3OT9A

Phosphopentomutase from bacillus cereus bound to glucose-1,6-bisphosphate
Total Genus 141
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
141
Knots found
sequence length
391
structure length
390
Chain Sequence
b'NKYKRIFLVVMDSVGIGEAPDAEQFGDLGSDTIGHIAEHMNGLQMPNMVKLGLGNIREMKGISKVEKPLGYYTKMQEKSTGKDMTGHWEIMGLYIDTPFQVFPEGFPKELLDELEEKTGRKIIGNKPASGTEILDELGQEQMETGSLIVYTSADSVLQIAAHEEVVPLDELYKICKIARELTLDEKYMVGRVIARPFVGEPGNFTRTPNRHDYALKPFGRTVMNELKDSDYDVIAIGKISDIYDGEGVTESLRTKSNMDGMDKLVDTLNMDFTGLSFLNLVDFDALFGHRRDPQGYGEALQEYDARLPEVFAKLKEDDLLLITADHGNDPIHPGTDHTREYVPLLAYSPSMKEGGQELPLRQTFADIGATVAENFGVKMPEYGTSFLNEL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phosphopentomutase
publication title Bacillus cereus Phosphopentomutase Is an Alkaline Phosphatase Family Member That Exhibits an Altered Entry Point into the Catalytic Cycle.
pubmed doi rcsb
source organism Bacillus cereus
molecule tags Isomerase
total genus 141
structure length 390
sequence length 391
chains with identical sequence B, C
other databases KnotProt 2.0: S +31
ec nomenclature ec 5.4.2.7: Phosphopentomutase.
pdb deposition date 2010-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01676 Metalloenzyme Metalloenzyme superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1250 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Phosphopentomutase 3ot9A02
3.40.720.10 Alpha Beta 3-Layer(aba) Sandwich Alkaline Phosphatase, subunit A Alkaline Phosphatase, subunit A 3ot9A01
4ZG9A 5LIAA 3DYCA 1N2KA 1AJBA 5LQQA 2RH6A 2ZKTA 5LRMA 4UOOA 4LR8A 1EJJA 4NWXA 3E2DA 4LRBA 3ED4A 3BDGA 1EQJA 1SHQA 1SHNA 5C66A 1ZEFA 2GLQA 2W5QA 4TN0A 2IUCB 3IDDA 1HJKA 4UPKA 3SZYA 3UO0A 4LR7A 4LQYA 3M8WA 2GSOA 4MY4A 2X98A 4MHXA 3TWZA 1ANJA 4CYRA 1KH5A 2GSNA 1KHNA 1K7HA 2QZUA 4KM4A 4CYSA 3OT9A 1ALIA 4B56A 1URBA 3UN2A 1N2LA 2GSUA 1EW2A 3NKNA 5EGEA 1EW9A 1EI6A 1KHJA 3LXQA 4FDJA 1ELYA 5HRTA 3NKOA 3M7VA 4GTYA 3A52A 1ED8A 5IJQA 4ZG7A 3MK0A 3TG0A 4LRAA 4UPIA 4CXUA 5DLWA 1O98A 2W5WA 4LRCA 3IGZB 1EW8A 2GA3A 3WAXA 3DPCA 4LREA 1B8JA 1KH9A 5L0EA 1HDHA 3NKQA 3T02A 4ZG6A 2VQRA 4UPLA 1P49A 1Y6VA 5INHA 2W8DA 2W5VA 1AJCA 1ALKA 1KH4A 3BDGB 4KAYA 4LR2A 5K4PA 3NVLA 1AUKA 3UN3A 3TX0A 1AJDA 4UOPA 2ANHA 3M8YA 3KD8A 4GTZA 1ALHA 5LRNA 3MK2A 4CXSA 1AJAA 2W8SA 1ANIA 2XR9A 3NKRA 4MIVA 4GTWA 4KAVA 5GOVA 5L0BA 2W5TA 3B5QA 4NWJA 1ELXA 1KHLA 1KHKA 5DLTA 3NKPA 1KH7A 2IFYA 4UORA 1Y7AA 1FSUA 3M8ZA 1E1ZP 4LRFA 5L0KA 1ALJA 4KJDA 3WAWA 4CXKA 3UNYA 1E3CP 2D1GA 3MK1A 5TJ3A 3T00A 4KJGA 2IUCA 3IGYB 1ZEBA 4YR1A 4LR9A 1E33P 5DLVA 2W5SA 1ED9A 2W5XA 3WAYA 4QAXA 4N7TA 4GTXA 5KXAA 3T01A 4FDIA 3BDHA 1O99A 4LRDA 3WAVA 2G9YA 1HQAA 1ZEDA 1E2SP 3NKMA 3Q3QA 4UPHA 5GRRA 3CMRA 5IJSA 5AJ9A 3BDFA 2W5RA 3SZZA 1ELZA 1URAA 4ZGAA 3UN5A 2XRGA 5EGHA 3WBHA
chains in the Genus database with same CATH superfamily
4RUHA 1VIOA 2I5JB 3AJ1A 3JSBA 1SC6A 3AJDA 3E01A 2IMWP 2FJBB 3HFZB 4IDKB 2OAUA 1RZMA 3F0NA 1L3VA 2EVZA 3MTKA 4ZDNA 1JLGA 2B43A 1S5ZA 2QZUA 5L8RC 4UZCA 4R5PA 2CVEA 5L1JA 1L3KA 1UFLA 1JLAB 5KG6A 3KNAA 2OH2A 4MMOA 2WVBA 1FDAA 1AZSB 2QA4G 3U1MA 1N8RT 2GMHA 3K58A 3GG1A 2L48A 1NZ8A 1CG2A 4I6YA 1NK7A 4K5RA 3IMQJ 4LSZB 4DQSA 4CXKA 1S99A 1TUVA 5EX3A 2R7RA 2QMWA 3B6BA 1MN9A 4ECVA 2ADBA 2UU9J 3HULA 2BE9B 3G6VA 4WFBQ 4OMFG 2CPDA 4JI2F 1LK5A 3T1AA 4LBPA 1VS3A 1HNZF 2U1AA 5A6PA 2P6SA 4PPDA 4CLYA 3S6EA 1UEVA 5IQ6A 2HBZB 4ER8A 1JWWA 4JI1J 3ZZTA 3JTPA 2ADCA 2BJ9A 4UY8T 2A6MA 5BYSA 2RT3A 3CD7A 2GAGC 4DPWA 1CJKB 1KLMA 1K8AT 5KFOA 4MIWA 5THWA 4B9NA 2KFZA 2KJWA 2VQRA 1JLCA 4QJVA 2Q6CA 4TY8A 2R7QA 2ZBCA 4YS2A 4TQRA 3MXHP 4IQXA 4DR2F 4NCBA 3DKDA 3MMAA 2HVIA 4DFJA 4AQYJ 3M8PA 4Q45A 1BLUA 1ZH5A 1RTDB 1FDNA 1J5EF 2C3PA 1IR1A 1WOOA 2XMWA 1PBAA 2YPYA 4EZ9A 1OPZA 1T05A 4NLQA 4OJ1A 1JX4A 3AXMA 1L3UA 3R5GA 4CM2A 2W4DA 5KFUA 5KFZA 3VAJA 4DR4J 1DURA 4ELVA 3BV8A 3KG1A 4H4KC 1D8ZA 3MD3A 2BKPA 3OFFA 2VG6A 1NEEA 1Q0NA 4CYUA 1KH5A 3PR5B 4DL0C 2QC3A 1T11A 3DGVA 4YDDB 1DFDA 4USHA 3GFZA 7FD1A 3ILOA 1F9HA 2BKOA 2HHVA 1JLQA 5CD4H 4NA3A 5HSPA 4TQSA 3NKQA 1HQ2A 2FUG9 4NCAA 2HHHJ 3NVLA 5B0EA 3WHIA 4ED5A 2ANHA 1U1LA 2APOA 1UJ5A 4DV0F 1SC3B 3PRVA 1KHWA 4P7VA 3DHWC 3DLEA 2ACYA 3TAPA 2IUCA 3QATA 2XULA 2M88A 4MJKA 4GKKF 1HA1A 5J1EB 3MEGA 1FTCA 1Y11A 5IS2A 3KK3B 4KH0B 1HQAA 4NX9A 1U02A 3CMRA 2ZH8A 1OYDA 4KHMA 2WW8A 5GMKa 1S1TB 4HL9A 4X4RA 3PVXA 3O2IA 6FD1A 2NXUA 2LECA 2WZ1A 4LQ9A 1PJ6A 1XNRJ 3VAHA 2EXUA 2JHEA 2QV6A 1RAHB 4ZVPB 3HD1A 3TA0A 3LXQA 1ELYA 1F1BB 2KKHA 5CABA 3D7SB 3DLGA 3OLAA 3I56S 1KR4A 3MM9B 4DZDA 5ETTA 1HBMB 3M9MB 2DPJA 4FKYA 2MSTA 1S10A 5KFRA 4QR0A 2DR6A 2IYIA 3G8SA 2N4DA 4Q0BB 5F8HA 1DJ0A 2BQRA 3GYNA 5J2NA 4ZP8A 1N6QB 3I5CA 4L76A 5D4OA 2VBZA 3K57A 5DGBA 1NJYA 3T01A 4LF6F 1T94A 3BN4A 3GB0A 2VHGA 1S76D 1FDDA 5D0EA 2MLXA 1RHMB 2YWFA 4JI3J 3AY0A 3D4JA 3OXLA 5F8LA 4IH6A 3SI8A 3KHRA 4DPYA 1U47A 1QVGR 1TU0B 4I2PB 1LNQA 1KOOA 3M2RB 1D9AA 5J2PA 3CB4A 2NUHA 4I7FB 2YKQA 4B3RF 5KG1A 4RW6B 3J81U 4TN2A 3VZHA 1KHJA 4DSFA 4RW8A 5ADZA 2EI5A 5HMYA 5LXRA 4RUBA 1YQHA 5D0HA 1SXLA 4NZ0A 1YITS 2C2MB 3CJQA 3PKYA 4ETXA 3MAAB 3MOJB 1O8BA 2E66A 3HVAA 2FY1A 2JFKA 2XS5A 3W5YA 4HKQA 4USWA 3J81j 1ZYQA 3AXKA 2LCWA 1OQ6A 2YKMB 3OTDA 4J9QA 1KTVA 1HW9A 3DRRA 1NDKA 4C3LA 4CLUA 5AT1B 4URQU 4B3MJ 1Q8LA 1RWWB 3M2UB 4TU9A 4QYRA 1LWEB 3TW0A 2J5AA 5L46A 2DITA 2DNMA 4OJHA 1N2KA 3MMCB 3OFGA 5F8NA 3H5SA 4K4YA 2HHWA 2KH9A 5EWGA 4PG6A 1I94F 4G1PA 3KK2B 2J7UA 1MG7A 4CO1A 3DN9A 3OTEA 3VGTA 4KAIA 3MEEB 2DNZA 1WJ9A 1YBTA 3CCMS 2DHSA 2JJ4D 1RA7A 3VR1A 2FHKA 4EBDA 4TNOA 1QJHA 1JQGA 2MPUA 2DHHA 4I1TA 2DISA 5HMXA 1Z4UA 5DQGA 2EWHA 4CXSA 3CJRA 3UVJA 2XMKA 3NGTA 2IBOA 4KJIA 3SCIE 2Y8WA 3BYRA 3K59A 3UCZP 3WC0A 3LGNA 3G6ES 2AYGA 1UA0A 3OUYA 2FD2A 1IKXB 2VFTA 4PXBA 2Y1JA 5HQMA 3CC4S 2HQGA 1Y10A 3HVRA 3Q3QA 3Q23A 2ZH5A 1TL1B 2V67A 1RT3B 2KXFA 3VZIA 5A2QY 1IJFB 3DRYA 4PWDA 4ZGAA 4ZVOB 5A0YB 4C0BA 4KKOA 1AXQA 1HYSA 4I2QA 1HNXJ 3T5KA 1P6TA 2HAFA 4FDFA 3IRXA 2WRMA 3TJ8A 2HBQB 5CH7B 4CQ1A 1TKXA 1KONA 2RB7A 3TUPA 2V4QA 1D1UA 3EPIA 2N3LA 4NLSA 4IG3B 1R6YA 4ECUA 2EK6A 2CVIA 1J5EJ 4PWUA 5HN0A 4K2XA 1WF2A 2KFNA 4ZKAA 4JV5J 1NHKL 1R8HA 3TARA 4QPXA 4DN9A 2YWHA 3Q89A 5H9EJ 4C9DA 4DHVA 3R2DJ 1H73A 1Q8IA 2CPYA 4J9RA 3AD8C 1FEHA 2JC1A 3CJ4A 1S1UA 4P7TA 4ZOSA 4F04B 2VA3A 2HSEB 3BB5A 2IHR1 1U6FA 1VRUB 5H1SV 3HK2A 1MMLA 4LIWA 3KLFB 5A8KB 4W90B 3SDEB 3DNCA 3FRYA 4WP3A 1RWVB 2XC9A 3L09A 2VG7A 1ZEFA 1N54B 2R2TA 3SZYA 2HVEA 3EMTA 2F63A 2P5VA 4C7QA 4KM4A 1HFEL 1P9QC 2DXFA 4NCGB 1NMEB 4UZBA 3S8SA 3BGRA 1IKVA 1RLCL 4E0DA 1TL7B 2AV5A 3UR3C 2B51A 5B0DA 1XC9A 3TAMB 3OPKA 3KD8A 1LXJA 2H65B 4FKXA 5ITHA 1ANIA 1UPPA 1QTMA 2CIMA 5ETLA 3MM6A 3DCAA 3CPWR 2FVSA 2M8DB 2CNLB 4MK7A 2VH7A 2V2ZA 1OO0B 4K0KF 1UEKA 1XIQA 3K5NA 2IAJB 3TUIC 3PW5A 2V8VA 1KRPA 2MTLA 1DBDA 1FWLA 2XEXA 1I6JA 2O01C 1FRJA 2HMIA 1IBKJ 1FEEA 1EP4A 1RWUA 2RHQB 4HDHA 3LP1B 2Q6BA 4EYIB 4LR7A 4IOBA 1YJ7A 2VA2A 3OR1B 4ZVRB 1TKTB 1X4FA 5B09A 3C6TB 4DR7J 4YHHF 5GADU 1KTQA 4ECXA 1HHTP 4O3PA 1S9GB 4ID5B 1R6VA 5ETOA 5IT4A 1LW2A 3Q8RB 3RTVA 3B8HA 3OLBA 2OMLA 4NE9C 4WK1A 1HBUA 4NLRA 1WSRA 2DY1A 4LF6J 4Y65A 1TUGB 4DSJA 3MECB 1FESA 4UOFA 4MIAA 4PG4A 4N76A 4YR3A 3R8YA 2JEJA 3WAYA 1O51A 2E9TA 1HIYA 4U8VA 2RJZA 2G9YA 2MKJA 4OV1A 4HVZA 4AUKA 4M5JA 1PC4A 2YKOA 2XMVA 3M1VA 8ATCB 2IC3A 3PACA 2I38A 4C11B 1BGXT 2RH6A 1ZAWA 2VJVA 5IV4A 2E9RX 3I31A 3MR6A 3NGDA 2GLQA 2W5QA 3MMJA 4L6V3 3M6VA 3KJVB 1WC6A 1QLNA 2HHXA 4PAAA 1Q4RA 2OO4A 3RB0A 1QAJA 1HMVA 2XY7A 2I1RA 2VFUA 4JI4F 3ZZYA 3CJKB 4KO0A 1K44A 2MYFA 1YSJA 1YZ6A 4KY3A 1KQFB 4GTYA 2BRKA 2DGVA 2EG1A 5DLFA 3RRHA 1M90T 3OXGA 1RT6B 3GYGA 4URGA 5AXLA 4G1IA 3HFKA 2RRAA 2NPIA 4IFYB 3C8YA 5LSLA 5E3QA 4RJVA 2IFYA 1PCAA 1N4LA 4TXSA 4ANEA 2B3TB 4LRFA 4DQRA 1SQGA 4N56A 4C8YA 3DOMB 3JAMU 2NUUG 4OLOA 4J9KA 2BXJA 4A8WA 3H59A 5KXAA 4J9SA 3FCHA 4JV2A 4PUOB 2IRYA 4Q8FA 3WQPA 4QIFA 2ZE2A 2C3OA 4HTIA 3ET6A 3MR2A 1W2BR 2OEJA 1S0OA 2CPHA 1HW8A 2YKNA 3X3UA 4LF4F 2ZKUA 5ETQA 1VQ7S 1Q95G 2VKZG 4FXDA 2V50A 3GPAA 1NBEB 4LF5J 3A13A 3K5MA 2RSQA 5KFFA 1EAYC 2DGXA 1H7XA 3QT6A 1I5OB 1IKWA 4ZK7M 1MW7A 2DRBA 3NBPA 2DNKA 5KFBA 2MB0B 2V4JA 1RAIB 1U8SA 4USIA 3T9NA 1KSPA 2QT7A 3QJLA 5GAEU 4LIRA 3RAXA 3K0JA 1R0AA 5HAOA 3NS7B 4O44A 4OI0A 3IA0A 1Z2ZA 2CQ1A 2JLEA 4GTXA 2UUBF 4O3SA 1T95A 4ZJQA 2XS7A 4ED4A 5CAAA 4ZLJA 2LVWA 2ASDA 2WB4A 1FKPA 1WI8A 1URAA 4YOEA 4N8OA 5JJBA 2X1GA 4CO4A 1UA1A 1BY9A 4PXCA 3BKTA 4R0EA 2UVUA 4K4VA 1N0VC 2X98A 3FBBA 2ZZTA 3HSGA 3CJ5A 2FJEB 4X4TA 1S6QA 4FDJA 1EKSA 2AGQA 1UVJA 1DY3A 4KRWA 2YWKA 8AT1B 4DX6A 3PTWA 4BWMA 1SL0A 2LQBA 1FTRA 3I32A 2GGPB 2WCXA 2YX1A 2AP6A 4DR3J 1FXRA 4V19J 4P75A 2F3JA 3H7HB 2VUGA 1KD1T 2UXCJ 4M5KA 3ZTSA 1REGX 2M0GB 1ZOTA 2J7KA 2WOMB 4KPCA 2K3KA 3P96A 2KZMA 1DZ5A 3FZBA 5IC6B 3ETOA 1PJ5A 1U2FA 2QA2A 4JV0A 1S77D 3I9ZA 5DLVA 1J2VA 3D28A 2GVDA 2F7VA 4JV1A 1DHMA 3H5YA 2HYIB 2K1RB 1NDPA 4XIUA 1OSDA 3K7RA 3CSKA 1XNQJ 4ILMA 2KXHA 1XQIA 1C0UA 1NZAA 3N6MA 2G1HA 2IA0A 3KLEB 3V6JA 4UY85 1OPIA 2PT0A 2VQFF 4YMEA 3G87A 4I64A 4DV3F 2C3UA 4KC5A 4A8XA 2BM0A 2XGPA 3CE8A 3PZPA 1DLOB 1KQSR 5IJQA 2QFIA 3CJ8A 4C8MA 3S1TA 1IBMJ 2PMZD 4O4RA 1APSA 2VFVA 1X0FA 1G2EA 2FHOB 4ZJLA 4LR2A 2WVCA 3SBMA 2KG0A 1B4SA 1CBKA 1PYTA 3BREA 2W8SA 1XJWB 4XDDA 2VQEJ 4A48A 3BQ1A 4ZHRA 1GXTA 4DPOA 1ZM3A 4RW4A 1EQMA 3DGPB 2ZM6F 2XHCA 2DHXA 5A8RB 4QIWD 3PW4A 3CD0A 4UW2A 2AJ0A 1XEZA 3ZTOA 4AE5A 4HLBA 4DS5A 2KZZA 1EIYB 1D8YA 4MKAA 3DLHA 1NKCA 1K73T 4WZMA 3E3XA 3O8WA 4F26A 3VQSA 1D09B 2FGOA 3J7YU 2QZ8A 3ONQA 5DQHA 5DDQC 1HWUA 2KI2A 4USVA 3MEKA 2H5JB 4OYMA 2PEHA 3C6UB 1Q8KA 1FNMA 2G9OA 3SCLE 1GXUA 3W2WA 3HVTB 1G6BA 3BSAA 4R8UB 4K4ZA 4GO5X 1S97A 3BQ2A 4L72B 1JLEB 1EW8A 2DYAA 3KK1B 3BN7A 2MKCA 3DXBA 2HHQA 1RLDA 1TK8A 3TEHB 3W64A 2OI2A 2VDHA 2L08A 2J0SD 2KTQA 1RHKB 1LW0A 4W4MA 1VQSA 4F0MA 2GC8A 1WDTA 2QLJB 2YQ3A 1E3CP 3MK1A 4OZ1A 2ZFHA 4J9UE 4YR1A 1R7IA 2OP5A 3W60A 3ILIA 2LDIA 4DR5F 4NWBA 1N33J 3SXLA 4A4JA 2EBEA 4B3SF 3FC9A 1FX2A 1SBRA 3DLKB 2XNRA 2CUYA 1K1SA 3FRZA 2Q3PA 3G71S 1Y3KA 4DOZA 4WXOA 1FK9A 2Y9HA 3TUZC 3ZZUA 4C48A 5DETA 4MFBA 3J80U 3RAMA 2HFSA 2OGUA 1RI7A 1UW4A 3M32B 3GR0A 2RH3A 2DNQA 2W9CA 2VFRA 3V81A 3AAWB 4RBVA 4OX8A 3QAUA 4LVOP 4DG1A 3KG4A 2MY8A 3NLCA 1NO8A 3DLBA 4V19X 1NHVA 5KFKA 1P1LA 4OIXA 3KKFA 1WC3A 4U7CA 4J37A 1AT1B 2C1EB 2E7VA 2OPPA 2AT1B 1N36J 3PO5A 3QT7A 3QLHA 5SUHA 1GTEA 3M8ZA 3MR7A 5KTQA 2PO4A 4MT1A 1Q79A 4ECYA 1VCTA 4AXIA 1HNWJ 4J9VA 5CYJA 1T3NA 3KLGA 3SQGB 2DY9A 2XCAA 3A8IA 1GH8A 2VC0A 3BDFA 3FEYB 3DOLA 2OTJS 2IDEA 1H2VZ 2MQOA 2UUWA 2EBGA 4DX8H 2FZKB 3HXMA 3LAKA 2LP4A 4OX9F 4NWXA 1N5SA 1XTZA 1PIEA 4LFAF 5C25A 2N4CA 3KMSA 3GV5B 5KT5A 1ANJA 3HDSA 2QLBB 1G4CA 3LANA 1NDLA 3HSZA 5M2UA 5DM7Q 1XMBA 2CQ3A 3V6KA 2RF2B 3ELHA 2H54B 2YVSA 1OY9A 2NSCA 3B82A 3AB4B 1SQEA 3KLIA 2YNGB 2R8KA 4IR9A 3FDSA 2V8PA 4DV1F 5GADI 1R43A 2D1CA 4F2RA 2HPUA 2HRUA 3CUNA 2WK4A 4QU7A 2CZVC 3HD2A 4CO2A 2IJNA 4DUTA 1NK4A 5CYQA 1YJ9S 5FLXY 2B4PA 3QNWB 2BW2A 3DYAA 3TAQA 4WP9A 4RNMA 2BOPA 1X4CA 2HIYA 1JB0C 2IA6A 2HIQA 4F0KA 4PEOA 2JEIA 1SPBP 1LV5A 2X51A 4CO0A 3ENAA 5IM0B 1QTNB 3HZEA 1RT2A 4DPXA 1WKKA 1BE4A 2E5IA 4QYZJ 3RGIA 4TU8A 3MEDB 1EJ7L 2YH1A 2P8IA 3D1QA 4Y2MA 4IG0B 3OFEA 1EW9A 4ERDA 1M5HA 4E2FB 1RTIA 3PXGa 1VBYA 2OKQA 4KPYA 2QN6B 4ITSA 2MKSA 4UPLA 4Y28C 4X66J 1HQEA 1HQUB 5D4LA 2QX0A 3SZ2A 3AT1B 2GFFA 3RJMB 2PDAA 4G1QA 3U27A 1H72C 3J7AN 4OV6A 3B5QA 5K8NA 1S57A 1QAYA 3EXCX 1VJQA 3T6BA 4YDXA 3EZUA 4F4AA 1RKJA 3AQPA 2IPOB 3DMJB 2B6AA 3JTNA 1U1KA 2DIUA 1R0CB 1Q82T 4B02A 3MMBB 4FS1A 1Q7YT 3D1HA 2QRRA 1GTHA 3SFGA 3VCDA 2VC1A 1S48A 2AYEA 5I42B 2Y0SD 1ZTTA 4LFBJ 2UP1A 4J7CA 4ZG9A 4NI2A 3EDQB 2W8LA 2A1BA 2Z2LA 1RUSA 2V8DA 1S9EB 4Y2IA 1X9SA 1NU4A 4WZQA 5F8JA 3V6DB 2CJKA 1CJVB 4QZVB 4PQUB 4A8KA 1NK9A 3QIPB 1GEHA 2W5WA 2D9OA 1JJ4A 2D3OR 1DTQB 3W2VB 2YPZA 1REVB 3I4HX 2CDRB 1NUEA 4DL2A 4ILLA 3FVYA 3SSRA 3UR0A 5L1LA 4DSEA 2W2MP 3HSDA 3OSNA 3IR7B 3QGIA 1SV5B 2GHPA 3N0VA 2VV5A 1RACB 2DB1A 3IBCB 2DCUB 2VU5A 5DQIA 2CJQA 2R2UA 3A3PB 4A8FA 2B4UA 5GAEI 1TKZB 3T19A 2HFVA 2CYYA 1Q7LB 3EZOA 4BWJA 2LXFA 1WOPA 5KFLA 2G0JA 4FF2A 4HYKA 3QSIA 2YQ0A 5EGHA 1VISA 1Y5IB 4MIBA 2W9BA 2IJFA 4F36A 3SIPB 2BE2B 4OYZA 3CCZA 5DDRC 5ETSA 4WYLA 2OPRB 4YB7A 4P9SA 2BW7A 2AEFA 5F8IA 4URSA 2EFVA 1RWPB 9ATCB 3NKNA 3IS9A 1Q81T 4AFFA 2DGQA 2LDYA 2CJAA 1K0TA 4CRJA 4AL6A 1SQFA 4C6AA 1SJ1A 5E41A 3FSXA 3FMWA 4DV2F 3IN5A 4O4GA 1S6OA 2GV1A 2D69A 1KKHA 5SZTA 2XR9A 2KVQE 4B3SJ 1MNEA 2BJ1A 1GK8A 1U1QA 4M95A 4AXJA 5HO4A 3T1YF 3I96A 2QO3A 4OZ2A 4DS4A 5KT4A 4FDIA 2OIHA 2Z30B 3QJPA 3NKMA 3Q2TC 3VVTA 1UVMA 3D1OA 1KFSA 3UN5A 2XRGA 3PEJA 4JYAF 2J8AA 2VFSA 1JK9B 2KYZA 3BEGB 3C66A 2G1DA 5EX0A 1WF1A 1JLFA 2Q1LA 1ZM4A 1S1XA 2KXNB 1UJ4A 2QGFB 4KFBA 4ANDA 2LFVA 1ZPVA 1JLBB 2RUSA 1OSCA 2P6TA 2ZD1B 4D3HA 4RWWA 4EFAC 4G3IA 2BR0A 2CXEA 2AJQA 2MJUA 2N7CA 4RW7A 4UPIA 1S79A 2Z58B 1QE1B 4X65J 1C0TA 4LSNB 1RTHB 1FKOB 3CJSA 4KAYA 2GMJA 2H3EB 5D3GB 4K4UA 4N8NA 3ZTRA 3JSMB 4OI6A 1KVIA 1GXLA 1LOUA 4R0JA 2MKKA 3KXDA 1LWFB 4KJDA 4L73A 3FSYA 5GVQA 2HVDA 4F3QA 4ECZA 4HH1A 4JI0J 4OX9J 3OTCA 4Q2MA 2E5HA 4YB1P 1CULB 3PYFA 2HZCA 1IVZA 2WHOA 4CH7A 4EI2A 3KOAA 4HR2A 2W2NP 4WPAA 3JXOA 2DNYA 2CQ4A 3M2RA 3SEOA 4U95A 2V9WA 3T5HA 4RU2A 5JUMA 3BJYA 5GMEA 3DOKA 2DH8A 5A6WA 1RAOA 5LOQA 2AEMA 2C2ZB 3TO8A 1QAXA 3THTA 5FDLA 4NASA 4JI6F 1UCNA 1Z2LA 3KLHB 4NXNJ 1Q5YA 1PO6A 3HVWA 5E3PA 2RE1A 1YJVA 2MZQA 3PYEA 3MAAA 2K7JA 2DK2A 2H48B 2HRYA 3NGSA 4NYZA 1IWGA 2RQKA 1RHRB 2I8EA 4MTPA 2CFXA 2GJFA 4UOPA 5KG0A 2A18A 4ZPTR 2EK1A 3AJ2A 4KYZA 3OTOF 3N6LA 5LJ5Y 2L9DA 3UNYA 1S0MA 1X60A 4CLPA 4TU7A 4GKJF 3B78A 3M2UA 1LWEA 3IR5B 5HMZA 4XDCA 5DO2A 2OEMA 3I0RA 2RQMA 3MMCA 2X1AA 4N5SA 3N5BA 5CA5A 2ROEA 2RQCA 4ENOA 3PX4A 5LSRA 3BDGA 3OQ2A 1B0TA 2B4VA 2BE7D 3FBFA 4HDGA 2KG1A 3FKBA 2G2YA 2RAQA 1HARA 2W01A 4UQTA 1UMJA 3ZZOA 3W5XA 3QO9A 3D6HB 2CZ9A 4X4SA 2RQ4A 2JSXA 3VAGA 3BH7B 4LJMA 4P72A 3E01B 1HWLA 3F56A 3GFHA 4PXEA 4JI8F 2HQFA 4WTOB 5AJ3J 3KWMA 1NSAA 1G1XA 2ZVIA 1JLGB 1WORA 4RNFA 3P5TL 4WFXA 3Q22A 4LF9F 2E29A 5DGAA 4DL6A 5DRKA 4H4KA 4R5PB 1VFJA 1IQZA 4C0OC 2O5DA 4C4WA 2MXYA 4X2BA 3PG9A 2CPEA 4ZVGA 2J7WA 3UWTA 2IY5B 2W7AA 4NLXA 2LQJA 2PE8A 2W4CA 4CTAA 3FFIA 2XBPA 2XLKA 1T9YA 3NCRA 4C3MA 1QSSA 1SKWA 3UD4P 3THVA 1PSDA 3IDDA 2CNNB 3IGNA 4ZVSB 4F25A 2ZJPQ 2E1AA 1JNRB 3BS9A 4CYSA 1JXLA 1F3FA 1Y4ZB 4B3OB 1LKZA 3MI7X 3ILLA 2R4FA 1O98A 1ITPA 3AFGA 3R7SB 1WG5A 5IWAJ 5FJ4A 1VC6A 2VONA 1BUXA 3GJQB 1KH4A 4OYIA 2JWNA 1FT8A 2FLPA 1ALHA 2NREA 4DX7A 1TR0A 2DJWA 1R8AA 4Y34A 2VKRA 4IO9Q 4B9UA 1XBWA 2F8HA 2MLZA 2F9DA 2Z0GA 1C1CA 1KLMB 5LMNF 2LEBA 2AEJA 3G9CA 5DZ6A 1RGVA 1JLCB 4B9SA 4TY8B 5F8MA 1TMJA 3BKUA 2HHPA 1I1GA 3SDEA 1VBKA 1Y00A 1VLOA 4EO8A 2RU9A 1I3OB 1F3VA 3MMAB 4O3OA 4ETZA 2QE5A 2ATLA 2XLJA 3M8PB 2V68A 3QFHA 1EQJA 1DQ9A 1TL4A 1HR0F 4AT1B 3WZ0A 3PHTA 4QR1A 1RT1A 2YWGA 2IIHA 3BBBA 3GU0A 1T05B 4I56A 4B9MA 4BS2A 1H98A 4FBTA 5J2QA 3M7VA 4ZMMA 4LF8J 2C22A 2PIIA 3EDRB 3IWXA 3Q8QB 3LGHA 3T1YJ 1SC1B 1SL2A 4C8OA 1RA6A 1BC6A 5HBMA 3M8QA 2VG6B 1CJUA 3MUTP 4CP5A 2LLZA 3TANA 1SIZA 2YQ1A 2QEXS 4DSLA 4IOCQ 3GCWP 1Y7AA 4IR1A 1NJZA 1S1WA 1RISA 2HHSA 4OZJA 1JLQB 4ZPBA 2R7VA 2IDLA 4OFZA 3V2UC 1P1TA 1WG1A 4YUDA 1BQNA 1NPKA 3CXCR 4RR5A 4M5DA 3TYTA 2CG8A 3EJMA 4IFVA 3JYTA 4WFAQ 2GS8A 1E6YA 3CJ0A 4FP9A 3QFWA 2KO1A 4KT0C 1XR7A 2C2RA 5LM7E 4DV7F 4K7QA 2PSZA 2Z56B 4TKTA 5IOLA 2IUCB 2FIUA 3CCVS 4F3OA 3MEGB 2DR7A 4QW8A 2Y0BB 5HATA 1BHNA 1D9FA 2WSFC 2HEKA 1S9GA 3V5RA 2EC2A 5H9FJ 3NNCA 2VDIA 5K14A 4NXMF 3Q8VA 3C3LA 2WVDA 3CVKA 2GA3A 1UL3A 4RUCA 4QR2A 3FCWA 5L1IA 4M5NA 3D6TB 3UFCX 1SCJB 2YNIA 4QPTA 3KMQA 3QT8A 2EFNA 2EG2A 3JQJA 3H5UA 5L0BA 2MQMA 1RADB 2UUCJ 2UZAA 3RR8A 3GYXB 1RU1A 2BABA 3DLGB 4DMZA 5C2GA 4DL4A 2GJIA 1NDCA 3IM9A 2J6UA 3TA1A 4ILRA 4U67Q 3TVKA 1ELZA 5LMUJ 3BSCA 2DPIA 3PY8A 3QGHA 1SJQA 3OVBA 1EJJA 5J2NB 3R5DA 1HNVA 1ZZNA 3MCNA 1BQXA 2AGPA 2CA9A 4HACA 2JZ5A 2X1BA 5HJYA 3IC1A 5IZHA 1CQMA 5K20B 3OW2R 1VQPS 3TG0A 5K9FA 3OJSA 3QWUA 2DIVA 2VASA 3T02A 1WC5A 4DL5A 4PQAA 5FIIA 2NLWA 3OVAA 3VGUA 2AKWB 1VI7A 5EGYA 3N4WA 1S59A 1WD6A 5J2PB 2ZBIA 2E5JA 1YLXA 2AJ1A 4M1KA 2O66A 1KQKA 4QWBA 4JUZA 5HROA 2Z2ZA 3KJNB 3AB2B 3Q8PB 1FRKA 4KV8A 4YR0A 2ZZMA 4ED1A 3F41A 2KRRA 3P3DA 3OSPA 2R8GA 5I3UA 4ZLNA 2VF3A 4PRFA 3PJXA 3MURP 1S0NA 5HANA 3BPSP 1EX8A 4ECRA 4DR1F 1MLAA 3U1NA 3GQCA 3WX8A 1YX2A 2HS3A 3DRRB 2B8PA 4Q44A 5I3QA 2DGTA 1X4AA 3GFYA 4ZN3A 3R2CJ 1RABB 4WU2A 4DV4F 3MCSA 1IBLF 1TMMA 4ATNA 1HWJA 1W25A 4LF9J 1TL3A 2DHAA 2W5VA 1ALKA 4JI7J 2LU2A 2Z57B 4X64J 1SKSA 4MKVA 5GMDA 2VPXB 3PFEA 1XK8A 1U2CA 1NK8A 3RRKA 2AYBA 1U6ZA 3T3FA 3FMBA 3QZ8A 4MAKA 4S0MA 1MSWD 1F6TA 1E33P 1SKRA 3ADAC 3ENQA 1U25A 1FXLA 5DS7A 3A8JA 4OZ5A 4XAKA 3H42A 2COLA 2BDPA 1M5SA 1TELA 4O0IA 4WJBA 3OJUA 3DI6A 3UVJB 1XWLA 2CWKA 1AROP 4YQWA 2R8JA 2OSQA 1KEKA 2DO4A 3N5FA 3TI0A 4CYRA 2J76E 5HRTA 5EWFA 4GO7X 4PWDB 1R27B 1FKAF 2GGPA 1Q16B 3DU6A 4KKOB 5INHA 1VQMS 1N32J 1VQ9S 3ITHA 3POTA 4QYZK 4I2QB 2E1RA 4OQJA 4BC7A 2HVHA 1EB0A 3IRXB 1QVFR 4USJC 2A10A 2JEFA 2E5LF 1TKXB 4P52A 2XO6A 1GNKA 1RT5B 2ZHAA 4B08A 2B0GA 3AD9C 4P6QA 1FSUA 2Y8YA 2HK2A 4DQPA 3HO1A 1KC8T 4ZCLA 4DJBA 2E5GA 1YRTA 1XMOJ 4NLOA 3TZWA 1U1OA 8RUCA 2HFNA 3KUHA 1X31C 1T8EA 1JXVA 1EETA 2BYCA 3NG8A 2VD3A 4H4OA 1BMQB 1S1UB 1DLOA 3V4IA 1KLNA 4ES1A 3RAQA 3AH6A 4GVBA 2PI4A 4AL5A 4X4OA 3R7BB 2M4MA 4ZA1A 2F4FA 1F2GA 2DD8S 3QGPA 4I0WA 3TJAA 1R3NA 5E2QA 3LGMA 2D3UA 4M8LA 3E51A 2VG7B 2C2EA 3BBCA 4CLWA 4OHVA 2DGSA 2HS0A 3TZXA 1VC5A 2W25A 3CULA 3I55S 3W65A 2QSWA 5JVHQ 3MAQA 2W2OP 2FJXA 1YGYA 3EX7B 3W3SA 3DRSB 1TK0A 4G6VB 2UXBJ 2MKIA 3MCOA 4OX6A 1FO1A 4DL7A 2DH9A 4CLSA 1ZAVA 3VGVA 1AB8A 1L5UA 3UD5A 3Q24A 5D8HB 3R5JB 1JJHA 4YEAA 3OTBA 1LWCA 3DDNA 1RJJA 4QWEA 4OI2A 4FBUA 1SJ3P 4K4WA 3R1HA 3HT3A 1UVKA 3C6UA 5T7LA 2V5HG 3TP2A 2SXLA 1WKJA 3MM6B 2BACA 4EUVA 3HVTA 4R8UA 3WIUA 3PFOA 3OR2A 3AOBA 1FD8A 1URBA 4EWTA 5U47A 1EI6A 4ZVQB 3A52A 4NLTA 4LSLA 1U1PA 1RWMB 3PRDA 1VQNS 2HMIB 1UZDA 2XSJA 1N5VA 2MGZA 5ETMA 1P49A 1K1QA 2FZGB 1EP4B 3K5LA 4RBTA 2AHOB 3SCKE 3LO3A 3FCVA 1UWAA 2ASJA 2KL8A 1PKUA 4MIVA 1H7WA 2M3DA 4KHPJ 6AT1B 4P2FA 2ZNYA 4OHWA 2HQIA 2VPWB 1YBAA 3FSIA 1VRTB 1S0VA 1NKBA 1E6VA 1ZEBA 5BR8F 4OI1A 3R9LA 4LF2A 1LW2B 3DM2B 3EPGA 4ID8A 1YHQS 3R1LA 2AW0A 1W26A 2CRLA 4WU3A 4RU9A 3G82A 4DR6F 2GX8A 4ANCA 1N0UA 3WX4A 3BPDA 1FJCA 3M32A 4OJ3A 2AJ4A 2EC0A 3BBFA 5D0GA 4RUAA 5I3PA 2QLWA 1NJIT 3EGWB 2ASLA 3M1VB 3LWLA 2IC3B 3M6WA 2AD9A 4HHUA 3TQEA 1MROA 3PJ9A 1N52B 3BYPA 4J90A 2X7IA 1RAEB 3TJ9A 4FXWA 3RU0A 3Q8SB 4DV6F 4ZPWR 1CC8A 1HMVB 2W9AA 4F50A 2GW8A 4KO0B 2ZZNA 2GNKA 2IRUA 4MKYA 4DR1J 3GCXP 5KFHA 4BHQA 3I5AA 3AD7C 4DN0A 2Q66A 4QAXA 2ZBQA 3MWBA 3HLUA 5JVGQ 4KGKA 1IJEB 2CQHA 4XPCA 1L3TA 4WFZA 4DX5A 3DRPA 4NYPA 3D68A 3OHBA 4DV4J 2EFPA 2UUAJ 1U09A 2PA8D 3HHLC 1FRIA 5AXMA 1U0HB 1XR5A 2FYXA 4ZVHA 2RRBA 4ZCMA 3GILA 2IFXA 5KG5A 1VQOS 1X4DA 3M8WA 4NLGA 4MHXA 2QL9B 3QWPA 3O5TB 2HHUA 5E3RA 1UEUA 4ZVTB 3D54A 2HK3A 1T02A 1F5CA 2ZE2B 3ET6B 2BMBA 3MK0A 3EZ5A 2VBYA 1UWBA 3JSYA 2YKNB 2JEGA 1XR6A 3NGKA 1VQ6S 3CJ2A 2B4OA 1A0OB 4MK9A 2EPIA 2YBVA 3J7ZT 1AUKA 1RT4B 1GMWD 2J0XA 1HHSA 2WBRA 2HQ3A 3PKMA 4ES2A 3MM5B 4Q2LA 2ROGA 2MKYA 1SUQA 1QAIA 1IKWB 4U7UD 3ILJA 3BO2A 3HJFA 2EFOA 3UPFA 3CCUS 3M2VA 1J5OA 1Q78A 1VHIA 3NBPB 4MYTA 1ED9A 1P9YA 1HD1A 2YXLA 1DTTA 3P4UB 2BJDA 3LQVA 4DPUA 3MR3A 3BZQA 2V4JB 1IM4A 4JP8A 3TR5A 1RU2A 4F8RA 1R0AB 3E2EA 4TYBA 1FRMA 4JI5F 2AF6A 4O44B 1YTYA 4AYBD 2FC9A 3VAMA 4C8KA 3PV8A 3BM7A 1YRUA 3CCQS 1SH3A 1MU2A 4NLUA 2A6OA 5KFYA 4EO6A 1FKPB 2I2YA 1CS4B 5G0RA 1WF0A 4JI2J 3T1HF 1M5OC 5L0EA 1RK8A 4J91A 1XMQF 1HNZJ 1AUSL 3HI9A 5K4PA 3BSOA 3CDUA 4IO1A 1NK0A 3KHLA 4UOCA 3IBWA 4HHHA 3R5CA 3IRWP 4O3QA 3I5BA 5ETRA 3U02A 1S6QB 2PC6A 5BYRA 2M5YA 1G3OA 2H4YB 2ZBRA 3C14A 2UVVA 3HHLD 2XWXA 4U9RA 2JH3A 4OYXA 2C28A 2U2FA 2DR8A 3QT5A 1VR6A 2DT9A 4LF7F 2PMHA 1H2UX 5CXTA 4FYVB 3H8YA 1Q1KA 4DR2J 3GR1A 4WKRA 2M2BA 4UUWA 3EWGA 3M8SA 3CMQA 1PBUA 3NKOA 3J81Y 2BJEA 4CXUA 1C0UB 3P6YC 3IGZB 5ETNA 3ISZA 3HPOA 4LREA 3I82A 3J7A1 3LP2B 3FBEA 1LK7A 2V8HA 3OHAA 3W66A 5AE3A 5C42A 4RPFA 1N34F 2YY3A 3O44A 5HP1A 4FF1A 5F9LA 3NGRA 4JI1F 5L0KA 2FVQA 2Q79A 4ED6A 3G8TA 5L39A 3C46A 1RTZA 3SV4A 1T9XA 4B9LA 1AW0A 1FRLA 3KUEA 3TUJC 4ZHRB 2IVFB 5IT9U 3O3LA 4RW4B 5J2MA 1VK3A 1HNIA 4DV0J 2B7BB 1HI8A 4RLEA 4OHYA 3W5ZA 2LKZA 2N7YA 2XMJA 1FVQA 5T14A 2GSNA 1RWOB 1KHVA 2ZEJA 4M5HA 4GKKJ 2W4PA 1IKYA 2KFYA 1N2LA 1U0SA 1EW2A 2GCFA 5BXIA 2EFGA 3EXYA 3C15A 1TFWA 1CSJA 1PC5A 3WAXA 1HDHA 3PRBA 3SMZA 5HJXA 2C2KB 5KFCA 4JBCA 2DVIA 3W63A 1QUPA 5BYQA 2J9EA 4DR4F 2WAQD 2MZTA 4N47A 4KSEB 5B0CA 4ZS6A 2H51B 2HKEA 1Q53A 3W2WB 1H38A 1N5QA 1FWPA 2QYCA 3EYZA 2NZCA 3HHLB 1B0PA 2FTRA 5IQQA 2W5XA 3L7PA 3AA8A 5GAHU 3C16A 4QBUA 1U24A 3HSJA 1YDLA 3S01A 4ECSA 4Q5VA 2CQPA 2XS2A 2FVRA 3BSNA 5J1NA 3EGNA 5IFMA 1A6LA 1IN0A 1WSVA 4MYUA 2HHHF 1LW0B 1YZ7A 4YFUA 2HGLA 4ZVFA 1LWXA 3UI3A 3W62A 1UZHA 2OPQA 2GSOA 3EVMA 4W92B 1KQGB 1K0VA 3K5PA 3G86A 3TNVA 3CCTA 2RDDA 1IUJA 2FHJD 4FYDA 1WACA 4Q7AA 5D78A 4AD6A 4ZIVA 2GHWA 4CLFA 2FJDB 2FVPA 3WIVA 1FK9B 5KFVA 3JSMA 3ZNUA 2CAJA 4I67A 2DNGA 2WB1D 5KT6A 2RKIA 2DNRA 4MFBB 3DLJA 4QOTA 3N28A 2FJAB 3JS9A 3MOZA 5H9FK 2BKNA 2HNDA 4B3RJ 4RL1A 1EHWA 4QU6A 1LEOA 1XNRF 2W9CB 3NAHA 3IO1A 3V81B 3I4PA 2DRAA 2JVOA 2UUTA 4OLPA 1WKLA 3OL6A 4GMKA 1F9EB 2BJ3A 4O3NA 1X4GA 2WSCC 3CCJS 5CHCB 2QA4S 1FHTA 1WI6A 2HS4A 3GWCA 3W9HA 4NA2A 2OPPB 1SB6A 1ROFA 3W9JA 2AX0A 3QLHB 5LSOA 2HNZA 2CG4A 1SHQA 4ZJOA 4F4YA 5HL7Q 1HJKA 1R8CA 4CNZA 2G2ZA 3QRQA 1T9WA 2V8GA 2BV3A 3KLGB 1F60B 3A8KA 4CDIA 3DOLB 3CMES 1YRXA 3O6QA 4RWXA 1KH9A 1BQMA 5KT2A 3VQTA 3PEHA 3D6FB 4H4MA 2CKWA 2BQ3A 1WUUA 3A1YG 4RW9A 1Y7PA 3M4XA 1I94J 5D4NA 2HBYB 3P5BP 2HHTA 4PZVA 4A8QA 2X3GA 3TZZA 2HQCA 2V94A 2AIRB 3D0GE 1NRKA 1HHQA 4LR9A 4MK8A 2LXIA 4ZVEA 5KFAA 1TVRA 3ZXWA 1MMNA 2VB6A 4OZNA 1QDUB 3GIIA 3R97A 2MY7A 2FQQB 1T03B 2ZUGA 4Y2CA 3EUNA 2JVRA 2MMYA 5DG7A 4X4QA 3T1HJ 4IQMA 3GIMA 2BVZA 3FGVA 4LQYA 2ZH4A 5CYQB 4HH0A 3QAEA 1ZM2A 4F4WA 3DYAB 1TTHB 3DDIA 1HWKA 3QIDA 4LVNP 5EGEA 2L9NA 4QW9A 3MDFA 5JXSA 3NNHA 4B3MF 2OEKA 4ED0A 2AZ3A 1FFSB 2HZVA 4ZCIA 2IM1A 2ILZA 4X4UA 4CLKA 2NZ4A 2RU3A 1RT2B 2ZHOA 1NSKL 1FXDA 1BXNA 3T5LA 1RTJB 2V9KA 3A4TA 3HF5A 5F3TA 2LA4A 4DUYF 3PIOQ 2F4VF 1RTIB 4HT7A 4LF7J 1SJRA 4NYOA 2P9CA 3Q8YA 1PAUB 2KHDA 1VMBA 1HQEB 2K7KA 1W7WA 1NSQA 4G1QB 1YJWS 2BX6A 1B64A 4Z37A 2GQQA 4FF3A 2ZITA 2UV8G 4M94A 3D6MB 3HHDA 1Y5LB 2B6AB 3LF0A 2L41A 4NZ6A 3CCSS 2R2SA 4B3OA 4M5GA 3BGOP 2W2QP 4ZPDA 3SSSA 2E7WA 1YBUA 3FNNA 1N34J 3BO4A 1VQ5S 1NHUA 3CWJA 4NPOA 1G7CB 4NI2B 3RBXA 1HPZA 4DLEA 2J6SA 1CJTA 2I6WA 1NJXA 1AJCA 4PWWA 3CDAA 1CVJA 3IR6B 2H9ZA 3W1YC 1QSYA 2ASYA 4YB6A 1VYAA 2YWWA 3R3TA 2XYPB 1HNXF 2AU0A 3UDEA 2AYMA 5KFSA 2CQIA 3H40A 4ICLA 2CADA 3MTJA 2FPHX 1ZM9A 3W61A 3JAMY 2HZAA 2H5IB 3CTRA 4LRDA 1WNEA 1E2SP 1RB0A 4LBHA 2HGNA 2KT5A 2QSFA 2RS8A 3VGSA 1IR0A 1MN7A 2DNPA 4QQBA 3QYYA 4JV5F 5C66A 4TN0A 4P2SA 3HT0A 4TLRA 3N01A 3KDNA 2MHNA 2OPSA 3OT9A 5CYMA 1FFWB 1U45A 4K0KJ 2GQ2A 3CCWA 4GVLA 2W9BB 4DWIA 5CD4A 1PG5B 1RT7A 3TVYA 3I0SB 1X5TA 4PPZA 3TX0A 5DZ7A 3QJJA 2XNQA 4TVAB 3MHYA 4W98A 2Z2MA 2RMLA 4NWJA 2GMLA 4F02A 3IS9B 1SI9A 4ZP7A 1JMTA 1IBCB 3CGIA 5T41A 4CNYA 4DL3A 1O5JA 1HBOA 3CDEA 4WE1A 4WCEQ 1URNA 2GA7A 3KNGA 4YHHJ 3LTOA 3BDHA 4O4GB 3VTIA 3MFHA 1YJNS 2XM3A 2V69A 2R8IA 4FYWB 3SCJE 1RAAB 1IWAA 4KGZB 3M30A 2KU7A 4UQGA 3DYCA 2B9XA 3L9ZA 4HTJA 2YNHA 2R7TA 2GVZA 3MM8A 3RYLA 1F0XA 1UJ6A 2K06A 5KFQA 2B9YA 4F4XA 4WK3A 1TZ0A 5E5NA 1Y9OA 2FJVA 3ZNJ1 4A8YA 2HNYB 2EKYA 3OFHA 4QWAA 4IUFA 1DRZA 2GO8A 4WIIA 1JLFB 4KHRA 2XMAA 2PEBA 1D0EA 4ELTA 1OY8A 1S1XB 4DBQA 3HZGA 2DNLA 4KFBB 1IR2A 1IBKF 5EDWA 1J27A 4F4ZA 4Q43A 2MQ8A 1KHKA 3QRPA 1NJWA 4GC7A 1YK9A 4B17A 2VG5A 5CCLA 2B5JA 4RW7B 4JI4J 4CCHA 1C0TB 3KG0A 4I6WA 1ACMB 2YH0A 2J0QD 4DR7F 4UOGA 5LJ3Y 1EQ0A 5A2QU 4UPHA 2JL9A 3D67A 4G65A 4QWCA 5A76A 5D6GA 2MKHA 3LP0A 2DNOA 3IWLA 1TV6A 4ZPVR 4FXVA 5HQLA 2M9KA 1TL5A 1RCOB 3IG1B 3SYZA 4KGXB 1FNOA 2GZOA 2BEFA 1V3RA 2RHSB 1A9NB 2WVEA 2I9SA 2CPXA 1GX6A 3V4MA 1RYRA 1HBNA 1NSPA 1Y6VA 5HLFA 1YJRA 1U26A 2FB0A 4LF4J 3D3BJ 3H5XA 3DOKB 1LQ9A 5HVHA 4GTZA 1T3OA 1JKHA 5FDLB 4YN3B 2W7PA 1UVNA 4CO3A 4Z2XA 4BDPA 1RKIA 3GJRB 2J9DA 1QD1A 4J9NA 1YJTA 2XZDB 1S6PA 3EE3A 2WSEC 2OHDA 2F1FA 2QJ3A 4DDFA 3NWRA 3RR7A 4A8OA 1RWKB 4PG8A 3JSRA 5G4DA 5GAHI 3OVSA 2ZKTA 3MM7B 2DBBA 1C1BB 4F3MA 1F9FA 1DAXA 1T9TA 4CLTA 2A3JA 2PI5A 3G4SS 3MR5A 1TAUA 3I0RB 2UUBJ 3ENVA 3J7Z5 1F5BA 3FUYA 3PDNA 5EUHA 2XZWA 1S1VA 2EW9A 3ZZPA 1UETA 2ZH2A 3CC2S 4DUYJ 2F4VJ 2WONB 3BDGB 3K5OA 2WW4A 1NNDA 1RAGB 3RG6A 1KWMA 4A8MP 3VWSA 3HMJG 1X9MA 1KHLA 5DLTA 2I5JA 2YNFB 5HMWA 1FRHA 3QO9B 2EEYA 3H0PA 3PW0A 2KM8C 4LF5F 4IDKA 3CNQP 4N7TA 5C24B 4CH0S 3MF5A 3Q83A 2VBXA 4RNOA 3OL8A 1M5PC 3DHXA 1M1GA 1JLAA 4NLVA 2CQ0A 3MPYA 5DLGA 5IV3A 3GIKA 4YB5A 1I51B 5KT7A 1AZSA 4YY3F 1RWNB 2FC8A 1R8PA 3FK4A 3RB3A 3PIPQ 4NMXA 4ES3A 1VQ8S 1ALIA 3J80Y 1KOHA 2I0XA 1ED8A 4M5IA 4HHJA 4CTAB 2QMXA 3FFIB 2QLXA 1V6HA 4WWSA 4DCPB 1SJFA 2XYHB 2R8HA 1RT5A 3BH6B 1Y5NB 3CD6S 2VQFJ 3PR4A 4ECTA 4DV3J 2FJWA 3NKPA 4K8RA 5K5MA 1S7IA 3QSYB 4OZ3A 2CQ2A 4USMA 1WTFA 3RW6A 2CJ9A 1PYSB 3N6NA 3HX9A 1DQ8A 3IXQA 4CH1A 4OHXA 2C2DA 4EMDA 2MLYA 4OJGA 2ZBPA 4ZITA 1CJKA 2M70A 3OD2A 3BO3A 1FJGF 3H4DA 2P2CB 5LRMA 4DR3F 1P27B 4UF4A 1WHVA 2A2DA 1SHNA 1C1CB 1O6XA 5B0GA 5D0RA 4UPKA 4Y2AA 4Z7CA 2HG4A 2M7SA 2MEWA 4IRKA 2ZM6J 3P45B 2UXCF 1Q86T 2OD6A 2CJXB 2J9DE 3IP0A 5B0FA 3UD3P 2A0FB 1RTDA 4DF4A 5E3AA 2K3IA 1VLYA 1XNQF 3P49B 2OUGA 4ECWA 1RT1B 1ZZFA 3DRSA 5M2RA 3M6UA 1X5SA 5H9EK 5J2QB 3L3CA 1YKWA 5L38A 1K47A 3IGVA 3CDBA 4J9LA 7AT1B 1O99A 1IBMF 4CO5A 1FRXA 2W24A 4BCAA 2Z2YB 5HBMB 5AE2A 3M8QB 1CJUB 5KG3A 3RBEA 3M9OB 1S1WB 2VQEF 2FVCA 4CT8A 2PMWA 1BQNB 3L7OA 3RZAA 4M5DB 4CM0A 1XERA 4IFVB 1H2TZ 3JYTB 4DR5J 4I6AA 1E6YB 1KFDA 4ZIWA 4DPTA 1N56A 1S4FA 4K4XA 4WBFA 1QUVA 5J1EA 3CEDA 1NH8A 5CZXA 3X1LB 3KK3A 5KT3A 4DV5F 4ED3A 1KN6A 3UN3A 2DRDA 1S1TA 2HVZA 3TX8A 1VRTA 1VRQC 4Y3CA 3FQLA 2VJUA 1HD0A 4UORA 5J1PA 1UVIA 3C19A 5K14B 4I4BA 2XY5A 1GQEA 2NQPA 3DM2A 5IC4B 3BDPA 2HLTA 1OS5A 1X9WA 3IWNC 2GIFA 2B8QA 5F0UA 5EHHA 5JMNA 1Q5VA 2YNIB 4RNNA 2BZ2A 1OIAA 5DG9A 4A46A 5AXNA 1FD2A 2KHCA 3MM9A 2K8GA 3UW1A 3CC7S 1X4EA 4LQ3A 2AJFE 2BJ8A 1RWXB 1HBMA 4EBCA 5LXYA 3ZZZA 3ETMA 3TQ1A 2YKPA 2D9PA 3H2LA 3FEXB 3W7BA 2ROPA 4Q0BA 2FZCB 3CJTA 5E7OB 1YVFA 2O3DA 3VALA 1ZS6A 1AA1B 1XN9A 1EKRA 3IM8A 1N6QA 4KGVB 3K8VA 4XO0A 1N33F 3Q8UA 1UP1A 3NOCA 2KM8B 1UW9A 2BM1A 1HNVB 3US5A 1M5VC 2Y1RI 4I68A 4HACB 4LFAJ 1X5PA 1FCAA 2JDJA 5IXUA 4ELUA 2X1FA 4Y0FA 4FN5A 3FBCA 4I2PA 3KTQA 1OY6A 2P9EA 3F44A 1OQ3A 2VPZB 1C2PA 4I7FA 4NLYA 4IRDA 4YP3A 3WAVA 4RW6A 2YX7A 4KB7A 4B9VA 3GFXA 3MGJA 1U0HA 4WFNQ 3SFUA 4FNIA 3NWGA 3DDKA 2ZWPA 1H3DA 4DU7A 3WBHA 3GSIA 2R7UA 3KFWX 3PCOB 4DV1J 3D66A 3ED4A 5HROB 2RDIA 1M1KT 3ISNC 2NYIA 2ATCB 4KV8B 1IXKA 1N5YB 1N36F 1B0VA 2ZDOA 5I3UB 2CPFA 2NXCA 2X3DA 5A8WB 1YG0A 2YKMA 4DCJB 2F65A 1FF2A 2XLIA 4ZP9A 1AUDA 1WC4A 4IRCA 1HNWF 3CO0P 4FF4A 2NR0A 1RT4A 4C3KA 2B9WA 3AOCA 2F8MA 4C8NA 2W8DA 1N88A 3MM5A 3CDWA 2WBMA 2N82B 2WTFA 2QTWA 4NEZA 1ULRA 3R6LB 4K2JA 3AODA 1VDHA 3A8EA 4PG5A 3T9ZA 3WAWA 2K2PA 3KK2A 1VHFA 3AQOA 1TL3B 4FYXB 5MAOA 3G96A 4YY3J 3MEEA 4OYBA 3VVUA 3LUYA 1FA0A 4K4SA 4KE5A 4DXLA 3GG0A 4PYDA 2CZ4A 1ZPWX 3QZ7A 5KFXA 2BANB 4IH5A 3W8GA 2HAIA 4YR2A 2DXDA 1KVJA 5GAGU 1K9MT 2BUNA 2MDAA 4GRSA 1ELOA 3KHGA 2R9LA 4XTTA 2D3O1 4WYWA 1ICEB 2DGUA 4RBUA 2VOOA 5AXKA 5DM6Q 1CS4A 2CPZA 2KB2A 2F40A 4Q8EA 1ZTWA 2ZH3A 4ZN1A 4KTQA 3DI6B 5HK4A 4DUZF 4L74A 1IKXA 1SL1A 3UDCA 1VOMA 4FZVA 4P10A 4OZLA 1V5IB 1TL1A 1RT3A 1BD6A 3NCPA 1JIHA 2ZJQQ 4FS2A 5A0YA 2DEIA 4BBYA 3GONA 1TP7A 2MQPA 4KJGA 1FJGJ 5LT5A 1H74A 4AL7A 3ITHB 3POTB 3PHEA 1PILA 4LFCF 1WEZA 3RUBL 1YWXA 3ISND 3Q0AA 3ZZRA 2H4WB 1FE4A 1NPRA 3NY0A 4IG3A 4ZPCA 4X66F 3L4BC 4K4TA 2ZOGA 3JQKA 1SH2A 3CCES 2ZC3A 3D0IE 1KS2A 3A3NB 2KYXA 3MZIA 3AOAA 2ZHBA 4DFKA 3NEKA 1HL6A 2HLUA 4OHZA 2RIJA 2VPYB 3LP2A 1SKUB 1GMWA 3DPCA 4MKBA 1X7VA 4KR0B 2RRNA 1EETB 3MPDA 3HHKA 2BJ7A 1YJUA 1S72S 4H4OB 4X4VA 1U48A 3WDOA 3LA0A 4LFBF 1SVDA 3V4IB 1BWEA 5C2CA 4NOHA 1VRUA 2CQBA 4GVBB 3RRGA 5DJBA 2ZUAA 4O3RA 1NAQA 3PM9A 3KLFA 3GJTB 5B08A 1RBOB 1X5OA 5A8KA 4C0HA 3M8RA 1LFWA 3KHHA 1RAJA 5K8OA 4X62F 2OELA 4J9PA 1ZEDA 3UDLA 2H5EA 4NCGA 5FD1A 4DV2J 2R7OA 4EBEA 2XI3A 3GSDA 4BLGA 3K2YA 5LQQA 4UOOA 2E7XA 1TL7A 4OYPA 2UVWA 4O0NA 3TAMA 1S49A 3GZ7A 5B0BA 3R6GB 4DV5J 1KVKA 2XO7A 2KT2A 3B4DA 4M5LA 5L1KA 1AFJA 3THPA 4HEA9 5HQ8A 3NMAA 4NRUA 2NSBA 1UAWA 1FDBA 3QGGA 1LWCB 4CYUB 2CPJA 1BWVA 5KG7A 1HKAA 2KVIA 3MUVP 2M8HA 1WWHA 2RDJA 3UCGA 3BDEA 4JYAJ 1S9FA 5T7LB 2IAJA 2XCPA 4OYWA 3MK2A 4NZ7A 3NKRA 4WXWA 3W9IA 4OZ0A 3OR2B 3HHLA 4A47A 3ZTPA 1FJEB 5FLXU 4LSLB 5CCMA 3LP1A 3DLEB 3H20A 3NS6A 4N77A 2ZH1A 3ENWA 4PYAA 2POKA 2XSJB 2MGZB 2HBRB 1SIWB 1CQNA 3CD5A 3OR1A 1TKTA 2HW3A 5AJ9A 3GIRA 3C6TA 2BOAA 3BR9A 4ZLPA 2RVJA 1QSLA 3T6JA 4ID5A 4J5OA 2QYGA 3I6PA 1PJ7A 3RB4A 2IM3A 1E6VB 4DEZA 2R42A 5L9XA 4TY9A 5F0WA 2GIRA 3MECA 3HP6A 3G2XA 3TRGA 2EFQA 2B9EA 4WFYA 2G2OA 2XMMA 3DC2A 4ED2A 1RYSA 4IH7A 1MWQA 3G82B 3V6HA 4EK2A 1O0PA 3UNGC 4B9TA 2GQCA 2D41A 2AX1A 2DEJA 3DLLQ 2CDQA 5ETVA 1X0PA 4U96A 1ZA2B 4C11A 2HWHA 3U1LA 3GV7B 2J8SA 2ZVSA 2IYGA 1PAEX 3GJSB 2DTJA 4JI6J 2PN6A 1L3SA 4EU0A 5CZVA 1NKEA 3KJVA 2V2KA 1MROB 4X84A 4PR6A 3ZTQA 3ICLA 1C4CA 1FVSA 3ULHA 2OJ3A 4DU8A 1HI1A 4X65F 3CJKA 1U1MA 3K8WA 2W5RA 2DH7A 2ZWOA 3R5BA 3DFEA 4FVMA 4HI1A 2FDNA 3BF4A 4LF1A 1D3WA 1GFWB 1N5TA 1RT6A 1MWYA 4ZLLA 3CT9A 2V6AA 6FDRA 3QQCD 1M1HA 3FZ2A 2LQ8A 3Q86A 1HLWA 3OTOJ 4IFYA 1S7HA 4GKJJ 2FHMA 4EEYA 7FDRA 2CQCA 3DRPB 4JI0F 2XB2D 3DOMA 2XG8A 4LRCA 2KRBA 3W8PA 2MHEA 2AWZA 4L3NA 2DXEA 4RW8B 1U4BA 5HI7A 2XYGB 4PUOA 4JOUA 1TQLA 4I69A 1NXIA 3GLJA 3M8YA 2BA9A 3KJFB 1TFYA 2Q43A 2ZOMA 2W5TA 4USTA 2LEAA 3EICA 4USUA 4WIQA 5KFTA 5TJ3A 4RX6A 2CQDA 1UWBB 3MCMA 4NXNF 2FGCA 5DDPC 2DKOB 2QG9B 2Y1IA 4DI6A 2NPFA 1T03A 3F73A 3SZZA 1WOSA 1P8GA 2RNEA 4JI8J 5C5JA 1SUQB 2W7OA 2NCKL 3G6XA 2FHJA 2RUGA 2UV8A 2PGCA 4DUZJ 4FPRA 3M2VB 1J5OB 2R7SA 3GV8B 2IVYA 1DTTB 3R5AA 2PA3A 5B0AA 1U49A 1JJ2R 1RBAA 4NA1A 1S12A 1IM6A 3O1LA 3QRRA 3CJ3A 1RTJA 5DG8A 2QA1A 1FFGB 3HFVA 4FYYB 1R31A 2P9GA 2DCLA 1MU2B 2QFJA 1YI2S 4LFCJ 1Y0HA 4IKAA 1JJCB 3TVZA 3DRXA 2V34A 2YWEA 2LXUA 1B3TA 3NNAA 5G0RB 2XMTA 1R8BA 3IAM9 1GMVA 2A2CA 3OUYB 5E0OA 4U8YA 4ZP6A 4DFMA 4ECQA 1FX4A 2J0WA 2XZTB 5AJ3F 1B7FA 2YTCA 3KLVA 4MY4A 4K5SA 1VQKS 2V2QA 1HYSB 5LMNJ 3C14B 4PKDB 2JLGA 5D77A 2RILA 2WOMA 1QM9A 3GIJA 2V0NA 2BBEA 3R27A 4C97A 3T41A 3UCUP 3KJQB 2E44A 3NRBA 3SQOP 5L9NA 2K1RA 3UQSA 3PX6A 3RB6A 5F9NA 2L3MA 1NCLA 3B54A 4ALZA 4E8UA 4X62J 4GTWA 4KAVA 4NLDA 5E33A 2Y3YA 1HR0J 1ELXA 1CLFA 3NL0A 3KLEA 1EARA 3IFEA 4WTYA 3LH2S 4Y2KA 5EWEA 4P73A 5KFNA 3H2VE 1WTBA 5ETKA 2JNJA 2M52A 4PG7A 2D74B 1S6UA 4M63A 2G0CA 3H90A 5C42B 2FLNA 3TZYA 5IWAF 4DSIA 4HT5A 3H98A 4RO0A 2FLOA 3M9NB 4X4NA 3JTOA 1GMUA 4TLQA 5HP1B 1PGZA 1S4EA 4C8LA 1TAQA 2NYHA 1UKUA 1VGYA 2VBWA 4UOHA 4OX7A 2MZRA 2CPIA 4DQQA 2IM2A 3HCXA 1RBLA 2DGWA 4LMZA 1VC0A 3OL9A 1H6KX 3H25A 1Q8BA 3DGPA 4NMLA 4XPEA 5GAGI 2NS1B 2B7CB 1B7YB 3I0SA 4C2MA 1VBZA 5A8RA 4IOAQ 4L75A 1NK5A 2LQ5A 2V2VA 5J2MB 3PW7A 2L9WA 1HNIB 3BGRB 2PFFB 1DQAA 4DSKA 3OL7A 4DV7J 1IKVB 2AZ1A 2ILYA 5LRNA 1AJAA 3QPIA 2NXJA 1IKYB 2D3ZA 1FWKA 4DZ6A 2HFZA 4OYOA 3ZO7A 3AHPA 3C15B 3PJWA 3PW2A 3VF0B 4NXMJ 1RXOB 2IBKA 2UVRA 1X8DA 2MQLA 4LF8F 5AE1A 2HQDA 3S7RA 2XWYA 4OI4A 4ED8A 1JLEA 3LPEA 4KIAA 2JLFA 3KK1A 5KG4A 4ZPAA 4UTGA 2MQNA 2DR9A 1X4HA 4J9MA 1U8WA 3L95X 5KFMA 2RS2A 5IT0A 1KBRA 3EVWA 1DARA 3WC2A 2QMUB 1R0BG 2VODA 2XQCA 3DU5A 4Y00A 1K7HA 9RUBA 3C16B 1KNZA 2HNYA 1RHQB 1WC0A 4QIEA 4Y6IA 3C2PA 3RW7A 2LA6A 2W2PP 3I87A 2HRTA 1SJ4P 4ZG6A 2KT3A 4FNHA 2E1CA 5F8GA 1JXEA 1T7PA 1HWIA 1URRA 3HHEA 4EZ6A 4FVCA 3DLKA 4OL8A 4F0HA 2OPQB 4HI2A 2C2OB 3KUGA 1A7GE 4PXDA 4CIOA 1VBXA 2MZJA 2IMOA 1HBUB 2AQ4A 3BQ0A 1KH7A 1RSCA 2OSRA 2C3YA 1U1RA 1WG4A 2VZ9A 3KYLA 3IGYB 2R3VA 1JNZB 4C98A 1T9VA 2V4RA 5GRRA 3OV7A 5KFGA 3NOGA 2RKIB 3RBZA 4A8SA 5KFDA 4MH8A 3BKFA 3IG1A 3JQMA 4ED7A 1SH0A 3NMRA 2HNDB 2CNOB 4CZCA 1C4AA 3CIZA 1V5VA 4LRBA 3CF5Q 1W2IA 5KG2A 3UO0A 3ZZ0A 2UUCF 4U7UK 1ZBTA 1UFWA 3UN2A 2OMOA 1V3ZA 2GO9A 4LRAA 4CI0B 1FERA 4XK8C 2QL5B 1UFKA 2CWXA 2ZH9A 5I4MA 2ZH6A 2HNZB 4KBIA 3UE2A 3SQGA 3FEZA 5LMUF 3J7YI 4J9OA 4NLPA 4IYQA 3MPWA 2OD4A 2XHWA 2DGOA 4GC6A 2ZDPA 1ALJA 3VAIA 2AMCB 2XI2A 4P2MA 3T00A 1GX5A 1IBLJ 4ZCKA 2W5SA 1BQMB 2D7SA 1KDNA 1LXNA 4H4MB 3IAS9 2CQGA 3WBZA 4BC9A 5IJSA 5K8MA 1CEZA 4RW9B 1OYEA 3MM7A 3LOUA 2RF2A 2JRSA 3FQKA 5KFIA 5LIAA 1NK6A 3NGUA 1C1BA 1NPPA 2YNGA 1H0HB 4NRTA 2E1MC 2QIFA 2DR5A 5HVGA 3MPVA 2JC0A 2QLFB 2CJYB 1TVRB 4B3TF 3D3CJ 4FPIA 2GSUA 1UPMB 2F8EX 1F5AA 2DO0A 2HURA 1NH7A 4N41A 2WONA 1FE0A 2ERRA 2DNHA 3MUMP 2XY6A 2ZH7A 2W8KA 4P71A 2KJVA 2JFDA 3N9UC 2MJNA 3KDOA 3VAFA 2LYVA 2YNFA 4D3GA 2XGQA 3TA2A 4KQZA 2ALYB 3U7JA 1U7LA 4JB8B 5C24A 2OTLS 5IM0A 2J6TA 2N3OA 2XSFA 2YX4A 3MEDA 3PX0A 3UDVA 5BJRA 4F2SA 4PABA 5K8PA 4IG0A 2MSSA 4PCQA 4O23A 2VL1A 3AA9A 1NLKL 4JI7F 2QL7B 1U6BA 5KFEA 2E5LJ 4X64F 3E2DA 3JB9k 1HQUA 3NCQA 4OYAA 3A12A 2UXDF 2JOQA 2GHVC 5HVFA 3BGUA 2W1BA 5M2PA 5EN1A 2PD1A 2H1YA 3TEGA 4KH1B 1VJWA 3K17A 4EYHB 3OBIA 3CCLS 3PNIA 1WEYA 3DMJA 4M5MA 4H54A 1RHJB 4CLLA 4QWDA 1N48A 1PYOB 1FNXH 3MMBA 1B8JA 3D2WA 3NAIA 5B7WA 1HI0P 3D9BA 5DDOC 1YIJS 3HM9A 1RP5A 2G4BA 1B99A 2ABYA 1M5KC 5I42A 1B70B 4NLWA 1TKDA 1WHYA 4LT6A 1UVLA 3NKYA 1ZA1B 5MLCV 5CQGA 4RZRA 1S9EA 2ZJRQ 1RAFB 2O67A 1WHXA 3HJVA 4U6PA 2ZOFA 1HPZB 2IJRA 4R25A 1CJTB 2ALZA 4F67A 3V6DA 3M05A 1CJVA 1M0SA 4PQUA 2AGOA 1IQTA 4V1Ak 3QIPA 5ETPA 2GVDB 2VICA 3EVOA 1N32F 1VQLS 2MZSA 1DTQA 2OLWA 3NXZA 3W2VA 4TYAA 1REVA 3SSQA 1TK5A 2PFDA 5LL6d 2UU9F 2VOPA 1TUWA 4NL5A 4ICLB 1Z1ZA 3GP9A 1CPZA 3LW5C 3PYGA 1AFIA 2J9CA 1SV5A 1U1NA 4B56A 1WHWA 3GE9A 3HHNB 2F9JA 3MAHA 3VV2B 2OFGX 5DLWA 4LBIA 4WKYA 1VQ4S 1XMOF 3H4BA 1WEXA 1TKZA 1Y3JA 3N79A 3EGZA 4CLZA 3K89A 2KDOA 4RNHA 4L3KA 1ZAXA 3FJ2A 2OPSB 3CO9A 1NB2A 2AJ2A 2C42A 2RD5C 5CYMB 3L7UA 4EGLA 2BE2A 4E98A 2GJ2A 2LEPA 2MZ1A 2OPRA 2C2NA 2IM0A 4NEYA 1RT7B 2YKAA 2NXNA 2HFOA 2BQUA 4AQYF 3QMQA 2R7WA 3I9V9 3PYDA 3B4MA 3HKWA 4CWBA 2JX2A 2VIHA 1AJBA 2E9ZA 1OWXA 4LR8A 3VAKA 4KGMA 2O1PA 1UTAA 1OMSA 2ZC4A 5E3CA 1RDRA 1CC7A 1HBOB 4WE1B 3H2UB 3TWZA 1D9DA 2DHGA 5BR8J 3D0HE 2UXBF 2GIQA 1VK8A 3M30B 3BR8A 3BGLA 1WC1A 4DF8A 4WF9Q 2YNHB 3GMGA 3CW2C 3OXFA 2GVZB 2B56A 4DR6J 2OFHX 1RQ0A 3LAMA 3MM8B 2HWIA 1U2RA 2BRLA 2HWTA 2NXEA 3G6YA 1FI4A 2Z4PA 3TOQA 1RE1B 2G0IA 4UUXA 1R89A 3Q2SC 3BGFA 2EKNA 1JLBA 2IVMA 1T0TV 2ZD1A 1F2HA 3RBDA 4X4PA 4ZVUB 3EM1A 4QIVA 3LPYA 3IBFB 2E1PA 1RCXB 4WP8A 3MFIA 1QE1A 3R7NB 2CNKB 4DV6J 4LSNA 3T5JA 2LU1A 1RTHA 1FKOA 4C8ZA 5C7PA 2VG5B 2B5JB 4KHPF 4DFPA 2XMUA 1NB7A 5D3GA 3A3OB 3MD1A 1FJ7A 3SV3A 2Z8QA 2HFUA 3E8OA 4P2XA 2LMIA 4OI3A 1LWFA 2R2RA 3CIMA 1RHUB 3LP0B 1ZETA 5D15A 1TV6B 2G13A 1CULA 4K50A 2R7XA 4RKUC 3CCRS 3LALA 4DG1B 1AJDA 3P8BB 1V3SA 3PO4A 2IRXA 3EGVA 3CMAS 4QIGA 1VIXA 2FLLA 1E1ZP 1GT8A 3M6XA 2D1GA 1GAOA 4DCOB 4USKA 3VHQA 3QBCA 4F4KA 3ZFVA 1HBNB 5KFPA 3MPUB 5HLFB 1OJ4A 2V63A 3KLHA 5KAKA 1AYEA 1T9UA 1NM2A 3DXSX 3ZC4A 1JKHB 4B3TJ 4LUBA 4Z7YA 5D4PA 3G8QA 1N5YA 5IT9Y 3NS5A 5A8WA 2WVFA 2XTJP 1MMDA 2HGMA 2GAHC 4P74A 1X4BA 3GTYX 1V9OA 5KFWA 1SC4B 1S6PB 5KOXA 1WELA 1KHNA 2C3MA 1KP6A 5C25B 4JI3F 4ZG7A 2ZNZA 4DLGA 1MWZA 4QCLA 1WDDA 2F5GA 3NP5A 5F41A 5F3ZA 1EZZB 2ACMA 2UUAF 4JI5J 3KLIB 4K59A 5KOWA 4CT9A 5GOVA 2KN4A 4UT4A 1QY7A 3LWMA 3HKZD 2FY8A 3D5MA 1S1VB 1VQYA 2MQQA 5RUBA 2Y1LB 2LQ9A 4F7VA 2DNNA 2UXDJ 1XMQJ 2BANA 1LFPA 2CJBA 4DQIA 5KFJA
chains in the Genus database with same CATH topology
4ZG9A 5LIAA 3DYCA 1N2KA 1AJBA 5LQQA 2RH6A 2ZKTA 5LRMA 4UOOA 4LR8A 1EJJA 4NWXA 3E2DA 4LRBA 3ED4A 3BDGA 1EQJA 1SHQA 1SHNA 5C66A 1ZEFA 2GLQA 2W5QA 4TN0A 2IUCB 3IDDA 1HJKA 4UPKA 3SZYA 3UO0A 4LR7A 4LQYA 3M8WA 2GSOA 4MY4A 2X98A 4MHXA 3TWZA 1ANJA 4CYRA 1KH5A 2GSNA 1KHNA 1K7HA 2QZUA 4KM4A 4CYSA 3OT9A 1ALIA 4B56A 1URBA 3UN2A 1N2LA 2GSUA 1EW2A 3NKNA 5EGEA 1EW9A 1EI6A 1KHJA 3LXQA 4FDJA 1ELYA 5HRTA 3NKOA 3M7VA 4GTYA 3A52A 1ED8A 5IJQA 4ZG7A 3MK0A 3TG0A 4LRAA 4UPIA 4CXUA 5DLWA 1O98A 2W5WA 4LRCA 3IGZB 1EW8A 2GA3A 3WAXA 3DPCA 4LREA 1B8JA 1KH9A 5L0EA 1HDHA 3NKQA 3T02A 4ZG6A 2VQRA 4UPLA 1P49A 1Y6VA 5INHA 2W8DA 2W5VA 1AJCA 1ALKA 1KH4A 3BDGB 4KAYA 4LR2A 5K4PA 3NVLA 1AUKA 3UN3A 3TX0A 1AJDA 4UOPA 2ANHA 3M8YA 3KD8A 4GTZA 1ALHA 5LRNA 3MK2A 4CXSA 1AJAA 2W8SA 1ANIA 2XR9A 3NKRA 4MIVA 4GTWA 4KAVA 5GOVA 5L0BA 2W5TA 3B5QA 4NWJA 1ELXA 1KHLA 1KHKA 5DLTA 3NKPA 1KH7A 2IFYA 4UORA 1Y7AA 1FSUA 3M8ZA 1E1ZP 4LRFA 5L0KA 1ALJA 4KJDA 3WAWA 4CXKA 3UNYA 1E3CP 2D1GA 3MK1A 5TJ3A 3T00A 4KJGA 2IUCA 3IGYB 1ZEBA 4YR1A 4LR9A 1E33P 5DLVA 2W5SA 1ED9A 2W5XA 3WAYA 4QAXA 4N7TA 4GTXA 5KXAA 3T01A 4FDIA 3BDHA 1O99A 4LRDA 3WAVA 2G9YA 1HQAA 1ZEDA 1E2SP 3NKMA 3Q3QA 4UPHA 5GRRA 3CMRA 5IJSA 5AJ9A 3BDFA 2W5RA 3SZZA 1ELZA 1URAA 4ZGAA 3UN5A 2XRGA 5EGHA 3WBHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZG9 A;  5LIA A;  3DYC A;  1N2K A;  1AJB A;  5LQQ A;  2RH6 A;  2ZKT A;  5LRM A;  4UOO A;  4LR8 A;  1EJJ A;  4NWX A;  3E2D A;  4LRB A;  3ED4 A;  3BDG A;  1EQJ A;  1SHQ A;  1SHN A;  5C66 A;  1ZEF A;  2GLQ A;  2W5Q A;  4TN0 A;  2IUC B;  3IDD A;  1HJK A;  4UPK A;  3SZY A;  3UO0 A;  4LR7 A;  4LQY A;  3M8W A;  2GSO A;  4MY4 A;  2X98 A;  4MHX A;  3TWZ A;  1ANJ A;  4CYR A;  1KH5 A;  2GSN A;  1KHN A;  1K7H A;  2QZU A;  4KM4 A;  4CYS A;  3OT9 A;  1ALI A;  4B56 A;  1URB A;  3UN2 A;  1N2L A;  2GSU A;  1EW2 A;  3NKN A;  5EGE A;  1EW9 A;  1EI6 A;  1KHJ A;  3LXQ A;  4FDJ A;  1ELY A;  5HRT A;  3NKO A;  3M7V A;  4GTY A;  3A52 A;  1ED8 A;  5IJQ A;  4ZG7 A;  3MK0 A;  3TG0 A;  4LRA A;  4UPI A;  4CXU A;  5DLW A;  1O98 A;  2W5W A;  4LRC A;  3IGZ B;  1EW8 A;  2GA3 A;  3WAX A;  3DPC A;  4LRE A;  1B8J A;  1KH9 A;  5L0E A;  1HDH A;  3NKQ A;  3T02 A;  4ZG6 A;  2VQR A;  4UPL A;  1P49 A;  1Y6V A;  5INH A;  2W8D A;  2W5V A;  1AJC A;  1ALK A;  1KH4 A;  3BDG B;  4KAY A;  4LR2 A;  5K4P A;  3NVL A;  1AUK A;  3UN3 A;  3TX0 A;  1AJD A;  4UOP A;  2ANH A;  3M8Y A;  3KD8 A;  4GTZ A;  1ALH A;  5LRN A;  3MK2 A;  4CXS A;  1AJA A;  2W8S A;  1ANI A;  2XR9 A;  3NKR A;  4MIV A;  4GTW A;  4KAV A;  5GOV A;  5L0B A;  2W5T A;  3B5Q A;  4NWJ A;  1ELX A;  1KHL A;  1KHK A;  5DLT A;  3NKP A;  1KH7 A;  2IFY A;  4UOR A;  1Y7A A;  1FSU A;  3M8Z A;  1E1Z P;  4LRF A;  5L0K A;  1ALJ A;  4KJD A;  3WAW A;  4CXK A;  3UNY A;  1E3C P;  2D1G A;  3MK1 A;  5TJ3 A;  3T00 A;  4KJG A;  2IUC A;  3IGY B;  1ZEB A;  4YR1 A;  4LR9 A;  1E33 P;  5DLV A;  2W5S A;  1ED9 A;  2W5X A;  3WAY A;  4QAX A;  4N7T A;  4GTX A;  5KXA A;  3T01 A;  4FDI A;  3BDH A;  1O99 A;  4LRD A;  3WAV A;  2G9Y A;  1HQA A;  1ZED A;  1E2S P;  3NKM A;  3Q3Q A;  4UPH A;  5GRR A;  3CMR A;  5IJS A;  5AJ9 A;  3BDF A;  2W5R A;  3SZZ A;  1ELZ A;  1URA A;  4ZGA A;  3UN5 A;  2XRG A;  5EGH A;  3WBH A; 
#chains in the Genus database with same CATH topology
 4RUH A;  1VIO A;  2I5J B;  3AJ1 A;  3JSB A;  1SC6 A;  3AJD A;  3E01 A;  2IMW P;  2FJB B;  3HFZ B;  4IDK B;  2OAU A;  1RZM A;  3F0N A;  1L3V A;  2EVZ A;  3MTK A;  4ZDN A;  1JLG A;  2B43 A;  1S5Z A;  2QZU A;  5L8R C;  4UZC A;  4R5P A;  2CVE A;  5L1J A;  1L3K A;  1UFL A;  1JLA B;  5KG6 A;  3KNA A;  2OH2 A;  4MMO A;  2WVB A;  1FDA A;  1AZS B;  2QA4 G;  3U1M A;  1N8R T;  2GMH A;  3K58 A;  3GG1 A;  2L48 A;  1NZ8 A;  1CG2 A;  4I6Y A;  1NK7 A;  4K5R A;  3IMQ J;  4LSZ B;  4DQS A;  4CXK A;  1S99 A;  1TUV A;  5EX3 A;  2R7R A;  2QMW A;  3B6B A;  1MN9 A;  4ECV A;  2ADB A;  2UU9 J;  3HUL A;  2BE9 B;  3G6V A;  4WFB Q;  4OMF G;  2CPD A;  4JI2 F;  1LK5 A;  3T1A A;  4LBP A;  1VS3 A;  1HNZ F;  2U1A A;  5A6P A;  2P6S A;  4PPD A;  4CLY A;  3S6E A;  1UEV A;  5IQ6 A;  2HBZ B;  4ER8 A;  1JWW A;  4JI1 J;  3ZZT A;  3JTP A;  2ADC A;  2BJ9 A;  4UY8 T;  2A6M A;  5BYS A;  2RT3 A;  3CD7 A;  2GAG C;  4DPW A;  1CJK B;  1KLM A;  1K8A T;  5KFO A;  4MIW A;  5THW A;  4B9N A;  2KFZ A;  2KJW A;  2VQR A;  1JLC A;  4QJV A;  2Q6C A;  4TY8 A;  2R7Q A;  2ZBC A;  4YS2 A;  4TQR A;  3MXH P;  4IQX A;  4DR2 F;  4NCB A;  3DKD A;  3MMA A;  2HVI A;  4DFJ A;  4AQY J;  3M8P A;  4Q45 A;  1BLU A;  1ZH5 A;  1RTD B;  1FDN A;  1J5E F;  2C3P A;  1IR1 A;  1WOO A;  2XMW A;  1PBA A;  2YPY A;  4EZ9 A;  1OPZ A;  1T05 A;  4NLQ A;  4OJ1 A;  1JX4 A;  3AXM A;  1L3U A;  3R5G A;  4CM2 A;  2W4D A;  5KFU A;  5KFZ A;  3VAJ A;  4DR4 J;  1DUR A;  4ELV A;  3BV8 A;  3KG1 A;  4H4K C;  1D8Z A;  3MD3 A;  2BKP A;  3OFF A;  2VG6 A;  1NEE A;  1Q0N A;  4CYU A;  1KH5 A;  3PR5 B;  4DL0 C;  2QC3 A;  1T11 A;  3DGV A;  4YDD B;  1DFD A;  4USH A;  3GFZ A;  7FD1 A;  3ILO A;  1F9H A;  2BKO A;  2HHV A;  1JLQ A;  5CD4 H;  4NA3 A;  5HSP A;  4TQS A;  3NKQ A;  1HQ2 A;  2FUG 9;  4NCA A;  2HHH J;  3NVL A;  5B0E A;  3WHI A;  4ED5 A;  2ANH A;  1U1L A;  2APO A;  1UJ5 A;  4DV0 F;  1SC3 B;  3PRV A;  1KHW A;  4P7V A;  3DHW C;  3DLE A;  2ACY A;  3TAP A;  2IUC A;  3QAT A;  2XUL A;  2M88 A;  4MJK A;  4GKK F;  1HA1 A;  5J1E B;  3MEG A;  1FTC A;  1Y11 A;  5IS2 A;  3KK3 B;  4KH0 B;  1HQA A;  4NX9 A;  1U02 A;  3CMR A;  2ZH8 A;  1OYD A;  4KHM A;  2WW8 A;  5GMK a;  1S1T B;  4HL9 A;  4X4R A;  3PVX A;  3O2I A;  6FD1 A;  2NXU A;  2LEC A;  2WZ1 A;  4LQ9 A;  1PJ6 A;  1XNR J;  3VAH A;  2EXU A;  2JHE A;  2QV6 A;  1RAH B;  4ZVP B;  3HD1 A;  3TA0 A;  3LXQ A;  1ELY A;  1F1B B;  2KKH A;  5CAB A;  3D7S B;  3DLG A;  3OLA A;  3I56 S;  1KR4 A;  3MM9 B;  4DZD A;  5ETT A;  1HBM B;  3M9M B;  2DPJ A;  4FKY A;  2MST A;  1S10 A;  5KFR A;  4QR0 A;  2DR6 A;  2IYI A;  3G8S A;  2N4D A;  4Q0B B;  5F8H A;  1DJ0 A;  2BQR A;  3GYN A;  5J2N A;  4ZP8 A;  1N6Q B;  3I5C A;  4L76 A;  5D4O A;  2VBZ A;  3K57 A;  5DGB A;  1NJY A;  3T01 A;  4LF6 F;  1T94 A;  3BN4 A;  3GB0 A;  2VHG A;  1S76 D;  1FDD A;  5D0E A;  2MLX A;  1RHM B;  2YWF A;  4JI3 J;  3AY0 A;  3D4J A;  3OXL A;  5F8L A;  4IH6 A;  3SI8 A;  3KHR A;  4DPY A;  1U47 A;  1QVG R;  1TU0 B;  4I2P B;  1LNQ A;  1KOO A;  3M2R B;  1D9A A;  5J2P A;  3CB4 A;  2NUH A;  4I7F B;  2YKQ A;  4B3R F;  5KG1 A;  4RW6 B;  3J81 U;  4TN2 A;  3VZH A;  1KHJ A;  4DSF A;  4RW8 A;  5ADZ A;  2EI5 A;  5HMY A;  5LXR A;  4RUB A;  1YQH A;  5D0H A;  1SXL A;  4NZ0 A;  1YIT S;  2C2M B;  3CJQ A;  3PKY A;  4ETX A;  3MAA B;  3MOJ B;  1O8B A;  2E66 A;  3HVA A;  2FY1 A;  2JFK A;  2XS5 A;  3W5Y A;  4HKQ A;  4USW A;  3J81 j;  1ZYQ A;  3AXK A;  2LCW A;  1OQ6 A;  2YKM B;  3OTD A;  4J9Q A;  1KTV A;  1HW9 A;  3DRR A;  1NDK A;  4C3L A;  4CLU A;  5AT1 B;  4URQ U;  4B3M J;  1Q8L A;  1RWW B;  3M2U B;  4TU9 A;  4QYR A;  1LWE B;  3TW0 A;  2J5A A;  5L46 A;  2DIT A;  2DNM A;  4OJH A;  1N2K A;  3MMC B;  3OFG A;  5F8N A;  3H5S A;  4K4Y A;  2HHW A;  2KH9 A;  5EWG A;  4PG6 A;  1I94 F;  4G1P A;  3KK2 B;  2J7U A;  1MG7 A;  4CO1 A;  3DN9 A;  3OTE A;  3VGT A;  4KAI A;  3MEE B;  2DNZ A;  1WJ9 A;  1YBT A;  3CCM S;  2DHS A;  2JJ4 D;  1RA7 A;  3VR1 A;  2FHK A;  4EBD A;  4TNO A;  1QJH A;  1JQG A;  2MPU A;  2DHH A;  4I1T A;  2DIS A;  5HMX A;  1Z4U A;  5DQG A;  2EWH A;  4CXS A;  3CJR A;  3UVJ A;  2XMK A;  3NGT A;  2IBO A;  4KJI A;  3SCI E;  2Y8W A;  3BYR A;  3K59 A;  3UCZ P;  3WC0 A;  3LGN A;  3G6E S;  2AYG A;  1UA0 A;  3OUY A;  2FD2 A;  1IKX B;  2VFT A;  4PXB A;  2Y1J A;  5HQM A;  3CC4 S;  2HQG A;  1Y10 A;  3HVR A;  3Q3Q A;  3Q23 A;  2ZH5 A;  1TL1 B;  2V67 A;  1RT3 B;  2KXF A;  3VZI A;  5A2Q Y;  1IJF B;  3DRY A;  4PWD A;  4ZGA A;  4ZVO B;  5A0Y B;  4C0B A;  4KKO A;  1AXQ A;  1HYS A;  4I2Q A;  1HNX J;  3T5K A;  1P6T A;  2HAF A;  4FDF A;  3IRX A;  2WRM A;  3TJ8 A;  2HBQ B;  5CH7 B;  4CQ1 A;  1TKX A;  1KON A;  2RB7 A;  3TUP A;  2V4Q A;  1D1U A;  3EPI A;  2N3L A;  4NLS A;  4IG3 B;  1R6Y A;  4ECU A;  2EK6 A;  2CVI A;  1J5E J;  4PWU A;  5HN0 A;  4K2X A;  1WF2 A;  2KFN A;  4ZKA A;  4JV5 J;  1NHK L;  1R8H A;  3TAR A;  4QPX A;  4DN9 A;  2YWH A;  3Q89 A;  5H9E J;  4C9D A;  4DHV A;  3R2D J;  1H73 A;  1Q8I A;  2CPY A;  4J9R A;  3AD8 C;  1FEH A;  2JC1 A;  3CJ4 A;  1S1U A;  4P7T A;  4ZOS A;  4F04 B;  2VA3 A;  2HSE B;  3BB5 A;  2IHR 1;  1U6F A;  1VRU B;  5H1S V;  3HK2 A;  1MML A;  4LIW A;  3KLF B;  5A8K B;  4W90 B;  3SDE B;  3DNC A;  3FRY A;  4WP3 A;  1RWV B;  2XC9 A;  3L09 A;  2VG7 A;  1ZEF A;  1N54 B;  2R2T A;  3SZY A;  2HVE A;  3EMT A;  2F63 A;  2P5V A;  4C7Q A;  4KM4 A;  1HFE L;  1P9Q C;  2DXF A;  4NCG B;  1NME B;  4UZB A;  3S8S A;  3BGR A;  1IKV A;  1RLC L;  4E0D A;  1TL7 B;  2AV5 A;  3UR3 C;  2B51 A;  5B0D A;  1XC9 A;  3TAM B;  3OPK A;  3KD8 A;  1LXJ A;  2H65 B;  4FKX A;  5ITH A;  1ANI A;  1UPP A;  1QTM A;  2CIM A;  5ETL A;  3MM6 A;  3DCA A;  3CPW R;  2FVS A;  2M8D B;  2CNL B;  4MK7 A;  2VH7 A;  2V2Z A;  1OO0 B;  4K0K F;  1UEK A;  1XIQ A;  3K5N A;  2IAJ B;  3TUI C;  3PW5 A;  2V8V A;  1KRP A;  2MTL A;  1DBD A;  1FWL A;  2XEX A;  1I6J A;  2O01 C;  1FRJ A;  2HMI A;  1IBK J;  1FEE A;  1EP4 A;  1RWU A;  2RHQ B;  4HDH A;  3LP1 B;  2Q6B A;  4EYI B;  4LR7 A;  4IOB A;  1YJ7 A;  2VA2 A;  3OR1 B;  4ZVR B;  1TKT B;  1X4F A;  5B09 A;  3C6T B;  4DR7 J;  4YHH F;  5GAD U;  1KTQ A;  4ECX A;  1HHT P;  4O3P A;  1S9G B;  4ID5 B;  1R6V A;  5ETO A;  5IT4 A;  1LW2 A;  3Q8R B;  3RTV A;  3B8H A;  3OLB A;  2OML A;  4NE9 C;  4WK1 A;  1HBU A;  4NLR A;  1WSR A;  2DY1 A;  4LF6 J;  4Y65 A;  1TUG B;  4DSJ A;  3MEC B;  1FES A;  4UOF A;  4MIA A;  4PG4 A;  4N76 A;  4YR3 A;  3R8Y A;  2JEJ A;  3WAY A;  1O51 A;  2E9T A;  1HIY A;  4U8V A;  2RJZ A;  2G9Y A;  2MKJ A;  4OV1 A;  4HVZ A;  4AUK A;  4M5J A;  1PC4 A;  2YKO A;  2XMV A;  3M1V A;  8ATC B;  2IC3 A;  3PAC A;  2I38 A;  4C11 B;  1BGX T;  2RH6 A;  1ZAW A;  2VJV A;  5IV4 A;  2E9R X;  3I31 A;  3MR6 A;  3NGD A;  2GLQ A;  2W5Q A;  3MMJ A;  4L6V 3;  3M6V A;  3KJV B;  1WC6 A;  1QLN A;  2HHX A;  4PAA A;  1Q4R A;  2OO4 A;  3RB0 A;  1QAJ A;  1HMV A;  2XY7 A;  2I1R A;  2VFU A;  4JI4 F;  3ZZY A;  3CJK B;  4KO0 A;  1K44 A;  2MYF A;  1YSJ A;  1YZ6 A;  4KY3 A;  1KQF B;  4GTY A;  2BRK A;  2DGV A;  2EG1 A;  5DLF A;  3RRH A;  1M90 T;  3OXG A;  1RT6 B;  3GYG A;  4URG A;  5AXL A;  4G1I A;  3HFK A;  2RRA A;  2NPI A;  4IFY B;  3C8Y A;  5LSL A;  5E3Q A;  4RJV A;  2IFY A;  1PCA A;  1N4L A;  4TXS A;  4ANE A;  2B3T B;  4LRF A;  4DQR A;  1SQG A;  4N56 A;  4C8Y A;  3DOM B;  3JAM U;  2NUU G;  4OLO A;  4J9K A;  2BXJ A;  4A8W A;  3H59 A;  5KXA A;  4J9S A;  3FCH A;  4JV2 A;  4PUO B;  2IRY A;  4Q8F A;  3WQP A;  4QIF A;  2ZE2 A;  2C3O A;  4HTI A;  3ET6 A;  3MR2 A;  1W2B R;  2OEJ A;  1S0O A;  2CPH A;  1HW8 A;  2YKN A;  3X3U A;  4LF4 F;  2ZKU A;  5ETQ A;  1VQ7 S;  1Q95 G;  2VKZ G;  4FXD A;  2V50 A;  3GPA A;  1NBE B;  4LF5 J;  3A13 A;  3K5M A;  2RSQ A;  5KFF A;  1EAY C;  2DGX A;  1H7X A;  3QT6 A;  1I5O B;  1IKW A;  4ZK7 M;  1MW7 A;  2DRB A;  3NBP A;  2DNK A;  5KFB A;  2MB0 B;  2V4J A;  1RAI B;  1U8S A;  4USI A;  3T9N A;  1KSP A;  2QT7 A;  3QJL A;  5GAE U;  4LIR A;  3RAX A;  3K0J A;  1R0A A;  5HAO A;  3NS7 B;  4O44 A;  4OI0 A;  3IA0 A;  1Z2Z A;  2CQ1 A;  2JLE A;  4GTX A;  2UUB F;  4O3S A;  1T95 A;  4ZJQ A;  2XS7 A;  4ED4 A;  5CAA A;  4ZLJ A;  2LVW A;  2ASD A;  2WB4 A;  1FKP A;  1WI8 A;  1URA A;  4YOE A;  4N8O A;  5JJB A;  2X1G A;  4CO4 A;  1UA1 A;  1BY9 A;  4PXC A;  3BKT A;  4R0E A;  2UVU A;  4K4V A;  1N0V C;  2X98 A;  3FBB A;  2ZZT A;  3HSG A;  3CJ5 A;  2FJE B;  4X4T A;  1S6Q A;  4FDJ A;  1EKS A;  2AGQ A;  1UVJ A;  1DY3 A;  4KRW A;  2YWK A;  8AT1 B;  4DX6 A;  3PTW A;  4BWM A;  1SL0 A;  2LQB A;  1FTR A;  3I32 A;  2GGP B;  2WCX A;  2YX1 A;  2AP6 A;  4DR3 J;  1FXR A;  4V19 J;  4P75 A;  2F3J A;  3H7H B;  2VUG A;  1KD1 T;  2UXC J;  4M5K A;  3ZTS A;  1REG X;  2M0G B;  1ZOT A;  2J7K A;  2WOM B;  4KPC A;  2K3K A;  3P96 A;  2KZM A;  1DZ5 A;  3FZB A;  5IC6 B;  3ETO A;  1PJ5 A;  1U2F A;  2QA2 A;  4JV0 A;  1S77 D;  3I9Z A;  5DLV A;  1J2V A;  3D28 A;  2GVD A;  2F7V A;  4JV1 A;  1DHM A;  3H5Y A;  2HYI B;  2K1R B;  1NDP A;  4XIU A;  1OSD A;  3K7R A;  3CSK A;  1XNQ J;  4ILM A;  2KXH A;  1XQI A;  1C0U A;  1NZA A;  3N6M A;  2G1H A;  2IA0 A;  3KLE B;  3V6J A;  4UY8 5;  1OPI A;  2PT0 A;  2VQF F;  4YME A;  3G87 A;  4I64 A;  4DV3 F;  2C3U A;  4KC5 A;  4A8X A;  2BM0 A;  2XGP A;  3CE8 A;  3PZP A;  1DLO B;  1KQS R;  5IJQ A;  2QFI A;  3CJ8 A;  4C8M A;  3S1T A;  1IBM J;  2PMZ D;  4O4R A;  1APS A;  2VFV A;  1X0F A;  1G2E A;  2FHO B;  4ZJL A;  4LR2 A;  2WVC A;  3SBM A;  2KG0 A;  1B4S A;  1CBK A;  1PYT A;  3BRE A;  2W8S A;  1XJW B;  4XDD A;  2VQE J;  4A48 A;  3BQ1 A;  4ZHR A;  1GXT A;  4DPO A;  1ZM3 A;  4RW4 A;  1EQM A;  3DGP B;  2ZM6 F;  2XHC A;  2DHX A;  5A8R B;  4QIW D;  3PW4 A;  3CD0 A;  4UW2 A;  2AJ0 A;  1XEZ A;  3ZTO A;  4AE5 A;  4HLB A;  4DS5 A;  2KZZ A;  1EIY B;  1D8Y A;  4MKA A;  3DLH A;  1NKC A;  1K73 T;  4WZM A;  3E3X A;  3O8W A;  4F26 A;  3VQS A;  1D09 B;  2FGO A;  3J7Y U;  2QZ8 A;  3ONQ A;  5DQH A;  5DDQ C;  1HWU A;  2KI2 A;  4USV A;  3MEK A;  2H5J B;  4OYM A;  2PEH A;  3C6U B;  1Q8K A;  1FNM A;  2G9O A;  3SCL E;  1GXU A;  3W2W A;  3HVT B;  1G6B A;  3BSA A;  4R8U B;  4K4Z A;  4GO5 X;  1S97 A;  3BQ2 A;  4L72 B;  1JLE B;  1EW8 A;  2DYA A;  3KK1 B;  3BN7 A;  2MKC A;  3DXB A;  2HHQ A;  1RLD A;  1TK8 A;  3TEH B;  3W64 A;  2OI2 A;  2VDH A;  2L08 A;  2J0S D;  2KTQ A;  1RHK B;  1LW0 A;  4W4M A;  1VQS A;  4F0M A;  2GC8 A;  1WDT A;  2QLJ B;  2YQ3 A;  1E3C P;  3MK1 A;  4OZ1 A;  2ZFH A;  4J9U E;  4YR1 A;  1R7I A;  2OP5 A;  3W60 A;  3ILI A;  2LDI A;  4DR5 F;  4NWB A;  1N33 J;  3SXL A;  4A4J A;  2EBE A;  4B3S F;  3FC9 A;  1FX2 A;  1SBR A;  3DLK B;  2XNR A;  2CUY A;  1K1S A;  3FRZ A;  2Q3P A;  3G71 S;  1Y3K A;  4DOZ A;  4WXO A;  1FK9 A;  2Y9H A;  3TUZ C;  3ZZU A;  4C48 A;  5DET A;  4MFB A;  3J80 U;  3RAM A;  2HFS A;  2OGU A;  1RI7 A;  1UW4 A;  3M32 B;  3GR0 A;  2RH3 A;  2DNQ A;  2W9C A;  2VFR A;  3V81 A;  3AAW B;  4RBV A;  4OX8 A;  3QAU A;  4LVO P;  4DG1 A;  3KG4 A;  2MY8 A;  3NLC A;  1NO8 A;  3DLB A;  4V19 X;  1NHV A;  5KFK A;  1P1L A;  4OIX A;  3KKF A;  1WC3 A;  4U7C A;  4J37 A;  1AT1 B;  2C1E B;  2E7V A;  2OPP A;  2AT1 B;  1N36 J;  3PO5 A;  3QT7 A;  3QLH A;  5SUH A;  1GTE A;  3M8Z A;  3MR7 A;  5KTQ A;  2PO4 A;  4MT1 A;  1Q79 A;  4ECY A;  1VCT A;  4AXI A;  1HNW J;  4J9V A;  5CYJ A;  1T3N A;  3KLG A;  3SQG B;  2DY9 A;  2XCA A;  3A8I A;  1GH8 A;  2VC0 A;  3BDF A;  3FEY B;  3DOL A;  2OTJ S;  2IDE A;  1H2V Z;  2MQO A;  2UUW A;  2EBG A;  4DX8 H;  2FZK B;  3HXM A;  3LAK A;  2LP4 A;  4OX9 F;  4NWX A;  1N5S A;  1XTZ A;  1PIE A;  4LFA F;  5C25 A;  2N4C A;  3KMS A;  3GV5 B;  5KT5 A;  1ANJ A;  3HDS A;  2QLB B;  1G4C A;  3LAN A;  1NDL A;  3HSZ A;  5M2U A;  5DM7 Q;  1XMB A;  2CQ3 A;  3V6K A;  2RF2 B;  3ELH A;  2H54 B;  2YVS A;  1OY9 A;  2NSC A;  3B82 A;  3AB4 B;  1SQE A;  3KLI A;  2YNG B;  2R8K A;  4IR9 A;  3FDS A;  2V8P A;  4DV1 F;  5GAD I;  1R43 A;  2D1C A;  4F2R A;  2HPU A;  2HRU A;  3CUN A;  2WK4 A;  4QU7 A;  2CZV C;  3HD2 A;  4CO2 A;  2IJN A;  4DUT A;  1NK4 A;  5CYQ A;  1YJ9 S;  5FLX Y;  2B4P A;  3QNW B;  2BW2 A;  3DYA A;  3TAQ A;  4WP9 A;  4RNM A;  2BOP A;  1X4C A;  2HIY A;  1JB0 C;  2IA6 A;  2HIQ A;  4F0K A;  4PEO A;  2JEI A;  1SPB P;  1LV5 A;  2X51 A;  4CO0 A;  3ENA A;  5IM0 B;  1QTN B;  3HZE A;  1RT2 A;  4DPX A;  1WKK A;  1BE4 A;  2E5I A;  4QYZ J;  3RGI A;  4TU8 A;  3MED B;  1EJ7 L;  2YH1 A;  2P8I A;  3D1Q A;  4Y2M A;  4IG0 B;  3OFE A;  1EW9 A;  4ERD A;  1M5H A;  4E2F B;  1RTI A;  3PXG a;  1VBY A;  2OKQ A;  4KPY A;  2QN6 B;  4ITS A;  2MKS A;  4UPL A;  4Y28 C;  4X66 J;  1HQE A;  1HQU B;  5D4L A;  2QX0 A;  3SZ2 A;  3AT1 B;  2GFF A;  3RJM B;  2PDA A;  4G1Q A;  3U27 A;  1H72 C;  3J7A N;  4OV6 A;  3B5Q A;  5K8N A;  1S57 A;  1QAY A;  3EXC X;  1VJQ A;  3T6B A;  4YDX A;  3EZU A;  4F4A A;  1RKJ A;  3AQP A;  2IPO B;  3DMJ B;  2B6A A;  3JTN A;  1U1K A;  2DIU A;  1R0C B;  1Q82 T;  4B02 A;  3MMB B;  4FS1 A;  1Q7Y T;  3D1H A;  2QRR A;  1GTH A;  3SFG A;  3VCD A;  2VC1 A;  1S48 A;  2AYE A;  5I42 B;  2Y0S D;  1ZTT A;  4LFB J;  2UP1 A;  4J7C A;  4ZG9 A;  4NI2 A;  3EDQ B;  2W8L A;  2A1B A;  2Z2L A;  1RUS A;  2V8D A;  1S9E B;  4Y2I A;  1X9S A;  1NU4 A;  4WZQ A;  5F8J A;  3V6D B;  2CJK A;  1CJV B;  4QZV B;  4PQU B;  4A8K A;  1NK9 A;  3QIP B;  1GEH A;  2W5W A;  2D9O A;  1JJ4 A;  2D3O R;  1DTQ B;  3W2V B;  2YPZ A;  1REV B;  3I4H X;  2CDR B;  1NUE A;  4DL2 A;  4ILL A;  3FVY A;  3SSR A;  3UR0 A;  5L1L A;  4DSE A;  2W2M P;  3HSD A;  3OSN A;  3IR7 B;  3QGI A;  1SV5 B;  2GHP A;  3N0V A;  2VV5 A;  1RAC B;  2DB1 A;  3IBC B;  2DCU B;  2VU5 A;  5DQI A;  2CJQ A;  2R2U A;  3A3P B;  4A8F A;  2B4U A;  5GAE I;  1TKZ B;  3T19 A;  2HFV A;  2CYY A;  1Q7L B;  3EZO A;  4BWJ A;  2LXF A;  1WOP A;  5KFL A;  2G0J A;  4FF2 A;  4HYK A;  3QSI A;  2YQ0 A;  5EGH A;  1VIS A;  1Y5I B;  4MIB A;  2W9B A;  2IJF A;  4F36 A;  3SIP B;  2BE2 B;  4OYZ A;  3CCZ A;  5DDR C;  5ETS A;  4WYL A;  2OPR B;  4YB7 A;  4P9S A;  2BW7 A;  2AEF A;  5F8I A;  4URS A;  2EFV A;  1RWP B;  9ATC B;  3NKN A;  3IS9 A;  1Q81 T;  4AFF A;  2DGQ A;  2LDY A;  2CJA A;  1K0T A;  4CRJ A;  4AL6 A;  1SQF A;  4C6A A;  1SJ1 A;  5E41 A;  3FSX A;  3FMW A;  4DV2 F;  3IN5 A;  4O4G A;  1S6O A;  2GV1 A;  2D69 A;  1KKH A;  5SZT A;  2XR9 A;  2KVQ E;  4B3S J;  1MNE A;  2BJ1 A;  1GK8 A;  1U1Q A;  4M95 A;  4AXJ A;  5HO4 A;  3T1Y F;  3I96 A;  2QO3 A;  4OZ2 A;  4DS4 A;  5KT4 A;  4FDI A;  2OIH A;  2Z30 B;  3QJP A;  3NKM A;  3Q2T C;  3VVT A;  1UVM A;  3D1O A;  1KFS A;  3UN5 A;  2XRG A;  3PEJ A;  4JYA F;  2J8A A;  2VFS A;  1JK9 B;  2KYZ A;  3BEG B;  3C66 A;  2G1D A;  5EX0 A;  1WF1 A;  1JLF A;  2Q1L A;  1ZM4 A;  1S1X A;  2KXN B;  1UJ4 A;  2QGF B;  4KFB A;  4AND A;  2LFV A;  1ZPV A;  1JLB B;  2RUS A;  1OSC A;  2P6T A;  2ZD1 B;  4D3H A;  4RWW A;  4EFA C;  4G3I A;  2BR0 A;  2CXE A;  2AJQ A;  2MJU A;  2N7C A;  4RW7 A;  4UPI A;  1S79 A;  2Z58 B;  1QE1 B;  4X65 J;  1C0T A;  4LSN B;  1RTH B;  1FKO B;  3CJS A;  4KAY A;  2GMJ A;  2H3E B;  5D3G B;  4K4U A;  4N8N A;  3ZTR A;  3JSM B;  4OI6 A;  1KVI A;  1GXL A;  1LOU A;  4R0J A;  2MKK A;  3KXD A;  1LWF B;  4KJD A;  4L73 A;  3FSY A;  5GVQ A;  2HVD A;  4F3Q A;  4ECZ A;  4HH1 A;  4JI0 J;  4OX9 J;  3OTC A;  4Q2M A;  2E5H A;  4YB1 P;  1CUL B;  3PYF A;  2HZC A;  1IVZ A;  2WHO A;  4CH7 A;  4EI2 A;  3KOA A;  4HR2 A;  2W2N P;  4WPA A;  3JXO A;  2DNY A;  2CQ4 A;  3M2R A;  3SEO A;  4U95 A;  2V9W A;  3T5H A;  4RU2 A;  5JUM A;  3BJY A;  5GME A;  3DOK A;  2DH8 A;  5A6W A;  1RAO A;  5LOQ A;  2AEM A;  2C2Z B;  3TO8 A;  1QAX A;  3THT A;  5FDL A;  4NAS A;  4JI6 F;  1UCN A;  1Z2L A;  3KLH B;  4NXN J;  1Q5Y A;  1PO6 A;  3HVW A;  5E3P A;  2RE1 A;  1YJV A;  2MZQ A;  3PYE A;  3MAA A;  2K7J A;  2DK2 A;  2H48 B;  2HRY A;  3NGS A;  4NYZ A;  1IWG A;  2RQK A;  1RHR B;  2I8E A;  4MTP A;  2CFX A;  2GJF A;  4UOP A;  5KG0 A;  2A18 A;  4ZPT R;  2EK1 A;  3AJ2 A;  4KYZ A;  3OTO F;  3N6L A;  5LJ5 Y;  2L9D A;  3UNY A;  1S0M A;  1X60 A;  4CLP A;  4TU7 A;  4GKJ F;  3B78 A;  3M2U A;  1LWE A;  3IR5 B;  5HMZ A;  4XDC A;  5DO2 A;  2OEM A;  3I0R A;  2RQM A;  3MMC A;  2X1A A;  4N5S A;  3N5B A;  5CA5 A;  2ROE A;  2RQC A;  4ENO A;  3PX4 A;  5LSR A;  3BDG A;  3OQ2 A;  1B0T A;  2B4V A;  2BE7 D;  3FBF A;  4HDG A;  2KG1 A;  3FKB A;  2G2Y A;  2RAQ A;  1HAR A;  2W01 A;  4UQT A;  1UMJ A;  3ZZO A;  3W5X A;  3QO9 A;  3D6H B;  2CZ9 A;  4X4S A;  2RQ4 A;  2JSX A;  3VAG A;  3BH7 B;  4LJM A;  4P72 A;  3E01 B;  1HWL A;  3F56 A;  3GFH A;  4PXE A;  4JI8 F;  2HQF A;  4WTO B;  5AJ3 J;  3KWM A;  1NSA A;  1G1X A;  2ZVI A;  1JLG B;  1WOR A;  4RNF A;  3P5T L;  4WFX A;  3Q22 A;  4LF9 F;  2E29 A;  5DGA A;  4DL6 A;  5DRK A;  4H4K A;  4R5P B;  1VFJ A;  1IQZ A;  4C0O C;  2O5D A;  4C4W A;  2MXY A;  4X2B A;  3PG9 A;  2CPE A;  4ZVG A;  2J7W A;  3UWT A;  2IY5 B;  2W7A A;  4NLX A;  2LQJ A;  2PE8 A;  2W4C A;  4CTA A;  3FFI A;  2XBP A;  2XLK A;  1T9Y A;  3NCR A;  4C3M A;  1QSS A;  1SKW A;  3UD4 P;  3THV A;  1PSD A;  3IDD A;  2CNN B;  3IGN A;  4ZVS B;  4F25 A;  2ZJP Q;  2E1A A;  1JNR B;  3BS9 A;  4CYS A;  1JXL A;  1F3F A;  1Y4Z B;  4B3O B;  1LKZ A;  3MI7 X;  3ILL A;  2R4F A;  1O98 A;  1ITP A;  3AFG A;  3R7S B;  1WG5 A;  5IWA J;  5FJ4 A;  1VC6 A;  2VON A;  1BUX A;  3GJQ B;  1KH4 A;  4OYI A;  2JWN A;  1FT8 A;  2FLP A;  1ALH A;  2NRE A;  4DX7 A;  1TR0 A;  2DJW A;  1R8A A;  4Y34 A;  2VKR A;  4IO9 Q;  4B9U A;  1XBW A;  2F8H A;  2MLZ A;  2F9D A;  2Z0G A;  1C1C A;  1KLM B;  5LMN F;  2LEB A;  2AEJ A;  3G9C A;  5DZ6 A;  1RGV A;  1JLC B;  4B9S A;  4TY8 B;  5F8M A;  1TMJ A;  3BKU A;  2HHP A;  1I1G A;  3SDE A;  1VBK A;  1Y00 A;  1VLO A;  4EO8 A;  2RU9 A;  1I3O B;  1F3V A;  3MMA B;  4O3O A;  4ETZ A;  2QE5 A;  2ATL A;  2XLJ A;  3M8P B;  2V68 A;  3QFH A;  1EQJ A;  1DQ9 A;  1TL4 A;  1HR0 F;  4AT1 B;  3WZ0 A;  3PHT A;  4QR1 A;  1RT1 A;  2YWG A;  2IIH A;  3BBB A;  3GU0 A;  1T05 B;  4I56 A;  4B9M A;  4BS2 A;  1H98 A;  4FBT A;  5J2Q A;  3M7V A;  4ZMM A;  4LF8 J;  2C22 A;  2PII A;  3EDR B;  3IWX A;  3Q8Q B;  3LGH A;  3T1Y J;  1SC1 B;  1SL2 A;  4C8O A;  1RA6 A;  1BC6 A;  5HBM A;  3M8Q A;  2VG6 B;  1CJU A;  3MUT P;  4CP5 A;  2LLZ A;  3TAN A;  1SIZ A;  2YQ1 A;  2QEX S;  4DSL A;  4IOC Q;  3GCW P;  1Y7A A;  4IR1 A;  1NJZ A;  1S1W A;  1RIS A;  2HHS A;  4OZJ A;  1JLQ B;  4ZPB A;  2R7V A;  2IDL A;  4OFZ A;  3V2U C;  1P1T A;  1WG1 A;  4YUD A;  1BQN A;  1NPK A;  3CXC R;  4RR5 A;  4M5D A;  3TYT A;  2CG8 A;  3EJM A;  4IFV A;  3JYT A;  4WFA Q;  2GS8 A;  1E6Y A;  3CJ0 A;  4FP9 A;  3QFW A;  2KO1 A;  4KT0 C;  1XR7 A;  2C2R A;  5LM7 E;  4DV7 F;  4K7Q A;  2PSZ A;  2Z56 B;  4TKT A;  5IOL A;  2IUC B;  2FIU A;  3CCV S;  4F3O A;  3MEG B;  2DR7 A;  4QW8 A;  2Y0B B;  5HAT A;  1BHN A;  1D9F A;  2WSF C;  2HEK A;  1S9G A;  3V5R A;  2EC2 A;  5H9F J;  3NNC A;  2VDI A;  5K14 A;  4NXM F;  3Q8V A;  3C3L A;  2WVD A;  3CVK A;  2GA3 A;  1UL3 A;  4RUC A;  4QR2 A;  3FCW A;  5L1I A;  4M5N A;  3D6T B;  3UFC X;  1SCJ B;  2YNI A;  4QPT A;  3KMQ A;  3QT8 A;  2EFN A;  2EG2 A;  3JQJ A;  3H5U A;  5L0B A;  2MQM A;  1RAD B;  2UUC J;  2UZA A;  3RR8 A;  3GYX B;  1RU1 A;  2BAB A;  3DLG B;  4DMZ A;  5C2G A;  4DL4 A;  2GJI A;  1NDC A;  3IM9 A;  2J6U A;  3TA1 A;  4ILR A;  4U67 Q;  3TVK A;  1ELZ A;  5LMU J;  3BSC A;  2DPI A;  3PY8 A;  3QGH A;  1SJQ A;  3OVB A;  1EJJ A;  5J2N B;  3R5D A;  1HNV A;  1ZZN A;  3MCN A;  1BQX A;  2AGP A;  2CA9 A;  4HAC A;  2JZ5 A;  2X1B A;  5HJY A;  3IC1 A;  5IZH A;  1CQM A;  5K20 B;  3OW2 R;  1VQP S;  3TG0 A;  5K9F A;  3OJS A;  3QWU A;  2DIV A;  2VAS A;  3T02 A;  1WC5 A;  4DL5 A;  4PQA A;  5FII A;  2NLW A;  3OVA A;  3VGU A;  2AKW B;  1VI7 A;  5EGY A;  3N4W A;  1S59 A;  1WD6 A;  5J2P B;  2ZBI A;  2E5J A;  1YLX A;  2AJ1 A;  4M1K A;  2O66 A;  1KQK A;  4QWB A;  4JUZ A;  5HRO A;  2Z2Z A;  3KJN B;  3AB2 B;  3Q8P B;  1FRK A;  4KV8 A;  4YR0 A;  2ZZM A;  4ED1 A;  3F41 A;  2KRR A;  3P3D A;  3OSP A;  2R8G A;  5I3U A;  4ZLN A;  2VF3 A;  4PRF A;  3PJX A;  3MUR P;  1S0N A;  5HAN A;  3BPS P;  1EX8 A;  4ECR A;  4DR1 F;  1MLA A;  3U1N A;  3GQC A;  3WX8 A;  1YX2 A;  2HS3 A;  3DRR B;  2B8P A;  4Q44 A;  5I3Q A;  2DGT A;  1X4A A;  3GFY A;  4ZN3 A;  3R2C J;  1RAB B;  4WU2 A;  4DV4 F;  3MCS A;  1IBL F;  1TMM A;  4ATN A;  1HWJ A;  1W25 A;  4LF9 J;  1TL3 A;  2DHA A;  2W5V A;  1ALK A;  4JI7 J;  2LU2 A;  2Z57 B;  4X64 J;  1SKS A;  4MKV A;  5GMD A;  2VPX B;  3PFE A;  1XK8 A;  1U2C A;  1NK8 A;  3RRK A;  2AYB A;  1U6Z A;  3T3F A;  3FMB A;  3QZ8 A;  4MAK A;  4S0M A;  1MSW D;  1F6T A;  1E33 P;  1SKR A;  3ADA C;  3ENQ A;  1U25 A;  1FXL A;  5DS7 A;  3A8J A;  4OZ5 A;  4XAK A;  3H42 A;  2COL A;  2BDP A;  1M5S A;  1TEL A;  4O0I A;  4WJB A;  3OJU A;  3DI6 A;  3UVJ B;  1XWL A;  2CWK A;  1ARO P;  4YQW A;  2R8J A;  2OSQ A;  1KEK A;  2DO4 A;  3N5F A;  3TI0 A;  4CYR A;  2J76 E;  5HRT A;  5EWF A;  4GO7 X;  4PWD B;  1R27 B;  1FKA F;  2GGP A;  1Q16 B;  3DU6 A;  4KKO B;  5INH A;  1VQM S;  1N32 J;  1VQ9 S;  3ITH A;  3POT A;  4QYZ K;  4I2Q B;  2E1R A;  4OQJ A;  4BC7 A;  2HVH A;  1EB0 A;  3IRX B;  1QVF R;  4USJ C;  2A10 A;  2JEF A;  2E5L F;  1TKX B;  4P52 A;  2XO6 A;  1GNK A;  1RT5 B;  2ZHA A;  4B08 A;  2B0G A;  3AD9 C;  4P6Q A;  1FSU A;  2Y8Y A;  2HK2 A;  4DQP A;  3HO1 A;  1KC8 T;  4ZCL A;  4DJB A;  2E5G A;  1YRT A;  1XMO J;  4NLO A;  3TZW A;  1U1O A;  8RUC A;  2HFN A;  3KUH A;  1X31 C;  1T8E A;  1JXV A;  1EET A;  2BYC A;  3NG8 A;  2VD3 A;  4H4O A;  1BMQ B;  1S1U B;  1DLO A;  3V4I A;  1KLN A;  4ES1 A;  3RAQ A;  3AH6 A;  4GVB A;  2PI4 A;  4AL5 A;  4X4O A;  3R7B B;  2M4M A;  4ZA1 A;  2F4F A;  1F2G A;  2DD8 S;  3QGP A;  4I0W A;  3TJA A;  1R3N A;  5E2Q A;  3LGM A;  2D3U A;  4M8L A;  3E51 A;  2VG7 B;  2C2E A;  3BBC A;  4CLW A;  4OHV A;  2DGS A;  2HS0 A;  3TZX A;  1VC5 A;  2W25 A;  3CUL A;  3I55 S;  3W65 A;  2QSW A;  5JVH Q;  3MAQ A;  2W2O P;  2FJX A;  1YGY A;  3EX7 B;  3W3S A;  3DRS B;  1TK0 A;  4G6V B;  2UXB J;  2MKI A;  3MCO A;  4OX6 A;  1FO1 A;  4DL7 A;  2DH9 A;  4CLS A;  1ZAV A;  3VGV A;  1AB8 A;  1L5U A;  3UD5 A;  3Q24 A;  5D8H B;  3R5J B;  1JJH A;  4YEA A;  3OTB A;  1LWC A;  3DDN A;  1RJJ A;  4QWE A;  4OI2 A;  4FBU A;  1SJ3 P;  4K4W A;  3R1H A;  3HT3 A;  1UVK A;  3C6U A;  5T7L A;  2V5H G;  3TP2 A;  2SXL A;  1WKJ A;  3MM6 B;  2BAC A;  4EUV A;  3HVT A;  4R8U A;  3WIU A;  3PFO A;  3OR2 A;  3AOB A;  1FD8 A;  1URB A;  4EWT A;  5U47 A;  1EI6 A;  4ZVQ B;  3A52 A;  4NLT A;  4LSL A;  1U1P A;  1RWM B;  3PRD A;  1VQN S;  2HMI B;  1UZD A;  2XSJ A;  1N5V A;  2MGZ A;  5ETM A;  1P49 A;  1K1Q A;  2FZG B;  1EP4 B;  3K5L A;  4RBT A;  2AHO B;  3SCK E;  3LO3 A;  3FCV A;  1UWA A;  2ASJ A;  2KL8 A;  1PKU A;  4MIV A;  1H7W A;  2M3D A;  4KHP J;  6AT1 B;  4P2F A;  2ZNY A;  4OHW A;  2HQI A;  2VPW B;  1YBA A;  3FSI A;  1VRT B;  1S0V A;  1NKB A;  1E6V A;  1ZEB A;  5BR8 F;  4OI1 A;  3R9L A;  4LF2 A;  1LW2 B;  3DM2 B;  3EPG A;  4ID8 A;  1YHQ S;  3R1L A;  2AW0 A;  1W26 A;  2CRL A;  4WU3 A;  4RU9 A;  3G82 A;  4DR6 F;  2GX8 A;  4ANC A;  1N0U A;  3WX4 A;  3BPD A;  1FJC A;  3M32 A;  4OJ3 A;  2AJ4 A;  2EC0 A;  3BBF A;  5D0G A;  4RUA A;  5I3P A;  2QLW A;  1NJI T;  3EGW B;  2ASL A;  3M1V B;  3LWL A;  2IC3 B;  3M6W A;  2AD9 A;  4HHU A;  3TQE A;  1MRO A;  3PJ9 A;  1N52 B;  3BYP A;  4J90 A;  2X7I A;  1RAE B;  3TJ9 A;  4FXW A;  3RU0 A;  3Q8S B;  4DV6 F;  4ZPW R;  1CC8 A;  1HMV B;  2W9A A;  4F50 A;  2GW8 A;  4KO0 B;  2ZZN A;  2GNK A;  2IRU A;  4MKY A;  4DR1 J;  3GCX P;  5KFH A;  4BHQ A;  3I5A A;  3AD7 C;  4DN0 A;  2Q66 A;  4QAX A;  2ZBQ A;  3MWB A;  3HLU A;  5JVG Q;  4KGK A;  1IJE B;  2CQH A;  4XPC A;  1L3T A;  4WFZ A;  4DX5 A;  3DRP A;  4NYP A;  3D68 A;  3OHB A;  4DV4 J;  2EFP A;  2UUA J;  1U09 A;  2PA8 D;  3HHL C;  1FRI A;  5AXM A;  1U0H B;  1XR5 A;  2FYX A;  4ZVH A;  2RRB A;  4ZCM A;  3GIL A;  2IFX A;  5KG5 A;  1VQO S;  1X4D A;  3M8W A;  4NLG A;  4MHX A;  2QL9 B;  3QWP A;  3O5T B;  2HHU A;  5E3R A;  1UEU A;  4ZVT B;  3D54 A;  2HK3 A;  1T02 A;  1F5C A;  2ZE2 B;  3ET6 B;  2BMB A;  3MK0 A;  3EZ5 A;  2VBY A;  1UWB A;  3JSY A;  2YKN B;  2JEG A;  1XR6 A;  3NGK A;  1VQ6 S;  3CJ2 A;  2B4O A;  1A0O B;  4MK9 A;  2EPI A;  2YBV A;  3J7Z T;  1AUK A;  1RT4 B;  1GMW D;  2J0X A;  1HHS A;  2WBR A;  2HQ3 A;  3PKM A;  4ES2 A;  3MM5 B;  4Q2L A;  2ROG A;  2MKY A;  1SUQ A;  1QAI A;  1IKW B;  4U7U D;  3ILJ A;  3BO2 A;  3HJF A;  2EFO A;  3UPF A;  3CCU S;  3M2V A;  1J5O A;  1Q78 A;  1VHI A;  3NBP B;  4MYT A;  1ED9 A;  1P9Y A;  1HD1 A;  2YXL A;  1DTT A;  3P4U B;  2BJD A;  3LQV A;  4DPU A;  3MR3 A;  3BZQ A;  2V4J B;  1IM4 A;  4JP8 A;  3TR5 A;  1RU2 A;  4F8R A;  1R0A B;  3E2E A;  4TYB A;  1FRM A;  4JI5 F;  2AF6 A;  4O44 B;  1YTY A;  4AYB D;  2FC9 A;  3VAM A;  4C8K A;  3PV8 A;  3BM7 A;  1YRU A;  3CCQ S;  1SH3 A;  1MU2 A;  4NLU A;  2A6O A;  5KFY A;  4EO6 A;  1FKP B;  2I2Y A;  1CS4 B;  5G0R A;  1WF0 A;  4JI2 J;  3T1H F;  1M5O C;  5L0E A;  1RK8 A;  4J91 A;  1XMQ F;  1HNZ J;  1AUS L;  3HI9 A;  5K4P A;  3BSO A;  3CDU A;  4IO1 A;  1NK0 A;  3KHL A;  4UOC A;  3IBW A;  4HHH A;  3R5C A;  3IRW P;  4O3Q A;  3I5B A;  5ETR A;  3U02 A;  1S6Q B;  2PC6 A;  5BYR A;  2M5Y A;  1G3O A;  2H4Y B;  2ZBR A;  3C14 A;  2UVV A;  3HHL D;  2XWX A;  4U9R A;  2JH3 A;  4OYX A;  2C28 A;  2U2F A;  2DR8 A;  3QT5 A;  1VR6 A;  2DT9 A;  4LF7 F;  2PMH A;  1H2U X;  5CXT A;  4FYV B;  3H8Y A;  1Q1K A;  4DR2 J;  3GR1 A;  4WKR A;  2M2B A;  4UUW A;  3EWG A;  3M8S A;  3CMQ A;  1PBU A;  3NKO A;  3J81 Y;  2BJE A;  4CXU A;  1C0U B;  3P6Y C;  3IGZ B;  5ETN A;  3ISZ A;  3HPO A;  4LRE A;  3I82 A;  3J7A 1;  3LP2 B;  3FBE A;  1LK7 A;  2V8H A;  3OHA A;  3W66 A;  5AE3 A;  5C42 A;  4RPF A;  1N34 F;  2YY3 A;  3O44 A;  5HP1 A;  4FF1 A;  5F9L A;  3NGR A;  4JI1 F;  5L0K A;  2FVQ A;  2Q79 A;  4ED6 A;  3G8T A;  5L39 A;  3C46 A;  1RTZ A;  3SV4 A;  1T9X A;  4B9L A;  1AW0 A;  1FRL A;  3KUE A;  3TUJ C;  4ZHR B;  2IVF B;  5IT9 U;  3O3L A;  4RW4 B;  5J2M A;  1VK3 A;  1HNI A;  4DV0 J;  2B7B B;  1HI8 A;  4RLE A;  4OHY A;  3W5Z A;  2LKZ A;  2N7Y A;  2XMJ A;  1FVQ A;  5T14 A;  2GSN A;  1RWO B;  1KHV A;  2ZEJ A;  4M5H A;  4GKK J;  2W4P A;  1IKY A;  2KFY A;  1N2L A;  1U0S A;  1EW2 A;  2GCF A;  5BXI A;  2EFG A;  3EXY A;  3C15 A;  1TFW A;  1CSJ A;  1PC5 A;  3WAX A;  1HDH A;  3PRB A;  3SMZ A;  5HJX A;  2C2K B;  5KFC A;  4JBC A;  2DVI A;  3W63 A;  1QUP A;  5BYQ A;  2J9E A;  4DR4 F;  2WAQ D;  2MZT A;  4N47 A;  4KSE B;  5B0C A;  4ZS6 A;  2H51 B;  2HKE A;  1Q53 A;  3W2W B;  1H38 A;  1N5Q A;  1FWP A;  2QYC A;  3EYZ A;  2NZC A;  3HHL B;  1B0P A;  2FTR A;  5IQQ A;  2W5X A;  3L7P A;  3AA8 A;  5GAH U;  3C16 A;  4QBU A;  1U24 A;  3HSJ A;  1YDL A;  3S01 A;  4ECS A;  4Q5V A;  2CQP A;  2XS2 A;  2FVR A;  3BSN A;  5J1N A;  3EGN A;  5IFM A;  1A6L A;  1IN0 A;  1WSV A;  4MYU A;  2HHH F;  1LW0 B;  1YZ7 A;  4YFU A;  2HGL A;  4ZVF A;  1LWX A;  3UI3 A;  3W62 A;  1UZH A;  2OPQ A;  2GSO A;  3EVM A;  4W92 B;  1KQG B;  1K0V A;  3K5P A;  3G86 A;  3TNV A;  3CCT A;  2RDD A;  1IUJ A;  2FHJ D;  4FYD A;  1WAC A;  4Q7A A;  5D78 A;  4AD6 A;  4ZIV A;  2GHW A;  4CLF A;  2FJD B;  2FVP A;  3WIV A;  1FK9 B;  5KFV A;  3JSM A;  3ZNU A;  2CAJ A;  4I67 A;  2DNG A;  2WB1 D;  5KT6 A;  2RKI A;  2DNR A;  4MFB B;  3DLJ A;  4QOT A;  3N28 A;  2FJA B;  3JS9 A;  3MOZ A;  5H9F K;  2BKN A;  2HND A;  4B3R J;  4RL1 A;  1EHW A;  4QU6 A;  1LEO A;  1XNR F;  2W9C B;  3NAH A;  3IO1 A;  3V81 B;  3I4P A;  2DRA A;  2JVO A;  2UUT A;  4OLP A;  1WKL A;  3OL6 A;  4GMK A;  1F9E B;  2BJ3 A;  4O3N A;  1X4G A;  2WSC C;  3CCJ S;  5CHC B;  2QA4 S;  1FHT A;  1WI6 A;  2HS4 A;  3GWC A;  3W9H A;  4NA2 A;  2OPP B;  1SB6 A;  1ROF A;  3W9J A;  2AX0 A;  3QLH B;  5LSO A;  2HNZ A;  2CG4 A;  1SHQ A;  4ZJO A;  4F4Y A;  5HL7 Q;  1HJK A;  1R8C A;  4CNZ A;  2G2Z A;  3QRQ A;  1T9W A;  2V8G A;  2BV3 A;  3KLG B;  1F60 B;  3A8K A;  4CDI A;  3DOL B;  3CME S;  1YRX A;  3O6Q A;  4RWX A;  1KH9 A;  1BQM A;  5KT2 A;  3VQT A;  3PEH A;  3D6F B;  4H4M A;  2CKW A;  2BQ3 A;  1WUU A;  3A1Y G;  4RW9 A;  1Y7P A;  3M4X A;  1I94 J;  5D4N A;  2HBY B;  3P5B P;  2HHT A;  4PZV A;  4A8Q A;  2X3G A;  3TZZ A;  2HQC A;  2V94 A;  2AIR B;  3D0G E;  1NRK A;  1HHQ A;  4LR9 A;  4MK8 A;  2LXI A;  4ZVE A;  5KFA A;  1TVR A;  3ZXW A;  1MMN A;  2VB6 A;  4OZN A;  1QDU B;  3GII A;  3R97 A;  2MY7 A;  2FQQ B;  1T03 B;  2ZUG A;  4Y2C A;  3EUN A;  2JVR A;  2MMY A;  5DG7 A;  4X4Q A;  3T1H J;  4IQM A;  3GIM A;  2BVZ A;  3FGV A;  4LQY A;  2ZH4 A;  5CYQ B;  4HH0 A;  3QAE A;  1ZM2 A;  4F4W A;  3DYA B;  1TTH B;  3DDI A;  1HWK A;  3QID A;  4LVN P;  5EGE A;  2L9N A;  4QW9 A;  3MDF A;  5JXS A;  3NNH A;  4B3M F;  2OEK A;  4ED0 A;  2AZ3 A;  1FFS B;  2HZV A;  4ZCI A;  2IM1 A;  2ILZ A;  4X4U A;  4CLK A;  2NZ4 A;  2RU3 A;  1RT2 B;  2ZHO A;  1NSK L;  1FXD A;  1BXN A;  3T5L A;  1RTJ B;  2V9K A;  3A4T A;  3HF5 A;  5F3T A;  2LA4 A;  4DUY F;  3PIO Q;  2F4V F;  1RTI B;  4HT7 A;  4LF7 J;  1SJR A;  4NYO A;  2P9C A;  3Q8Y A;  1PAU B;  2KHD A;  1VMB A;  1HQE B;  2K7K A;  1W7W A;  1NSQ A;  4G1Q B;  1YJW S;  2BX6 A;  1B64 A;  4Z37 A;  2GQQ A;  4FF3 A;  2ZIT A;  2UV8 G;  4M94 A;  3D6M B;  3HHD A;  1Y5L B;  2B6A B;  3LF0 A;  2L41 A;  4NZ6 A;  3CCS S;  2R2S A;  4B3O A;  4M5G A;  3BGO P;  2W2Q P;  4ZPD A;  3SSS A;  2E7W A;  1YBU A;  3FNN A;  1N34 J;  3BO4 A;  1VQ5 S;  1NHU A;  3CWJ A;  4NPO A;  1G7C B;  4NI2 B;  3RBX A;  1HPZ A;  4DLE A;  2J6S A;  1CJT A;  2I6W A;  1NJX A;  1AJC A;  4PWW A;  3CDA A;  1CVJ A;  3IR6 B;  2H9Z A;  3W1Y C;  1QSY A;  2ASY A;  4YB6 A;  1VYA A;  2YWW A;  3R3T A;  2XYP B;  1HNX F;  2AU0 A;  3UDE A;  2AYM A;  5KFS A;  2CQI A;  3H40 A;  4ICL A;  2CAD A;  3MTJ A;  2FPH X;  1ZM9 A;  3W61 A;  3JAM Y;  2HZA A;  2H5I B;  3CTR A;  4LRD A;  1WNE A;  1E2S P;  1RB0 A;  4LBH A;  2HGN A;  2KT5 A;  2QSF A;  2RS8 A;  3VGS A;  1IR0 A;  1MN7 A;  2DNP A;  4QQB A;  3QYY A;  4JV5 F;  5C66 A;  4TN0 A;  4P2S A;  3HT0 A;  4TLR A;  3N01 A;  3KDN A;  2MHN A;  2OPS A;  3OT9 A;  5CYM A;  1FFW B;  1U45 A;  4K0K J;  2GQ2 A;  3CCW A;  4GVL A;  2W9B B;  4DWI A;  5CD4 A;  1PG5 B;  1RT7 A;  3TVY A;  3I0S B;  1X5T A;  4PPZ A;  3TX0 A;  5DZ7 A;  3QJJ A;  2XNQ A;  4TVA B;  3MHY A;  4W98 A;  2Z2M A;  2RML A;  4NWJ A;  2GML A;  4F02 A;  3IS9 B;  1SI9 A;  4ZP7 A;  1JMT A;  1IBC B;  3CGI A;  5T41 A;  4CNY A;  4DL3 A;  1O5J A;  1HBO A;  3CDE A;  4WE1 A;  4WCE Q;  1URN A;  2GA7 A;  3KNG A;  4YHH J;  3LTO A;  3BDH A;  4O4G B;  3VTI A;  3MFH A;  1YJN S;  2XM3 A;  2V69 A;  2R8I A;  4FYW B;  3SCJ E;  1RAA B;  1IWA A;  4KGZ B;  3M30 A;  2KU7 A;  4UQG A;  3DYC A;  2B9X A;  3L9Z A;  4HTJ A;  2YNH A;  2R7T A;  2GVZ A;  3MM8 A;  3RYL A;  1F0X A;  1UJ6 A;  2K06 A;  5KFQ A;  2B9Y A;  4F4X A;  4WK3 A;  1TZ0 A;  5E5N A;  1Y9O A;  2FJV A;  3ZNJ 1;  4A8Y A;  2HNY B;  2EKY A;  3OFH A;  4QWA A;  4IUF A;  1DRZ A;  2GO8 A;  4WII A;  1JLF B;  4KHR A;  2XMA A;  2PEB A;  1D0E A;  4ELT A;  1OY8 A;  1S1X B;  4DBQ A;  3HZG A;  2DNL A;  4KFB B;  1IR2 A;  1IBK F;  5EDW A;  1J27 A;  4F4Z A;  4Q43 A;  2MQ8 A;  1KHK A;  3QRP A;  1NJW A;  4GC7 A;  1YK9 A;  4B17 A;  2VG5 A;  5CCL A;  2B5J A;  4RW7 B;  4JI4 J;  4CCH A;  1C0T B;  3KG0 A;  4I6W A;  1ACM B;  2YH0 A;  2J0Q D;  4DR7 F;  4UOG A;  5LJ3 Y;  1EQ0 A;  5A2Q U;  4UPH A;  2JL9 A;  3D67 A;  4G65 A;  4QWC A;  5A76 A;  5D6G A;  2MKH A;  3LP0 A;  2DNO A;  3IWL A;  1TV6 A;  4ZPV R;  4FXV A;  5HQL A;  2M9K A;  1TL5 A;  1RCO B;  3IG1 B;  3SYZ A;  4KGX B;  1FNO A;  2GZO A;  2BEF A;  1V3R A;  2RHS B;  1A9N B;  2WVE A;  2I9S A;  2CPX A;  1GX6 A;  3V4M A;  1RYR A;  1HBN A;  1NSP A;  1Y6V A;  5HLF A;  1YJR A;  1U26 A;  2FB0 A;  4LF4 J;  3D3B J;  3H5X A;  3DOK B;  1LQ9 A;  5HVH A;  4GTZ A;  1T3O A;  1JKH A;  5FDL B;  4YN3 B;  2W7P A;  1UVN A;  4CO3 A;  4Z2X A;  4BDP A;  1RKI A;  3GJR B;  2J9D A;  1QD1 A;  4J9N A;  1YJT A;  2XZD B;  1S6P A;  3EE3 A;  2WSE C;  2OHD A;  2F1F A;  2QJ3 A;  4DDF A;  3NWR A;  3RR7 A;  4A8O A;  1RWK B;  4PG8 A;  3JSR A;  5G4D A;  5GAH I;  3OVS A;  2ZKT A;  3MM7 B;  2DBB A;  1C1B B;  4F3M A;  1F9F A;  1DAX A;  1T9T A;  4CLT A;  2A3J A;  2PI5 A;  3G4S S;  3MR5 A;  1TAU A;  3I0R B;  2UUB J;  3ENV A;  3J7Z 5;  1F5B A;  3FUY A;  3PDN A;  5EUH A;  2XZW A;  1S1V A;  2EW9 A;  3ZZP A;  1UET A;  2ZH2 A;  3CC2 S;  4DUY J;  2F4V J;  2WON B;  3BDG B;  3K5O A;  2WW4 A;  1NND A;  1RAG B;  3RG6 A;  1KWM A;  4A8M P;  3VWS A;  3HMJ G;  1X9M A;  1KHL A;  5DLT A;  2I5J A;  2YNF B;  5HMW A;  1FRH A;  3QO9 B;  2EEY A;  3H0P A;  3PW0 A;  2KM8 C;  4LF5 F;  4IDK A;  3CNQ P;  4N7T A;  5C24 B;  4CH0 S;  3MF5 A;  3Q83 A;  2VBX A;  4RNO A;  3OL8 A;  1M5P C;  3DHX A;  1M1G A;  1JLA A;  4NLV A;  2CQ0 A;  3MPY A;  5DLG A;  5IV3 A;  3GIK A;  4YB5 A;  1I51 B;  5KT7 A;  1AZS A;  4YY3 F;  1RWN B;  2FC8 A;  1R8P A;  3FK4 A;  3RB3 A;  3PIP Q;  4NMX A;  4ES3 A;  1VQ8 S;  1ALI A;  3J80 Y;  1KOH A;  2I0X A;  1ED8 A;  4M5I A;  4HHJ A;  4CTA B;  2QMX A;  3FFI B;  2QLX A;  1V6H A;  4WWS A;  4DCP B;  1SJF A;  2XYH B;  2R8H A;  1RT5 A;  3BH6 B;  1Y5N B;  3CD6 S;  2VQF J;  3PR4 A;  4ECT A;  4DV3 J;  2FJW A;  3NKP A;  4K8R A;  5K5M A;  1S7I A;  3QSY B;  4OZ3 A;  2CQ2 A;  4USM A;  1WTF A;  3RW6 A;  2CJ9 A;  1PYS B;  3N6N A;  3HX9 A;  1DQ8 A;  3IXQ A;  4CH1 A;  4OHX A;  2C2D A;  4EMD A;  2MLY A;  4OJG A;  2ZBP A;  4ZIT A;  1CJK A;  2M70 A;  3OD2 A;  3BO3 A;  1FJG F;  3H4D A;  2P2C B;  5LRM A;  4DR3 F;  1P27 B;  4UF4 A;  1WHV A;  2A2D A;  1SHN A;  1C1C B;  1O6X A;  5B0G A;  5D0R A;  4UPK A;  4Y2A A;  4Z7C A;  2HG4 A;  2M7S A;  2MEW A;  4IRK A;  2ZM6 J;  3P45 B;  2UXC F;  1Q86 T;  2OD6 A;  2CJX B;  2J9D E;  3IP0 A;  5B0F A;  3UD3 P;  2A0F B;  1RTD A;  4DF4 A;  5E3A A;  2K3I A;  1VLY A;  1XNQ F;  3P49 B;  2OUG A;  4ECW A;  1RT1 B;  1ZZF A;  3DRS A;  5M2R A;  3M6U A;  1X5S A;  5H9E K;  5J2Q B;  3L3C A;  1YKW A;  5L38 A;  1K47 A;  3IGV A;  3CDB A;  4J9L A;  7AT1 B;  1O99 A;  1IBM F;  4CO5 A;  1FRX A;  2W24 A;  4BCA A;  2Z2Y B;  5HBM B;  5AE2 A;  3M8Q B;  1CJU B;  5KG3 A;  3RBE A;  3M9O B;  1S1W B;  2VQE F;  2FVC A;  4CT8 A;  2PMW A;  1BQN B;  3L7O A;  3RZA A;  4M5D B;  4CM0 A;  1XER A;  4IFV B;  1H2T Z;  3JYT B;  4DR5 J;  4I6A A;  1E6Y B;  1KFD A;  4ZIW A;  4DPT A;  1N56 A;  1S4F A;  4K4X A;  4WBF A;  1QUV A;  5J1E A;  3CED A;  1NH8 A;  5CZX A;  3X1L B;  3KK3 A;  5KT3 A;  4DV5 F;  4ED3 A;  1KN6 A;  3UN3 A;  2DRD A;  1S1T A;  2HVZ A;  3TX8 A;  1VRT A;  1VRQ C;  4Y3C A;  3FQL A;  2VJU A;  1HD0 A;  4UOR A;  5J1P A;  1UVI A;  3C19 A;  5K14 B;  4I4B A;  2XY5 A;  1GQE A;  2NQP A;  3DM2 A;  5IC4 B;  3BDP A;  2HLT A;  1OS5 A;  1X9W A;  3IWN C;  2GIF A;  2B8Q A;  5F0U A;  5EHH A;  5JMN A;  1Q5V A;  2YNI B;  4RNN A;  2BZ2 A;  1OIA A;  5DG9 A;  4A46 A;  5AXN A;  1FD2 A;  2KHC A;  3MM9 A;  2K8G A;  3UW1 A;  3CC7 S;  1X4E A;  4LQ3 A;  2AJF E;  2BJ8 A;  1RWX B;  1HBM A;  4EBC A;  5LXY A;  3ZZZ A;  3ETM A;  3TQ1 A;  2YKP A;  2D9P A;  3H2L A;  3FEX B;  3W7B A;  2ROP A;  4Q0B A;  2FZC B;  3CJT A;  5E7O B;  1YVF A;  2O3D A;  3VAL A;  1ZS6 A;  1AA1 B;  1XN9 A;  1EKR A;  3IM8 A;  1N6Q A;  4KGV B;  3K8V A;  4XO0 A;  1N33 F;  3Q8U A;  1UP1 A;  3NOC A;  2KM8 B;  1UW9 A;  2BM1 A;  1HNV B;  3US5 A;  1M5V C;  2Y1R I;  4I68 A;  4HAC B;  4LFA J;  1X5P A;  1FCA A;  2JDJ A;  5IXU A;  4ELU A;  2X1F A;  4Y0F A;  4FN5 A;  3FBC A;  4I2P A;  3KTQ A;  1OY6 A;  2P9E A;  3F44 A;  1OQ3 A;  2VPZ B;  1C2P A;  4I7F A;  4NLY A;  4IRD A;  4YP3 A;  3WAV A;  4RW6 A;  2YX7 A;  4KB7 A;  4B9V A;  3GFX A;  3MGJ A;  1U0H A;  4WFN Q;  3SFU A;  4FNI A;  3NWG A;  3DDK A;  2ZWP A;  1H3D A;  4DU7 A;  3WBH A;  3GSI A;  2R7U A;  3KFW X;  3PCO B;  4DV1 J;  3D66 A;  3ED4 A;  5HRO B;  2RDI A;  1M1K T;  3ISN C;  2NYI A;  2ATC B;  4KV8 B;  1IXK A;  1N5Y B;  1N36 F;  1B0V A;  2ZDO A;  5I3U B;  2CPF A;  2NXC A;  2X3D A;  5A8W B;  1YG0 A;  2YKM A;  4DCJ B;  2F65 A;  1FF2 A;  2XLI A;  4ZP9 A;  1AUD A;  1WC4 A;  4IRC A;  1HNW F;  3CO0 P;  4FF4 A;  2NR0 A;  1RT4 A;  4C3K A;  2B9W A;  3AOC A;  2F8M A;  4C8N A;  2W8D A;  1N88 A;  3MM5 A;  3CDW A;  2WBM A;  2N82 B;  2WTF A;  2QTW A;  4NEZ A;  1ULR A;  3R6L B;  4K2J A;  3AOD A;  1VDH A;  3A8E A;  4PG5 A;  3T9Z A;  3WAW A;  2K2P A;  3KK2 A;  1VHF A;  3AQO A;  1TL3 B;  4FYX B;  5MAO A;  3G96 A;  4YY3 J;  3MEE A;  4OYB A;  3VVU A;  3LUY A;  1FA0 A;  4K4S A;  4KE5 A;  4DXL A;  3GG0 A;  4PYD A;  2CZ4 A;  1ZPW X;  3QZ7 A;  5KFX A;  2BAN B;  4IH5 A;  3W8G A;  2HAI A;  4YR2 A;  2DXD A;  1KVJ A;  5GAG U;  1K9M T;  2BUN A;  2MDA A;  4GRS A;  1ELO A;  3KHG A;  2R9L A;  4XTT A;  2D3O 1;  4WYW A;  1ICE B;  2DGU A;  4RBU A;  2VOO A;  5AXK A;  5DM6 Q;  1CS4 A;  2CPZ A;  2KB2 A;  2F40 A;  4Q8E A;  1ZTW A;  2ZH3 A;  4ZN1 A;  4KTQ A;  3DI6 B;  5HK4 A;  4DUZ F;  4L74 A;  1IKX A;  1SL1 A;  3UDC A;  1VOM A;  4FZV A;  4P10 A;  4OZL A;  1V5I B;  1TL1 A;  1RT3 A;  1BD6 A;  3NCP A;  1JIH A;  2ZJQ Q;  4FS2 A;  5A0Y A;  2DEI A;  4BBY A;  3GON A;  1TP7 A;  2MQP A;  4KJG A;  1FJG J;  5LT5 A;  1H74 A;  4AL7 A;  3ITH B;  3POT B;  3PHE A;  1PIL A;  4LFC F;  1WEZ A;  3RUB L;  1YWX A;  3ISN D;  3Q0A A;  3ZZR A;  2H4W B;  1FE4 A;  1NPR A;  3NY0 A;  4IG3 A;  4ZPC A;  4X66 F;  3L4B C;  4K4T A;  2ZOG A;  3JQK A;  1SH2 A;  3CCE S;  2ZC3 A;  3D0I E;  1KS2 A;  3A3N B;  2KYX A;  3MZI A;  3AOA A;  2ZHB A;  4DFK A;  3NEK A;  1HL6 A;  2HLU A;  4OHZ A;  2RIJ A;  2VPY B;  3LP2 A;  1SKU B;  1GMW A;  3DPC A;  4MKB A;  1X7V A;  4KR0 B;  2RRN A;  1EET B;  3MPD A;  3HHK A;  2BJ7 A;  1YJU A;  1S72 S;  4H4O B;  4X4V A;  1U48 A;  3WDO A;  3LA0 A;  4LFB F;  1SVD A;  3V4I B;  1BWE A;  5C2C A;  4NOH A;  1VRU A;  2CQB A;  4GVB B;  3RRG A;  5DJB A;  2ZUA A;  4O3R A;  1NAQ A;  3PM9 A;  3KLF A;  3GJT B;  5B08 A;  1RBO B;  1X5O A;  5A8K A;  4C0H A;  3M8R A;  1LFW A;  3KHH A;  1RAJ A;  5K8O A;  4X62 F;  2OEL A;  4J9P A;  1ZED A;  3UDL A;  2H5E A;  4NCG A;  5FD1 A;  4DV2 J;  2R7O A;  4EBE A;  2XI3 A;  3GSD A;  4BLG A;  3K2Y A;  5LQQ A;  4UOO A;  2E7X A;  1TL7 A;  4OYP A;  2UVW A;  4O0N A;  3TAM A;  1S49 A;  3GZ7 A;  5B0B A;  3R6G B;  4DV5 J;  1KVK A;  2XO7 A;  2KT2 A;  3B4D A;  4M5L A;  5L1K A;  1AFJ A;  3THP A;  4HEA 9;  5HQ8 A;  3NMA A;  4NRU A;  2NSB A;  1UAW A;  1FDB A;  3QGG A;  1LWC B;  4CYU B;  2CPJ A;  1BWV A;  5KG7 A;  1HKA A;  2KVI A;  3MUV P;  2M8H A;  1WWH A;  2RDJ A;  3UCG A;  3BDE A;  4JYA J;  1S9F A;  5T7L B;  2IAJ A;  2XCP A;  4OYW A;  3MK2 A;  4NZ7 A;  3NKR A;  4WXW A;  3W9I A;  4OZ0 A;  3OR2 B;  3HHL A;  4A47 A;  3ZTP A;  1FJE B;  5FLX U;  4LSL B;  5CCM A;  3LP1 A;  3DLE B;  3H20 A;  3NS6 A;  4N77 A;  2ZH1 A;  3ENW A;  4PYA A;  2POK A;  2XSJ B;  2MGZ B;  2HBR B;  1SIW B;  1CQN A;  3CD5 A;  3OR1 A;  1TKT A;  2HW3 A;  5AJ9 A;  3GIR A;  3C6T A;  2BOA A;  3BR9 A;  4ZLP A;  2RVJ A;  1QSL A;  3T6J A;  4ID5 A;  4J5O A;  2QYG A;  3I6P A;  1PJ7 A;  3RB4 A;  2IM3 A;  1E6V B;  4DEZ A;  2R42 A;  5L9X A;  4TY9 A;  5F0W A;  2GIR A;  3MEC A;  3HP6 A;  3G2X A;  3TRG A;  2EFQ A;  2B9E A;  4WFY A;  2G2O A;  2XMM A;  3DC2 A;  4ED2 A;  1RYS A;  4IH7 A;  1MWQ A;  3G82 B;  3V6H A;  4EK2 A;  1O0P A;  3UNG C;  4B9T A;  2GQC A;  2D41 A;  2AX1 A;  2DEJ A;  3DLL Q;  2CDQ A;  5ETV A;  1X0P A;  4U96 A;  1ZA2 B;  4C11 A;  2HWH A;  3U1L A;  3GV7 B;  2J8S A;  2ZVS A;  2IYG A;  1PAE X;  3GJS B;  2DTJ A;  4JI6 J;  2PN6 A;  1L3S A;  4EU0 A;  5CZV A;  1NKE A;  3KJV A;  2V2K A;  1MRO B;  4X84 A;  4PR6 A;  3ZTQ A;  3ICL A;  1C4C A;  1FVS A;  3ULH A;  2OJ3 A;  4DU8 A;  1HI1 A;  4X65 F;  3CJK A;  1U1M A;  3K8W A;  2W5R A;  2DH7 A;  2ZWO A;  3R5B A;  3DFE A;  4FVM A;  4HI1 A;  2FDN A;  3BF4 A;  4LF1 A;  1D3W A;  1GFW B;  1N5T A;  1RT6 A;  1MWY A;  4ZLL A;  3CT9 A;  2V6A A;  6FDR A;  3QQC D;  1M1H A;  3FZ2 A;  2LQ8 A;  3Q86 A;  1HLW A;  3OTO J;  4IFY A;  1S7H A;  4GKJ J;  2FHM A;  4EEY A;  7FDR A;  2CQC A;  3DRP B;  4JI0 F;  2XB2 D;  3DOM A;  2XG8 A;  4LRC A;  2KRB A;  3W8P A;  2MHE A;  2AWZ A;  4L3N A;  2DXE A;  4RW8 B;  1U4B A;  5HI7 A;  2XYG B;  4PUO A;  4JOU A;  1TQL A;  4I69 A;  1NXI A;  3GLJ A;  3M8Y A;  2BA9 A;  3KJF B;  1TFY A;  2Q43 A;  2ZOM A;  2W5T A;  4UST A;  2LEA A;  3EIC A;  4USU A;  4WIQ A;  5KFT A;  5TJ3 A;  4RX6 A;  2CQD A;  1UWB B;  3MCM A;  4NXN F;  2FGC A;  5DDP C;  2DKO B;  2QG9 B;  2Y1I A;  4DI6 A;  2NPF A;  1T03 A;  3F73 A;  3SZZ A;  1WOS A;  1P8G A;  2RNE A;  4JI8 J;  5C5J A;  1SUQ B;  2W7O A;  2NCK L;  3G6X A;  2FHJ A;  2RUG A;  2UV8 A;  2PGC A;  4DUZ J;  4FPR A;  3M2V B;  1J5O B;  2R7S A;  3GV8 B;  2IVY A;  1DTT B;  3R5A A;  2PA3 A;  5B0A A;  1U49 A;  1JJ2 R;  1RBA A;  4NA1 A;  1S12 A;  1IM6 A;  3O1L A;  3QRR A;  3CJ3 A;  1RTJ A;  5DG8 A;  2QA1 A;  1FFG B;  3HFV A;  4FYY B;  1R31 A;  2P9G A;  2DCL A;  1MU2 B;  2QFJ A;  1YI2 S;  4LFC J;  1Y0H A;  4IKA A;  1JJC B;  3TVZ A;  3DRX A;  2V34 A;  2YWE A;  2LXU A;  1B3T A;  3NNA A;  5G0R B;  2XMT A;  1R8B A;  3IAM 9;  1GMV A;  2A2C A;  3OUY B;  5E0O A;  4U8Y A;  4ZP6 A;  4DFM A;  4ECQ A;  1FX4 A;  2J0W A;  2XZT B;  5AJ3 F;  1B7F A;  2YTC A;  3KLV A;  4MY4 A;  4K5S A;  1VQK S;  2V2Q A;  1HYS B;  5LMN J;  3C14 B;  4PKD B;  2JLG A;  5D77 A;  2RIL A;  2WOM A;  1QM9 A;  3GIJ A;  2V0N A;  2BBE A;  3R27 A;  4C97 A;  3T41 A;  3UCU P;  3KJQ B;  2E44 A;  3NRB A;  3SQO P;  5L9N A;  2K1R A;  3UQS A;  3PX6 A;  3RB6 A;  5F9N A;  2L3M A;  1NCL A;  3B54 A;  4ALZ A;  4E8U A;  4X62 J;  4GTW A;  4KAV A;  4NLD A;  5E33 A;  2Y3Y A;  1HR0 J;  1ELX A;  1CLF A;  3NL0 A;  3KLE A;  1EAR A;  3IFE A;  4WTY A;  3LH2 S;  4Y2K A;  5EWE A;  4P73 A;  5KFN A;  3H2V E;  1WTB A;  5ETK A;  2JNJ A;  2M52 A;  4PG7 A;  2D74 B;  1S6U A;  4M63 A;  2G0C A;  3H90 A;  5C42 B;  2FLN A;  3TZY A;  5IWA F;  4DSI A;  4HT5 A;  3H98 A;  4RO0 A;  2FLO A;  3M9N B;  4X4N A;  3JTO A;  1GMU A;  4TLQ A;  5HP1 B;  1PGZ A;  1S4E A;  4C8L A;  1TAQ A;  2NYH A;  1UKU A;  1VGY A;  2VBW A;  4UOH A;  4OX7 A;  2MZR A;  2CPI A;  4DQQ A;  2IM2 A;  3HCX A;  1RBL A;  2DGW A;  4LMZ A;  1VC0 A;  3OL9 A;  1H6K X;  3H25 A;  1Q8B A;  3DGP A;  4NML A;  4XPE A;  5GAG I;  2NS1 B;  2B7C B;  1B7Y B;  3I0S A;  4C2M A;  1VBZ A;  5A8R A;  4IOA Q;  4L75 A;  1NK5 A;  2LQ5 A;  2V2V A;  5J2M B;  3PW7 A;  2L9W A;  1HNI B;  3BGR B;  2PFF B;  1DQA A;  4DSK A;  3OL7 A;  4DV7 J;  1IKV B;  2AZ1 A;  2ILY A;  5LRN A;  1AJA A;  3QPI A;  2NXJ A;  1IKY B;  2D3Z A;  1FWK A;  4DZ6 A;  2HFZ A;  4OYO A;  3ZO7 A;  3AHP A;  3C15 B;  3PJW A;  3PW2 A;  3VF0 B;  4NXM J;  1RXO B;  2IBK A;  2UVR A;  1X8D A;  2MQL A;  4LF8 F;  5AE1 A;  2HQD A;  3S7R A;  2XWY A;  4OI4 A;  4ED8 A;  1JLE A;  3LPE A;  4KIA A;  2JLF A;  3KK1 A;  5KG4 A;  4ZPA A;  4UTG A;  2MQN A;  2DR9 A;  1X4H A;  4J9M A;  1U8W A;  3L95 X;  5KFM A;  2RS2 A;  5IT0 A;  1KBR A;  3EVW A;  1DAR A;  3WC2 A;  2QMU B;  1R0B G;  2VOD A;  2XQC A;  3DU5 A;  4Y00 A;  1K7H A;  9RUB A;  3C16 B;  1KNZ A;  2HNY A;  1RHQ B;  1WC0 A;  4QIE A;  4Y6I A;  3C2P A;  3RW7 A;  2LA6 A;  2W2P P;  3I87 A;  2HRT A;  1SJ4 P;  4ZG6 A;  2KT3 A;  4FNH A;  2E1C A;  5F8G A;  1JXE A;  1T7P A;  1HWI A;  1URR A;  3HHE A;  4EZ6 A;  4FVC A;  3DLK A;  4OL8 A;  4F0H A;  2OPQ B;  4HI2 A;  2C2O B;  3KUG A;  1A7G E;  4PXD A;  4CIO A;  1VBX A;  2MZJ A;  2IMO A;  1HBU B;  2AQ4 A;  3BQ0 A;  1KH7 A;  1RSC A;  2OSR A;  2C3Y A;  1U1R A;  1WG4 A;  2VZ9 A;  3KYL A;  3IGY B;  2R3V A;  1JNZ B;  4C98 A;  1T9V A;  2V4R A;  5GRR A;  3OV7 A;  5KFG A;  3NOG A;  2RKI B;  3RBZ A;  4A8S A;  5KFD A;  4MH8 A;  3BKF A;  3IG1 A;  3JQM A;  4ED7 A;  1SH0 A;  3NMR A;  2HND B;  2CNO B;  4CZC A;  1C4A A;  3CIZ A;  1V5V A;  4LRB A;  3CF5 Q;  1W2I A;  5KG2 A;  3UO0 A;  3ZZ0 A;  2UUC F;  4U7U K;  1ZBT A;  1UFW A;  3UN2 A;  2OMO A;  1V3Z A;  2GO9 A;  4LRA A;  4CI0 B;  1FER A;  4XK8 C;  2QL5 B;  1UFK A;  2CWX A;  2ZH9 A;  5I4M A;  2ZH6 A;  2HNZ B;  4KBI A;  3UE2 A;  3SQG A;  3FEZ A;  5LMU F;  3J7Y I;  4J9O A;  4NLP A;  4IYQ A;  3MPW A;  2OD4 A;  2XHW A;  2DGO A;  4GC6 A;  2ZDP A;  1ALJ A;  3VAI A;  2AMC B;  2XI2 A;  4P2M A;  3T00 A;  1GX5 A;  1IBL J;  4ZCK A;  2W5S A;  1BQM B;  2D7S A;  1KDN A;  1LXN A;  4H4M B;  3IAS 9;  2CQG A;  3WBZ A;  4BC9 A;  5IJS A;  5K8M A;  1CEZ A;  4RW9 B;  1OYE A;  3MM7 A;  3LOU A;  2RF2 A;  2JRS A;  3FQK A;  5KFI A;  5LIA A;  1NK6 A;  3NGU A;  1C1B A;  1NPP A;  2YNG A;  1H0H B;  4NRT A;  2E1M C;  2QIF A;  2DR5 A;  5HVG A;  3MPV A;  2JC0 A;  2QLF B;  2CJY B;  1TVR B;  4B3T F;  3D3C J;  4FPI A;  2GSU A;  1UPM B;  2F8E X;  1F5A A;  2DO0 A;  2HUR A;  1NH7 A;  4N41 A;  2WON A;  1FE0 A;  2ERR A;  2DNH A;  3MUM P;  2XY6 A;  2ZH7 A;  2W8K A;  4P71 A;  2KJV A;  2JFD A;  3N9U C;  2MJN A;  3KDO A;  3VAF A;  2LYV A;  2YNF A;  4D3G A;  2XGQ A;  3TA2 A;  4KQZ A;  2ALY B;  3U7J A;  1U7L A;  4JB8 B;  5C24 A;  2OTL S;  5IM0 A;  2J6T A;  2N3O A;  2XSF A;  2YX4 A;  3MED A;  3PX0 A;  3UDV A;  5BJR A;  4F2S A;  4PAB A;  5K8P A;  4IG0 A;  2MSS A;  4PCQ A;  4O23 A;  2VL1 A;  3AA9 A;  1NLK L;  4JI7 F;  2QL7 B;  1U6B A;  5KFE A;  2E5L J;  4X64 F;  3E2D A;  3JB9 k;  1HQU A;  3NCQ A;  4OYA A;  3A12 A;  2UXD F;  2JOQ A;  2GHV C;  5HVF A;  3BGU A;  2W1B A;  5M2P A;  5EN1 A;  2PD1 A;  2H1Y A;  3TEG A;  4KH1 B;  1VJW A;  3K17 A;  4EYH B;  3OBI A;  3CCL S;  3PNI A;  1WEY A;  3DMJ A;  4M5M A;  4H54 A;  1RHJ B;  4CLL A;  4QWD A;  1N48 A;  1PYO B;  1FNX H;  3MMB A;  1B8J A;  3D2W A;  3NAI A;  5B7W A;  1HI0 P;  3D9B A;  5DDO C;  1YIJ S;  3HM9 A;  1RP5 A;  2G4B A;  1B99 A;  2ABY A;  1M5K C;  5I42 A;  1B70 B;  4NLW A;  1TKD A;  1WHY A;  4LT6 A;  1UVL A;  3NKY A;  1ZA1 B;  5MLC V;  5CQG A;  4RZR A;  1S9E A;  2ZJR Q;  1RAF B;  2O67 A;  1WHX A;  3HJV A;  4U6P A;  2ZOF A;  1HPZ B;  2IJR A;  4R25 A;  1CJT B;  2ALZ A;  4F67 A;  3V6D A;  3M05 A;  1CJV A;  1M0S A;  4PQU A;  2AGO A;  1IQT A;  4V1A k;  3QIP A;  5ETP A;  2GVD B;  2VIC A;  3EVO A;  1N32 F;  1VQL S;  2MZS A;  1DTQ A;  2OLW A;  3NXZ A;  3W2V A;  4TYA A;  1REV A;  3SSQ A;  1TK5 A;  2PFD A;  5LL6 d;  2UU9 F;  2VOP A;  1TUW A;  4NL5 A;  4ICL B;  1Z1Z A;  3GP9 A;  1CPZ A;  3LW5 C;  3PYG A;  1AFI A;  2J9C A;  1SV5 A;  1U1N A;  4B56 A;  1WHW A;  3GE9 A;  3HHN B;  2F9J A;  3MAH A;  3VV2 B;  2OFG X;  5DLW A;  4LBI A;  4WKY A;  1VQ4 S;  1XMO F;  3H4B A;  1WEX A;  1TKZ A;  1Y3J A;  3N79 A;  3EGZ A;  4CLZ A;  3K89 A;  2KDO A;  4RNH A;  4L3K A;  1ZAX A;  3FJ2 A;  2OPS B;  3CO9 A;  1NB2 A;  2AJ2 A;  2C42 A;  2RD5 C;  5CYM B;  3L7U A;  4EGL A;  2BE2 A;  4E98 A;  2GJ2 A;  2LEP A;  2MZ1 A;  2OPR A;  2C2N A;  2IM0 A;  4NEY A;  1RT7 B;  2YKA A;  2NXN A;  2HFO A;  2BQU A;  4AQY F;  3QMQ A;  2R7W A;  3I9V 9;  3PYD A;  3B4M A;  3HKW A;  4CWB A;  2JX2 A;  2VIH A;  1AJB A;  2E9Z A;  1OWX A;  4LR8 A;  3VAK A;  4KGM A;  2O1P A;  1UTA A;  1OMS A;  2ZC4 A;  5E3C A;  1RDR A;  1CC7 A;  1HBO B;  4WE1 B;  3H2U B;  3TWZ A;  1D9D A;  2DHG A;  5BR8 J;  3D0H E;  2UXB F;  2GIQ A;  1VK8 A;  3M30 B;  3BR8 A;  3BGL A;  1WC1 A;  4DF8 A;  4WF9 Q;  2YNH B;  3GMG A;  3CW2 C;  3OXF A;  2GVZ B;  2B56 A;  4DR6 J;  2OFH X;  1RQ0 A;  3LAM A;  3MM8 B;  2HWI A;  1U2R A;  2BRL A;  2HWT A;  2NXE A;  3G6Y A;  1FI4 A;  2Z4P A;  3TOQ A;  1RE1 B;  2G0I A;  4UUX A;  1R89 A;  3Q2S C;  3BGF A;  2EKN A;  1JLB A;  2IVM A;  1T0T V;  2ZD1 A;  1F2H A;  3RBD A;  4X4P A;  4ZVU B;  3EM1 A;  4QIV A;  3LPY A;  3IBF B;  2E1P A;  1RCX B;  4WP8 A;  3MFI A;  1QE1 A;  3R7N B;  2CNK B;  4DV6 J;  4LSN A;  3T5J A;  2LU1 A;  1RTH A;  1FKO A;  4C8Z A;  5C7P A;  2VG5 B;  2B5J B;  4KHP F;  4DFP A;  2XMU A;  1NB7 A;  5D3G A;  3A3O B;  3MD1 A;  1FJ7 A;  3SV3 A;  2Z8Q A;  2HFU A;  3E8O A;  4P2X A;  2LMI A;  4OI3 A;  1LWF A;  2R2R A;  3CIM A;  1RHU B;  3LP0 B;  1ZET A;  5D15 A;  1TV6 B;  2G13 A;  1CUL A;  4K50 A;  2R7X A;  4RKU C;  3CCR S;  3LAL A;  4DG1 B;  1AJD A;  3P8B B;  1V3S A;  3PO4 A;  2IRX A;  3EGV A;  3CMA S;  4QIG A;  1VIX A;  2FLL A;  1E1Z P;  1GT8 A;  3M6X A;  2D1G A;  1GAO A;  4DCO B;  4USK A;  3VHQ A;  3QBC A;  4F4K A;  3ZFV A;  1HBN B;  5KFP A;  3MPU B;  5HLF B;  1OJ4 A;  2V63 A;  3KLH A;  5KAK A;  1AYE A;  1T9U A;  1NM2 A;  3DXS X;  3ZC4 A;  1JKH B;  4B3T J;  4LUB A;  4Z7Y A;  5D4P A;  3G8Q A;  1N5Y A;  5IT9 Y;  3NS5 A;  5A8W A;  2WVF A;  2XTJ P;  1MMD A;  2HGM A;  2GAH C;  4P74 A;  1X4B A;  3GTY X;  1V9O A;  5KFW A;  1SC4 B;  1S6P B;  5KOX A;  1WEL A;  1KHN A;  2C3M A;  1KP6 A;  5C25 B;  4JI3 F;  4ZG7 A;  2ZNZ A;  4DLG A;  1MWZ A;  4QCL A;  1WDD A;  2F5G A;  3NP5 A;  5F41 A;  5F3Z A;  1EZZ B;  2ACM A;  2UUA F;  4JI5 J;  3KLI B;  4K59 A;  5KOW A;  4CT9 A;  5GOV A;  2KN4 A;  4UT4 A;  1QY7 A;  3LWM A;  3HKZ D;  2FY8 A;  3D5M A;  1S1V B;  1VQY A;  2MQQ A;  5RUB A;  2Y1L B;  2LQ9 A;  4F7V A;  2DNN A;  2UXD J;  1XMQ J;  2BAN A;  1LFP A;  2CJB A;  4DQI A;  5KFJ A; 
#chains in the Genus database with same CATH homology
 4ZG9 A;  5LIA A;  3DYC A;  1N2K A;  1AJB A;  5LQQ A;  2RH6 A;  2ZKT A;  5LRM A;  4UOO A;  4LR8 A;  1EJJ A;  4NWX A;  3E2D A;  4LRB A;  3ED4 A;  3BDG A;  1EQJ A;  1SHQ A;  1SHN A;  5C66 A;  1ZEF A;  2GLQ A;  2W5Q A;  4TN0 A;  2IUC B;  3IDD A;  1HJK A;  4UPK A;  3SZY A;  3UO0 A;  4LR7 A;  4LQY A;  3M8W A;  2GSO A;  4MY4 A;  2X98 A;  4MHX A;  3TWZ A;  1ANJ A;  4CYR A;  1KH5 A;  2GSN A;  1KHN A;  1K7H A;  2QZU A;  4KM4 A;  4CYS A;  3OT9 A;  1ALI A;  4B56 A;  1URB A;  3UN2 A;  1N2L A;  2GSU A;  1EW2 A;  3NKN A;  5EGE A;  1EW9 A;  1EI6 A;  1KHJ A;  3LXQ A;  4FDJ A;  1ELY A;  5HRT A;  3NKO A;  3M7V A;  4GTY A;  3A52 A;  1ED8 A;  5IJQ A;  4ZG7 A;  3MK0 A;  3TG0 A;  4LRA A;  4UPI A;  4CXU A;  5DLW A;  1O98 A;  2W5W A;  4LRC A;  3IGZ B;  1EW8 A;  2GA3 A;  3WAX A;  3DPC A;  4LRE A;  1B8J A;  1KH9 A;  5L0E A;  1HDH A;  3NKQ A;  3T02 A;  4ZG6 A;  2VQR A;  4UPL A;  1P49 A;  1Y6V A;  5INH A;  2W8D A;  2W5V A;  1AJC A;  1ALK A;  1KH4 A;  3BDG B;  4KAY A;  4LR2 A;  5K4P A;  3NVL A;  1AUK A;  3UN3 A;  3TX0 A;  1AJD A;  4UOP A;  2ANH A;  3M8Y A;  3KD8 A;  4GTZ A;  1ALH A;  5LRN A;  3MK2 A;  4CXS A;  1AJA A;  2W8S A;  1ANI A;  2XR9 A;  3NKR A;  4MIV A;  4GTW A;  4KAV A;  5GOV A;  5L0B A;  2W5T A;  3B5Q A;  4NWJ A;  1ELX A;  1KHL A;  1KHK A;  5DLT A;  3NKP A;  1KH7 A;  2IFY A;  4UOR A;  1Y7A A;  1FSU A;  3M8Z A;  1E1Z P;  4LRF A;  5L0K A;  1ALJ A;  4KJD A;  3WAW A;  4CXK A;  3UNY A;  1E3C P;  2D1G A;  3MK1 A;  5TJ3 A;  3T00 A;  4KJG A;  2IUC A;  3IGY B;  1ZEB A;  4YR1 A;  4LR9 A;  1E33 P;  5DLV A;  2W5S A;  1ED9 A;  2W5X A;  3WAY A;  4QAX A;  4N7T A;  4GTX A;  5KXA A;  3T01 A;  4FDI A;  3BDH A;  1O99 A;  4LRD A;  3WAV A;  2G9Y A;  1HQA A;  1ZED A;  1E2S P;  3NKM A;  3Q3Q A;  4UPH A;  5GRR A;  3CMR A;  5IJS A;  5AJ9 A;  3BDF A;  2W5R A;  3SZZ A;  1ELZ A;  1URA A;  4ZGA A;  3UN5 A;  2XRG A;  5EGH A;  3WBH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...