3OT6A

Crystal structure of an enoyl-coa hydratase/isomerase family protein from psudomonas syringae
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
230
structure length
230
Chain Sequence
AMSDLVSYHLDDGVATLTLNNGKVNAISPDVIIAFNAALDQAEKDRAIVIVTGQPGILSGGYDLKVMTSSAEAAINLVAQGSTLARRMLSHPFPIIVACPGHAVAKGAFLLLSADYRIGVAGPFSIGLNEVQIGMTMHHAGIELARDRLRKSAFNRSVINAEMFDPEGAMAAGFLDKVVSVEELQGAALAVAAQLKKINMNAHKKTKLKVRKGLLDTLDAAIEQDRQHML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of an enoyl-CoA hydratase/isomerase family protein from Psudomonas syringae
rcsb
source organism Pseudomonas syringae pv. tomato
molecule tags Isomerase
molecule keywords Enoyl-CoA hydratase/isomerase family protein
total genus 80
structure length 230
sequence length 230
ec nomenclature
pdb deposition date 2010-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00378 ECH_1 Enoyl-CoA hydratase/isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 3ot6A00
5KDRB 1Y7OA 3K50A 1SZOA 5KJPA 1O8UA 3SLLA 3P85A 4FB8A 4Q1IA 3WG5A 2ZL0A 3IB9A 3TVUA 3U9RB 5MGBA 4KD6A 5G1RA 3H0JA 1UYRA 3ZWCA 1UYVA 3DORA 4U18A 4B3JA 1K39A 3HRXA 3H81A 3RRVA 1Q51A 4KNPA 2A7KA 5DTWA 3QREA 1WDKA 4U19A 1VRGA 2IEXA 3ZW8A 5C9GA 4IZDA 1UYTA 5JBWA 3Q1TA 3QXZA 4ELXA 4ELSA 2VSUC 1FC6A 1XO6A 4L6WA 2F9IA 4RYFA 2A81A 2GTRA 1WZ8A 2J5IA 3QXIA 4QIIA 3JU1A 1NZYA 2EJ5A 2NP9A 4WZ8B 3N6RB 4FNBA 4I4ZA 2PG8A 3GF7A 1ON9A 3GF3A 1OD2A 1TG6A 2CE3A 4YLHA 5DKPA 3RSIA 1WDMA 1UIYA 2PBPA 4L8KA 4ZDEA 1FC7A 2F9YA 1EY3A 2C8TA 3ZW9A 1RJNA 1MJ3A 4WYOB 2VSSA 4WCZA 3TV5A 3TT6A 3PEAA 4F47A 4DI1A 5DTPA 4JCQA 4Z0MA 3T8BA 3STAA 3HINA 4JFCA 2DEOA 3QKAA 5FIFA 2FW2A 4Q0GA 5E0SA 4G2RA 1YG8A 1FCFA 5DUFA 4MXIA 1Q52A 2J5GA 2J5II 1XX4A 4FN8A 5DZKH 2A7SA 4JJTA 4IZCA 1N6DA 4JCSA 5DU6A 4B3IA 1XNWA 3BF0A 2VSSE 3P5MA 4FN7A 2PPYA 2X58A 2ZL3A 1N6FA 3HE2A 1JXZA 4ZDDA 4ELWA 5DL1A 3OC7A 2VSUE 1WDLA 3MYBA 1TYFA 2CBYA 3I47A 4JCRA 3KTHA 1PIXA 3BEZA 3QYRA 2W3PA 3RSTA 1ON3A 5DUCA 3U9SB 4ZU2A 3FF6A 1XNVA 3NJBA 1K32A 3L3SA 3KTIA 3IAVA 4QFEA 4ZDCA 4B3HA 3OT6A 3KTKA 4I42A 3T3WA 3GKBA 3R0OA 2FZSA 5CTCA 3TZ3A 3V5IA 5G1SA 2Q35A 3DJAA 2VX2A 4FNDA 1UYSA 4HNKA 1YG6A 3KTGA 1X0UA 3QMJA 3SWXA 3MOYA 1DUBA 2ZQRA 4U1AA 4KPKA 1FC9A 1SG4A 3PGQA 4NNQA 1PJHA 4JYLA 5G1QA 3TVWA 3FDUA 1EF9A 5DZKA 3QWDA 5CTBA 3GMAA 3IBBA 1N6EA 4KWBA 4U0GH 3M6NA 1XNYA 3OMEA 1RJMA 5C90A 1J7XA 3H02A 2WTBA 5E0SH 3U9TB 3R9QA 4K2NA 4U0HA 3Q0GA 4JSBA 1HNUA 5E0NX 5DU4A 3NJDA 2ZL2A 5INFA 2VSSF 4K3WA 2X24A 3K8XA 4OG1A 3ZWAA 1HZDA 2BZRA 3R9SA 4FJWD 3T89A 2VSUF 4JOTA 2F6IA 4GM2A 2Q2XA 2F9IB 2VREA 4JWVA 3ISAA 5JBXA 4RCNA 4JCTA 3TDCA 2Q34A 3G64A 4JYJA 3QK8A 1OD4A 1DCIA 3TT7A 2F6QA 5INGA 3V5EA 5DU8A 3Q7HA 3T8AA 3T88A 2J5SA 2ZL4A 3H0QA 2VSUA 4ZDFA 5KDRA 4MI2A 1NZYB 5FUSA 2ZQQA 1W2XA 4EMPA 3TRRA 4HC8A 4K29A 3P2LA 3KQFA 4MOUA 4EMLA 3H0UA 3HLN1 5IKLB 4LK5A 3Q0JA 3VIVA 1EF8A 3BPPA 4I52A 4RYFH 2UZFA 3KTJA 4IZBA 4ASIA 1HNOA 3ZWBA 3R6HA 4U0GA 3GLMA 5INIA 4JVTA 4FZWC 2DUBA 3LKEA 3MFMA 2J5IB 3MT6A 3HP0A 4FZWA 3H0SA 4ZDBA 2QQ3A 2D3TA 3PZKA 3LAOA 3ST9A 4QIJA 2HW5A 2FBMA 3R9TA 4GHNA 4OMRA 3TLFA 4EMMA 3PE8A 4NEKA 3M6MA 2J5GD 2F9YB 4OLQA
chains in the Genus database with same CATH superfamily
5KDRB 1Y7OA 3K50A 1SZOA 5KJPA 1O8UA 3SLLA 3P85A 4FB8A 4Q1IA 3WG5A 2ZL0A 3IB9A 3TVUA 3U9RB 5MGBA 4KD6A 5G1RA 3H0JA 1UYRA 3ZWCA 1UYVA 3DORA 4U18A 4B3JA 1K39A 3HRXA 3H81A 3RRVA 1Q51A 4KNPA 2A7KA 5DTWA 3QREA 1WDKA 4U19A 1VRGA 2IEXA 3ZW8A 5C9GA 4IZDA 1UYTA 5JBWA 3Q1TA 3QXZA 4ELXA 4ELSA 2VSUC 1FC6A 1XO6A 4L6WA 2YJGA 2F9IA 4RYFA 2A81A 2GTRA 1WZ8A 2J5IA 3QXIA 4QIIA 3JU1A 1NZYA 2EJ5A 2NP9A 4WZ8B 3N6RB 4FNBA 4I4ZA 2PG8A 3GF7A 1ON9A 3GF3A 1OD2A 1TG6A 2CE3A 4YLHA 5DKPA 3RSIA 1WDMA 1UIYA 2PBPA 4L8KA 4ZDEA 1FC7A 2F9YA 1EY3A 2C8TA 3ZW9A 1RJNA 1MJ3A 4WYOB 2VSSA 4WCZA 3TV5A 3TT6A 3PEAA 4F47A 4DI1A 5DTPA 4JCQA 4Z0MA 3T8BA 3STAA 3HINA 4JFCA 2DEOA 3QKAA 5FIFA 2FW2A 4Q0GA 5E0SA 4G2RA 1YG8A 1FCFA 5DUFA 4MXIA 1Q52A 2J5GA 2J5II 1XX4A 4FN8A 5DZKH 2A7SA 4JJTA 4IZCA 1N6DA 4JCSA 5DU6A 4B3IA 1XNWA 3BF0A 2VSSE 3P5MA 4FN7A 2PPYA 2X58A 2ZL3A 1N6FA 3HE2A 1JXZA 4ZDDA 4ELWA 5DL1A 3OC7A 2VSUE 1WDLA 3MYBA 1TYFA 2CBYA 3I47A 4JCRA 3KTHA 1PIXA 3BEZA 3QYRA 2W3PA 3RSTA 1ON3A 5DUCA 3U9SB 4ZU2A 3FF6A 1XNVA 3NJBA 1K32A 3L3SA 3KTIA 3IAVA 4QFEA 4ZDCA 4B3HA 3OT6A 3KTKA 4I42A 3T3WA 3GKBA 3R0OA 2FZSA 5CTCA 3TZ3A 3V5IA 5G1SA 2Q35A 3DJAA 2VX2A 4FNDA 1UYSA 4HNKA 1YG6A 3KTGA 5HUQA 1X0UA 3QMJA 3SWXA 3MOYA 1DUBA 2ZQRA 4U1AA 4KPKA 1FC9A 1SG4A 3PGQA 4NNQA 1PJHA 4JYLA 5G1QA 3TVWA 3FDUA 1EF9A 5DZKA 3QWDA 5CTBA 3GMAA 3IBBA 1N6EA 4KWBA 4U0GH 3M6NA 1XNYA 4HDTA 3OMEA 1RJMA 5C90A 1J7XA 3H02A 2WTBA 5E0SH 3U9TB 3R9QA 4K2NA 4U0HA 3Q0GA 4JSBA 1HNUA 5E0NX 5DU4A 3NJDA 2ZL2A 5INFA 2VSSF 4K3WA 2X24A 3K8XA 4OG1A 3ZWAA 1HZDA 2BZRA 3R9SA 4FJWD 3T89A 2VSUF 4JOTA 2F6IA 4GM2A 2Q2XA 2F9IB 2VREA 4JWVA 3ISAA 5JBXA 4RCNA 4JCTA 3TDCA 2Q34A 3G64A 4JYJA 3QK8A 1OD4A 1DCIA 3TT7A 2F6QA 5INGA 3V5EA 5DU8A 3Q7HA 3T8AA 3T88A 2J5SA 2ZL4A 3H0QA 2VSUA 4ZDFA 5KDRA 4MI2A 1NZYB 5FUSA 2ZQQA 1W2XA 4NARA 4EMPA 3TRRA 4HC8A 4J2UA 3BPTA 4K29A 3P2LA 3KQFA 4MOUA 4EMLA 3H0UA 3HLN1 5IKLB 4LK5A 3Q0JA 3VIVA 1EF8A 3BPPA 4I52A 4RYFH 2UZFA 3KTJA 4IZBA 4ASIA 1HNOA 3ZWBA 3R6HA 4U0GA 3GLMA 5INIA 4JVTA 4FZWC 2DUBA 3LKEA 3MFMA 2J5IB 3MT6A 3HP0A 4FZWA 3H0SA 4ZDBA 2QQ3A 2D3TA 3PZKA 3LAOA 3ST9A 4QIJA 2HW5A 2FBMA 3R9TA 4GHNA 4OMRA 3TLFA 4EMMA 3PE8A 4NEKA 3M6MA 2J5GD 2F9YB 4OLQA
chains in the Genus database with same CATH topology
5KDRB 1Y7OA 3K50A 1SZOA 5KJPA 1O8UA 3SLLA 3P85A 4FB8A 4Q1IA 3WG5A 2ZL0A 3IB9A 3TVUA 3U9RB 5MGBA 4KD6A 5G1RA 3H0JA 1UYRA 3ZWCA 1UYVA 3DORA 4U18A 4B3JA 1K39A 3HRXA 3H81A 3RRVA 1Q51A 4KNPA 2A7KA 5DTWA 3QREA 1WDKA 4U19A 1VRGA 2IEXA 3ZW8A 5C9GA 4IZDA 1UYTA 5JBWA 3Q1TA 3QXZA 4ELXA 4ELSA 2VSUC 1FC6A 1XO6A 4L6WA 2YJGA 2F9IA 4RYFA 2A81A 2GTRA 1WZ8A 2J5IA 3QXIA 4QIIA 3JU1A 1NZYA 2EJ5A 2NP9A 4WZ8B 3N6RB 4FNBA 4I4ZA 2PG8A 3GF7A 1ON9A 3GF3A 1OD2A 1TG6A 2CE3A 4YLHA 5DKPA 3RSIA 1WDMA 1UIYA 2PBPA 4L8KA 4ZDEA 1FC7A 2F9YA 1EY3A 2C8TA 3ZW9A 1RJNA 1MJ3A 4WYOB 2VSSA 4WCZA 3TV5A 3TT6A 3PEAA 4F47A 4DI1A 5DTPA 4JCQA 4Z0MA 3T8BA 3STAA 3HINA 4JFCA 2DEOA 3QKAA 5FIFA 2FW2A 4Q0GA 5E0SA 4G2RA 1YG8A 1FCFA 5DUFA 4MXIA 1Q52A 2J5GA 2J5II 1XX4A 4FN8A 5DZKH 2A7SA 4JJTA 4IZCA 1N6DA 4JCSA 5DU6A 4B3IA 1XNWA 3BF0A 2VSSE 3P5MA 4FN7A 2PPYA 2X58A 2ZL3A 1N6FA 3HE2A 1JXZA 4ZDDA 4ELWA 5DL1A 3OC7A 2VSUE 1WDLA 3MYBA 1TYFA 2CBYA 3I47A 4JCRA 3KTHA 1PIXA 3BEZA 3QYRA 2W3PA 3RSTA 1ON3A 5DUCA 3U9SB 4ZU2A 3FF6A 1XNVA 3NJBA 1K32A 3L3SA 3KTIA 3IAVA 4QFEA 4ZDCA 4B3HA 3OT6A 3KTKA 4I42A 3T3WA 3GKBA 3R0OA 2FZSA 5CTCA 3TZ3A 3V5IA 5G1SA 2Q35A 3DJAA 2VX2A 4FNDA 1UYSA 4HNKA 1YG6A 3KTGA 5HUQA 1X0UA 3QMJA 3SWXA 3MOYA 1DUBA 2ZQRA 4U1AA 4KPKA 1FC9A 1SG4A 3PGQA 4NNQA 1PJHA 4JYLA 5G1QA 3TVWA 3FDUA 1EF9A 5DZKA 3QWDA 5CTBA 3GMAA 3IBBA 1N6EA 4KWBA 4U0GH 3M6NA 1XNYA 4HDTA 3OMEA 1RJMA 5C90A 1J7XA 3H02A 2WTBA 5E0SH 3U9TB 3R9QA 4K2NA 4U0HA 3Q0GA 4JSBA 1HNUA 5E0NX 5DU4A 3NJDA 2ZL2A 5INFA 2VSSF 4K3WA 2X24A 3K8XA 4OG1A 3ZWAA 1HZDA 2BZRA 3R9SA 4FJWD 3T89A 2VSUF 4JOTA 2F6IA 4GM2A 2Q2XA 2F9IB 2VREA 4JWVA 3ISAA 5JBXA 4RCNA 4JCTA 3TDCA 2Q34A 3G64A 4JYJA 3QK8A 1OD4A 1DCIA 3TT7A 2F6QA 5INGA 3V5EA 5DU8A 3Q7HA 3T8AA 3T88A 2J5SA 2ZL4A 3H0QA 2VSUA 4ZDFA 5KDRA 4MI2A 1NZYB 5FUSA 2ZQQA 1W2XA 4NARA 4EMPA 3TRRA 4HC8A 4J2UA 3BPTA 4K29A 3P2LA 3KQFA 4MOUA 4EMLA 3H0UA 3HLN1 5IKLB 4LK5A 3Q0JA 3VIVA 1EF8A 3BPPA 4I52A 4RYFH 2UZFA 3KTJA 4IZBA 4ASIA 1HNOA 3ZWBA 3R6HA 4U0GA 3GLMA 5INIA 4JVTA 4FZWC 2DUBA 3LKEA 3MFMA 2J5IB 3MT6A 3HP0A 4FZWA 3H0SA 4ZDBA 2QQ3A 2D3TA 3PZKA 3LAOA 3ST9A 4QIJA 2HW5A 2FBMA 3R9TA 4GHNA 4OMRA 3TLFA 4EMMA 3PE8A 4NEKA 3M6MA 2J5GD 2F9YB 4OLQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5KDR B;  1Y7O A;  3K50 A;  1SZO A;  5KJP A;  1O8U A;  3SLL A;  3P85 A;  4FB8 A;  4Q1I A;  3WG5 A;  2ZL0 A;  3IB9 A;  3TVU A;  3U9R B;  5MGB A;  4KD6 A;  5G1R A;  3H0J A;  1UYR A;  3ZWC A;  1UYV A;  3DOR A;  4U18 A;  4B3J A;  1K39 A;  3HRX A;  3H81 A;  3RRV A;  1Q51 A;  4KNP A;  2A7K A;  5DTW A;  3QRE A;  1WDK A;  4U19 A;  1VRG A;  2IEX A;  3ZW8 A;  5C9G A;  4IZD A;  1UYT A;  5JBW A;  3Q1T A;  3QXZ A;  4ELX A;  4ELS A;  2VSU C;  1FC6 A;  1XO6 A;  4L6W A;  2F9I A;  4RYF A;  2A81 A;  2GTR A;  1WZ8 A;  2J5I A;  3QXI A;  4QII A;  3JU1 A;  1NZY A;  2EJ5 A;  2NP9 A;  4WZ8 B;  3N6R B;  4FNB A;  4I4Z A;  2PG8 A;  3GF7 A;  1ON9 A;  3GF3 A;  1OD2 A;  1TG6 A;  2CE3 A;  4YLH A;  5DKP A;  3RSI A;  1WDM A;  1UIY A;  2PBP A;  4L8K A;  4ZDE A;  1FC7 A;  2F9Y A;  1EY3 A;  2C8T A;  3ZW9 A;  1RJN A;  1MJ3 A;  4WYO B;  2VSS A;  4WCZ A;  3TV5 A;  3TT6 A;  3PEA A;  4F47 A;  4DI1 A;  5DTP A;  4JCQ A;  4Z0M A;  3T8B A;  3STA A;  3HIN A;  4JFC A;  2DEO A;  3QKA A;  5FIF A;  2FW2 A;  4Q0G A;  5E0S A;  4G2R A;  1YG8 A;  1FCF A;  5DUF A;  4MXI A;  1Q52 A;  2J5G A;  2J5I I;  1XX4 A;  4FN8 A;  5DZK H;  2A7S A;  4JJT A;  4IZC A;  1N6D A;  4JCS A;  5DU6 A;  4B3I A;  1XNW A;  3BF0 A;  2VSS E;  3P5M A;  4FN7 A;  2PPY A;  2X58 A;  2ZL3 A;  1N6F A;  3HE2 A;  1JXZ A;  4ZDD A;  4ELW A;  5DL1 A;  3OC7 A;  2VSU E;  1WDL A;  3MYB A;  1TYF A;  2CBY A;  3I47 A;  4JCR A;  3KTH A;  1PIX A;  3BEZ A;  3QYR A;  2W3P A;  3RST A;  1ON3 A;  5DUC A;  3U9S B;  4ZU2 A;  3FF6 A;  1XNV A;  3NJB A;  1K32 A;  3L3S A;  3KTI A;  3IAV A;  4QFE A;  4ZDC A;  4B3H A;  3OT6 A;  3KTK A;  4I42 A;  3T3W A;  3GKB A;  3R0O A;  2FZS A;  5CTC A;  3TZ3 A;  3V5I A;  5G1S A;  2Q35 A;  3DJA A;  2VX2 A;  4FND A;  1UYS A;  4HNK A;  1YG6 A;  3KTG A;  1X0U A;  3QMJ A;  3SWX A;  3MOY A;  1DUB A;  2ZQR A;  4U1A A;  4KPK A;  1FC9 A;  1SG4 A;  3PGQ A;  4NNQ A;  1PJH A;  4JYL A;  5G1Q A;  3TVW A;  3FDU A;  1EF9 A;  5DZK A;  3QWD A;  5CTB A;  3GMA A;  3IBB A;  1N6E A;  4KWB A;  4U0G H;  3M6N A;  1XNY A;  3OME A;  1RJM A;  5C90 A;  1J7X A;  3H02 A;  2WTB A;  5E0S H;  3U9T B;  3R9Q A;  4K2N A;  4U0H A;  3Q0G A;  4JSB A;  1HNU A;  5E0N X;  5DU4 A;  3NJD A;  2ZL2 A;  5INF A;  2VSS F;  4K3W A;  2X24 A;  3K8X A;  4OG1 A;  3ZWA A;  1HZD A;  2BZR A;  3R9S A;  4FJW D;  3T89 A;  2VSU F;  4JOT A;  2F6I A;  4GM2 A;  2Q2X A;  2F9I B;  2VRE A;  4JWV A;  3ISA A;  5JBX A;  4RCN A;  4JCT A;  3TDC A;  2Q34 A;  3G64 A;  4JYJ A;  3QK8 A;  1OD4 A;  1DCI A;  3TT7 A;  2F6Q A;  5ING A;  3V5E A;  5DU8 A;  3Q7H A;  3T8A A;  3T88 A;  2J5S A;  2ZL4 A;  3H0Q A;  2VSU A;  4ZDF A;  5KDR A;  4MI2 A;  1NZY B;  5FUS A;  2ZQQ A;  1W2X A;  4EMP A;  3TRR A;  4HC8 A;  4K29 A;  3P2L A;  3KQF A;  4MOU A;  4EML A;  3H0U A;  3HLN 1;  5IKL B;  4LK5 A;  3Q0J A;  3VIV A;  1EF8 A;  3BPP A;  4I52 A;  4RYF H;  2UZF A;  3KTJ A;  4IZB A;  4ASI A;  1HNO A;  3ZWB A;  3R6H A;  4U0G A;  3GLM A;  5INI A;  4JVT A;  4FZW C;  2DUB A;  3LKE A;  3MFM A;  2J5I B;  3MT6 A;  3HP0 A;  4FZW A;  3H0S A;  4ZDB A;  2QQ3 A;  2D3T A;  3PZK A;  3LAO A;  3ST9 A;  4QIJ A;  2HW5 A;  2FBM A;  3R9T A;  4GHN A;  4OMR A;  3TLF A;  4EMM A;  3PE8 A;  4NEK A;  3M6M A;  2J5G D;  2F9Y B;  4OLQ A; 
#chains in the Genus database with same CATH topology
 5KDR B;  1Y7O A;  3K50 A;  1SZO A;  5KJP A;  1O8U A;  3SLL A;  3P85 A;  4FB8 A;  4Q1I A;  3WG5 A;  2ZL0 A;  3IB9 A;  3TVU A;  3U9R B;  5MGB A;  4KD6 A;  5G1R A;  3H0J A;  1UYR A;  3ZWC A;  1UYV A;  3DOR A;  4U18 A;  4B3J A;  1K39 A;  3HRX A;  3H81 A;  3RRV A;  1Q51 A;  4KNP A;  2A7K A;  5DTW A;  3QRE A;  1WDK A;  4U19 A;  1VRG A;  2IEX A;  3ZW8 A;  5C9G A;  4IZD A;  1UYT A;  5JBW A;  3Q1T A;  3QXZ A;  4ELX A;  4ELS A;  2VSU C;  1FC6 A;  1XO6 A;  4L6W A;  2YJG A;  2F9I A;  4RYF A;  2A81 A;  2GTR A;  1WZ8 A;  2J5I A;  3QXI A;  4QII A;  3JU1 A;  1NZY A;  2EJ5 A;  2NP9 A;  4WZ8 B;  3N6R B;  4FNB A;  4I4Z A;  2PG8 A;  3GF7 A;  1ON9 A;  3GF3 A;  1OD2 A;  1TG6 A;  2CE3 A;  4YLH A;  5DKP A;  3RSI A;  1WDM A;  1UIY A;  2PBP A;  4L8K A;  4ZDE A;  1FC7 A;  2F9Y A;  1EY3 A;  2C8T A;  3ZW9 A;  1RJN A;  1MJ3 A;  4WYO B;  2VSS A;  4WCZ A;  3TV5 A;  3TT6 A;  3PEA A;  4F47 A;  4DI1 A;  5DTP A;  4JCQ A;  4Z0M A;  3T8B A;  3STA A;  3HIN A;  4JFC A;  2DEO A;  3QKA A;  5FIF A;  2FW2 A;  4Q0G A;  5E0S A;  4G2R A;  1YG8 A;  1FCF A;  5DUF A;  4MXI A;  1Q52 A;  2J5G A;  2J5I I;  1XX4 A;  4FN8 A;  5DZK H;  2A7S A;  4JJT A;  4IZC A;  1N6D A;  4JCS A;  5DU6 A;  4B3I A;  1XNW A;  3BF0 A;  2VSS E;  3P5M A;  4FN7 A;  2PPY A;  2X58 A;  2ZL3 A;  1N6F A;  3HE2 A;  1JXZ A;  4ZDD A;  4ELW A;  5DL1 A;  3OC7 A;  2VSU E;  1WDL A;  3MYB A;  1TYF A;  2CBY A;  3I47 A;  4JCR A;  3KTH A;  1PIX A;  3BEZ A;  3QYR A;  2W3P A;  3RST A;  1ON3 A;  5DUC A;  3U9S B;  4ZU2 A;  3FF6 A;  1XNV A;  3NJB A;  1K32 A;  3L3S A;  3KTI A;  3IAV A;  4QFE A;  4ZDC A;  4B3H A;  3OT6 A;  3KTK A;  4I42 A;  3T3W A;  3GKB A;  3R0O A;  2FZS A;  5CTC A;  3TZ3 A;  3V5I A;  5G1S A;  2Q35 A;  3DJA A;  2VX2 A;  4FND A;  1UYS A;  4HNK A;  1YG6 A;  3KTG A;  5HUQ A;  1X0U A;  3QMJ A;  3SWX A;  3MOY A;  1DUB A;  2ZQR A;  4U1A A;  4KPK A;  1FC9 A;  1SG4 A;  3PGQ A;  4NNQ A;  1PJH A;  4JYL A;  5G1Q A;  3TVW A;  3FDU A;  1EF9 A;  5DZK A;  3QWD A;  5CTB A;  3GMA A;  3IBB A;  1N6E A;  4KWB A;  4U0G H;  3M6N A;  1XNY A;  4HDT A;  3OME A;  1RJM A;  5C90 A;  1J7X A;  3H02 A;  2WTB A;  5E0S H;  3U9T B;  3R9Q A;  4K2N A;  4U0H A;  3Q0G A;  4JSB A;  1HNU A;  5E0N X;  5DU4 A;  3NJD A;  2ZL2 A;  5INF A;  2VSS F;  4K3W A;  2X24 A;  3K8X A;  4OG1 A;  3ZWA A;  1HZD A;  2BZR A;  3R9S A;  4FJW D;  3T89 A;  2VSU F;  4JOT A;  2F6I A;  4GM2 A;  2Q2X A;  2F9I B;  2VRE A;  4JWV A;  3ISA A;  5JBX A;  4RCN A;  4JCT A;  3TDC A;  2Q34 A;  3G64 A;  4JYJ A;  3QK8 A;  1OD4 A;  1DCI A;  3TT7 A;  2F6Q A;  5ING A;  3V5E A;  5DU8 A;  3Q7H A;  3T8A A;  3T88 A;  2J5S A;  2ZL4 A;  3H0Q A;  2VSU A;  4ZDF A;  5KDR A;  4MI2 A;  1NZY B;  5FUS A;  2ZQQ A;  1W2X A;  4NAR A;  4EMP A;  3TRR A;  4HC8 A;  4J2U A;  3BPT A;  4K29 A;  3P2L A;  3KQF A;  4MOU A;  4EML A;  3H0U A;  3HLN 1;  5IKL B;  4LK5 A;  3Q0J A;  3VIV A;  1EF8 A;  3BPP A;  4I52 A;  4RYF H;  2UZF A;  3KTJ A;  4IZB A;  4ASI A;  1HNO A;  3ZWB A;  3R6H A;  4U0G A;  3GLM A;  5INI A;  4JVT A;  4FZW C;  2DUB A;  3LKE A;  3MFM A;  2J5I B;  3MT6 A;  3HP0 A;  4FZW A;  3H0S A;  4ZDB A;  2QQ3 A;  2D3T A;  3PZK A;  3LAO A;  3ST9 A;  4QIJ A;  2HW5 A;  2FBM A;  3R9T A;  4GHN A;  4OMR A;  3TLF A;  4EMM A;  3PE8 A;  4NEK A;  3M6M A;  2J5G D;  2F9Y B;  4OLQ A; 
#chains in the Genus database with same CATH homology
 5KDR B;  1Y7O A;  3K50 A;  1SZO A;  5KJP A;  1O8U A;  3SLL A;  3P85 A;  4FB8 A;  4Q1I A;  3WG5 A;  2ZL0 A;  3IB9 A;  3TVU A;  3U9R B;  5MGB A;  4KD6 A;  5G1R A;  3H0J A;  1UYR A;  3ZWC A;  1UYV A;  3DOR A;  4U18 A;  4B3J A;  1K39 A;  3HRX A;  3H81 A;  3RRV A;  1Q51 A;  4KNP A;  2A7K A;  5DTW A;  3QRE A;  1WDK A;  4U19 A;  1VRG A;  2IEX A;  3ZW8 A;  5C9G A;  4IZD A;  1UYT A;  5JBW A;  3Q1T A;  3QXZ A;  4ELX A;  4ELS A;  2VSU C;  1FC6 A;  1XO6 A;  4L6W A;  2YJG A;  2F9I A;  4RYF A;  2A81 A;  2GTR A;  1WZ8 A;  2J5I A;  3QXI A;  4QII A;  3JU1 A;  1NZY A;  2EJ5 A;  2NP9 A;  4WZ8 B;  3N6R B;  4FNB A;  4I4Z A;  2PG8 A;  3GF7 A;  1ON9 A;  3GF3 A;  1OD2 A;  1TG6 A;  2CE3 A;  4YLH A;  5DKP A;  3RSI A;  1WDM A;  1UIY A;  2PBP A;  4L8K A;  4ZDE A;  1FC7 A;  2F9Y A;  1EY3 A;  2C8T A;  3ZW9 A;  1RJN A;  1MJ3 A;  4WYO B;  2VSS A;  4WCZ A;  3TV5 A;  3TT6 A;  3PEA A;  4F47 A;  4DI1 A;  5DTP A;  4JCQ A;  4Z0M A;  3T8B A;  3STA A;  3HIN A;  4JFC A;  2DEO A;  3QKA A;  5FIF A;  2FW2 A;  4Q0G A;  5E0S A;  4G2R A;  1YG8 A;  1FCF A;  5DUF A;  4MXI A;  1Q52 A;  2J5G A;  2J5I I;  1XX4 A;  4FN8 A;  5DZK H;  2A7S A;  4JJT A;  4IZC A;  1N6D A;  4JCS A;  5DU6 A;  4B3I A;  1XNW A;  3BF0 A;  2VSS E;  3P5M A;  4FN7 A;  2PPY A;  2X58 A;  2ZL3 A;  1N6F A;  3HE2 A;  1JXZ A;  4ZDD A;  4ELW A;  5DL1 A;  3OC7 A;  2VSU E;  1WDL A;  3MYB A;  1TYF A;  2CBY A;  3I47 A;  4JCR A;  3KTH A;  1PIX A;  3BEZ A;  3QYR A;  2W3P A;  3RST A;  1ON3 A;  5DUC A;  3U9S B;  4ZU2 A;  3FF6 A;  1XNV A;  3NJB A;  1K32 A;  3L3S A;  3KTI A;  3IAV A;  4QFE A;  4ZDC A;  4B3H A;  3OT6 A;  3KTK A;  4I42 A;  3T3W A;  3GKB A;  3R0O A;  2FZS A;  5CTC A;  3TZ3 A;  3V5I A;  5G1S A;  2Q35 A;  3DJA A;  2VX2 A;  4FND A;  1UYS A;  4HNK A;  1YG6 A;  3KTG A;  5HUQ A;  1X0U A;  3QMJ A;  3SWX A;  3MOY A;  1DUB A;  2ZQR A;  4U1A A;  4KPK A;  1FC9 A;  1SG4 A;  3PGQ A;  4NNQ A;  1PJH A;  4JYL A;  5G1Q A;  3TVW A;  3FDU A;  1EF9 A;  5DZK A;  3QWD A;  5CTB A;  3GMA A;  3IBB A;  1N6E A;  4KWB A;  4U0G H;  3M6N A;  1XNY A;  4HDT A;  3OME A;  1RJM A;  5C90 A;  1J7X A;  3H02 A;  2WTB A;  5E0S H;  3U9T B;  3R9Q A;  4K2N A;  4U0H A;  3Q0G A;  4JSB A;  1HNU A;  5E0N X;  5DU4 A;  3NJD A;  2ZL2 A;  5INF A;  2VSS F;  4K3W A;  2X24 A;  3K8X A;  4OG1 A;  3ZWA A;  1HZD A;  2BZR A;  3R9S A;  4FJW D;  3T89 A;  2VSU F;  4JOT A;  2F6I A;  4GM2 A;  2Q2X A;  2F9I B;  2VRE A;  4JWV A;  3ISA A;  5JBX A;  4RCN A;  4JCT A;  3TDC A;  2Q34 A;  3G64 A;  4JYJ A;  3QK8 A;  1OD4 A;  1DCI A;  3TT7 A;  2F6Q A;  5ING A;  3V5E A;  5DU8 A;  3Q7H A;  3T8A A;  3T88 A;  2J5S A;  2ZL4 A;  3H0Q A;  2VSU A;  4ZDF A;  5KDR A;  4MI2 A;  1NZY B;  5FUS A;  2ZQQ A;  1W2X A;  4NAR A;  4EMP A;  3TRR A;  4HC8 A;  4J2U A;  3BPT A;  4K29 A;  3P2L A;  3KQF A;  4MOU A;  4EML A;  3H0U A;  3HLN 1;  5IKL B;  4LK5 A;  3Q0J A;  3VIV A;  1EF8 A;  3BPP A;  4I52 A;  4RYF H;  2UZF A;  3KTJ A;  4IZB A;  4ASI A;  1HNO A;  3ZWB A;  3R6H A;  4U0G A;  3GLM A;  5INI A;  4JVT A;  4FZW C;  2DUB A;  3LKE A;  3MFM A;  2J5I B;  3MT6 A;  3HP0 A;  4FZW A;  3H0S A;  4ZDB A;  2QQ3 A;  2D3T A;  3PZK A;  3LAO A;  3ST9 A;  4QIJ A;  2HW5 A;  2FBM A;  3R9T A;  4GHN A;  4OMR A;  3TLF A;  4EMM A;  3PE8 A;  4NEK A;  3M6M A;  2J5G D;  2F9Y B;  4OLQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...