3OT6A

Crystal structure of an enoyl-coa hydratase/isomerase family protein from psudomonas syringae
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
230
structure length
230
Chain Sequence
b'AMSDLVSYHLDDGVATLTLNNGKVNAISPDVIIAFNAALDQAEKDRAIVIVTGQPGILSGGYDLKVMTSSAEAAINLVAQGSTLARRMLSHPFPIIVACPGHAVAKGAFLLLSADYRIGVAGPFSIGLNEVQIGMTMHHAGIELARDRLRKSAFNRSVINAEMFDPEGAMAAGFLDKVVSVEELQGAALAVAAQLKKINMNAHKKTKLKVRKGLLDTLDAAIEQDRQHML'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Enoyl-CoA hydratase/isomerase family protein
publication title Crystal Structure of an enoyl-CoA hydratase/isomerase family protein from Psudomonas syringae
rcsb
source organism Pseudomonas syringae pv. tomato
molecule tags Isomerase
total genus 80
structure length 230
sequence length 230
ec nomenclature
pdb deposition date 2010-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00378 ECH_1 Enoyl-CoA hydratase/isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 3ot6A00
3G64A 4ZDFA 3BPPA 3KTGA 2VSUC 1DUBA 4RYFH 3NJDA 2ZQQA 4IZDA 5E0SA 4FZWA 1RJMA 1XNYA 5C9GA 4OMRA 3IB9A 3ZWBA 3R9SA 1PJHA 3L3SA 3RSIA 4ZDCA 4L6WA 1Q51A 1N6EA 1Y7OA 1XO6A 3OC7A 3KTHA 1UYTA 3MOYA 5FUSA 3QMJA 3M6NA 3HE2A 4JSBA 1HNUA 4QIJA 4JJTA 5INIA 2FW2A 3HINA 4K3WA 2QQ3A 1HZDA 3R0OA 1J7XA 4NEKA 4I42A 3GF7A 4HC8A 4U1AA 2CBYA 5KDRB 4EMLA 1X0UA 5G1QA 2ZL2A 4GHNA 2J5GA 2PG8A 1OD4A 3Q0JA 3H0JA 2ZL0A 4B3HA 4WZ8B 2J5GD 2VREA 4KNPA 1ON3A 4ELWA 5DUCA 4Z0MA 3HP0A 4F47A 5E0NX 3U9TB 5DTPA 3P5MA 4B3JA 4JOTA 3STAA 1UIYA 5MGBA 3FDUA 5INGA 3IBBA 2IEXA 2VSSF 1K39A 3PE8A 2Q34A 4L8KA 2PPYA 3T3WA 3QK8A 5DZKA 3DORA 1XNWA 1UYSA 3K50A 2VX2A 2F9YB 2VSSE 4JCQA 2VSUF 5DUFA 4ZDDA 1UYVA 3SLLA 2HW5A 3LAOA 3QKAA 5INFA 1NZYA 4RYFA 3M6MA 2F9IB 1SZOA 2Q35A 3U9SB 2VSUE 3KTIA 3N6RB 4RCNA 2VSSA 1O8UA 1WDLA 1MJ3A 3FF6A 2A81A 3Q1TA 1TG6A 2X24A 1EF8A 1YG8A 3P85A 3PGQA 3I47A 3T89A 3KTKA 4FNDA 2DUBA 3JU1A 3T8AA 2A7SA 2VSUA 1W2XA 3H02A 5DU6A 1FCFA 1OD2A 3PEAA 5JBWA 3TRRA 3ISAA 4ELSA 1XNVA 5IKLB 4EMMA 2GTRA 3R9QA 1TYFA 1EY3A 4IZBA 2J5SA 1WDKA 4MI2A 3T88A 3V5IA 2NP9A 1WZ8A 3QWDA 1K32A 3BEZA 1N6DA 2UZFA 5FIFA 3P2LA 4KD6A 2W3PA 2J5IB 3Q7HA 3ZW9A 4WYOB 4LK5A 1FC6A 5C90A 2C8TA 3ZW8A 4U0GH 1Q52A 5KDRA 1XX4A 4U0HA 4JVTA 3GKBA 3RSTA 1ON9A 3QXZA 3LKEA 1FC9A 2X58A 4I4ZA 4JCSA 4GM2A 5DTWA 3H81A 3U9RB 4ASIA 4KPKA 4ELXA 4Q1IA 5E0SH 4K2NA 3H0SA 3TLFA 5DU8A 3ST9A 1JXZA 3RRVA 3GMAA 4QIIA 2CE3A 1FC7A 4ZDEA 2EJ5A 4OLQA 3QXIA 4NNQA 5G1SA 3QREA 1UYRA 4KWBA 3TZ3A 4IZCA 3H0UA 2D3TA 1DCIA 4Q0GA 3ZWCA 4MXIA 4ZDBA 5KJPA 4K29A 3TT7A 3KQFA 2ZL4A 4QFEA 2F9YA 2ZQRA 3NJBA 3Q0GA 5DU4A 1N6FA 3MYBA 3ZWAA 2Q2XA 4B3IA 4JYJA 4JYLA 3GF3A 3R6HA 1PIXA 2WTBA 3MT6A 2BZRA 2F9IA 3BF0A 4FN8A 2ZL3A 5JBXA 4WCZA 3OMEA 4OG1A 4FJWD 4MOUA 3TT6A 4U18A 4FB8A 2J5II 5CTBA 4G2RA 3DJAA 3PZKA 4JCTA 4U19A 3GLMA 3R9TA 3QYRA 5DL1A 3MFMA 3WG5A 2FZSA 3VIVA 4JWVA 3TVWA 4HNKA 4ZU2A 4FZWC 5CTCA 3TV5A 5DKPA 2F6IA 4EMPA 1YG6A 2F6QA 3V5EA 4I52A 4JCRA 3K8XA 4FN7A 2DEOA 1VRGA 1SG4A 3HLN1 3OT6A 4JFCA 1NZYB 3HRXA 3SWXA 3TVUA 3IAVA 4YLHA 4DI1A 5DZKH 5G1RA 4U0GA 4FNBA 3TDCA 1RJNA 3KTJA 1EF9A 2PBPA 2FBMA 1HNOA 3T8BA 2A7KA 1WDMA 3H0QA 2J5IA
chains in the Genus database with same CATH superfamily
3G64A 4ZDFA 3BPPA 3KTGA 2VSUC 1DUBA 4RYFH 3NJDA 2ZQQA 4IZDA 5E0SA 4FZWA 1RJMA 1XNYA 5C9GA 4OMRA 3IB9A 3ZWBA 3R9SA 1PJHA 3L3SA 3RSIA 4ZDCA 4L6WA 1Q51A 1N6EA 1Y7OA 1XO6A 3OC7A 3KTHA 1UYTA 3MOYA 5FUSA 3QMJA 3M6NA 3HE2A 4JSBA 1HNUA 4QIJA 4JJTA 5INIA 2FW2A 3HINA 4K3WA 2QQ3A 1HZDA 3R0OA 1J7XA 4NEKA 4I42A 3GF7A 4HC8A 4U1AA 2CBYA 5KDRB 4EMLA 1X0UA 5G1QA 2ZL2A 4GHNA 2J5GA 2PG8A 1OD4A 3Q0JA 3H0JA 2ZL0A 4B3HA 4WZ8B 2J5GD 2VREA 4KNPA 1ON3A 4ELWA 4J2UA 5DUCA 4Z0MA 3HP0A 4F47A 5E0NX 3U9TB 5DTPA 3P5MA 4B3JA 4JOTA 3STAA 1UIYA 5MGBA 4NARA 3FDUA 5INGA 3IBBA 2IEXA 2VSSF 1K39A 3PE8A 2Q34A 4L8KA 2PPYA 3T3WA 3QK8A 5DZKA 3DORA 1XNWA 1UYSA 3K50A 2VX2A 2F9YB 2VSSE 4JCQA 2VSUF 5DUFA 4ZDDA 1UYVA 3SLLA 2HW5A 3LAOA 3QKAA 5INFA 1NZYA 4RYFA 3M6MA 2F9IB 1SZOA 2Q35A 3U9SB 2VSUE 3KTIA 3N6RB 4RCNA 2VSSA 1O8UA 1WDLA 1MJ3A 3FF6A 2A81A 3Q1TA 1TG6A 2X24A 1EF8A 1YG8A 3P85A 3PGQA 3I47A 3T89A 3KTKA 4FNDA 2DUBA 3JU1A 3T8AA 2A7SA 2VSUA 1W2XA 3H02A 5DU6A 1FCFA 1OD2A 3PEAA 5JBWA 3TRRA 3ISAA 4ELSA 1XNVA 5IKLB 4EMMA 3BPTA 2GTRA 3R9QA 1TYFA 1EY3A 4IZBA 2J5SA 1WDKA 4MI2A 3T88A 3V5IA 2NP9A 1WZ8A 3QWDA 1K32A 3BEZA 1N6DA 2UZFA 5FIFA 3P2LA 4KD6A 2W3PA 2J5IB 3Q7HA 3ZW9A 4WYOB 4LK5A 1FC6A 5C90A 2C8TA 3ZW8A 4U0GH 1Q52A 5KDRA 1XX4A 4U0HA 4JVTA 3GKBA 3RSTA 1ON9A 3QXZA 3LKEA 1FC9A 2X58A 4I4ZA 4JCSA 4GM2A 5DTWA 3H81A 3U9RB 4ASIA 4KPKA 4ELXA 4Q1IA 5E0SH 4K2NA 3H0SA 3TLFA 5DU8A 3ST9A 1JXZA 3RRVA 3GMAA 4QIIA 2CE3A 1FC7A 4ZDEA 2EJ5A 4OLQA 3QXIA 4NNQA 5G1SA 3QREA 1UYRA 4KWBA 3TZ3A 4IZCA 3H0UA 2D3TA 1DCIA 4Q0GA 3ZWCA 4MXIA 4ZDBA 5KJPA 4K29A 3TT7A 3KQFA 2ZL4A 4QFEA 2F9YA 2ZQRA 3NJBA 3Q0GA 5DU4A 1N6FA 3MYBA 3ZWAA 2Q2XA 4B3IA 4JYJA 5HUQA 4JYLA 3GF3A 3R6HA 1PIXA 2WTBA 3MT6A 2BZRA 2F9IA 3BF0A 4FN8A 2ZL3A 5JBXA 4WCZA 3OMEA 4OG1A 4FJWD 4MOUA 3TT6A 4U18A 4FB8A 2J5II 5CTBA 4G2RA 3DJAA 3PZKA 4JCTA 4U19A 3GLMA 3R9TA 3QYRA 5DL1A 3MFMA 3WG5A 2FZSA 3VIVA 4HDTA 4JWVA 3TVWA 4HNKA 4ZU2A 4FZWC 5CTCA 3TV5A 5DKPA 2F6IA 4EMPA 1YG6A 2F6QA 3V5EA 4I52A 4JCRA 3K8XA 4FN7A 2DEOA 1VRGA 1SG4A 3HLN1 3OT6A 4JFCA 1NZYB 3HRXA 3SWXA 3TVUA 3IAVA 4YLHA 4DI1A 5DZKH 5G1RA 4U0GA 4FNBA 3TDCA 1RJNA 3KTJA 2YJGA 1EF9A 2PBPA 2FBMA 1HNOA 3T8BA 2A7KA 1WDMA 3H0QA 2J5IA
chains in the Genus database with same CATH topology
3G64A 4ZDFA 3BPPA 3KTGA 2VSUC 1DUBA 4RYFH 3NJDA 2ZQQA 4IZDA 5E0SA 4FZWA 1RJMA 1XNYA 5C9GA 4OMRA 3IB9A 3ZWBA 3R9SA 1PJHA 3L3SA 3RSIA 4ZDCA 4L6WA 1Q51A 1N6EA 1Y7OA 1XO6A 3OC7A 3KTHA 1UYTA 3MOYA 5FUSA 3QMJA 3M6NA 3HE2A 4JSBA 1HNUA 4QIJA 4JJTA 5INIA 2FW2A 3HINA 4K3WA 2QQ3A 1HZDA 3R0OA 1J7XA 4NEKA 4I42A 3GF7A 4HC8A 4U1AA 2CBYA 5KDRB 4EMLA 1X0UA 5G1QA 2ZL2A 4GHNA 2J5GA 2PG8A 1OD4A 3Q0JA 3H0JA 2ZL0A 4B3HA 4WZ8B 2J5GD 2VREA 4KNPA 1ON3A 4ELWA 4J2UA 5DUCA 4Z0MA 3HP0A 4F47A 5E0NX 3U9TB 5DTPA 3P5MA 4B3JA 4JOTA 3STAA 1UIYA 5MGBA 4NARA 3FDUA 5INGA 3IBBA 2IEXA 2VSSF 1K39A 3PE8A 2Q34A 4L8KA 2PPYA 3T3WA 3QK8A 5DZKA 3DORA 1XNWA 1UYSA 3K50A 2VX2A 2F9YB 2VSSE 4JCQA 2VSUF 5DUFA 4ZDDA 1UYVA 3SLLA 2HW5A 3LAOA 3QKAA 5INFA 1NZYA 4RYFA 3M6MA 2F9IB 1SZOA 2Q35A 3U9SB 2VSUE 3KTIA 3N6RB 4RCNA 2VSSA 1O8UA 1WDLA 1MJ3A 3FF6A 2A81A 3Q1TA 1TG6A 2X24A 1EF8A 1YG8A 3P85A 3PGQA 3I47A 3T89A 3KTKA 4FNDA 2DUBA 3JU1A 3T8AA 2A7SA 2VSUA 1W2XA 3H02A 5DU6A 1FCFA 1OD2A 3PEAA 5JBWA 3TRRA 3ISAA 4ELSA 1XNVA 5IKLB 4EMMA 3BPTA 2GTRA 3R9QA 1TYFA 1EY3A 4IZBA 2J5SA 1WDKA 4MI2A 3T88A 3V5IA 2NP9A 1WZ8A 3QWDA 1K32A 3BEZA 1N6DA 2UZFA 5FIFA 3P2LA 4KD6A 2W3PA 2J5IB 3Q7HA 3ZW9A 4WYOB 4LK5A 1FC6A 5C90A 2C8TA 3ZW8A 4U0GH 1Q52A 5KDRA 1XX4A 4U0HA 4JVTA 3GKBA 3RSTA 1ON9A 3QXZA 3LKEA 1FC9A 2X58A 4I4ZA 4JCSA 4GM2A 5DTWA 3H81A 3U9RB 4ASIA 4KPKA 4ELXA 4Q1IA 5E0SH 4K2NA 3H0SA 3TLFA 5DU8A 3ST9A 1JXZA 3RRVA 3GMAA 4QIIA 2CE3A 1FC7A 4ZDEA 2EJ5A 4OLQA 3QXIA 4NNQA 5G1SA 3QREA 1UYRA 4KWBA 3TZ3A 4IZCA 3H0UA 2D3TA 1DCIA 4Q0GA 3ZWCA 4MXIA 4ZDBA 5KJPA 4K29A 3TT7A 3KQFA 2ZL4A 4QFEA 2F9YA 2ZQRA 3NJBA 3Q0GA 5DU4A 1N6FA 3MYBA 3ZWAA 2Q2XA 4B3IA 4JYJA 5HUQA 4JYLA 3GF3A 3R6HA 1PIXA 2WTBA 3MT6A 2BZRA 2F9IA 3BF0A 4FN8A 2ZL3A 5JBXA 4WCZA 3OMEA 4OG1A 4FJWD 4MOUA 3TT6A 4U18A 4FB8A 2J5II 5CTBA 4G2RA 3DJAA 3PZKA 4JCTA 4U19A 3GLMA 3R9TA 3QYRA 5DL1A 3MFMA 3WG5A 2FZSA 3VIVA 4HDTA 4JWVA 3TVWA 4HNKA 4ZU2A 4FZWC 5CTCA 3TV5A 5DKPA 2F6IA 4EMPA 1YG6A 2F6QA 3V5EA 4I52A 4JCRA 3K8XA 4FN7A 2DEOA 1VRGA 1SG4A 3HLN1 3OT6A 4JFCA 1NZYB 3HRXA 3SWXA 3TVUA 3IAVA 4YLHA 4DI1A 5DZKH 5G1RA 4U0GA 4FNBA 3TDCA 1RJNA 3KTJA 2YJGA 1EF9A 2PBPA 2FBMA 1HNOA 3T8BA 2A7KA 1WDMA 3H0QA 2J5IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3G64 A;  4ZDF A;  3BPP A;  3KTG A;  2VSU C;  1DUB A;  4RYF H;  3NJD A;  2ZQQ A;  4IZD A;  5E0S A;  4FZW A;  1RJM A;  1XNY A;  5C9G A;  4OMR A;  3IB9 A;  3ZWB A;  3R9S A;  1PJH A;  3L3S A;  3RSI A;  4ZDC A;  4L6W A;  1Q51 A;  1N6E A;  1Y7O A;  1XO6 A;  3OC7 A;  3KTH A;  1UYT A;  3MOY A;  5FUS A;  3QMJ A;  3M6N A;  3HE2 A;  4JSB A;  1HNU A;  4QIJ A;  4JJT A;  5INI A;  2FW2 A;  3HIN A;  4K3W A;  2QQ3 A;  1HZD A;  3R0O A;  1J7X A;  4NEK A;  4I42 A;  3GF7 A;  4HC8 A;  4U1A A;  2CBY A;  5KDR B;  4EML A;  1X0U A;  5G1Q A;  2ZL2 A;  4GHN A;  2J5G A;  2PG8 A;  1OD4 A;  3Q0J A;  3H0J A;  2ZL0 A;  4B3H A;  4WZ8 B;  2J5G D;  2VRE A;  4KNP A;  1ON3 A;  4ELW A;  5DUC A;  4Z0M A;  3HP0 A;  4F47 A;  5E0N X;  3U9T B;  5DTP A;  3P5M A;  4B3J A;  4JOT A;  3STA A;  1UIY A;  5MGB A;  3FDU A;  5ING A;  3IBB A;  2IEX A;  2VSS F;  1K39 A;  3PE8 A;  2Q34 A;  4L8K A;  2PPY A;  3T3W A;  3QK8 A;  5DZK A;  3DOR A;  1XNW A;  1UYS A;  3K50 A;  2VX2 A;  2F9Y B;  2VSS E;  4JCQ A;  2VSU F;  5DUF A;  4ZDD A;  1UYV A;  3SLL A;  2HW5 A;  3LAO A;  3QKA A;  5INF A;  1NZY A;  4RYF A;  3M6M A;  2F9I B;  1SZO A;  2Q35 A;  3U9S B;  2VSU E;  3KTI A;  3N6R B;  4RCN A;  2VSS A;  1O8U A;  1WDL A;  1MJ3 A;  3FF6 A;  2A81 A;  3Q1T A;  1TG6 A;  2X24 A;  1EF8 A;  1YG8 A;  3P85 A;  3PGQ A;  3I47 A;  3T89 A;  3KTK A;  4FND A;  2DUB A;  3JU1 A;  3T8A A;  2A7S A;  2VSU A;  1W2X A;  3H02 A;  5DU6 A;  1FCF A;  1OD2 A;  3PEA A;  5JBW A;  3TRR A;  3ISA A;  4ELS A;  1XNV A;  5IKL B;  4EMM A;  2GTR A;  3R9Q A;  1TYF A;  1EY3 A;  4IZB A;  2J5S A;  1WDK A;  4MI2 A;  3T88 A;  3V5I A;  2NP9 A;  1WZ8 A;  3QWD A;  1K32 A;  3BEZ A;  1N6D A;  2UZF A;  5FIF A;  3P2L A;  4KD6 A;  2W3P A;  2J5I B;  3Q7H A;  3ZW9 A;  4WYO B;  4LK5 A;  1FC6 A;  5C90 A;  2C8T A;  3ZW8 A;  4U0G H;  1Q52 A;  5KDR A;  1XX4 A;  4U0H A;  4JVT A;  3GKB A;  3RST A;  1ON9 A;  3QXZ A;  3LKE A;  1FC9 A;  2X58 A;  4I4Z A;  4JCS A;  4GM2 A;  5DTW A;  3H81 A;  3U9R B;  4ASI A;  4KPK A;  4ELX A;  4Q1I A;  5E0S H;  4K2N A;  3H0S A;  3TLF A;  5DU8 A;  3ST9 A;  1JXZ A;  3RRV A;  3GMA A;  4QII A;  2CE3 A;  1FC7 A;  4ZDE A;  2EJ5 A;  4OLQ A;  3QXI A;  4NNQ A;  5G1S A;  3QRE A;  1UYR A;  4KWB A;  3TZ3 A;  4IZC A;  3H0U A;  2D3T A;  1DCI A;  4Q0G A;  3ZWC A;  4MXI A;  4ZDB A;  5KJP A;  4K29 A;  3TT7 A;  3KQF A;  2ZL4 A;  4QFE A;  2F9Y A;  2ZQR A;  3NJB A;  3Q0G A;  5DU4 A;  1N6F A;  3MYB A;  3ZWA A;  2Q2X A;  4B3I A;  4JYJ A;  4JYL A;  3GF3 A;  3R6H A;  1PIX A;  2WTB A;  3MT6 A;  2BZR A;  2F9I A;  3BF0 A;  4FN8 A;  2ZL3 A;  5JBX A;  4WCZ A;  3OME A;  4OG1 A;  4FJW D;  4MOU A;  3TT6 A;  4U18 A;  4FB8 A;  2J5I I;  5CTB A;  4G2R A;  3DJA A;  3PZK A;  4JCT A;  4U19 A;  3GLM A;  3R9T A;  3QYR A;  5DL1 A;  3MFM A;  3WG5 A;  2FZS A;  3VIV A;  4JWV A;  3TVW A;  4HNK A;  4ZU2 A;  4FZW C;  5CTC A;  3TV5 A;  5DKP A;  2F6I A;  4EMP A;  1YG6 A;  2F6Q A;  3V5E A;  4I52 A;  4JCR A;  3K8X A;  4FN7 A;  2DEO A;  1VRG A;  1SG4 A;  3HLN 1;  3OT6 A;  4JFC A;  1NZY B;  3HRX A;  3SWX A;  3TVU A;  3IAV A;  4YLH A;  4DI1 A;  5DZK H;  5G1R A;  4U0G A;  4FNB A;  3TDC A;  1RJN A;  3KTJ A;  1EF9 A;  2PBP A;  2FBM A;  1HNO A;  3T8B A;  2A7K A;  1WDM A;  3H0Q A;  2J5I A; 
#chains in the Genus database with same CATH topology
 3G64 A;  4ZDF A;  3BPP A;  3KTG A;  2VSU C;  1DUB A;  4RYF H;  3NJD A;  2ZQQ A;  4IZD A;  5E0S A;  4FZW A;  1RJM A;  1XNY A;  5C9G A;  4OMR A;  3IB9 A;  3ZWB A;  3R9S A;  1PJH A;  3L3S A;  3RSI A;  4ZDC A;  4L6W A;  1Q51 A;  1N6E A;  1Y7O A;  1XO6 A;  3OC7 A;  3KTH A;  1UYT A;  3MOY A;  5FUS A;  3QMJ A;  3M6N A;  3HE2 A;  4JSB A;  1HNU A;  4QIJ A;  4JJT A;  5INI A;  2FW2 A;  3HIN A;  4K3W A;  2QQ3 A;  1HZD A;  3R0O A;  1J7X A;  4NEK A;  4I42 A;  3GF7 A;  4HC8 A;  4U1A A;  2CBY A;  5KDR B;  4EML A;  1X0U A;  5G1Q A;  2ZL2 A;  4GHN A;  2J5G A;  2PG8 A;  1OD4 A;  3Q0J A;  3H0J A;  2ZL0 A;  4B3H A;  4WZ8 B;  2J5G D;  2VRE A;  4KNP A;  1ON3 A;  4ELW A;  4J2U A;  5DUC A;  4Z0M A;  3HP0 A;  4F47 A;  5E0N X;  3U9T B;  5DTP A;  3P5M A;  4B3J A;  4JOT A;  3STA A;  1UIY A;  5MGB A;  4NAR A;  3FDU A;  5ING A;  3IBB A;  2IEX A;  2VSS F;  1K39 A;  3PE8 A;  2Q34 A;  4L8K A;  2PPY A;  3T3W A;  3QK8 A;  5DZK A;  3DOR A;  1XNW A;  1UYS A;  3K50 A;  2VX2 A;  2F9Y B;  2VSS E;  4JCQ A;  2VSU F;  5DUF A;  4ZDD A;  1UYV A;  3SLL A;  2HW5 A;  3LAO A;  3QKA A;  5INF A;  1NZY A;  4RYF A;  3M6M A;  2F9I B;  1SZO A;  2Q35 A;  3U9S B;  2VSU E;  3KTI A;  3N6R B;  4RCN A;  2VSS A;  1O8U A;  1WDL A;  1MJ3 A;  3FF6 A;  2A81 A;  3Q1T A;  1TG6 A;  2X24 A;  1EF8 A;  1YG8 A;  3P85 A;  3PGQ A;  3I47 A;  3T89 A;  3KTK A;  4FND A;  2DUB A;  3JU1 A;  3T8A A;  2A7S A;  2VSU A;  1W2X A;  3H02 A;  5DU6 A;  1FCF A;  1OD2 A;  3PEA A;  5JBW A;  3TRR A;  3ISA A;  4ELS A;  1XNV A;  5IKL B;  4EMM A;  3BPT A;  2GTR A;  3R9Q A;  1TYF A;  1EY3 A;  4IZB A;  2J5S A;  1WDK A;  4MI2 A;  3T88 A;  3V5I A;  2NP9 A;  1WZ8 A;  3QWD A;  1K32 A;  3BEZ A;  1N6D A;  2UZF A;  5FIF A;  3P2L A;  4KD6 A;  2W3P A;  2J5I B;  3Q7H A;  3ZW9 A;  4WYO B;  4LK5 A;  1FC6 A;  5C90 A;  2C8T A;  3ZW8 A;  4U0G H;  1Q52 A;  5KDR A;  1XX4 A;  4U0H A;  4JVT A;  3GKB A;  3RST A;  1ON9 A;  3QXZ A;  3LKE A;  1FC9 A;  2X58 A;  4I4Z A;  4JCS A;  4GM2 A;  5DTW A;  3H81 A;  3U9R B;  4ASI A;  4KPK A;  4ELX A;  4Q1I A;  5E0S H;  4K2N A;  3H0S A;  3TLF A;  5DU8 A;  3ST9 A;  1JXZ A;  3RRV A;  3GMA A;  4QII A;  2CE3 A;  1FC7 A;  4ZDE A;  2EJ5 A;  4OLQ A;  3QXI A;  4NNQ A;  5G1S A;  3QRE A;  1UYR A;  4KWB A;  3TZ3 A;  4IZC A;  3H0U A;  2D3T A;  1DCI A;  4Q0G A;  3ZWC A;  4MXI A;  4ZDB A;  5KJP A;  4K29 A;  3TT7 A;  3KQF A;  2ZL4 A;  4QFE A;  2F9Y A;  2ZQR A;  3NJB A;  3Q0G A;  5DU4 A;  1N6F A;  3MYB A;  3ZWA A;  2Q2X A;  4B3I A;  4JYJ A;  5HUQ A;  4JYL A;  3GF3 A;  3R6H A;  1PIX A;  2WTB A;  3MT6 A;  2BZR A;  2F9I A;  3BF0 A;  4FN8 A;  2ZL3 A;  5JBX A;  4WCZ A;  3OME A;  4OG1 A;  4FJW D;  4MOU A;  3TT6 A;  4U18 A;  4FB8 A;  2J5I I;  5CTB A;  4G2R A;  3DJA A;  3PZK A;  4JCT A;  4U19 A;  3GLM A;  3R9T A;  3QYR A;  5DL1 A;  3MFM A;  3WG5 A;  2FZS A;  3VIV A;  4HDT A;  4JWV A;  3TVW A;  4HNK A;  4ZU2 A;  4FZW C;  5CTC A;  3TV5 A;  5DKP A;  2F6I A;  4EMP A;  1YG6 A;  2F6Q A;  3V5E A;  4I52 A;  4JCR A;  3K8X A;  4FN7 A;  2DEO A;  1VRG A;  1SG4 A;  3HLN 1;  3OT6 A;  4JFC A;  1NZY B;  3HRX A;  3SWX A;  3TVU A;  3IAV A;  4YLH A;  4DI1 A;  5DZK H;  5G1R A;  4U0G A;  4FNB A;  3TDC A;  1RJN A;  3KTJ A;  2YJG A;  1EF9 A;  2PBP A;  2FBM A;  1HNO A;  3T8B A;  2A7K A;  1WDM A;  3H0Q A;  2J5I A; 
#chains in the Genus database with same CATH homology
 3G64 A;  4ZDF A;  3BPP A;  3KTG A;  2VSU C;  1DUB A;  4RYF H;  3NJD A;  2ZQQ A;  4IZD A;  5E0S A;  4FZW A;  1RJM A;  1XNY A;  5C9G A;  4OMR A;  3IB9 A;  3ZWB A;  3R9S A;  1PJH A;  3L3S A;  3RSI A;  4ZDC A;  4L6W A;  1Q51 A;  1N6E A;  1Y7O A;  1XO6 A;  3OC7 A;  3KTH A;  1UYT A;  3MOY A;  5FUS A;  3QMJ A;  3M6N A;  3HE2 A;  4JSB A;  1HNU A;  4QIJ A;  4JJT A;  5INI A;  2FW2 A;  3HIN A;  4K3W A;  2QQ3 A;  1HZD A;  3R0O A;  1J7X A;  4NEK A;  4I42 A;  3GF7 A;  4HC8 A;  4U1A A;  2CBY A;  5KDR B;  4EML A;  1X0U A;  5G1Q A;  2ZL2 A;  4GHN A;  2J5G A;  2PG8 A;  1OD4 A;  3Q0J A;  3H0J A;  2ZL0 A;  4B3H A;  4WZ8 B;  2J5G D;  2VRE A;  4KNP A;  1ON3 A;  4ELW A;  4J2U A;  5DUC A;  4Z0M A;  3HP0 A;  4F47 A;  5E0N X;  3U9T B;  5DTP A;  3P5M A;  4B3J A;  4JOT A;  3STA A;  1UIY A;  5MGB A;  4NAR A;  3FDU A;  5ING A;  3IBB A;  2IEX A;  2VSS F;  1K39 A;  3PE8 A;  2Q34 A;  4L8K A;  2PPY A;  3T3W A;  3QK8 A;  5DZK A;  3DOR A;  1XNW A;  1UYS A;  3K50 A;  2VX2 A;  2F9Y B;  2VSS E;  4JCQ A;  2VSU F;  5DUF A;  4ZDD A;  1UYV A;  3SLL A;  2HW5 A;  3LAO A;  3QKA A;  5INF A;  1NZY A;  4RYF A;  3M6M A;  2F9I B;  1SZO A;  2Q35 A;  3U9S B;  2VSU E;  3KTI A;  3N6R B;  4RCN A;  2VSS A;  1O8U A;  1WDL A;  1MJ3 A;  3FF6 A;  2A81 A;  3Q1T A;  1TG6 A;  2X24 A;  1EF8 A;  1YG8 A;  3P85 A;  3PGQ A;  3I47 A;  3T89 A;  3KTK A;  4FND A;  2DUB A;  3JU1 A;  3T8A A;  2A7S A;  2VSU A;  1W2X A;  3H02 A;  5DU6 A;  1FCF A;  1OD2 A;  3PEA A;  5JBW A;  3TRR A;  3ISA A;  4ELS A;  1XNV A;  5IKL B;  4EMM A;  3BPT A;  2GTR A;  3R9Q A;  1TYF A;  1EY3 A;  4IZB A;  2J5S A;  1WDK A;  4MI2 A;  3T88 A;  3V5I A;  2NP9 A;  1WZ8 A;  3QWD A;  1K32 A;  3BEZ A;  1N6D A;  2UZF A;  5FIF A;  3P2L A;  4KD6 A;  2W3P A;  2J5I B;  3Q7H A;  3ZW9 A;  4WYO B;  4LK5 A;  1FC6 A;  5C90 A;  2C8T A;  3ZW8 A;  4U0G H;  1Q52 A;  5KDR A;  1XX4 A;  4U0H A;  4JVT A;  3GKB A;  3RST A;  1ON9 A;  3QXZ A;  3LKE A;  1FC9 A;  2X58 A;  4I4Z A;  4JCS A;  4GM2 A;  5DTW A;  3H81 A;  3U9R B;  4ASI A;  4KPK A;  4ELX A;  4Q1I A;  5E0S H;  4K2N A;  3H0S A;  3TLF A;  5DU8 A;  3ST9 A;  1JXZ A;  3RRV A;  3GMA A;  4QII A;  2CE3 A;  1FC7 A;  4ZDE A;  2EJ5 A;  4OLQ A;  3QXI A;  4NNQ A;  5G1S A;  3QRE A;  1UYR A;  4KWB A;  3TZ3 A;  4IZC A;  3H0U A;  2D3T A;  1DCI A;  4Q0G A;  3ZWC A;  4MXI A;  4ZDB A;  5KJP A;  4K29 A;  3TT7 A;  3KQF A;  2ZL4 A;  4QFE A;  2F9Y A;  2ZQR A;  3NJB A;  3Q0G A;  5DU4 A;  1N6F A;  3MYB A;  3ZWA A;  2Q2X A;  4B3I A;  4JYJ A;  5HUQ A;  4JYL A;  3GF3 A;  3R6H A;  1PIX A;  2WTB A;  3MT6 A;  2BZR A;  2F9I A;  3BF0 A;  4FN8 A;  2ZL3 A;  5JBX A;  4WCZ A;  3OME A;  4OG1 A;  4FJW D;  4MOU A;  3TT6 A;  4U18 A;  4FB8 A;  2J5I I;  5CTB A;  4G2R A;  3DJA A;  3PZK A;  4JCT A;  4U19 A;  3GLM A;  3R9T A;  3QYR A;  5DL1 A;  3MFM A;  3WG5 A;  2FZS A;  3VIV A;  4HDT A;  4JWV A;  3TVW A;  4HNK A;  4ZU2 A;  4FZW C;  5CTC A;  3TV5 A;  5DKP A;  2F6I A;  4EMP A;  1YG6 A;  2F6Q A;  3V5E A;  4I52 A;  4JCR A;  3K8X A;  4FN7 A;  2DEO A;  1VRG A;  1SG4 A;  3HLN 1;  3OT6 A;  4JFC A;  1NZY B;  3HRX A;  3SWX A;  3TVU A;  3IAV A;  4YLH A;  4DI1 A;  5DZK H;  5G1R A;  4U0G A;  4FNB A;  3TDC A;  1RJN A;  3KTJ A;  2YJG A;  1EF9 A;  2PBP A;  2FBM A;  1HNO A;  3T8B A;  2A7K A;  1WDM A;  3H0Q A;  2J5I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...