3OSZA

Crystal structure of the complex of proteinase k with an antimicrobial nonapeptide, at 2.26 a resolution
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
279
structure length
279
Chain Sequence
b'AAQTNAPWGLARISSTSPGTSTYYYDESAGQGSCVYVIDTGIEASHPEFEGRAQMVKTYYYSSRDGNGHGTHCAGTVGSRTYGVAKKTQLFGVKVLDDNGSGQYSTIIAGMDFVASDKNNRNCPKGVVASLSLGGGYSSSVNSAAARLQSSGVMVAVAAGNNNADARNYSPASEPSVCTVGASDRYDRRSSFSNYGSVLDIFGPGTDILSTWIGGSTRSISGTSMATPHVAGLAAYLMTLGKTTAASACRYIADTANKGDLSNIPFGTVNLLAYNNYQA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Proteinase K
publication title Crystal Structure of the complex of proteinase K with an antimicrobial nonapeptide, at 2.26 A resolution
rcsb
molecule tags Hydrolase
total genus 100
structure length 279
sequence length 279
ec nomenclature ec 3.4.21.64: Peptidase K.
pdb deposition date 2010-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 3oszA00
4DWWA 1CSEE 1GNSA 1THMA 4MZDA 3LPCA 1Y3FE 2DP4E 2SICE 1ZVKA 2G4VA 3QFHA 2DUJA 3VV2A 5JXJA 3EIFA 4M1ZA 1AK9A 3I34X 1SUAA 1R6VA 3I2YX 1DUIA 3I37X 1KDZA 1OYVA 5FBZA 4HX2A 3H42B 1BFKA 5JXHA 2ST1A 3VTAA 1P7VA 1TM1E 1IAVA 4LVOA 2SNIE 1S01A 3DE2X 2IXTA 1DBIA 2IY9A 3DVRX 4Z2AA 1SUPA 3CO0S 3DE1X 2X8JA 3A3NA 2XRMA 3LPAA 2WV7A 1NDQA 1T1IA 1YU6A 2TECE 1SH7A 1WMFA 1VSBA 3LXUX 3GT4A 1SUDA 5JMOA 3Q40A 1GTJ1 5CW1A 1TM7E 2PYZA 2W2NA 1R0RE 5FAXA 3BGOS 3DE6X 1HT3A 1SIUA 2ZWOA 1SUEA 3DW1X 2Z2XA 4B5LA 3WIUA 1KDVA 1EA7A 1GTG1 3ZXYA 1KDYA 4OMDA 3DDZX 1WMEA 3DVSX 4YN3A 1GA6A 4C3UA 1TM4E 1SUBA 1SBHA 3DYBA 1YJCA 2Z30A 1AVTA 4K8RB 1BH6A 5JXIA 2PQ2A 3Q5GA 3DE0X 1Y3BE 2Z2ZA 3AJ9A 1SCJA 3T41A 1AU9A 3BPSA 1BE8A 1BFUA 1R64A 1YJBA 3D43A 1PEKE 4KB5A 5AQEA 2DQKA 3D9QX 3L1KA 1BE6A 4CFYA 2WWTA 2HD4A 1JEAA 1BJRE 1SVNA 3DWEX 3EDYA 4ZOQI 3WQBA 3F7MA 3PTLA 4RYDA 1V6CA 3VV3A 3F49S 4KPGA 1TO1E 2ID8A 3HJRA 1Y3CE 1OT5A 4AKTA 2PWAA 5JXGA 1SCBA 4ZARA 3DW3X 3QMPA 3BX1A 3VYVA 5B1DA 1A2QA 2WUVA 4CG0A 2WUWE 3I30X 1TO2E 4DJ5X 1MPTA 2XTJA 4KG7A 5AVJA 1C9NA 3AFGA 2Z2YA 5K7SA 1S2NA 1WSDA 1GNVA 3LPDA 3GCWA 1PJ8A 4LVNA 2Z58A 4DZTA 4H6XA 1GT91 1S02A 4OV6B 4FONA 1AF4A 1C9MA 1WMDA 4CFZA 3TECE 2W2PA 2P4EA 1XF1A 1ZVJA 3A3OA 3DE4X 2GKOA 3A3PA 2PKCA 1KE1A 4AKSA 1SCNE 1SPBS 2PRKA 4I0WB 1LW6E 5ARBA 3DVQX 4OMCA 1AQNA 3F7OA 1ST3A 3DE5X 4J94A 1Y4AE 4WOBA 1WVMA 2E1PA 4HVLA 1EGQA 1Y4DE 1SBTA 1SBNE 1SELA 1AH2A 2Z56A 3GT3A 1Y9ZA 3GCXA 3WIVA 3AJ8A 3EE6A 1PFGA 1Y34E 1SCDA 1V5IA 4JP8A 2ZWPA 2V8BA 4NMXB 4H6VA 3VSBA 2QTWB 5FFNA 2ZRQA 1Y48E 1C9JA 3VHQA 2Z57A 3SICE 3PRKE 4NE7A 1AV7A 1T1EA 1SIBE 1Y1KE 1SUCA 2X8JB 1UBNA 2W2MA 4NE9A 5SICE 3OSZA 3UNXA 1Y33E 1Y3DE 1TM5E 1CNMA 3ZXXA 1ST2A 1SCAA 3DE7X 1SN7A 5ARCA 5B1EA 1TK2A 1P8JA 3WHIA 1SBCA 2HPZA 2SECE 1MEEA 1T1GA 3QTLA 5I9SA 3TI9A 5AVKA 3P5BA 5AMXA 1P7WA 4H6WA 2SBTA 1TECE 1PTKA 1IC6A 2PWBA 2W2QA 1NLUA 1SIOA 4C3VA 2B6NA 3SQOA 1GCIA 1YJAA 4WOCA 1GA1A 1NDUA 3DE3X 4GI3A 1C3LA 2PMWB 2ID4A 1TM3E 3CNQS 5ARDA 1Q5PA 1SBIA 4BWGA 3TI7A 1GTL1 1OYOA 1GA4A 1KE2A 2W2OA 1TMGE
chains in the Genus database with same CATH superfamily
1E2GA 1E1CA 2WWXA 3F3YA 1P1CA 4HAOA 4L7QA 2FPLA 4UBMA 4M7RA 4MVJH 1NP3A 3VPAA 4MW2A 4FFLA 4C4TA 4D0LB 5CAEB 2YWRA 4R7TA 1KOFA 3Q7PA 3CN7A 4J2OA 2BMFA 4IUBS 5IMBA 2C0CA 2XMCA 4R8VA 4PHHA 1OTHA 1RJWA 4PLZA 3RS0A 3AEYA 3RK4A 1FPQA 1E3DA 2WHRA 3PGMA 1S1CA 4I14A 4B1FA 5FDFA 3EGDB 4K40A 5JXJA 1DHTA 4O4IA 4OUDA 3JS5A 1FZTA 1Q1ZA 2WTAA 3E3NA 4GRIA 1SK9A 4K2HA 2RGRA 3ICEA 5J2UA 4A4DA 3FNBA 3L0DA 3O3OB 5IULC 1V95A 1Z5VA 2VDNB 2E4XA 3NYIA 1LVGA 4M9QA 3HB5X 1ICEA 1DT5A 4HB4A 1I4OA 2ETVA 1KI1A 3T1YB 2O8DB 3RYIA 5I45A 4LKRA 3WBFA 5BRAA 2RH9B 4NTZA 2A2ZA 1V7ZA 3K8YA 2QAGB 4TQUS 1VB3A 5BQ3A 4URZR 5C1BA 3EOAI 3NH9A 5B7NA 1T6BY 1A8SA 1EVZA 2ZYGA 4I08A 4KO4S 4CIDA 5BT8A 1OYVA 4H60A 1A8IA 3IKLA 3VH2A 3Q8LA 1XMVA 3QI7A 3DLPX 4RM3A 4RKFA 4R69A 5BR1A 1M34E 3R0ZA 5ALZA 2BI4A 1D4OA 1U04A 2CJPA 2I7DA 4IV0A 1CY6A 1NI3A 2H9IA 4TGLA 4I55A 2DLNA 3S1AA 3X3HA 2WWIA 3IPAA 3IELA 4ALNA 3ZGVA 3ZDYB 2D1RA 5E1MA 1AGXA 1SUPA 3RVDA 2C4WA 4JXXA 1W47A 4F85A 1D2NA 2P78A 4DMHA 5FH9A 5KEIA 3TZHA 3ZR4B 4D3DA 1T5DX 2F1RA 4FGJA 3LDGA 2FPIB 1P5FA 3UJ9A 4GZ6A 4KYIB 5KCZA 1R50A 3AVPA 4PR3A 2WV7A 4A5SA 4RZSA 5A4IS 4UHEA 2V9PA 2XHZA 3SJUA 1IFXA 3B38A 5JS7A 3RBXA 2OV2A 3VKUA 4GPBA 2XDWA 2PT5A 4BO5A 3H9CA 3IIMA 1DIBA 1JQBA 4AZ0A 4YRAA 3TSWA 4I1RA 1ZFNA 1L7RA 4OQNA 3RVBA 3RYCB 1U2SA 2C61A 5C32A 4URUR 4ZTBA 3IUYA 1HQKA 4K87A 3RFUA 3UGKA 4EW2A 4FGUA 4W1RA 4HV4A 2FPXA 2R8EA 4TTIA 1RWPA 3HDHA 3WE7A 4EYGA 2AL7A 4GGOA 4Q4LA 1HDEA 1H69A 2OG1A 3F9RA 4B83A 4PYQA 4O4HA 4K6MA 2YICA 4OHRA 1BGWA 1TO6A 3DE6X 2VPWA 4W6QA 5FX2A 2H92A 3SVTA 1I36A 2E87A 2H4ZA 4P4UA 4ED9A 2Y1LA 2VYCA 4DT1A 4EP1A 2GAIA 1U2PA 1UBMS 2J0VA 1M34A 4NMWA 1LTQA 4JBIA 1W59A 5HMMA 3QXCA 4L73A 1PT6A 3KQYA 2ZKIA 3N8DA 5AOVA 3TQOA 1U8UA 3PE6A 5B2ZA 4F2WA 2JIZA 1QHEA 1OVGA 3NTOA 5CT5A 4PONA 5BW4A 2WDZA 1KSGA 4Q3CA 1VQ1A 2B2NA 2JEYA 2HO5A 4A0SA 4C1NA 2C20A 2GF2A 3IUSA 5JY1A 2D5IA 2PVPA 4WOPA 2HSWA 1X1EA 1E79D 4O3FA 2ZRPA 4PBRA 2ZCVA 3DT8A 2SHKA 4PAQA 2WKPA 3AB3A 3CEMA 1ZGBA 2XYHA 3P9ZA 3WFZA 2WJHA 3R5XA 1G8AA 4IIJB 3DT9A 4JP5A 4UFNA 1RKQA 4G1UC 4OHOA 4FYXA 1M8FA 1DRWA 4LZAA 3GWGA 4B09A 3NORA 3DOEA 4Q4AB 3I9LA 1U6KA 2GRJA 3MFYA 2R8ZA 4KTTE 5DCYA 5DNUA 3AQIA 1W4ZA 4B44A 1PL7A 1GZSA 2VQ6A 3HCOA 3F1LA 3KJGA 1ONSA 4URWR 2QY6A 3CLKA 2AOVA 5D86A 4OFBA 3TJMA 5BSKA 2VJDA 4M9UA 2GAOA 3BMCB 2Z3ZA 4RHFA 2B1QA 4JYMA 3FDJA 3K9BA 4RHYA 5DMXA 3B1JA 3AEKB 1XMSA 2XYGA 3ENWA 4L8GA 5ADWA 1KMHB 4FYKA 3JD4A 1TB4A 3ANLA 3ROFA 1YQGA 3USZA 4NG5A 3VR1A 4GG1A 1OFHA 2GT1A 1A2OA 1PV4A 3DAPA 2CDAA 4O2BA 1X6VA 1RHJA 4Y1RB 4C2AA 3BA6A 1MXHA 3U48A 5CFQA 2WJWA 4RJTA 4N9WA 3TX6A 1I51A 1VE1A 3O92A 2IYPA 1ZH6A 3EDYA 3FIUA 3OPVA 3EDCA 1BX3A 2P5SA 1UR5A 5LDGA 4JVMA 3OFJA 1R6UA 4LCBA 4X24A 3WJAA 3KKPA 3C1OA 1A71A 2QUZA 1AUOA 3G17A 4PQRA 4NONA 5EHIA 1V37A 3FHJA 1NF2A 1LB1B 2C0PA 4PHFA 3NFRA 2VJPA 4EGQA 3P9SA 4I6EA 4MINA 2FQXA 1WPGA 3U4QB 1SJ9A 2EGHA 4MWTA 3WIDA 2HLDA 2A0YA 3PJFA 1QR6A 5KZMB 1U0HC 1OFGA 3GLFB 1CULC 3OPYB 3OJ0A 1DAIA 1YDHA 4F9TA 3GLHB 1OAOC 3DUFA 1T0UA 3HKBB 3PXGA 5HUQA 4X66B 3R1IA 2PX3A 1YE3A 1XD2B 4RFLA 5DV9A 4CTMA 2Q3DA 3SJAA 2ZYDA 5D85A 3QOFA 4TZ0A 3ME5A 4NOMA 1TGYA 1QF6A 2NU6A 4A27A 3EC7A 4D26A 4LE2A 1ES9A 3KXDA 4KH1A 4U6NA 5A06A 3CX7A 3MTQA 4MZXA 5A71A 2ISSD 1YQXA 1VECA 2ZJ4A 4OP3A 2VHJA 4GW3A 3ETHA 3IA2A 4EJ0A 5IRCD 4TQGA 1HT1E 1EUZA 3TB4A 1EM8B 2WBLC 4DARA 4B3CA 1E0AA 4LV5B 3E9NA 3K2QA 2CMFA 3R24A 4LEIA 4D8XA 4R1QA 3IXLA 3U39A 3DBLA 1VSUA 1N7GA 1AUPA 4L5JA 4MYTA 1SOUA 2B2XA 4KVZA 1T9HA 1L9KA 1GSIA 1ICIA 4CRWB 4QYWA 1SVUA 1ZD9A 4BNFA 2WWFA 2ASVA 1O0CA 5JDIC 2BM8A 2WKRA 3BIFA 4WLEA 3IO5A 3UFXB 1W30A 2PH3A 3T1HB 3O74A 4K28A 2NZ2A 1V1RA 4JOSA 3R6TA 1JWLA 1MPXA 3U7FB 3GQBB 1QHHB 4KQEA 4RKRA 2BKVA 1OASA 1XXHB 3NEYA 4Q18A 1WNTA 5LU9A 2VF2A 3K1YA 3UXEA 4PBSA 1QGDA 5DOVA 1XHLA 5DSTA 1IZZA 1JEJA 3PNBA 4KZPA 4EH1A 1ZZEA 4ZT4A 2XB2A 2FW9A 4C2UA 3VR2A 1S02A 3U7IA 2PGDA 5JVDF 1OAAA 4UCFA 1RC1A 5IAGA 4HN4B 3P4XA 2V7GA 1DQNA 2JAQA 3I72A 2C5BA 1ZRNA 2IHYA 4FOSA 4PQGA 5AJHA 4NDZA 2QM0A 4NBRA 2BMAA 4P6VF 1G20B 2XA9A 5SZJA 3WP0A 2PRIA 2G3YA 4LMBA 4YMGA 2SCUB 3KR2A 3LI2A 3CYFA 4PG4A 4PN7A 1NW7A 5KTRA 2DH6A 4IKPA 4CIVA 2B1RA 5CB4F 1SXJC 2HGSA 4B34A 2XE8A 4QX6A 3GC6A 3M7IA 1MEJA 1IJFA 1K89A 3ER8A 5FADA 3WRYA 4IO0A 1RE0A 1P5HA 2F62A 1NSFA 3OE5A 3E5NA 3MGAA 1F8GA 1Q1QA 3V34A 4AXXA 2OV1A 1UK9A 1H2YA 2WAMA 3E7FA 4MW5A 2PL3A 1L5OA 2BFMA 3BL5A 5ICMA 2ON6A 1K98A 3HCDA 5F64A 2BW0A 4XCQA 1JAHA 2Q4BA 2RHWA 3ORFA 4DA6A 2QYHA 4AMZA 3A37A 3EDMA 3VC1A 4ESOA 3QXSA 2J59A 3M8KA 1SC1A 3L6CA 3EIWA 1TA9A 5DSXA 4EJMA 5ARBA 3F8WA 4LE1A 1CUAA 1NJSA 2QRLA 3PQDA 2P2DA 5LFAA 2AWOA 4KE8A 5ITWA 5E8RA 1Q0RA 2ZBRA 1RAEA 3KQVA 3NOQA 1H0SA 1MRSA 1HX7A 3BHNA 1N9GB 1ZRSA 3DCYA 4GMFA 5HCIA 4KBGA 2Z43A 3E3MA 1IQUA 4MCHA 1G8PA 5IM4F 4KXQA 1KEEB 1MVLA 3TK1A 2X6TA 2B36A 1MBZA 1X7GA 4JLJA 3T9EA 5E1OA 4BE7B 2J33A 4WD3A 1HZJA 3BZWA 1EVYA 1BDMA 1P2TA 1QHIA 4LN1A 4R9SA 5DDIP 3TLKA 2ZE8A 3RIGA 3GN1A 4F92B 1MO6A 1B1AA 1CZOA 4I6GA 2Q5IA 3IMCA 1R74A 4JI3B 3QU2A 3O2NA 1CEQA 3GT3A 2EZTA 2G0AA 4FZRA 5CLFA 2WMDA 1W0CA 2AFHE 5G02A 4BQFA 1Z6ZA 1MB0A 2VTKA 3BS4A 4DIBA 1YFZA 3NTUA 3OOEA 5E2IA 4MWSA 2HSDA 2H9AA 3KTDA 4XGIA 4IL5A 1R4MA 4U2EA 3RARA 1BMFA 3GJRA 3UK2A 1M5UA 1THTA 5BYKA 3GLIA 5CEEA 4JLMA 3CTPA 2YFQA 4TYMA 2YN0A 2Z1NA 5C1PA 2X2PA 4ZCQA 4F4HA 2A30A 3S2UA 1SXJD 3EXEB 1N2HA 4E1BA 1T5HX 1SHTX 1H4QA 4TLAA 2GILA 3CG4A 3MIIA 3ILYA 4RK7A 1B8VA 4MDHA 2O48X 3NHYA 3B1XA 4DANA 3CUYA 2VXCA 3NJ4A 3ON5A 1W96A 5CFPA 2PEYA 4RVDA 3C3PA 3TWOA 2O6HA 2VNSA 4OTZA 2XQJA 5H9VA 3HJAA 3RREA 3L6DA 4XJVA 3PLAE 4FIZA 3AESB 2IYWA 2J5RA 4ER0A 4PCVA 1ONPA 3QNWA 1Y48E 4QNMA 4D42A 3PPWA 3L0IB 1G3RA 2YY6A 3DTTA 4G8DA 4IVNA 5ALVA 5ULLA 1VIYA 2VZEA 2GVNA 2QD4A 2V98A 1P7ZA 2ECKA 3N70A 4RCVA 4BQQA 4HQ6A 3FNHA 4ZO7A 5G1PA 3QU7A 2LE0A 1GTRA 3WMFA 5IF3A 3S28A 3LW8A 4X9XA 2AC4A 1X2EA 4MRSA 4C29A 4EHFA 4NXMB 2GPAA 2W6PA 4G63A 3ZZMA 3V4OA 4DFDA 3ANYB 4WZAA 4ZHSA 5A03A 4QHSA 2H5LA 4WBNA 1IHDA 3QSYA 1TQ2A 16PKA 1IHUA 4GPIB 4A0GA 1AQJA 1Q1GA 3AM4A 4HWKA 3C41J 2Q0QA 5AHRA 1Y3DE 4DMKA 1XRLA 4W7HA 3WA7A 4PRKA 3A6DA 3SLKA 1I2MA 2ZRHA 3DPSA 1ZGHA 1OOEA 1GZ3A 2GEJA 1L3CA 4BJ5A 3VR4A 5H3HA 1SCAA 4F4CA 3AK4A 3FZQA 4V02A 3DVAB 2DPXA 4IXMA 4JA0A 5LYJB 5BR8B 1IAQA 1CS4C 1NN3A 1P45A 3TCKA 3PQ2A 5CA1A 1A88A 1QIGA 2F6RA 4MLDA 3THOA 3VVCA 4AUKA 1CJTC 1GZUA 5FHQA 1GR0A 1UMBA 2OCXA 3BMQB 4DDVA 2F4VB 3ITEA 1SU6A 4IXWA 4EENA 3SMQA 5H3CA 3W2HA 1LEHA 4U7TB 5BNTA 2SECE 1DG1G 1KPIA 3H1FA 4A0QA 3N5CA 2NAPA 3OY7A 5DNDA 2NU7A 4TKMA 4IOLA 2H4JA 4AZ3B 2REQA 3I2GA 3EIOA 3PR3A 3C7KA 3EY9A 1X80B 1WXFA 2Z98A 4BCBA 4BP9A 3PC4A 3R8FA 1KQNA 2JFWA 3ZDXB 2JA2A 4COOA 2HIAA 1MXFA 1QBGA 4MUAA 2DC1A 2HJGA 3V1UA 3SEQA 4FI3F 4FMCB 5AJXA 3WYAA 4BYMA 4V0OA 4FFMA 1AQ6A 3OIDA 4D9MA 1I0ZA 4REQB 2YX1A 1NUUA 1JHXA 2C2HA 4KX5A 1H6CA 4JOQA 4Y2TA 1VPLA 2Q2QA 4OGGA 4JC8A 1KYVA 2Y2UA 3W5DA 2D1FA 3VU8A 1GCUA 1PO7A 1XBTA 1F2TB 1NF3A 4JA2A 3TBHA 5A5DA 1PR4A 3SCZA 2J9GA 4M0FA 2BE9A 1Q50A 3GEEA 1JFRA 1QQ5A 3BXHA 3SXUA 1Y6GA 4LF5B 1NW3A 2Z1MA 2C9ZA 3E18A 3MD0A 5CDYA 5SV2A 2H29A 3ZD8A 3OOYA 4M37A 3UBTA 2P40A 1WBBA 1Z5WA 1N2ZA 3TOSA 1Q1NA 5THQA 4BN0A 2JHCA 1ECGA 2QLTA 4HX5A 4OH7A 3P0RA 4JJGA 4RWEA 3USCS 1AKEA 2IODA 3THSA 4UNQA 2IYUA 2PD6A 1WMSA 3Q0EA 2OFFA 4CTKA 4ENRA 4PNHA 3S81A 1B00A 2F3SA 1TYZA 3PRHA 3NNSA 4KQ6A 1ZWLA 2J1LA 4TLDA 5LQAA 4J1QA 2WIGA 3H18A 4N5IX 4M3NA 2VRWA 5BWOA 2V9CA 1VL2A 3KWJA 1Y4UA 1THMA 1QU2A 5JMWA 3BWYA 3LPCA 4JELA 2A9QA 3LLUA 1NJGA 3EXHA 3FVRA 1P3JA 1UPCA 4ML3A 3TFQA 1QHSA 1GZ6A 4FQ7A 1GGMA 1WY7A 3L2OB 4FYMA 1B15A 1P81A 4R16A 4OB6A 5JYDA 2PT7A 3VJLA 1GPLA 1H6DA 3UOGA 4EEKA 4YREA 2VJBA 3RV3A 2GK3A 3LCJA 4R54A 2VK2A 3CR3C 2DLDA 4Z1OA 2HR1A 4N5LA 3LYAA 1KP2A 1N5KA 2GFQA 3ORHA 3QVXA 5AXCA 5LMUB 1ZGCA 4L9AA 1GSHA 1CETA 1LSSA 1AK9A 1GRRA 1E99A 2RK3A 5F1KA 1Z8DA 4O8CA 1G98A 2ZRFA 4RORA 2H4XA 3DC7A 3HUUA 4U7GA 3RHTA 3WIEA 3AR8A 5IDYA 1TKCA 2PTHA 1GYRA 3FOBA 1Z15A 1VE9A 5AHOA 3UAZA 1WW3A 2FPPA 2GZ2A 2YBEA 3TRJA 4ZYLA 5EZYF 2A35A 3UJ8A 5JQGA 1UJCA 3UWSA 1ODTC 1OGIA 1Z45A 4IEFB 5TV2A 3ZWQA 4AJ4A 3HKCA 1H9CA 1TYDE 2RC5A 1XQ1A 1P39A 2ZP1A 4LK3A 4BAGA 2W48A 7REQA 3ONVA 4J1SA 1DUIA 1UAGA 4LDZA 1M10A 1A9XB 4QUKA 3U3OA 1DRUA 3P2IA 4HUQB 2B5VA 3IDOA 2WD7A 5FBZA 2AUMA 3FTNA 5K0JA 1KQPA 2WNIA 4TVSA 2DQ4A 3S3TA 3WK9A 3KEGA 5EG5A 4R0MA 3SQXA 2Q5JA 3AEQA 4P5DA 2XZPA 3DL4A 3IB6A 3NASA 3T7CA 1O6FA 1Z25A 2AVDA 4BP1A 5JUWA 5LQDA 2PAFA 1W48A 3O4JA 1YWGO 5CHYA 8LDHA 1QH9A 3ZWXA 2UUBB 1I6KA 2A1TR 2PKQP 2D3WA 5LB2A 3H2IA 2IXTA 4YP9A 3U81A 2OK8A 3T9AA 4OQQA 4X54A 1RI4A 2PJUA 5CNKA 3FYSA 5JSZA 5FJIA 2L69A 2VPQA 3A2LA 3GMDA 4MW1A 2GMWA 1I01A 3D02A 1EPUA 1I7SB 1SU7A 3FGOA 1TAHA 4J9VA 2V1UA 2GBLC 3MWYW 1KRHA 3DTVA 2C04A 3COSA 3V6MA 4DV1B 5E7QA 3TDNA 3KHKA 1OROA 2HWUA 3PUIA 3HGTA 1VLZA 1L4FA 4H31A 4PPFA 1LA2A 1RLUA 2D0DA 5ALLA 1M2JA 4HGZA 4RV9A 1FSPA 1CUGA 2FEAA 2I6TA 4R1TA 5J59A 3VR3A 4Q48A 1VSBA 4WZBB 5E2BA 5CX1B 1N3LA 2Q07A 3QVLA 4HXYA 3R7DA 4RD0A 4RPJA 3IAXA 3MOIA 5JMOA 4KK3A 3NALA 2RJNA 4N3BA 3EG5A 2JLSA 3AI1A 1H0KA 1PR6A 4JKYA 2QN2A 3NWBA 4OCZA 2CGEA 1XTJA 1Z6PA 4N82A 4YDRA 2A92A 3H04A 1R9NA 4FCVA 3QKTA 1UOEA 3BB4A 5EZSA 5T41A 1GTSA 4WJZA 5JJCA 5ES3A 5M34A 1TZKA 1CRLA 2I0FA 1Z2EA 4FHEA 4BX0A 1R4ZA 3LVQE 1TLLA 2B69A 1A2BA 2FMIA 4KN8A 4F6RB 2VUIB 4AVYA 1FMLA 4YRIA 3G8YA 1TKBA 2GASA 1P62B 2WMNB 2ILVA 3V4VB 1T6ZA 1FS5A 5LZ7A 1OI7A 5HKOA 1MH1A 4XZ3A 5BR7A 1ZLYA 1N7JA 2HWKA 3GIDA 4HLNA 2C2WA 5TMDA 2I2XB 1KY4A 1RADA 2OECA 4LRSB 2VAVA 4GXNA 2H18A 4ZCPA 3W5IA 3INRA 2AX4A 2QN3A 1UFRA 1U4OA 3G0IA 1Y5NA 3YASA 2QUIA 2KE5A 4CVNA 4LF9B 1JXQA 5M2QA 1GZHB 1TTTA 2YS6A 4CEIB 5JNVA 1FLAA 4O2AF 1WY5A 5TJ9A 3TPZA 1AK1A 5K6AC 4FFRA 1E1RA 2QP3A 3GRVA 4HEHA 2XKJE 6ADHA 4RSMA 1HO3A 2YYYA 1I3CA 3GEMA 2G71A 5LM3A 1EZ4A 2WU4A 1SCJA 4G24A 5MN6A 3OP1A 3SQDA 3I8OA 2JL1A 1SXHA 4EG1A 3HA3A 5EJGA 5BN5A 4O8ZA 4HCJA 2OAEA 1BWSA 2TMDA 4GX0A 4O4JF 4QT0A 1EXMA 2GERA 2C5EA 2V7PA 4J43A 3ZDAA 4RLHA 2WFLA 2JNWA 2NSDA 1NVGA 4J2TA 3D4IA 2MYTA 3TZEA 3R20A 2NGRA 3THWA 3G8CA 4REOA 1QQAA 4I50F 5ALPA 2GSDA 3T0FA 4M46A 4P4SB 1TQ6A 2PL9A 4I5FA 4DNXA 5J5VA 1E7WA 3MERA 4MR9A 1V48A 1DBVO 4WQMA 1TUGA 1QTIA 3KOZA 4DA9A 2B35A 3IE2A 5KNLA 5T7BA 1GG8A 1JHQA 1TEZA 1Z2OX 2R6DA 1RPNA 2L2QA 2OCIA 1JIKA 1QIJA 5KYUA 3UZUA 3SX4A 4Z7JA 3EJWA 3HV0A 5EE0A 4KO3S 3OKPA 2O7RA 1AKQA 4OGFA 5FR2A 3HU3A 5T8KA 4NYIQ 3RIXA 1X38A 1IM2A 1J06A 4MQBA 1EFLA 4GIBA 4D9BA 2VF4X 3WY9A 4QICA 1V4NA 2W42A 1FIUA 5EKDA 1EFPA 1Y81A 2BRUA 2XVXA 3I58A 4CLHA 2VUHB 4JAVC 1GQFA 3DDHA 3L7YA 2FY8A 4H9GA 4IMIB 4QELA 3OZBA 1TAUA 1TDJA 5K4GA 1L3BA 3KKLA 1SXQA 2JLZA 2FLWA 2DETA 4JYPA 2JLCA 1ZH4A 4OQZA 2YXDA 1Z0FA 1N0IA 3IMFA 4C06A 2EBHX 2P79A 2PWAA 1LPBB 2B6HA 3G49A 1VA5A 1JIVA 1H6AA 2VYND 4ZVUA 3TH5A 2EZ4A 4EUNA 3IXMA 4YMIA 5PNTA 2JK0A 4FGLA 4WOJA 4FD2A 1JEYB 4XXHA 3RO7A 1NATA 2IU6A 2VAXA 4J0KA 4AT1A 3OM1A 4BX8A 3ZY2A 1GGHA 1C14A 1O1YA 1SAYA 1A2QA 3RFVA 5DTQA 1TYCA 5COQA 5A6SB 4YAKA 2QRQA 1H2ZA 5EEHA 3ZQ6A 1NM5A 1FTSA 3UGTA 2FYTA 1V8PA 2ZWVA 4UDNA 4UHBA 4HLUC 1Q7TA 4ZYZA 5BUCA 5BQOA 3O5AA 2W37A 1TKAA 5HJ2A 3SIRA 4M9XA 4BV3A 5FTKA 1NG9A 4CGZA 4RKWA 3E4DA 4HDMA 5BN4B 3EMKA 1PL6A 4AM8A 1N6KA 4MB0A 1Z2DA 5J5CA 3P2KA 4P3KA 4Z0NA 5JD4A 4FM9A 2CLIB 2R7AA 1RZRD 1X87A 2AMLA 3HP7A 4JJ4A 3WA6A 2PQ6A 2ZIAA 1P33A 3NT5A 2WHQA 5K8JB 3MCTA 5HMLA 4X1YA 1FXWA 1PR3A 1G2IA 2ORWA 2UKDA 3IJRA 5DJ5A 4B7ZA 5K2OA 1ZK4A 1C80A 2LZ0A 5DGIA 1D9XA 2XMPA 3BF7A 5EIHA 1HQCA 1PWXA 1QV6A 1M6HA 3PXCX 4ZDKA 1QG2A 5WRFA 1NGSA 1DDGA 1WL8A 2FRVA 4O0LA 5ALIA 4ETMA 2CE2X 4RCYA 4WK6A 4WLNA 3W8EA 5CB4B 2XUKA 1GFZA 4RD1A 4DLXA 2MYPA 2NSYA 3QKSB 4GMDA 3GAZA 4MV3A 4MUKA 3HU1A 3O84A 1Y89A 1UJNA 2V59A 1TJPB 3Q9NA 4KO8A 2RARA 3GCDA 3I61A 3T5MA 4Z3OA 3IUBA 4H0FA 5CLQA 4YGXB 2FP4A 3RODA 1FFDA 5B6IA 2WB2A 1VXRA 4HJXA 5P21A 3EEYA 3ROQA 1ILWA 3EXFA 3H3XA 1EX9A 1T0IA 3OAAD 4MHSA 1U99A 4FEYA 5DLYA 4N48A 2H2IA 2B9VA 4FBLA 3K8OE 2P91A 2YRFA 4O63O 1H8HA 3AF5A 3O83A 3W04A 5I4BA 2YMQA 2WB4A 1JSZA 3N2NA 1ZVJA 1YKFA 2CNNA 2R6HA 4LY3A 3COJA 2A59A 2YWEA 4BVHA 4E4RA 3DOUA 4TSRA 2FZVA 4Q9KA 3N2KA 5ITZB 4HWSA 5HXAA 3U56A 2PIDA 3A4IA 1FTQA 1KIFA 4E5PA 2FSGA 1SKAA 2GJAA 2RHGB 3EVBA 5K0SA 1U3UA 2VATA 1KE1A 2DUWA 4FJ0A 2ATIA 1CIVA 2D6FA 2PRKA 5EE3A 5DGCA 5CURA 1V1MB 2AN3A 5BXYA 1ONNA 4N0DA 1OXXK 1C8BA 1PJAA 3ND6A 4RD2A 5T4FA 4AC9A 1DOAA 2QG4A 4U2GA 2I67A 4O1HA 3SSOA 3UJ6A 1MX5A 2IQ5A 3IX7A 3JQFA 1B26A 3I6BA 4P8RA 4IMRA 4ZN6A 3HVHA 4C21A 4M89A 3MZ0A 1XRRA 4KDRA 1QVWA 3QOWA 1LLCA 3CV3A 5IAKA 3KG2A 2UYCA 3AC0A 4TN5A 1I10A 2ONKA 4QYIA 5HBRA 5K2MA 3RPEA 1F5NA 5BWLA 4BTEA 1DKNA 2FZ4A 2NADA 1WD7A 1DL5A 2R87A 1GQQA 3ZLUA 5A9TA 1R0XA 1EWRA 3W6OA 3GR6A 1E9VA 1RIFA 2B8WA 2Z0MA 1OBFO 3AV3A 4Q5IA 2WG2A 4L22A 4AURA 4QJBA 4Y9SA 5HZHA 1RAIA 4JCCA 2B1GA 4II2A 4LGMA 5E7IA 2C9DA 1JH9A 4R3UC 1X42A 3M6IA 1U3GA 1DB3A 2XRFA 1MZVA 4LJ8A 4YMWA 4IILA 1BHQ1 2B4AA 4FS8A 4NRDA 1PBNA 5DHTA 3RUEA 3UYLA 1VLLA 1E89A 5JADA 4LJLA 4YDSA 4GVLA 1XMOB 1NX9A 2D3TA 4BU0A 4NZMA 1HQYE 2BEWB 2IBMA 2X0FA 4RLSA 3ZHYA 2XJ9A 2GZDA 3RD5A 4G5RA 4ENQA 2X4GA 2RI0A 4TX1A 2V7BA 3HCAA 3NIBA 3Q15C 4MKGA 3ERCA 2J6CA 2M6KA 3JAKA 1K7XB 2G17A 3S4YA 2DJ5A 3K0KA 3HQ4O 1HNWB 4ALLA 4RNCA 1VIDA 1TIPA 4D97A 4PQEA 1WLSA 1QDLB 4LUCA 1BW9A 3P2YA 1SXIA 5KOJB 1AUXA 1QGUB 1RLIA 2HSGA 3BXOA 3JD0A 4JGIA 4A73A 4C1BA 2IYSA 2F00A 2YMPA 1UKEA 4Y6RA 2JI6A 4I19A 5B1HA 2O8CB 1R8YA 1R9MA 3BE5A 4TKLA 4E0BA 5IAOA 4UBLA 3CMCO 2OKGA 2Y9MB 3FNFA 1VYVA 3EXIB 1JN0A 4G09A 3W4IA 3CCFA 3CINA 3OZXA 4Q0MA 4CZ2A 4DJAA 2ZXEA 4UEWA 3L8GA 1OBHA 1SCQA 3RLIA 1O96A 2XITA 5A7HA 1QIIA 4YAJA 1PFVA 2QVZX 2GLUA 4TXLA 2ZXFA 1DEOA 5E95A 2LP4Y 1T0PA 2GZHA 3FSEA 5FUMA 4JI6B 2ZRIA 1SHZA 3KHUA 1ST2A 3I3SR 2ZRDA 1PEAA 2XE4A 1IOLA 3V4ZA 2VDWB 4I4CA 1B23P 4GRAA 4WXHA 2HRDA 3CW2A 3PA8A 3VPGA 5IKPA 1U9ZA 4DB4A 1W5EA 2X8BA 1YZYA 3F3SA 4LOIA 4CHGA 2XT6A 3I5UA 1USVA 2B99A 3PQ6A 3WLFA 3PDJA 4K03A 4NZOA 1TD1A 1JFFB 3PDIA 4OSPA 3HVRA 3IAM1 2W6JA 2OXEA 5LZ8A 3WGUA 3AHFA 5G0UA 4YWHA 5A9RA 5JO0A 3HCWA 1IN7A 4M6WB 3U4IA 4ZPXA 2XNHA 2IYLD 2DKFA 3W5AA 3KSDO 2PJZA 2WWYA 3R9WA 2JATA 2CXSA 2F9MA 3UUFA 2YVKA 4MICA 4LG1A 4S1WA 1R9GA 4CKCA 4BNLA 3D5EA 4E5MA 1EK1A 3H2BA 2FSVA 3BA1A 3VAZA 3VO1A 4HGQA 5I7VA 3R75A 1YVDA 3NONA 4JKIA 4OI4A 4AS1A 2AW5A 2BEVB 2ZULA 3IDZA 3O8QA 4L75A 4DNPA 1OLXB 2Y6UA 5L4NA 2JIZD 5J1TB 2PY6A 5T64A 2REOA 3RVSA 2QN6A 4MWCA 3B20A 3IAS6 3V4SA 3VOTA 1EK2A 4EHIA 3AUSA 3BORA 3GRAA 1AZTA 3QHPA 4TXNA 3FFWA 3H6GA 2WT8A 5A2QA 7MDHA 1TEHA 3GUHA 2AXEA 3V8EA 1NT4A 3UVEA 4RNDB 3JQAB 3PC6A 2ZYVX 2DVMA 4CG1A 3ZEAA 3QU5A 1LRKA 3OQOA 1NONA 1LPSA 3E2MA 3K96A 4KJXA 3K9CA 5BOSB 4DOMA 3UK1A 2DF8A 1A1VA 3EZLA 1HK7A 4MQ5A 4EI2A 2HM7A 3GJ6A 3V4FA 1YONA 4D4IA 1O8CA 4DS3A 5KJFA 1Y6ZA 1NSTA 1XVIA 2J85A 2UZ1A 3Q9UA 3D64A 5DCWA 3UJNA 5JOQA 5TQ2A 4ZQBA 1L5MA 2YQ4A 3I2HA 4MKIA 4KUEA 1GNSA 1SKYB 3U1BA 3EVAA 3Q3JB 1FU4A 2Q3BA 5PGMA 3VGPA 3TIGA 5AUOB 2DP4E 4RA9B 4BOYA 1XTRA 1TUEA 4YMVA 5I7OA 2X2OA 2RDMA 2C92A 3C3WA 3T5TA 3V8PA 3VGJA 1FDOA 4BQSA 3ZE7A 1BZYA 4XFJA 1V39A 4OGLA 1VRWA 2DU8A 1LSJA 2HNBA 2R44A 2AYYA 4JMLA 1TAQA 4B0PA 4DV7B 3BWXA 5DRYA 1EIWA 4ZAWA 4HUTA 3FPSA 3ROEA 1ZK0A 1RVV1 3FWPA 3G6WA 3O0TA 2IW1A 3A4VA 4TTRA 1L7NA 4HK4A 2X5NA 4B17A 1P1FA 3CU5A 2Q99A 5CVCA 5I7EA 2R86A 5AW3A 1F5SA 2M32A 2MSDB 3E9MA 2I6GA 1V9CA 4ZQFA 2I2WA 3KPYA 4RLFA 2UXDB 4HMOA 3C5CA 3RADC 4W5OA 3EGIA 4GEKA 5LMNB 2GCOA 5LXTA 2ZT7A 3NI2A 1KRWA 3BN3A 4KGZA 4JVSB 4DDWA 4HSEA 1ZYUA 4ESEA 3EZNA 3O1LA 3WTCA 1OB2A 3RW9A 1WUJS 1J8YF 1Y7TA 4ENTA 1FBTA 2OD2A 5CB8A 2WWWA 2YWGA 3H6HA 1UFKA 3SAJA 2VBFA 3NHBA 4OMFG 4C6TB 3PDHA 2COUA 2E89A 5KYWA 3PFNA 2ZRCA 4QTXA 4A36A 4L4XA 2YQZA 4MCJA 2VDLB 1PNTA 4ILEA 2HLDD 1L8LA 3ITKA 4Q00A 2FQWA 2OL4A 1E5LA 2Q9AA 2QD5A 1QOQB 4L2IA 1NU6A 1TZ2A 2I80A 1P7VA 5TGTA 1ORRA 3I1IA 2VKQA 3T54A 2H1OA 3PSAA 3BF8A 3FKSA 4YLYA 1M0EA 1LS6A 4YCSA 3QG5A 4L7VA 2QZ9A 1LF5A 4OATA 1DBIA 3BQ9A 3DVRX 2GYWA 1L8XA 4AJPA 3DE1X 4C08A 3K72B 4M22A 2QPAA 1LD3A 2SKCA 3LVRE 1HSZA 2H07A 2PTGA 2MMCA 1ESCA 2XRMA 5EAIA 4ARVA 2IUTA 1F38A 1E1YA 3UK7A 1PWEA 1EI9A 4R1PA 2QZSA 2QI9F 3WRYC 2AYZA 3K4QA 4N5MA 2WPDA 5ITSA 4Z7QB 3TCXB 4TQAA 3NANA 1SH7A 3HCEA 4DYVA 1FUKA 1ZC3A 4AO8A 3TM4A 1P9WA 1YK0A 3NHPA 2YVQA 3OZGA 3GT4A 3BGIA 1F0NA 1PNQA 3DXYA 2Z2IA 4UMVA 2NXJA 4YS6A 3LK7A 4KSCA 1T13A 1P1BA 3LUAA 3I32A 5FOSA 2IC5A 2FGJA 5FPYA 2NPIA 3DV0B 1NULA 3DHYA 4PXYA 5EXEA 5M7EA 2ABWA 3DM9B 4TKUB 1V3UA 3NHKA 2ZETA 1OU4A 1UUFA 3OTIA 3FKJA 4DQKA 1FFGA 2GEDA 4C4SA 3C74A 3RRBA 1D2AA 2PGJA 3M9LA 4G1BA 2Q8NA 1DC7A 3W6PA 3EWNA 2QRMA 3M9WA 1QIHA 1LH0A 2XUQA 1GGEA 2GJ9A 3ETLA 3JZIA 2AHOA 3ZXUB 5KTOA 5TJHA 3JATB 1JA1A 2D5BA 4JZKA 1GAQA 1SUBA 1NR5A 1RJ9A 4PRZA 4M7WA 3R3ZA 3OT1B 4OJNA 1F2UA 3O94A 5ESRA 1TUIA 5KNBA 1WB9A 3VR2D 1QGOA 4KQWA 4M1OA 4NL4H 5FLYA 3ELUA 1VBKA 1N1DA 1XWFA 2PZ8A 1QIEA 4BAZA 1XZAA 3OZVA 3C8MA 3GLKA 1HDCA 1NQTA 1LDGA 2C59A 3MAJA 4D46A 4DSUA 4MV4A 5KU1A 3DP7A 4KMRA 4WCVA 2E4UA 4OB8A 2HYIC 2FN7A 2QAJA 1CE8A 4V0RA 1Y3BE 4Z1MA 5JPCA 2Q5QA 4FCTA 1J2EA 1Z4JA 1K4YA 4J75A 4CIYA 3D7LA 1O57A 3I09A 5CRIA 1L5ZA 3EWIA 2BE7A 2G63A 1U7XA 3ABOB 5H68A 1SZPA 4PLHA 1PHPA 2O2XA 1EVEA 1S1MA 2PLFA 1R64A 5KHLB 4GYWA 3H83A 2JIQA 1NMXA 3M70A 4Y1FA 4YYZA 5B5SA 1ODCA 2WE8A 3M5WA 4P4TA 2XVYA 4BJ3A 1N34B 1ZXBA 2JLYA 3L1KA 1NA5A 3FNEA 4PXAA 2UUPA 5I3ZA 4JBLA 2OZKA 4KHPB 4DCOA 1KYZA 1ENYA 4LYGA 1G0OA 4LDAA 4MV9A 1LNZA 1FMFA 1HFKA 4BTLA 4IWNA 4J1NA 4DL9A 4DJJA 3L7IA 3AIOA 4FTWA 4UJ5A 4YH1A 5AICA 4TWZA 4EDFA 1KH2A 3EGDA 1N5JA 2IHUA 2HIHA 5CYGA 3WXMA 2QB5A 1JT9A 1PI3A 5IKEA 1NW4A 1PE0A 4ZPJA 1Z38A 5DTEA 2AD5A 3OPYI 5CDHA 3K1JA 2ZIUB 3LQQA 1IEQA 2HDOA 5KC9A 4KWCA 3VV3A 4ZZ1A 3BD9A 4G1EB 2ODTX 2IL1A 1NOKA 3E0XA 2UAGA 2PMKA 3KOXA 3X2FA 1N3YA 1D2GA 4E5KA 2WJIA 3IALA 2AGVA 4AMBA 1RYEA 1JIUA 1PVDA 3IPYA 1WDWB 2PM8A 2BFCB 3HJRA 3PFGA 4DPLA 3LJKA 2QAGA 5B1SA 1ONBA 1X3SA 1OYWA 1IBRA 4KQMA 3O9ZA 4N03A 5K03A 1W6UA 5EXXA 1SZDA 3IP5A 2BHNA 4CIXA 1WV1A 1NUSA 3WS7A 4N1AA 1QYRA 3U49A 1FTYA 3VR0A 2CMDA 2QGZA 3Q72A 1ZN7A 4JIGA 2EYUA 3H99A 1RYDA 3SSNA 3U3MA 4BY9E 3VNVA 3FUTA 2IKQA 4XGRA 4CG0A 5EY5B 3BWVA 2P6UA 4ZALA 1DJLA 4ZJYA 1Z4LA 1UKVY 4TTVA 2IHTA 4OA5A 4IZIA 1ZAKA 4AS2A 3L05A 1J4AA 4RANA 2E9SA 1YSCA 2PBZA 1RM3A 5LKRA 5G2OA 2AZDA 5AW4A 4I5EA 5IDXA 3VPDA 4R1SA 1BDJA 3ANXA 3QHAA 5LZ2A 1RBMA 3INNA 5IFKA 2A5LA 1FDVA 4EK9A 1WDLA 4F3TA 3P27A 4DG9A 4HZUA 3RUCA 4FDVA 1QS0B 1ZJ5A 3S40A 3C8UA 4IMPA 3DV9A 4OQYA 4HDQB 3HWX1 1UDCA 4UUAA 1HE5A 3G6KA 3IERA 3B1FA 3HVKA 2Q3EA 3A6EA 1PQUA 2HCBA 4ZI7B 2VRCA 3T1VA 4EKDA 2G7ZA 2JAHA 3EVDA 1QTQA 2W43A 3R7WA 3RYCA 3TPFA 3DNMA 1FF9A 1C1YA 1UT6A 2YCBA 4YT2A 3FB1A 5JZ9A 3OM8A 3JVUA 1Z7BA 1YCGA 4K9SA 4M1MA 1GJRA 1WG8A 3FPGA 1J7JA 1DKMA 3AJRA 4R4JA 1ZH2A 4YONB 5CVEA 1NQXA 3B3FA 1ILEA 2Y0EA 3VR4D 7ADHA 1XNQB 4N0PA 1G5QA 2FPUA 1RPTA 4HKTA 1XNJA 3WLEA 3BJRA 4MWDA 3IQFA 1MDFA 1T3GA 1Z5ZA 1HYBA 5DNAA 3UHOA 3VA7A 2IZ0A 3OFNA 4QLOA 1VGRA 3ILHA 4QXQA 3RSHA 3IMGA 2ERCA 2NTJA 3LWNA 4M0KA 4OQMA 4PGMA 4PN3A 3K70C 4H18A 2O54A 1VIMA 2JCVA 3ZV6A 5EJEA 1JPNA 1NNLA 3CZQA 3GJ3A 4FW9A 4KIUA 4BLRA 3OX4A 1M3SA 4L08A 2B21A 5DBFA 3GMSA 1LVHA 5GP1A 2A86A 3WGLA 4MVJG 3I9JA 3MMNA 4M1YA 1NBEA 1X74A 1C3OB 1L4EA 4RZ3A 1I9CA 4KKXB 4MWZA 2QN9A 3MWLA 2PU7A 4LY0A 4LWQA 3OQ1A 5EMMA 3SJ7A 3ZVRA 3CUTA 2O1WA 5BV8A 4U7HA 1IWPB 1P9RA 2QTZA 2BFNA 3WLMA 1II8B 4OQFA 4ZAVA 1L4LA 2G80A 2OB2A 1Z4QA 1BSVA 3IDAA 1XJ5A 2YZNA 1CW2B 3VMFA 3VYRB 3LQYA 3N2GB 3OM9A 1A0OA 1RLTA 3VPXA 4G67A 4Q4AA 4YCBA 2WJYA 4FFDA 4HGOA 4FKZA 1QLHA 1D2HA 3DWIA 1RFLA 4OMCA 1NLYA 1EUQA 1JEDA 3K30A 3T7IA 1WKVA 3N53A 4CF4A 5KQMA 1GRQA 1TF7A 5FULA 2NACA 1ECCA 2C42A 1MU0A 1PJ3A 1X7XB 1JDSA 4BVLA 4NYJR 3ODPA 1TQ8A 4GVXA 3BMCA 4GMKA 3KLPX 5DULA 3U6KA 4PYMA 3HXTA 3OIYA 3IPRA 3AZPA 4HH1A 4WINA 2FNAA 4MITA 4X41A 3ZW7A 2PKWA 2JJ1A 5IPFA 1AO0A 3AVQA 3T5BA 4JIMA 3HL0A 4MPDA 4MVJA 2CXNA 4X6LA 4FR5A 1RWKA 2EF0A 3AI2A 4RDHA 1P0CA 1QKJA 3I64A 4Q7QA 5B7GA 3CNHA 1H3EA 2PUBA 1E94E 3KR0A 1HYQA 2JFUA 4TXHA 1G6Q1 3EF1A 3ZV3A 4EELA 1CRQA 1PJCA 1YRYE 3K20A 3QKIA 2XDQB 5TF4A 1ZIYA 4KRGA 2ES4A 4ZEOA 1M2OB 4X0EA 3GELA 4EFLA 5KMGA 1OLUB 1V2HE 3Q98A 1JIQA 1Y7PA 3K70D 1L5RA 1JF8A 4DR6B 1PFGA 2PLWA 4H7JA 1IM8A 1GP2A 2G4CA 4FK8A 4HAIA 1SQFA 3UAVA 2V9ZA 1ZOSA 4B40A 2O7QA 3OE4A 1Z0JA 1YB2A 1D6NA 3ZI4A 2XYVA 4KE7A 5AK3A 1XPUA 2FA9A 3K9NA 4L27A 3K4PA 1N2EA 1U0SY 3ND7A 2Q1TA 3GJYA 1T3SA 1VRVA 2NWQA 2V8BA 2ZWPA 2ZRNA 4G5SA 4KUHA 4F2HA 2OV8A 4ID3A 4NMXB 5DWDA 2GYVA 1YR8A 3OOSA 3OJLA 3VSBA 1FRVA 1ORWA 3QLTA 1AKTA 2ROQA 1P77A 5HF8A 5HRCA 5H9WA 4TZKA 4HQ0A 2Z8YM 1Z34A 4KWEA 1EFDN 1DO8A 1JFLA 3BMNB 2G25A 1C9JA 4DLLA 5KYYB 3OQ6A 4L3WA 4B82A 1NVFA 1RC0A 2Z57A 1USGA 1TZCA 1WX1A 2D2XA 2GCNA 2X76A 3DWGA 1VLQA 3EVNA 2H1LA 4WBSA 5AKKA 3ICWA 5DP2A 4RKYA 5EXPA 3SHTA 4C4RA 4GBJA 2ODQA 2JFYA 1RRCA 5AJYA 3N3BC 5AI0A 3LD9A 1IRXA 1ACLA 4WGFA 4QSHA 1LWNA 1GTZA 2BGJA 5L53A 3WJ2A 5ALRA 2J9XB 1A95A 1EM8A 4EPTA 5IC6A 4GYKA 1BRMA 1NC3A 3PX3A 5AHKA 1JDBB 4XI9A 1E6KA 1YC2A 3UMCA 2YYSA 1R4NB 2V54A 5DBGA 3V2UA 3RC1A 2OBLA 4AYWA 3ZXIA 4U02A 4HS4A 1EGHA 3ER6A 3ICOA 5JO9A 2OORA 5BRNA 4AYTA 4YRQA 4MI1A 1ATIA 1QF7A 4URVR 5CG2A 5JFTA 2J9YB 2VN8A 5A7GA 3GVCA 4QO8A 1JT2A 4R7ZA 1VPTA 1ISGA 1EINA 2G1JA 3AR2A 2F7SA 4W5JA 3J7AC 4P38A 3VSCA 3EXAA 2H63A 3K5WA 4A2QA 4B3GA 4JROA 4AUEA 1W73A 4Z54A 1T0BA 2XCUA 3DTVD 5AJTA 3KQTA 1XYGA 5ARCA 2J6BA 3V8MA 1KK0A 2QR2A 4GWGA 4MHTA 2WAAA 3GQBA 4CIBA 1HYHA 3M2TA 1P2BA 3E3LA 3KEFA 5D5QA 3AU9A 3HZHA 1UXJA 1YV9A 3JU3A 5IC5A 1KWKA 4QBIA 1JKFA 4K7JA 3RVPA 4DBZA 3FR8A 4KQCA 1OA0A 4RIIA 3E7WA 1GAWA 4O3MA 2JLVA 2VYFA 4CG2A 5C8VA 3WLAA 3MAAC 4L4YA 3TI9A 1N5MA 1TX4B 4CKBA 4ZGWA 3PEYA 2WKQA 3H6KA 4NENB 5K0LA 1GZVA 1UEIA 2VH1A 4IIDA 1L5SA 1KHHA 3B2QA 4H6WA 4NBUA 5AWFC 5E8JA 3TNYA 3LX6A 4NPAA 4OYRA 3T99A 1G20A 2YJ5A 3BGWA 4C3VA 4GLFA 2SCUA 1BJKA 2V7UA 3JVVA 4KRFA 4IFEA 1W0KA 4OJTA 5BSMA 4BO8A 3BREA 3HB9A 4LC9A 1M83A 2X23A 4Q3NA 4B79A 4AL4A 1URPA 4P4GA 5DLPA 4NNPA 1X1BA 2H00A 3E82A 4XYBA 1Z5GA 1Z74A 4BUZA 3T1NA 3H2ZA 3BMOB 2FOXA 5EP1A 2XUGA 4LS3A 3MCZA 5T8KC 1CERA 1Q15A 5ENZA 4MV8A 1UBUS 1CDZA 2YH2A 1KQGA 2BRUC 5J40A 3DZIA 1R5BA 2Z1DA 5FFMA 1E60A 1FU7A 1GA4A 4A6EA 1NU8A 4HMQA 4Q4JA 4Y6LA 5JXWA 3ZE1B 5C4IA 1GIAA 3CRVA 2R11A 3VU3A 3KJFA 4CETA 3IH5A 4Y1EA 1K6MA 2V65A 1MW9X 4S0XA 2X40A 4IH4A 2O06A 5EYPA 4ZEWA 1E1RD 4N47A 5FA5A 4D9CA 3F47A 4MUIA 1KFEB 4II7A 3WL8A 3MK31 2CNOA 4DWWA 4MW7A 1OFTA 4G4JA 4GL2A 1KEEA 5KTSA 3O9MA 4IHQA 3MVEA 4IUCS 5KTNA 1LX6A 2VT6A 4W99A 4UTRA 2FWRA 1JAIA 1N2CB 3KAKA 4OPMA 5JD3A 1DT3A 4ZEXA 4BMSA 3G59A 5KHAA 1ECLA 3NT4A 2CXPA 3LY9A 1EFCA 4PTZA 4BB6A 2V1XA 1HH4A 4L4UA 2MCFA 5HGXA 1E6LA 4EITA 3UATA 1NM5C 3CM0A 1YE5A 2QVCA 1MAVA 1A72A 1NZFA 5FUBA 1HPLA 5CIYA 4Q16A 1E2LA 4CIAA 3OF3A 1EU1A 1QV9A 2X3YA 3TAXA 1QE3A 2FPRA 4MP6A 3AR3A 4E2XA 1CUHA 1OWMA 2BFEA 2R25B 5IJ0A 1F4PA 2OV4A 1LV7A 1YZNA 3SDZA 4UEJA 4IDGA 1IXKA 2OFWA 2BH2A 4QM6A 1C7ZA 2FN4A 3FFBA 5DTRA 1SUAA 4M87A 5K3AA 1I1OA 1MQAA 1PK8A 2EVWX 2GNOA 2OG2A 3DKPA 3QX8A 4DA8A 4EJ2A 2OR3A 4PVCA 1ZD5A 3TKLA 3RS2A 1Z7EA 3GRCA 4NQRA 1V5FA 3O8RA 4CUJA 1FQOA 3UFBA 1UPBA 2NYUA 1BN7A 1HE3A 2CZCA 1G60A 2DECA 1OTYA 3A9SA 1KEPA 1SUFA 3MTDA 3IOBA 4XE5A 5IVIA 4W5TA 3OY2A 1AGRA 4ES6A 3B78A 2I4TA 2BF4A 1PYDA 2MDTA 2QE7A 3OCXA 5JSHA 4QGAA 1MDBA 2E5LB 2GCIA 3UOWA 1B8UA 1RXUA 4XD7A 3KJNA 2I8AA 1RC8A 2ESRA 1IAVA 3DO6A 3K09A 3ZQJA 5B4UA 3OU6A 3SNHA 3CRRA 4B3BA 4BRWA 3KNZA 3DLHA 3F8TA 4R1UA 4FEGA 2NU9B 3Q1LA 2FWNA 3V2HA 3DFKA 4I9NA 3WKEA 1PT8A 1JKMA 1DBRA 4ZC8A 3QZUA 4HFMA 2JFZA 5SY4A 5HS4A 1N2BA 1EBFA 3F4BA 3GMIA 3OZTA 5LBUA 2XNDA 3CWZA 3ANMA 3BIOA 3NWPA 1VJRA 3FAKA 3ENKA 1Z2AA 2QA5A 1AV6A 2DZDA 2QUJA 4PVDA 2G9VA 5DHRA 2Y1KA 3Q10A 2IHBA 4HGRA 3H9BA 5CFRA 3Q3EA 3RAEC 2RHHA 5FQOA 2AXPA 2P5UA 1E6WA 1T10A 2P7HA 3FETA 1FX1A 4ZCIA 1R0WA 1MC8A 3OH8A 1EG7A 3SYMA 3F6EX 4BLPA 1FDIA 1ZDMA 2R8OA 5AIBA 3OETA 5HZKA 3KUXA 1MJGA 4H77A 2ZRAA 4NVRA 1M6EX 4AECA 1GTJ1 1FA9A 2DBQA 2OE2A 2JD1A 2XLBA 3HEMA 3PJDA 5L40A 1GAXA 2QIPA 3CW9A 3U60B 3FHLA 1CLEA 1MX3A 4R8KA 3ZK7A 2R1TB 1OI4A 1TZBA 3HRKA 3BGOS 1WD5A 2OZLB 3BMQA 4QDKA 3VHXB 1JI0A 3JQFC 1RRPA 1I4DD 2XUOA 1WB5A 2XUHA 4JXJA 2NZJA 1HG0A 3FMIA 2BSAA 2ISCA 3EH1A 4L3OA 1KOJA 4Q3KA 5K8LA 2JD2A 3LTNC 4EZIA 3KZOA 1X80A 2BR3A 2E82A 3KPJA 3HR8A 3A2NA 4EB0A 3O38A 1W0JA 5I51A 2VJMA 4X1KA 1X1DA 4F45A 4OHVA 2ZS8A 2H65A 2IS1A 1O7JA 3VO9A 3GI1A 1WW2A 1BH6A 3HO6A 3IQHX 3UHPA 2WJ4A 1K8RA 3B2EA 3GZTB 4Q7EA 5TB5A 2HUNA 2IF0A 1M5TA 4REQA 3NGMA 3AHIA 5IBPA 1FDSA 3S2SA 4E08A 3T38A 3U13A 1TPYA 2ZAGA 1U7HA 2AFIE 4UFPA 2ZE6A 2G06A 2JGJA 1F2TA 3ZGNA 1KO8A 4B9EA 1GUYA 3R3UA 1EWYA 2P0YA 2RI6A 3GEHA 1H8HD 2BVNA 1H22A 4GOJA 2WG0A 4P83A 4PAMA 3CIFA 1XZCA 4QPPA 4XR9A 4U7WA 3WK8A 5AJVB 1IVYA 1UXKA 5LOVF 1WHSB 4B74A 3GWZA 1L4MA 4DR2B 2I6UA 1JR3D 1DBQA 4GDFA 3ZJ5A 1RZUA 3RSQA 4E3ZA 2XVAA 3SKVA 4ZD6A 3U7EB 3DDSA 1RYFA 4BQRA 3K9FC 3MTIA 4WNIA 4OP2A 2IOFA 1I1HA 4R40A 3B3GA 3TD9A 3ZIDA 3TW6A 4DY6A 1I1NA 3A10A 1MFZA 2JFBA 2P9FA 4OQ4A 1VHTA 3PITA 4NK5A 3IBGA 3NRBA 1DG9A 4GC5A 2EHJA 3DDNA 2HPAA 2WWTA 1XCJA 2ADMA 3HN6A 3HUFA 3MRXA 2C7GA 3PWKA 1QG4A 5DK6A 3CRMA 3U4MA 1Z68A 2HXGA 2P30A 5DW0A 1NI4B 5DYIA 3OQHA 4MQEB 5THXA 3V7UA 2WOOA 4UTOA 4MQFB 4N7RA 5DYYA 3RK1A 4BVGA 3N0XA 4YRZA 2X8AA 3DFUA 1AGNA 3GJZA 1KH1A 3IT1A 1WAMA 1Z9BA 1EGMB 2RGAA 4CE6A 1SXJB 1KKMA 4Q4CA 3S2FA 5CFLA 1INLA 1HTWA 2G67A 3UKOA 4RDXA 4LOJA 4L9RA 2XODA 2HQRA 5ESWA 3HJHA 1SQ5A 4FGSA 4TLLB 4CNQA 5FTWA 1SVWA 4NU8X 4P33A 2DSNA 1YJ5A 3T9CA 1ZQ9A 1P19A 4EG0A 4I9HA 4Q47A 3F5DA 5C53B 3PFBA 3HXLA 4DR4B 1U11A 2P6PA 2IV7A 3WK7A 1Y9DA 4PGGA 4AIRA 4FOLA 1E6MA 5MDHA 1CUIA 1ODSA 4N6OA 3T1QA 3LBAA 1GCOA 1UZMA 4KP7A 5JWOA 1FNSA 2BGTA 3W8RA 3HBLA 1SQSA 4LOLA 4MUNA 2GK4A 3AR6A 2XQIA 5CDUA 1A9XA 5K01A 1USWA 3PKJA 3AWDA 3RC3A 1WE2A 1Z7WA 2WNHA 3LU1A 3TNLA 4D0NA 1I4TD 2H4HA 3SZOA 2QQ5A 5AKYA 4IFTA 3IQXA 2A0KA 3MTEA 1YKSA 4G1MB 3OTWA 3R7AA 4R1LA 4NOLA 3SKXA 4CTJA 3PNKA 2CB0A 5MFZA 1SXGA 1QONA 2B34A 3BIXA 3BWDD 4U4AA 3K6RA 3FRJA 5FUVA 2WUGA 3JVDA 3MJVA 3NEJA 4OHMA 3ZBTA 1ZOOA 3FHCB 4BGEA 2XE6A 2Y0DA 2FSVC 4DBVO 5KTTA 1Q0TA 1AMNA 3EF0A 3AFGA 1EJ0A 1NTOA 3LDUA 5K7SA 4QEZA 4PLPA 1VPEA 4I8IA 1JHOA 4XFDA 2KSQA 4KR9A 1YNSA 3SE0A 2EWVA 4DWVA 4CMHA 3K6SB 2D0PB 5CH5A 3CH7A 1WSDA 1Q0UA 3UOAB 1CQXA 1LDBA 5L3SA 3G2NA 2VBGA 3AO0B 4WZBA 5CX1A 4LXUA 1T6NA 2LBPA 3DZDA 4L8VA 1ZL0A 5TVGA 5LZ4A 3OFKA 3R6DA 2VCYA 4I9FA 4LVNA 1IE3A 2Q9UA 2IEAA 3PUHA 4IJVA 4O6VA 3AP2A 3CISA 2W6ZA 3ZH2A 3T5GA 2VQSA 2JJMA 4RO0A 5AVZA 2HBZA 2Q1YA 3CLRC 1Q92A 5JTTA 3C5WP 1P1IA 3EH2A 4HFJA 4IO1A 3OVMA 4YCNA 1U80A 4K0KB 3JASB 1AZSC 1DO0A 3F3KA 3NWOA 1KFBB 1QH1B 2R1VB 4BVBA 1OH6A 1QWSA 5ALTA 2JI9A 1ML4A 3G0HA 1P75A 4NZNA 3QE9Y 4OBWA 5HZMA 2CFOA 4YIKA 3IURA 2WG1A 1A4RA 4PZEA 4ER7A 4YRLA 1VBNA 1ZL2A 3IA7A 2PK3A 3RABA 5JAMA 1QAMA 4WFKA 2HLHA 2W6JD 5EMNA 2HO4A 1REQB 3HVUA 4O4LB 3ZBPA 1RM4A 4E3WA 4EA6A 2FMKA 3KWMA 4KBFA 1RAAA 4F3YA 2HAEA 4ZHQB 4NHOA 1NXWA 3D59A 5A4JA 4DR7B 3FNQA 2WKSA 4W1PA 5KREA 1CR1A 2WVJA 4UEOA 4LF8B 1ZXLA 1H3NA 1QO9A 2D00A 3A32A 3E53A 3PQ5A 5EXDA 1Y1QA 5AVOA 4FDLA 4NDNE 4OIFA 2PKCA 5AXAA 2CMGA 3D5TA 1M1NB 3W6NA 1ZA1A 3O1IC 3Q3HA 5K3FA 2PQ0A 4CEIA 3EY4A 4FHFA 1L7PA 3C3YA 4L1KA 4ZVRA 2J6IA 5FWDA 3E35A 4LTNA 1Y8RA 4KIWA 1AA9A 3WL7A 1T9GR 1M2NA 2EFHB 1B14A 1N2SA 3JQ7B 3OC6A 5CT9A 3T5DA 1AQNA 5CBPB 2UYQA 4IRUB 2J09A 1L6IA 2WSBA 3RT1A 4J94A 1Z56C 5DFAA 3QXHA 4EPWA 2RAFA 1Z0KA 2W6IA 5CVVA 1KJJA 3BHMA 4GLOA 4MV1A 3T3IA 2E1PA 3FBWA 3OP4A 1B7GO 4TTSA 4R2IA 5E4YA 4MUYA 1AN9A 3O47A 3GVXA 2XGMA 1TW3A 1LQTA 3ESYA 3BYZA 4B9AA 2Y3IA 2CD9A 2LIVA 4HHEA 2PEZA 1C1XA 1Y82A 2OV3A 3H9JA 3CLRD 1E2EA 4NEQA 4QFMA 2EFEB 1DC8A 3ZN2A 3ORQA 4G5QA 2IUYA 4F97A 1O97C 3IV6A 1A7AA 2EBUA 2C8KA 3AUYA 3PD1A 1WS6A 2CF6A 2OBXA 1D2EA 4V0MA 5JEDA 3TQFA 5BQPA 2L82A 4ZRNA 1G66A 3M4YA 4KLZA 5ED0A 3ITDA 4RHUA 3EE6A 5FI3A 1T2FA 1DJQA 1KQOA 1RMQA 4HGYA 4OLFA 4TROA 1A9TA 2V74B 5HBGA 3EGEA 4B4DA 5BXQC 1EUYA 4BO1A 1VE3A 3OF5A 5FNVF 2G8LA 3UPDA 4TVBA 1U3CA 4LGVA 1U94A 1XEXA 1XRMA 4HNSA 4ITUA 3W7VA 4UOZA 2I6FA 4QDUA 1KR2A 3E5MA 3OX1A 1QZ3A 5C1IA 5LLSA 3UW3A 1VL8A 4ZODA 5AW5A 1UIMA 4MXDA 1VP9A 1FE8A 2G72A 2EZ9A 3E9RA 1XZNA 3E9QA 2QSYA 3KHSA 4HH4A 621PA 2WWVD 2ZE7A 3VHQA 5JCZA 2EQ5A 4FN4A 2Q46A 3UY4A 5I4KA 4GPD1 4JD5A 2PKXA 3BTVA 3DAOA 4ZYXA 1V47A 3T9FA 4EGJA 3AL3A 5JBIA 4NULA 1JEYA 3OWXA 6REQA 1ZESA 2ADOA 4GYJA 4IKEA 4L72A 1EX7A 5DLQC 3C16C 5JH7F 5K09A 3F2VA 3R4VA 1NBOA 3OZAA 2IOHA 2V4UA 1N5IA 3UAGA 2IFTA 5A6SA 2NSLA 2J4CA 3HO8A 3JCZA 2ECQA 1XQ6A 1NVVR 4H2DA 4ZKEA 4V1CB 2FG6C 3NVAA 4PPYA 3UB2A 1MQSA 4HQRA 2BP7B 1X8KA 4IHKA 2PSSA 3K6JA 4RYLA 4ZVKA 1VRCA 4TN1A 1R6TA 4BNYA 5BN4A 3FKSD 2Y9PB 3WOVA 1Y33E 2Z08A 2FK7A 1EUCB 3FCEA 1O97D 4EYEA 3H97A 4LHXA 1AUVA 3A9VA 3E03A 4IFIA 4N8DA 2XGOA 3CRW1 4FR2A 1CX9B 3DBHB 2ONCA 3IIKA 5ER6A 5ELMA 3NWEA 3TSYA 3B7GA 4JDPA 3TPCA 5KVVA 3KAQA 3MMSA 1KYIA 5TSDA 4Z4FA 2DULA 1ARZA 4BWVA 4JU9A 5K3CA 5B4TA 3E2PA 4D8WA 4ZP1A 1LPPA 3KQKA 3ZXSA 1XLWA 2R6GA 1U1FA 5DKFA 3STXA 2WPDD 5CB4A 1U9IA 3X2EA 2KWIA 4HYQA 3C98A 3DMPA 3QLEA 2NTYC 3N74A 4JBNA 3I73A 4ZCMA 2A5YB 5EE5B 5IKXA 4IJ6A 1ACMA 1MNAA 1PYOA 3B82A 3QTLA 4I4IA 4H6PA 1Q0ZA 2Q2WA 2PUJA 2Q6LA 3H2SA 5A02A 4ZYVA 4DJDC 3A4TA 4BLQA 3W5CA 4P08A 1WM1A 5TC4A 1TK3A 3KZVA 5FI5A 1E3MA 1P7WA 2E21A 3S7ZA 1QVVA 4IAOA 3FW1A 1XVTA 1MQ9A 3VJKA 3WICA 2W2QA 3EJ6A 2Y1FA 1ZM4A 3U9SA 1XZFA 1DKOA 2AR0A 3RFXA 1K9VF 3QG1A 2C2BA 3OC0A 5ITZA 3ZTWA 3ZIAA 1Z26A 2YZMA 1APBA 2C3YA 4UEQA 1JHVA 4Q39A 3DMFA 3F5SA 5ALSA 3LZCA 1KJWA 4HTFB 2AJTA 1BIFA 1J70A 2JZOA 3B6KA 5IM4A 2HN9A 5T4HA 2X15A 2DCUA 2OGUA 2Q3MA 2QRUA 2P3QA 5B55A 2FQQA 1E5VA 1XZGA 2D06A 5KNBD 1C1HA 1XA4A 2R7NA 2E49A 2YNMA 4O1MA 4XM0A 4ZOEA 4B75A 5HA5A 3B51X 3MTGA 4LE0A 3LNTA 1DFHA 4MIEA 2RIPA 2YUIA 4GNRA 1TLTA 3LY5A 3PNQA 3VTZA 1KE2A 1OX4B 5K8TA 4WI1A 4AWXA 1KEVA 2QAGC 4INAA 4ARSA 4U6SA 1ND6A 3JAWA 4LV8B 4Q9JA 4CMIA 3EHDA 5E7MA 1RRGA 1VP3A 4PC2A 3A6KA 3EQ7A 3R6LA 4TTJA 3AKYA 4FMDF 5ALYA 4Z1MD 3ESXA 3RYHB 4C5CA 5L95A 2XCOA 2A5FA 2VPIA 3I76A 2P6NA 2V55B 4RFVA 4B43A 1YUBA 1Z73A 2XYRA 4CW7A 5JY6A 1OC4A 1MAWA 1S8AA 1TCCA 3ZOKA 5IWAB 3BJZA 4ZOCA 1GUBA 1DMSA 4H35A 3DDUA 2QL5A 3QWIA 5F9MA 2XCQA 4BZWA 2IDJA 4R83A 1QQ7A 3VV2A 4QOEA 4ZEVA 1P5RA 2VHVA 4GP7A 1TUBB 4HDOB 4XCXA 3TUZC 1JR4A 2OLEA 3WGKA 5JTUA 3ZLJA 4MCAA 2ONZA 3MRSA 1NYQA 3FBTA 4QOJA 2H54A 1CKEA 1AS2A 1R3UA 2FMXA 5EVCA 2I7TA 4XWGA 5JHGB 1P4HA 2QRJA 2GEUA 3CEAA 3EW7A 5DSZA 4FDTA 2J31A 3NIGB 5BT9A 2D1TA 3S2GA 2HMYB 4C4AA 1D8TA 2CHVA 3FI0A 4G0OA 4G5HA 1DPFA 1T2DA 3D8SA 3PHHA 1OB5A 1U0LA 2WF7A 1WXEA 4BQPA 1ZGGA 4IS3A 2X0KA 4KLCA 3ZWDA 2B7CA 3I2YX 1LPNA 2HRBA 4RPCA 3RBZA 4EAAA 4CKZA 3I37X 5TQ0B 2HADA 3IUJA 1IPHA 4GT1A 1BXZA 2F3TA 4Q7KA 3DLBA 4LY6A 1GRNA 3ZY4A 2WKWA 1L7DA 2VT2A 2OHOA 3O3CA 1SWVA 3IESA 2QXYA 4YNBA 1NVDA 4JLVA 4TL9A 721PA 3PNLA 4ECAA 1TM1E 1N5DA 3INGA 6YASA 4ME6A 2DUMA 1XDSA 1EB8A 1KR5A 4JJAA 5KOJA 3QBVA 5KDOA 2HSEA 2K6GA 3EQ9A 1W4BA 2JDIA 2VK1A 4NAUA 3I1JA 1WNFA 2O8CA 4ZT3A 1DZIA 4OXIA 3GL9A 1D7AA 4YV2A 4HWPA 2O5RA 2OGSA 2DWOA 1PZEA 3WNQA 4B48A 3FTQA 5GV7A 5I8PA 4GPEA 4WY2A 5A5EA 1RLJA 2X0JA 3RSZA 1L0BA 2YN2A 3FYTA 4F46A 2X7XA 3KR9A 1NDQA 1VHLA 3S55A 4DDHA 3GF4A 2JIRA 3IQEA 3ZCXA 1B93A 1WMFA 1VL0A 2E4YA 1UZNA 4EMTA 4Z3KA 3FE2A 5IG2A 2EOAA 3VVBA 3O1JC 5L8VA 1ADCA 3PC2A 2NMVA 3UYKA 1GADO 1E9BA 5J47A 4LJRA 3KM0A 1VLMA 2YV3A 3MJRA 4QLBA 2C7BA 3MAGA 4QPDA 4V24A 4BNVA 1DAEA 4E5SA 3V7NA 3X1XA 4CT4B 4RJLA 1UWLA 5KNCA 3NOOA 4LSZA 1QPZA 1JSRA 1XX6A 1VCOA 3I01M 1EQAA 4FQ5A 4R01A 2A3RA 3ESBA 3IUNA 3PK0A 5BMVF 1TRHA 1SULA 1VI5A 2OC4A 1JFFA 4JQYA 3CNLA 1ULHA 4BNMA 4KYUA 5EQDA 1G3QA 3K0CA 2BFAA 4W7IA 1JQLB 4E2ZA 3RT7A 3C5HA 2VRCD 4LNAA 1SA0B 3PYLA 3ZXYA 3KUDA 1A7KA 2AQ8A 1X7ZB 4Q4HA 3RK0A 2QTVB 4AJEA 4D9IA 2DR2A 2ZB2A 4C0HA 4S1VA 5LOVB 3ZE9A 3LYLA 1RKBA 1NG1A 3GJSA 4OLJA 4IIFA 3N59A 5ECYA 1T34A 4JJFA 4XEUA 3HRIA 1KI6B 1GWNA 1HRKA 2DUNA 3I28A 3OU2A 3EIQA 1NPDA 2WA1A 3WG9A 4PZ9A 2FAXA 4P7JA 5IBQA 2XUDA 4WUVA 3WMWA 2YWXA 2B37A 2BEVA 2YVAA 3OFND 4Q3OA 5EKXA 3HLKA 3IR7A 3PD0A 3WLHA 5F2KA 3NAQA 4Q01A 3BD8A 3REQB 3SZMA 4LV6A 1PD0A 2J5BA 1N9KA 4WFQA 4FHZA 1Q1BA 3BK1A 4W1SA 2VP6A 4WCDA 4ZT7A 2QVGA 3CX3A 1ISHA 1ZN2A 2JIDA 2Y0PA 5CD1A 4KFRA 4AKEA 1DGQA 4D25A 2ODNA 2Q1WA 3JQAA 4BGDA 1Q22A 3K9GA 3VC7A 3CKYA 2YZKA 1WQ4A 3GLGA 1L3IA 3JQRA 1UFOA 4XVQA 2B4QA 4JN6B 1TCVA 2HH9A 4R9RA 2DY1A 3QX7A 3VR6H 2VFAA 3FNGA 2FPGA 1O2DA 3WP1B 2I2FA 3GHHA 3SFVA 2Z8XA 3GUZA 3ZKWA 4DSAA 4WX2B 1PU2A 4LZPA 4JP2A 4AUMA 2OHIA 5ELXA 5JPDA 4KMMA 3T3DA 2DR3A 3Q6IA 3ENZA 1IONA 2XYQA 1SZJG 5EJAA 2ZAYA 3K73O 4RA9A 2BJVA 5M3BA 5THKA 3D4NA 5EZYA 3TDMA 2EBFX 4IJWA 2CHFA 1EYZA 3HFSA 4X95A 3FTFA 1FUUA 5ALOA 1C5KA 2P8JA 1GY8A 5C5EA 1Q77A 4NIMA 2DPLA 2XB9A 1NW5A 3GRKA 1F3OA 3MB8A 3FVVA 3QA3E 1U0EA 2B25A 4KRXA 3ZG6A 1E63A 1J22A 4A8JA 4CLOB 4RESA 4NCBA 6NULA 4CCYA 3UMRA 3BJIC 2JJ1D 4DR5B 1SG6A 3AERA 5AESA 1Q6YA 2VSXA 1C4KA 1DINA 4MVJD 3V8RA 2OORC 3REFA 5TMPA 1TO1E 1C9EA 2I6QA 2IYZA 2O2IA 2XRYA 2JCYA 3SEFA 3X1MA 5HTOA 2FHPA 4ZI5A 2IHNA 4HDSB 3UHFA 1W35A 2WDPA 4QD3A 4AY5A 4DRYA 5BNWA 4B0OA 1HDRA 2G36A 3DO5A 5GGXA 1QV7A 1Z5OA 3E9DA 3LH5A 1QCZA 3EOZA 4GGPA 4H7HA 4KK4A 4E03A 4QDJA 2BGKA 2I8CA 2QLFA 4NH4A 5JR3A 4Q3AA 5JXGA 3U5TA 1QFXA 2APJA 2Y27A 1OBOA 2R00A 4NCHA 2ZTVA 2O19A 2QT0A 2DQZA 3MXTA 1IATA 1NL3A 4AN4A 3ZU6A 5C8ZA 3GP3A 2EJWA 3LQRA 4UXIA 1XZBA 1PK7A 1VI2A 3ID6C 1PR2A 1SFRA 3IO3A 3PFKA 1K6JA 2V7TA 4U1RA 5NULA 3UK0A 4ZTUB 2O8EA 2EJUA 2R8BA 5I9TA 1WUKS 1QXSA 4I55B 3S1AB 4C0LA 4F06A 5GZ1A 1T5OA 4IIBA 3R9XB 4Q9LA 4DWJA 2X2FA 5JSKA 1TFRA 1W36C 3I30X 1CUCA 2EFGA 3OI7A 4NCXA 4ZFNA 1XPOA 1KVSA 3AR7A 4OO3A 5LWQA 2V0NA 1CRZA 3OO0A 4LDJA 5T5QA 8OHMA 3ADDA 4EF4A 2HF9A 1WWKA 2ECFA 2ZZKA 1NFFA 2J3LA 3TTSA 3GRUA 1D5WA 1N2GA 2FX2A 3PFIA 2AOXA 5JNTA 4F1JA 2XQGA 1Y1LA 3O1HB 3P45A 1GNVA 1E1QA 1I0LA 2XNKA 1GPNA 1GKIA 2H1CA 2J5KA 4V0NA 4UTVA 1CF4A 1G3UA 1SEPA 2Y2VA 2C2YA 3DMTA 4YO7A 1S2IA 1SUSA 1ND5A 3B1ZA 2KW5A 2EKBA 1ZITA 5I6DA 1XTKA 4LJAA 4Z7OB 3MTAA 1UK8A 3B2NA 1DOHA 4BHTA 1NQVA 4MVJM 4Z8YA 2LWIA 1VDMA 4CQNA 2O2SA 3DOJA 4NMLA 5EHGA 4LXIA 4LMAA 2X9VA 3QYAA 3AHJA 4DT1B 2RAUA 1T3TA 1M34B 2XKAA 3NVMB 4O2AA 3AFIA 1E2UA 5AD1A 1D0SA 3HBAA 1EZ1A 1KZ9A 3JATA 4B33A 2J0SA 5HNKA 3EVGA 4D41A 1YRHA 4CKXA 4BDTA 1BJTA 4TMKA 3PL1A 1XZHA 2ZI6A 3F7NA 2Q50A 1HG1A 2EKPA 3GXOA 4O4JA 5G1OA 2FTKE 1RWMA 3NV7A 3I4FA 5CLHA 3OURA 3RWOA 2L0XA 4LCEA 1G4AE 2X1MA 5B36A 1EVIA 3TL2A 1UBSB 1R27A 2PUFA 1MEOA 1SHKA 4QE3A 1G8GA 2C54A 1T2NA 3KWLA 4Q3BA 1GSOA 4BNIA 1RQPA 1W36D 3M3DA 3QE0A 4PW0A 4QJIA 4I50A 1AB6A 1QH8B 2IXDA 1PWYE 1IQ0A 5FXMA 1J0AA 2NM0A 4IZ6A 5KSYA 3STWA 2GJ4A 4UE3S 4I0WB 3PUZA 5DE3A 3IKTA 1W0KD 3F6CA 4Q3EA 4LNHA 1PHRA 1SO8A 1DIRA 3F7OA 3P4YA 3UENA 3WLSA 2GAJA 5ALWA 5KYKA 4RK0A 1BHO1 1J5PA 5EPUA 3TJZA 4BMDA 4KDFA 1V4BA 2AJCA 4G3XA 4LYYA 4WY8A 5BNZA 3NOXA 1FLNA 2RONA 2OPBA 3N07A 1U7OA 3B5JA 3OLXA 2ZIXB 4F4JA 1FYWA 1SVOA 1QDEA 1UPUA 4F5DA 4D98A 2IYXA 4IGEA 4IVPA 2JIBA 3H9EO 3OOWA 3O73A 3R0JA 5FNVB 4QJ4A 3K09C 4BE9A 1OZHA 1XU7A 4FLEA 3ZBUA 4JUAA 4M8NE 3LUBA 4XB2A 1C7JA 4OQLA 4NMHA 1XN4A 5KU7A 4O2BB 4K9LA 2O0MA 4JENA 3PIRA 3SXPA 5KTPA 2DBYA 2HWWA 1Y9ZA 2I1VB 3FZGA 4LJ5A 1YL6A 2JH9A 4D9FA 1ID8A 1DKQA 4B8YA 5K0ZA 2X9QA 2AKYA 3WB9A 5IKOA 3RKUA 1DZ3A 3AY0A 5H3LA 1A5SB 4EMUA 1XXLA 3D8RA 4NU5A 4IEEA 2QNRA 3BWEA 3B6ZA 5H81A 5I7FA 5L7WA 3HG7A 2XPCA 5ICGA 1T5TA 2PH1A 4J6FA 4F86A 1NBIA 2PN1A 4M86A 1J0CA 2VUUA 4AP5A 4QYXA 1SPXA 1G55A 1MB9A 1MJNA 2Y4OA 4MGEA 4OFXA 3VO2A 1SKBA 4AWBA 1Z35A 3FCCA 3BC1A 4PFJA 3UA3A 2J45A 3MJEA 3OJWA 2DCMA 4XJTA 3FWHA 4RTJA 9LDTA 2FZKA 3HKDA 4LRWA 2CHGA 3VI4B 5J1SB 1D6MA 3F98A 4G56A 4C7BA 3AKZA 421PA 1FNMA 1Z8NA 1JTVA 5CK5A 4L02A 4IDDA 3DUFB 2C2KA 2CNWA 5KSWB 5A5VA 2W5UA 2OLJA 1M6VA 1ZONA 3AXTA 4N5NA 4NCAA 3DB2A 4NV0A 2BGMA 4RMGA 4LHSA 4KFTA 1M1YE 1S89A 3FDXA 1R7RA 3L7DA 3MWGA 3MS4A 3PRKE 1FS4A 1YRAA 4KN9S 5GGYA 3GEGA 4HB3A 3FFAA 3HFRA 2B3DA 4NR0A 1B43A 4N3NA 4Q7MB 4GI1A 5B6PA 3FROA 3KKNA 3OPQA 3TSAA 1T3HA 1Y3HA 1NPYA 1VJ5A 2B94A 3Q8XB 1DKUA 1F2VA 1YASA 1XU9A 1Q1AA 1SUCA 1H65A 2X86A 3KJXA 4N4AA 1UINA 1QK5A 1DAMA 1OXMA 2ECPA 2PUVA 1MVOA 2VP3A 1GN8A 4WV3A 1BYUA 5IARA 2QE7D 3L4BA 4Q9NA 1M8PA 1FSGA 4NE9A 4TLEA 5TY0A 4XD7D 3T3NA 2R8PA 2Y1EA 5CT6A 4AY2A 3DBLB 5CFOA 4GUAA 3DO8A 1R0KA 3QJ5A 4CCSA 5KQRA 3T1OA 1XCGB 3W5SA 3KELA 4BEBA 1R00A 1SGWA 3ZXXA 4NKRA 5ILOA 2H6EA 3O8NA 5IJZA 2HC9A 1YOBA 5K6TA 3L41A 2XNDD 3AL0C 3VR4H 2FEMA 3OLYA 1PFWA 1IJEA 1V1RB 3B70A 1UPXA 1BXGB 3EVEA 3IFSA 1NBMD 3N86A 4H7FA 2XCTB 1XAHA 2QL9A 2XHEA 3N6RA 4J76A 2QE6A 4KXWA 2QYSA 4BZXA 1LNQA 5H59A 5LD2B 1B3BA 2WJ6A 1N1EA 3W2IA 3A6GA 3QH4A 5BW5A 1YFLA 4WT7A 3WZMA 2JLWA 5BR4A 5JZBA 2GJKA 1X13A 2ZS9A 2PSEA 2EZUA 3ESQA 2ZRMA 1BO6A 1JH8A 4E5YA 1CPYA 1KDOA 1JPVA 3G82C 1E2PA 2C78A 2YV5A 1TIBA 5HRAA 3R5KA 2WF9A 4LYHA 1K6IA 3QV2A 3ZYCA 1FNDA 1PTKA 1AG9A 2DQYA 4P92A 4WL0A 3KZMA 3W7BA 5E0OA 3LKZA 4HH0A 2Q1SA 2QN7A 2XUIA 3JTMA 4PG6A 4EHDA 1GZDA 2FFQA 1VI6A 1I7NA 4GHWA 2FSPA 2RAVA 1E66A 3MYYA 3NETA 4GI3A 4WA8A 1EFAA 3TNFA 3RJ5A 4YHBA 2REXB 5IYZF 1E32A 2GBCA 3MLAA 2WAYA 1JL3A 4FDUA 1Q5PA 1W0JD 3QGMA 4FYJA 3WYEA 1W2GA 4FYHA 3TZBA 2OP0A 3PUVA 3PF8A 3R2JA 3TZLA 3DYIA 4ZYUA 4RQBA 4XLZA 1DIOB 4R2HA 2WABA 3OCZA 3W9YA 2PV7A 2MSCB 3QEAZ 2VYQA 4X3OA 2BGIA 5E1DA 4TYQA 5JQWA 4RTLA 3IIIA 3QOXA 2G6BA 4A92A 4DIEA 1RBQA 3L7BA 2F1KA 3IE0A 1KP3A 4RETA 1DUSA 3LPMA 2QK4A 4JEHA 2P9CA 2NO9A 4WKBA 1GPYA 5CTJA 5ALDA 4M36A 1X7XA 2POCA 5DF1A 1H23A 1N6RA 5A3RA 3ZW9A 2G09A 2IP2A 3WGJA 2IYQA 2EW2A 1DBWA 2ASEA 5AJWA 4L6AA 3UMSA 4BC1A 4L4RA 2R47A 1NWHA 2A7XA 4MYHA 4EKGA 1WTCA 2GAFA 2BEKA 4RZIA 3UAXA 1C4XA 1TQDA 4TSFD 5JECA 1N1MA 2QM8A 3MRTA 5B7QA 4MOWA 3N2YA 1NC1A 4QEKA 2DEUA 3JQGA 1UJ4A 3SBOA 1T3LA 3W4JA 2PD4A 1FDWA 4LECA 2QW8A 1Z2CA 1A98A 2I55A 1QLJA 3LWDA 1M2OA 1JHPA 2YHIB 3DB1A 1QX3A 5BNFA 3ST7A 1EDEA 4OAPA 1GFWA 1OF1A 1V9SA 1CF2O 5D3MA 2JLAA 2D4HA 4MB6A 3GLIB 5A2GA 1LJUA 4G1CA 1QIMA 1CUFA 1X14A 3LS2A 3PQEA 4S0ZA 4UNIA 1HRDA 3E84A 1SKUA 2J0UA 3LUJA 2HHLA 1G18A 1B6GA 3QWFA 1JLLA 2IPXA 4R98A 3WLJA 4B6OA 4BNJA 2VT7A 2WIFA 4RKQA 3U4CA 1RJFA 3RTAA 4F8EA