PRNB 4RTVA 3S37H 5IHUH 2YD0A 1M1XA 1QBBA 2DIBA 2Q2EB 1H3PL 4YIQA 1T7ZA 5FCUL 1BOGA 4OKDA 4Z88A 2K5LA 2W91A 2OR7A 2ZOTA 5C08E 3NCYS 1RUPL 5F1SA 4JRQA 3CVIH 3AWFA 2KL6A 4HUCA 5EFIA 1OCWL 2AAAA 2HPOA 4GW4A 5IHIA 3P9LB 4YBLB 3TVMA 2ZD0A 3E2HB 4ODXB 4A63A 1DL7L 4K3GA 3SGDI 2H2SC 4Z5RA 3T2NL 2VM4A 1M1KR 4MNQD 3S37L 1XGPA 2CZ6B 4V1DB 5IHUL 5AOZA 4D0DA 3VGEA 5FW8A 3T6QC 2EJ1A 4GS7C 1N6UA 5DVNA 3EYUH 4WNQB 4YHZH 1FO0A 5CO7A 1KY7A 4Y2DD 3CVIL 5C09E 2KEAA 2OTPA 5T1KB 2IAMC 1QASA 3GJFK 3S35L 5H4YA 2E6PA 1JGEB 5DI8A 3UO1L 4M6NL 3DURA 3KEDA 2OBGA 1RIUH 1RUQH 4EZMA 5C7XL 2APFA 1S7XA 4LO9A 2F18A 4GMSL 3OMGA 3V5HB 2LAGB 4NLAA 2KQNA 1G87A 5FGCE 4IJTA 3RZCB 3BQUB 3ZOAA 2DLPA 4J6YA 4PGEB 4Z0BL 1NWOA 4WTOB 2VW6A 1UKTA 2ITDB 1S7RB 5DMGD 3SOBL 3GLEA 4YZFE 4P07A 3M07A 3RX8A 3SODB 3E1ZA 2YBRA 2WGNB 3KWVA 2ALAA 3QDMA 2ZAHA 5HHOD 2E56A 1RIUL 3RBBB 2FL5B 3G5XA 3H3PH 1I8UA 4MS6A 5J3HC 3NN8B 4NT6B 2DTMH 4RMSA 3BWUF 5I9QB 1PCXA 5E6RB 5IMKB 3N1GC 4P23B 4YZFF 2A0FB 4HIHB 1XL6A 3FUJA 4LPVA 3SWNC 2JKIS 4HCCA 2F61A 1OOTA 1U8KB 2DAVA 4H5SB 4GUOA 3IBEA 3H3PL 2YQ3A 2P48B 1OAXH 2YWYA 3L3DB 3FQ2A 2DTML 2K3BA 3DRQA 5BVJA 1WLPB 3L5WB 2ZP0T 4FTVD 1A9VA 4NKDA 3LS4L 3NJGA 2PCFA 2BNRB 2Y4XA 4LP8A 2FEIA 3TO4A 5HYQB 5D7KD 1JFHA 1TVDA 3NSXA 2J4WH 1MCQA 1NUFA 1S8DA 4C8QE 2PP7A 1XF1A 2WZ5A 4MS8C 4PJBA 5HYEA 3VD5A 2FZKB 2GSIA 3K2MC 2MIZA 4ZK8A 2SEBB 4F7EA 2LJ0A 2QA4Q 1U91A 2FLMA 2G6FX 1WCQA 4G5ZH 5EZIH 2EE6A 1KCLA 5HHPB 1JPFA 4NRXB 5CQXA 4OLUH 1S7UA 1TDQA 2LFGA 4XXCC 3TT3H 4QRTB 4C8QF 3MRHA 4JY4B 4X4KA 2E7HA 1E9PA 1YI2Q 5EBWA 1NDMB 1QI4A 2EYSA 3D87B 2J4WL 1GKEA 1M05A 1QD0A 2QASA 1PY9A 4M77E 2IV9A 1NA8A 4Z8AA 4HIIB 4ZUVB 1NGWB 4K71B 4B9YA 5F0LB 4E42B 5IB2A 2PYED 4U1NB 3VYHB 2GT9A 5CEZD 4BINA 3UA6A 3LH2H 3VRYA 4G5ZL 5EZIL 1VQLQ 2F1AA 1QW8A 1JXMA 3FQWB 4ZQTA 3VXUD 4JS7A 1XTDA 3SYPA 4OLUL 4M77F 1C08B 3BT2H 1WBYB 3GMPA 3S3PA 2P24A 3RR6A 1BBDH 1PVHA 3CXCP 3N9GH 2JTDA 3DVGB 4PGZA 5IT9E 2I07A 1KXQA 4I48B 1JK9A 4PWEA 2ICEA 2MKLC 5DEZA 3C5ZB 2R5MA 4P57B 3UTTA 1A6VH 1NCHA 3PXLA 1OPGH 2OXHB 4WI6A 3BCFA 2COVD 1L9OA 5JO5A 5T5FH 3LH2L 2LVMA 4M3KB 5SX4I 2GJRA 4BE6A 4MCYA 3DHMA 1D1CA 3Q2VA 4MNGA 3A67H 5I1DB 2LQNA 4HCRA 5E6ID 4CKQA 3BT2L 2ICES 3G71A 2AC0A 4FKKA 2SRCA 1Z2KA 1BBDL 1CG9B 1UM5L 2D73A 3I74A 5KUMA 1O9WA 1TYJA 4P46C 3J7AF 5JQIB 1YIJA 3HI1B 3TREA 3QIBC 1PAZA 4M62H 3OHXB 3CCJA 1A6VL 2AQPA 1OPGL 4NQEE 1UVQA 5IVZB 2VZ3A 5EC1B 5T5FL 1FZOA 2GHZA 3ZQXA 2MPAL 3F5WB 3A67L 4CAGA 2NUTA 3QZWG 4GAAA 4J1UA 4PG2C 3QZWB 2DY2A 1I8AA 5F0JB 1FL6B 4DEYA 1ONQA 2P5WA 3BZ4B 1JZFA 2WXRA 5IK3B 2VDKH 5F72S 3TBYB 5HTSA 1NJ9B 2PABA 3FLGA 3RGBA 4G1EA 1KACB 3CMAQ 2GIMA 4ESRA 2B59B 2CCLA 4JFZH 2OYKA 2CT3A 3ZDYE 5KBNC 1LYQA 3B6SB 4R8WH 5GJWB 4N86A 1YJWT 2OMTB 4QHLA 1S9XA 4Q14A 3RIAK 2YXMA 1MCEA 4KKRA 2Y4SA 1AD0B 1AHWA 4NHUB 4IIMA 1RI0A 5ISZA 3HG3A 4LRIC 1MHEA 3RGHA 3RB7A 2B15A 1AXSA 3O8VA 2VDKL 4OVAA 4YOKA 3TBTA 2WNKA 5HDWA 5BNXD 4EDXA 4F5CE 3UC2A 4FXLA 4B9CA 3QO1B 5F7NC 4JFZL 4Q9QL 2YSSA 3Q1EA 4ZGEB 1IAII 5HVWA 4U1GB 5IR1A 2L7QA 1FBIH 1QR1A 4LUDA 3IFPB 3TS8A 1P7KB 5M9OA 1BHGA 1MWAA 5FYKU 3HPWA 2YHGA 2CGRH 3PGDA 4J9EA 5C07A 4Z78A