3OSZA

Crystal structure of the complex of proteinase k with an antimicrobial nonapeptide, at 2.26 a resolution
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
279
structure length
279
Chain Sequence
AAQTNAPWGLARISSTSPGTSTYYYDESAGQGSCVYVIDTGIEASHPEFEGRAQMVKTYYYSSRDGNGHGTHCAGTVGSRTYGVAKKTQLFGVKVLDDNGSGQYSTIIAGMDFVASDKNNRNCPKGVVASLSLGGGYSSSVNSAAARLQSSGVMVAVAAGNNNADARNYSPASEPSVCTVGASDRYDRRSSFSNYGSVLDIFGPGTDILSTWIGGSTRSISGTSMATPHVAGLAAYLMTLGKTTAASACRYIADTANKGDLSNIPFGTVNLLAYNNYQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Proteinase K
publication title Crystal Structure of the complex of proteinase K with an antimicrobial nonapeptide, at 2.26 A resolution
rcsb
molecule tags Hydrolase
total genus 100
structure length 279
sequence length 279
ec nomenclature ec 3.4.21.64: Peptidase K.
pdb deposition date 2010-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 3oszA00
1SUPA 3DE4X 1BH6A 5JXIA 1Y3DE 3DW3X 4GI3A 1S2NA 4K8RB 1AH2A 1ST2A 5ARBA 3LXUX 1SBTA 1C3LA 1SIOA 2WUWE 1Y33E 1WMEA 3A3PA 2WUVA 3D43A 3LPAA 2Z58A 5JMOA 1BE8A 1T1GA 1AQNA 1R0RE 1YU6A 2PKCA 2B6NA 1Y3CE 1AU9A 1GTL1 1AK9A 3AFGA 1LW6E 2Z57A 5K7SA 1C9MA 2E1PA 3A3OA 2ZRQA 1TM4E 1Y3FE 1WMFA 1SUCA 1SBHA 2G4VA 4ZARA 1SCAA 1DBIA 4LVOA 3F49S 1SIUA 2HPZA 2DUJA 2W2OA 3QTLA 3BPSA 4ZOQI 2W2QA 2X8JA 1UBNA 1T1IA 1NLUA 3EE6A 3DYBA 3VYVA 3I30X 2ZWOA 1WSDA 2X8JB 3WIUA 1Y3BE 2ID8A 1C9JA 4CFZA 1SCJA 4HX2A 3DVRX 2TECE 3DDZX 1EA7A 1GA4A 3GCXA 2Z2XA 1CSEE 5FAXA 3SQOA 5FBZA 2Z2ZA 1GCIA 3L1KA 4M1ZA 2IY9A 4KB5A 1SPBS 1A2QA 1KE1A 1BFUA 1EGQA 4AKTA 1SUBA 2IXTA 4NE9A 1Y4AE 3LPCA 1DUIA 3CO0S 2WWTA 1VSBA 4WOBA 3D9QX 1TK2A 1ZVKA 4BWGA 2V8BA 3PRKE 1OYVA 1TECE 2ID4A 5B1EA 1SUDA 1HT3A 1SBNE 1TM1E 1AV7A 1V5IA 1THMA 2SNIE 1JEAA 1PEKE 2Z30A 1NDQA 1C9NA 1Y48E 3F7OA 2XRMA 3DW1X 1IAVA 5B1DA 1KE2A 2XTJA 1SN7A 1P7WA 2GKOA 1Y34E 3QMPA 1Y9ZA 1XF1A 4RYDA 1PJ8A 2ZWPA 3EDYA 3TECE 3BGOS 3VV3A 4H6XA 1Y1KE 1GTG1 1GTJ1 2Z2YA 5ARCA 1GA6A 4YN3A 1PFGA 4FONA 5FFNA 5AQEA 3AJ9A 1GNSA 1TO1E 3LPDA 5JXJA 4DJ5X 5SICE 3PTLA 1WVMA 4B5LA 3I34X 1KDYA 3TI9A 1SUAA 3SICE 2PYZA 3ZXXA 1WMDA 1BJRE 3GCWA 2QTWB 3I37X 4NE7A 3UNXA 1Q5PA 4H6WA 4JP8A 3P5BA 1SBCA 2SECE 4I0WB 1TMGE 4CFYA 5AMXA 2W2PA 3GT4A 1YJAA 2SICE 3H42B 5ARDA 1SIBE 1GT91 3QFHA 1YJCA 1TM3E 2PWAA 1IC6A 4AKSA 3CNQS 3DWEX 4C3UA 5I9SA 3VHQA 3I2YX 1S01A 3GT3A 5JXHA 4NMXB 1BE6A 2DQKA 4KG7A 1TO2E 4DZTA 1ST3A 3ZXYA 1NDUA 2PQ2A 1T1EA 5AVKA 3F7MA 4OMCA 2Z56A 3BX1A 3WHIA 1SBIA 1BFKA 3DE2X 3VSBA 1GA1A 1KDZA 1MEEA 4Z2AA 3WQBA 1CNMA 3Q40A 1Y4DE 4HVLA 4J94A 3DE6X 4H6VA 3A3NA 2SBTA 1OT5A 2PMWB 1SCDA 1R6VA 3DE7X 3HJRA 3DE1X 4CG0A 2PWBA 1SELA 1PTKA 3DE3X 3VTAA 1SCNE 5AVJA 3EIFA 1SCBA 1V6CA 3OSZA 4KPGA 2WV7A 3Q5GA 2PRKA 1YJBA 1SVNA 2DP4E 1KDVA 5JXGA 1SH7A 4OMDA 1SUEA 3TI7A 4MZDA 2W2MA 3DVQX 4OV6B 3DVSX 3AJ8A 4WOCA 1MPTA 1TM7E 3DE0X 1TM5E 3DE5X 1ZVJA 2HD4A 4C3VA 4DWWA 1OYOA 1P8JA 4LVNA 3WIVA 2P4EA 2ST1A 1AVTA 3T41A 1S02A 1AF4A 1P7VA 5CW1A 3VV2A 2W2NA 1R64A 1GNVA
chains in the Genus database with same CATH superfamily
3IQXA 1K86A 2O6HA 2FJ0A 3P45A 3T9BA 1GGEA 3WV5A 5JASA 1E9AA 3EMDA 2JEOA 2F67A 1BG6A 4WCFC 3K9HA 4J0FA 5JNUA 2B35A 2N47A 2I2FA 2IYLD 1KS2A 4LNUB 5HIJA 4A0GA 2DG2A 2IYPA 3NBMA 4EB8A 3OCYA 4W5OA 4ZCTA 2J48A 4NYIQ 1WG8A 2CSXA 1CX9B 1K0UA 3AVQA 1TA0A 4P86A 3DLAA 1OBVA 2RGBA 4ZVQA 3L92A 1T36B 4DCPA 2ERCA 2IZ5A 1MABA 1XAJA 1CUSA 2ZE6A 3B6JA 4ND5A 2WUVA 2PYIA 2IYAA 3Q4GA 1GZUA 1S6YA 1UMKA 1YQ9A 5CG1A 1YDHA 1KIFA 3B13B 4TKVB 5FOSA 1XVAA 4CKEB 1SJ9A 2UVPB 3FPJA 3VO2A 4HDCA 4MVJM 4MROA 1I1OA 4RD2A 4Z9FA 3F6SA 1TVKA 2B92A 4UHDA 3CTPA 4TTVA 4ZP1A 4N5NA 3VH4A 4IDCA 2I34A 4L50A 1IB6A 2FKNA 2PFKA 2E3JA 4MVYA 4H31A 2JCSA 2R751 3FW1A 5KC9A 1SKQA 5F2OA 2VZ8A 6Q21A 1W6UA 1YDWA 1J2TA 3FRHA 2WLSA 3OLWA 3SJ7A 3UXEA 1C30B 1LDNA 1SZPA 1Y3CE 2JAPA 2XMDA 1PQPA 3TL2A 1N5RA 1VFPA 2ZTMA 3RIYA 4I1SA 4YECA 3L02A 3WRXA 3CXUA 1C5KA 4YJ2F 2WJZB 4YIHA 1GZSA 1KGDA 1Q84A 4G25A 3R77A 1G7TA 4H35A 3FZYA 3PUWA 1ZHFA 2M1ZA 4KDFA 3RVPA 3R5JA 5A9TA 3M3HA 3UEOA 3RHSA 1SB8A 1OBHA 3ZHCA 2FMIA 3UJHA 3GRCA 2OG1A 4LBVA 1PL6A 4QRDA 3QTTA 4YXWD 2O2IA 4Q3KA 2OLEA 3MUNA 2GD2A 4ITVA 3IMCA 4QUIA 3VPDA 4CIAA 3D6JA 4V3BA 3RIMA 4LRWA 1ZSYA 2B99A 2HU5A 2OE2A 3ADPA 3MIIA 3CVJA 2UUCB 3AM3A 3RC1A 4BFTA 4B87A 1JG7A 2CYBA 1LDEA 3JD0A 3DHYA 3OU7A 3O9MA 1T1IA 7MHTA 1K1EA 1O89A 2JC3A 4GZ5A 5FNVF 1BRTA 3S0JA 3C7AA 3VYVA 1JQJC 1L2TA 2AQ8A 4XA8A 2IBMA 1HO3A 4Y1RB 4AF7A 3WKCA 1ZJYA 4FMDF 4IY1A 3LWNA 1XKQA 3JR3A 3JY6A 3K1AA 3J7TA 3O4RA 4KSCA 5T4FA 4NG4A 5FULA 2AUNA 2X5JO 4N0PA 3O9VA 5FA8A 3RSGA 5CBPB 2DLCX 5KSZA 3W06A 5IJ0B 4CFZA 1SC1A 5U9CA 5FDFA 2YWBA 2Y9MB 4JP5A 3RPEA 4EHFA 2PR7A 4EA6A 1YIOA 3VR3D 3N2YA 1KVQA 4TMXA 3NS7A 2B8WA 4P32A 5MDHA 2JGAA 3A1UA 1DQSA 5BUZA 3M2TA 1TC2A 1DHTA 3IESA 1UJ6A 3CJQA 2QI9F 1QH8B 4BKQA 1J90A 4DXAA 1WCIB 3CCCA 1YZUA 2PMBA 3HL4A 3TMKA 4BNXA 5KTPA 3JYQA 3MCWA 3O8OA 2DFKB 1IWPB 3GXBA 4ZHQF 3STXA 4R2LA 4QT4A 4GWGA 1NW3A 2VXOA 4NDNE 1EVZA 1F2TA 3UIEA 3QKUA 1JDTA 1E3QA 2W00A 3I4CA 1QIEA 4DQKA 3RRBA 1GCIA 2ZJOA 4BVBA 4DJTA 4JC0A 1KU6A 2FSUA 3B1XA 1XZDA 4KVGA 1X77A 5KZMB 2J0UB 1QZUA 1KP9A 5JZSA 2H9YA 4O2LA 4TZ6A 8MHTA 2G4LA 3JQ7B 2Q8NA 2ACVA 2JD2A 1KJQA 1NQOA 1A82A 1B16A 3NWEA 4Q39A 3V2UA 4BQEA 4E11A 1NSYA 3NIWA 1M2FA 821PA 3IUEA 3WHPA 2IHYA 3TB6A 3B1FA 1RXYA 5KJ6A 1DXQA 3OI7A 4FFPA 2W6QA 4GF5A 4Q34A 1R00A 3WBKA 3WQQA 4B8WA 4BEVA 4J0QA 2BLLA 3WKEA 2C7PA 2GJ8A 1VDZA 5BV2P 2J9FB 5IH3A 2FEOA 2FWNA 1S4MA 2MYTA 3JTMA 4CQMB 4MYHA 4V03A 3IP6A 1Z35A 1YVUA 2EF1A 4KCGA 3WGLA 2J7KA 4MA5A 2NO6A 4JOCA 2AXQA 3RYHA 4CIVA 1G8GA 3LRXA 3UCFA 5H4GA 3I04A 3NRBA 2GEJA 4QXMA 2ZATA 5T41A 5G53C 3IOYA 4F21A 1Y3HA 1WLSA 1UKAA 1ZI6A 4HEJA 4FMBB 4KQEA 1Z0ZA 3EUFA 4UBIA 3DZKA 1IULA 3QVKA 3WOVA 2JD1A 5JRZA 4XLTA 2I2XB 5D5QA 4DCOA 1A9SA 5J43A 3I8SA 3WLKX 4QFBA 4BBAA 3KELA 3H9EO 3L7AA 3U3XA 1AMUA 1FMJA 1EUCB 2QSJA 5EPUA 3OT5A 1FP1D 3VZPA 5IXSA 3UFXA 3RBXA 2C4HA 3F47A 1HMYA 4QM6A 5JXWA 2NSJA 3JYNA 3QIAA 1HC7A 1NVEA 1PS8A 5JAOA 4A16A 1IOVA 2K7ZA 4PCAA 4ZO6A 2XKKA 1ORTA 3MGKA 4NHOA 1A95A 2WMYA 3W6ZA 4X64B 4M1YA 1XCJA 5AW0A 1GAEO 2PKEA 1EFVB 4MWEA 4RQUA 1GRCA 2C1XA 3ORQA 2RONA 2IU4A 1ZH8A 2DH5A 4GYJA 4FS8A 4G81A 3RAEC 2XRMA 4ILEA 4RTNA 2PRJA 3B3AA 4KSBA 1F3LA 4F12A 1CUJA 4OUDB 1KI6A 4TVKA 3CLUC 1R0YA 2E6UX 3TF5A 3JWJA 3NAGA 4QDUA 4ZOAA 2OC4A 1H22A 2PVPA 3AR2A 3HCWA 5CXUA 1ZD4A 3T4UA 2XQKA 4NYMQ 4ZT2A 2NPFA 4BNWA 4YRBA 3BWYA 4FLFA 2REXB 2VDWB 1J0AA 2QN3A 1ORVA 3DBRA 1N0UA 2CJPA 1Y34E 1JHMA 2PGIA 4W6QA 2Z8YM 1N77A 2B25A 3O94A 1KK2A 5LMNB 1JL3A 2PRYA 3QMWA 2Q7XA 1YV9A 4RKYA 4URVR 2RGRA 4LYGA 1JR3E 2CUTA 4F5DA 5AVOA 1JJVA 1ZONA 3ONNA 3K1TA 4B33A 3ZE8A 2RAVA 3U2QA 3QVSA 3LV8A 1IY0A 1UKCA 5DTIA 1T2AA 1JHZA 4FDLA 4P4SB 3UCXA 3ETJA 4B84A 1DG3A 3GEMA 3H5IA 3R6TA 3FFAA 3LDUA 4MS3B 4HV4A 3CZ5A 1IQUA 4JI8B 4CIDA 1UBFA 3ZH9B 5ARCA 1JIIA 3ICVA 4TLLB 5E3IA 3R76A 1PFGA 1QP7A 2ZCJA 3WZLA 3Q15C 3AW8A 1P17A 1PHRA 2J7PD 4RJIA 5ECYA 4PNHA 1KWKA 1KFBB 3H84A 1IUKA 3I3OA 4G5GA 5JECA 1RI1A 2A9JA 3PENA 5ULLA 4NNOA 5IAAA 4MIYA 1EBBA 3RVOA 1Y7LA 5SICE 4ZVSA 3ZZTA 1NBWB 1JXAA 4W7IA 4O25A 3KVNA 1PK8A 4C1BA 1TVMA 4GLBA 4KE9A 4Y6OA 5K3BA 3UT0A 2ZM5A 2AIRA 4I2NA 4QQ8A 4LWOA 3X1DA 2FPRA 3ID6C 2FUG6 3L7CA 5EMHA 4EYSA 3COPA 1U8EA 3MRSA 5JVDF 1K2VN 1Z4IA 2ZM6B 7REQB 4WV3A 4J9VA 4NE7A 1TZBA 3A04A 4UBMA 3KEQA 5D87A 3C3AA 4MUJA 2VF2A 2X76A 4YRJA 1X7WB 3HKBB 3PNPA 3RVSA 3Q1KA 5LXTA 2JW5A 5BN3B 1T4GA 5A9SA 5REQA 1EM8B 3MWJA 4DLLA 1EDDA 1NMSA 1GDHA 2CBGA 4EG3A 3L9WA 4NFYA 2ZUUA 2I3ZA 3H1EA 2VJDA 4RZSA 2OZLB 4DQXA 3GNQA 4N5LA 1E1KA 2NU6A 2EW8A 2WMNB 3PRYA 3KK0A 5I7AA 1CV2A 3R3SA 5K51A 3VSEA 1QRSA 4PZLA 4BFYA 1QYCA 1TJ3A 1M0EA 4CCYB 1FU4A 2WMOB 4ZJZA 4MHTA 3VC1A 3DDCA 1KC3A 2DPHA 4G5SA 3F5FA 1A4XA 1AN9A 4HO1X 2XXAA 3DAOA 1EFLA 3PPXA 4PSVA 4PV7A 3T7TA 1A7KA 3FOCA 4L85A 1Q6ZA 1R0KA 5KIAA 2AMLA 3E9DA 1QYVA 3TW0A 4MWSA 4B32A 5EP3A 4EUNA 1OBFO 1T2EA 3HHPA 1TAUA 2XDQA 3VTZA 3ED5A 1NBOA 2GYYA 1T13A 4DM3A 1AKTA 4OHKA 2PM8A 1N2SA 2C5SA 1DKOA 3A28A 4KWIA 3V4LA 5CVUA 1Q1QA 2ZIVB 3F78A 5GAJA 4NR0A 3TLMA 2VIIA 3QA3E 3HA7A 2OM2A 4UPVA 3V1YA 5E2IA 1BQ4A 2WM8A 4QUKA 2HLNA 5TB5A 2NVUB 2QBYA 1NDHA 4EPYA 1WKCA 4UM9D 1ANKA 2YDXA 1JMYA 5CIQA 1OI4A 1RZRA 1C1DA 2ISCA 5TS2A 2EKPA 1YRQA 4LQ4A 1TO2E 2ZT5A 4LKOA 1PWXA 2JAXA 4TTPA 2EKZA 2H08A 5CA0A 1FQOA 3ND8A 4HSGA 5DGDA 3DJFA 5C0OE 5KU1A 3BEOA 3W6OA 1IOZA 2C2YA 3AB8A 1EDBA 1SU7A 3H83A 2H4WA 5AHXA 4YMIA 4R68A 4JWTA 3ZN2A 3F5QA 3V3KA 3EC7A 5AW5A 4AJLA 3EJ6A 2Q3LA 3H1PA 4U0KA 5C5EA 5DTQA 2BR5A 4G56A 4QUBA 1N5JA 1VCHA 3BGSA 3MS7A 2C04A 1SWWA 1OXXK 5E6RA 2OCPA 3H97A 4PCLA 3V1NA 1KOFA 3K35A 4JA0A 2KI5A 3Q8KA 1JR2A 3JVEA 4YIKA 2F4NA 1C7EA 4HN9A 4P22A 4M0DA 4E31A 4DR2B 1ZAKA 4E4RA 2GA8A 1PR5A 5KSWB 1OFTA 3A4MA 3IBTA 3L46A 3NX4A 5KCMA 3QUSA 3OIVA 1Y8RA 2XUZA 2A4KA 4RE5A 4YRMA 1PUIA 2P4UA 5FLYA 4B3SB 2CHUA 4FUTA 5FWNA 1CR0A 4AG5A 2C31A 3N2LA 1J06A 2X86A 4KNWA 5DNWA 2AN4A 4UMDA 1M2JA 1UT6A 2A9VA 1UPCA 1RXEA 3EXHB 4D0LB 3WGZA 4EWLA 4EW6A 2WU1A 3I6BA 4BKPA 1II9A 4ZVPA 4OSOA 3L6BA 5AUNB 4UW9A 1W9MA 3R7SA 2JF0A 3SKXA 3BIWA 8LDHA 3WGHA 4D9CA 2EV9A 3FVQA 4OCZA 3SC2A 4CG0A 1EI9A 1PTKA 2E85A 2V7BA 2GZHA 2YHIB 3DV0A 4Q3BA 2X77A 1WV0A 3LP5A 2F43A 3U49A 3ZD7A 1Z0UA 2WHRA 2YFYA 5D51S 1SQGA 3IPLA 3SDSA 3WRWA 4MCHA 4WKNA 1VFNA 3VDXA 1M5UA 3VISA 1RHUA 3OPNA 1BXRB 1YCDA 2VSXA 2WV7A 2ZULA 1Z16A 4J6EA 4M7PA 2P9FA 4ZC8A 1E3SA 1M54A 5ECDA 1N2ZA 1G20B 2C94A 1FFCA 3E27A 2A9FA 1W4LA 4RMGA 2J9XB 2NV6A 1MIHA 3K15A 1DDGA 1OA1A 2GPNA 2Q1XA 1NJ8A 3IERA 1RIFA 1KFEB 2G4CA 3KT0A 3Q7EA 1NUUA 2RGCA 4BN5A 3EIXA 1B4DA 3NHPA 3PDIA 1E8MA 1ZI8A 2BM9A 1TTHA 2BFMA 2OBLA 1EE9A 3L6DA 1D8TA 4IHJA 3G2PA 4QJIA 4ZVVA 3GDGA 2X3UA 1PWEA 5A3SA 4C6TB 2CNWA 3AERA 1QFJA 1R4MA 2I7TA 3BQMB 2X8AA 3KTOA 3QVMA 4L51A 4AKEA 4DTIA 4YHHB 3UOWA 4FILA 3S2ZA 2H5EA 4MZDA 3PQ8A 3VR5D 3WFZA 2ZJ8A 4GQAA 4RW0A 4EENA 3M6WA 3W5BA 5F78A 3OQPA 2OXIA 3D31A 4BQPA 1J9GA 4CRWB 5BT9A 1FTQA 1MPTA 3H13A 1PS9A 5AK0A 3GLIE 3UJ6A 2AZXA 4OLAA 4B31A 2VJNA 4QE3A 3LLSA 2ZRCA 2QJOA 1QE3A 2ZSUA 3ROEA 3VPXA 3RRJA 1YRYE 3OAAA 1U7DA 3ZWXA 2PXHA 5KAPA 4PAQA 2QX4A 5ICMA 1PJSA 2P7IA 1A5ZA 1P9WA 3KKLA 4CMJA 1Q19A 4EECA 4X93A 1C7ZA 4DHEA 4H7HA 3FTDA 1GQYA 1WMBA 1WXEA 1Y42X 1OH7A 2CEAA 3DWGA 4QO7A 2IUUA 3T0GA 3GEIA 4Q5IA 2ENUA 3TQFA 2X6RA 4Y7CA 1MV5A 4B2IA 2PSSA 2E82A 1TM2A 2PH3A 4KFUA 1DQPA 2P9GA 2HPAA 2J5RA 3WA6A 3VH3A 3KYCA 2VJLA 2QTCA 1W9HA 1G19A 2IE8A 1N4AA 2W6IA 5FWDA 1H93A 4J0CA 4OFWA 4M1SA 2Z9CA 3T41A 1U80A 5FJJA 4B9EA 3ZCRA 1IZZA 2C8LA 2NSDA 2W6JD 4RA6B 3ICWA 2G0TA 2R97A 2W2NA 2C03A 6CHYA 1G98A 4RZIA 1UT5A 1X0VA 3BL8A 4WASA 5KTOA 1BH6A 3G0HA 4PX5A 2XWQA 2GZSA 4FD2A 1MPXA 2DWPA 5FI1B 1W88A 2WICA 3P5SA 4CDMA 1Y3DE 3EGDB 3W4IA 2QLMA 1NVVQ 2V54A 4K8RB 2EHDA 2XOKA 1L4LA 1YFZA 4ZQGA 1KEPA 4Z7NB 1QWOA 5EE5B 1SVSA 2NQTA 5E6SB 1ZGGA 4YFYA 1GWNA 1D5WA 1YI0A 2OYSA 4G1FA 4UAGA 4C5AA 4ZC1A 3K2BA 1YQUA 3ZVNA 1N2GA 2I1LA 2DWCA 1FFXA 2EP5A 1YJXA 1Z6XA 1Z45A 3EEYA 3HNRA 4FSHA 4MGIR 3FR8A 4NOMA 3GRYA 3AX6A 3IQHX 3NKFA 4RPCA 4YJHB 5C8XA 1VYUA 4CKZA 1PIWA 4MJLA 3S2UA 3ZYCA 4BO7A 2XNJA 4ZT3A 1E1CA 3TNDA 2EC5A 4QJ3A 3ZE6A 3O90A 1TT5A 4NVRA 4AYTA 3DO6A 4FYXA 1QIHA 3ABZA 2QD1A 3ZU3A 5ITSA 3KVOA 3WGIA 1L7XA 1UXHA 1UQUA 1A0OA 1U7PA 2AW3A 3UAOA 4WBNF 4YV0A 1K68A 2HHAA 4UCQA 5G0SA 1FUYB 4XGNA 2OENG 4X95A 3NOOA 2FW6A 1QM5A 4NBTA 5C1BA 5C7IO 4QJBA 2IZOA 3ZV5A 2Z9BA 2QM7A 1Z06A 3M1YA 4R51A 3UMMA 4C0SA 3LW8A 1J56A 3BSSA 4RF5A 1D0IA 1GTL1 3GGJA 4TLBA 5DYNA 1ML3A 1N2CE 2WU0A 4LXYA 4F46A 1MORA 5L4NA 1WBDA 2J32A 1T3GA 2QSUA 3OCVA 4NOLA 5TC4A 4ENPA 1U0SY 1U0EA 4YRGA 4PO9A 3RVQA 5BV7A 2QK4A 1QPBA 3E5NA 3RSCA 2C82A 2HXSA 1TM4E 2DHCA 4M0FA 4ACBA 3AM1A 5DN6A 2ZRPA 3KJXA 2CLCX 3RYFB 2B78A 2VS1A 4QGGA 1I6WA 4YP9A 2HI0A 1U7OA 3RVLA 3WKAA 1ZD2P 1IQPA 2R87A 1U3UA 4QWWA 5AFSA 2HPZA 2IITA 4EARA 2PUAA 2FG7C 3OCXA 1ZU5A 3M9XA 3Q88A 2F64A 3A70A 2HDWA 2VHYA 4UUNA 4C7MA 4DMCA 2W2QA 1LPOA 4KUEA 3D8NA 2CUNA 3Q0TA 1AGPA 3UK1A 1L9KA 2O8NA 2JA1A 3DDNA 1NLUA 3NPAA 5L3QB 1E0JA 1V4VA 2VTDA 1QGZA 3PR1A 1A88A 3A10A 3EXEA 3GCGA 4BLTA 3FSRA 4TKMA 1R8SA 1NVAA 3SNHA 3UZUA 4OP2A 3TAUA 3HZRA 1QP8A 4PHGA 4TSFD 1LX7A 3F4BA 5CJ2A 5CH8A 3ZXIA 3LL7A 5ELXA 2Y0CA 2ANBA 4R2KA 4F3RA 1WF3A 1YR1A 1L4GA 3P9QA 1DWUA 4Q1FA 1Z15A 2VNSA 1E6CA 2HC9A 3IQZA 3DDZX 4B2YA 4KI7A 3D3EA 3EXAA 3GCXA 2CXNA 1REQB 1RWXA 2D8MA 2PU7A 5AJVB 2F9MA 4P81A 1JMKC 4LPKA 5BWNA 4ZI2A 3INRA 3NKVA 4BNKA 1UDXA 4MUGA 3RKRA 2IYQA 3TN7A 1RWBA 1V11A 4GBGA 2HWUA 1E6EA 4LDRA 3NJ4A 4MTCA 4JCOA 2NW6A 2QUKA 4BVKA 3FN4A 4NMLA 3L4BC 4QLOA 5IP5A 1ZAYA 1KQGA 4CF6A 5I7WA 3CKLA 1NV8A 3C8ZA 4BNZA 2GPJA 2G72A 1PFKA 3QUTA 4M1ZA 5IM4A 1B1AA 1N7GA 2IY9A 5K3CA 2LBPA 5EI5A 3KSAC 3LIIA 2FN7A 4HNRA 4NENB 2V7WA 4U00A 4PHCA 4XYMA 2QDKA 3AC0A 1B7GO 2C9CA 1P2GA 5IW8A 2SCUA 2X7XA 3REGA 2YJGA 4ILKA 5HXAA 1F9AA 5K3OA 2LIPA 4X6LA 1TCAA 1QAQA 2ZSKA 3A9TA 1JTFA 1SUBA 1U2DA 3BHNA 3JWPA 4RIFA 2Y93A 3ORRA 1QVVA 4RV9A 4D46A 2Q07A 2Y9PB 3F98A 3S68A 2HCJB 1JA0A 2QTFA 2ZGVA 5KYUA 3EGXB 3ZOZA 1A9PA 3AILA 5AW7A 4NXNB 3C5CA 1GUBA 1DUIA 1UEXC 1EUDA 4QGFA 1W581 5I51A 1A5SB 5KPDA 3KFLA 4CKYA 3OTGA 1OLOA 2FPSA 4LYHA 5ALZA 4YUVA 3I1FA 1ZNXA 2VDUE 3D9QX 1XN4A 4R2XA 1KXZA 4E5KA 3GP3A 1QG2A 2FPGA 3ZNPA 4CW7A 1Z2PX 2Q50A 3C1TA 3MWEB 1PNQA 1M2KA 1E2EA 3G9TA 1O4VA 3TJZA 4FYVA 3ZLVA 5JI2E 3NCTA 2N9UA 4K9RA 4Z4FA 2QPAA 1QANA 5AI5A 3L93A 3W04A 4WFQA 3OO1A 3QPWA 2HIAA 2JHGA 2RK3A 3TCNA 1M10A 3DG9A 2NX2A 1M1YB 1MOPA 1NRXA 1YC5A 2G40A 1XL0A 2WJVA 3FVTA 3U6KA 2WPNA 2AJLI 4ZAFA 4DADA 4FEEA 1AKMA 4RTSA 3V5NA 2X0KA 4LVCA 2X3YA 4O2BA 2RIRA 3GEGA 3H9QA 4QASA 4WXMA 4G0XA 4ZCPA 5TJHA 3EPHA 1V2GA 1D2HA 3M5DA 3WWOA 3OP4A 1XQ9A 1WY7A 3EGVA 1Q7EA 4DN6A 1KJZA 3AGQA 1P0FA 3DOEA 1MG0A 4JENA 5DNDA 3JAMA 4LF6B 3REFA 3HC7A 1ZMXA 3P52A 5M29A 2OORC 1QG0A 2MINA 1EFUA 1CUIA 4CZ2A 3NVDA 1QKKA 5I48A 4LHYA 2OOKA 5IKMA 1DQZA 2AOWA 4RV4A 3HZHA 4C22A 3ADBA 3UMSA 3KPVA 3HLTA 2TRSB 5JD4A 3ZBUA 1IAVA 1KIAA 1UJMA 1EGHA 2J6BA 4Z0HO 4FFSA 1DG1G 1MRZA 1PL8A 5KNCD 5U4XA 4GKJB 4CKBB 4D3ZA 5DOZA 1PQYA 4E1BA 4H4DA 1NI3A 1VLZA 3EZXA 3W5IA 2LCFA 5I9LA 2YCLA 2XCUA 3IS3A 3MM4A 2VP0A 4XOUA 1RXWA 2Q62A 5BVHB 3L1VA 5FX2A 1L3BA 1QYRA 2WEKA 3B8HA 1QHYA 2Y4NA 3FYDA 1OH5A 3RT7A 5G1OA 5KNBH 1M2GA 4A3SA 5F77A 2R60A 3O91A 4DDWA 4BGDA 4QYIB 3C4VA 2FPMA 4F5ZA 1HDOA 4REOA 1Q95A 4CIWA 4F3YA 4DZZA 5IVHA 4GU5A 3TQHA 1W4CA 1C2YA 3IV7A 1F0NA 3S1SA 2PX4A 2Y1FA 4OHWA 4GNKA 4I50B 1WNTA 3A1FA 1NW6A 4X3CA 4H6XA 1KY3A 4IIHA 5EE3A 1YS6A 3NDPA 1GTJ1 1N9ZA 3RUDA 2FN8A 4AJ2A 4PSCA 2CLKB 3PHJA 5A5EA 4Q21A 1XTJA 5JZ9A 3OCCA 4Q15A 3PYXA 3PYLA 3O1HB 2P41A 4FOLA 2XQGA 4GSYA 4L07A 4TS9A 1YE8A 1XL1A 3SX0A 3FNRA 1YCHA 4H1HA 4UVEA 4XSGA 2WKWA 2Y1OA 2ZAIA 1FYFA 1DXHA 1JDPA 1U2GC 1V41E 2I6GA 1HEYA 3LPDA 3O3OB 1FRNA 3R7WB 3HBLA 1AA9A 1D0VA 4ARIA 5DNYB 1E2MA 2G82A 2HMVA 1JLRA 3TZHA 2P62A 3HP7A 1RYNA 4XUCA 5B53A 1KDYA 1T6ZA 1YKFA 5TNXA 3ZWBA 3R9XA 2ZI3A 4HP8A 2B82A 2HGSA 3DBHA 4IHAA 5G1NA 3SICE 3TMAA 3FCXA 1DOZA 4Y8VA 1V1RB 3WSTA 3TLBA 2LD4A 1W36D 4IDEA 1RWOA 4INZA 4E5UA 4L0QA 1FB5A 2HMTA 3NALA 4IQFA 5AUQA 1AUPA 1M34E 1M6VA 5LQSA 4BP1A 4F1JA 3ZW8A 1XRNA 2I6QA 1CPYA 4OG2A 4RD6A 4CFYA 3FPAA 2C4UA 2B4QA 3F9IA 1C0LA 1T3LA 4JXJA 2DQ4A 2QXTA 3K05A 4XFKA 5G4KB 4RLFA 5GONA 3T5TA 5B58T 3OZRA 1PQUA 4B7ZA 3OQ1A 4AL4A 1IJFA 4RMNA 1P1HA 1ZFNA 4JP3A 4UU8A 2CHGA 4AUNA 2I1WA 1XYYA 2D06A 2OYCA 1N0WA 5BW6B 2VP4A 2G88A 3H42B 4M87A 3AUXA 3AK4A 5KOHA 1QHEA 2YV3A 1LDGA 3QFHA 5JSQA 1IEQA 4RJLA 2H52A 4DJJA 1D2RA 1T10A 1H6CA 3CB2A 1EA5A 2XUFA 4X3PA 1LBIA 3TJRA 3O47A 3JQQA 2V7EA 4P08A 1N5MA 2KM1A 3TE6A 3I4LA 3N8KA 4H1UA 4XDYA 5FUXA 1OLSA 4B6QA 1MUUA 4BP8A 4DLRA 2K2QB 1AUXA 4YACA 3O4IA 3CNQS 4LCBA 4BNMA 5A6SA 1C0EA 1NRJB 1UJBA 1JFFB 3PFIA 4A91A 5KSYA 1EBUA 3RUCA 1OH6A 1UBKS 2C92A 4MGHA 1I5OA 5EE9A 5JANA 2BELA 3CUTA 4Q4JB 4YT8A 3CSSA 2NXEA 2X9VA 4NMXB 2RAPA 4QRHA 3N2EA 5HE9A 4N5MA 4V0ME 1DEAA 2EP7A 4OHXA 3L8HA 3Q11A 3T15A 4L0DA 1NYRA 4WRRA 3TRFA 2CWDA 4HQFA 3QOFA 2A9KA 4URXR 4REQA 1KI3A 2Q2NA 3M1LA 1PEDA 3EA5A 3VDQA 3IJ5A 2DRIA 4G0UA 3V34A 1A9QA 3IJRA 5FQOA 1CY1A 4MRSA 2AN5A 3O8RA 3DLBA 2ZIFA 3N2IA 5B1YA 4CR6A 5IYZA 4RESA 3D6MA 4FK8A 2R6GA 2BZ1A 4IQ4A 3RWOA 2Z98A 4RDCA 3OY2A 4ONEA 5DNUA 4BJ5A 3R9XB 2CJWA 4OQXA 1FUEA 1SQ5A 5NULA 1EVKA 1LPAB 2EHJA 4D0RA 5KWVA 3PHHA 1V0JA 4F2HA 2RH5A 1L5ZA 2HHJA 1PX0A 1VGRA 1L7DA 2J33A 3BK7A 3H8WA 4DE5A 3MHTA 4D96A 3RQSA 3ITNA 1TZCA 5DYGA 1IU9A 1MHTA 3GJTA 3RH0A 4S3MA 2AI3A 4Z2AA 1L5YA 4NHEA 1YQGA 2QGFA 2HAEA 3DLCA 1X7GA 4LDAA 1MX5A 3NXSA 4KR6A 3JALA 4QXAA 2HCRA 1KDRA 1G63A 3VZSA 1I30A 1KZGB 5ER6A 3IP8A 3VNQA 3BKWA 4KI0A 4AJJA 1PFVA 3ER6A 16PKA 4WKBA 2NO9A 2PNFA 4CKCA 3H3XA 3USES 1OD6A 5LQJA 3BCSA 2YHUA 4N82A 4JI6B 3RCBA 2BCJQ 3SQDA 4PG8A 3GLFE 3EIHA 1DKQA 1I6LA 2Z4RA 4QHSA 3QPBA 5F4ZA 3RUAA 2O8CB 1GPJA 1Z4PX 3IEKA 1PT9A 4G1VA 4GPBA 2R6CA 1EVQA 3D1JA 2XTAA 3I42A 1RHMA 3LQ4A 4RENA 4E5DA 4J90A 5FBRB 4AUKA 1U0GA 3ZU4A 2HWKA 3UFBA 1MNQA 2VSYA 3FUTA 1PF7E 2HSZA 2FRVA 4MGEA 3EVFA 3EIFA 4N5DA 1PV4A 1FMLA 2Z8ZA 3OPXA 4TRMA 4WDQA 3UGTA 4EQ6A 2GEBA 4ZRDA 2I4LA 3PI7A 1P2VA 1NM5C 3MIZA 5A5FA 1YR8A 3BCUA 2YNMA 1HEIA 2CB0A 1A8PA 4X20A 3Q5GA 5AI8A 4PXYA 3G8DA 5JJLA 5DHPA 3CIFA 3KU4A 3DH0A 5EP1A 5HMMA 1TYEB 1Q3TA 1KSGA 4US1R 1KI2A 1TKRA 4XH9B 5GVRA 2EKLA 4CMEA 2ZDQA 3GCZA 4O6VA 2NZ2A 1NZFA 4O4LB 1T1SA 2BJWA 4L9SA 1W2WB 3WMFA 4XDHA 4E2XA 5KWJA 4Y1FA 1H2HA 2HZ7A 2YL2A 3CISA 2UV8A 5DWQA 4OMDA 1IBSA 2P68A 2X8BA 3GELA 1YVDA 4EW3A 1KBQA 2YXEA 4FZJA 3G8AA 1GCGA 4UQOA 2BMJA 3WXMA 4RC9A 5JI3E 4NQZA 4YCNA 1E7WA 1S2MA 3EXIB 2CDRA 5CP8A 1FMCA 3QPUA 1UJ4A 4EFLA 3WNBA 3ZNQA 4D98A 1L5SA 2VWPA 4HDMB 4YJFA 5C53B 4KL8S 5GINE 2WE7A 3CCFA 1XLUA 4AN0A 2WVAA 2DQSA 3CU5A 1KERA 1I4OA 4NARA 3V48A 3DE0X 2XWBF 1S2OA 4JLNA 1Z4NA 3K16A 3MWKA 4DCGA 3SQNA 2CXQA 1XP5A 4H3KB 1ZJ4A 4MLCA 3OD5A 4UE6A 4DSNA 2WKSA 1F0PA 1II8A 5L51A 3PWTA 5FFFA 4D3DA 4KKXB 4LC9A 1ZN8A 2O1EA 3KYJB 4N65A 4BC0A 4OQNA 3J80A 1AX9A 3PUXA 2JD0A 1H23A 4PEVA 4XVRA 5EESA 2Z5LA 2GERA 2DQZA 3K0AA 3VHRA 3L4JA 3N5KA 4I4CA 2JIBA 5H7XA 2QA5A 1XQ6A 2CVOA 3M9WA 4H1VA 4ZAWA 3WDKA 3GXOA 2NO7A 3BGIA 2ZWAA 3WYEA 3FNHA 4XWOA 2IYSA 2C2WA 4X00A 1SA0B 1Q1NA 3UWKA 1AF4A 4CTKA 1GPH1 4L4RA 5ALYA 1JEQB 1S1CA 2HU7A 3L0YA 3CSUA 3I5MA 3NI2A 1Q44A 5EKTA 1U8FO 4F93B 1S3SA 4PBSA 1FDVA 3HTXA 2GM5A 1NBMA 3ZWPA 1ZJWA 4HUQB 1KI7A 1IE3A 1I5RA 1PHPA 2A57A 1BWPA 5CB4B 5HF8A 5EJ9A 5LDDC 1E9BA 2E55A 5AKHA 3RRNA 4Q9DA 3PDJA 4PN3A 1EZ4A 4EG6A 1XHLA 3NAMA 4ARAA 5FEUA 4JBXA 2PX6A 2EFGA 4CV1A 2RHDA 4JLJA 5J1TB 1AK2A 1ZCJA 1EU1A 1JU9A 1QH0A 5GGYA 3V8BA 3BIJA 4I1VA 1Y33E 1W7AA 1EVIA 3BREA 1OAOC 1UBHS 2QNIA 3T8YA 3U80A 5B30A 5I3CA 3BFXA 2W6CX 2Z5VA 1JJFA 5F21A 3BDIA 3UY4A 2YWJA 1U8TA 5EERA 2R79A 3VHLB 1UIRA 2C78A 3FH0A 2OILA 1M9NA 3I9NA 5AHRA 3Q1LA 2FW8A 2XCLA 2Y68A 4PLPA 3CUKA 4RL6A 1ES9A 1SHKA 9ABPA 2WYVA 3G79A 4JJ6A 5JC1A 3JQBC 1VMDA 2JZCA 1IN8A 1VL1A 2UZIR 3OZBA 4TOIA 2Y1XA 1V5GA 3L0ZA 3DHWC 4LF8B 4HGRA 2I4OA 4FZVA 2H85A 3DAYA 1Y6ZA 1U1GA 4YRRA 2PAFA 5KNDH 1JIUA 1O5TA 2VQ3A 3VNSA 1VXOA 1ZCFA 1QGUA 4R2IA 4AY5A 3LZ6A 1D6MA 5GMOA 4IRXA 1J07A 1MXFA 2AFVA 5LP6C 4QSHA 4M86A 1XQ1A 3GIDA 1C9MA 4J1TC 5FRDA 3RFFA 3ED1A 4WVLA 1U2EA 2PWYA 4MV4A 3A3OA 1N1EA 1RWNA 3B20A 3QNWA 1WXGA 4TV8B 3H9GA 4Q4AA 3UHJA 5AVTA 3RREA 5IT9A 3IUPA 2QZPA 4CVNA 1EBFA 1PR0A 2QJFA 4MKZA 1E0SA 1DP4A 2YW2A 5I01A 1ZYUA 4I1PA 2P2ZA 4N0DA 2X7HA 1GV1A 1MO5A 3OFKA 1T26A 3T3MB 1OZFA 3EGWA 2D0OB 5G0TA 2VPQA 4FD3A 5ICSA 4EFMA 3CVUA 3MINA 2P2GA 1O95A 2QPOA 3WMRA 2QN1A 5FWXA 1V8PA 1ZK4A 2X8JA 1Z37A 3OLVA 1ZOIA 2DBRA 2O2YA 2W7TA 3WFJA 4AJPA 1IUNA 2W6MA 4PX2A 5TPZA 3BXPA 5BQFA 3I30X 5FHRA 2HDHA 1M2VA 1TQDA 1PJQA 1XRSB 3U7QA 2VWQA 3M5WA 1ZX1A 4CM6A 4XTRA 3QVOA 2IA5A 4H1TA 1GR0A 3ZZ0A 2CF6A 3G6KA 2IDMA 1HDCA 4PTYA 5CHYA 5E4TA 5KYNA 4L3OA 4P4GA 4DEYA 4KYUA 2QQFA 2NADA 4LFCB 2WD9A 2AB0A 1AZTA 1ZOPA 2AD5A 2AS0A 2VZ0A 2J41A 2XMSA 3IURA 4BU1A 4MAFA 3LDGA 3FCCA 3ZLTA 3VA7A 2FSHA 1J33A 1TT7A 3MNFA 4LF9B 1EVJA 1E18A 2P35A 3RFUA 3REQA 3C6MA 3K1AB 1XR3A 2ZQYA 2NT3A 2DQYA 5EFZA 5IHPA 4B43A 4S1NA 3FSEA 3QUBA 3WS7A 2O8FA 2AG1A 4PBRA 1XA4A 1ZEJA 3B1JA 1KS9A 2I3GA 3I76A 5SY4A 3WVNA 1K7SN 3DFIA 3WL3A 1V96A 2E4WA 3HJNA 3LCMA 4M8LA 2ZRHA 1ZS9A 4WHMA 5CIWA 1AKYA 5ESWA 1CUXA 2J1LA 2G28A 1KKMA 3P9CA 1DX9A 2GS9A 3JQGB 5ESRA 3SYKA 5JZBA 1GGHA 1AIPA 1XSEA 4H0CA 5HQ3A 2IQ5A 4XJXA 1W19A 2WW8A 1EAYA 3OZFA 2RDMA 3HCNA 3W8FA 3D2CA 3L6EA 2HTFA 3PGA1 4FJ0A 5IBRA 1V8OA 4PZZA 5LQDA 2BGJA 2C9BA 3DAPA 1G4HA 4C01A 1UF9A 4ZGWA 3O8OB 2D74A 4HRVA 4P6VF 1LDMA 4N40A 4X44A 5HSGA 1QO0A 1XYGA 1VE9A 1FTSA 1VKZA 2VJOA 3D3KA 4XDZA 2QQ0A 3ZQ4A 4BMNA 4GPAA 4IH9A 4TYNA 4L15A 3X1KA 2PJUA 3WXBA 1SY7A 1HX7A 3AEKA 3SBDA 4RCYA 2HFKA 1HZJA 2B5OA 3Q5EA 4O02B 1JQAA 3SWWA 3FRJA 2O5EA 4MIKA 1IZ8A 4HH0A 2J5XA 1EB9A 4WINA 2DU8A 4ZYXA 1QBGA 3UB3A 5K0CA 2GYVA 4ER7A 1B0AA 3THWA 4X1YA 1N2XA 5BSFA 2XXBA 3GAAA 1RAGA 3HKDB 3I5AA 1MQAA 4J1SA 2Y3IA 5IMBA 2WWTA 4PYQA 2VO1A 3TFQA 4B81A 4ABTA 1CY7A 3I12A 2FVXA 4D9KA 4YMTA 1GL6A 5DX8A 4CMAA 4FHEA 2XECA 3G9UA 3SS8A 2R62A 5CA0F 1FJ2A 4WK4B 1MCZA 1IM5A 4Q9IA 2D2XA 4UCXA 4CDGA 2XKJE 4DNXA 4QU8A 4RTMA 1R18A 5SZJA 2QW0X 2ZW9A 3M5PA 4RHFA 4BWGA 4ALLA 2I78A 4N76A 2Z43A 3V32A 2DHEA 1PI3A 2QAIA 2G6TA 4LZAA 1Z12A 3RSQA 4B6GA 2WPDD 1WW8A 2VCEA 2XPCA 4P92A 4RPHA 3I23A 4DCMA 2BH2A 1EX7A 2GN0A 4OHVA 5JNWA 2VP6A 2COEA 2OZVA 3K0EA 4LDZA 1KOLA 3NUQA 4EI7A 4UTOA 1X19A 1RM4A 2HA0A 2W98A 4P7KA 2XNHA 4LE1A 2ZSFA 3RJZA 4Q1CA 2Y66A 1NKTA 3PXBA 4FP9A 3QNUA 3ACCA 4RNDB 4B0PA 4DBZA 1EK6A 4DUGD 4ZCRA 3UFXB 1Q50A 1R16A 1OYYA 2OLJA 5F2NA 1SHUX 1C1XA 3G5AA 3FJOA 1EJ6A 3TW8A 4C30A 1U2SA 4WBXC 3DAFA 5GJBA 1L5WA 1E3LA 1T6BY 3GNTA 1UR5A 3IDSA 3GEPA 3D8UA 3W8DA 3NHUA 1N5IA 4NCKA 4ZZ3A 1UCFA 4MULA 1NJGA 5E2AA 4B4KA 3BMNA 1CD5A 1DT3A 1TQHA 2Q3CA 2Y05A 2AFIA 3D4OA 4D4GA 3T0IA 1FTNA 2H4ZA 2UUBB 1G5RA 4AW9A 1VIMA 4ECAA 4C3ZA 4UFNA 3HRHA 4AFNA 5BOSB 1IMJA 2R8ZA 2WIAA 2IHKA 1IQ0A 1KZYC 1CJSA 1XD8A 2F3QA 2QJWA 4LOJA 5P21A 4PN7A 3OESA 1J5XA 1A9RA 3VPFA 1Z28A 3QV1A 3LECA 3V1KA 3LZCA 4JV5B 3VVCA 1DMSA 5ALFA 1F3OA 1B73A 4IKEA 2J45A 2O48X 1IVNA 1EIWA 5BY2A 5EG5A 5JPIA 2J4DA 3SC6A 3OT4A 2CY0A 4IRUB 3FPHA 3G0DA 3DZJA 4FWIB 4WGFA 1V8BA 4YLEA 3HSYA 2PDAA 3DBRB 3UH0A 2JLYA 1HOXA 1E9EA 1Z82A 4JUIA 1RQNA 3QRWA 1XFAA 4MS1B 3D2AA 4UEOA 5DM60 2J3MA 4ZALA 4D02A 3VOTA 1Y8ZA 2QG9A 1VL8A 5BQOA 4Q48A 4LIPD 3EA4A 2PUCA 3AWDA 4C5CA 2IOFA 3ORSA 3P20A 2FWBA 4JMLA 1PVVA 4XX0A 3T5CA 2CFRA 2VHXA 2YV1A 3F5DA 2Q6VA 3HXOA 4M8KA 3U17A 1PJ2A 1Q7BA 1S1MA 1G6Q1 1NBAA 2F48A 2H00A 2QMOA 4NOKA 3K0FB 3P1JA 2JS7A 3HSSA 1RD4A 5KVVA 5CLLA 1X7ZB 1E32A 3GQBA 4MCJA 4N3BA 4O4IA 4PFQA 2PYZA 1WMDA 4IJVA 4ENWA 4FE4A 1OJ7A 4TYYA 2QTWB 4ED9A 3A14A 3CZ4A 3G6WA 4HXGA 3ZIAA 4H6WA 1KI4A 4JP8A 5IK2A 3DS8A 1QVWA 1K8ZB 1TMGE 1UZNA 3CBQA 3PUJA 1ZVMA 4PICA 3OX3A 2LKCA 4LSWA 1FTYA 4U2FA 5F2KA 4ZVUA 3ITDA 1RWQA 2EATA 5AW1A 2BGWA 4NCJA 3WNVA 3WGTA 1E3WA 2VUIB 3C74A 2IEGA 3M4YA 3OM1A 2HK7A 3OZXA 2ATCA 2AEEA 4P4LA 4ZTBA 2O8BA 1O97D 4EKDA 1YZHA 4BLSA 4JODA 2COUA 4EFNA 1PW5A 4G37A 5LXTB 4B6EA 2HU8A 1MO2A 2Q28A 4HZUA 3UOGA 1UMDA 3OOWA 4Q4HA 1LVHA 4PIPA 1DBWA 4TWJA 3EPKA 4TM8A 1TJ5A 3GLGB 2D1RA 5FF9A 1DCMA 1ZK2A 3MN1A 4BUZA 1VI5A 3T06B 2FPXA 1ZNWA 5HGJA 5TGZA 4DV3B 5ALEA 5B6JA 3KQSA 4BVLA 2V7PA 5KVQA 1NZDA 3ZWVA 1BKSB 1Z7BA 2QR3A 3WNCA 2HBRA 1WCV1 4H3HB 1GTRA 3W34A 1GPUA 1JB9A 2ASVA 2GCPA 3GPDG 1SHTX 3HVIA 3N8DA 3QF7A 1F4PA 4Q7MB 1B0PA 1ZI9A 4M6WA 3R0XA 3RG2A 2WJ6A 4AO8A 1TU3A 2PKWA 3DFFA 2X2FA 1YONA 2WJGA 4IRMA 3VDRA 2BEWA 4O33A 3UH1A 3OTQA 4YAWA 1OBOA 3GBVA 4KU4A 3Q7QA 3PRJA 2XDQB 4DLUA 4UM8B 1XZGA 4RGBA 2OVFA 2WHEA 5F2EA 4ZEMA 4I55A 1A5TA 2BR4A 2O2ZA 4D8WA 1JSCA 3KB6A 3DWFA 4JOSA 2X0FA 3RR2A 2PEYA 3SBXA 2A7QA 3MFYA 5I9TA 1E6WA 1X38A 2QUHA 3B7PA 3N1UA 1DBVO 4PAWA 2PS0A 1UKZA 2YN2A 3Q3CA 4HLQB 5T3UA 2GUWA 4WJZA 2AGVA 3FDZB 2XNDD 3ROXA 3U4AA 1I0LA 2ZVQX 4ESVA 2UXCB 3IMKA 4AMVA 1LSUA 4YUAA 2VHWA 2WA1A 2RCYA 2Z2KA 3II6X 3PJEA 3T9AA 3W3ZB 1F8XA 3NIFB 2ZI6A 1PGJA 1VMIA 2CW5A 3PP8A 4QULA 5ES3A 4DLXA 4TYMA 3MOGA 3KJGA 4PCUA 2BMAA 5DYYA 3WIDA 2WI8A 4JGGA 5A5GA 1XMPA 2JRCA 5IF9A 2ZTVA 3IKMB 1UJ5A 1YHZA 3GYGA 4XYEA 1FVXA 4LRTB 3JRNA 2JIDA 1P9LA 4ZVMA 4B4UA 4GPEA 5E6RB 5JYEA 3TO5A 4J0DA 1P1RA 3AIIA 4OIFA 5K3DA 1UXIA 1YVPA 5BR8B 2YY7A 3WWDA 4H6VA 2QMQA 3IAHA 4HN4B 4LOIA 4PXAA 1BVYF 1L5OA 3A6FA 3H2KA 4MVJD 3P0HA 3S99A 5FOUA 1SK9A 3OUUA 3B82A 4QYTA 1GAJA 2JKYA 3ZJVA 4M88A 3K0CC 2DM6A 3G0BA 3LLMA 2NUTA 1T0BA 2IXAA 1E3IA 1CRWG 3E4CA 3BQ9A 1OLXB 3P2KA 4YC7A 5EWJA 3G89A 4B4DA 5HZHA 3F6PA 3O95A 2AD1A 3K9CA 3T1QA 1XKXA 1BOFA 3A7EA 2E9SA 2PVCA 1Z8FA 2XA2A 4URHA 5AVJA 1EJBA 2GYUA 5CVTA 1WU8A 3IMEA 4C14A 4NY1A 3HN6A 1W73A 1Z68A 3PL5A 4UBJA 5LYYA 1TF2A 1PD0A 3OSZA 2DJ5A 2CE2X 3OE4A 3SC2B 3T9DA 4B45A 1GYQA 5K09A 3DV0B 1OQAA 5JUWA 2RHLA 4GLOA 3MAGA 2F43B 3FJ1A 5AJXA 2W42A 4IFBA 1CQZA 3KQYA 1BFDA 1RM0A 3VKUA 3BUSA 2LPMA 1EQUA 1JHQA 3C15C 4FZRA 3KB2A 4N9QA 3ZI4A 1TF7A 2AW5A 1CY2A 2VAXA 4HDQB 3KE8A 1DZIA 2NP6A 1ABFA 1M66A 2R5WA 1GEEA 3QELA 3H2YA 4B48A 4HBGA 1D7AA 1PSWA 4CR7A 3TDNA 2C3OA 3I01A 1XU9A 1V3VA 3K6SA 4CEHA 2IEZA 1VRWA 2JK0A 3T7AA 4BL5A 3VI3B 4N12A 1M1NA 3PDCA 4JLWA 3PLRA 2GHQA 4LVUA 1SOAA 2V55B 1BKDR 4UD6A 4D4HA 4DLYA 4IHJB 5FOVA 1YKGA 4JKYA 2A5FA 3SCZA 2OECA 3ZEIA 4ACAA 4DRXA 1X1QA 3OIUA 1GUYA 1L5NA 3AERB 1L5KA 1N6LA 4YO8A 1J0CA 4XM1A 3KSUA 4UARA 2IEAA 5C31A 2GTHA 2IYYA 1V7ZA 3DD1A 4AS2A 2EZ9A 1JDBC 2AOUA 3PQ2A 2FW0A 4QUAA 3BJIC 2GVDC 5E9JA 1RQ2A 5J3JA 3EVNA 4HL6A 1P8JA 2E18A 1P6XA 2VAMA 3V46A 3A0RB 3T1TA 4YH1A 1BDMA 1F38A 2PSHA 8GPBA 3F2IA 5AJWA 2NYUA 1S3IA 1YS7A 2OV6A 1S7GA 2PGDA 3EWNA 5IFKA 2FQYA 4KLAA 5LVAA 2PKXA 3UK6A 1SVLA 3OETA 1DFHA 4QRIA 5DLPA 3AHFA 2II6A 1P7VA 4XJVA 2BEJA 2OCYC 1X3SA 5C1IA 4HC4A 5JSZB 3JD1A 5F23A 4TKLA 1FDRA 1VDMA 4UNPA 3NNSA 3KZMA 5KINB 1O94C 3VR5H 1P7PA 1XNJA 3DW3X 3KYCB 4X7BA 3R0JA 1K08A 1R6DA 4D9JA 2ACKA 3HU2A 3UWPA 1QHHA 2QYTA 4KHPB 1T6YA 1VC2A 1YVEI 5ALGA 4DYVA 3I01M 3PC7A 3RJ5A 3MMZA 4BWFB 2Q1WA 4M0MA 4R1SA 5JCZA 1NR5A 3R3XA 4FBMA 5AJUA 1W88B 4XQCA 2JVIA 3SHTA 5ESDA 1NQWA 3OLCX 1PFQA 4FMCF 1NHGA 4L4ZA 3L7MA 4LJ9A 1SKBA 4PZEA 3DC7A 1TADA 4IJQA 4O2BF 1LV7A 9MHTA 3PITA 1AA6A 2ASEA 3BMOB 4C4SA 5G40A 3SI7A 4FFLA 2D2IA 1G8KA 3C43A 2RH9B 1Y7PA 1EWTA 3G2IA 3BH0A 2CLIB 3OURA 1TQ2A 3FRIA 5DXJA 5F35A 1JBQA 3QVTA 4UXJA 1DBQA 1FFXB 2ALJA 4I6GA 4R7TA 1EG2A 4EA9A 4MICA 1MAVA 2QL6A 2IYRA 2QVZX 1Y9DA 3EGEA 2C54A 4X54A 5BQ3A 2XGJA 1SKAA 2D2FA 2XDYA 5L53A 1NF3A 1E1CB 1J9EA 4RY9A 5ETJA 2VHUA 4JITA 3TW4A 1TT5B 4R1QA 2HRCA 4IX9A 4DOMA 1A76A 1Q0RA 3Q8MA 2DSNA 5FJIA 1AK9A 1JQLB 3ELBA 4FFVA 5CG2A 3ZDAA 5ICCA 2HDOA 1T1JA 4WJLA 2VHJA 3W2IA 4UATA 5G02A 3NDJA 3VJKA 4BMCA 3A3YA 3S8MA 4HS4A 3PNOA 5DHQA 3WLFA 3CE9A 2GGSA 1BKYA 4E03A 2VSQA 3QXCA 1Y4SA 3QVXA 3JWEA 1K27A 3FYCA 3I9V6 1RHKA 2JJQA 4RFLA 2VH1A 3T7SA 4KAFA 4DWVA 5CBPA 3T61A 3UMJA 2ERYA 4MPTA 4FUQA 3CH5A 3RS8A 3R0IA 2IPXA 4M1TA 3KQQA 3MILA 5CD9A 1VKOA 2GWHA 1P1IA 3IDZA 2HL6A 3A6HA 3RTGA 2FN4A 2ZYAA 3G0IA 3QTLA 4A8JA 3IPYA 4DUZB 1A5AB 3HEBA 3MJ4A 4R69A 4R8SA 2I76A 1RQRA 3G02A 1ZP6A 1GNRA 4F0JA 4YCCA 4DA6A 1Q0UA 2VQDA 4MWTA 4YRAA 1QK4A 2ZIWB 3D64A 2V96A 1R5JA 4R8KA 4AXBA 1R50A 4Q6BA 2W8ZA 3PC8A 4C4YA 3HQ4O 3A58B 3ETLA 4Q24A 3IAAA 2YIMA 5D86A 2NZ8A 4DKXA 4TMZA 4UD2A 5DNVA 2YR0A 1IIRA 4HH1A 4GNRA 2IXEA 3GL9A 2OD7A 4J0EA 4LRYA 4W7SA 2VHVA 3ON5A 2A1TS 3BBPA 3S2SA 4D6XA 5LPNA 1YQXA 2PS3A 3BSWA 1JB1A 3EXEB 3MMNA 3ZGOA 3CJTA 5HOEA 1PNTA 1FJHA 2VT6A 2WYUA 2TECE 2H4YA 4ZEVA 5CA1A 1ZR2A 2LXNA 3ESCA 4LGVA 3F73A 3CN9A 3RBVA 4TVOA 3EDCA 2ADOA 2WRZA 1KHHA 1R8XA 3WZ2A 1G59A 5DHRA 3V1TC 1GQRA 5F5NA 2D2VA 5JAIA 2IYWA 4W7HA 5IULC 1QZZA 1ZGHA 5TMBA 3PZBA 1CB7A 4Q4DA 3UK0A 4BMSA 3MJFA 3CT4A 1Q20A 5CUQA 1N1MA 3ZDZB 2FE1A 2Z1MA 4NV3A 2BDTA 2CD7A 2QAGC 3NTRA 4JUBA 4F9GA 3V2IA 1P4JA 1ISHA 1S8FA 1KEKA 4LJRA 5LLDA 1V3QE 1KAOA 2BDUA 3RE1A 4BNNA 4QFCA 1U5CA 1V11B 2IUSA 1YR6A 1HTWA 2YVUA 3SEZA 1C4OA 2VF7A 2AN9A 3ND5A 4EL5A 4AKIA 3E9CA 4CL0A 1U7WA 1VE3A 1Y1RA 4UBNA 4KYIB 1RP7A 4MO2A 2Y1WA 1TYZA 4G26A 1S8AA 5AVWA 3TJMA 1NQTA 2WYOA 4DIBA 2ZBGA 5EWMA 3IKTA 1E79D 2UYGA 4H27A 4IFIA 4RQAA 4U1RA 4U7DA 4D4IA 1E2BA 1YR9A 4IS3A 4R84A 2JVJA 2RHJA 3PI6A 4GBJA 5DU2A 1ZUIA 2H6EA 3FTNA 2B1IA 1P33A 3FUWA 4WLUA 4WOBA 3DXFA 4GXQA 3T7IA 3CRW1 3HZOA 2A30A 1Z83A 2DMRA 3JQDA 4G65A 5FR2A 3TPFA 3H5AA 4WL0A 5KYUB 5H9WA 4ARZA 2JGFA 2NZWA 5HRUA 4MYDA 4FNOA 4OLFA 3VR2D 4K9QA 4DM7A 4DMLA 3R3WA 3GRVA 3BMQA 1M6EX 2HQRA 4RLHA 3AUKA 5K3EA 4Q1DA 5IYZF 3MUOA 4HEQA 3RUPA 3GI1A 3B2EA 5J2UA 1VE1A 3JPYA 5CJJA 1KQOA 3A9WA 1L0BA 4BVHA 2OBNA 4AIRA 1AKNA 1I1HA 1N3BA 3WL5A 4EO4A 1XPJA 1JHXA 3NDIA 3ZJ5A 1RXUA 1OTYA 3C41J 4ALJA 4JLSA 3U4GA 1TO6A 2AEMA 1HKHA 1D8AA 4M1EA 1V16A 2FFRA 2WFMA 4AWXA 1V5FA 2WTEA 1ZXBA 3KSDO 3YASA 4TTRA 3CUVA 3OJFA 4MUKA 4Y2XA 3EVCA 3N5CA 3U7FB 2HLHA 4D1YA 1Y6QA 1GFSA 3NC1C 1FYXA 4GVPA 3JARA 2Z30A 4BGIA 1L5RA 1VIDA 1A72A 3MJHA 4HGZA 4IGAA 1VXRA 1ABBA 4D6PA 1YZ3A 4FKMA 4Q1BA 4OMUA 3HKCA 4U7PB 3UVEA 4HAYA 3G88A 2QTHA 4MGKR 2YBEA 4U02A 4RHXA 4IFEA 1T0HB 3CWCA 2NU9B 4J16C 5AVUA 1N3LA 1KDOA 1UJCA 1D6NA 1E1NA 4XWYA 2Z09A 2A33A 2G3YA 4I1IA 5E6UB 2XTJA 4RTQA 5KOJA 1ZUHA 1M0SA 1M1XB 1JDUA 2W83A 1P7WA 3OEEA 4PHHA 4WOJA 5B7PA 2GD0A 2VYFA 4DGSA 1TLFA 2NYVA 3D6HA 3CM0A 1QRDA 1VE6A 3CO5A 4XQ9A 3W7AA 4WN9A 2YJ4A 2CDCA 4YROA 4ZOLA 4PSUA 3WBFA 4EHNA 3W1WA 4BUJA 5BT8A 2I2CA 1GTSA 1PJ8A 2WIFA 1W4BA 1H65A 4L6IA 1VA5A 2VA8A 1QGAA 1HG0A 1JQ5A 2IEBA 4K6FA 4QIHA 5DCWA 5SZKB 1CUDA 2HCFA 4IDNA 4BUCA 2O0HA 1OSNA 1QH1A 2BFOA 2J09A 2YFHA 3CFYA 3LE8A 2H0RA 4JVOA 4TZKA 3FFTA 4J4HA 2HRRA 3PKZA 4IDHA 2K6GA 1QQ6A 1WZEA 4FE7A 4PHFA 1NSTA 3KOXA 4TM7A 2BRUA 3LCCA 2YBDA 1S8NA 2AXPA 4DLBA 4L8GA 2MWMA 4BMVA 4DXHA 3G2OA 1QFMA 3SC3A 1A4UA 2VJKA 2OV4A 2ZI9A 1HTTA 4NS1A 1E9FA 4UNIA 3RKUA 1A27A 4OFXA 1U31A 3QH4A 4Z1MD 3C8MA 3B1KA 1WVMA 3LFTA 4R4JA 3RFVA 3RC7A 4TWBA 4W5NA 1SPXA 4YBRA 3GGGA 3NT5A 2P2NA 4RJ2A 3TL6A 1A04A 4ANFA 2V7TA 1RRCA 4D92A 3IEPA 1K6IA 4Z4QA 5KNCH 1HLGA 1JR3A 1NR7A 2RAUA 3UHOA 1RRKA 1T34A 3VMMA 1U8CB 4K6CA 2G7ZA 4RX1A 4M7RA 2D5AA 1JG6A 1G0NA 3E3AA 3I37X 1WTAA 4GZLA 3TVTA 3FAKA 2XCRB 3RJ9A 2PQ6A 3GUUA 4UBKA 3RIHA 3I9KA 4Z86A 2AUMA 4BLQA 3MCTA 4QKQA 2QHXA 5B12A 5AMXA 5JSFA 5KJ1A 1E99A 4JYPA 3P4XA 5J63A 4BP9A 1RSZA 2BFFB 3IALA 4RTJA 1JDSA 4RGVA 1AXRA 3P9KA 4JH0A 3PNYA 2P91A 4KPFC 1XWWA 2JB9A 3V8NA 4C0JA 4C4PA 4J9UE 4Z5XA 4WLNA 1U6JA 2R7AA 4JR1A 3VH2A 3FWNA 3WLHA 4ZAZA 4GDFA 2ZUCA 1L5VA 3S8EA 1OAAA 3EIQA 3G17A 3AUTA 3D7KA 1YJCA 2VZ9A 5GONB 4B46A 2J0SA 2A0KA 2OVBA 3FOAA 3KS9A 2PWAA 1BXGB 1D2NA 2RB4A 2VP2A 1WCXA 2WOOA 2BF4A 4ABYA 1VSUA 2A92A 3DDHA 2JPDA 3U4IA 4ERNA 2CL6X 5LD2B 4C6RA 4OXKA 4BV3A 3KJIA 1ISJA 1ZM2A 3GGOA 1HFWA 3ZHXA 3C87A 4FGLA 4ZANA 3FPSA 3TLCA 3VHQA 4X6UA 1TOAA 1U8AA 4OOEA 4XD2A 4CGYA 5LQCA 1HZZA 3EH2A 3TRKA 4NK5A 1VMAA 3L0DA 1F5SA 2IF0A 3CF6R 3Q3HA 1UKEA 1OLSB 3QMMA 5JDCC 1K8RA 4B3MB 3AFIA 2QG4A 3NP7A 4NBNA 5KHOC 1TEVA 2C59A 2FXVA 1HDGO 3F96A 4KG7A 3TZQA 2BI4A 5K8CA 2BFPA 4DZTA 1LLFA 1T2NA 1QJ4A 3LA6A 4C4ZA 2XQIA 2HRZA 1C3VA 2YWCA 4AJEA 3C3JA 1OWPA 1KYIA 2ZJ5A 2ZUVA 2A5JA 2FWJA 6ABPA 4FNGA 4KH1A 3ISVA 1SUIA 4KPUA 1W5SA 4D9FA 5I45A 1Q21A 3WWYA 4R1OA 3A4YA 2XGSA 3FHLA 4LQLA 4D4MA 1P2DA 5C4GB 2XX3A 4YLGA 2AR7A 5KX5A 3UBTA 2H1CA 3Q12A 221PA 3RWMB 3BT7A 1J0BA 1KRWA 4I50F 2WTBA 4M8SA 5TVGA 3HWRA 4B8ZA 4U6SA 4HQLA 1E3TA 4KBFA 1MEEA 1T8SA 3E48A 4DLNA 4EOGA 2XBMA 4HYQA 5IT5A 1U1EA 3IRVA 3P9RA 1EQAA 5JO9A 3ORFA 1HH4A 2CJWB 4LV8B 4E2ZA 3NQ41 3FOWA 3GLHE 4H17A 1Q1BA 4PGFA 4XB6B 5JCJA 4O3FA 4RF3A 8ATCA 3P0FA 1OGJA 2X42A 4HAZA 5DTJA 1W25A 3L8EA 3PICA 2D7CA 4HQ6A 3DBOB 4N7RA 4UUBA 4XB1A 4X41A 4UC0A 3DE1X 2C77A 3ICOA 4HLUA 1T15A 4OL9A 3TLXA 5IPFA 1ZHHA 3BWBA 2RHMA 5JFTA 1Y98A 3JALB 4INJA 5T7BA 1K7YA 1G3RA 1MB3A 2WJ3A 4CKCB 4D3FA 2G36A 5HG0A 5I4BA 3OO0A 3F3YA 1A50B 1SCBA 1T5OA 2ZB4A 4D80A 1H6DA 1M2OA 1GPMA 4OQDA 1AQ6A 1PUJA 1TD1A 3LD9A 1K7FB 2AFHE 2NQ8A 1C7FA 4JYCA 4KPGA 3UJCA 4HLDA 1YOBA 2FG6C 2ZLBA 3SIRA 3KRTA 4EJSA 2QRUA 2X1HA 3R3UA 4B4VA 3I2JA 4ER3A 2HQBA 2Q5CA 1V37A 2I4TA 3JRXA 1NXPA 4KN5A 5IAGA 1VGVA 3ZCXA 4GM4A 5K8LA 3DMTC 1PD1A 4EQ6B 3DL2A 4OKNA 4DM4A 2NYAA 4D7AA 3OQNA 4R9RA 3KM0A 1QH9A 2QLFA 3AB7A 3ZQKA 4MUNA 1XCMA 2AF3C 5DT2A 5GY7A 4X20B 9LDTA 4RK1A 4BX9A 1SQSA 4ZYTA 3KG2A 1CQIB 1DIHA 1PEAA 2QZJA 4MKHA 1P6QA 3DXYA 4NNJA 5D85A 2R6FA 4RY0A 4ZQHA 1PWYE 4QU0A 4Q9LA 2Z3WA 4R1MA 2CSUA 3OQBA 2PRSA 4AJNA 3L4EA 1H8ED 1QRAA 4CM8A 2LVBA 5JBIA 4EO7A 2VPYA 1E6UA 4GZ3A 2Z6VA 2GJAA 5JLJA 1A5BB 4GE3A 1D4AA 4IUDS 4G86A 3AOEC 5BVGA 5F98A 4N8EA 3OZCA 3G2MA 3VFDA 3ROZA 4D4LA 1KJIA 1F17A 4A92A 4BFUA 7ABPA 3C8HA 4C0BA 3UQYS 4BTVA 3LVBA 2NM0A 3FLBA 3MMSA 2JIZA 2HSJA 3QUQA 4G1BA 1E2DA 5M04A 2HR1A 4YJFB 4ZN6A 1U9ZA 2AK3A 2PQMA 2QN2A 2CXTA 4Y0AA 2XLBA 3UAGA 3ZDEA 3FNGA 5DMHA 4KZPA 2XMBA 3N0WA 5DKFA 4HRXA 3RYIA 5JH7A 4NAVA 2JI4A 1U3CA 4GI7A 4GH5A 2Q7OE 1MQSA 1II8B 5H68A 5JJKA 5DP1A 3A2MA 4I5DA 1UC9A 3GO4A 4OATA 4RPIA 1VG9B 3DF7A 2AHOA 2JFZA 3LAWA 4BQSA 1PR3A 1SUPA 2V9ZA 2LDBA 2I22A 1N2OA 2R47A 3UT5A 1MX9A 4IOMA 4WMLA 1E66A 2R1TA 4RVHA 1TL7C 2G1KA 2OXFA 1IHPA 3BC1A 4H0NA 5HIIA 1VJRA 4EVIA 2FCAA 3SFZA 3LKVA 3OWHA 1UBMS 3SZGA 1ESEA 3S55A 2PIDA 4WOKA 1UDAA 1W52X 1Z0DA 3DTTA 1OREA 2FKAA 2R84A 3BZBA 5KYYA 4L8VA 2J3QA 5DSZA 3ZTYA 1TE2A 1U8UA 1WEKA 1Z74A 2IYFA 1RTKA 1TW2A 1EYZA 2MYPA 4X90A 2OGTA 3OU6A 3I73A 2BTEA 2H2HA 2IUEA 3LP8A 3L79A 3AEZA 4JXKA 2JLBA 5AI4A 3ZCUA 3QSYA 5DBEX 5H02A 4QLBA 4I3HA 4Y98A 4BV8A 4G8CA 2PCJA 4HADA 4DPKA 5A5DA 4AJ9A 3AESA 3GR6A 3BG5A 1Z4OA 2PKQP 2QVCA 4W5TA 1T1GA 3OZSA 2PJDA 4XKJA 3FMVA 1WZIA 2G70A 3UB2A 3K53A 3R5HA 1KF0A 2LTAA 2WOJA 4MCAA 1WRBA 3DF9A 1F8YA 4O59O 2GR9A 3MRTA 4EVRA 5JNRA 2O19A 3PR3A 4NJMB 5CJPA 1BX3A 1D2AA 1XA0A 2IC5A 2QUAA 4HWTA 4R7GA 1UAAA 2E4YA 1J0EA 2P4QA 3K30A 5EMNA 1WUHS 4G67A 4XGKA 4WFJA 3CHYA 3UK2A 1U94A 4WNCA 5AKZA 4WGGA 1S2DA 2W6OA 2MSEB 1YR7A 4JB2A 1F14A 3N6VA 3M6MD 2IELA 2WBLC 2QQGA 4PM4A 2OEPA 4YONB 3EODA 1XXHB 2EERA 1QB8A 2ZWIA 5IVPA 1TRKA 2X8LA 2ZRQA 2GPYA 1QZTA 4JFRA 1IEWA 1E2PA 3I8XA 1IYZA 2X0JA 2ZCVA 4JP2A 3ZWCA 4RA9A 1ZU4A 3TTSA 4XOIA 1UC5B 1J8VA 1SBHA 2WIJA 2ORWA 3QOYA 1MJGA 2GD6A 2XTZA 4D8UA 9GPBA 4YRKA 1FMFA 2HRBA 2YFQA 3FNEA 1U2TA 3OKCA 4OJYA 4EGSA 3UJ8A 3HCOA 3I8OA 2UAGA 3LX8A 1PJTA 2Z95A 2X23A 5FD8A 5ALSA 4FDUA 2FHPA 1O96A 4C4OA 5HRCA 3G1WA 3KCQA 1PJZA 3DL4A 3SMQA 1MB2A 3HYNA 4HS9A 3DOUA 4CMBA 4U0JA 4CHTA 4LAFA 1EB8A 1UBNA 2WE8A 2IZZA 2ISQA 4U7FA 3WGYA 3Q5DA 3EE6A 3NIDB 4ENSA 1GADO 4K9DA 3IGFA 3NUZA 5C8YA 4HDNB 4DG8A 3ONDA 4LCEA 5AIBA 3NVAA 4P7GA 2HO5A 3K2IA 1BXZA 1G16A 1PZNA 1E9DA 2QYHA 5IJAA 3ASYA 3FOZA 1WSDA 5FWXB 1FP4B 2X8JB 1CUHA 5JFOA 3HLYA 3JTEA 4IDOA 1EFHA 1LI7A 5JISA 2R86A 1TTPB 2Y8EA 1NBEA 3PVSA 3GDFA 4FWBA 4LX8A 4MVJF 1NF9A 5F1YA 3DOCA 3OF2A 4S1WA 1M2VB 4JUFA 1P77A 4XWGA 1NMXA 1K4YA 1OU0A 4LXUA 2I29A 4IF4A 5JOQA 3PFBA 2R8EA 2WWHA 4J3JA 4OQFA 4A0RA 2X8WA 4GMDA 3HCPA 4ZVNA 5MF6A 3OHPA 5KNLA 1VSQA 1TYBE 1JI3A 2B4RO 1C8BA 2IOHA 1PTJA 2GOYA 2QJTA 1P62B 3AV3A 4TXHA 3ZDRA 5J4LA 2RARA 3BRWD 3IE1A 1QDEA 3K09C 5J2TB 4ADSG 1A3CA 1D9ZA 4KQ9A 3JAWA 3REQB 3CX6A 3ZJ4A 2XNKA 2XZLA 4JOQA 3B9BA 1ZLYA 3HVRA 2EEZA 1E0AA 1E94E 2QD4A 4HOYA 4KX3A 4Q00A 2ACEA 1C80A 4IPTA 4YV7A 4ZI7F 1WB9A 4R01A 1YS2X 1YO6A 3I3SR 2G9QA 3PHGA 1BVUA 1GG8A 5K01A 2ECKA 5ILQA 3TSAA 4RKRA 4W4TA 4JBIA 5C3MA 4L22A 3U7IA 1PR1A 3ZQUA 1NASA 1ZNZA 5KKAA 2WU4A 3T3DA 4IZHA 3RU7A 1H9BA 5BSRA 1IOWA 4DIFA 4AY6A 3U9TA 2ORYA 5FBVB 4FYIA 1KARA 2O2HA 4JQSA 7YASA 1XZEA 1B26A 4RVOA 1I2DA 1WXXA 4MUEA 3UYKA 4EY4A 4RZHA 4C2UA 4Q93A 2HIHA 3UJ7A 1LPSA 2RGXA 1XJQA 2AX4A 3T5MA 1CZRA 4EJMA 2VYCA 3V7FA 3BRSA 2HV8A 3QK7A 4HWGA 5LKRA 1FNBA 3K8ZA 2X9LA 3MWDA 3LT5A 4IILA 3EAGA 2GZ2A 3BSFA 3TSYA 3WTCA 1EEHA 3T4XA 4A03A 2EFDB 4PZAA 3M6AA 4M0CA 4NI5A 2Q7DA 1F2VA 3WLAA 2F55A 5DNAA 1T3ZA 1U28A 4C2TA 4X1YB 1OTXA 4JNCA 4S2UA 4PFJA 2XT6A 4BZWA 2CK3A 4R5HA 5EVCA 1AQJA 1O9BA 3RC3A 4M1WA 4XPIA 4L4XA 2REOA 3SKVA 1EJ0A 2VZEA 1CZUA 1M5RA 2IQIA 3GMDA 4B0OA 4MKXA 3R5XA 1RJ9A 1X70A 1AD2A 1WF6A 2XKAA 1KFKB 4LY3A 1D1QA 3LQRA 3KZNA 4DMHA 5JTTA 4P35A 3EWSA 4TUYA 3IDFA 3IC5A 2B98A 2P3QA 1KQPA 5LKAA 4OREX 5HGXA 2AC4A 1J09A 2RBKA 3GT0A 2F9FA 1XQVA 3Q85A 1ZN9A 4BVFA 3LHIA 2YMQA 4D97A 1THMA 5EKUA 3IHLA 3P26A 4M9QA 1HPLA 4E51A 5B7NA 1SO8A 4I4TA 2VRBA 3OE5A 1I3OA 4QWMA 4W5HA 4OPMA 5HHTA 5CX1A 1TU4A 5DBFA 1MO6A 2Q1UA 1KDTA 4E6EA 2PLAA 3ILVA 3HRIA 1E89A 1LQTA 4YJGA 3ZK7A 2PVSA 4TRNA 4OY3A 3FWPA 5LIRA 1Z63A 1ONSA 2PH1A 2EBHX 3EFBA 5IRCD 3SF8A 4CBVA 4MMXB 4N03A 4BFVA 1QX3A 2Q49A 1JZQA 4OSEA 3W5JA 2QU7A 3H11B 4W8HA 1W0KA 4CTOA 1E1QD 4O63O 3OQIB 2JH3A 4HEHA 4R1LA 4K6GA 4QJ4A 5D7NA 1V39A 1ZN7A 4ARCA 3X2EA 3GJYA 1XZMA 1VYTA 2Q3JA 4PLHA 5JU6A 3KDSE 3CB4A 3FNQA 1N2IA 2OWEA 3BMNB 3H17A 4G09A 1WPRA 4HNHA 1R27A 4PGHA 4Q0MA 2I7VA 2AFIB 2ZYWX 3SAJA 3ZV7A 1LTKA 2XVAA 1KRXA 2QL5A 2Y0EA 1YBVA 5A2GA 2DTDA 4QBFA 4A7PA 1IDOA 3CTMA 2C99A 2F2TA 1HFKA 2VT3A 2O1WA 2CKMA 2WAYA 1Y5NA 4R54A 5TEVA 1JXMA 4LJ4A 4UU1A 3TR0A 3UUWA 4DSOA 3P2YA 4I9UA 1NXTA 1B3BA 3O8NA 1JUDA 1T9ZA 4MW7A 1BU8A 5C5CA 1KYQA 2H57A 4G4SO 4UCWA 4M9RA 3EISA 3TXXA 3FPBA 3LWBA 1RW4A 1QR2A 3B5EA 3CZCA 5CGQB 4YN3A 3R74A 4F45A 2O52A 3THSA 1EINA 5HZMA 2XMQA 5J4HA 3CRRA 4P0TA 2NMVA 4W1RA 1XZLA 3B51X 3R7AA 1U8YA 2P3OA 1L4MA 3N74A 2H7VA 3BF7A 3R7BA 5JS7A 4LQDA 1NJSA 2W8BA 1R0XA 4I81A 3ABIA 3H6HA 2WJIA 1CJTC 3D5TA 3JZIA 4C88A 1PE0A 4DQ0A 4N39A 3KX2A 3PTLA 4GP7A 1S4QA 2Y77A 3K0BA 4F9FA 4MVJI 5TLSA 2CFIA 2E0IA 4PAGA 4RTPA 3QVLA 3WRYA 3F97A 4QHYA 5TQ0A 3BK1A 4L9RA 5ITVA 5EZYA 5K05A 2YV4A 5ALLA 4CU2A 2EOAA 4AP9A 4JI2B 2PYDA 2NAFA 3G8CA 4YMHA 9ATCA 5IABA 2EW1A 2R6JA 4IJWA 4NIMA 4QOGA 3RV3A 4PPGA 1ODKA 2H1IA 4Y2VA 4URFA 1BDIA 4KPYA 4KRYA 1ND5A 3BL5A 4U6NA 4UVIA 3GQBB 1CUAA 5ERXA 2W2PA 1NY6A 4GUDA 2O7VA 2BFDA 3GUHA 4FC6A 2BBOA 4I08A 3QXHA 4OLHA 4S1VA 5B1HA 2B8EA 2WT9A 3M34A 3VZQA 1KSHA 1XT6A 4RXMA 2HMWA 3NETA 5AKKA 1D2CA 1NI5A 4PRZA 4KV7A 5EXXA 3T7EA 5TT1A 4PE5B 1NFRA 2PZBA 1GT6A 3AVTA 1OASA 4PZ9A 2VF5X 3ZC3A 2ZYIA 3PNVA 4U7HA 1FZQA 4YUXA 4HXYA 1XI2A 5D3ZA 5LCXA 3AKZA 1PT6A 1T3TA 3TZBA 1IH8A 2JFYA 1E3WB 2H5JA 1PJAA 1N34B 1ZC4A 1FRFS 2QENA 4TRRA 2R1VB 4JBHA 3A9CA 3C8UA 3ZR4B 2O8BB 1SKMA 3M4ZA 2CWWA 2DE0X 5F3DA 3W6PA 2XYHA 4R6WA 1UMDB 1W6RA 2CFSA 4OU4A 2I91A 3HN2A 3FE2A 4EJFA 1M34A 2IYZA 4PTLA 1L6RA 4GKBA 2F7SA 4UBLA 5CNKA 1EFCA 3URMA 4P3NA 4DSTA 2RGNA 4TT3A 2ZRFA 1YFJA 2IX3A 2B6HA 3RUIA 4C6HA 1QRUA 1EXVA 4E4TA 3PGMA 5I7HA 4R2WA 3U31A 5AM0A 3D6VA 4YAOA 2X5OA 3L5OA 4DDVA 2EZUA 1SG9A 2HK9A 4MPDA 4R1PA 2QL9A 3M1IA 2ZE7A 3CNHA 2ZJ3A 3BHMA 1WULS 5FBLB 3SLGA 4M6WB 5K1ZA 3HJGA 3VYWA 3DLIA 6ADHA 1C7RA 2HJRA 2BFEA 1JSLA 3KQUA 2BEWB 3GLUA 4JLBA 4UHBA 4EGQA 4MDEA 4KQFA 4TWAA 4F4CA 3QFSA 3VZRA 3LC1O 4NU6A 4Q4LA 1LI4A 1UT8A 1Q7RA 2X2EA 3MS4A 1MX3A 2DCUA 2J3JA 1VZ2A 4J0KA 4I55B 4R8MA 1Y6FA 4M8NE 4KR2A 3LZDA 1QMPA 2RCNA 1XB2A 1Z5OA 2HMUA 1AS0A 1NVMB 2J5KA 3HE3A 1FVHA 3PR2B 1T2UA 4J2TA 4XJTA 1SD5A 3LM8A 4HJRA 4YUYA 3S81A 3IL2A 1XTRA 1ISMA 1Y7HA 1GL7A 4IIYA 4X0EA 3DE2X 1JYFA 2QDXA 3NM5A 1BMFA 1UADA 1Y6GA 1QR6A 4RTLA 2YCBA 3QW4B 4YQYA 2AV6A 1TMYA 5EJ6A 3FHOA 3ILHA 4A9AA 3O2NA 2NO5A 3TBFA 1X1SA 5E3HA 4CV3A 4V0MA 4PG6A 3OPVA 4WK0B 3KEGA 4DVGA 3WK9A 4LZJA 4IVQA 2QRJA 1QV9A 3RQIA 4CLEA 4U2CA 1NFFA 1O6CA 1E2QA 3A31A 1JBKA 5T4HA 5THKA 5LM3A 3A3NA 5DGCA 4H3SA 3VSAA 3WWPA 1FS5A 1JWBB 4BX3A 3OKAA 4ZO9A 3SHFA 2HCTA 4CT0A 3E84A 4B7AA 1RAIA 3MQ4A 4PYMA 4RSHA 2QX9A 2YV2A 4JLVA 2G63A 1RABA 3EEOA 1H0KA 2BP7B 2YYAA 1LK0A 5B3KA 2G9UA 4PINA 4QUEA 1QK5A 2PWBA 3T1NA 1A4IA 2EGUA 2AE2A 1LEHA 1WXHA 3DFMA 3GY0A 3EGCA 2J5QA 1E3DA 4L75A 4GWKA 2GLTA 4E5SA 3CE6A 3PJGA 4MA0A 1IWBB 2R3SA 1LNZA 1SXQA 4KFSA 1DU4A 3CX4A 5FO0A 1PGQA 5KHAA 2B0JA 2P75A 5M34A 5EKSA 4BRSA 5EWJB 2HA3A 3NC4A 1SMKA 5LOVA 1WV1A 3WZMA 4BMPB 3TIVA 2AOVA 4F7WA 5A06A 5ISMA 5MHTA 1P4HA 4HCJA 2GM3A 3NBUA 1K7EB 4BAUA 3B1WA 2HUPA 4WCDA 2ZUFA 1JEYB 4GE0A 4CQNA 1DPFA 4K6HA 3HBJA 3N59A 4EW2A 1BDHA 2ZT7A 1FXSA 3DM9B 4BJ3A 3SX4A 2UXBB 3H1BA 2GZAA 3AL3A 2CLMB 3ECCA 3ZX5A 1VLQA 2A0UA 3NORA 4LWQA 2CNKA 3PYMA 3PNMA 4V0KA 4ZQCB 3G2LA 2W2MA 1DO2A 4BC1A 4CCAA 4YPOA 3BVPA 3ELUA 2YXPX 4BVGA 4MVJH 2QN9A 3AJ8A 1W75A 4A0QA 1TEHA 4OYHA 5EMMA 3X1XA 1DVRA 3D1VA 1R5BA 3ZLJA 4YMGA 3KSZO 1UOPA 3OM0A 3H8SA 3T3OA 1VBNA 5DPMA 4G6ZA 2FWPA 4LN1A 4EP1A 3MLBA 4A2CA 4ZZ1A 2CKDA 3GRRA 5AHOA 2J07A 4RJTA 3LYHA 2PBFA 4CEHB 2XI4A 1I10A 1YZFA 2O59A 4FFBA 1FDWA 4MRMB 3ANXA 3EVBA 1MFZA 1PR4A 1J22A 5C32A 2NWQA 1E96A 3M6VA 1O5OA 4S2EA 4DRXB 3LVQE 2H8KA 2RH4A 1KZ6A 2J5BA 4NTZA 4OO3A 2GDZA 5EXPA 1JQDA 1JXOA 1OFUA 1MKYA 2FU5C 3WAGA 4HK4A 1ZUNA 3GMIA 5CTAA 2P4EA 4CF4A 2CHEA 4V0NA 3ECAA 2IIBA 4BO5A 2C5GA 3IUJA 4E21A 4F9TA 1AVTA 1WKBA 1N8NA 1IATA 1N75A 1W4ZA 1WS6A 1XCLA 2D2EA 2F1IA 2WHPA 3MT8A 5JS2A 2B4KA 5FPQA 5A4KA 1S02A 2HSGA 3EH1A 3EXHC 4WE3A 4GVLA 2Z2JA 4HEA6 5ENZA 1G2OA 1WZNA 1OLUA 2OHJA 3FB1A 3K9WA 3KJQA 3OCUA 2X5NA 4FOTA 4JEHA 3SZOA 2FJPA 5EPEA 3F1KA 5BYBA 1I4EB 4IJMA 5FXMA 3H6GA 2FEPA 3RYCA 5EEHA 1MJHA 1V47A 1OE0A 5I8WA 2KS6A 4YI3A 4R31A 2BF7A 1O95D 2C7BA 2OR3A 3EZNA 1ST2A 3EGIA 1SXHA 3N86A 1YZYA 1HQCA 4MYCA 4YT4A 3L6UA 3QFFA 3IRUA 1RLOA 3EOZA 4HH3C 2HF2A 3DMDA