3OSZA

Crystal structure of the complex of proteinase k with an antimicrobial nonapeptide, at 2.26 a resolution
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
279
structure length
279
Chain Sequence
AAQTNAPWGLARISSTSPGTSTYYYDESAGQGSCVYVIDTGIEASHPEFEGRAQMVKTYYYSSRDGNGHGTHCAGTVGSRTYGVAKKTQLFGVKVLDDNGSGQYSTIIAGMDFVASDKNNRNCPKGVVASLSLGGGYSSSVNSAAARLQSSGVMVAVAAGNNNADARNYSPASEPSVCTVGASDRYDRRSSFSNYGSVLDIFGPGTDILSTWIGGSTRSISGTSMATPHVAGLAAYLMTLGKTTAASACRYIADTANKGDLSNIPFGTVNLLAYNNYQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the complex of proteinase K with an antimicrobial nonapeptide, at 2.26 A resolution
rcsb
molecule keywords Proteinase K
molecule tags Hydrolase
total genus 100
structure length 279
sequence length 279
ec nomenclature ec 3.4.21.64: Peptidase K.
pdb deposition date 2010-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 3oszA00
4OMCA 4NMXB 2QTWB 2IXTA 1YJAA 3TI7A 4HVLA 2WWTA 4CFZA 3DE4X 2XRMA 2HPZA 4MZDA 4KG7A 3DE1X 1C9MA 3WHIA 3QFHA 4ZOQI 1SCBA 2ZRQA 1SUCA 1BE6A 1SBHA 1AH2A 4C3VA 1UBNA 1GA1A 3VV3A 2Z58A 4M1ZA 5ARDA 3I30X 1SVNA 2DQKA 3UNXA 2PMWB 2IY9A 1THMA 5B1EA 2ID4A 1SBTA 3GCXA 4WOCA 1KE2A 5K7SA 2PWAA 1KDVA 2WUWE 1BFKA 2X8JA 2W2PA 1AU9A 2PQ2A 3DE6X 1P7WA 1BE8A 1P8JA 1BH6A 2W2QA 4KPGA 1C9JA 1IC6A 4I0WB 4DJ5X 3VV2A 3WQBA 1SBIA 1KDZA 1GT91 1IAVA 1TMGE 1EA7A 1TM7E 1TM4E 2GKOA 1YJBA 3DE0X 3DWEX 3SQOA 1S2NA 1AV7A 1BJRE 1Y34E 4OV6B 2W2MA 1TK2A 3PRKE 2ZWOA 1YU6A 3GT3A 5I9SA 1OYVA 3Q40A 1AF4A 2B6NA 2DUJA 1WMDA 3F7MA 1R6VA 3AFGA 4WOBA 1CSEE 3DVQX 5JXIA 1WVMA 2PKCA 1AK9A 4CFYA 1T1IA 3HJRA 3A3NA 1SIUA 2Z2YA 5AMXA 3QTLA 1DUIA 3DE3X 4CG0A 1MEEA 4H6VA 1Y3DE 1VSBA 4DWWA 1SH7A 1SPBS 2ID8A 1R64A 4ZARA 2Z30A 1WMEA 3DW3X 2DP4E 2PRKA 5JXJA 1HT3A 3EDYA 1JEAA 1GNVA 2PYZA 1GNSA 3BPSA 1BFUA 3H42B 2X8JB 2XTJA 1AVTA 3D9QX 2W2OA 5AVKA 1LW6E 1SCDA 3LPCA 1ZVKA 1OYOA 4AKSA 3BGOS 3QMPA 4KB5A 1WSDA 3BX1A 4NE9A 1C3LA 1KE1A 2W2NA 1Y1KE 1XF1A 1SBCA 3GT4A 4J94A 1EGQA 3EE6A 4LVNA 1Y33E 1WMFA 1TM3E 1V5IA 1SBNE 1C9NA 4JP8A 4C3UA 4DZTA 3LPDA 1PFGA 4Z2AA 5FAXA 2TECE 3DE2X 5FBZA 2V8BA 5JMOA 3LXUX 3CO0S 1AQNA 2Z56A 1ZVJA 3DVRX 1PJ8A 2WV7A 3I34X 1P7VA 1SIBE 3DVSX 3F49S 1TM5E 3F7OA 1NDQA 1T1GA 2HD4A 4B5LA 1SCNE 1TM1E 2SECE 1DBIA 3VTAA 1A2QA 3WIUA 1S01A 2G4VA 1SUEA 2SNIE 1Y3BE 1Y9ZA 3DE5X 3TECE 1V6CA 1SUPA 1GA6A 1GTG1 3CNQS 1OT5A 3WIVA 3I37X 4H6XA 1MPTA 2SICE 3DW1X 5FFNA 1PTKA 4LVOA 4H6WA 3TI9A 1SELA 4NE7A 5JXGA 4HX2A 3P5BA 5B1DA 3ZXXA 3T41A 3DDZX 4YN3A 3VSBA 1T1EA 1YJCA 1TECE 3L1KA 3VHQA 3DE7X 3VYVA 1GTJ1 1R0RE 1S02A 3AJ8A 1SIOA 2P4EA 4K8RB 3I2YX 4FONA 1KDYA 3Q5GA 3A3PA 5ARCA 1GTL1 4AKTA 5CW1A 2Z2ZA 3EIFA 1SUAA 3D43A 1TO2E 3AJ9A 2E1PA 3A3OA 1SCJA 1Y3CE 2ZWPA 3PTLA 1GA4A 3GCWA 5JXHA 1PEKE 1NLUA 5AQEA 2Z57A 1GCIA 4GI3A 1Y4DE 3OSZA 4OMDA 1CNMA 2SBTA 2PWBA 4RYDA 3DYBA 3LPAA 1SUDA 1NDUA 1Q5PA 2ST1A 4BWGA 1TO1E 1SCAA 2WUVA 3SICE 1Y3FE 1SUBA 2Z2XA 5AVJA 5SICE 3ZXYA 1Y4AE 1Y48E 1ST2A 5ARBA 1ST3A 1SN7A
chains in the Genus database with same CATH superfamily
4BNNA 3PNMA 1RWVA 1CUWA 4UQPA 4RYLA 5KREA 5JQGF 2Y0PA 5CEJA 1DCKA 1ZLYA 1XU4A 3L4BC 4I9FA 4QD3A 2XTMA 1RHKA 3R3HA 1XMXA 2INGX 1KZGB 1FYEA 4FR5A 3EPKA 1W8DA 3RCBA 1D2MA 1XZLA 2FZWA 3FNIA 1KHTA 4KQHA 1JYEA 2PUDA 4MVJF 2H65A 1J6UA 4BKPA 2EX1A 4Z4IA 1M8JA 5AJYA 4R7TA 1M3SA 2NU8A 4P86A 3U4GA 3P0IA 4HNSA 2V74B 3PF8A 1YCGA 4MGIR 1AB5A 1L9KA 3F74A 1WTCA 4I5GA 5LQRA 2QRNA 1N1EA 3AWDA 4Z4QA 2HJWA 4BU1A 5JIBA 3LU1A 3AHCA 5FUBA 3SFTA 1HLPA 1TJ3A 4GPTA 1A72A 4Y6QA 4LYJA 2OORC 3ACDA 5BPHA 5L9AA 1YFKA 3GMTA 2YVUA 1IBKB 2YZKA 2V3CC 4Q7LA 5FEMA 1DC7A 4MO2A 3G6WA 4QUKA 1YQGA 1CR2A 3P97A 1MABA 4MWTA 4KE7A 4B3BA 2CYBA 5T67A 4BE7B 4EHJA 1QO7A 2GUWA 1X8XA 4GWLA 3V3KA 2RB5A 2QG4A 3EY4A 4II3A 4JVLA 4XIGS 3WGIA 4RTSA 3QBJA 2VT6A 4CIYA 1ODKA 4M2LA 3HJTA 2VQEB 3KVRA 2VTVA 4UM9B 3PQ5A 2ATIA 4C2TA 1UQTA 2JH3A 2C4TA 4M1ZA 2ZEJA 2WT9A 3K5HA 2B99A 3GBSA 5HWSA 1H2ZA 5ARDA 4JI7B 2JHFA 4Q9KA 3SF0A 4RHTA 4GYJA 3NEAA 2OP1A 1I6WA 4H77A 3RGGA 2Q21A 4A0QA 5D2CA 4H7KA 1SZJG 5E7QA 1G4AE 2HGZA 3PF9A 4GGMX 2NU9A 3H1PA 1I4EB 3O4GA 4V0ME 1K66A 2XYPA 1NJGA 5FH9A 4EX6A 2CFTA 3R7SA 5JYDA 1BN6A 2WTBA 5JS7A 1FRQA 3JZDA 4AKGA 1A7UA 5IKPA 1I7DA 2W11A 3SHQA 1Y3IA 3T52A 4D98A 3OZTA 1B8UA 3ICOA 3F8TA 1QGOA 3JVEA 4ME6A 1C0LA 4XWTA 4O0LA 3A32A 3AO0B 2XWJI 2I4TA 3GVIA 1KEEA 5HP4A 1LFDB 3B1ZA 3CBQA 3SQDA 4OA5A 2D74A 2VJBA 4MYCA 2AJ8A 1KY2A 1NKVA 3HBLA 3O47A 1P7WA 3HZHA 3S6JA 4U3JA 2EZ9A 1PLJA 2X3YA 5ICMA 3U44B 4WZAE 4WT7A 2AR7A 5GV8A 2MINA 1E3QA 1PV1A 4ZVVA 2YV4A 1A5TA 3FMVA 1HLDA 1HMYA 3SBDA 5EKDA 3VV2A 1TTTA 4P82A 2QT1A 4FTWA 3BKXA 3FH0A 4FZ3A 5ENZA 3E0XA 3V4SA 1R4MB 1VG1A 4B2LA 3EVCA 4GLBA 1YTUA 2BFAA 3FLEA 2YXPX 3KFVA 3NYIA 4J0IA 1TVCA 2X8LA 1PT7A 4CDRA 1DCTA 2VJMA 4EPYA 2B34A 5CD9A 2B4YA 1UJCA 4FQ5A 2JCBA 4OL9A 4UM5A 3BMQA 2VCEA 3MWDB 1E89A 2AXEA 1VCMA 4PN7A 1JS1X 1GT6A 3GRZA 4D4LA 4PAMA 2OKCA 3IX7A 4MCIA 1S2NA 4RX1A 5JDIA 1YI8A 3ZCTA 4C6TB 1SC6A 5BVHB 1KZ7B 2ORYA 1Q3TA 4LPKA 3LT1A 4FILA 5FUXA 3T3MB 4HMQA 1K7YA 2H0QA 2ZIVB 5ALKA 4QRIA 2F2TA 4MS1B 3PR3A 1E0SA 4II2A 1GKLA 1E9DA 1I5RA 2ERYA 4R41A 3IR5A 5AIAA 3GGGA 1YBMA 4N8DA 3UA4A 3EWNA 3L6OO 4RL6A 2QGFA 2HDWA 1XXLA 1DV2A 1OI7A 3TIVA 2FMHA 3U4AA 1E92A 3VPBA 1QO0A 1PGJA 3NHFA 2O8BB 3Q8XB 4KP7A 1G7SA 1TO6A 2OZEA 1HT2E 3C3PA 4FOOA 2VHYA 1QHHA 5DE3A 4CF7A 4XE5A 1AKTA 2IUEA 4UVGA 1W5SA 1JAXA 1Z2PX 1G8GA 3LV8A 3NHKA 4N8SA 1R8JA 1F3OA 2HEIA 4OGGA 1ZJ6A 5FNVA 2C2ZA 2IV3A 1N4AA 5CCBA 4WY5A 3U7HB 2CL6X 2A3NA 4IICA 4LGMA 3HO6A 2I8AA 4RJLA 5U4QA 3RSCA 3VX3A 1Q1EA 2CNDA 2YZNA 1NZFA 3K31A 1Q7RA 3P4YA 4QO7A 4YRLA 4DKXA 4F8JA 3DGEC 1KOLA 1DKQA 3PQ2A 2KSQA 3HVJA 2CYAA 3QUAA 3A4YA 1UK8A 2KBEA 3B9QA 3M70A 1ZIDA 2ZLBA 2V8OA 2V7VA 4R1UA 3TSZA 5IJ0B 4OHOA 3D4NA 4M88A 3BHMA 4YCBA 1CVLA 3G2MA 5EXEA 5H3LA 2FY8A 2JLRA 5JAZA 1RJ9A 4PSKA 5BORA 4RPHA 5TMDA 1QIHA 4KPFC 2Y1KA 3QFSA 1KYTA 2G1UA 4UZFA 3U7QB 5I5GA 1D5WA 3CT4A 3QEKA 5H9VA 5P21A 3S5UA 4LC0A 4B8ZA 1Z37A 2JS7A 4R1OA 5J5AA 1YACA 4J4HA 1Y7TA 4QWWA 5CYPA 1DUIA 1YZYA 3WJ2A 5BUSA 4RV4A 2GF2A 2WU4A 3RO7A 1ZIOA 3TH5A 4KK3A 5ALNA 5K4GA 3NTLA 2TMGA 3EODA 4LVCA 1S2OA 4MWSA 4F91B 1LVUA 1FJGB 4ZVUA 3CLRD 3QRWA 2N75A 1KFCB 4V3CA 2NTVA 1Q7CA 1ORWA 2HY7A 1AUXA 2QMQA 3KOUA 4FS3A 3QJYA 1J49A 1Q7BA 3EYAA 2JGJA 1WXHA 3LZDA 4RKEA 4TTRA 4A8TA 4KR6A 1JB1A 4TVOA 1HNXB 3A6DA 3OZCA 4XWOA 4IX1A 3ANSA 4MGZR 1W4LA 3Q6MA 4Y98A 4D9EA 2CDBA 5LL6P 1VECA 3KZCA 1YQTA 1SULA 2VF4X 4HXGA 4XQEA 2VP2A 4KYVA 3A1WA 3BERA 1WXXA 1A7JA 1IHUA 3LECA 2AEEA 2C42A 3EZ2A 2PNFA 1QTIA 4V02A 1EHCA 3MMPA 1RPTA 3O74A 1ZO8A 2IV2X 3DLIA 3U31A 4TZKA 4BEWA 1GL6A 1O54A 2PZGA 2KMLA 4K26A 1X0XA 2AE1A 3GT0A 1WUKS 4G01B 4LC9A 2WD7B 4WZAA 2MWMA 3VJRA 4FMDF 4W5HA 4D9NA 1CUAA 2YCBA 3CE9A 3M2TA 5A4JA 4IFEA 5LDGA 1RLUA 1OI2A 3GW8A 3QXJA 2Z04A 3AYXB 5B37A 3SR0A 4CLOB 3C2QA 4DMGA 3E4DA 2XQFA 3MRXA 1T6YA 4R2LA 1E6WA 2P2GA 5HIMA 4ZHQF 4Z4CA 1SVOA 1UM9B 4R2WA 5ALEA 2E0IA 4YUZA 1PG2A 1IOVA 4AJNA 3EGXB 5DWVA 1Z0KA 4PZEA 1BOOA 1S2IA 1TW2A 3O8CA 1JR3D 4IKPA 1IHYA 5BV1A 3BEOA 4BO1A 4PHFA 4L5YA 5IU6A 4YQZA 1Q7TA 3GT4A 5KTSA 3FM9A 5MGBA 1NQWA 1J8FA 4AF8A 4LHXA 1D2GA 3CLUC 1KYQA 1ZG3A 3NOQA 2UVPA 3PE4A 4ZAGA 1O89A 4Z5XA 3WWCA 3JQGB 3L4BA 1U11A 2ZRGA 1Z0JA 2WICA 1WU8A 3AK4A 3I2GA 1US8B 5K0LA 2JD1A 4N3GA 1EFRA 3VPAA 5ALSA 1RE1A 4D82A 4P08A 1ZCAA 3LE8A 2G5PA 1W0KD 4RZSA 3TPCA 3VQTA 2VH1A 4OPMA 2V8BA 2HPAA 3LY8A 3SSNA 2HOQA 4WCFC 4BVGA 2QVCA 5G4LA 2J6CA 1KVSA 1GCGA 2JAHA 2CHUA 2UV8A 4HRXA 5ALRA 1NVGA 1PVDA 1X94A 3UUEA 5LD2B 4IIJF 4BKMA 4K9KA 4NULA 4ZT2A 1CQIB 3RAGA 3CISA 1JP7A 1CFJA 3Q1KA 4FCWA 5EWLA 3HTXA 1E6CA 3KAKA 5FL3A 1BWSA 2GM9A 3AUTA 2OORA 3TTYA 4R0VA 1D9ZA 5EWMB 1LPNA 1MV8A 2KWIA 3ECCA 3QUBA 4D9JA 4FD2A 1T2UA 4EY6A 4QUHA 3CKMA 3T61A 2FN9A 1P45A 3ORRA 1L5QA 1VPWA 1BRMA 1TM1E 4L0CA 1KA9H 1CCWA 2FZEA 1W76A 4LY6A 2HF2A 2YHSA 1DO8A 2SNIE 2WYHA 4HDKA 4N5HX 4FKBA 1K8YB 3KE8A 4JVOA 2VLBA 1YZ3A 4K81B 1XK6A 2VSNA 1LFAA 2ETXA 4PPGA 4OGLA 3A6EA 3LBFA 4YAFA 4TGLA 5DU2A 2Y71A 1E7QA 4JEMA 1PJBA 4P33A 2PKRA 3QMVA 1RMYA 2CUKA 2C9MA 2COEA 3RSOA 3OA0A 4OAPA 5ECDA 4YGXB 5LBTA 4BCCA 4TXMA 3GP8A 3GQBA 1ML3A 2JCXA 1F8FA 4EEKA 1II9A 4Q9NA 1IY9A 3HYCA 2Q6IA 3QOYA 1KSGA 2C7RA 2O8EB 2AN4A 2PFSA 3G2JA 3ROPA 5IF9A 1QV6A 3KR2A 4XUEA 1V25A 2IEAA 4OHPA 5HIJA 3TLZA 2ROQA 4URVR 5BNIA 1K2VN 1NBHA 4EA6A 2CZGA 1E1DA 4NMLA 3ROKA 1YHZA 3VXKA 2VOEA 5DKFA 2DWCA 3QA3E 4L7QA 3A4MA 3VDRA 3RABA 2I2FA 1OX6A 3FWPA 2I2AA 3RADC 1HQCA 4X7MA 3K0AA 4F86A 2OHXA 1FTGA 4WPGA 3LYAA 3L8YA 3WISA 2XCIA 5DNAA 3PQ6A 4MUHA 4BL5A 4BN5A 3V7WA 1KRWA 2PSJA 4B7ZA 2XWPA 4BNYA 5DZSA 4XJXA 2FFHA 5ITZA 2O8VA 4R2XA 5IYZA 1AUQA 4WVLA 4C3ZA 4DIMA 2XD9A 1A9XA 1DAOA 1DBRA 2IHKA 4UU0A 5ALXA 3PB3A 4HQ6A 4QXAA 1RC0A 3FKJA 1AZWA 3KYIB 5ALGA 1OGJA 3ZGVA 4DCCA 4LECA 2ZZKA 5KYXA 1UK9A 5FPTA 1OFGA 3ROZA 2IU6A 2FNAA 2PR7A 1EK5A 1KIMA 4IYRA 3UFXA 5LN1A 1R5OA 1CRWG 4IHQA 2PVCA 3KZVA 2JDIA 4I99A 2QL5A 2ONYA 1YE8A 1E2FA 1QFXA 3D8UA 4IJ5A 3Q41A 4TRJA 3MTJA 1XDZA 2VS1A 3OCYA 1TRHA 3BF8A 2Q2QA 1B1AA 1N2IA 3AETB 2QLMA 2Y05A 3BHIA 2ECOA 3ZIAD 1XJ0A 2CWDA 1VC2A 3EJ6A 3PDUA 1A1SA 4RE6A 5H81A 4R05A 4LOJA 4ANFA 1PWZA 1L4KA 1N0VC 3L0CA 4U2KA 1OLSB 3ZLVA 3Q8WA 1AS0A 4ZDKA 1Z2NX 3GEHA 1VHWA 3N05A 2QTNA 2QL9A 4E2YA 3EIFA 1SUAA 1YTLA 2QXUA 4C0SA 1MQ8B 1TT7A 3DDCA 4HS4A 1YR6A 2NM0A 5HTOA 3RVLA 3F3SA 2V7GA 3DO8A 2VTKA 1BROA 3EZXA 4XDGA 3OBIA 4RACA 3ELBA 2PT5A 4I66A 3RJ9A 1Y81A 1H4SA 5JC8A 2ZI4A 2VHCA 1CRQA 4NF2A 5EOVA 1S2DA 2GSWA 4KJXA 2VXCA 4FMCF 2CLSA 4YAEA 1ZNZA 1QP8A 4MJ7A 2IT1A 4HBZA 1VDMA 3OICA 4YJGA 3TI7A 1U5CA 1Y8RA 3A8TA 5AW1A 3JQCA 1JLHA 4FQ8A 4LXGA 1KMHB 2XECA 4P8RA 1I2ZA 5CJJA 2IPNA 3M5DA 5EKSA 1G4HA 3OZAA 1Q6YA 2PKXA 1J7KA 1FP4A 2BFBB 3QU7A 3SIXA 4BFWA 4DEVA 4DREA 5B3KA 3IE1A 1QHSA 4WXEA 4AUKA 1KQPA 3ETDA 2MIIA 4LYDA 3RBAA 3HBFA 2RCYA 2PWZA 5THKA 2NO9A 1CYEA 2H92A 5BSVA 1PG0A 3GN2A 1ZICA 4S35A 1VL0A 5HPYB 1PJ4A 3OSZA 4RHEA 1T9KA 4RPCA 2RGNC 3VH4A 3QEBZ 1LPMA 1XP5A 4J03A 2EFGA 2PT9A 1ULHA 1E2IA 2AZDA 3DVLA 3H9UA 3D81A 3ORYA 2VSFA 3HWRA 4E3ZA 3FCXA 3EFBA 4OXKA 4JV5B 4D9IA 1Z7WA 3ESBA 5GONA 4MWCA 1NDHA 3EXFA 3W1EA 3ZD8A 4DLWA 2WK1A 5U9CA 1VLHA 3PXUA 3R44A 5K8UA 4NJOA 4AJ2A 1I7PA 2RJ3A 3VPSA 3L4KA 4P0PB 3U0VA 4HGRA 3W6NA 4B3FX 4A8PA 4B3JA 4YP7A 1O7JA 2Z5GA 4L28A 4EYKA 4ECAA 4JYPA 4M22A 1UXKA 2GMWA 1U0HC 2RH4A 3UJAA 4FT2A 2OK8A 2VP6A 1XD8A 1MH1A 1C30A 1Y4AE 3OWHA 1Z25A 3PCRB 4ER7A 3EZLA 2AWOA 4B9AA 4J1NA 3F6RA 1D3AA 3ICWA 4D8TA 5GZ1A 5IJZA 4PNHA 1MEJA 1UOPA 1SUSA 2KJQA 3DBHA 1WCIA 1PR3A 3F46A 3GAMA 1HT1E 2AEMA 4HD8A 1LF0A 2JEZA 4RJKA 1OXUA 1XRLA 3JQ7B 1FIUA 4D9MA 1REQB 1BD4A 3CX3A 1X1EA 3WL6A 4FC6A 1VL6A 1Y7HA 2LR0A 3PK0A 4MUGA 3NM4A 1IY1A 5JC1A 3WBBA 2X13A 1SUIA 1R12A 3AUSA 3FLBA 4AJJA 3VSAA 1K6JA 2A0FA 3FDZB 2FWAA 3AF4A 4I6EA 2YY6A 4S0XA 1Y6ZA 4Y2TA 3TEJA 2Y0BA 1YDHA 3TTUA 4EYQA 3BIJA 3CLTD 2B8JA 3PEVA 1VP3A 1X80B 3AHDA 3KUDA 3L7IA 4BFXA 3H19A 4RHFA 2Q5JA 1K3FA 3C7KA 4WZZA 3V7NA 3M1IA 5J43A 1P9RA 1Z7BA 4ATNA 2UXDB 1IWPB 5DHUA 4D4MA 2BGKA 1MO6A 4JUCA 3N0TA 4OGWA 5JCOC 1P91A 1PS9A 1SQ5A 3AQIA 1RAGA 1ZOLA 1PJSA 3FVQA 3HJHA 3PYMA 1H3FA 4L3WA 2DWQA 4XQGA 2AYYA 5I4BA 1QU2A 3EVZA 1J1UA 3E82A 3M4NA 3OUTA 4JEHA 3NHJA 4XW2A 5LSAA 4QECA 4U6NA 3WHIA 4L27A 1XQYA 5CK4A 3UA3A 2B4AA 4JU9A 1DJNA 2J1LA 4KWIA 3MTIA 3DVAB 3E15A 4HP8A 3ZWXA 4DIBA 5E7MA 1EHYA 1UIRA 3NAQA 3FNBA 1V9CA 1WP4A 2AX4A 4YAIA 3CF6R 3KAPA 5T4FA 4EGJA 3SBXA 1KO7A 1KJYA 1UJ5A 3H4IA 3SEAA 4HNAB 1V2HE 1XB2A 4XARA 3OQIA 3FSRA 3D02A 3WLQA 4WCFA 1CUIA 5EQTA 1WKCA 2I6TA 2OCDA 1NXXA 2H08A 2W00A 3BHNA 4UDXX 1DPGA 1I0IA 2O2IA 2PY6A 3CC8A 1U5AA 2J41A 5EESA 2XXAB 4OUKX 4FYPA 4Z9AA 4HLDA 1K9VF 4A5SA 4ETNA 1SHZA 2ZYIA 3AB3A 3AFOA 5K4AA 4F3TA 2OD2A 4A10A 5AHRA 4ECEA 1S5PA 1XTPA 1VSTA 3W2FA 4YCMA 4JOCA 1ISJA 4L6CA 2G07A 3ZCPA 1UMDA 1B7GO 2PS9A 1Z2CA 5A06A 2WFLA 3OAAD 4I1PA 5A6SA 1NI5A 1VI5A 2RGBA 2HWKA 1F06A 4YAWA 5DMHA 5EINA 2ATEA 4ENQA 1M5UA 3AI3A 1NI3A 2Q50A 2W2LD 4A2WA 5ERXA 4RY0A 4KUHA 4TUYF 1P81A 3JQFA 6NULA 3FA2A 2MSDB 1WXIA 3MQ2A 5GM2A 5JUWA 5B36A 5AM4A 3F6CA 2DKOA 2WWWA 3PGVA 2I6SA 5EJ5A 1DXOA 2FF5A 1EFUA 4YCNA 1FXWF 2Q7DA 2XDWA 5JBQA 4RMGA 1Y5IA 5CA0F 3SHFA 1NF9A 3MS2A 1KEKA 4FGJA 2EFJA 2RBEA 3ENKA 1QYVA 3MTBA 4LDZA 4ND8A 3SMQA 4OLBA 1Q7GA 4KQJA 3SM3A 1CVRA 3H2JA 4BMNA 1XTBA 3ICCA 3EAFA 2ZRPA 1OE0A 1QH8B 4Q7EA 1SBIA 4I4IA 3WHLA 4TS3A 1NGSA 1EP2B 1THZA 1ULAA 3FAKA 1V3UA 2HWYA 4BXOA 1LUAA 1PDVA 1V5FA 5HXAA 5G1OA 4MR9B 3UEOA 5ED4A 4QYTA 4PFKA 3PHGA 5CX4A 4TTJA 2P4QA 3IULA 1E4EB 4F11A 1TM4E 3T5AA 2DPGA 2GWHA 2OLKA 2HM7A 3NPMA 4FDLA 3K6SA 2HSJA 1CDEA 1G1AA 1GYQA 4HI0E 1RT9A 3SQOA 2I2XB 3V3TA 3OLVA 3GYBA 4BQRA 2CMFA 4XD7A 2BD0A 2VHQA 1Q83A 2WLTA 3TDKA 3VOSA 1A9YA 3K1AA 3FOWA 3KSDO 4M1SA 3OO1A 2G40A 5J59A 4CPDA 2OZLA 3P0FA 2QJOA 4F6RB 5KU1A 1NYLA 2R4QA 2JZOA 2QHXA 3MINA 3VKHA 1P80A 2HCBA 1JVBA 4XPIA 1O8CA 4D41A 2HA6A 1XN1A 1L7RA 1JL3A 2WJWA 1LJUA 2BUCA 4X45A 3T34A 4EFNA 2YZMA 4MQ4A 1SAYA 5FPHA 3WLEA 1PYOA 1WCWA 3TGLA 1BKSB 1DRWA 2XOEA 3TRFA 2AQIA 4GEKA 4MRNA 1M66A 1JIJA 1OW3B 3I76A 1G64A 5JHHB 1HE3A 1Z26A 2VDJA 4G84A 1OSNA 5CAEA 3TKLA 1F9EA 1AQUA 1AS3A 2WTAA 4JMLA 4JMPA 3RRBA 4YYEA 2RARA 1V1RB 1XRNA 1ZM3A 4UDYX 1OQAA 2I4NA 1IK6A 5ES3A 3UTCA 4HDRA 3QU2A 1R9NA 4XGKA 3F5QA 5TPWB 1RM4A 3W8DA 5IMBA 4EG6A 3PJDA 1SO8A 4O2LA 3MB5A 4WKNA 2P6UA 1A9ZA 1TC2A 4PFQA 3WWDA 3ZK7A 4YLYA 1G63A 1FSGA 4QE3A 1P3Y1 2G7ZA 4HCJA 5EHNA 3VSEA 4RZXA 3W2IA 1GG9A 1TVKB 3GMDA 4RMNA 4XM2A 3UQZA 4E6PA 3STWA 3ZWYA 3FXAA 2CNBA 3T3GA 1LSOA 2NQTA 1C1XA 3EGOA 3RRFA 1VBNA 1VE6A 1PL0A 3L8ZA 3PE6A 2XMZA 3FPKA 3E84A 1BHSA 5CIWA 2GN2A 3M5CA 1KBQA 4KCGA 1OWOA 5LR6A 1V9LA 3LTNC 4L4ZA 5DT2A 4EUHA 3QW2A 4YAGA 1E98A 5DM60 1V45E 4L5IA 1E6EA 2AI3A 2CHFA 1YRYE 4KX5A 1DKMA 2NSDA 1W6RA 1FLVA 4CETA 1Z17A 2ZM5A 3I2IA 3HHEA 4PQGA 3W5CA 2FEOA 3PR2B 2VK8A 2DR2A 3VPGA 2EBHX 4ZVRA 4ZC1A 4P38A 4TVBA 2XEDA 3EX7C 1O94C 2GCPA 2HRRA 1NQVA 2NTYC 3DV0B 1ABFA 4OKSA 3OFND 3VTFA 1NG9A 2ZR8A 2PD6A 3SBOA 1PEYA 2XB8A 1JFRA 3Q0IA 3STUA 2AKAB 3BA1A 3JQ8A 1TMKA 4YALA 4DIUA 1ZKMA 2FGKA 1SOUA 2O8FA 1C0EA 3EDYA 2ARKA 3JZAA 1WX1A 5FLKA 5CXQA 3AHFA 1Q0HA 1ZOOA 1AZSC 1TEVA 2ABWA 3BQNB 2PJZA 4XX0A 4E4RA 1B42A 1JEAA 1NMZA 3HB1A 4HRYA 2PYZA 1GSAA 3TW8A 1TLTA 3BPSA 2RGNA 2QTGA 3TVYA 3ER9A 3HXKA 5LMZA 3VHXA 2NVOA 4E1AA 1G5QA 3GZNA 2V6BA 2G09A 1Z13A 2PPVA 3CRW1 4MQEA 3ZD6A 4YASA 2R00C 1O5TA 1IQRA 2VPIA 3OLZA 5T7BA 2ZPUA 3B5JA 4NZNA 4RSMA 3U4MA 4ZQGA 3M4JA 2YX1A 3LXXA 4D25A 2QLTA 1PRYA 3GJXC 3GFSA 2P30A 5KU7A 1AXGA 2GDJA 5LXTF 3IEIA 4GBED 4K6KA 5E1OA 3KG2A 5A3RA 3GV0A 1QORA 2X86A 3BGOS 3C97A 2JI8A 3R5KA 2XUPA 4MIKA 3NRJA 3ESQA 4POAA 2N46A 5A71A 5CB0A 3RIMA 3T4EA 4FBLA 3WKDA 1KU6A 4RTRA 3FE2A 1EX7A 2I7CA 4PC6A 2C9BA 1X8KA 2YHAA 1MAAA 1CZRA 1GDDA 3BB3A 3MM4A 4FYKA 1SBCA 4W99A 4WOPA 5DJ5A 5F21A 3TNFA 4RK4A 3VX4A 4WLVA 4D6PA 1D6NA 3UH1A 4NZZA 3FPGA 3NM6B 5IT5A 1TYBE 1V1JA 2WJIA 4FT4A 4YCSA 5IUKC 3PQ4A 4MX8A 5F35A 4A26A 5K8JB 5DCLA 3WR5A 4R1PA 3UKDA 3EVDA 4IFTA 2OILA 4YQEA 2BLNA 3TZHA 4HRVA 2BH9A 2D2VA 2FP4A 2GN4A 5A3QA 4FSHA 1D0VA 2OCGA 4MJLA 1MN6A 3QSGA 5FAXA 3N8IA 4Q1EA 1KERA 1A2KC 1SCUA 4NBUA 4TS1A 4ND7A 4WWHA 2Y0CA 4KL8S 1IIBA 2RAPA 1D1SA 2Z83A 4MUMA 5A03A 2X4IA 1QYWA 2GK7A 2Z1NA 1WS6A 3ZI0A 1L7OA 2JRLA 4LIPD 4PZCA 5JISA 3ABSB 4X64B 1X15A 3I34X 5GWXA 2DBYA 3JZIA 5TQ2A 3RS5A 1JPNA 5JCOA 5KQLA 3JQ9C 1NJ1A 4PXSA 2OK7A 3O3MB 1YAJA 1UBKS 2CF6A 2YQ4A 3F7OA 4H15A 3TOXA 4YJKA 5AI9A 5FI1B 1WKBA 1T1GA 4G3XA 1BO6A 2ZIXA 1BVRA 2OXIA 4GOND 4C21A 5JNTA 3KAQA 3H2SA 2TSYB 1OBHA 3H0CA 3HGMA 2H54A 4P4LA 5F2KA 5BW8A 3PRYA 2YXLA 4X71A 5LVAA 4L5JA 2CKDA 1S01A 2ZUTA 3PQ3A 1E20A 5FA8A 2ZS9A 2AD5A 5BW5A 3RFVA 3DSRA 2YY5A 3EG5A 4WX2B 2W58A 2WTUA 1QAQA 4DVJA 2DQZA 1KKUA 1RJDA 4MAMA 3KZKA 4JNCA 1JG2A 3BE5A 2I80A 3CU5A 2BEUB 3ZU4A 4HZUA 2IL1A 1G60A 1N3IA 2PA3A 2ZQZA 1CZHA 2OZVA 1TNDA 2X1VA 5G0SA 4BOYA 5BMVB 1J9ZA 1QR2A 1J9GA 1QHNA 2O20A 5E3HA 3OJ0A 1X6VA 2XNSA 3RYHA 3PUJA 2FWPA 2P2SA 2H4YA 2FW9A 2G25A 2Q2WA 2VYFA 3QMWA 5LJLA 1VSUA 4JITA 1C4WA 2BMDA 3W5BA 2J48A 5EP2A 1OX4A 1MTZA 2CFRA 3FRJA 4JJFA 3UZUA 1I1QB 2MSEB 3NT5A 4P36A 1BJTA 2QXTA 2VDOB 1H4VB 2XPCA 1QK3A 1U04A 3WHKA 2PUTA 4IGFA 1OXXK 2IF0A 3TFWA 4H6WA 2AOTB 2A5LA 2Z9CA 3OU7A 1H0KA 3OEWA 4D0NA 3QVGA 2H1LA 1MPXA 1PK9A 3M6WA 1TPZA 4L4YA 4Y0NA 4ZQFA 4AK9A 3ED5A 1ZU5A 4M9ZA 1TYAE 1D04A 2QMEA 3A1SA 4WXYB 3SOZA 1JHAA 1EU1A 2QE7A 2GASA 1MIOA 1JEYB 3TW4A 5BQXA 2R8EA 3CVOA 4IHJF 4RFLA 5MFZA 3TTVA 3IAM1 4Z8XA 5C8YB 1NRIA 3B5IA 1CR1A 1ML4A 1JDVA 4X85A 3D64A 4MW6A 5B3AA 2RC6A 4PHTA 1JKJA 3ON5A 3E9RA 1UPTA 5HSGA 2V65A 4OJYA 1JDPA 1YQQA 1U6IA 2FPGA 2WSMA 1H94A 4JK3A 1DO0A 3U49A 4YRNA 3OF5A 1PWXA 4RTJA 4Q9LA 4YO7A 2BMWA 2CE7A 1RXCA 4I6JA 1LNZA 3AW9A 4Q9JA 1LBHA 2FE1A 4BGEA 4MUJA 4FQ7A 4YP9A 1SOVA 4LW8A 5HOEA 3QVTA 4CEHB 3VNUA 3IALA 2K5UA 3U62A 4AVYA 3HUUA 4FONA 2QX6A 1QPBA 3WJ1A 3HJBA 3EQ7A 10MHA 2JIZA 1IG0A 2PPLA 3WLLA 3Q5GA 5LMUB 2RJOA 1FSZA 1QBKC 3CTPA 4MVJE 3QF4A 3D6UA 1XK7A 2C3MA 2HU7A 4PAOA 2FW8A 1QHEA 5JE8A 2PX0A 1JMKC 3EGIA 1BW9B 3FHJA 1CZUA 2CF5A 3NCHA 4RZ2A 3W1WA 3VU1A 4DC9A 4G63A 2OC9A 4Z1OA 1AK2A 4P7KA 1UKYA 3NI2A 2NYUA 1W35A 2MR6A 2ORWA 2GBGA 2E7ZA 3I0NA 3I2JA 3MAGA 3PIIA 1BMQA 5DT9A 3CLKA 5TPZD 1O8BA 1K3UB 4EYOA 1FFXB 2HLDD 1GM5A 2O2YA 3RTCA 4W7SA 1K5DA 4FNMA 4EK9A 3C8MA 3GPBA 4FHCA 3EQ6A 4CDNA 2JGKA 3NXSA 4K9RA 2A14A 2WI8A 4Y0VA 1GFWA 5HDBB 4BRWA 4FCTA 4LSZA 5HDQA 5ICCA 3HGQA 3I42A 3QHAA 3MRTA 4JN6B 1CR4A 1DIBA 4WY8A 4DRXA 4IDNA 1L3IA 1W36C 1HDRA 4NPHA 2W43A 2VPPA 1BOFA 3FSJX 3JX9A 5KNCA 1E69A 5KTTA 2O6HA 4LOHA 1GCUA 1YSCA 1A5BB 2XNHA 3WYGA 4CCAA 1Y6GA 1PU2A 3OLWA 3M1YA 1NKTA 3USCS 1O9HA 1WDLA 1E5DA 4Q00A 1GUZA 1L5RA 1VRWA 1XROA 2ZUFA 4MPDA 4GE0A 1ZJYA 3NC1C 4RYDA 2VVTA 5HGJA 5I9LA 3QWHA 4MS3B 3NW9A 4MKIA 4TYWA 4R9RA 3RC2A 4OUDB 3CZMA 4OLHA 4FM9A 2ZJ8A 4CMJA 2XI4A 3NH6A 1G8MA 3H5NA 4NJMB 4M7OA 4WBNB 1QYRA 3ENQA 4HDMA 4I55F 1HRDA 1U6JA 1UC5B 4YJ2F 3L7JA 2R66A 4EG4A 1W52X 3MJ4A 1EH5A 5JHGB 5JY1A 4CE6A 3OKPA 4OK3A 1AKVA 1JJVA 2EX0A 3U1VA 1O94A 3ZE8A 1KMMA 2F8MA 2Z3ZA 2A84A 2WIKA 3BFPA 3P2IA 1HSZA 3AR2A 1NLYA 2GBPA 2LBPA 2OFWA 2WM3A 4MLCA 4D96A 2HJHA 3OECA 1OFVA 5ECWA 4D42A 3D6HA 5G1NA 2I22A 1X7WA 3HNRA 4J3JA 3UGTA 4DV2B 2G80A 4EY3A 4GIBA 4ODIA 4G5XA 4CMGA 3V55A 2GPNA 3ONFA 4RE5A 4ZEWA 1HSOA 3QEMB 3UAGA 3X0DA 4INPA 1ZRNA 2Q28A 3EXIB 1WQ1R 2JFYA 4P3NA 4WINA 3DHWC 3O8RA 2BHTA 2QBYB 1YJAA 4PLZA 1M74A 2IP4A 4OIMA 2R00A 3L18A 4UVIA 1OI4A 5C4MA 2EAUA 2P6OA 3SP1A 1XHFA 2BY4A 2P9CA 2O3JA 4LI0A 4DG5A 3OF3A 4HVLA 4JR1A 1B8NA 2BE9A 2WWTA 3L7AA 4OSEA 1YOBA 3IUNA 1VGVA 5AJTA 4K6MA 3BL8A 4ZVNA 3IBFA 4OM8A 4ALLA 1XDWA 3N2IA 2B83A 2OHOA 5BN4A 4UULA 1NXOA 5JAMA 1QNFA 2WAAA 2WHXA 1WIWA 2HPZA 1A76A 5T3UA 1PLKA 3SKXA 3EEIA 4OHRA 2GDZA 1WWKA 3PPYA 3GMIA 4IEIA 3R6DA 5E6SA 3JYHA 1GRVA 4U2GA 4Q0MA 2OY0A 5JYCA 4HB0A 3ZW8A 1TEXA 1UAYA 2BBTA 3OOJA 4HAXA 3TXAA 4KKVA 1FQOA 3AY7A 1M5RA 4C6HA 1J00A 3EGCA 4YJHB 1X14A 3IODA 2GCOA 5K4HA 4S2UA 4ER3A 3RC8A 3Q3VA 4CKEB 3L6EA 4EBFA 4BDSA 3WQQA 2YC4C 3AF0A 4MVJA 5EJAA 3OCCA 2ZJ5A 2FDRA 1EGHA 3SD7A 3ZDQA 4CIVA 4JNKA 4MVXA 4EJ0A 1QFYA 1WSAA 1J23A 4XPZA 2NVUB 1VHJA 2BM9A 5E38A 1COWD 1D2AA 3EFOA 4B80A 4BFVA 4EHFA 4PANA 4EWLA 2FR8C 1N0IA 2SKDA 3IIIA 3KD2A 1KO8A 1V7QA 1Y89A 2F1OA 3KJFA 2DQ4A 3F9CA 3L1IA 1F2TA 1OMOA 2FMTA 1GGKA 1P7PA 4L15A 2PT6A 3RVMA 4BNJA 2XRZA 1Q7EA 3Q6NA 1ZIYA 2IQIA 2QMHA 4P53A 4MGHA 3ICVA 1PR9A 3I64A 1K92A 2OR3A 2PR2A 4E4YA 4EKEA 2WF6A 4F2HA 1SUWA 3JQ9A 4JLKA 1AURA 1X9IA 1W19A 2HSGA 4HWGA 4WOCA 4CBVA 4E2WA 4PONA 3L84A 3TLJA 4Z49A 2XOKD 2RHLA 3HCWA 3A26A 1XDSA 4PC2A 3G89A 2Q5QA 2CXNA 3UMYA 1XO1A 1DSSG 3CNNA 4YAUA 4R9UC 3QYJA 2XGOA 1MENA 4G9BA 4LNUB 3IT2A 4UTXA 5DYGA 5IKXA 3OT1A 4MRRA 1VYHA 3C3WA 5FYQA 2HQRA 5CDUA 4TWIA 4UOZA 1QLHA 2QRMA 1XTJA 1XYGA 1RYBA 4CN9A 2GD2A 1BYUA 3GRYA 3NDRA 2REQB 1A2BA 2HMVA 3IE0A 2UZ1A 1K97A 5JMTA 3BUSA 4ALMA 1L5SA 2C5LA 2NGRA 4K40A 5JPCA 3ECAA 3D1LA 3N76A 4Q4AB 2RAFA 4AKIA 3AERA 3UW3A 3W8EA 3C98A 2YCLA 2PJRA 3L6BA 1O6GA 2RDMA 2Y27A 4YVFA 3WO1A 2NAPA 3BKWA 1NL3A 1UZLA 2DJIA 1P18A 1WR8A 2AC4A 3LUDA 5EUCA 3EPLA 1G41A 3RC3A 3T1HB 2IOYA 4Y2PA 5I48A 4JUAA 3MWGA 5KIAA 1WB4A 4LCBA 2H06A 5EPEA 3DE0X 1UFQA 5KTYA 3I62A 2FEMA 2WVGA 4LHZA 2V7QA 1W6UA 2B3TA 3QPCA 4KN8A 2VWQA 4ADSG 2ALJA 3ZQ6A 5EPUA 4D9CA 2GN9A 4KVZA 4D3XA 3R4VA 1X9GA 1GZDA 1CY0A 2IKSA 1KTIA 2EFEB 3KXDA 2VZEA 4K6FA 3VR2A 2UYGA 2Y1WA 1FYDA 1Q74A 4EKDA 2YJGA 4HPXB 4XDZA 7REQB 5KYYA 1FW6A 5K05A 4HN9A 1CJMA 3IVXA 3O95A 1J2EA 1ESMA 3B9PA 3B6MA 4ER6A 3AVUA 2I8CA 1FX0A 2B21A 2CLKB 2Z4SA 1L5LA 3HDVA 2CSUA 2KQUA 2V9ZA 3AGPA 4XIYA 3L9WA 4TMFA 3THXA 3SHVA 3Q8LA 1LW7A 1II8A 4Y2VA 1JZQA 3HKBB 1R16A 4H18A 2FXIA 1R6VA 5J2TF 4UU7A 3C8UA 5TQJA 5FBLB 4XD2A 2BFPA 4O4LF 3AFGA 3LWBA 4OGFA 3P8ZA 3FDFA 2A1TR 3G8YA 3AKZA 2O5CA 5CPBA 1WEKA 1GHTA 3OTHA 3CPEA 2OFPA 3PKJA 3SPXA 3HFSA 2Q5CA 4MHSA 2E37A 3BS4A 1JLMA 3C5WP 3L0OA 3TL3A 4IH4A 3EEOA 4EOGA 4K9NA 2WKWA 4JL5A 3ZZNA 4WACA 4DLSA 2OYCA 4IJMA 4TSRA 3GLIA 2WHPA 1B8OA 3V2HA 1DE0A 1WG8A 4CFYA 1C50A 5KJ6A 4LFAB 2OUKA 5FQNA 4G24A 4JGGA 3X44A 3DYVA 4W6QA 3EPPA 5AVOA 1OILA 2V7BA 1FBTA 1DT3A 1LB1B 3WB0A 4RIGA 4JLJA 4EHLA 1LTHR 2C8LA 1ZBDA 3RS8A 3RT1A 4GZ6A 3L02A 3VFDA 3TD6A 3GLVA 1PQWA 5FDFA 3JRXA 5FI5A 5GQSA 3ZJVA 1AKNA 3H4MA 1G20B 2JKVA 3F78A 4JOQA 5CNJA 1IVSA 2F4VB 1JQJC 4ZV4A 4OFZA 2ZAIA 5DYIA 3LC1O 3NORA 4UE2A 3UHPA 3ICEA 2I9PA 2OHFA 4O4JF 1NN1A 1XZFA 1U3VA 4XLTA 4EI2A 3TFOA 5GIPE 3D3NA 1N3YA 4GOKA 1V0JA 3L6CA 4P3KA 3JQAD 3N8HA 4B45A 4H16A 1P2DA 3C1UA 3MMNA 3VNAA 3H9CA 2DP4E 4QOFA 1H8ED 2VOJA 3BE6A 4A91A 1OH7A 4GT1A 3O4FA 4Q7MB 1E2KA 1W4AA 2A1TS 2FEKA 4Q03A 1U2PA 3HZZA 1JEJA 3D0QA 3EIEA 3QKSB 4FNGA 4HB4A 3KJHA 3L0PA 4V0OA 2ZAMA 2AYZA 2O8NA 3TUIC 2AYXA 4AJHA 3ZHSA 3TX2A 1XKQA 4YCAA 1GNSA 3OFSA 1JEOA 4IXNA 4KN6A 4ZGWA 5K8LA 2BUBA 4KXQA 3V8RA 1GILA 3P26A 3QJGA 4ZXFA 3BD7A 4P6VF 3ZDRA 1JGTA 4FNAA 2ZYRA 4DDTA 3VR4D 1AQLA 3KL2A 2IYUA 2EG5A 2WZCA 3F4LA 3ZY3A 2ONZA 2C2OA 4Q34A 1G21A 1LW6E 1UANA 1J33A 1QIFA 3VO8A 1X1AA 4XX1A 2HK7A 1J5XA 1BQEA 2WPDD 3F0TA 4C29A 3GL9A 5ICEA 5EFOA 1BS1A 1XN4A 3QU9A 4JOSA 4WY2A 2A92A 1U2GC 3IDQA 5KPDA 4YCDA 2P2ZA 1AS2A 4LQLA 1QYCA 3P4XA 1IJKA 3KZXA 2HAEA 3T38A 1XAJA 2GNPA 3TMKA 4D56A 3HPRA 1WSDA 1VI6A 1ZKDA 3IC5A 3H75A 3KEGA 2BF4A 5IFKA 4ZC8A 3KO8A 5KSOA 4V39A 2C2HA 2GBIA 2NSYA 2WU1A 1WMSA 2BISA 1FSPA 3CVJA 1JYSA 1O1YA 2C96A 3GOHA 2CBZA 1C8VB 5C7LO 5D1NA 3V4VB 1XEFA 4B4DA 2H7CA 2NTNA 1Z12A 2HSZA 3IIEA 1K89A 2QD2A 5BW6B 3W3AH 2GM4A 1XBTA 4A8JB 5ITVA 4R2HA 521PA 5D01A 3DXZA 4NYMR 4N0EA 1SKQA 4X00A 1TA0A 3GB9A 2Y67A 3IJRA 3Q0TA 4QBFA 4RJJA 5IBQA 1RPNA 5JVDB 3U3DA 2JD0A 1O0SA 4IXMA 4ZHQA 4IMPA 3W9UA 3DH0A 1LQUA 2D5BA 1ZGZA 3N6XA 4MQUA 1TAHA 2NNLD 3P45A 4LXYA 4WFJA 1U63A 3ZU2A 2XSZD 5C8DA 3C87A 3KQQA 1ECGA 5KNLA 2Q6TA 1C3VA 1SOMA 3G9ZA 5EZSA 4B6OA 1BMFD 4I1UA 1G8SA 2JGDA 1ARZA 5JG7A 5K99A 1AKMA 2NYVA 1JZTA 2OCLA 3KZOA 1T3GA 2HLPA 1R0WA 1SIBE 3DVSX 1EM8A 5HOQA 1E3WB 1K7FB 4R1QA 2B3DA 3H3JA 1FXUA 1H2YA 1UMCA 2HFJA 1WV0A 1R0KA 4YLEA 4W82A 1N2CB 4H1HA 5TNXA 4ARIA 2QPAA 4Z4EA 1E77A 3BD8A 1DOZA 4EGQA 5I8PA 2ECPA 1SKBA 4KI0A 3T3NA 3WIDA 3EIUA 2JFFA 3VR6A 1F4PA 4QUBA 1XNQB 3BQ9A 2CJFA 3KCNA 2BMEA 5AVZA 2X9VA 2BFWA 1OFUX 3RS3A 4DCGA 3PNQA 2HIHA 1AKYA 3F5FA 4FYYA 4FJ1A 4IIJA 4Z53A 2CVPA 3RLIA 4DR6B 3TECE 2IYXA 4NXMB 1RYDA 2IYZA 1J0CA 1J90A 3I1IA 2R2AA 3LFUA 5FULA 3LCMA 4RC9A 1D07A 1T9CA 2QP3A 3ET4A 4US0R 3W0LB 13PKA 2VQ6A 5KTPA 1PZMA 1GGMA 4DIFA 1J2TA 1OT5A 1KSFX 2ZATA 3DONA 3E1SA 4IZ6A 2LGJA 4TTVA 2CLOB 3AUXA 4XDHA 3FF4A 1VL8A 1KS9A 1TQDA 4HQKA 2NU7A 2EBWA 3N58A 3R41A 4B8WA 4F71A 4CCWA 3H65A 4E32A 2VBFA 2Z1MA 2HCRA 1NY5A 2ZS8A 5EPOA 3Q2OA 4M8SA 2E4WA 4RELA 3KAJA 4G65A 2WNIA 5G1PA 2HSWA 2WE7A 3T1OA 3SQNA 2NXEA 1KORA 4B1FA 4YI3A 3I61A 4YCCA 1QCCA 2H1RA 2QZPA 2ZJ7A 4KSBA 4OFBA 1W88B 4FGSA 4HYYA 5ESXA 2FOLA 1KC3A 2VDLB 3DOUA 3TSWA 3W5UA 3N0WA 2YIJA 3CRMA 3L6UA 1ZM9A 3EHDA 3RU7A 4R51A 4BO4A 1IN1A 4V1CA 2OXCA 2J3DA 2X19A 4B83A 3ZXXA 1E2DA 3TLBA 5LD2C 5IHXA 3BRWD 3F47A 3UMVA 4LJRA 4LTNA 3IBSA 4N1AA 1TF5A 3JCZA 4FW9A 1F1BA 3TNDA 3VSBA 5LA6B 1ISMA 5DISB 3T0GA 2P2LA 3MVEA 1HZZC 2OPHA 5FWXA 4A6XA 4B7CA 3Q7RA 5AW4A 4B3TB 2G6BA 4AG6A 5HBGA 1M1YE 1XZIA 2QN1A 4R3UC 1X87A 5EJ4A 2O5RA 3WIOA 2C9ZA 2P65A 4C76A 4Q4LA 3QFFA 5KAMA 1DL5A 2B82A 3T4UA 3GRFA 3V48A 1YS4A 3BFVA 3D3WB 4TTTS 3TOVA 3WIEA 5FX2A 5EXPA 4MCJA 2WEKA 4E94A 1SK8A 3UV3A 2EBUA 1DEOA 2FPIB 1NF2A 4ND4A 4HTFB 3JY6A 1B6SA 2JZCA 5AM0A 3AZQA 5FR1A 1KBOA 4S05A 4YRJA 2G9ZA 2ZBPA 4I46A 3TNYA 1P7YA 3NKFA 2QVBA 3CZAA 1S2MA 3H7IA 2D7JA 3KSRA 4N01A 4ASUA 1N8TA 1V7PC 1KVRA 1IZZA 1E6LA 3MAJA 5ALJA 2FG5A 2BEJA 1DFGA 1EINA 3UJCA 3UMJA 5JSFA 1I01A 3PTLA 2QLJA 5CEEA 4BY9E 2Q5LA 4LXTA 4TQAA 2B7LA 4X8MA 2DETA 3TTSA 1H23A 4G0PA 2GPAA 2D7DA 2AFVA 3B82A 3O2QB 3O4IA 2H5IA 4YJDA 1W5EA 1PYGA 4F84A 2J07A 3QSYA 1Y3HA 3TSYA 1LSJA 1EWTA 2PLAA 1LDGA 4PCLA 5HW0A 1NUAA 3ZEIA 1AXEA 1XPUA 3SR4A 3A1DA 1PQUA 3QWFA 4CRWB 4L22A 3U37A 3AM5A 4YMHA 1M2OB 1MF7A 1UBMS 3JVIA 1QH1B 3A37A 2PX8A 3F2IA 3P94A 3IPRA 4UHEA 4ZT4A 3UAZA 4LY3A 3S8EA 5C8VA 2GGSA 1RBMA 1A96A 2J7KA 2RHBA 3COYA 1EUDA 2G8LA 3DKKA 1TCUA 4J0EA 4KQWA 4BDTA 2FAXA 1KI1A 3HXOA 2JPDA 3GPDG 2I54A 3QENA 4LRWA 1GWNA 4IRUB 1JJBA 3OZWA 3FYDA 4EL5A 2OOKA 2WRZA 3OHMA 4GE3A 2ST1A 4NV3A 2ZJ2A 4AS2A 2CEKA 3MW8A 4DDKA 5CFMA 1D8TA 1H69A 4QDJA 2EYUA 3EDQA 1P31A 1RCUA 1SXJB 2IX9A 4IDOA 4WK4B 4CLXA 1Z5GA 3HMKA 1NQOA 4IAOA 3ZDYB 4YRSA 3MWDA 4CM4B 3I6ZA 1DG3A 3TSCA 1VE7A 2R2GA 3X43A 4R7GA 3QA9A 4NBWA 4X1IA 4Y6LA 1VPDA 4B6GA 1LBQA 3B3FA 4C6TA 1H2BA 3FG9A 4ZI5A 4IBOA 2E82A 1R8XA 1XDBA 3BMCA 4IUBS 3KEQA 4PX9A 5L7TA 4JT9A 3L5OA 1BA2A 5F3DA 2ERCA 5C37A 5K0EA 2ACKA 4GYKA 1TADA 3PHLA 4UCFA 2IEYA 4Q7KA 4C0BA 4FEEA 1NVBA 4I4TF 4X5OA 1SU4A 5KWSA 4N9WA 2WU0A 1NVMB 4JFRA 1U0JA 2DAPA 2HKIA 2NTEA 4DR7B 2JANA 4DPMA 2XEXA 4L6IA 1YI0A 2QLNA 2DH6A 1OVGA 5LFAA 4MMZB 4Z0NA 5F5LA 1HQYE 5JS2A 2QXYA 3DLTA 4EX7A 1JI0A 2IY8A 5HUHA 2BSQA 4ZOBA 3PL1A 3VR4H 4KYTA 5DTIA 1Q0ZA 5HM6A 3I23A 3DA8A 1RDFA 3QVJA 4YXWD 3KSMA 1F0YA 4QYIA 4DN6A 5CFNA 2VC2B 3AI7A 2JI4A 1QO0D 1EVKA 4PYMA 5LQDA 4PQRA 3V6MA 4LFBB 1NSTA 2PX6A 3ANLA 3UC9A 3KVYA 4C6RA 4YONB 3RUIA 4IH9A 1GRQA 1NVDA 1PW5A 1XYYA 1M33A 1M8PA 3D3KA 3KOYA 1M1YA 3VJMA 3ZHTA 3IGFA 5J63A 3DMYA 5KNDD 2XUJA 4DJEC 1QKKA 4QU8A 4DZRA 3G0IA 2BFFB 2PZBA 2GA9A 3AIIA 4EUEA 4C7MA 2NV2B 3QFHA 2JHAA 2ZIAA 2YXEA 3PFGA 4M0DA 4UD2A 3RARA 3U7QA 1VXOA 3WBJA 5LOVF 1N75A 2HNBA 3R0IA 4GECA 2R6CA 2JCSA 2QTRA 4UUBA 1GQRA 3V4FA 4X3OA 2ZIUB 4UE6A 2ZBRA 2X0FA 4CM7A 1OLUA 4UTZA 1AH2A 3ND8A 4HPJB 4QFBA 1N4DA 4B6PA 2XCOA 3Q6IA 4F5DA 5IHPA 3VYRB 2GEUA 1M6NA 3OOSA 1U5BB 3VR5D 5B1IA 2Z9BA 4X1OA 2PH7A 1E7YA 3GJ7A 2GBFA 3PPVA 1OJ7A 4MAAA 3FOEC 2ZOSA 4EGFA 4DLKA 1DWOA 2ZBVA 3PHJA 2JGEA 1MG5A 4QPPA 3T8YA 4N03A 1PJ2A 1PFKA 2IIVA 4BNKA 3GARA 2OCAA 2HFKA 3S1AB 5B1EA 1SBTA 4AZTA 1RRVA 1DCFA 3OE1A 1FFYA 1ZW1A 2HWWA 2P2CA 5DX8A 4ZI3A 1DAMA 2GBCA 3W2HA 5G41A 3IA2A 1GQOA 1RM3A 2C7OA 1GXSB 1E6MA 2VJOA 2FJ0A 3C7TA 4CG2A 4AULA 1IXSB 3GLRA 1H6AA 4YV0A 1L5YA 4LJ5A 3KPWA 1KC1A 1NWCA 4G4IA 4AXBA 1F4LA 1FPMA 2PEYA 4IUDS 1UKAA 1W59A 1RYNA 2EP7A 2ZDHA 5ILQA 2O8DA 2WD7A 4O2AB 2I7VA 1X7XB 3J7AC 121PA 3OEHA 5KI6A 1BE8A 2D1QA 4CLOA 1NYRA 1IXKA 3C0KA 1R15A 1ZK0A 1GQFA 3ND6A 2B1RA 1X1SA 4HFRA 4J76A 5BSTA 4E51A 4EIWA 4TRNA 4EZBA 5LLDA 2IIQA 3UPUA 4GX0A 3KYCB 4R84A 5DYNA 1DAPA 3EGXA 1R6BX 1ETUA 4IVQA 1NNSA 4LE1A 3JAWA 3GG9A 3C4QA 2ET6A 3BJMA 4KXFB 2ZITA 4J9VA 2C7GA 4PC3A 4XRRA 1YUBA 3ZHYA 1UXGA 1L4GA 3Q15C 4C7JA 4G56A 5JBIA 2AVDA 1VA5A 1ADJA 2RHOA 4M99A 1EVLA 1Q1NA 3L8DA 4CI0B 3W6ZA 3JQGA 4FZ5A 3PV0A 5EIBD 3K8QA 1SVSA 1US8A 4ILEA 4S24A 5CA0A 1Z4KA 2IV7A 1KJ8A 3ZVKA 2CK3A 3ZCXA 1H66A 4MA4A 1XTSA 4Q48A 1EFKA 2R6HA 3FMFA 5KNBA 1LA2A 1JLRA 1HDIA 3IAHA 1KP2A 5JH7F 1JJAA 1HTWA 4AURA 2ZRLA 2PKWA 4RK1A 3MWFA 2ZWOA 1H9AA 4WV3A 4DT1B 3UXMA 2GM5A 2OXFA 1HNWB 4DARA 4UKDA 2YUTA 3REFA 1E79A 4KE8A 1MDBA 1OYVA 3FDJA 1CQIA 3NR2A 4Q4DA 4ZHSA 2H1VA 2HL6A 2YOFA 1H2HA 1HDZA 3OMLA 1C7QA 1SBYA 3PDHA 3I8XA 3MLEA 1T2EA 3N7UA 4KBGA 2ISQA 1JAYA 1E1QA 4X6YA 5EL0A 4X7PA 2F9LA 2RHHA 4Q1DA 4NV0A 4WDQA 1HZZA 3IP6A 1E9BA 2I3BA 2OEPA 3HL4A 4JC4A 5EWMA 5FOQA 3RREA 4LC1A 1YJXA 3DDSA 1XA4A 5CB4B 1TUBB 3K9QO 5J40A 3RYCB 4R3WA 1KFKB 5FXMA 3LOUA 1L7MA 2C8JA 3E70C 4W8GA 4D3SA 4U00A 4DLUA 1NW6A 3IAM6 4MWBA 1RC1A 4P84A 3WGTA 2WB4A 2WT4A 3DPIA 2C4WA 4XSHA 3EGEA 4ZICA 3PA8A 4EO7A 3FIJA 5CP8A 4M76B 1TAUA 4ZN6A 4Z3OA 3ELDA 1TJ4A 4HUQB 3TQCA 3H1AA 3HA7A 1EXVA 1J97A 3AF3A 3V8QA 3UIEA 2H57A 2RHTA 3A6ZA 5AM5A 4EKGA 1LKZA 1U3TA 3FAZA 4PPFA 2UUOA 4GRAA 5CT4A 3TTTA 1YA6A 4HAOA 3D0RA 3OZIA 4C05A 3OZ7A 4TXLA 1K27A 1E2BA 5DP1A 1KTVA 1ZJ4A 3NONA 3PHHA 4QDKA 1SC9A 4CDMA 1AMOA 1F17A 2NP6A 2ZDQA 1UH5A 1PX0A 2J0UB 4UJ5A 1OWLA 4E5VA 3MRSA 3D6FA 3RIXA 3WYCA 3COWA 2VUTA 3IIJA 1WMEA 3C3JA 3BM5A 4XFDA 3G5TA 2EQ5A 4GVLA 2NSJA 2AT1A 3M6IA 1TZBA 2A9VA 2Q3BA 4CODB 4EI9A 4KIFA 1S3FA 4JQSA 1HFWA 1OVMA 4B6QA 4NU0A 1ZX1A 2EYQA 3MTQA 3WICA 4DLZA 1EYZA 4I4NA 1ISFA 2P4UA 3KEOA 3PEWA 5E9JA 3SYMA 2Z6AA 4YRTA 1RLTA 2FPMA 4FOSA 2GZRA 3D8BA 2GO1A 5E6UB 4H7EA 2AJBA 3H42B 5JJLA 2ZTMA 4KV9A 3SZOA 1OLOA 4ZYTA 1Z5ZA 1FE8A 3CX8A 3NFYA 4CLHA 3WWPA 5AVKA 3KT3A 3IQDB 5CVUA 4F2DA 4QHYA 5CDHA 4AZ3B 4IHAA 2BDEA 3G2QA 3CKLA 4I50F 1SQSA 3ZHOA 4BLPA 4JIMA 4EG8A 4EH1A 5JMWA 4IIFA 1IBCA 2EGHA 2WQ7A 3GFQA 4GHWA 2XIJA 4WBXC 1EZ1A 3CGGA 4FE4A 2A5JA 4P7JA 4WECA 5ADVA 1JWAB 1RBZA 2NN3C 3C3XA 5SY9A 3RRYA 2FFJA 4BWYA 5I47A 4U2CA 4ZDWA 1NA5A 4TTQA 2PRSA 3R6WA 4GOJA 3MBIA 1OLSA 1TX4B 1LI5A 1YZTA 2R9VA 3IIMA 4FFVA 1P2BA 3IR7A 3M0EA 4J1QA 2VI5A 2Y1LA 4W1RA 4ZRNA 3T9EA 3NTVA 1KJ9A 2IZ6A 4NXNB 4HHEA 1J8VA 1J0DA 3EE6A 4B6RA 3A3YA 3T1TA 4J0DA 4DHWA 4E22A 1AGRA 2C2XA 2EL7A 2VHWA 2B20A 1CT9A 3AUAA 2ZRNA 3BC1A 4F60A 5LBUA 2WIJA 3FTEA 2W2KB 1A4RA 5LIRA 3KVVA 3SXUB 4ALKA 2PA0A 2OHVA 3U9LA 3PR1A 4FLEA 4PPQA 3RD5A 4N9QA 3PEYA 1XG5A 1ZM7A 1HEUA 2ZXEA 4RUKA 5DLPA 1SU6A 2CVQA 3HL0A 3PA6A 3BREA 1M34E 1U1FA 1PF7E 4MPRA 4TMTA 4TRMA 3CO0S 5CUQA 5ENVA 3WXMA 3QK7A 4EZEA 3I4LA 5AJVB 4F93B 4JUBA 5CCXA 1K7SN 5ESDA 4XTRA 2FQQA 3NQ41 4K03A 2H1SA 3K9GA 4TYQA 1U3WA 1XWFA 2Q3LA 1ECLA 2QTVA 1H2XA 1LD3A 3NX4A 4DGQA 4E3WA 1KMHA 3DLBA 1AB6A 1PR0A 4X6LA 2QD4A 1PSDA 3STTA 1HQKA 1F38A 2K4MA 2O0HA 2BFBA 2ZGVA 3GHYA 3O90A 3LDFA 3P20A 4MV1A 4ZTBA 4OA8A 3HP4A 1JFFA 4NYIR 1G8YA 1OY1A 3IO5A 3NHRA 3UB4A 4U7FA 1HKHA 1NN3A 2FSFA 1Q2UA 3MGKA 2LE0A 5JZ9A 4NG5A 3OCZA 2RAUA 3KKQA 2R5WA 2J5BA 4KQIA 4Q5IA 3I83A 3MHPA 1CY2A 1GQQA 1N5JA 1J8MF 2EF0A 2I87A 1DBIA 1GAWA 3G9XA 4NBKA 1MGPA 4TQ9A 1NNI1 1OXTA 1WXFA 4TSFA 4X6XA 2DJ5A 2G4LA 3AGQA 5FORA 2ATXA 1V35A 2XNCA 4O59O 2B1GA 3RUAA 1TJYA 1A69A 1EVJA 1VJ0A 1OAOC 4KODA 1F0KA 2A67A 1MC5A 4EA9A 4F9EA 3FVTA 3LNCA 5F3WB 1WVGA 2RG7A 2XUOA 3JQAB 4P93A 4XEHA 1XLUA 3PQFA 2XZPA 2CBGA 3K32A 3KK0A 4E2XA 4KYIB 2G6TA 3HCPA 3IV6A 3FRHA 5EP4A 3EARA 4OHZA 5KYUB 2Q3JA 4I14A 4EW2A 3UJ9A 4URHA 4C4PA 1RFLA 3IB6A 5DX0A 4YYZA 4MVWA 2CXRA 2VNJA 1G6OA 5HBRA 2C3PA 2GAFA 2ZYTX 4JLAA 3MLBA 1NTRA 3ZU5A 1EXDA 4N48A 1UKBA 2QZ9A 5ADHA 2NSLA 3E22A 1YAHA 2PXXA 3JQ7A 1F2UB 3GELA 4HL6A 2HYDA 1GJRA 3FX2A 4PLWA 5TSDA 5EIFA 3KLNA 3MMSA 2CUNA 1IVNA 2AG0A 3TZCA 1YO6A 1CRPA 3M8KA 2R6R1 2QEQA 3O1IC 1BYIA 4E13A 3FDZA 2GHQA 5LKRA 1SELA 1KXJA 1FSFA 2YJ6A 4L50A 2XB6A 4FFSA 1G4UR 1HK7A 2W6JA 2ECQA 4HJXA 1OXKB 4DGSA 3RANA 3E9DA 3I6QA 3TX6A 1N3BA 3ZNOA 5JJBA 4PQYA 2JJ2A 1RYHA 1X80A 3ZDDA 4Y8VA 3FF1A 5DMXA 1GARA 1LRJA 4ZMBA 4RIHA 2WINI 5I3CA 1XEAA 5LDDC 1UZMA 1H9CA 1KMQA 3JV7A 5H5JA 4D9KA 4QM6A 2YFHA 4RLHA 1MW8X 1RRFA 1SKUA 2I1WA 3NWJA 3FDIA 1IBRA 4RQTA 4GBMA 2I91A 3B1VA 4ALJA 3SC6A 1R6UA 4GWGA 4R8SA 1Z5VA 5FLYA 4C4OA 3Q8KA 1HKUA 2YJZA 3QLVC 3NHWA 4JSRA 5L6MB 1MO2A 2NWQA 2D5AA 1VPTA 2Y99A 1QRRA 3CB2A 3CSDA 1CUHA 3GAFA 2NT4A 3T15A 3U7JA 2P9JA 3O31A 5I45A 3I9V1 3I2YX 2H5JA 3FNHA 4DM4A 4WZBE 2VJDA 3BGIA 4OHXA 1NYTA 3AEQB 4PXAA 4ACAA 1QGZA 3CLRC 2SKEA 1KH1A 4FYJA 2VHJA 4LSMA 1CY4A 5ARCA 5AM1A 2ZUSA 4PWYA 3ZW7A 2R8YA 3VKVA 2F1KA 4DLXA 4DR3B 1IK4A 3GJTA 1B8VA 3HRKA 4H7HA 4BNVA 2UYCA 2IRWA 1E3IA 1ADCA 2V1UA 2Z2KA 2ZT7A 1BXGA 2XXAA 3E5MA 3QUTA 4UHBA 1VSQA 2ZRDA 2WWGA 1KRXA 3IJ5A 2GEBA 4EY7A 2C00A 2COKA 4HS9A 2J5KA 4MW9A 3ZCSA 2V0CA 4LSGA 4WE3A 1HI9A 5DCYA 1NW4A 4J0CA 2QN7A 2R1TA 3DZBA 5DXJA 2DU8A 4B47A 3WGVA 4M3NA 3KKPA 1BKDR 1F6BA 1RI3A 1SEVA 3BH0A 4M1OA 2ZI3A 3R77A 1ZINA 3D1JA 1JT9A 1CERA 1EDDA 1T36B 4XCVA 1HMPA 2W93A 1ZHFA 1EWYA 3FZEA 3LL7A 2BR5A 5TEWA 4WJZA 1UMBB 5C3UA 5TDHA 4ALNA 4KOAA 4RJ2A 1PV4A 2BFEA 5CA1F 1QAOA 4NFHA 1NVAA 1GVHA 7MHTA 2Q0HA 1FDWA 1IPEA 4P0TA 3LPMA 1E96A 2RK3A 1EGVB 2QZJA 1QQBA 3AP3A 3CG0A 4G1CA 2ZTVA 1HE1C 1PI3A 4K9LA 3OZUA 4FEGA 3C6BA 4BO7A 1L5VA 5GIOE 1B14A 2EHDA 4J0QA 4N6OA 4QC2A 4RFVA 3VO1A 4S1NA 4TWAA 1SUDA 4XUGB 1KYYA 2AMJA 3HM2A 5TARA 3VR3D 2GJ9A 2UUPA 5EKXA 1UKCA 4Z0PA 4ES6A 4QT0A 1PS8A 1TAQA 3EA4A 1XTKA 2MJLA 3HGTA 4BC0A 1U81A 1YUNA 4IOJA 4I8IA 3PLNA 4MR9A 1JFVA 2WUVA 1LF5A 2MCFA 4JENA 2YRWA 2HPVA 2AC2A 3E9EA 2J9FB 3CCCA 1H1LA 1EVQA 2RFLA 4MRAA 1RR6A 1Z2AA 3KKLA 4F9FA 1N6NA 3BJIC 2XB4A 5AVJA 5FPYA 3OBBA 3O0TA 2X9GA 2V55B 4BVLA 3CNHA 2BFCA 2WJHA 4LWZA 3DS8A 4YMSA 3DEYX 1EUCA 3H6KA 3K6KA 3JAMA 3ZZMA 1WXGA 1Z2DA 3A70A 3KU1A 2VXYA 4V0RA 3CX6A 1QJCA 2QVXX 4NBTA 2R7AA 2Z6QA 2GPJA 2JAPA 3A1TA 4ZAZA 4F6RA 1VHQA 4F4FA 4PFSA 4Q3AA 4EMTA 3DEFA 3RIYA 1L4YA 3CBGA 4ZEXA 2QTWB 4QXOA 3GEPA 3UWSA 1T8WA 1IUKA 3C1TA 2FPPB 3E4CA 2NU8B 5CIYA 2WIFA 4XQCA 4AF7A 2WG2A 5J3JA 3TW6A 4ZK2A 5JD3A 1VIYA 1IIRA 4YP6A 5TS3A 4A2PA 3KB8A 1D03A 3NM5A 3VO9A 5K3FA 3ZHCA 3P71T 1XZQA 5I9BA 5C52B 4I1RA 4IY1A 2CLHB 2WKRA 4AMGA 4J1SA 1I4OA 5FPQA 4OQLA 4ARZA 3R8FA 4HDSB 3OIWA 4H27A 4P83A 2YMPA 1MABB 5K01A 1V1RA 4P98A 5B53A 1K7XB 1EBUA 3K9FC 2OTCA 2WDPA 1CEQA 5TPWA 5JZBA 1ZH0A 4H3HB 4DV4B 1VZ2A 5DPMA 2X22A 5GVSA 4H31A 2C20A 3FKSA 5CNKA 1IJBA 1JILA 1GU7A 1OC2A 1VKNA 2BGMA 1PJRA 2I66A 2ZAOA 3FVRA 4I2NA 3NUZA 3F4BA 1JEQB 4WZBA 5CH3A 4QGSA 1PGQA 3DO5A 3E3AA 5LMNB 1UT8A 4ZODA 4A6EA 4XWGA 2QDXA 4YDRA 3HBAA 1VLVA 1AKQA 1SUCA 2BGLA 2NZUG 3PD1A 2IP2A 2OBXA 4KFRA 2RHMA 5MFPA 4KRYA 4OLFA 4E11A 3IJPA 2WF8A 2ODPA 3X1DA 4Y6RA 2Q6VA 2LZ0A 2GF0A 3LHSA 3LW8A 2NU9B 3ESXA 1ENZA 4M0LA 5JEDA 2ATVA 2QE6A 3QWIA 2CJXA 3Q3EA 4YWJA 1DDIA 4TX1A 3TAHA 3TQFA 1ORVA 4EPXA 1HURA 3IAXA 3UGJA 3U81A 3KKEA 3EIQA 4CEIA 1GADO 4MVJI 4GC5A 4X95A 2UYHA 1MQ9A 3SVLA 4K1LA 3FPAA 3IOCA 3LGXA 1L5HA 3CUWA 1IM2A 1HE4A 3DV0A 1SBQA 3U26A 3WGYA 4Z1MD 2VTEA 3NVMB 1O4WA 1CNEA 2H2GA 4HGNA 2C82A 2GPWA 2DBRA 1WDMA 3ILVA 3TXYA 5AFSA 3WLRA 2RB4A 1H6CA 3GCGA 3V8NA 1U0RA 2IUYA 3HY4A 4ZCLA 4G0WA 1R0YA 2BFOA 1DWPA 3QKTA 2VYCA 2IUSA 1P2SA 2ZWIA 2PHZA 4ICIA 5ERGB 4QTUB 2ANCA 3KSBC 3QJ5A 2J67A 3BDAA 1W34A 2HO4A 1I5EA 4MUKA 1IHXA 1ZL0A 5C51B 1M0EA 3AP1A 2XE8A 1BZYA 2Y8EA 1C7IA 3LHIA 5KYNA 1EBFA 3P2KA 4ZZ1A 1NOIA 2XDQA 3DBLB 1R0LA 2MINB 2ZREA 2G04A 4DR4B 1Z8FA 2AZMA 2C59A 4GUDA 3GF4A 3E5HA 3EASA 4QDUA 4P58A 1OAOA 4R69A 3EXG1 4B44A 3VZQA 5B3JC 4TTPA 2QV7A 2ZT8A 2D4HA 3IBGA 3QLJA 3HUDA 2A7QA 3KTOA 2GCNA 4G9EA 1YVUA 4RVCA 4YRQA 2O7VA 1ESEA 1HFKA 3SX0A 3IAS1 1B15A 1C9JA 4I0WB 4ENSA 3MJDA 1Z29A 4YRGA 1NW3A 1NF3A 3JR3A 1QO9A 3DFZA 1LK5A 1IZYA 2DBQA 2G63A 1NXWA 2XQJA 2K7FA 4FFLA 1W581 1RXUA 3MT9A 5EUMA 2AD1A 3JZFA 5A0TA 2LCQA 3GH3A 4H7PA 3RT7A 2HV9A 2XTZA 2GKOA 1QH9A 3QYPA 4O0MA 3RH0A 3UBMA 4BQOA 4NIMA 4KREA 4HB3A 1BJRE 1ORDA 4C5AA 2WTMA 1ZUIA 1PJLA 3T35A 5FLEX 4C7VA 2E6UX 3AB7A 4MHTA 4R31A 2ZIWB 1Y7IA 5LQJA 3H2KA 1RS0A 3IKMB 1ZQ9A 3PYXA 1MVLA 1YRWA 4PZLA 1XCJA 3WK6A 3ZKWA 3A1NA 1Q3HA 4ZIRB 4CKWA 4GXRA 1FYFA 2XRFA 3W9SA 4ZYXA 4PYIA 3OQJA 4GO1A 3ZGOA 2PVSA 3IAFA 1RCFA 4MQ6A 5H80A 3SE0A 3WNDA 5IXSA 3DG9A 2B1QA 3IP3A 5K3EA 3JQPA 3VKGA 2XRYA 5KSZA 3KQHA 3HKCB 3IAAA 1G2OA 3TNLA 1XZ8A 4NK5A 3BBLA 5A3JA 3NDBB 4M1YA 2ZANA 4UHDA 1WF3A 2HGSA 3Q10A 4U5XA 3S81A 3G0OA 1R6AA 2HRDA 2OC4A 4MKFA 4DKJA 5FWAA 3OPVA 2WSYB 2L18A 2WIBA 4FDMA 4NTZA 4FJ2A 4JLBA 4DCPA 4K6GA 2QSYA 1RJ9B 1JHYA 1B4DA 2ZI9A 4INZA 1M1NB 3ZHXA 2WY2D 1SFRA 3E7WA 3MOIA 3T6KA 3HUFA 4D3DA 1LJLA 3U1BA 2VZ0A 3PFCA 3ETLA 4RVSA 4MB6A 5CMLA 3U9SA 1GIAA 4HVTA 2JFWA 1KNXA 3H16A 2ZVJA 3OX2A 2Q1SA 3H6HA 5H16A 5JCJA 3TB4A 1DHRA 2O0KA 4OI1A 4GM4A 2BEUA 2V4UA 1AQYA 2XE7A 2ECKA 5K45A 2C5EA 1R5BA 3ACCA 3V7UA 4AIIA 1RD4A 1B0ZA 2F3PA 4OSPA 1XEXB 4C22A 5BMVA 2GOYA 2HA5A 3H5AA 5T4EA 1Z4IA 4TV9B 1IY2A 3M4ZA 4BFTA 1VSBA 3KTDA 4OXNA 4QJBA 3K72B 5C4GB 2X40A 1TKAA 3V4LA 3RRZA 1CUCA 1AX9A 4U2FA 3UJNA 1JMYA 4J4BA 1W5BA 1YOVB 1R64A 5AW8A 1VCIA 4R68A 3M6UA 3PXAA 2II6A 2FJPA 1M2WA 3GUYA 3TLXA 3CLTC 3EC1A 5DLEA 4XIIA 2H1WA 3BCUA 3HO8A 2G1AA 2QRGA 4AMVA 3R7BA 1XT6A 4Q66C 3EZGA 5GADl 4IDFA 1DC3A 3E3NA 3CUUA 3Q7SA 1QK5A 1EFLA 4AAYA 4ED9A 1GN8A 4EMBA 1FRNA 1MJ5A 2IYRA 4WZAB 2YVLA 4D3FA 4DHEA 4F2PA 1J0AA 1E3TA 1JEYA 4RLQA 2BHSA 3BVPA 2XIQA 4MIYA 4JBYA 4PAQA 1SUFA 1BCRB 2QL7A 3KALA 2XYHA 4INAA 4LJ8A 5C8YA 4Q9IA 2WWRA 3TUJC 3RKRA 2DMRA 2RG1A 1EX6A 5CDFE 3GNTA 3OY2A 4FFBB 4GZMA 5KHAA 5KX5F 3TOSA 2QE7D 3G5UA 1QCYA 2EW2A 3KLOA 4FYMA 2D62A 2OB1A 3AH8A 4H7FA 3RVJA 3EXEA 4NOLA 1EIZA 3BWCA 3VZBA 4WVFA 2HO5A 4IDDA 1RSZA 3V4ZA 4CEHA 3JS5A 5A9SA 2Q4EA 3GVPA 4ZO6A 2ENWA 3SAJA 5IW8A 4ZYVA 2GZAA 3WLOA 3KBBA 2UVPB 3SKVA 1Z68A 4J0HA 3BB1A 1C3LA 2HMAA 2CL5A 5EZQA 2A35A 4ENPA 1U8ZA 1YR8A 3ILSA 2C99A 1KF0A 1ZK2A 4M6WB 1BW9A 1GEGA 1DMSA 3KUUA 3OQ6A 4PAGA 4PYKA 2DWOA 4BZQA 1T1SA 2FG6C 1IHPA 2OXRA 4FGKA 1CQWA 3L8FA 3KYDA 3PCTA 1LNSA 3QYFA 4UTOA 3OESA 1SBNE 1C9NA 4FDUA 4K05A 3H3FA 2UUBB 2BAGA 4LV6A 3C41J 4GPIB 4PG4A 3N6RA 1N1DA 3I6YA 1HYQA 2AOVA 4M38A 1ZCJA 4QQFA 3ZQUA 2J3QA 2PMDA 3LAWA 2H2DA 5DULA 5EJIA 3OUZA 3RC9A 4CTNA 2KLHA 1CPYA 1HOTA 2R79A 3JTMA 3PIRA 4KO2S 3NEPX 2XWBF 3NG1A 2NV0A 3C8HA 3KJGA 1A95A 4H3SA 5F1YA 2GXSA 2ZE6A 1RVDA 1QMGA 3M6FA 3BZBA 1E1LA 4IR7A 4DC1A 4W5JA 1PJ8A 3IOBA 4J1TC 2C77A 1GTZA 2WYOA 4L95C 3MJFA 3C3BA 3MYRA 5GAJA 4GVPA 4TRRA 2R7NA 4QU0A 3ESCA 1NVXQ 4YXFA 4HAIA 5TXGA 1BE0A 4G1VA 4XFJA 1FRZA 1TXGA 2P27A 3CMMA 1DGQA 3M81A 2B4QA 3ADCA 5EERA 4M7PA 1TE2A 1NDQA 1CBUA 1T4CB 1ZMBA 2F00A 5I9TA 3R9KA 3RRJA 4RDCA 1YMVA 3R6TA 3ZOKA 4EMSA 1LNQA 1TFUA 1R88A 2P9GA 2GTIA 2J0EA 3OTWA 4G2NA 3DL2A 1GPBA 1M8KA 3G13A 2XZTA 4ZVOA 4B8YA 2ZRBA 4PGMA 5KTOA 4YMTA 3EVGA 4KZPA 3WIUA 1JIXA 2AOXA 1VPVA 3GQBB 1QZZA 1VJDA 4NJMA 1P1KA 2EP8A 5FQOA 4FEYA 4CU5A 4E5UA 4WBNA 2CT8A 4RLFA 1J24A 3MLAA 1Y9ZA 5I9IA 4MJXA 4US2R 3M6MD 5CCEA 2ENUA 3GO4A 4IMIB 4KQXA 3UK2A 2XITA 3H8SA 4KMSA 1SUPA 3TZKA 2QD5A 4LQCA 3TG8A 2UUCB 1JECA 3RFUA 4TZ6A 2XCTB 3B12A 3RVNA 2REBA 4AX4A 3R1IA 3C6MA 1XJ5A 1QANA 1VMIA 2FLWA 3CINA 4ZAFA 4NESA 3SKYA 4WESB 5AW0A 2V7TA 3STVA 5GJVC 3DZCA 3ENZA 821PA 1S9HA 3WGQA 1Z56C 1BAPA 2XZDA 4YRPA 3HB5X 4FB4A 3OZVA 1LPAB 1TLLA 5LC1A 5FAKA 2XZLA 3K0AB 4IGKA 5EG5A 4OQZA 4B6EA 2LUOA 3Q7EA 1YDMA 4ITRC 3PNYA 1T5OA 3X1KA 1ZN2A 3EXIA 1YZQA 3HDJA 4A8JC 1RMQA 3GGDA 1JHVA 1L4LA 5DF1A 4D9HA 4R1TA 1DCMA 1KS2A 3BTUA 3CN7A 3JR7A 4UDOA 2AKYA 5HS4A 3L1UA 3L8MA 5FTMA 1KMIY 3PNBA 4ZVSA 3M3HA 4BQFA 5D6NA 4L08A 3BA6A 3HB7A 5B3JA 4YEDA 3AR4A 5CPFA 2GVNA 3DEZA 4FHZA 4FYVA 4B09A 3OY7A 5TVGA 2W22A 3DQQA 1XCPA 3D7NA 5TGTA 3UFXB 1RZRA 4CQLA 1YCHA 2WKSA 3GJZA 2OCPA 2CXTA 1GPNA 4HNHA 2AN5A 5K3SA 5CDFA 3V8VA 3GFFA 3LGAA 1POXA 2YL2A 2ZSBA 3GJ5A 1DAIA 4FIZA 4ARAA 4X62B 1RC8A 1XAHA 5BV7A 4O4HB 1IM5A 5LLSA 1K1EA 1R4ZA 1UDAA 3P9XA 3PUXA 4NECA 1XMVA 1FYVA 1L5OA 1P3JA 1ESZA 4LWPA 2VXBA 3UK7A 1BSVA 1N5DA 3DPSA 4RESA 1II0A 1TECE 4ZQCB 1B74A 3LRTA 3JQEA 4YJHA 3REQB 4V1CI 3EY9A 4G4SO 1ACMA 3WL3A 5A62A 4A7PA 1CZKA 3AJ8A 3COZA 3W5IA 1RKBA 2FZCA 3DMTA 3KQSA 3MIZA 2V7PA 3VRHA 1DB3A 4DCSA 5EE9A 2Q1TA 3KLBA 2EWWA 3WB1A 1ES9A 4PHHA 4QIHA 1IZ7A 1KVTA 2NVUA 4QULA 1T8PA 3L07A 1NNEA 2G3YA 4BFUA 1CF4A 3FNQA 4BTLA 3PXDA 1U2TA 4BRSA 4C2UA 2ONCA 3VU3A 4IYJA 3HA5A 5TY0A 5DRYA 1NU8A 2WSBA 4REMA 4ZOCA 4MYRA 4MVJD 1E0AA 1SB8A 2ZSAA 4E08A 2PL9A 3CSSA 5KOHB 5A0FA 4IPTA 4PQEA 3KSUA 3W7AA 2FEAA 3SDZA 5AVRA 5L3VA 4CEJB 4YJGB 5HJ2A 1EWRA 1XTRA 2CC2A 2C84A 5EYPA 3OIFA 3QVXA 2Z4TA 3W7BA 2JGFA 1Q17A 2WZDA 5LU8A 2VP0A 5KAPA 4UE3S 2Y92A 1HETA 1TGYA 3IYLW 4RSGA 2OGSA 3HMQA 4TLDA 3SC3A 3LS2A 1FP4B 4OBWA 1RAEA 2X58A 3KR0A 3EG9B 3I32A 5ITWA 2Q7OE 4OBXA 3RVKA 3QFRA 5LLTA 5EHGA 3CW9A 3GGSA 5C80A 1FUYB 4V24A 3I28A 3ROGA 2ISSD 5ELXA 4ZKDA 1RKXA 4LNUA 1KFEB 5FTLA 2QI9C 3QWBA 4W9RA 2ZYAA 2PLFA 1ZDMA 2FW6A 2W0MA 3KHKA 3ISJA 4N12A 1LXCA 4PGAA 1UC8A 2QG6A 3N53A 2FUG1 2HRQA 4R9NA 5HE9A 4IFIA 1BH2A 5PNTA 4OQFA 2PH1A 4E14A 1S3GA 1YWGO 4JX9A 5GONB 2QG9A 3EXFB 4V0LA 1IM8A 3DWGA 1CNMA 1DQRA 1X1TA 3ONWA 3ZCRA 4UTNA 5LP6F 2GEJA 4HAUA 4Q4AA 1U3UA 2GARA 3FGPA 2NACA 4FFWA 4LPSA 3EVBA 4RVFA 2M6KA 3U13A 5J58A 5JI2E 2IDJA 5L3QA 1Q5PA 4G97A 3HUEA 2IKQA 4C30A 2QVGA 3RHFA 1SCAA 5HQJA 3A1VA 4WEOA 1PGOA 1S89A 4ISBA 2VQSA 3SICE 3STXA 4BJHB 3DXXA 1KU0A 3KQOA 2IYYA 1C7JA 2PGXA 4F12A 3NIWA 1P75A 2R60A 1PR6A 1R8SA 3LXRA 5L4NA 4AD8A 1TKRA 1MXFA 1XVVA 2OP0A 3VR0A 1JQBA 5CT8A 3JVUA 2FRXA 4EGAA 4R2JA 3A14A 2BFDA 3OLXA 1XVAA 1GRCA 3D5TA 2JLAA 4OXXA 4Q02A 3PJEA 2CNLA 3TXXA 4DQDA 1QRAA 5KOYA 3CVXA 1YHNA 2ZYSA 2QUHA 3JALB 3K5IA 2B92A 1SN7A 1X13A 2CHVA 2QLBA 2IH2A 3ZCVA 5CB6A 2C8VA 4G1BA 1F60A 4JJ4A 5ERYA 5KQMA 4MKXA 5KTMA 1C1HA 1T0UA