3OT9A

Phosphopentomutase from bacillus cereus bound to glucose-1,6-bisphosphate
Total Genus 141
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
141
Knots found
sequence length
391
structure length
390
Chain Sequence
NKYKRIFLVVMDSVGIGEAPDAEQFGDLGSDTIGHIAEHMNGLQMPNMVKLGLGNIREMKGISKVEKPLGYYTKMQEKSTGKDMTGHWEIMGLYIDTPFQVFPEGFPKELLDELEEKTGRKIIGNKPASGTEILDELGQEQMETGSLIVYTSADSVLQIAAHEEVVPLDELYKICKIARELTLDEKYMVGRVIARPFVGEPGNFTRTPNRHDYALKPFGRTVMNELKDSDYDVIAIGKISDIYDGEGVTESLRTKSNMDGMDKLVDTLNMDFTGLSFLNLVDFDALFGHRRDPQGYGEALQEYDARLPEVFAKLKEDDLLLITADHGNDPIHPGTDHTREYVPLLAYSPSMKEGGQELPLRQTFADIGATVAENFGVKMPEYGTSFLNEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phosphopentomutase
publication title Bacillus cereus Phosphopentomutase Is an Alkaline Phosphatase Family Member That Exhibits an Altered Entry Point into the Catalytic Cycle.
pubmed doi rcsb
source organism Bacillus cereus
molecule tags Isomerase
total genus 141
structure length 390
sequence length 391
chains with identical sequence B, C
other databases KnotProt 2.0: S +31
ec nomenclature ec 5.4.2.7: Phosphopentomutase.
pdb deposition date 2010-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01676 Metalloenzyme Metalloenzyme superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1250 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Phosphopentomutase 3ot9A02
3.40.720.10 Alpha Beta 3-Layer(aba) Sandwich Alkaline Phosphatase, subunit A Alkaline Phosphatase, subunit A 3ot9A01
2IUCB 1ZEDA 1O99A 3NKPA 5LQQA 4LRDA 1ELXA 3CMRA 2GLQA 1AJAA 2X98A 4QAXA 4KAYA 1O98A 3M8YA 1EW9A 4FDIA 3BDGA 3WBHA 5IJQA 1EW8A 5TJ3A 1URAA 4UOOA 4ZG6A 3M8ZA 1KH7A 2XR9A 4KAVA 4CXKA 3M7VA 3T02A 2GSUA 3BDFA 5K4PA 3UN5A 1SHNA 3UN3A 3UNYA 4UPKA 5LIAA 2VQRA 1EJJA 5EGHA 3NKOA 1KHJA 1KHNA 5AJ9A 1ALKA 5L0EA 4LRFA 1URBA 2XRGA 4KJGA 1ALIA 1AJBA 2W5XA 3IGYB 2W5WA 5C66A 1KH9A 3IDDA 4UPLA 4MIVA 1KH5A 2ANHA 4UPIA 3TWZA 4LR7A 1P49A 1E1ZP 4GTXA 4CYSA 1E33P 1HQAA 5INHA 2G9YA 1KH4A 3B5QA 4LREA 5DLWA 4UORA 2W5VA 3M8WA 4UPHA 2RH6A 4LRCA 4B56A 2W8SA 1N2KA 3IGZB 2GSOA 5L0BA 3NKQA 1KHLA 4FDJA 3NKRA 3MK2A 2D1GA 5GOVA 4MY4A 1EW2A 1Y6VA 3BDGB 1ELZA 4KJDA 1AJDA 4NWXA 1ZEBA 5DLTA 3MK1A 3UO0A 3LXQA 4GTWA 4CXUA 2ZKTA 3T01A 1ED8A 5LRNA 1ANJA 1E2SP 5HRTA 5DLVA 1FSUA 2GSNA 5IJSA 3WAVA 4CYRA 3WAYA 4KM4A 2IUCA 4LR2A 3WAXA 5GRRA 1Y7AA 1KHKA 4CXSA 3TG0A 1B8JA 5L0KA 3NKNA 4UOPA 2W8DA 2QZUA 1AJCA 1ANIA 1ELYA 3NKMA 1ED9A 1HJKA 4N7TA 5LRMA 3T00A 3A52A 3DPCA 4ZG7A 4GTYA 1HDHA 4LR8A 2W5SA 1EI6A 4ZGAA 3SZYA 4TN0A 3UN2A 2IFYA 2W5TA 2W5RA 3TX0A 3OT9A 3SZZA 4LR9A 1ZEFA 3MK0A 3DYCA 1SHQA 3Q3QA 3WAWA 3KD8A 3NVLA 2W5QA 1EQJA 1ALHA 5EGEA 5KXAA 4LQYA 1N2LA 4LRAA 3E2DA 4NWJA 4LRBA 4ZG9A 1ALJA 4MHXA 4YR1A 1K7HA 1E3CP 3BDHA 2GA3A 1AUKA 3ED4A 4GTZA
chains in the Genus database with same CATH superfamily
4KO0A 1HBMB 3H20A 5CYMB 2Q3PA 2CZVC 3CJKB 2GSUA 2POKA 5K8MA 1XC9A 1SV5A 3MMAB 1KHJA 4DCJB 5HP1A 5BR8F 4Y65A 3R3TA 5KT7A 4OJ1A 1S9EB 1SKWA 3MUVP 2ROGA 5K8NA 4LF4F 3EDRB 2MZRA 3TEHB 3OXLA 2A2CA 3Q8VA 3F0NA 4H4OA 3BDGB 5E33A 1GMWD 2ZBPA 4WU2A 1RWPB 2B9EA 1CJVB 1Y4ZB 1E2SP 3TANA 5KFWA 2KU7A 5A2QY 2G2YA 1TV6B 1S48A 1GXUA 2GVZB 5FLXY 2FY1A 5J2MA 4ZIVA 3C6UB 4YOEA 1ZM9A 4GTYA 3FSXA 3W9HA 2YKAA 4ZPAA 3WAWA 1WEXA 2V4JB 2XS7A 2EFVA 3GJTB 4J90A 2EFPA 1LWEA 2BQUA 1S9GB 1EP4A 3D6FB 1TK0A 1T9WA 2PE8A 1RT3B 4DG1A 1KDNA 5C2GA 5DETA 5BYQA 2AQ4A 3QIPA 4F4KA 4KJGA 4L73A 4X4RA 1JX4A 2A6MA 4MIVA 2Y1IA 3D2WA 4C97A 4W98A 1P8GA 1T94A 3A3PB 3IBCB 5KG2A 2ALYB 1EETA 2N4CA 2OPSA 1RTDB 5KFZA 2XZDB 3RGIA 1IR2A 4ZVSB 4KQZA 4B3OB 4NLQA 2KHCA 2EVZA 1YJWS 5HRTA 2QYGA 1MMLA 2DPJA 5H9EJ 1FJEB 4RW8A 3TA2A 4JI4J 3Q89A 2JL9A 3FEZA 4LF7J 3PW5A 4DL0C 2ROPA 1DRZA 5SZTA 5GAGI 4RW6B 4NZ0A 3UVJB 1Z2LA 1Y9OA 5H9FJ 4WCEQ 1JMTA 4QU7A 3MEEB 4NLXA 1VQ4S 3ENVA 2M70A 3W5YA 2DNOA 4I6AA 4L76A 5DRKA 3QGIA 3MGJA 3RW7A 5FLXU 2YQ3A 5GAHU 4IOAQ 3T6JA 5HATA 2LQ9A 3TP2A 3K5MA 3DRRA 4CO3A 4PWDB 2HBQB 3V6HA 3OL7A 2W5WA 3G8QA 4PR6A 3GG0A 1NO8A 1W2IA 2L3MA 5KT3A 3MAAB 1TKZB 3CF5Q 1R7IA 4F4YA 2FLOA 2BUNA 2CQGA 2GHPA 4LSNB 4CH1A 3HHLD 4Q44A 4K7QA 3H5SA 1U48A 3M4XA 3QGHA 3T5HA 1B0TA 1F6TA 2HW3A 4CYRA 2UVUA 3OTEA 1NPKA 2A18A 3TX8A 4CT9A 1C0UB 1VQKS 3LUYA 4F4WA 2OMOA 3DPCA 3P96A 4MKVA 1R6VA 4OHWA 3EVOA 4OZLA 1IBMF 3CJ2A 4DQIA 1N54B 5DLGA 1SJ1A 3EWGA 4AL5A 4ES1A 1SH3A 5JUMA 1YRUA 1L3UA 3E3XA 3CTRA 1LXNA 1SUQA 1RKJA 2WHOA 3FSIA 3J80U 1WHWA 2HNDB 2HS4A 1N5YA 2WVCA 5C5JA 1TVRA 1VQLS 2E7XA 5IT9Y 4F02A 5ETQA 4XPEA 3QNWB 2IAJA 2EWHA 1E1ZP 3OR1B 3HP6A 3ILJA 1JLFB 4A47A 4ZLLA 1F9HA 1HD0A 3OR2A 4P73A 4DR5F 5U47A 4DUYF 1JLQB 4ECZA 1KQFB 4Y0FA 4O4RA 2RQ4A 4JV2A 2HLTA 2E1CA 2CJ9A 2QEXS 2GHVC 5KG1A 4EU0A 2IFXA 3JQKA 3T00A 2ZVIA 2CJAA 5CD4A 1BQXA 1HNWF 2B4PA 2HFNA 5L46A 3OT9A 1HMVB 1TKTA 5IS2A 1D8ZA 1N56A 4NYZA 3OFHA 2WVEA 3MM7A 4CWBA 3KFWX 1FX4A 3T1HJ 5D77A 1UP1A 3GG1A 3V2UC 4O4GA 5CD4H 2X98A 1RT7A 1EW8A 1URAA 3PEJA 2G1HA 2R2SA 4ILMA 3SSSA 5D15A 4CO2A 4A8FA 2PDAA 1RA7A 2Z4PA 2W7AA 4J5OA 2PGCA 2WB1D 1NDKA 3KHGA 4Y2IA 1ZM2A 5D0HA 2DNKA 3CC2S 2OI2A 3OHBA 2CPJA 2V2VA 6AT1B 1NHVA 2V34A 2C2KB 4BBYA 2UV8G 1NJWA 5J2QB 4JI2J 4J9SA 4A8MP 1NHUA 1TL7A 1P1LA 1RWWB 3QLHA 2IM2A 2M4MA 3R5BA 3W2VA 4RNOA 4WE1B 5CHCB 3T5KA 2N82B 2HBZB 2OP5A 5IQQA 3TAQA 3CJSA 1XBWA 1ZH5A 5D0RA 1H6KX 2V2QA 5K20B 2XQCA 1AT1B 4AXJA 1KS2A 3JTPA 3MAQA 2JEJA 2I0XA 2E1AA 2JLGA 4DBQA 4F3MA 2IRUA 3DYCA 3NGUA 4YQWA 2UZAA 1EQJA 2W2NP 4LRAA 1PC4A 2P6TA 4WJBA 2E9RX 2Y0SD 5F3TA 3AD9C 4K0KJ 1GX5A 5KFVA 3IFEA 1SH2A 1ZAVA 4AUKA 5TJ3A 4RNNA 5EX3A 3UFCX 1UWBB 1VBXA 1X31C 4X4UA 4U6PA 4QIGA 2VODA 1H38A 1MMDA 4CRJA 1GK8A 1YJUA 5LMNJ 2B9XA 2MMYA 4B9SA 4Z2XA 1V9OA 1Q78A 4DPXA 2EW9A 4J7CA 4G1IA 1VC0A 3ISNC 1Q53A 2QMXA 2IHR1 3A8KA 3EE3A 2E1MC 4A46A 5A8KB 2HLUA 1SJ4P 4ZP6A 3MK2A 1YJVA 3C14B 2VF3A 5IM0A 4X66J 2W9BB 2HNZB 4R5PB 4JI3J 2GJIA 2HPUA 2YWKA 3PV8A 4EBCA 1FXRA 3SEOA 1I1GA 3NAIA 2VFSA 2B5JA 2EFGA 1NKBA 1ZETA 4YB7A 3RAQA 3KUHA 2XS2A 3NY0A 2DY9A 1JXVA 1X0PA 1RTIA 3HHEA 2EK6A 4FYDA 3CULA 2XYGB 2V8HA 1BQNA 2C28A 1EW9A 4YHHF 2UU9F 3T02A 1T9YA 3DLGB 1JLBB 2I5JA 5B0EA 2X51A 4CLLA 4DCOB 5F9NA 1AFIA 3LA0A 2XWYA 2G0CA 2M88A 2WB4A 4O44B 3VAKA 2XB2D 1U25A 2OPPA 4IQXA 4RUBA 5DLFA 2W5VA 3MAHA 2CG4A 1U49A 2VG5B 3CCQS 4HTJA 3IS9A 1NKCA 4YFUA 3HKZD 3QT6A 4P75A 2OEJA 2GSNA 2XEXA 1I3OB 3R6GB 3CCES 2F4FA 4EYHB 1WTFA 3ITHA 2YKPA 1EQ0A 2BRKA 1D3WA 3FJ2A 3I5AA 3PJXA 2DH8A 4M5NA 1IJFB 1Q8LA 3PRDA 4JI1F 3PW0A 4NMLA 3KHRA 2FVQA 1XERA 4K5RA 5IV4A 4NXNJ 3ILOA 4AT1B 3KXDA 3OL9A 1NU4A 1L3TA 2M8HA 2ADBA 3EZ5A 2YBVA 5KFNA 1AUDA 2BJ1A 3WX8A 4DXLA 1YK9A 1YBUA 1IKVB 1DFDA 2R42A 4HLBA 5SUHA 3DM2B 1F1BB 1GNKA 1RTHA 2MZTA 4XO0A 1Q95G 3WHIA 2DB1A 3NBPA 3OLBA 1YWXA 2DIVA 3S6EA 2Q6CA 2GSOA 2H5EA 4TU7A 2I1RA 1VRTA 4ES2A 1OY9A 2OFHX 1S1XB 1EW2A 1RLCL 3RR7A 4NWXA 2Y3YA 3DI6A 1U2RA 4L75A 1ANJA 3TUIC 1HNZF 1IKYB 3CB4A 3DOKB 1JKHA 3NP5A 2ZZMA 3BYPA 1WC3A 2R2RA 1Y11A 1FKAF 2HHUA 3FNNA 4WBFA 3G82A 2DRDA 2H4WB 1U0HA 4C3LA 3BSOA 3OTDA 5DG7A 4ELUA 2CZ9A 4G6VB 4DR4F 4Y34A 2K3IA 1L3VA 4WZQA 1O51A 3LAMA 4IQMA 4U67Q 3H90A 3DYAA 1ELXA 1LV5A 4NXMJ 1QAYA 1RA6A 3GFYA 3KG0A 3MM5A 1WNEA 1M5KC 3IGVA 1WORA 1T9TA 3IR5B 1HWKA 1RDRA 2CA9A 3VCDA 4MKYA 4LJMA 1WHXA 4J9QA 3GYGA 1UA0A 2QE5A 2CADA 3HSDA 1N36F 4ED8A 1WC1A 4X4NA 2W24A 5HROA 2E66A 2FYXA 3I9V9 4X62F 4B9NA 1REGX 1FNXH 4MY4A 4OJGA 4C2MA 2NXUA 4K8RA 1KTVA 3IR7B 3HVRA 4TVAB 3D0HE 5G0RB 3EMTA 2ZJQQ 4F36A 3W9JA 1B8JA 3DLKB 2B4UA 3I5BA 5CH7B 1R31A 3LAKA 1CQNA 4IFYB 1UJ5A 1M0SA 1U47A 1GFWB 4DJBA 3MPUB 4K4UA 5IWAJ 1GEHA 4AL6A 2V69A 3QAEA 4DU8A 2CPFA 4L74A 1G4CA 2DR5A 3U1LA 3W2WB 4NA3A 4C11A 4C8OA 2B9WA 5B09A 1I94F 4WFYA 2D1CA 1HWJA 4QIFA 2ZUAA 1SIZA 3BPSP 2YH1A 3NAHA 1UWAA 4ECXA 5L0EA 1VQYA 4DR2F 1XMBA 1AW0A 2KN4A 1KH9A 5HI7A 1HI0P 2F63A 1JNZB 1UEUA 2AW0A 2ILZA 3ZTOA 1XR5A 4X4SA 3DGVA 3DOMB 2HGLA 2VJUA 5A6WA 3K2YA 1FHTA 2A10A 4DSJA 1WTBA 1RK8A 1TU0B 3N9UC 2YNFB 5I4MA 2C2NA 5C42A 2FUG9 4I68A 3CC4S 3ISND 3D6TB 1JJ4A 1ED9A 5LRMA 4Y28C 3NGSA 1DY3A 1S7HA 4CTAB 3GSDA 2F9JA 2ILYA 4ZN3A 2F5GA 2AYMA 3JYTB 4USVA 1RT2B 3SXLA 2NYHA 1JLEB 1HNXF 4HTIA 1FTCA 1WWHA 2MJUA 4K4YA 2LXFA 1HNIA 1VK3A 1H7XA 3HVTB 3IN5A 3AOAA 1TELA 1NZAA 3T41A 4NLUA 5T14A 2WAQD 4Q8FA 2VQRA 4IG0A 4NLVA 3OSPA 2UP1A 4ECVA 1AJBA 4LSLA 1N88A 2PSZA 2ABYA 2AZ3A 2ZHBA 3I31A 3UNGC 2QMWA 5HANA 3M30B 2CIMA 2C1EB 4ENOA 2R7UA 1U1OA 3KLIB 2JFDA 1LW0B 2F4VF 4LBHA 1DTTB 4N8NA 3BGRB 2R7XA 3RBZA 2K06A 2GO9A 2AMCB 5AE3A 1HPZB 2W9CA 3L3CA 1JJ2R 2AP6A 5KFMA 1VMBA 1HYSA 1T8EA 1PKUA 4ZGAA 1FRIA 1SPBP 1ZEFA 3TRGA 5L1KA 2HYIB 1MROA 5EGEA 4FN5A 3CJRA 3KTQA 1PJ5A 2FLNA 1VC5A 4GTZA 2G2OA 1TQLA 1SC4B 3KK3B 1R8PA 2DRBA 1O99A 2PN6A 3GWCA 2YWEA 2PFDA 1PG5B 2ZDPA 1UEKA 5HBMB 4JI0J 1QDUB 1KH7A 1FKPA 1UJ6A 4QW8A 2CYYA 4NCGB 1YZ7A 3MMJA 2MKKA 4UPLA 1Y0HA 1DTQB 2JEIA 4N8OA 4DS5A 1QSSA 1XNRJ 1WEZA 3TZWA 4DL6A 3NKRA 4KE5A 2CNNB 1SCJB 2HIQA 1ZAWA 3KLEB 4OYWA 2ZH1A 4ID8A 3ILIA 1RHQB 1N32F 5BXIA 4NRUA 1TL5A 3MWBA 4CXSA 2W4PA 5A8RB 1U4BA 1ANIA 1AJCA 3ZZZA 2EC0A 4OLPA 3OTOF 3C16A 3M8RA 1KD1T 4OX6A 1WI8A 1U8SA 4ED4A 1N6QA 1EZZB 3THPA 4IRCA 3GP9A 4WK3A 4M5DA 3HF5A 2ASDA 3OUYB 2HEKA 4ZVTB 1M1GA 3BH7B 5F8LA 3LWMA 4IDKB 2XNRA 4TN2A 5HO4A 2RD5C 1C1CA 2BJEA 4KGVB 1FK9B 3JXOA 3DLBA 3PZPA 3BEGB 2KO1A 2KRBA 1YSJA 2EKNA 4WPAA 2QLWA 2YQ0A 3M8WA 2JJ4D 3US5A 4U96A 3EVMA 4JYAF 2KI2A 2VB6A 2L9NA 1CPZA 2VPXB 2CWXA 4FBUA 5A0YB 1VS3A 1NK7A 5GMEA 3B4DA 3TG0A 3MHYA 2HHPA 3G6ES 2E5LF 3AB2B 1F9EB 3NLCA 2P2CB 1HA1A 3D3CJ 1SB6A 1UJ4A 1NSAA 3QSYB 2ZHAA 4DR7F 4O3SA 2N3OA 3FK4A 3OJUA 2EXUA 3RRGA 3S8SA 1GMWA 1PYTA 1WSVA 2GMJA 1UVJA 1N5QA 5BJRA 4B3RJ 1RT5B 3TQ1A 4Y3CA 1QTNB 1Y5IB 3H4BA 3NNAA 4J9PA 1FRJA 2DGTA 1VQSA 5KFPA 2NXCA 3ENAA 2JEFA 1HWUA 4PXDA 5J1EB 3SIPB 4KKOA 1Y3JA 1CJUA 1LW2A 4JI5J 2L41A 1R0AB 2IYGA 4HR2A 3GYXB 2IDEA 1S6QA 3DKDA 3HSZA 5E3PA 2OGUA 3MCSA 4QPXA 4MYUA 1U26A 1AYEA 5GAGU 2YKMA 5ETMA 1BGXT 3K58A 3MCOA 2X1AA 3MEGB 2LA4A 4LFBF 3ETMA 1U1QA 3W62A 1QJHA 4YR0A 1A0OB 2OUGA 4NASA 2W25A 4YY3J 2GA3A 2A0FB 3ZNJ1 3SI8A 5C24A 3KG1A 4DSFA 1SBRA 3UDEA 2FVRA 3I87A 1J27A 2UUAF 2YNHB 4OLOA 1SHNA 5LIAA 2EKYA 4UW2A 1Q7YT 4QPTA 2C3MA 2A1BA 2FGCA 1MN7A 2RJZA 2MZSA 1NK6A 3KOAA 2PA3A 1X4EA 3HHKA 4IKAA 3EPGA 5B0GA 5KFIA 1TL1A 2P6SA 2GQ2A 1RTJA 4ZPTR 2CKWA 4R25A 3FRZA 3RB0A 1RJJA 1ZEBA 3I0SB 3UO0A 5F8IA 3JSRA 1XEZA 3DC2A 1N52B 3X1LB 1S1UA 2RF2B 4QIEA 2IUCA 5GRRA 2AJ1A 1JB0C 4RW7A 1TKXB 1NHKL 5JVHQ 1EP4B 3IBFB 4HDGA 1TP7A 2YWWA 1UW9A 1IBLF 2BQRA 3B4MA 1JQGA 1LWFB 4ETXA 5CYQA 1X9WA 3MTJA 4ZP7A 2RUGA 3AB4B 4HACA 3H98A 2XI2A 1CG2A 4JV5F 1WC6A 4DSEA 4DPYA 5E5NA 3BGUA 1IQZA 2XCAA 4X2BA 3HHLA 2MKYA 4LMZA 2OHDA 3M8ZA 1RP5A 3TW0A 5DM6Q 1NSKL 2C3OA 2O67A 2V8GA 2CPIA 1KHWA 2PMHA 1KH5A 4M5HA 1WEYA 1VBKA 2VFRA 3FCWA 3B5QA 2LQ5A 2FJBB 1T03B 3TZXA 2CPEA 3GYNA 3CCUS 3L4BC 4FNIA 3J7A1 2M2BA 1RBOB 5DQGA 3Q8UA 4DPTA 2XG8A 1RUSA 3BKFA 3HDSA 4M5GA 1HW8A 2EFNA 1NBEB 4NMXA 4Q45A 2CQCA 4UUWA 3VAHA 3OFGA 1WF0A 1SKRA 2JZ5A 3P3DA 1EAYC 3UD3P 4JI4F 2IBKA 3PX0A 5HL7Q 2ADCA 5J2NB 1REVB 1S5ZA 1X0FA 2KRRA 5KXAA 4JP8A 3NXZA 2RDDA 4ECYA 4B9MA 2W7OA 2DRAA 5B0FA 3C46A 2NUHA 3GR0A 4A48A 1RAGB 1OS5A 4CNYA 2YKQA 4IH5A 1NZ8A 1VBYA 2BXJA 3E01B 1G3OA 2IMOA 4HI2A 2DHAA 9RUBA 4AE5A 3J7Z5 4IG3A 4Q8EA 2LMIA 2GVDB 2VQFF 1ITPA 1LNQA 3ZZTA 2J6TA 1RU1A 4BWMA 4ICLA 4U7UK 4LBIA 4DV1F 4QYRA 2GZOA 2H54B 3W5ZA 3LP0A 1RAIB 1CJKB 2V8VA 4RL1A 2V6AA 3FMBA 3HSGA 1X4FA 2BOAA 4C48A 2QLJB 2DHHA 3KJFB 3QFHA 4FS2A 4M5JA 1UL3A 1Q86T 1IKXB 1QE1A 4KAIA 4LQ3A 2BM1A 2DNQA 4Q0BA 2K8GA 4OI2A 4LR8A 4F26A 1W2BR 3W9IA 2CDQA 5I42A 3CMES 2BJ3A 4P10A 2CJKA 1CULB 3SCIE 3NGTA 1JLAA 5KOWA 3EXYA 4ED0A 2EI5A 2EBGA 2QSWA 2DHXA 3LP2A 2BANA 3BO4A 1UW4A 2W01A 2MQMA 4EK2A 4R8UB 2B9YA 4C7QA 1S1TA 1KKHA 4WF9Q 5KAKA 1CJTA 3L09A 2YNGA 4FF4A 4AXIA 1SL0A 2XMUA 3NNHA 4URGA 2NQPA 4ELTA 2NZCA 1JLGB 4ZJOA 4ZVHA 2W4DA 5JVGQ 2XSJA 3AD7C 1RHKB 3X3UA 3MM8A 3CD7A 2CNOB 3CMAS 2OTJS 4ZPDA 2VBZA 4S0MA 3MM6B 2R7TA 2M52A 5GMKa 2BE7D 4JI8J 3V4IA 3TVKA 1QM9A 3D54A 3OTCA 4DQRA 2OKQA 1N0UA 1P1TA 1C1BA 4NEZA 1FFWB 5LJ3Y 3AHPA 4DQSA 1R27B 2AZ1A 3O3LA 2UXBJ 4DL7A 3Q0AA 1FT8A 2HHXA 4WFBQ 3M1VA 4QR0A 3LGHA 1TMMA 3MOZA 1HBOA 3CJ0A 3D9BA 3T1HF 1BWEA 4MK9A 3FDSA 1MWYA 3SCJE 2HBYB 2R8IA 3BDFA 4DPWA 1N0VC 1YTYA 1TL7B 3DRSB 4I1TA 1B3TA 1V5IB 2R8HA 4JOUA 4UPIA 3Q86A 5LSRA 2Q1LA 3LGNA 2MHEA 2PC6A 1SJRA 5DLWA 4ZIWA 3KK1A 2VG6B 3C15B 2XYPB 3QBCA 3EXCX 2I38A 1G6BA 4RW9B 1BUXA 3QRRA 8RUCA 2BBEA 1TUGB 1S1WB 4PG4A 4IRDA 2DR9A 3HPOA 4J91A 3IC1A 4DR3F 5HSPA 3P45B 4L6V3 4G3IA 3AOCA 2IJRA 4KH1B 3AJ1A 3NMRA 2ZC3A 3OVSA 4B3MF 4AYBD 2FVSA 3MPVA 1S59A 3CWJA 3CGIA 4LQYA 4H54A 2UUCF 4NLWA 4F50A 4KV8B 3JSMB 4I0WA 2BQ3A 3BH6B 4TY8B 5LMUF 2EFOA 2WK4A 4GVLA 2FJDB 3FBBA 2DNMA 5IZHA 1JXEA 3GU0A 5DQHA 4G1QA 4LFCF 1Q81T 2FPHX 4A8YA 4USHA 4DUZF 3CDBA 3G96A 2XZTB 2H51B 2BR0A 3C8YA 1RT6B 4DR1J 1TR0A 3GJSB 1U0SA 4JUZA 1SIWB 2W4CA 4GVBB 3VVUA 4CT8A 3T01A 1P27B 2O1PA 3PYFA 2XY7A 2U1AA 1EARA 2CQIA 2VBYA 3ADAC 1ELOA 3A8JA 2HIYA 4OZ3A 1ELYA 5KFUA 2GX8A 4JI3F 3BZQA 2JX2A 3Q22A 4ATNA 3M2UA 1ZTWA 3TJ8A 2VPYB 4YB5A 1B7YB 1BHNA 2MLXA 3GIMA 3PFOA 1VIXA 1WC4A 1WDTA 4K2JA 3BGLA 1OYDA 4NEYA 3CO9A 4PXEA 2PI5A 3HD2A 3I5CA 2NLWA 3EGVA 1H98A 4USKA 2ATLA 3A4TA 1M90T 4FF1A 4QWDA 2F9DA 2VC0A 2Z0GA 1PJ6A 3N79A 3VHQA 4DN9A 2HRYA 3IGYB 2DNZA 3CC7S 4IOCQ 2DIUA 2UUTA 4HHHA 1ZYQA 5CA5A 1U7LA 3MM9B 4LF2A 2Q43A 4FKYA 1LK7A 3ITHB 3NGDA 2YWGA 1JIHA 2E9ZA 2N7YA 4JI6J 1T05A 2D1GA 3VAMA 3ET6A 2CPXA 1FX2A 1PCAA 4UZBA 3AAWB 1XK8A 3KHHA 4Z7YA 4KIAA 2FTRA 4CH0S 5KT4A 2DXFA 3QGPA 4ZCMA 4DDFA 2VD3A 2VG7B 4LF9J 1ZPVA 5T7LB 1FFGB 4O3NA 1FCAA 2K3KA 3JSYA 2FJVA 2GGPB 4DV5J 2G9OA 3U1MA 3QWPA 2QMUB 1RAOA 1HBNB 1KFSA 3OFFA 3UI3A 2HMIB 1NB2A 4ZG9A 4PUOB 2F8HA 2MY8A 3TAPA 4KYZA 3M8PB 4WTOB 2FGOA 2KTQA 4NOHA 3HFKA 2YXLA 3I56S 2KJWA 1NSQA 4CLFA 5J2PB 1R8HA 2R2UA 1S0VA 2KG0A 3V6DB 2I2YA 1Y3KA 1RT1A 2Y0BB 4RLEA 4ID5A 4PRFA 3MMCA 2VIHA 4N77A 5FD1A 4B56A 1LEOA 2Z2LA 2AEJA 1VYAA 3P5TL 5DO2A 2ZBRA 1Q5VA 5IQ6A 3PRVA 1OY6A 5KT6A 4NCAA 2YWFA 3HK2A 2KKHA 4R0EA 3W66A 5CZXA 5KG3A 3AJDA 2QYCA 1UA1A 3SSRA 3MI7X 2B6AB 4NLGA 5HVFA 1FNOA 3E2EA 3ZZOA 2OAUA 5T41A 4IFVB 2KHDA 5CXTA 4Q2MA 3CT9A 5L1JA 4GKJJ 4DV6F 3CDAA 4DOZA 4LFAJ 2KT3A 1VC6A 3I55S 3W3SA 5KG5A 3VAFA 3GQCA 3D68A 2AF6A 2F8MA 3NCRA 2GV1A 1CC7A 4WFZA 3WZ0A 1Z2ZA 1H74A 3Q2TC 3KLHA 4KHMA 4FPIA 4DSKA 2KH9A 2WONA 1EHWA 5A8WB 3AQOA 2V4QA 1WDDA 2WBRA 1T9VA 1AZSB 4CYUA 2DGWA 3BM7A 4ED2A 2ZM6J 2GHWA 3PIOQ 1U24A 2AEMA 2G9YA 1UMJA 2KFYA 2W8SA 4LT6A 3R1HA 4FXWA 1S99A 2BZ2A 1YJ9S 3L7UA 3BB5A 3FCHA 2FZCB 4OX7A 4FVMA 3MDFA 1RCOB 2HQDA 3BGFA 3SDEA 2AWZA 2HWTA 3TAMB 4LR2A 2J0XA 4K4VA 3A12A 3A8IA 2KDOA 5I3UA 3M32A 3QQCD 4AQYJ 1N5TA 2V2ZA 1NKEA 2KXNB 4M5IA 1VI7A 2XMWA 4MIWA 2ZH8A 2WVFA 1S49A 3LPYA 3NVLA 1XTZA 3W61A 1H0HB 4DV4J 2RS2A 3CPWR 2M5YA 1YVFA 4ANEA 1U6FA 3WDOA 2XBPA 3I96A 1XR6A 1T3OA 3ONQA 5DM7Q 4WZMA 4ETZA 2BE9B 2CDRB 1U1LA 4C0HA 3EJMA 2EC2A 4FF2A 1S7IA 3AT1B 4USUA 3SYZA 4E98A 3AA9A 4LR7A 3PCOB 2YPZA 1TL4A 1WKJA 3CD5A 4L72B 4LREA 4RW4A 1ULRA 4PG6A 5BR8J 4UPHA 1N2KA 5CYJA 5LXRA 1UPMB 4LUBA 1YX2A 4KJDA 2KJVA 4LF4J 3P8BB 2IM1A 4RJVA 3K7RA 3WIVA 3ZZPA 1R0BG 2VDIA 2LKZA 2YWHA 1HBMA 3AJ2A 5CYMA 3CJ4A 1PO6A 3CJKA 1WACA 4C8MA 3MMAA 3FZ2A 5KFQA 3SZYA 1GMUA 3TZZA 1S12A 1S9EA 2WVBA 1CEZA 2DGUA 1T7PA 1G2EA 4LVOP 1VHIA 5HVHA 3TNVA 3BDGA 3M8QB 3OXGA 1X60A 1CJVA 4NL5A 2E5IA 1TV6A 3W8PA 1ROFA 2GVZA 4OHZA 3VGUA 2MTLA 4ER8A 1V5VA 1XMOF 4ECRA 4CLSA 3C6UA 2C2OB 1S6PB 4IUFA 3FZBA 2HHSA 4AFFA 4OX8A 2CQ3A 4HVZA 2V4JA 2DT9A 5LRNA 5IC4B 1MROB 4NE9C 1S9GA 2ZC4A 4F8RA 4B17A 2OPRB 3TUZC 1ZBTA 1FO1A 1NM2A 1RT3A 1PJ7A 3O44A 4DFPA 4FYWB 5M2RA 2VH7A 4NI2B 2PI4A 2PEHA 3K8VA 3GJQB 2LQBA 1URNA 2DR8A 4NA2A 3U1NA 3BO3A 1IQTA 1Q79A 1RTDA 5C25A 3EYZA 1UVIA 1EQMA 3R5GA 5AXNA 4B3OA 1RAHB 4F0HA 3HX9A 1N34F 4ZVUB 2ZJRQ 1HBUB 1AXQA 1VCTA 2VASA 1SQGA 1K8AT 2RH3A 3L95X 3KYLA 7AT1B 4KHPJ 1OY8A 4RW6A 1DLOB 1BMQB 5DJBA 3UVJA 2FZGB 2VKRA 3DOLB 2DNPA 5I3QA 1YBTA 4ZPWR 3OL8A 1UCNA 3TUPA 4WIIA 4ZVQB 2F7VA 2NUUG 3IO1A 1VISA 2QZUA 5KG6A 4OL8A 1Z1ZA 1UFWA 1IBCB 1FRKA 4OFZA 4OYOA 1CLFA 2H3EB 5D4OA 4A8SA 3J81j 3PEHA 2CZ4A 4PWDA 2QL7B 3BBFA 1G1XA 4PQUB 1TAQA 4CLZA 4JB8B 1N48A 2ZHOA 3M9OB 1KC8T 5LJ5Y 1M1KT 2XCPA 3MAAA 1TKZA 1IBMJ 4HT5A 5ETPA 1UFKA 3L9ZA 4LSNA 2XMTA 2QRRA 2LEPA 4M5LA 4WYLA 3B8HA 3HXMA 3NOCA 1MN9A 3N4WA 4CQ1A 4B9TA 4O3QA 3R97A 2HGNA 4DZ6A 3ZC4A 1C0UA 3MD1A 1S76D 3KLGB 2DGQA 3F73A 2QX0A 2GAHC 1IUJA 3MURP 1UZDA 1S0NA 1S0OA 5KFOA 2K1RB 4OZ1A 1KHVA 1RAEB 2QIFA 2Z57B 2E5JA 2VFTA 3FBFA 2HNDA 3IRWP 3IMQJ 2MB0B 1SC3B 4J9OA 4OZ2A 3KWMA 3Q24A 4GC7A 5B0CA 1MSWD 3MK0A 2LXUA 3DLEB 3PYDA 4PXBA 2BYCA 2R9LA 2CQHA 3OR1A 5B7WA 4CCHA 4P74A 1JLFA 2MZ1A 1QSLA 4FXDA 1HNWJ 4F4ZA 5GAEI 4GKKF 4OYBA 2AKWB 1LW2B 1OJ4A 2QFIA 2FVCA 3PO4A 1P6TA 2HQIA 3DMJB 2AD9A 2HQGA 1Y5NB 2KM8B 1MWQA 2MQLA 1NDLA 1FDAA 2ASYA 1JNRB 1RBLA 3IGZB 4MIAA 4C3KA 2VQEF 1FJ7A 4BLGA 1HMVA 1SH0A 1WHVA 4DFMA 3Q8RB 2GIQA 1J5EF 4UOFA 3PO5A 5EWFA 1RQ0A 3DU6A 2MKIA 2RMLA 2RIJA 3QO9B 1NK8A 3HCXA 1UVLA 4CLTA 2MLYA 2HNYB 5KFDA 2IJNA 1NDCA 1VQMS 2AU0A 5KFYA 2HAIA 4HHUA 2KG1A 1RU2A 3SMZA 3M6XA 4EO6A 1X5PA 3NS6A 4MMOA 2NREA 3GCWP 1LFWA 2XS5A 5J2QA 1VIOA 1Q16B 1R6YA 4ZKAA 4ZPVR 2IJFA 2RKIA 2RILA 4WE1A 5HMXA 4ED3A 1NB7A 2ZE2B 1S97A 4QYZK 3QZ8A 4DSIA 3UDCA 1XNQF 4UTGA 1URRA 3EZUA 3PW7A 3FFIB 2CQBA 1PC5A 3G71S 3D5MA 5K14B 3MFIA 1CS4B 3TZYA 4HACB 3M8SA 3CD6S 2LU2A 3T9NA 4K4ZA 2VHGA 5A2QU 4N7TA 4HDHA 5ETTA 1XMQF 1AB8A 1YRTA 1NK0A 1PAUB 4OX9F 3KJQB 2CNKB 1ALJA 2Z2YB 2JOQA 5A8KA 4E0DA 1RACB 4IOBA 3UDLA 3DHXA 3IBWA 3C14A 3DGPB 2KT5A 2J9DA 3B54A 4Y2CA 4RUCA 4RR5A 3D1QA 2LP4A 2BKOA 1YQHA 4FNHA 2W9BA 1XQIA 2IC3A 2HNZA 5F8GA 4R5PA 1ALIA 2H65B 4YHHJ 2YX1A 2UU9J 2W1BA 1QAXA 1S1VB 4KRWA 1N33F 1HNVA 5IOLA 4WP9A 3MR6A 1IM6A 2QT7A 4KT0C 2BRLA 3BV8A 4P2XA 4ECTA 3TO8A 1JLCB 4CXUA 2FLLA 4NLPA 3T1YF 4V1Ak 3J7ZT 1LOUA 2O3DA 3MEKA 2UXCF 3CD0A 3BQ2A 4RWXA 4UOHA 4OYIA 2JC1A 2XO6A 4DV3F 1BQMB 2Y9HA 2HFVA 2DEJA 3AQPA 3DLGA 4ZG7A 5J1NA 3W63A 4JI7F 3MMBB 1IN0A 2B4OA 4O44A 1ZA1B 2CG8A 1E3CP 2GO8A 2WW8A 3LP1B 4WTYA 4L3KA 1OPZA 1H7WA 4PQAA 1AJAA 2VG5A 4JI1J 1T9XA 1YJNS 3CNQP 2KVQE 4OZ0A 4FS1A 3RBXA 2UVWA 4X65F 2CUYA 4CI0B 3POTB 1EB0A 4NLRA 1FVSA 2HURA 1XWLA 5G4DA 1JK9B 4DV7F 2R8GA 4KHRA 3BJYA 2OSRA 2B7BB 4PG5A 3SQGB 2MZJA 4PXCA 3PHTA 2MQ8A 3H7HB 3CDUA 2DR7A 1HNZJ 1BY9A 3LQVA 4TYBA 2ZD1B 3QT7A 1SJQA 4DX7A 4RBUA 3DM2A 1V6HA 3H4DA 4LF5F 3I4HX 5F8NA 1NK5A 1NEEA 3QJLA 1KVKA 2D41A 3IWNC 2QGFB 1S1XA 3MM8B 4X4TA 4LF8J 3NS7B 5CQGA 3O5TB 1SC6A 1ZZNA 1HWLA 1L3KA 5JXSA 5K4PA 1IKYA 3DOKA 2IM0A 2MDAA 1UEVA 2W5XA 3MR3A 1S57A 1KFDA 2GMHA 4MFBB 1GQEA 3CJQA 5IT9U 2KXFA 3DDIA 1HL6A 1WD6A 3R7SB 5K8OA 2XY6A 3HKWA 1IKWB 2CJQA 4C8KA 3BSCA 5FDLB 2CVEA 4CO5A 5THWA 1RISA 1NJIT 7FD1A 1BE4A 1D9AA 3LF0A 2R8KA 1N36J 3BS9A 2UUBF 4DEZA 3MUMP 4KM4A 4LQ9A 4X62J 4ZLJA 2DY1A 4RNHA 4HHJA 4OMFG 2DR6A 2YNIB 1CC8A 3TJ9A 1R8BA 4A8XA 2W5QA 4FYYB 3W5XA 4DHVA 1FVQA 4DV2F 2D69A 1NJYA 1YI2S 2QL9B 3HZGA 4GO5X 3W1YC 3CCVS 3KJVB 1Q5YA 2XMVA 2ZH2A 2BJ9A 5AJ9A 5G0RA 2ZKUA 1ZOTA 3KJNB 3F44A 2YQ1A 4Q5VA 1DBDA 2ANHA 3UQSA 1I94J 2B0GA 2LCWA 1SJ3P 1HIYA 2BW2A 5DZ7A 4NWBA 4RX6A 4HYKA 3OTBA 2J0WA 5HLFB 4IFYA 1VRUB 3CJTA 2GC8A 4DR2J 1U1NA 1JJHA 1N8RT 2OPQB 1NH7A 3ZXWA 4DF4A 4ES3A 4W4MA 3D6HB 4XDDA 2ZH5A 3RU0A 1TL3B 3ZFVA 2XMJA 5KFHA 3W2WA 5KFAA 2MYFA 3DU5A 4UOPA 4DV0F 2RUSA 1S77D 3IG1B 4U7UD 2ZEJA 4MT1A 2FC8A 2UXDF 2ZNYA 4YP3A 3EM1A 3D6MB 1KN6A 3PW4A 4BC7A 5DDRC 4N5SA 3LO3A 1VOMA 2L9DA 2XWXA 1HW9A 3AFGA 5IT0A 5DDPC 1O98A 4Q7AA 1TTHB 4RKUC 2K7KA 3C19A 2RU3A 4DWIA 2YNFA 2X1BA 2LFVA 1RT4B 3F41A 3HHNB 1ALKA 2PA8D 4CDIA 2BE2B 3FBCA 1HHSA 4FYVB 3UW1A 4ZHRA 1EX8A 5HMWA 3AH6A 4CTAA 3DXBA 1SVDA 1YDLA 3ENWA 5K5MA 1X9SA 1KTQA 5AJ3F 3T5LA 1VDHA 4F4XA 3JYTA 4OIXA 4EZ9A 2VONA 2G4BA 2DGXA 2CJBA 5DGBA 3MK1A 4H4KC 1JLEA 1OQ6A 3HFVA 5D4NA 4KJIA 3HVTA 4YDXA 1PBAA 3BDPA 4NLOA 5F8MA 4E8UA 3CUNA 1F2HA 4X64F 3I9ZA 2F4VJ 1WELA 3M6VA 2XLIA 1FEEA 3HSJA 1Y7PA 1VQ7S 3TX0A 1EIYB 4B3TF 1FRMA 3N6NA 5D3GB 3M30A 2KM8C 1TK5A 1XIQA 2GW8A 4WFNQ 3THVA 3CJ3A 5LQQA 3KLIA 3HHDA 3KLFB 5B0DA 1RLDA 2MQNA 1DZ5A 1L3SA 1LW0A 2RQKA 4BHQA 2IIHA 3UN5A 1DTTA 3BGRA 2HFSA 4ECWA 3ZTRA 3FCVA 4PYAA 3K5PA 1I6JA 1HQAA 2G0JA 2WCXA 1RWMB 2EK1A 4WXOA 1JXLA 4IRKA 2XM3A 3LGMA 4B3SJ 4KPYA 2KT2A 3NKQA 3DRYA 3SV3A 4FBTA 5E41A 2AYBA 5KFGA 3CCJS 4C9DA 4GC6A 3RYLA 3Q8YA 2D3UA 3FC9A 1NXIA 2GJFA 3KK3A 2RRAA 2PIIA 4V19J 2RE1A 2MSTA 5BYSA 5C7PA 2ZVSA 4NCBA 2ZZNA 2R7QA 2BEFA 1PYOB 2BVZA 1N32J 1SI9A 3FBEA 4NCGA 1BD6A 5CCMA 4B9VA 2M3DA 2CPHA 4CLUA 2PFFB 1RT1B 2J76E 2RVJA 1DTQA 4NYPA 1DQAA 3OTOJ 5E2QA 2EG2A 3CCLS 2AJFE 4CH7A 3D0GE 5F0WA 1WG5A 4LRDA 5B0BA 5DGAA 3NKPA 2Z2ZA 3DLHA 3CW2C 1F9FA 2W8LA 4ECSA 1EKRA 2YH0A 4MKAA 4UOOA 3MPDA 3KLEA 2W2PP 5KFXA 4ZCLA 2AGQA 3G4SS 2CWKA 2FD2A 2VV5A 3GJRB 1VGYA 3BBCA 5A8RA 1YG0A 2C3YA 3JAMY 2HQFA 3OPKA 2WOMB 3I0RB 4C0OC 2XHCA 2B56A 5IV3A 5GADI 1K9MT 4TLQA 3QJPA 3R5JB 2J0SD 4M5MA 3RJMB 2Z8QA 3BYRA 4PWUA 3HJFA 3WAVA 2HG4A 2BJ7A 2R8JA 3OUYA 3SSQA 4PPZA 3UE2A 2V8PA 4JYAJ 3BREA 1UTAA 3TA0A 4IDKA 1F3VA 2MGZB 3O2IA 3CO0P 2OO4A 1IR0A 1BLUA 3PFEA 5ETVA 1FK9A 3MECB 4CP5A 2EPIA 1Q1KA 2W2MP 3GFZA 2E5LJ 2FDNA 3KNAA 2ZOFA 2XULA 1HI1A 2PMWA 3ED4A 4GKJF 1WJ9A 4DR7J 4NLTA 4ZJLA 2KXHA 3UR0A 4ZVFA 3DRPB 3VQSA 2CPZA 4QJVA 3CCTA 2PEBA 3OD2A 4TY9A 1VQ6S 5KT5A 2HHQA 9ATCB 4CYSA 3M32B 5M2PA 2RHSB 3LH2S 4OI0A 1R8AA 2ACYA 2YVSA 3AODA 3GIIA 2QLFB 5KFRA 2XMAA 3SCLE 1Q4RA 3D1HA 4G65A 2HSEB 2JH3A 2NSCA 3R9LA 2BKPA 2XHWA 3Q8QB 2HQ3A 3QZ7A 1K0VA 3TEGA 5EDWA 1FD2A 2IMWP 3SCKE 1RT5A 2AEFA 2AJQA 2R7OA 3PNIA 4RUHA 2WSFC 3LOUA 2KB2A 1WC0A 2LEAA 2IYIA 2YKNB 5HVGA 2OLWA 4USWA 4NZ6A 4N76A 2R2TA 2V50A 4LFBJ 4K5SA 1O8BA 3C66A 1WOPA 3M6WA 4GRSA 1R0AA 3PKYA 1BXNA 2VPWB 1HQUB 2F8EX 2FB0A 3Q23A 4BS2A 1IBKF 3MPWA 2V9KA 4CXKA 3DHWC 1WKLA 1V3SA 1HR0F 4DR6F 3R7NB 2GMLA 2NSBA 4E2FB 4I7FB 1Z4UA 3W65A 2UUAJ 3UD4P 3P6YC 4PKDB 4DN0A 3MEGA 2IA0A 4F7VA 3QT8A 3V81B 5ETNA 4G1PA 2HVEA 1KNZA 5C2CA 1C0TA 2DD8S 4M63A 2C22A 1LWCB 2HHHF 1QSYA 2OH2A 3MCMA 3U7JA 4RNFA 1U1RA 4HH0A 1KHKA 1Q82T 1K0TA 4KC5A 2VU5A 3TARA 3NKMA 3M2RB 2YNHA 4TQRA 3DDKA 5F8HA 2AJ2A 3UN2A 1JWWA 4PABA 1UVKA 1KOHA 1YIJS 1XJWB 1ZAXA 1MU2B 5AE1A 3CCRS 3OV7A 1IBLJ 3GIKA 4OHVA 1X4HA 1APSA 3IM8A 2DYAA 4EGLA 3R1LA 4I2QB 1E6YB 4FKXA 3I0SA 1ZTTA 3OQ2A 2WVDA 1TFYA 2X3GA 4JV5J 3KK2B 2RF2A 1TKXA 5EWGA 2RS8A 5CABA 1RWUA 1LK5A 1C2PA 3THTA 5L1IA 3VVTA 1HWIA 1LWFA 4QIVA 1WOSA 4ZPBA 3WX4A 1RSCA 2XLKA 2KZZA 1ACMB 4ZLNA 3V6JA 4HT7A 3DRXA 4OV6A 3MEDB 4ZDNA 1DAXA 1HARA 3H5XA 5C25B 1NJZA 3BPDA 5BYRA 2DPIA 4KB7A 5GAEU 3Q8SB 4DLEA 1I51B 3OXFA 2C2MB 4W90B 1TZ0A 5HMZA 5DDQC 3GMGA 3J80Y 4XAKA 5JJBA 1T03A 2DO0A 5AXKA 2FIUA 4PZVA 1S4FA 2ZUGA 3MXHP 1KVJA 4KAVA 3O6QA 1VQ5S 2XGPA 4UOGA 4ZVEA 2D3O1 2ACMA 2VC1A 3GV8B 4L3NA 4KGMA 7FDRA 2MPUA 1URBA 5ETKA 5C66A 5KFSA 4ERDA 4OHYA 4LIWA 1IR1A 3IDDA 2BV3A 3UWTA 4AL7A 4H4MA 1U1MA 1R43A 1FJGF 2W2QP 5ETSA 4B9UA 4ZN1A 4I2PA 4F0MA 4P9SA 4DL3A 1J5OB 1YLXA 1NCLA 2CPYA 3SBMA 2IBOA 4XIUA 5J2NA 1REVA 2VQFJ 4OZJA 5IXUA 4KHPF 2D3OR 3ULHA 4RWWA 1W25A 2HFOA 2HVHA 4DPUA 4DV1J 2FHOB 4J9MA 4KFBB 5GMDA 1SC1B 1UAWA 5DQIA 4ILLA 4CLYA 4CLWA 3E01A 4RBVA 2VZ9A 1LWXA 3D1OA 3GLJA 4O3PA 2Q66A 4AD6A 2GVDA 1QVFR 4GMKA 4LRBA 1MW7A 5DG9A 3RG6A 3CDWA 3HVWA 1X8DA 3G87A 1KLMB 3B82A 3QFWA 3VTIA 2JVOA 2ZWOA 4ZG6A 1CJKA 4IH6A 1M5VC 2NXNA 4QR2A 2QL5B 4QOTA 2C2RA 4CO1A 5EX0A 1G7CB 2Z58B 2ROEA 2HK3A 2JWNA 1IKXA 1HQEB 1E33P 2FJXA 4USTA 4ZK7M 4TXSA 4J9RA 4LF6F 1E6VB 2JRSA 2DNGA 3PXGa 4KO0B 3SQOP 5KFJA 1UPPA 4YS2A 4ZA1A 3P5BP 3D3BJ 1CULA 4GTWA 1D9DA 3EGWB 4EYIB 2RNEA 4J9NA 1SV5B 1RXOB 1K47A 5HP1B 5JMNA 1NH8A 1PGZA 3S01A 2WTFA 2KVIA 4O3RA 3K0JA 4R8UA 3GIRA 4ITSA 1OWXA 4H4OB 4WKRA 4LR9A 2DGSA 2G13A 3HT0A 4YB6A 3DN9A 3GZ7A 2E9TA 2DH7A 1JLGA 5KG4A 4U8VA 1NUEA 4FP9A 4EI2A 3GR1A 3W8GA 3RAXA 2QA2A 1M5HA 3ELHA 5LM7E 4F67A 1ZZFA 2ZNZA 2CRLA 5J2MB 4EFAC 1O6XA 2HFZA 3FEYB 1TAUA 3MM6A 2WRMA 2HVDA 1KVIA 3ZZYA 5KFCA 4N56A 1X5TA 2DKOB 2IPOB 4DL4A 3MOJB 3HZEA 4J37A 4M1KA 1LWEB 4ZPCA 1QUPA 2AIRB 1H72C 4I56A 2YX7A 2HWIA 1LFPA 2ZH7A 4LBPA 4DG1B 3AXKA 4URQU 4P2FA 5E3AA 2V68A 4ZITA 3QIPB 1FJCA 3WAYA 1PBUA 1FWLA 3ETOA 2LDYA 3DRSA 4P2MA 4B08A 2W5SA 4IO9Q 1F60B 2RKIB 4DR3J 1EETB 2OPSB 2BA9A 3TJAA 2DHSA 1DARA 3VAJA 4NWJA 4B3MJ 4DFJA 4YR2A 1DJ0A 4MHXA 3PG9A 3KUGA 5EN1A 2VG6A 3C15A 4QWBA 3G86A 4U95A 3JTNA 5J1PA 2HZCA 4TKTA 1J2VA 4RW9A 2LECA 2UUCJ 4RW8B 3QPIA 4M8LA 3DXSX 1S1WA 3RB6A 5LMUJ 1GXLA 1K44A 1WC5A 1D09B 1YJRA 3CCSS 2CVIA 3TVZA 1M5PC 1GXTA 3RTVA 4LFCJ 4WU3A 4X4PA 2OD4A 4DUZJ 1KRPA 1X5SA 3M2VA 4FPRA 4BC9A 4TYAA 3GPAA 2WSCC 2RQMA 2HKEA 4KV8A 3JSMA 5ETRA 4LF7F 3DRRB 4TY8A 5RUBA 1TKDA 5HQ8A 1WG4A 3BKUA 1F3FA 4WKYA 3LPEA 4WP3A 1OSDA 3NCQA 2P5VA 1HDHA 2FHKA 2CQ1A 1Q7LB 2IC3B 4K4SA 3NCPA 3NKYA 1FKOA 1VQ8S 1RT6A 1YZ6A 4CLPA 2FJAB 3CVKA 1HNVB 2NCKL 4OI4A 1R0CB 4GVBA 3QSIA 3NG8A 1IVZA 1WF2A 2GS8A 3JQMA 3PIPQ 3QAUA 3BSNA 3B78A 2GIFA 1H2TZ 4XK8C 4C4WA 4K59A 4A8KA 2M8DB 1FNMA 5LSLA 3GE9A 3TWZA 1VLYA 3MFHA 3IRXA 1U1KA 4XTTA 1NNDA 2J7KA 4IR9A 3PX6A 1VRQC 1VK8A 1SUQB 3G8TA 2MLZA 1N5YB 2QFJA 1TVRB 2DH9A 5HJYA 2R7VA 4NRTA 1RGVA 1U2FA 1M5SA 2IAJB 1RWOB 4F3QA 1VFJA 2UVVA 2F1FA 4OQJA 3G6XA 1A6LA 3HMJG 3OR2B 2IVYA 3D66A 4OJ3A 5IFMA 3W7BA 2DVIA 3MCNA 3K8WA 1KBRA 3MM9A 5E3QA 1FA0A 2J6UA 4QAXA 3IR6B 2QA4G 2RHQB 2ASLA 3C6TA 4U8YA 2E44A 1RAJA 1NK4A 2NPIA 4KBIA 1TKTB 3OJSA 2VG7A 4ZVRB 3VAIA 4NLDA 5T7LA 3MM7B 2Z56B 4O4GB 2GGPA 4EBDA 4PWWA 2AHOB 3VWSA 1RT7B 2CNLB 1U2CA 2BM0A 5K9FA 3BF4A 1HBNA 2KFZA 2HMIA 4PUOA 2Y1JA 4Q2LA 1U1PA 4RU9A 1H73A 3M8PA 2C3UA 4MTPA 2EEYA 1QTMA 2E7WA 5J2PA 3V6KA 2HS0A 3R5AA 2HHWA 2MKHA 1FI4A 4KGXB 3V6DA 4UY85 3QGGA 5EUHA 4UOCA 4MK8A 3H8YA 1AUSL 1N2LA 4A8WA 2JEGA 3QLHB 3CIMA 3W2VB 1WG1A 5AT1B 2MY7A 2OFGX 4KGKA 4DV6J 2DGVA 3FEXB 2APOA 2HAFA 2G2ZA 2QJ3A 2GQCA 1QLNA 4LF8F 3R2DJ 1EJJA 2NXJA 3BR8A 3EX7B 2FHJD 2XMKA 2ZH4A 3RR8A 3S1TA 1RWXB 3NNCA 1YRXA 4D3GA 3I82A 4URSA 4JI2F 2B6AA 2PD1A 3OLAA 1ICEB 2CFXA 5L1LA 4IFVA 4YR3A 3FRYA 4OI3A 1AROP 3NGRA 4FDFA 4ALZA 4WIQA 2ZZTA 1Y00A 3H5UA 2V5HG 4RO0A 4F0KA 1NLKL 4J9KA 3N5FA 5A8WA 2QZ8A 2IRXA 1SQFA 2VA2A 2RT3A 4K0KF 3VGVA 1H3DA 1AZSA 2H4YB 2CQ2A 5KG7A 3T6BA 5IM0B 2J9DE 2QLXA 5L39A 2DNHA 3NRBA 2XYHB 2LVWA 4Z7CA 2Y1RI 3KUEA 1YHQS 2FLPA 5LMNF 2E1PA 1P9QC 4LVNP 2QN6B 3ENQA 5HQMA 2MKCA 3V4MA 2B5JB 3TAMA 3OHAA 3HM9A 1GAOA 3OSNA 1RTIB 4X66F 4IH7A 3JB9k 1L5UA 3J81Y 2A3JA 1KQGB 1B64A 1UKUA 3BN4A 1BQNB 1AJDA 3ZZUA 1HD1A 3TR5A 1H2VZ 3WIUA 2C3PA 5HAOA 2FZKB 2I5JB 1KONA 5GVQA 1RHRB 5L38A 1QUVA 2W8DA 4C8ZA 2MKSA 2G0IA 5AE2A 2OPPB 2YPYA 4JV1A 1C4CA 3MR5A 2DISA 1RCXB 3PY8A 4N41A 4JV0A 3SZZA 3IS9B 3MD3A 4MIBA 2DCLA 2Q79A 4QQBA 2YX4A 1VQ9S 3CEDA 2IRYA 3FUYA 3LALA 4ZHRB 3BDHA 2IVFB 1HHTP 1N4LA 1S79A 2HRTA 1A7GE 1Q8IA 3TUJC 4KPCA 2NS1B 4DPOA 1OIAA 1OSCA 1KHNA 3VV2B 3AA8A 4Y6IA 4QWCA 2CAJA 1TUWA 1QAIA 5GADU 1U09A 4NA1A 5KFTA 1B4SA 5MAOA 2ASJA 2QO3A 4GO7X 3UR3C 2N3LA 3J7AN 2KYZA 3PRBA 1X4GA 2LXIA 1XMOJ 1R8CA 4OI1A 1AFJA 4UUXA 4OYZA 1NPPA 2FVPA 2VJVA 1VQPS 4ZP8A 1RI7A 3BO2A 1GH8A 2J5AA 4J9VA 1RAFB 2E1RA 3M8QA 1NDPA 1TUVA 2QTWA 4WK1A 2H5IB 3CIZA 3MR7A 5F9LA 1RTHB 3MPYA 3NBPB 1EKSA 3J81U 1VRTB 2XSFA 4K2XA 2PMZD 4D3HA 1SHQA 3HJVA 2B8PA 4NXNF 1M1HA 3DI6B 1W7WA 4MJKA 3N6MA 3GILA 3N6LA 3AOBA 2HVZA 3ZZRA 5EGYA 1JKHB 1S6PA 4W92B 4USMA 2N7CA 2NPFA 2FJEB 1IM4A 5KTQA 2N4DA 3G82B 4NX9A 1DURA 1U0HB 2LU1A 2GCFA 2NXEA 2OPRA 1B7FA 3D7SB 2CQPA 1SL1A 2FHMA 3PVXA 3GSIA 2OJ3A 4TU8A 1SXLA 2CJYB 4NI2A 4LIRA 2VA3A 3DYAB 3PJ9A 1N34J 1T95A 2VOOA 2UV8A 3R7BB 1VJQA 4B3SF 5L9NA 4USJC 6FDRA 3MM5B 1XR7A 1SQEA 4RUAA 1FWPA 5DS7A 1Y7AA 2ZBQA 1Q0NA 4ANDA 2EG1A 2J6SA 4PAAA 1PIEA 3ZTQA 4DL5A 5HROB 4DU7A 4IO1A 4UZCA 4RZRA 2IFYA 4TNOA 4A4JA 1HBUA 4DMZA 2E7VA 1ALHA 4NXMF 1WUUA 4OV1A 3M9NB 2O5DA 3BN7A 4M95A 3D28A 4DSLA 4ED1A 4RPFA 3QRQA 3EPIA 3CJ8A 1DLOA 4CZCA 3CMQA 2F3JA 4RNMA 3DOLA 3VR1A 1FDBA 2ZBCA 1GX6A 2WW4A 3R6LB 4RU2A 3EVWA 3WQPA 3BQ0A 3G9CA 4C8NA 2D74B 3DDNA 2QSFA 3T19A 2OEMA 8AT1B 3RBDA 2RRNA 4PCQA 1KHLA 2DITA 2DNYA 3NMAA 3CXCR 4C11B 4P6QA 3S7RA 4NLYA 4YUDA 4PQUA 3PJWA 3D4JA 3IM9A 4QBUA 2AJ4A 4EO8A 1T9UA 1X4BA 2DTJA 2PT0A 1KQKA 4PEOA 2D9PA 5IWAF 1BC6A 3J7YI 4UF4A 4J9LA 4ZMMA 2OMLA 3K5LA 1PSDA 5E7OB 1R89A 2B43A 3IP0A 3Q3QA 5LSOA 2V9WA 4ZVOB 1K1SA 1FE4A 4I4BA 4TQSA 2MQQA 1GMVA 3PW2A 5HQLA 3KLGA 4U9RA 3U27A 1PYSB 5C42B 3BQ1A 3SFGA 3FKBA 4YN3B 4O0IA 4C98A 3OW2R 4EZ6A 1RWVB 2K1RA 2HZVA 3PYEA 4UPKA 1NJXA 2PO4A 4OI6A 4GKKJ 4B02A 3EUNA 2X1GA 3FQLA 4WYWA 3RAMA 1HNIB 4H4KA 2ZH3A 2NR0A 4ZLPA 5GOVA 3GB0A 3DLEA 1T0TV 3CE8A 3LXQA 2XO7A 2MZQA 2OTLS 4IG0B 2VQEJ 1D9FA 2XTJP 4LSLB 2W7PA 2V2KA 1CQMA 1AA1B 4I64A 4HEA9 2XGQA 1J5EJ 3DMJA 2X1FA 2JNJA 4P72A 1WOOA 5CZVA 2DXEA 2VFVA 3HO1A 1B99A 4ZS6A 1I5OB 2LYVA 4WXWA 2GFFA 2AJ0A 2LQJA 3PTWA 4Y00A 1HKAA 3RB3A 4QIWD 1RE1B 3W60A 2FQQB 6FD1A 1ZPWX 4QW9A 2W9CB 2LLZA 2XZWA 1D1UA 2XLJA 4DX5A 1YJTA 2BKNA 1QD1A 1C0TB 1HYSB 2W9AA 2XI3A 3HULA 1S0MA 3EGZA 1VJWA 3NKOA 4Q43A 5DG8A 2FY8A 3R5CA 4NYOA 1VQNS 5KOXA 4GTXA 4DFKA 3QO9A 2VBXA 3LANA 5HN0A 4NPOA 4KY3A 2DEIA 2GA7A 2HNYA 2V8DA 1CSJA 4QCLA 1XNQJ 1FKPB 2ZJPQ 4EBEA 1K73T 2QC3A 2ZOGA 2JLEA 2CQ0A 3NKNA 5LOQA 4BWJA 2B7CB 2RQCA 3T3FA 3T5JA 1U6ZA 2LEBA 1EI6A 1OO0B 3NWRA 1WI6A 2ZE2A 1MLAA 1TMJA 1XN9A 2BMBA 3SZ2A 4JI0F 2VPZB 1X4AA 4FXVA 1XMQJ 3JQJA 1Y5LB 1MMNA 4EMDA 1S6UA 3FFIA 2I6WA 1FERA 4OX9J 3RZAA 5IT4A 3IGNA 2JDJA 2A6OA 2DBBA 3L7OA 5K14A 1ZM3A 1CS4A 4ED5A 2L9WA 1XNRF 5FJ4A 3C16B 3G6YA 5D0EA 3JSBA 2XRGA 3O1LA 2D9OA 2RB7A 4BCAA 1FDNA 4K4WA 3MEEA 4ZCIA 1N6QB 4KTQA 4BDPA 4M5DB 1CBKA 4ZVGA 3HFZB 4OYAA 3I4PA 4HKQA 4Z37A 3GV5B 1N33J 4DQQA 1FF2A 2E5GA 3N5BA 2Z2MA 5A76A 1RYSA 2ATCB 2F65A 1C1CB 2B3TB 3VAGA 2D7SA 3WAXA 2B51A 3E8OA 3TI0A 4MAKA 1NAQA 1BWVA 4I67A 1VBZA 3DGPA 1NK9A 5DDOC 3VGTA 3T1YJ 5CAAA 1K1QA 4X84A 2UXCJ 4B9LA 4EEYA 3GONA 3N28A 3KD8A 3HD1A 4DV3J 1S1VA 3TOQA 4FVCA 3G2XA 4C0BA 1K7HA 3AXMA 4H4MB 4LSZB 4JI7J 1RHJB 3B6BA 4CLKA 4I2PB 2DO4A 1HI8A 4N47A 1JLCA 5EGHA 2DXDA 3HI9A 2HBRB 1O5JA 3H5YA 3I32A 1BQMA 2UVRA 4DR5J 3OL6A 3T9ZA 3MMBA 4DUYJ 2RRBA 3R2CJ 5LXYA 1VHFA 5HJXA 4X65J 3GCXP 3KMQA 3F56A 3UD5A 4IR1A 4K4XA 3LP1A 4ANCA 1CVJA 4HH1A 1T3NA 2V63A 4PG7A 4DV7J 4KKOB 5HK4A 1CJUB 2OEKA 3RBEA 2RDJA 1JLQA 1NRKA 1S6QB 4B3RF 1ZS6A 4DCPB 4YDDB 3POTA 3CMRA 2G1DA 2YKMB 2GAGC 4LF5J 4KR0B 1DHMA 4K4TA 1IWGA 1OQ3A 3AD8C 4MYTA 2XNQA 4ZCKA 4JI5F 3SQGA 3OBIA 1X9MA 2CQDA 2RU9A 4P71A 5GAHI 4Y2MA 3SV4A 3MTKA 1B0PA 4P7TA 5C24B 1OMSA 2ZD1A 3IA0A 5A6PA 2X3DA 3H59A 3RRHA 3O8WA 1QY7A 2ZWPA 1ED8A 4KSEB 2WSEC 2UUWA 3TQEA 2VOPA 2RAQA 1UVNA 3BBBA 3L7PA 2HHVA 5DZ6A 2KYXA 5E3CA 2VDHA 1TL1B 5K8PA 2O66A 1RTJB 2UUBJ 2AGPA 4YY3F 2AYEA 4ELVA 2VICA 2KZMA 5KFLA 2J9EA 3WBZA 2J8SA 4QWAA 4MFBA 2BACA 3K17A 2ZFHA 4P7VA 1RB0A 3I6PA 1LXJA 1S1UB 2CXEA 3P4UB 1UVMA 3PKMA 3KDOA 2YY3A 2Y8WA 2IUCB 1IKWA 2H5JB 2IDLA 5FDLA 4RW7B 2J8AA 2H1YA 4DV2J 3NWGA 3PDNA 5D4LA 1FTRA 3M9MB 2L48A 5CCLA 4P2SA 2AV5A 5CYQB 1FE0A 1WSRA 1C4AA 3BSAA 2M9KA 1RKIA 3H40A 2YNIA 3BGOP 2VFUA 4NZ7A 3A13A 2I9SA 1UWBA 4DLGA 3HHLB 1F5AA 5DLTA 1RADB 1FRLA 5E0OA 2JLFA 8ATCB 2FJWA 1VQOS 3M05A 2U2FA 2HWHA 4CNZA 2QG9B 3KJVA 2DGOA 4F2RA 4DZDA 5D8HB 3MF5A 4O23A 3NS5A 2BJDA 4OZNA 5ADZA 2J7UA 4DV0J 3HT3A 3LW5C 1WF1A 1NMEB 5HLFA 5F0UA 2UXDJ 1T02A 2D3ZA 1VRUA 2RSQA 2L08A 2OPQA 3H2LA 1GTHA 3VQTA 1RBAA 2R3VA 3H2UB 2NZ4A 3M2VB 5F8JA 1KP6A 1OPIA 1TL3A 3BDEA 4LRFA 1W26A 1FDDA 2LDIA 3KNGA 2QA1A 1Y10A 2WBMA 1SKUB 5KG0A 4TU9A 3IG1A 3UCUP 2JC0A 2P9GA 4LRCA 3PX4A 1QVGR 4OHXA 2LQ8A 1JLBA 3EICA 2V67A 3A3OB 1LKZA 2QLBB 1DQ8A 3IWLA 3OVAA 1FKOB 2CPDA 5AJ3J 4I69A 1SJFA 4IG3B 5B08A 3P49B 3KG4A 4DI6A 3NL0A 3MUTP 1U6BA 3NGKA 5E3RA 4YEAA 2QA4S 1VLOA 4PPDA 1RT4A 2AT1B 4ICLB 5D6GA 2BE2A 5EWEA 2ALZA 3PACA 3DCAA 2DNLA 3LP0B 5D0GA 5KFKA 2DJWA 4C6AA 4OJHA 4X64J 1S9FA 3NEKA 4DX6A 1FRXA 4USIA 3IRXB 1A9NB 4HL9A 4B3TJ 3NOGA 4KAYA 3M8YA 1RHMB 1YITS 1QE1B 2XC9A 1H2UX 3D67A 4Q0BB 1SL2A 5MLCV 2MKJA 2DNRA 3FMWA 2OIHA 3RRKA 3DNCA 3R5DA 3N01A 5I42B 2IM3A 3K89A 2EBEA 1JLAB 3OVBA 3KLVA 1DQ9A 5D4PA 3IAS9 2H48B 3ILLA 2VKZG 4Y2KA 3LP2B 2BANB 5H9EK 4F25A 2ZOMA 5D3GA 4CO4A 1S1TB 1IKVA 4O0NA 4X4OA 1CJTB 1WKKA 1YBAA 5B0AA 2YNGB 2ZH9A 3KLFA 5M2UA 2SXLA 2P9EA 5H9FK 4ZP9A 3CCWA 4DL2A 3C6TB 3A52A 4ZJQA 2XSJB 2FHJA 1IWAA 3DFEA 1O0PA 4DR4J 4DQPA 2RDIA 2GIRA 1X4DA 5L8RC 2R7RA 1U02A 3IXQA 4Y2AA 1IXKA 2EFQA 1FD8A 2DNNA 2IVMA 4FZVA 3V4IB 5FIIA 3H42A 3D0IE 4UY8T 4J9UE 2LA6A 3CCZA 1RAAB 5ETLA 3ZNUA 1C1BB 1N5SA 2HK2A 1HHQA 1OYEA 3MR2A 1FXLA 2C42A 1P49A 4DF8A 3M1VB 3DLJA 1KOOA 4UORA 1HBOB 2O01C 4QR1A 5L0BA 4FDJA 3LWLA 2M7SA 4PYDA 4JI8F 4OYPA 4ZVPB 2GNKA 3CDEA 1MWZA 4OYXA 3A1YG 4TLRA 2VBWA 1YJ7A 2MHNA 3DLLQ 1X5OA 3R8YA 2ERRA 3Q83A 2UXBF 1WHYA 4MH8A 5AXLA 4V19X 4FF3A 1F5BA 3KK1B 3TA1A 4TN0A 1S4EA 2AX1A 3Q2SC 3ZZ0A 2HVIA 4C3MA 4ED6A 1V3RA 3CCMS 3QATA 2B8QA 2WOMA 1ZA2B 3DLKA 3I0RA 4KH0B 1S72S 3A3NB 5KFBA 4EWTA 2R7WA 2HQCA 4R0JA 4UT4A 1X7VA 1KQSR 4LF1A 1GTEA 3ZTSA 2H9ZA 4XDCA 3ZTPA 3H2VE 1MG7A 3WC2A 2E29A 2MXYA 3JTOA 1S6OA 2MGZA 4M5KA 3QJJA 3QIDA 3QYYA 2C2EA 1V3ZA 4KGZB 1X4CA 3EZOA 5F41A 3PM9A 2GJ2A 2BABA 3MECA 2Q6BA 3V5RA 2KL8A 1FSUA 4G1QB 5IJSA 4K50A 1RWKB 5ETOA 3ZO7A 3K57A 2OD6A 3UDVA 3GTYX 2MQOA 1Q8BA 2C2DA 3GV7B 4CM0A 2OSQA 2MSSA 1M5OC 3DOMA 3UCZP 2KFNA 2VL1A 4MKBA 3DRPA 4WFXA 4HI1A 3K5OA 1HNXJ 2W5TA 2V94A 2V0NA 3T1AA 3VALA 2K7JA 1EJ7L 1UETA 3E2DA 3KDNA 2BOPA 4X4VA 3CJ5A 1Q8KA 1FRHA 2JVRA 1ZEDA 2BX6A 2J9CA 2AX0A 1NSPA 3GFXA 3M2UB 2YKOA 4DR1F 2E5HA 1RT2A 2ZBIA 2QV6A 3ISZA 1IBKJ 1KWMA 2HHTA 2Z30B 3KHLA 2V4RA 3SFUA 1U8WA 1HR0J 4DR6J 3M6UA 5INHA 1QAJA 1KSPA 4ILRA 4XPCA 2Y8YA 1F5CA 1KR4A 4ECUA 3PHEA 2YKNA 1ELZA 1PAEX 2MQPA 1UFLA 2IA6A 1PILA 5IC6B 4F3OA 1ZM4A 1RWNB 1IJEB 3A8EA 2C2ZB 3AY0A 4ED7A 3QT5A 1HQUA 4IYQA 2DCUB 3WC0A 1FFSB 1KEKA 2HHHJ 1HJKA 1HQ2A 2R4FA 5KT2A 3RW6A 3GFHA 5AXMA 3VZHA 1T05B 4I7FA 2COLA 3ET6B 3RUBL 4WFAQ 3G6VA 4JBCA 4WWSA 4I6WA 1AUKA 4YMEA 1HLWA 4F4AA 2W8KA 5LT5A 4UQGA 3V81A 5D78A 1HPZA 2GLQA 1S10A 5IJQA 2A2DA 3FSYA 1D0EA 1LWCA 3UNYA 2B4VA 3MZIA 5F3ZA 4CO0A 4JI6F 1RTZA 1RYRA 1P9YA 3M2RA 1R3NA 2ZH6A 2F40A 1UZHA 5HBMA 2YTCA 2CJXB 1TFWA 1Y6VA 2BDPA 4LF9F 4F2SA 2ZDOA 3FGVA 2AYGA 2JFKA 1MU2A 3J7YU 5HMYA 4QWEA 1TK8A 4DV5F 2W2OP 4I2QA 1E6YA 2Y1LB 4ID5B 3G8SA 3MMCB 3VF0B 3HVAA 3N0VA 2ZITA 3KK2A 4WP8A 1RABB 3FQKA 1SKSA 3OFEA 2X7IA 2CQ4A 2JHEA 4YB1P 4A8OA 4FDIA 1YKWA 2XR9A 1N5VA 3EGNA 2XMMA 3HHLC 2BW7A 1B0VA 4EUVA 4CIOA 5EHHA 3KMSA 3TVYA 3MEDA 3VGSA 2I8EA 1KLNA 4RBTA 2K2PA 1KH4A 1U45A 3PR5B 4I6YA 2RH6A 2MEWA 4O3OA 2HZAA 3TYTA 3CSKA 4C8LA 2HRUA 2J0QD 1HFEL 3KLHB 1FJGJ 2ZKTA 2DHGA 1B70B 4MK7A 2VUGA 2WONB 5DLVA 1RZMA 2OELA 2IY5B 2NYIA 2HS3A 3LTOA 5KFFA 4UQTA 3UCGA 4CYUB 3K5NA 1RHUB 5L0KA 4M94A 5I3PA 5LL6d 2XY5A 2HGMA 1FXDA 1VR6A 4PG8A 5ITHA 4LFAF 1FWKA 4ECQA 3FVYA 3BR9A 2W5RA 4U7CA 3QRPA 5A0YA 4OZ5A 4CM2A 2GQQA 4A8QA 2J7WA 2WZ1A 3SDEB 1NPRA 1J5OA 2DK2A 3VZIA 3QMQA 3WBHA 5I3UB 3H25A 3QWUA 3Q8PB 2ZM6F 3M7VA 3PYGA 3GIJA 2MJNA 3UN3A 2R7SA 4QYZJ 2FC9A 4QU6A 4NLSA 1FESA 4C8YA 4OYMA 4KFBA 1LQ9A 3IAM9 3BKTA 3EDQB 1MNEA 2HFUA 3KKFA 3H0PA 1JJCB 3U02A 3PR4A 3E51A 4ZOSA 1F2GA 5H1SV 2M0GB 3R27A 3JAMU 3HLUA 4AQYF 2P9CA 4LF6J 5L9XA 4FYXB 1KLMA 3UPFA 3C2PA 2BJ8A 5J1EA 2JSXA 5KFEA 3W64A 3K59A 1GT8A 4QZVB 4P52A 3C3LA 3IWXA 2AGOA 4RW4B 4DV4F 4DS4A 1F0XA 1FEHA 4DX8H 4X4QA 1T11A 4DUTA 4F04B 3JS9A 1D8YA 1HQEA 3ICLA 4YR1A 1YGYA 3RB4A 2P8IA 1E6VA
chains in the Genus database with same CATH topology
2IUCB 1ZEDA 1O99A 3NKPA 5LQQA 4LRDA 1ELXA 3CMRA 2GLQA 1AJAA 2X98A 4QAXA 4KAYA 1O98A 3M8YA 1EW9A 4FDIA 3BDGA 3WBHA 5IJQA 1EW8A 5TJ3A 1URAA 4UOOA 4ZG6A 3M8ZA 1KH7A 2XR9A 4KAVA 4CXKA 3M7VA 3T02A 2GSUA 3BDFA 5K4PA 3UN5A 1SHNA 3UN3A 3UNYA 4UPKA 5LIAA 2VQRA 1EJJA 5EGHA 3NKOA 1KHJA 1KHNA 5AJ9A 1ALKA 5L0EA 4LRFA 1URBA 2XRGA 4KJGA 1ALIA 1AJBA 2W5XA 3IGYB 2W5WA 5C66A 1KH9A 3IDDA 4UPLA 4MIVA 1KH5A 2ANHA 4UPIA 3TWZA 4LR7A 1P49A 1E1ZP 4GTXA 4CYSA 1E33P 1HQAA 5INHA 2G9YA 1KH4A 3B5QA 4LREA 5DLWA 4UORA 2W5VA 3M8WA 4UPHA 2RH6A 4LRCA 4B56A 2W8SA 1N2KA 3IGZB 2GSOA 5L0BA 3NKQA 1KHLA 4FDJA 3NKRA 3MK2A 2D1GA 5GOVA 4MY4A 1EW2A 1Y6VA 3BDGB 1ELZA 4KJDA 1AJDA 4NWXA 1ZEBA 5DLTA 3MK1A 3UO0A 3LXQA 4GTWA 4CXUA 2ZKTA 3T01A 1ED8A 5LRNA 1ANJA 1E2SP 5HRTA 5DLVA 1FSUA 2GSNA 5IJSA 3WAVA 4CYRA 3WAYA 4KM4A 2IUCA 4LR2A 3WAXA 5GRRA 1Y7AA 1KHKA 4CXSA 3TG0A 1B8JA 5L0KA 3NKNA 4UOPA 2W8DA 2QZUA 1AJCA 1ANIA 1ELYA 3NKMA 1ED9A 1HJKA 4N7TA 5LRMA 3T00A 3A52A 3DPCA 4ZG7A 4GTYA 1HDHA 4LR8A 2W5SA 1EI6A 4ZGAA 3SZYA 4TN0A 3UN2A 2IFYA 2W5TA 2W5RA 3TX0A 3OT9A 3SZZA 4LR9A 1ZEFA 3MK0A 3DYCA 1SHQA 3Q3QA 3WAWA 3KD8A 3NVLA 2W5QA 1EQJA 1ALHA 5EGEA 5KXAA 4LQYA 1N2LA 4LRAA 3E2DA 4NWJA 4LRBA 4ZG9A 1ALJA 4MHXA 4YR1A 1K7HA 1E3CP 3BDHA 2GA3A 1AUKA 3ED4A 4GTZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IUC B;  1ZED A;  1O99 A;  3NKP A;  5LQQ A;  4LRD A;  1ELX A;  3CMR A;  2GLQ A;  1AJA A;  2X98 A;  4QAX A;  4KAY A;  1O98 A;  3M8Y A;  1EW9 A;  4FDI A;  3BDG A;  3WBH A;  5IJQ A;  1EW8 A;  5TJ3 A;  1URA A;  4UOO A;  4ZG6 A;  3M8Z A;  1KH7 A;  2XR9 A;  4KAV A;  4CXK A;  3M7V A;  3T02 A;  2GSU A;  3BDF A;  5K4P A;  3UN5 A;  1SHN A;  3UN3 A;  3UNY A;  4UPK A;  5LIA A;  2VQR A;  1EJJ A;  5EGH A;  3NKO A;  1KHJ A;  1KHN A;  5AJ9 A;  1ALK A;  5L0E A;  4LRF A;  1URB A;  2XRG A;  4KJG A;  1ALI A;  1AJB A;  2W5X A;  3IGY B;  2W5W A;  5C66 A;  1KH9 A;  3IDD A;  4UPL A;  4MIV A;  1KH5 A;  2ANH A;  4UPI A;  3TWZ A;  4LR7 A;  1P49 A;  1E1Z P;  4GTX A;  4CYS A;  1E33 P;  1HQA A;  5INH A;  2G9Y A;  1KH4 A;  3B5Q A;  4LRE A;  5DLW A;  4UOR A;  2W5V A;  3M8W A;  4UPH A;  2RH6 A;  4LRC A;  4B56 A;  2W8S A;  1N2K A;  3IGZ B;  2GSO A;  5L0B A;  3NKQ A;  1KHL A;  4FDJ A;  3NKR A;  3MK2 A;  2D1G A;  5GOV A;  4MY4 A;  1EW2 A;  1Y6V A;  3BDG B;  1ELZ A;  4KJD A;  1AJD A;  4NWX A;  1ZEB A;  5DLT A;  3MK1 A;  3UO0 A;  3LXQ A;  4GTW A;  4CXU A;  2ZKT A;  3T01 A;  1ED8 A;  5LRN A;  1ANJ A;  1E2S P;  5HRT A;  5DLV A;  1FSU A;  2GSN A;  5IJS A;  3WAV A;  4CYR A;  3WAY A;  4KM4 A;  2IUC A;  4LR2 A;  3WAX A;  5GRR A;  1Y7A A;  1KHK A;  4CXS A;  3TG0 A;  1B8J A;  5L0K A;  3NKN A;  4UOP A;  2W8D A;  2QZU A;  1AJC A;  1ANI A;  1ELY A;  3NKM A;  1ED9 A;  1HJK A;  4N7T A;  5LRM A;  3T00 A;  3A52 A;  3DPC A;  4ZG7 A;  4GTY A;  1HDH A;  4LR8 A;  2W5S A;  1EI6 A;  4ZGA A;  3SZY A;  4TN0 A;  3UN2 A;  2IFY A;  2W5T A;  2W5R A;  3TX0 A;  3OT9 A;  3SZZ A;  4LR9 A;  1ZEF A;  3MK0 A;  3DYC A;  1SHQ A;  3Q3Q A;  3WAW A;  3KD8 A;  3NVL A;  2W5Q A;  1EQJ A;  1ALH A;  5EGE A;  5KXA A;  4LQY A;  1N2L A;  4LRA A;  3E2D A;  4NWJ A;  4LRB A;  4ZG9 A;  1ALJ A;  4MHX A;  4YR1 A;  1K7H A;  1E3C P;  3BDH A;  2GA3 A;  1AUK A;  3ED4 A;  4GTZ A; 
#chains in the Genus database with same CATH topology
 4KO0 A;  1HBM B;  3H20 A;  5CYM B;  2Q3P A;  2CZV C;  3CJK B;  2GSU A;  2POK A;  5K8M A;  1XC9 A;  1SV5 A;  3MMA B;  1KHJ A;  4DCJ B;  5HP1 A;  5BR8 F;  4Y65 A;  3R3T A;  5KT7 A;  4OJ1 A;  1S9E B;  1SKW A;  3MUV P;  2ROG A;  5K8N A;  4LF4 F;  3EDR B;  2MZR A;  3TEH B;  3OXL A;  2A2C A;  3Q8V A;  3F0N A;  4H4O A;  3BDG B;  5E33 A;  1GMW D;  2ZBP A;  4WU2 A;  1RWP B;  2B9E A;  1CJV B;  1Y4Z B;  1E2S P;  3TAN A;  5KFW A;  2KU7 A;  5A2Q Y;  2G2Y A;  1TV6 B;  1S48 A;  1GXU A;  2GVZ B;  5FLX Y;  2FY1 A;  5J2M A;  4ZIV A;  3C6U B;  4YOE A;  1ZM9 A;  4GTY A;  3FSX A;  3W9H A;  2YKA A;  4ZPA A;  3WAW A;  1WEX A;  2V4J B;  2XS7 A;  2EFV A;  3GJT B;  4J90 A;  2EFP A;  1LWE A;  2BQU A;  1S9G B;  1EP4 A;  3D6F B;  1TK0 A;  1T9W A;  2PE8 A;  1RT3 B;  4DG1 A;  1KDN A;  5C2G A;  5DET A;  5BYQ A;  2AQ4 A;  3QIP A;  4F4K A;  4KJG A;  4L73 A;  4X4R A;  1JX4 A;  2A6M A;  4MIV A;  2Y1I A;  3D2W A;  4C97 A;  4W98 A;  1P8G A;  1T94 A;  3A3P B;  3IBC B;  5KG2 A;  2ALY B;  1EET A;  2N4C A;  2OPS A;  1RTD B;  5KFZ A;  2XZD B;  3RGI A;  1IR2 A;  4ZVS B;  4KQZ A;  4B3O B;  4NLQ A;  2KHC A;  2EVZ A;  1YJW S;  5HRT A;  2QYG A;  1MML A;  2DPJ A;  5H9E J;  1FJE B;  4RW8 A;  3TA2 A;  4JI4 J;  3Q89 A;  2JL9 A;  3FEZ A;  4LF7 J;  3PW5 A;  4DL0 C;  2ROP A;  1DRZ A;  5SZT A;  5GAG I;  4RW6 B;  4NZ0 A;  3UVJ B;  1Z2L A;  1Y9O A;  5H9F J;  4WCE Q;  1JMT A;  4QU7 A;  3MEE B;  4NLX A;  1VQ4 S;  3ENV A;  2M70 A;  3W5Y A;  2DNO A;  4I6A A;  4L76 A;  5DRK A;  3QGI A;  3MGJ A;  3RW7 A;  5FLX U;  2YQ3 A;  5GAH U;  4IOA Q;  3T6J A;  5HAT A;  2LQ9 A;  3TP2 A;  3K5M A;  3DRR A;  4CO3 A;  4PWD B;  2HBQ B;  3V6H A;  3OL7 A;  2W5W A;  3G8Q A;  4PR6 A;  3GG0 A;  1NO8 A;  1W2I A;  2L3M A;  5KT3 A;  3MAA B;  1TKZ B;  3CF5 Q;  1R7I A;  4F4Y A;  2FLO A;  2BUN A;  2CQG A;  2GHP A;  4LSN B;  4CH1 A;  3HHL D;  4Q44 A;  4K7Q A;  3H5S A;  1U48 A;  3M4X A;  3QGH A;  3T5H A;  1B0T A;  1F6T A;  2HW3 A;  4CYR A;  2UVU A;  3OTE A;  1NPK A;  2A18 A;  3TX8 A;  4CT9 A;  1C0U B;  1VQK S;  3LUY A;  4F4W A;  2OMO A;  3DPC A;  3P96 A;  4MKV A;  1R6V A;  4OHW A;  3EVO A;  4OZL A;  1IBM F;  3CJ2 A;  4DQI A;  1N54 B;  5DLG A;  1SJ1 A;  3EWG A;  4AL5 A;  4ES1 A;  1SH3 A;  5JUM A;  1YRU A;  1L3U A;  3E3X A;  3CTR A;  1LXN A;  1SUQ A;  1RKJ A;  2WHO A;  3FSI A;  3J80 U;  1WHW A;  2HND B;  2HS4 A;  1N5Y A;  2WVC A;  5C5J A;  1TVR A;  1VQL S;  2E7X A;  5IT9 Y;  4F02 A;  5ETQ A;  4XPE A;  3QNW B;  2IAJ A;  2EWH A;  1E1Z P;  3OR1 B;  3HP6 A;  3ILJ A;  1JLF B;  4A47 A;  4ZLL A;  1F9H A;  1HD0 A;  3OR2 A;  4P73 A;  4DR5 F;  5U47 A;  4DUY F;  1JLQ B;  4ECZ A;  1KQF B;  4Y0F A;  4O4R A;  2RQ4 A;  4JV2 A;  2HLT A;  2E1C A;  2CJ9 A;  2QEX S;  2GHV C;  5KG1 A;  4EU0 A;  2IFX A;  3JQK A;  3T00 A;  2ZVI A;  2CJA A;  5CD4 A;  1BQX A;  1HNW F;  2B4P A;  2HFN A;  5L46 A;  3OT9 A;  1HMV B;  1TKT A;  5IS2 A;  1D8Z A;  1N56 A;  4NYZ A;  3OFH A;  2WVE A;  3MM7 A;  4CWB A;  3KFW X;  1FX4 A;  3T1H J;  5D77 A;  1UP1 A;  3GG1 A;  3V2U C;  4O4G A;  5CD4 H;  2X98 A;  1RT7 A;  1EW8 A;  1URA A;  3PEJ A;  2G1H A;  2R2S A;  4ILM A;  3SSS A;  5D15 A;  4CO2 A;  4A8F A;  2PDA A;  1RA7 A;  2Z4P A;  2W7A A;  4J5O A;  2PGC A;  2WB1 D;  1NDK A;  3KHG A;  4Y2I A;  1ZM2 A;  5D0H A;  2DNK A;  3CC2 S;  2OI2 A;  3OHB A;  2CPJ A;  2V2V A;  6AT1 B;  1NHV A;  2V34 A;  2C2K B;  4BBY A;  2UV8 G;  1NJW A;  5J2Q B;  4JI2 J;  4J9S A;  4A8M P;  1NHU A;  1TL7 A;  1P1L A;  1RWW B;  3QLH A;  2IM2 A;  2M4M A;  3R5B A;  3W2V A;  4RNO A;  4WE1 B;  5CHC B;  3T5K A;  2N82 B;  2HBZ B;  2OP5 A;  5IQQ A;  3TAQ A;  3CJS A;  1XBW A;  1ZH5 A;  5D0R A;  1H6K X;  2V2Q A;  5K20 B;  2XQC A;  1AT1 B;  4AXJ A;  1KS2 A;  3JTP A;  3MAQ A;  2JEJ A;  2I0X A;  2E1A A;  2JLG A;  4DBQ A;  4F3M A;  2IRU A;  3DYC A;  3NGU A;  4YQW A;  2UZA A;  1EQJ A;  2W2N P;  4LRA A;  1PC4 A;  2P6T A;  4WJB A;  2E9R X;  2Y0S D;  5F3T A;  3AD9 C;  4K0K J;  1GX5 A;  5KFV A;  3IFE A;  1SH2 A;  1ZAV A;  4AUK A;  5TJ3 A;  4RNN A;  5EX3 A;  3UFC X;  1UWB B;  1VBX A;  1X31 C;  4X4U A;  4U6P A;  4QIG A;  2VOD A;  1H38 A;  1MMD A;  4CRJ A;  1GK8 A;  1YJU A;  5LMN J;  2B9X A;  2MMY A;  4B9S A;  4Z2X A;  1V9O A;  1Q78 A;  4DPX A;  2EW9 A;  4J7C A;  4G1I A;  1VC0 A;  3ISN C;  1Q53 A;  2QMX A;  2IHR 1;  3A8K A;  3EE3 A;  2E1M C;  4A46 A;  5A8K B;  2HLU A;  1SJ4 P;  4ZP6 A;  3MK2 A;  1YJV A;  3C14 B;  2VF3 A;  5IM0 A;  4X66 J;  2W9B B;  2HNZ B;  4R5P B;  4JI3 J;  2GJI A;  2HPU A;  2YWK A;  3PV8 A;  4EBC A;  1FXR A;  3SEO A;  1I1G A;  3NAI A;  2VFS A;  2B5J A;  2EFG A;  1NKB A;  1ZET A;  4YB7 A;  3RAQ A;  3KUH A;  2XS2 A;  3NY0 A;  2DY9 A;  1JXV A;  1X0P A;  1RTI A;  3HHE A;  2EK6 A;  4FYD A;  3CUL A;  2XYG B;  2V8H A;  1BQN A;  2C28 A;  1EW9 A;  4YHH F;  2UU9 F;  3T02 A;  1T9Y A;  3DLG B;  1JLB B;  2I5J A;  5B0E A;  2X51 A;  4CLL A;  4DCO B;  5F9N A;  1AFI A;  3LA0 A;  2XWY A;  2G0C A;  2M88 A;  2WB4 A;  4O44 B;  3VAK A;  2XB2 D;  1U25 A;  2OPP A;  4IQX A;  4RUB A;  5DLF A;  2W5V A;  3MAH A;  2CG4 A;  1U49 A;  2VG5 B;  3CCQ S;  4HTJ A;  3IS9 A;  1NKC A;  4YFU A;  3HKZ D;  3QT6 A;  4P75 A;  2OEJ A;  2GSN A;  2XEX A;  1I3O B;  3R6G B;  3CCE S;  2F4F A;  4EYH B;  1WTF A;  3ITH A;  2YKP A;  1EQ0 A;  2BRK A;  1D3W A;  3FJ2 A;  3I5A A;  3PJX A;  2DH8 A;  4M5N A;  1IJF B;  1Q8L A;  3PRD A;  4JI1 F;  3PW0 A;  4NML A;  3KHR A;  2FVQ A;  1XER A;  4K5R A;  5IV4 A;  4NXN J;  3ILO A;  4AT1 B;  3KXD A;  3OL9 A;  1NU4 A;  1L3T A;  2M8H A;  2ADB A;  3EZ5 A;  2YBV A;  5KFN A;  1AUD A;  2BJ1 A;  3WX8 A;  4DXL A;  1YK9 A;  1YBU A;  1IKV B;  1DFD A;  2R42 A;  4HLB A;  5SUH A;  3DM2 B;  1F1B B;  1GNK A;  1RTH A;  2MZT A;  4XO0 A;  1Q95 G;  3WHI A;  2DB1 A;  3NBP A;  3OLB A;  1YWX A;  2DIV A;  3S6E A;  2Q6C A;  2GSO A;  2H5E A;  4TU7 A;  2I1R A;  1VRT A;  4ES2 A;  1OY9 A;  2OFH X;  1S1X B;  1EW2 A;  1RLC L;  3RR7 A;  4NWX A;  2Y3Y A;  3DI6 A;  1U2R A;  4L75 A;  1ANJ A;  3TUI C;  1HNZ F;  1IKY B;  3CB4 A;  3DOK B;  1JKH A;  3NP5 A;  2ZZM A;  3BYP A;  1WC3 A;  2R2R A;  1Y11 A;  1FKA F;  2HHU A;  3FNN A;  4WBF A;  3G82 A;  2DRD A;  2H4W B;  1U0H A;  4C3L A;  3BSO A;  3OTD A;  5DG7 A;  4ELU A;  2CZ9 A;  4G6V B;  4DR4 F;  4Y34 A;  2K3I A;  1L3V A;  4WZQ A;  1O51 A;  3LAM A;  4IQM A;  4U67 Q;  3H90 A;  3DYA A;  1ELX A;  1LV5 A;  4NXM J;  1QAY A;  1RA6 A;  3GFY A;  3KG0 A;  3MM5 A;  1WNE A;  1M5K C;  3IGV A;  1WOR A;  1T9T A;  3IR5 B;  1HWK A;  1RDR A;  2CA9 A;  3VCD A;  4MKY A;  4LJM A;  1WHX A;  4J9Q A;  3GYG A;  1UA0 A;  2QE5 A;  2CAD A;  3HSD A;  1N36 F;  4ED8 A;  1WC1 A;  4X4N A;  2W24 A;  5HRO A;  2E66 A;  2FYX A;  3I9V 9;  4X62 F;  4B9N A;  1REG X;  1FNX H;  4MY4 A;  4OJG A;  4C2M A;  2NXU A;  4K8R A;  1KTV A;  3IR7 B;  3HVR A;  4TVA B;  3D0H E;  5G0R B;  3EMT A;  2ZJQ Q;  4F36 A;  3W9J A;  1B8J A;  3DLK B;  2B4U A;  3I5B A;  5CH7 B;  1R31 A;  3LAK A;  1CQN A;  4IFY B;  1UJ5 A;  1M0S A;  1U47 A;  1GFW B;  4DJB A;  3MPU B;  4K4U A;  5IWA J;  1GEH A;  4AL6 A;  2V69 A;  3QAE A;  4DU8 A;  2CPF A;  4L74 A;  1G4C A;  2DR5 A;  3U1L A;  3W2W B;  4NA3 A;  4C11 A;  4C8O A;  2B9W A;  5B09 A;  1I94 F;  4WFY A;  2D1C A;  1HWJ A;  4QIF A;  2ZUA A;  1SIZ A;  3BPS P;  2YH1 A;  3NAH A;  1UWA A;  4ECX A;  5L0E A;  1VQY A;  4DR2 F;  1XMB A;  1AW0 A;  2KN4 A;  1KH9 A;  5HI7 A;  1HI0 P;  2F63 A;  1JNZ B;  1UEU A;  2AW0 A;  2ILZ A;  3ZTO A;  1XR5 A;  4X4S A;  3DGV A;  3DOM B;  2HGL A;  2VJU A;  5A6W A;  3K2Y A;  1FHT A;  2A10 A;  4DSJ A;  1WTB A;  1RK8 A;  1TU0 B;  3N9U C;  2YNF B;  5I4M A;  2C2N A;  5C42 A;  2FUG 9;  4I68 A;  3CC4 S;  3ISN D;  3D6T B;  1JJ4 A;  1ED9 A;  5LRM A;  4Y28 C;  3NGS A;  1DY3 A;  1S7H A;  4CTA B;  3GSD A;  2F9J A;  2ILY A;  4ZN3 A;  2F5G A;  2AYM A;  3JYT B;  4USV A;  1RT2 B;  3SXL A;  2NYH A;  1JLE B;  1HNX F;  4HTI A;  1FTC A;  1WWH A;  2MJU A;  4K4Y A;  2LXF A;  1HNI A;  1VK3 A;  1H7X A;  3HVT B;  3IN5 A;  3AOA A;  1TEL A;  1NZA A;  3T41 A;  4NLU A;  5T14 A;  2WAQ D;  4Q8F A;  2VQR A;  4IG0 A;  4NLV A;  3OSP A;  2UP1 A;  4ECV A;  1AJB A;  4LSL A;  1N88 A;  2PSZ A;  2ABY A;  2AZ3 A;  2ZHB A;  3I31 A;  3UNG C;  2QMW A;  5HAN A;  3M30 B;  2CIM A;  2C1E B;  4ENO A;  2R7U A;  1U1O A;  3KLI B;  2JFD A;  1LW0 B;  2F4V F;  4LBH A;  1DTT B;  4N8N A;  3BGR B;  2R7X A;  3RBZ A;  2K06 A;  2GO9 A;  2AMC B;  5AE3 A;  1HPZ B;  2W9C A;  3L3C A;  1JJ2 R;  2AP6 A;  5KFM A;  1VMB A;  1HYS A;  1T8E A;  1PKU A;  4ZGA A;  1FRI A;  1SPB P;  1ZEF A;  3TRG A;  5L1K A;  2HYI B;  1MRO A;  5EGE A;  4FN5 A;  3CJR A;  3KTQ A;  1PJ5 A;  2FLN A;  1VC5 A;  4GTZ A;  2G2O A;  1TQL A;  1SC4 B;  3KK3 B;  1R8P A;  2DRB A;  1O99 A;  2PN6 A;  3GWC A;  2YWE A;  2PFD A;  1PG5 B;  2ZDP A;  1UEK A;  5HBM B;  4JI0 J;  1QDU B;  1KH7 A;  1FKP A;  1UJ6 A;  4QW8 A;  2CYY A;  4NCG B;  1YZ7 A;  3MMJ A;  2MKK A;  4UPL A;  1Y0H A;  1DTQ B;  2JEI A;  4N8O A;  4DS5 A;  1QSS A;  1XNR J;  1WEZ A;  3TZW A;  4DL6 A;  3NKR A;  4KE5 A;  2CNN B;  1SCJ B;  2HIQ A;  1ZAW A;  3KLE B;  4OYW A;  2ZH1 A;  4ID8 A;  3ILI A;  1RHQ B;  1N32 F;  5BXI A;  4NRU A;  1TL5 A;  3MWB A;  4CXS A;  2W4P A;  5A8R B;  1U4B A;  1ANI A;  1AJC A;  3ZZZ A;  2EC0 A;  4OLP A;  3OTO F;  3C16 A;  3M8R A;  1KD1 T;  4OX6 A;  1WI8 A;  1U8S A;  4ED4 A;  1N6Q A;  1EZZ B;  3THP A;  4IRC A;  3GP9 A;  4WK3 A;  4M5D A;  3HF5 A;  2ASD A;  3OUY B;  2HEK A;  4ZVT B;  1M1G A;  3BH7 B;  5F8L A;  3LWM A;  4IDK B;  2XNR A;  4TN2 A;  5HO4 A;  2RD5 C;  1C1C A;  2BJE A;  4KGV B;  1FK9 B;  3JXO A;  3DLB A;  3PZP A;  3BEG B;  2KO1 A;  2KRB A;  1YSJ A;  2EKN A;  4WPA A;  2QLW A;  2YQ0 A;  3M8W A;  2JJ4 D;  3US5 A;  4U96 A;  3EVM A;  4JYA F;  2KI2 A;  2VB6 A;  2L9N A;  1CPZ A;  2VPX B;  2CWX A;  4FBU A;  5A0Y B;  1VS3 A;  1NK7 A;  5GME A;  3B4D A;  3TG0 A;  3MHY A;  2HHP A;  3G6E S;  2E5L F;  3AB2 B;  1F9E B;  3NLC A;  2P2C B;  1HA1 A;  3D3C J;  1SB6 A;  1UJ4 A;  1NSA A;  3QSY B;  2ZHA A;  4DR7 F;  4O3S A;  2N3O A;  3FK4 A;  3OJU A;  2EXU A;  3RRG A;  3S8S A;  1GMW A;  1PYT A;  1WSV A;  2GMJ A;  1UVJ A;  1N5Q A;  5BJR A;  4B3R J;  1RT5 B;  3TQ1 A;  4Y3C A;  1QTN B;  1Y5I B;  3H4B A;  3NNA A;  4J9P A;  1FRJ A;  2DGT A;  1VQS A;  5KFP A;  2NXC A;  3ENA A;  2JEF A;  1HWU A;  4PXD A;  5J1E B;  3SIP B;  4KKO A;  1Y3J A;  1CJU A;  1LW2 A;  4JI5 J;  2L41 A;  1R0A B;  2IYG A;  4HR2 A;  3GYX B;  2IDE A;  1S6Q A;  3DKD A;  3HSZ A;  5E3P A;  2OGU A;  3MCS A;  4QPX A;  4MYU A;  1U26 A;  1AYE A;  5GAG U;  2YKM A;  5ETM A;  1BGX T;  3K58 A;  3MCO A;  2X1A A;  3MEG B;  2LA4 A;  4LFB F;  3ETM A;  1U1Q A;  3W62 A;  1QJH A;  4YR0 A;  1A0O B;  2OUG A;  4NAS A;  2W25 A;  4YY3 J;  2GA3 A;  2A0F B;  3ZNJ 1;  3SI8 A;  5C24 A;  3KG1 A;  4DSF A;  1SBR A;  3UDE A;  2FVR A;  3I87 A;  1J27 A;  2UUA F;  2YNH B;  4OLO A;  1SHN A;  5LIA A;  2EKY A;  4UW2 A;  1Q7Y T;  4QPT A;  2C3M A;  2A1B A;  2FGC A;  1MN7 A;  2RJZ A;  2MZS A;  1NK6 A;  3KOA A;  2PA3 A;  1X4E A;  3HHK A;  4IKA A;  3EPG A;  5B0G A;  5KFI A;  1TL1 A;  2P6S A;  2GQ2 A;  1RTJ A;  4ZPT R;  2CKW A;  4R25 A;  3FRZ A;  3RB0 A;  1RJJ A;  1ZEB A;  3I0S B;  3UO0 A;  5F8I A;  3JSR A;  1XEZ A;  3DC2 A;  1N52 B;  3X1L B;  1S1U A;  2RF2 B;  4QIE A;  2IUC A;  5GRR A;  2AJ1 A;  1JB0 C;  4RW7 A;  1TKX B;  1NHK L;  5JVH Q;  1EP4 B;  3IBF B;  4HDG A;  1TP7 A;  2YWW A;  1UW9 A;  1IBL F;  2BQR A;  3B4M A;  1JQG A;  1LWF B;  4ETX A;  5CYQ A;  1X9W A;  3MTJ A;  4ZP7 A;  2RUG A;  3AB4 B;  4HAC A;  3H98 A;  2XI2 A;  1CG2 A;  4JV5 F;  1WC6 A;  4DSE A;  4DPY A;  5E5N A;  3BGU A;  1IQZ A;  2XCA A;  4X2B A;  3HHL A;  2MKY A;  4LMZ A;  2OHD A;  3M8Z A;  1RP5 A;  3TW0 A;  5DM6 Q;  1NSK L;  2C3O A;  2O67 A;  2V8G A;  2CPI A;  1KHW A;  2PMH A;  1KH5 A;  4M5H A;  1WEY A;  1VBK A;  2VFR A;  3FCW A;  3B5Q A;  2LQ5 A;  2FJB B;  1T03 B;  3TZX A;  2CPE A;  3GYN A;  3CCU S;  3L4B C;  4FNI A;  3J7A 1;  2M2B A;  1RBO B;  5DQG A;  3Q8U A;  4DPT A;  2XG8 A;  1RUS A;  3BKF A;  3HDS A;  4M5G A;  1HW8 A;  2EFN A;  1NBE B;  4NMX A;  4Q45 A;  2CQC A;  4UUW A;  3VAH A;  3OFG A;  1WF0 A;  1SKR A;  2JZ5 A;  3P3D A;  1EAY C;  3UD3 P;  4JI4 F;  2IBK A;  3PX0 A;  5HL7 Q;  2ADC A;  5J2N B;  1REV B;  1S5Z A;  1X0F A;  2KRR A;  5KXA A;  4JP8 A;  3NXZ A;  2RDD A;  4ECY A;  4B9M A;  2W7O A;  2DRA A;  5B0F A;  3C46 A;  2NUH A;  3GR0 A;  4A48 A;  1RAG B;  1OS5 A;  4CNY A;  2YKQ A;  4IH5 A;  1NZ8 A;  1VBY A;  2BXJ A;  3E01 B;  1G3O A;  2IMO A;  4HI2 A;  2DHA A;  9RUB A;  4AE5 A;  3J7Z 5;  4IG3 A;  4Q8E A;  2LMI A;  2GVD B;  2VQF F;  1ITP A;  1LNQ A;  3ZZT A;  2J6T A;  1RU1 A;  4BWM A;  4ICL A;  4U7U K;  4LBI A;  4DV1 F;  4QYR A;  2GZO A;  2H54 B;  3W5Z A;  3LP0 A;  1RAI B;  1CJK B;  2V8V A;  4RL1 A;  2V6A A;  3FMB A;  3HSG A;  1X4F A;  2BOA A;  4C48 A;  2QLJ B;  2DHH A;  3KJF B;  3QFH A;  4FS2 A;  4M5J A;  1UL3 A;  1Q86 T;  1IKX B;  1QE1 A;  4KAI A;  4LQ3 A;  2BM1 A;  2DNQ A;  4Q0B A;  2K8G A;  4OI2 A;  4LR8 A;  4F26 A;  1W2B R;  3W9I A;  2CDQ A;  5I42 A;  3CME S;  2BJ3 A;  4P10 A;  2CJK A;  1CUL B;  3SCI E;  3NGT A;  1JLA A;  5KOW A;  3EXY A;  4ED0 A;  2EI5 A;  2EBG A;  2QSW A;  2DHX A;  3LP2 A;  2BAN A;  3BO4 A;  1UW4 A;  2W01 A;  2MQM A;  4EK2 A;  4R8U B;  2B9Y A;  4C7Q A;  1S1T A;  1KKH A;  4WF9 Q;  5KAK A;  1CJT A;  3L09 A;  2YNG A;  4FF4 A;  4AXI A;  1SL0 A;  2XMU A;  3NNH A;  4URG A;  2NQP A;  4ELT A;  2NZC A;  1JLG B;  4ZJO A;  4ZVH A;  2W4D A;  5JVG Q;  2XSJ A;  3AD7 C;  1RHK B;  3X3U A;  3MM8 A;  3CD7 A;  2CNO B;  3CMA S;  2OTJ S;  4ZPD A;  2VBZ A;  4S0M A;  3MM6 B;  2R7T A;  2M52 A;  5GMK a;  2BE7 D;  4JI8 J;  3V4I A;  3TVK A;  1QM9 A;  3D54 A;  3OTC A;  4DQR A;  2OKQ A;  1N0U A;  1P1T A;  1C1B A;  4NEZ A;  1FFW B;  5LJ3 Y;  3AHP A;  4DQS A;  1R27 B;  2AZ1 A;  3O3L A;  2UXB J;  4DL7 A;  3Q0A A;  1FT8 A;  2HHX A;  4WFB Q;  3M1V A;  4QR0 A;  3LGH A;  1TMM A;  3MOZ A;  1HBO A;  3CJ0 A;  3D9B A;  3T1H F;  1BWE A;  4MK9 A;  3FDS A;  1MWY A;  3SCJ E;  2HBY B;  2R8I A;  3BDF A;  4DPW A;  1N0V C;  1YTY A;  1TL7 B;  3DRS B;  4I1T A;  1B3T A;  1V5I B;  2R8H A;  4JOU A;  4UPI A;  3Q86 A;  5LSR A;  2Q1L A;  3LGN A;  2MHE A;  2PC6 A;  1SJR A;  5DLW A;  4ZIW A;  3KK1 A;  2VG6 B;  3C15 B;  2XYP B;  3QBC A;  3EXC X;  2I38 A;  1G6B A;  4RW9 B;  1BUX A;  3QRR A;  8RUC A;  2BBE A;  1TUG B;  1S1W B;  4PG4 A;  4IRD A;  2DR9 A;  3HPO A;  4J91 A;  3IC1 A;  4DR3 F;  5HSP A;  3P45 B;  4L6V 3;  4G3I A;  3AOC A;  2IJR A;  4KH1 B;  3AJ1 A;  3NMR A;  2ZC3 A;  3OVS A;  4B3M F;  4AYB D;  2FVS A;  3MPV A;  1S59 A;  3CWJ A;  3CGI A;  4LQY A;  4H54 A;  2UUC F;  4NLW A;  4F50 A;  4KV8 B;  3JSM B;  4I0W A;  2BQ3 A;  3BH6 B;  4TY8 B;  5LMU F;  2EFO A;  2WK4 A;  4GVL A;  2FJD B;  3FBB A;  2DNM A;  5IZH A;  1JXE A;  3GU0 A;  5DQH A;  4G1Q A;  4LFC F;  1Q81 T;  2FPH X;  4A8Y A;  4USH A;  4DUZ F;  3CDB A;  3G96 A;  2XZT B;  2H51 B;  2BR0 A;  3C8Y A;  1RT6 B;  4DR1 J;  1TR0 A;  3GJS B;  1U0S A;  4JUZ A;  1SIW B;  2W4C A;  4GVB B;  3VVU A;  4CT8 A;  3T01 A;  1P27 B;  2O1P A;  3PYF A;  2XY7 A;  2U1A A;  1EAR A;  2CQI A;  2VBY A;  3ADA C;  1ELO A;  3A8J A;  2HIY A;  4OZ3 A;  1ELY A;  5KFU A;  2GX8 A;  4JI3 F;  3BZQ A;  2JX2 A;  3Q22 A;  4ATN A;  3M2U A;  1ZTW A;  3TJ8 A;  2VPY B;  4YB5 A;  1B7Y B;  1BHN A;  2MLX A;  3GIM A;  3PFO A;  1VIX A;  1WC4 A;  1WDT A;  4K2J A;  3BGL A;  1OYD A;  4NEY A;  3CO9 A;  4PXE A;  2PI5 A;  3HD2 A;  3I5C A;  2NLW A;  3EGV A;  1H98 A;  4USK A;  2ATL A;  3A4T A;  1M90 T;  4FF1 A;  4QWD A;  2F9D A;  2VC0 A;  2Z0G A;  1PJ6 A;  3N79 A;  3VHQ A;  4DN9 A;  2HRY A;  3IGY B;  2DNZ A;  3CC7 S;  4IOC Q;  2DIU A;  2UUT A;  4HHH A;  1ZYQ A;  5CA5 A;  1U7L A;  3MM9 B;  4LF2 A;  2Q43 A;  4FKY A;  1LK7 A;  3ITH B;  3NGD A;  2YWG A;  1JIH A;  2E9Z A;  2N7Y A;  4JI6 J;  1T05 A;  2D1G A;  3VAM A;  3ET6 A;  2CPX A;  1FX2 A;  1PCA A;  4UZB A;  3AAW B;  1XK8 A;  3KHH A;  4Z7Y A;  4KIA A;  2FTR A;  4CH0 S;  5KT4 A;  2DXF A;  3QGP A;  4ZCM A;  4DDF A;  2VD3 A;  2VG7 B;  4LF9 J;  1ZPV A;  5T7L B;  1FFG B;  4O3N A;  1FCA A;  2K3K A;  3JSY A;  2FJV A;  2GGP B;  4DV5 J;  2G9O A;  3U1M A;  3QWP A;  2QMU B;  1RAO A;  1HBN B;  1KFS A;  3OFF A;  3UI3 A;  2HMI B;  1NB2 A;  4ZG9 A;  4PUO B;  2F8H A;  2MY8 A;  3TAP A;  4KYZ A;  3M8P B;  4WTO B;  2FGO A;  2KTQ A;  4NOH A;  3HFK A;  2YXL A;  3I56 S;  2KJW A;  1NSQ A;  4CLF A;  5J2P B;  1R8H A;  2R2U A;  1S0V A;  2KG0 A;  3V6D B;  2I2Y A;  1Y3K A;  1RT1 A;  2Y0B B;  4RLE A;  4ID5 A;  4PRF A;  3MMC A;  2VIH A;  4N77 A;  5FD1 A;  4B56 A;  1LEO A;  2Z2L A;  2AEJ A;  1VYA A;  3P5T L;  5DO2 A;  2ZBR A;  1Q5V A;  5IQ6 A;  3PRV A;  1OY6 A;  5KT6 A;  4NCA A;  2YWF A;  3HK2 A;  2KKH A;  4R0E A;  3W66 A;  5CZX A;  5KG3 A;  3AJD A;  2QYC A;  1UA1 A;  3SSR A;  3MI7 X;  2B6A B;  4NLG A;  5HVF A;  1FNO A;  3E2E A;  3ZZO A;  2OAU A;  5T41 A;  4IFV B;  2KHD A;  5CXT A;  4Q2M A;  3CT9 A;  5L1J A;  4GKJ J;  4DV6 F;  3CDA A;  4DOZ A;  4LFA J;  2KT3 A;  1VC6 A;  3I55 S;  3W3S A;  5KG5 A;  3VAF A;  3GQC A;  3D68 A;  2AF6 A;  2F8M A;  3NCR A;  2GV1 A;  1CC7 A;  4WFZ A;  3WZ0 A;  1Z2Z A;  1H74 A;  3Q2T C;  3KLH A;  4KHM A;  4FPI A;  4DSK A;  2KH9 A;  2WON A;  1EHW A;  5A8W B;  3AQO A;  2V4Q A;  1WDD A;  2WBR A;  1T9V A;  1AZS B;  4CYU A;  2DGW A;  3BM7 A;  4ED2 A;  2ZM6 J;  2GHW A;  3PIO Q;  1U24 A;  2AEM A;  2G9Y A;  1UMJ A;  2KFY A;  2W8S A;  4LT6 A;  3R1H A;  4FXW A;  1S99 A;  2BZ2 A;  1YJ9 S;  3L7U A;  3BB5 A;  3FCH A;  2FZC B;  4OX7 A;  4FVM A;  3MDF A;  1RCO B;  2HQD A;  3BGF A;  3SDE A;  2AWZ A;  2HWT A;  3TAM B;  4LR2 A;  2J0X A;  4K4V A;  3A12 A;  3A8I A;  2KDO A;  5I3U A;  3M32 A;  3QQC D;  4AQY J;  1N5T A;  2V2Z A;  1NKE A;  2KXN B;  4M5I A;  1VI7 A;  2XMW A;  4MIW A;  2ZH8 A;  2WVF A;  1S49 A;  3LPY A;  3NVL A;  1XTZ A;  3W61 A;  1H0H B;  4DV4 J;  2RS2 A;  3CPW R;  2M5Y A;  1YVF A;  4ANE A;  1U6F A;  3WDO A;  2XBP A;  3I96 A;  1XR6 A;  1T3O A;  3ONQ A;  5DM7 Q;  4WZM A;  4ETZ A;  2BE9 B;  2CDR B;  1U1L A;  4C0H A;  3EJM A;  2EC2 A;  4FF2 A;  1S7I A;  3AT1 B;  4USU A;  3SYZ A;  4E98 A;  3AA9 A;  4LR7 A;  3PCO B;  2YPZ A;  1TL4 A;  1WKJ A;  3CD5 A;  4L72 B;  4LRE A;  4RW4 A;  1ULR A;  4PG6 A;  5BR8 J;  4UPH A;  1N2K A;  5CYJ A;  5LXR A;  1UPM B;  4LUB A;  1YX2 A;  4KJD A;  2KJV A;  4LF4 J;  3P8B B;  2IM1 A;  4RJV A;  3K7R A;  3WIV A;  3ZZP A;  1R0B G;  2VDI A;  2LKZ A;  2YWH A;  1HBM A;  3AJ2 A;  5CYM A;  3CJ4 A;  1PO6 A;  3CJK A;  1WAC A;  4C8M A;  3MMA A;  3FZ2 A;  5KFQ A;  3SZY A;  1GMU A;  3TZZ A;  1S12 A;  1S9E A;  2WVB A;  1CEZ A;  2DGU A;  1T7P A;  1G2E A;  4LVO P;  1VHI A;  5HVH A;  3TNV A;  3BDG A;  3M8Q B;  3OXG A;  1X60 A;  1CJV A;  4NL5 A;  2E5I A;  1TV6 A;  3W8P A;  1ROF A;  2GVZ A;  4OHZ A;  3VGU A;  2MTL A;  4ER8 A;  1V5V A;  1XMO F;  4ECR A;  4CLS A;  3C6U A;  2C2O B;  1S6P B;  4IUF A;  3FZB A;  2HHS A;  4AFF A;  4OX8 A;  2CQ3 A;  4HVZ A;  2V4J A;  2DT9 A;  5LRN A;  5IC4 B;  1MRO B;  4NE9 C;  1S9G A;  2ZC4 A;  4F8R A;  4B17 A;  2OPR B;  3TUZ C;  1ZBT A;  1FO1 A;  1NM2 A;  1RT3 A;  1PJ7 A;  3O44 A;  4DFP A;  4FYW B;  5M2R A;  2VH7 A;  4NI2 B;  2PI4 A;  2PEH A;  3K8V A;  3GJQ B;  2LQB A;  1URN A;  2DR8 A;  4NA2 A;  3U1N A;  3BO3 A;  1IQT A;  1Q79 A;  1RTD A;  5C25 A;  3EYZ A;  1UVI A;  1EQM A;  3R5G A;  5AXN A;  4B3O A;  1RAH B;  4F0H A;  3HX9 A;  1N34 F;  4ZVU B;  2ZJR Q;  1HBU B;  1AXQ A;  1VCT A;  2VAS A;  1SQG A;  1K8A T;  2RH3 A;  3L95 X;  3KYL A;  7AT1 B;  4KHP J;  1OY8 A;  4RW6 A;  1DLO B;  1BMQ B;  5DJB A;  3UVJ A;  2FZG B;  2VKR A;  3DOL B;  2DNP A;  5I3Q A;  1YBT A;  4ZPW R;  3OL8 A;  1UCN A;  3TUP A;  4WII A;  4ZVQ B;  2F7V A;  2NUU G;  3IO1 A;  1VIS A;  2QZU A;  5KG6 A;  4OL8 A;  1Z1Z A;  1UFW A;  1IBC B;  1FRK A;  4OFZ A;  4OYO A;  1CLF A;  2H3E B;  5D4O A;  4A8S A;  3J81 j;  3PEH A;  2CZ4 A;  4PWD A;  2QL7 B;  3BBF A;  1G1X A;  4PQU B;  1TAQ A;  4CLZ A;  4JB8 B;  1N48 A;  2ZHO A;  3M9O B;  1KC8 T;  5LJ5 Y;  1M1K T;  2XCP A;  3MAA A;  1TKZ A;  1IBM J;  4HT5 A;  5ETP A;  1UFK A;  3L9Z A;  4LSN A;  2XMT A;  2QRR A;  2LEP A;  4M5L A;  4WYL A;  3B8H A;  3HXM A;  3NOC A;  1MN9 A;  3N4W A;  4CQ1 A;  4B9T A;  4O3Q A;  3R97 A;  2HGN A;  4DZ6 A;  3ZC4 A;  1C0U A;  3MD1 A;  1S76 D;  3KLG B;  2DGQ A;  3F73 A;  2QX0 A;  2GAH C;  1IUJ A;  3MUR P;  1UZD A;  1S0N A;  1S0O A;  5KFO A;  2K1R B;  4OZ1 A;  1KHV A;  1RAE B;  2QIF A;  2Z57 B;  2E5J A;  2VFT A;  3FBF A;  2HND A;  3IRW P;  3IMQ J;  2MB0 B;  1SC3 B;  4J9O A;  4OZ2 A;  3KWM A;  3Q24 A;  4GC7 A;  5B0C A;  1MSW D;  3MK0 A;  2LXU A;  3DLE B;  3PYD A;  4PXB A;  2BYC A;  2R9L A;  2CQH A;  3OR1 A;  5B7W A;  4CCH A;  4P74 A;  1JLF A;  2MZ1 A;  1QSL A;  4FXD A;  1HNW J;  4F4Z A;  5GAE I;  4GKK F;  4OYB A;  2AKW B;  1LW2 B;  1OJ4 A;  2QFI A;  2FVC A;  3PO4 A;  1P6T A;  2HQI A;  3DMJ B;  2AD9 A;  2HQG A;  1Y5N B;  2KM8 B;  1MWQ A;  2MQL A;  1NDL A;  1FDA A;  2ASY A;  1JNR B;  1RBL A;  3IGZ B;  4MIA A;  4C3K A;  2VQE F;  1FJ7 A;  4BLG A;  1HMV A;  1SH0 A;  1WHV A;  4DFM A;  3Q8R B;  2GIQ A;  1J5E F;  4UOF A;  3PO5 A;  5EWF A;  1RQ0 A;  3DU6 A;  2MKI A;  2RML A;  2RIJ A;  3QO9 B;  1NK8 A;  3HCX A;  1UVL A;  4CLT A;  2MLY A;  2HNY B;  5KFD A;  2IJN A;  1NDC A;  1VQM S;  2AU0 A;  5KFY A;  2HAI A;  4HHU A;  2KG1 A;  1RU2 A;  3SMZ A;  3M6X A;  4EO6 A;  1X5P A;  3NS6 A;  4MMO A;  2NRE A;  3GCW P;  1LFW A;  2XS5 A;  5J2Q A;  1VIO A;  1Q16 B;  1R6Y A;  4ZKA A;  4ZPV R;  2IJF A;  2RKI A;  2RIL A;  4WE1 A;  5HMX A;  4ED3 A;  1NB7 A;  2ZE2 B;  1S97 A;  4QYZ K;  3QZ8 A;  4DSI A;  3UDC A;  1XNQ F;  4UTG A;  1URR A;  3EZU A;  3PW7 A;  3FFI B;  2CQB A;  1PC5 A;  3G71 S;  3D5M A;  5K14 B;  3MFI A;  1CS4 B;  3TZY A;  4HAC B;  3M8S A;  3CD6 S;  2LU2 A;  3T9N A;  4K4Z A;  2VHG A;  5A2Q U;  4N7T A;  4HDH A;  5ETT A;  1XMQ F;  1AB8 A;  1YRT A;  1NK0 A;  1PAU B;  4OX9 F;  3KJQ B;  2CNK B;  1ALJ A;  2Z2Y B;  2JOQ A;  5A8K A;  4E0D A;  1RAC B;  4IOB A;  3UDL A;  3DHX A;  3IBW A;  3C14 A;  3DGP B;  2KT5 A;  2J9D A;  3B54 A;  4Y2C A;  4RUC A;  4RR5 A;  3D1Q A;  2LP4 A;  2BKO A;  1YQH A;  4FNH A;  2W9B A;  1XQI A;  2IC3 A;  2HNZ A;  5F8G A;  4R5P A;  1ALI A;  2H65 B;  4YHH J;  2YX1 A;  2UU9 J;  2W1B A;  1QAX A;  1S1V B;  4KRW A;  1N33 F;  1HNV A;  5IOL A;  4WP9 A;  3MR6 A;  1IM6 A;  2QT7 A;  4KT0 C;  2BRL A;  3BV8 A;  4P2X A;  4ECT A;  3TO8 A;  1JLC B;  4CXU A;  2FLL A;  4NLP A;  3T1Y F;  4V1A k;  3J7Z T;  1LOU A;  2O3D A;  3MEK A;  2UXC F;  3CD0 A;  3BQ2 A;  4RWX A;  4UOH A;  4OYI A;  2JC1 A;  2XO6 A;  4DV3 F;  1BQM B;  2Y9H A;  2HFV A;  2DEJ A;  3AQP A;  3DLG A;  4ZG7 A;  5J1N A;  3W63 A;  4JI7 F;  3MMB B;  1IN0 A;  2B4O A;  4O44 A;  1ZA1 B;  2CG8 A;  1E3C P;  2GO8 A;  2WW8 A;  3LP1 B;  4WTY A;  4L3K A;  1OPZ A;  1H7W A;  4PQA A;  1AJA A;  2VG5 A;  4JI1 J;  1T9X A;  1YJN S;  3CNQ P;  2KVQ E;  4OZ0 A;  4FS1 A;  3RBX A;  2UVW A;  4X65 F;  2CUY A;  4CI0 B;  3POT B;  1EB0 A;  4NLR A;  1FVS A;  2HUR A;  1XWL A;  5G4D A;  1JK9 B;  4DV7 F;  2R8G A;  4KHR A;  3BJY A;  2OSR A;  2B7B B;  4PG5 A;  3SQG B;  2MZJ A;  4PXC A;  3PHT A;  2MQ8 A;  3H7H B;  3CDU A;  2DR7 A;  1HNZ J;  1BY9 A;  3LQV A;  4TYB A;  2ZD1 B;  3QT7 A;  1SJQ A;  4DX7 A;  4RBU A;  3DM2 A;  1V6H A;  3H4D A;  4LF5 F;  3I4H X;  5F8N A;  1NK5 A;  1NEE A;  3QJL A;  1KVK A;  2D41 A;  3IWN C;  2QGF B;  1S1X A;  3MM8 B;  4X4T A;  4LF8 J;  3NS7 B;  5CQG A;  3O5T B;  1SC6 A;  1ZZN A;  1HWL A;  1L3K A;  5JXS A;  5K4P A;  1IKY A;  3DOK A;  2IM0 A;  2MDA A;  1UEV A;  2W5X A;  3MR3 A;  1S57 A;  1KFD A;  2GMH A;  4MFB B;  1GQE A;  3CJQ A;  5IT9 U;  2KXF A;  3DDI A;  1HL6 A;  1WD6 A;  3R7S B;  5K8O A;  2XY6 A;  3HKW A;  1IKW B;  2CJQ A;  4C8K A;  3BSC A;  5FDL B;  2CVE A;  4CO5 A;  5THW A;  1RIS A;  1NJI T;  7FD1 A;  1BE4 A;  1D9A A;  3LF0 A;  2R8K A;  1N36 J;  3BS9 A;  2UUB F;  4DEZ A;  3MUM P;  4KM4 A;  4LQ9 A;  4X62 J;  4ZLJ A;  2DY1 A;  4RNH A;  4HHJ A;  4OMF G;  2DR6 A;  2YNI B;  1CC8 A;  3TJ9 A;  1R8B A;  4A8X A;  2W5Q A;  4FYY B;  3W5X A;  4DHV A;  1FVQ A;  4DV2 F;  2D69 A;  1NJY A;  1YI2 S;  2QL9 B;  3HZG A;  4GO5 X;  3W1Y C;  3CCV S;  3KJV B;  1Q5Y A;  2XMV A;  2ZH2 A;  2BJ9 A;  5AJ9 A;  5G0R A;  2ZKU A;  1ZOT A;  3KJN B;  3F44 A;  2YQ1 A;  4Q5V A;  1DBD A;  2ANH A;  3UQS A;  1I94 J;  2B0G A;  2LCW A;  1SJ3 P;  1HIY A;  2BW2 A;  5DZ7 A;  4NWB A;  4RX6 A;  4HYK A;  3OTB A;  2J0W A;  5HLF B;  4IFY A;  1VRU B;  3CJT A;  2GC8 A;  4DR2 J;  1U1N A;  1JJH A;  1N8R T;  2OPQ B;  1NH7 A;  3ZXW A;  4DF4 A;  4ES3 A;  4W4M A;  3D6H B;  4XDD A;  2ZH5 A;  3RU0 A;  1TL3 B;  3ZFV A;  2XMJ A;  5KFH A;  3W2W A;  5KFA A;  2MYF A;  3DU5 A;  4UOP A;  4DV0 F;  2RUS A;  1S77 D;  3IG1 B;  4U7U D;  2ZEJ A;  4MT1 A;  2FC8 A;  2UXD F;  2ZNY A;  4YP3 A;  3EM1 A;  3D6M B;  1KN6 A;  3PW4 A;  4BC7 A;  5DDR C;  4N5S A;  3LO3 A;  1VOM A;  2L9D A;  2XWX A;  1HW9 A;  3AFG A;  5IT0 A;  5DDP C;  1O98 A;  4Q7A A;  1TTH B;  4RKU C;  2K7K A;  3C19 A;  2RU3 A;  4DWI A;  2YNF A;  2X1B A;  2LFV A;  1RT4 B;  3F41 A;  3HHN B;  1ALK A;  2PA8 D;  4CDI A;  2BE2 B;  3FBC A;  1HHS A;  4FYV B;  3UW1 A;  4ZHR A;  1EX8 A;  5HMW A;  3AH6 A;  4CTA A;  3DXB A;  1SVD A;  1YDL A;  3ENW A;  5K5M A;  1X9S A;  1KTQ A;  5AJ3 F;  3T5L A;  1VDH A;  4F4X A;  3JYT A;  4OIX A;  4EZ9 A;  2VON A;  2G4B A;  2DGX A;  2CJB A;  5DGB A;  3MK1 A;  4H4K C;  1JLE A;  1OQ6 A;  3HFV A;  5D4N A;  4KJI A;  3HVT A;  4YDX A;  1PBA A;  3BDP A;  4NLO A;  5F8M A;  4E8U A;  3CUN A;  1F2H A;  4X64 F;  3I9Z A;  2F4V J;  1WEL A;  3M6V A;  2XLI A;  1FEE A;  3HSJ A;  1Y7P A;  1VQ7 S;  3TX0 A;  1EIY B;  4B3T F;  1FRM A;  3N6N A;  5D3G B;  3M30 A;  2KM8 C;  1TK5 A;  1XIQ A;  2GW8 A;  4WFN Q;  3THV A;  3CJ3 A;  5LQQ A;  3KLI A;  3HHD A;  3KLF B;  5B0D A;  1RLD A;  2MQN A;  1DZ5 A;  1L3S A;  1LW0 A;  2RQK A;  4BHQ A;  2IIH A;  3UN5 A;  1DTT A;  3BGR A;  2HFS A;  4ECW A;  3ZTR A;  3FCV A;  4PYA A;  3K5P A;  1I6J A;  1HQA A;  2G0J A;  2WCX A;  1RWM B;  2EK1 A;  4WXO A;  1JXL A;  4IRK A;  2XM3 A;  3LGM A;  4B3S J;  4KPY A;  2KT2 A;  3NKQ A;  3DRY A;  3SV3 A;  4FBT A;  5E41 A;  2AYB A;  5KFG A;  3CCJ S;  4C9D A;  4GC6 A;  3RYL A;  3Q8Y A;  2D3U A;  3FC9 A;  1NXI A;  2GJF A;  3KK3 A;  2RRA A;  2PII A;  4V19 J;  2RE1 A;  2MST A;  5BYS A;  5C7P A;  2ZVS A;  4NCB A;  2ZZN A;  2R7Q A;  2BEF A;  1PYO B;  2BVZ A;  1N32 J;  1SI9 A;  3FBE A;  4NCG A;  1BD6 A;  5CCM A;  4B9V A;  2M3D A;  2CPH A;  4CLU A;  2PFF B;  1RT1 B;  2J76 E;  2RVJ A;  1DTQ A;  4NYP A;  1DQA A;  3OTO J;  5E2Q A;  2EG2 A;  3CCL S;  2AJF E;  4CH7 A;  3D0G E;  5F0W A;  1WG5 A;  4LRD A;  5B0B A;  5DGA A;  3NKP A;  2Z2Z A;  3DLH A;  3CW2 C;  1F9F A;  2W8L A;  4ECS A;  1EKR A;  2YH0 A;  4MKA A;  4UOO A;  3MPD A;  3KLE A;  2W2P P;  5KFX A;  4ZCL A;  2AGQ A;  3G4S S;  2CWK A;  2FD2 A;  2VV5 A;  3GJR B;  1VGY A;  3BBC A;  5A8R A;  1YG0 A;  2C3Y A;  3JAM Y;  2HQF A;  3OPK A;  2WOM B;  3I0R B;  4C0O C;  2XHC A;  2B56 A;  5IV3 A;  5GAD I;  1K9M T;  4TLQ A;  3QJP A;  3R5J B;  2J0S D;  4M5M A;  3RJM B;  2Z8Q A;  3BYR A;  4PWU A;  3HJF A;  3WAV A;  2HG4 A;  2BJ7 A;  2R8J A;  3OUY A;  3SSQ A;  4PPZ A;  3UE2 A;  2V8P A;  4JYA J;  3BRE A;  1UTA A;  3TA0 A;  4IDK A;  1F3V A;  2MGZ B;  3O2I A;  3CO0 P;  2OO4 A;  1IR0 A;  1BLU A;  3PFE A;  5ETV A;  1FK9 A;  3MEC B;  4CP5 A;  2EPI A;  1Q1K A;  2W2M P;  3GFZ A;  2E5L J;  2FDN A;  3KNA A;  2ZOF A;  2XUL A;  1HI1 A;  2PMW A;  3ED4 A;  4GKJ F;  1WJ9 A;  4DR7 J;  4NLT A;  4ZJL A;  2KXH A;  3UR0 A;  4ZVF A;  3DRP B;  3VQS A;  2CPZ A;  4QJV A;  3CCT A;  2PEB A;  3OD2 A;  4TY9 A;  1VQ6 S;  5KT5 A;  2HHQ A;  9ATC B;  4CYS A;  3M32 B;  5M2P A;  2RHS B;  3LH2 S;  4OI0 A;  1R8A A;  2ACY A;  2YVS A;  3AOD A;  3GII A;  2QLF B;  5KFR A;  2XMA A;  3SCL E;  1Q4R A;  3D1H A;  4G65 A;  2HSE B;  2JH3 A;  2NSC A;  3R9L A;  2BKP A;  2XHW A;  3Q8Q B;  2HQ3 A;  3QZ7 A;  1K0V A;  3TEG A;  5EDW A;  1FD2 A;  2IMW P;  3SCK E;  1RT5 A;  2AEF A;  2AJQ A;  2R7O A;  3PNI A;  4RUH A;  2WSF C;  3LOU A;  2KB2 A;  1WC0 A;  2LEA A;  2IYI A;  2YKN B;  5HVG A;  2OLW A;  4USW A;  4NZ6 A;  4N76 A;  2R2T A;  2V50 A;  4LFB J;  4K5S A;  1O8B A;  3C66 A;  1WOP A;  3M6W A;  4GRS A;  1R0A A;  3PKY A;  1BXN A;  2VPW B;  1HQU B;  2F8E X;  2FB0 A;  3Q23 A;  4BS2 A;  1IBK F;  3MPW A;  2V9K A;  4CXK A;  3DHW C;  1WKL A;  1V3S A;  1HR0 F;  4DR6 F;  3R7N B;  2GML A;  2NSB A;  4E2F B;  4I7F B;  1Z4U A;  3W65 A;  2UUA J;  3UD4 P;  3P6Y C;  4PKD B;  4DN0 A;  3MEG A;  2IA0 A;  4F7V A;  3QT8 A;  3V81 B;  5ETN A;  4G1P A;  2HVE A;  1KNZ A;  5C2C A;  1C0T A;  2DD8 S;  4M63 A;  2C22 A;  1LWC B;  2HHH F;  1QSY A;  2OH2 A;  3MCM A;  3U7J A;  4RNF A;  1U1R A;  4HH0 A;  1KHK A;  1Q82 T;  1K0T A;  4KC5 A;  2VU5 A;  3TAR A;  3NKM A;  3M2R B;  2YNH A;  4TQR A;  3DDK A;  5F8H A;  2AJ2 A;  3UN2 A;  1JWW A;  4PAB A;  1UVK A;  1KOH A;  1YIJ S;  1XJW B;  1ZAX A;  1MU2 B;  5AE1 A;  3CCR S;  3OV7 A;  1IBL J;  3GIK A;  4OHV A;  1X4H A;  1APS A;  3IM8 A;  2DYA A;  4EGL A;  3R1L A;  4I2Q B;  1E6Y B;  4FKX A;  3I0S A;  1ZTT A;  3OQ2 A;  2WVD A;  1TFY A;  2X3G A;  4JV5 J;  3KK2 B;  2RF2 A;  1TKX A;  5EWG A;  2RS8 A;  5CAB A;  1RWU A;  1LK5 A;  1C2P A;  3THT A;  5L1I A;  3VVT A;  1HWI A;  1LWF A;  4QIV A;  1WOS A;  4ZPB A;  3WX4 A;  1RSC A;  2XLK A;  2KZZ A;  1ACM B;  4ZLN A;  3V6J A;  4HT7 A;  3DRX A;  4OV6 A;  3MED B;  4ZDN A;  1DAX A;  1HAR A;  3H5X A;  5C25 B;  1NJZ A;  3BPD A;  5BYR A;  2DPI A;  4KB7 A;  5GAE U;  3Q8S B;  4DLE A;  1I51 B;  3OXF A;  2C2M B;  4W90 B;  1TZ0 A;  5HMZ A;  5DDQ C;  3GMG A;  3J80 Y;  4XAK A;  5JJB A;  1T03 A;  2DO0 A;  5AXK A;  2FIU A;  4PZV A;  1S4F A;  2ZUG A;  3MXH P;  1KVJ A;  4KAV A;  3O6Q A;  1VQ5 S;  2XGP A;  4UOG A;  4ZVE A;  2D3O 1;  2ACM A;  2VC1 A;  3GV8 B;  4L3N A;  4KGM A;  7FDR A;  2MPU A;  1URB A;  5ETK A;  5C66 A;  5KFS A;  4ERD A;  4OHY A;  4LIW A;  1IR1 A;  3IDD A;  2BV3 A;  3UWT A;  4AL7 A;  4H4M A;  1U1M A;  1R43 A;  1FJG F;  2W2Q P;  5ETS A;  4B9U A;  4ZN1 A;  4I2P A;  4F0M A;  4P9S A;  4DL3 A;  1J5O B;  1YLX A;  1NCL A;  2CPY A;  3SBM A;  2IBO A;  4XIU A;  5J2N A;  1REV A;  2VQF J;  4OZJ A;  5IXU A;  4KHP F;  2D3O R;  3ULH A;  4RWW A;  1W25 A;  2HFO A;  2HVH A;  4DPU A;  4DV1 J;  2FHO B;  4J9M A;  4KFB B;  5GMD A;  1SC1 B;  1UAW A;  5DQI A;  4ILL A;  4CLY A;  4CLW A;  3E01 A;  4RBV A;  2VZ9 A;  1LWX A;  3D1O A;  3GLJ A;  4O3P A;  2Q66 A;  4AD6 A;  2GVD A;  1QVF R;  4GMK A;  4LRB A;  1MW7 A;  5DG9 A;  3RG6 A;  3CDW A;  3HVW A;  1X8D A;  3G87 A;  1KLM B;  3B82 A;  3QFW A;  3VTI A;  2JVO A;  2ZWO A;  4ZG6 A;  1CJK A;  4IH6 A;  1M5V C;  2NXN A;  4QR2 A;  2QL5 B;  4QOT A;  2C2R A;  4CO1 A;  5EX0 A;  1G7C B;  2Z58 B;  2ROE A;  2HK3 A;  2JWN A;  1IKX A;  1HQE B;  1E33 P;  2FJX A;  4UST A;  4ZK7 M;  4TXS A;  4J9R A;  4LF6 F;  1E6V B;  2JRS A;  2DNG A;  3PXG a;  4KO0 B;  3SQO P;  5KFJ A;  1UPP A;  4YS2 A;  4ZA1 A;  3P5B P;  3D3B J;  1CUL A;  4GTW A;  1D9D A;  3EGW B;  4EYI B;  2RNE A;  4J9N A;  1SV5 B;  1RXO B;  1K47 A;  5HP1 B;  5JMN A;  1NH8 A;  1PGZ A;  3S01 A;  2WTF A;  2KVI A;  4O3R A;  3K0J A;  4R8U A;  3GIR A;  4ITS A;  1OWX A;  4H4O B;  4WKR A;  4LR9 A;  2DGS A;  2G13 A;  3HT0 A;  4YB6 A;  3DN9 A;  3GZ7 A;  2E9T A;  2DH7 A;  1JLG A;  5KG4 A;  4U8V A;  1NUE A;  4FP9 A;  4EI2 A;  3GR1 A;  3W8G A;  3RAX A;  2QA2 A;  1M5H A;  3ELH A;  5LM7 E;  4F67 A;  1ZZF A;  2ZNZ A;  2CRL A;  5J2M B;  4EFA C;  1O6X A;  2HFZ A;  3FEY B;  1TAU A;  3MM6 A;  2WRM A;  2HVD A;  1KVI A;  3ZZY A;  5KFC A;  4N56 A;  1X5T A;  2DKO B;  2IPO B;  4DL4 A;  3MOJ B;  3HZE A;  4J37 A;  4M1K A;  1LWE B;  4ZPC A;  1QUP A;  2AIR B;  1H72 C;  4I56 A;  2YX7 A;  2HWI A;  1LFP A;  2ZH7 A;  4LBP A;  4DG1 B;  3AXK A;  4URQ U;  4P2F A;  5E3A A;  2V68 A;  4ZIT A;  3QIP B;  1FJC A;  3WAY A;  1PBU A;  1FWL A;  3ETO A;  2LDY A;  3DRS A;  4P2M A;  4B08 A;  2W5S A;  4IO9 Q;  1F60 B;  2RKI B;  4DR3 J;  1EET B;  2OPS B;  2BA9 A;  3TJA A;  2DHS A;  1DAR A;  3VAJ A;  4NWJ A;  4B3M J;  4DFJ A;  4YR2 A;  1DJ0 A;  4MHX A;  3PG9 A;  3KUG A;  5EN1 A;  2VG6 A;  3C15 A;  4QWB A;  3G86 A;  4U95 A;  3JTN A;  5J1P A;  2HZC A;  4TKT A;  1J2V A;  4RW9 A;  2LEC A;  2UUC J;  4RW8 B;  3QPI A;  4M8L A;  3DXS X;  1S1W A;  3RB6 A;  5LMU J;  1GXL A;  1K44 A;  1WC5 A;  1D09 B;  1YJR A;  3CCS S;  2CVI A;  3TVZ A;  1M5P C;  1GXT A;  3RTV A;  4LFC J;  4WU3 A;  4X4P A;  2OD4 A;  4DUZ J;  1KRP A;  1X5S A;  3M2V A;  4FPR A;  4BC9 A;  4TYA A;  3GPA A;  2WSC C;  2RQM A;  2HKE A;  4KV8 A;  3JSM A;  5ETR A;  4LF7 F;  3DRR B;  4TY8 A;  5RUB A;  1TKD A;  5HQ8 A;  1WG4 A;  3BKU A;  1F3F A;  4WKY A;  3LPE A;  4WP3 A;  1OSD A;  3NCQ A;  2P5V A;  1HDH A;  2FHK A;  2CQ1 A;  1Q7L B;  2IC3 B;  4K4S A;  3NCP A;  3NKY A;  1FKO A;  1VQ8 S;  1RT6 A;  1YZ6 A;  4CLP A;  2FJA B;  3CVK A;  1HNV B;  2NCK L;  4OI4 A;  1R0C B;  4GVB A;  3QSI A;  3NG8 A;  1IVZ A;  1WF2 A;  2GS8 A;  3JQM A;  3PIP Q;  3QAU A;  3BSN A;  3B78 A;  2GIF A;  1H2T Z;  4XK8 C;  4C4W A;  4K59 A;  4A8K A;  2M8D B;  1FNM A;  5LSL A;  3GE9 A;  3TWZ A;  1VLY A;  3MFH A;  3IRX A;  1U1K A;  4XTT A;  1NND A;  2J7K A;  4IR9 A;  3PX6 A;  1VRQ C;  1VK8 A;  1SUQ B;  3G8T A;  2MLZ A;  1N5Y B;  2QFJ A;  1TVR B;  2DH9 A;  5HJY A;  2R7V A;  4NRT A;  1RGV A;  1U2F A;  1M5S A;  2IAJ B;  1RWO B;  4F3Q A;  1VFJ A;  2UVV A;  2F1F A;  4OQJ A;  3G6X A;  1A6L A;  3HMJ G;  3OR2 B;  2IVY A;  3D66 A;  4OJ3 A;  5IFM A;  3W7B A;  2DVI A;  3MCN A;  3K8W A;  1KBR A;  3MM9 A;  5E3Q A;  1FA0 A;  2J6U A;  4QAX A;  3IR6 B;  2QA4 G;  2RHQ B;  2ASL A;  3C6T A;  4U8Y A;  2E44 A;  1RAJ A;  1NK4 A;  2NPI A;  4KBI A;  1TKT B;  3OJS A;  2VG7 A;  4ZVR B;  3VAI A;  4NLD A;  5T7L A;  3MM7 B;  2Z56 B;  4O4G B;  2GGP A;  4EBD A;  4PWW A;  2AHO B;  3VWS A;  1RT7 B;  2CNL B;  1U2C A;  2BM0 A;  5K9F A;  3BF4 A;  1HBN A;  2KFZ A;  2HMI A;  4PUO A;  2Y1J A;  4Q2L A;  1U1P A;  4RU9 A;  1H73 A;  3M8P A;  2C3U A;  4MTP A;  2EEY A;  1QTM A;  2E7W A;  5J2P A;  3V6K A;  2HS0 A;  3R5A A;  2HHW A;  2MKH A;  1FI4 A;  4KGX B;  3V6D A;  4UY8 5;  3QGG A;  5EUH A;  4UOC A;  4MK8 A;  3H8Y A;  1AUS L;  1N2L A;  4A8W A;  2JEG A;  3QLH B;  3CIM A;  3W2V B;  1WG1 A;  5AT1 B;  2MY7 A;  2OFG X;  4KGK A;  4DV6 J;  2DGV A;  3FEX B;  2APO A;  2HAF A;  2G2Z A;  2QJ3 A;  2GQC A;  1QLN A;  4LF8 F;  3R2D J;  1EJJ A;  2NXJ A;  3BR8 A;  3EX7 B;  2FHJ D;  2XMK A;  2ZH4 A;  3RR8 A;  3S1T A;  1RWX B;  3NNC A;  1YRX A;  4D3G A;  3I82 A;  4URS A;  4JI2 F;  2B6A A;  2PD1 A;  3OLA A;  1ICE B;  2CFX A;  5L1L A;  4IFV A;  4YR3 A;  3FRY A;  4OI3 A;  1ARO P;  3NGR A;  4FDF A;  4ALZ A;  4WIQ A;  2ZZT A;  1Y00 A;  3H5U A;  2V5H G;  4RO0 A;  4F0K A;  1NLK L;  4J9K A;  3N5F A;  5A8W A;  2QZ8 A;  2IRX A;  1SQF A;  2VA2 A;  2RT3 A;  4K0K F;  3VGV A;  1H3D A;  1AZS A;  2H4Y B;  2CQ2 A;  5KG7 A;  3T6B A;  5IM0 B;  2J9D E;  2QLX A;  5L39 A;  2DNH A;  3NRB A;  2XYH B;  2LVW A;  4Z7C A;  2Y1R I;  3KUE A;  1YHQ S;  2FLP A;  5LMN F;  2E1P A;  1P9Q C;  4LVN P;  2QN6 B;  3ENQ A;  5HQM A;  2MKC A;  3V4M A;  2B5J B;  3TAM A;  3OHA A;  3HM9 A;  1GAO A;  3OSN A;  1RTI B;  4X66 F;  4IH7 A;  3JB9 k;  1L5U A;  3J81 Y;  2A3J A;  1KQG B;  1B64 A;  1UKU A;  3BN4 A;  1BQN B;  1AJD A;  3ZZU A;  1HD1 A;  3TR5 A;  1H2V Z;  3WIU A;  2C3P A;  5HAO A;  2FZK B;  2I5J B;  1KON A;  5GVQ A;  1RHR B;  5L38 A;  1QUV A;  2W8D A;  4C8Z A;  2MKS A;  2G0I A;  5AE2 A;  2OPP B;  2YPY A;  4JV1 A;  1C4C A;  3MR5 A;  2DIS A;  1RCX B;  3PY8 A;  4N41 A;  4JV0 A;  3SZZ A;  3IS9 B;  3MD3 A;  4MIB A;  2DCL A;  2Q79 A;  4QQB A;  2YX4 A;  1VQ9 S;  3CED A;  2IRY A;  3FUY A;  3LAL A;  4ZHR B;  3BDH A;  2IVF B;  1HHT P;  1N4L A;  1S79 A;  2HRT A;  1A7G E;  1Q8I A;  3TUJ C;  4KPC A;  2NS1 B;  4DPO A;  1OIA A;  1OSC A;  1KHN A;  3VV2 B;  3AA8 A;  4Y6I A;  4QWC A;  2CAJ A;  1TUW A;  1QAI A;  5GAD U;  1U09 A;  4NA1 A;  5KFT A;  1B4S A;  5MAO A;  2ASJ A;  2QO3 A;  4GO7 X;  3UR3 C;  2N3L A;  3J7A N;  2KYZ A;  3PRB A;  1X4G A;  2LXI A;  1XMO J;  1R8C A;  4OI1 A;  1AFJ A;  4UUX A;  4OYZ A;  1NPP A;  2FVP A;  2VJV A;  1VQP S;  4ZP8 A;  1RI7 A;  3BO2 A;  1GH8 A;  2J5A A;  4J9V A;  1RAF B;  2E1R A;  3M8Q A;  1NDP A;  1TUV A;  2QTW A;  4WK1 A;  2H5I B;  3CIZ A;  3MR7 A;  5F9L A;  1RTH B;  3MPY A;  3NBP B;  1EKS A;  3J81 U;  1VRT B;  2XSF A;  4K2X A;  2PMZ D;  4D3H A;  1SHQ A;  3HJV A;  2B8P A;  4NXN F;  1M1H A;  3DI6 B;  1W7W A;  4MJK A;  3N6M A;  3GIL A;  3N6L A;  3AOB A;  2HVZ A;  3ZZR A;  5EGY A;  1JKH B;  1S6P A;  4W92 B;  4USM A;  2N7C A;  2NPF A;  2FJE B;  1IM4 A;  5KTQ A;  2N4D A;  3G82 B;  4NX9 A;  1DUR A;  1U0H B;  2LU1 A;  2GCF A;  2NXE A;  2OPR A;  1B7F A;  3D7S B;  2CQP A;  1SL1 A;  2FHM A;  3PVX A;  3GSI A;  2OJ3 A;  4TU8 A;  1SXL A;  2CJY B;  4NI2 A;  4LIR A;  2VA3 A;  3DYA B;  3PJ9 A;  1N34 J;  1T95 A;  2VOO A;  2UV8 A;  3R7B B;  1VJQ A;  4B3S F;  5L9N A;  4USJ C;  6FDR A;  3MM5 B;  1XR7 A;  1SQE A;  4RUA A;  1FWP A;  5DS7 A;  1Y7A A;  2ZBQ A;  1Q0N A;  4AND A;  2EG1 A;  2J6S A;  4PAA A;  1PIE A;  3ZTQ A;  4DL5 A;  5HRO B;  4DU7 A;  4IO1 A;  4UZC A;  4RZR A;  2IFY A;  4TNO A;  4A4J A;  1HBU A;  4DMZ A;  2E7V A;  1ALH A;  4NXM F;  1WUU A;  4OV1 A;  3M9N B;  2O5D A;  3BN7 A;  4M95 A;  3D28 A;  4DSL A;  4ED1 A;  4RPF A;  3QRQ A;  3EPI A;  3CJ8 A;  1DLO A;  4CZC A;  3CMQ A;  2F3J A;  4RNM A;  3DOL A;  3VR1 A;  1FDB A;  2ZBC A;  1GX6 A;  2WW4 A;  3R6L B;  4RU2 A;  3EVW A;  3WQP A;  3BQ0 A;  3G9C A;  4C8N A;  2D74 B;  3DDN A;  2QSF A;  3T19 A;  2OEM A;  8AT1 B;  3RBD A;  2RRN A;  4PCQ A;  1KHL A;  2DIT A;  2DNY A;  3NMA A;  3CXC R;  4C11 B;  4P6Q A;  3S7R A;  4NLY A;  4YUD A;  4PQU A;  3PJW A;  3D4J A;  3IM9 A;  4QBU A;  2AJ4 A;  4EO8 A;  1T9U A;  1X4B A;  2DTJ A;  2PT0 A;  1KQK A;  4PEO A;  2D9P A;  5IWA F;  1BC6 A;  3J7Y I;  4UF4 A;  4J9L A;  4ZMM A;  2OML A;  3K5L A;  1PSD A;  5E7O B;  1R89 A;  2B43 A;  3IP0 A;  3Q3Q A;  5LSO A;  2V9W A;  4ZVO B;  1K1S A;  1FE4 A;  4I4B A;  4TQS A;  2MQQ A;  1GMV A;  3PW2 A;  5HQL A;  3KLG A;  4U9R A;  3U27 A;  1PYS B;  5C42 B;  3BQ1 A;  3SFG A;  3FKB A;  4YN3 B;  4O0I A;  4C98 A;  3OW2 R;  4EZ6 A;  1RWV B;  2K1R A;  2HZV A;  3PYE A;  4UPK A;  1NJX A;  2PO4 A;  4OI6 A;  4GKK J;  4B02 A;  3EUN A;  2X1G A;  3FQL A;  4WYW A;  3RAM A;  1HNI B;  4H4K A;  2ZH3 A;  2NR0 A;  4ZLP A;  5GOV A;  3GB0 A;  3DLE A;  1T0T V;  3CE8 A;  3LXQ A;  2XO7 A;  2MZQ A;  2OTL S;  4IG0 B;  2VQE J;  1D9F A;  2XTJ P;  4LSL B;  2W7P A;  2V2K A;  1CQM A;  1AA1 B;  4I64 A;  4HEA 9;  2XGQ A;  1J5E J;  3DMJ A;  2X1F A;  2JNJ A;  4P72 A;  1WOO A;  5CZV A;  2DXE A;  2VFV A;  3HO1 A;  1B99 A;  4ZS6 A;  1I5O B;  2LYV A;  4WXW A;  2GFF A;  2AJ0 A;  2LQJ A;  3PTW A;  4Y00 A;  1HKA A;  3RB3 A;  4QIW D;  1RE1 B;  3W60 A;  2FQQ B;  6FD1 A;  1ZPW X;  4QW9 A;  2W9C B;  2LLZ A;  2XZW A;  1D1U A;  2XLJ A;  4DX5 A;  1YJT A;  2BKN A;  1QD1 A;  1C0T B;  1HYS B;  2W9A A;  2XI3 A;  3HUL A;  1S0M A;  3EGZ A;  1VJW A;  3NKO A;  4Q43 A;  5DG8 A;  2FY8 A;  3R5C A;  4NYO A;  1VQN S;  5KOX A;  4GTX A;  4DFK A;  3QO9 A;  2VBX A;  3LAN A;  5HN0 A;  4NPO A;  4KY3 A;  2DEI A;  2GA7 A;  2HNY A;  2V8D A;  1CSJ A;  4QCL A;  1XNQ J;  1FKP B;  2ZJP Q;  4EBE A;  1K73 T;  2QC3 A;  2ZOG A;  2JLE A;  2CQ0 A;  3NKN A;  5LOQ A;  4BWJ A;  2B7C B;  2RQC A;  3T3F A;  3T5J A;  1U6Z A;  2LEB A;  1EI6 A;  1OO0 B;  3NWR A;  1WI6 A;  2ZE2 A;  1MLA A;  1TMJ A;  1XN9 A;  2BMB A;  3SZ2 A;  4JI0 F;  2VPZ B;  1X4A A;  4FXV A;  1XMQ J;  3JQJ A;  1Y5L B;  1MMN A;  4EMD A;  1S6U A;  3FFI A;  2I6W A;  1FER A;  4OX9 J;  3RZA A;  5IT4 A;  3IGN A;  2JDJ A;  2A6O A;  2DBB A;  3L7O A;  5K14 A;  1ZM3 A;  1CS4 A;  4ED5 A;  2L9W A;  1XNR F;  5FJ4 A;  3C16 B;  3G6Y A;  5D0E A;  3JSB A;  2XRG A;  3O1L A;  2D9O A;  2RB7 A;  4BCA A;  1FDN A;  4K4W A;  3MEE A;  4ZCI A;  1N6Q B;  4KTQ A;  4BDP A;  4M5D B;  1CBK A;  4ZVG A;  3HFZ B;  4OYA A;  3I4P A;  4HKQ A;  4Z37 A;  3GV5 B;  1N33 J;  4DQQ A;  1FF2 A;  2E5G A;  3N5B A;  2Z2M A;  5A76 A;  1RYS A;  2ATC B;  2F65 A;  1C1C B;  2B3T B;  3VAG A;  2D7S A;  3WAX A;  2B51 A;  3E8O A;  3TI0 A;  4MAK A;  1NAQ A;  1BWV A;  4I67 A;  1VBZ A;  3DGP A;  1NK9 A;  5DDO C;  3VGT A;  3T1Y J;  5CAA A;  1K1Q A;  4X84 A;  2UXC J;  4B9L A;  4EEY A;  3GON A;  3N28 A;  3KD8 A;  3HD1 A;  4DV3 J;  1S1V A;  3TOQ A;  4FVC A;  3G2X A;  4C0B A;  1K7H A;  3AXM A;  4H4M B;  4LSZ B;  4JI7 J;  1RHJ B;  3B6B A;  4CLK A;  4I2P B;  2DO4 A;  1HI8 A;  4N47 A;  1JLC A;  5EGH A;  2DXD A;  3HI9 A;  2HBR B;  1O5J A;  3H5Y A;  3I32 A;  1BQM A;  2UVR A;  4DR5 J;  3OL6 A;  3T9Z A;  3MMB A;  4DUY J;  2RRB A;  3R2C J;  5LXY A;  1VHF A;  5HJX A;  4X65 J;  3GCX P;  3KMQ A;  3F56 A;  3UD5 A;  4IR1 A;  4K4X A;  3LP1 A;  4ANC A;  1CVJ A;  4HH1 A;  1T3N A;  2V63 A;  4PG7 A;  4DV7 J;  4KKO B;  5HK4 A;  1CJU B;  2OEK A;  3RBE A;  2RDJ A;  1JLQ A;  1NRK A;  1S6Q B;  4B3R F;  1ZS6 A;  4DCP B;  4YDD B;  3POT A;  3CMR A;  2G1D A;  2YKM B;  2GAG C;  4LF5 J;  4KR0 B;  1DHM A;  4K4T A;  1IWG A;  1OQ3 A;  3AD8 C;  4MYT A;  2XNQ A;  4ZCK A;  4JI5 F;  3SQG A;  3OBI A;  1X9M A;  2CQD A;  2RU9 A;  4P71 A;  5GAH I;  4Y2M A;  3SV4 A;  3MTK A;  1B0P A;  4P7T A;  5C24 B;  1OMS A;  2ZD1 A;  3IA0 A;  5A6P A;  2X3D A;  3H59 A;  3RRH A;  3O8W A;  1QY7 A;  2ZWP A;  1ED8 A;  4KSE B;  2WSE C;  2UUW A;  3TQE A;  2VOP A;  2RAQ A;  1UVN A;  3BBB A;  3L7P A;  2HHV A;  5DZ6 A;  2KYX A;  5E3C A;  2VDH A;  1TL1 B;  5K8P A;  2O66 A;  1RTJ B;  2UUB J;  2AGP A;  4YY3 F;  2AYE A;  4ELV A;  2VIC A;  2KZM A;  5KFL A;  2J9E A;  3WBZ A;  2J8S A;  4QWA A;  4MFB A;  2BAC A;  3K17 A;  2ZFH A;  4P7V A;  1RB0 A;  3I6P A;  1LXJ A;  1S1U B;  2CXE A;  3P4U B;  1UVM A;  3PKM A;  3KDO A;  2YY3 A;  2Y8W A;  2IUC B;  1IKW A;  2H5J B;  2IDL A;  5FDL A;  4RW7 B;  2J8A A;  2H1Y A;  4DV2 J;  3NWG A;  3PDN A;  5D4L A;  1FTR A;  3M9M B;  2L48 A;  5CCL A;  4P2S A;  2AV5 A;  5CYQ B;  1FE0 A;  1WSR A;  1C4A A;  3BSA A;  2M9K A;  1RKI A;  3H40 A;  2YNI A;  3BGO P;  2VFU A;  4NZ7 A;  3A13 A;  2I9S A;  1UWB A;  4DLG A;  3HHL B;  1F5A A;  5DLT A;  1RAD B;  1FRL A;  5E0O A;  2JLF A;  8ATC B;  2FJW A;  1VQO S;  3M05 A;  2U2F A;  2HWH A;  4CNZ A;  2QG9 B;  3KJV A;  2DGO A;  4F2R A;  4DZD A;  5D8H B;  3MF5 A;  4O23 A;  3NS5 A;  2BJD A;  4OZN A;  5ADZ A;  2J7U A;  4DV0 J;  3HT3 A;  3LW5 C;  1WF1 A;  1NME B;  5HLF A;  5F0U A;  2UXD J;  1T02 A;  2D3Z A;  1VRU A;  2RSQ A;  2L08 A;  2OPQ A;  3H2L A;  1GTH A;  3VQT A;  1RBA A;  2R3V A;  3H2U B;  2NZ4 A;  3M2V B;  5F8J A;  1KP6 A;  1OPI A;  1TL3 A;  3BDE A;  4LRF A;  1W26 A;  1FDD A;  2LDI A;  3KNG A;  2QA1 A;  1Y10 A;  2WBM A;  1SKU B;  5KG0 A;  4TU9 A;  3IG1 A;  3UCU P;  2JC0 A;  2P9G A;  4LRC A;  3PX4 A;  1QVG R;  4OHX A;  2LQ8 A;  1JLB A;  3EIC A;  2V67 A;  3A3O B;  1LKZ A;  2QLB B;  1DQ8 A;  3IWL A;  3OVA A;  1FKO B;  2CPD A;  5AJ3 J;  4I69 A;  1SJF A;  4IG3 B;  5B08 A;  3P49 B;  3KG4 A;  4DI6 A;  3NL0 A;  3MUT P;  1U6B A;  3NGK A;  5E3R A;  4YEA A;  2QA4 S;  1VLO A;  4PPD A;  1RT4 A;  2AT1 B;  4ICL B;  5D6G A;  2BE2 A;  5EWE A;  2ALZ A;  3PAC A;  3DCA A;  2DNL A;  3LP0 B;  5D0G A;  5KFK A;  2DJW A;  4C6A A;  4OJH A;  4X64 J;  1S9F A;  3NEK A;  4DX6 A;  1FRX A;  4USI A;  3IRX B;  1A9N B;  4HL9 A;  4B3T J;  3NOG A;  4KAY A;  3M8Y A;  1RHM B;  1YIT S;  1QE1 B;  2XC9 A;  1H2U X;  3D67 A;  4Q0B B;  1SL2 A;  5MLC V;  2MKJ A;  2DNR A;  3FMW A;  2OIH A;  3RRK A;  3DNC A;  3R5D A;  3N01 A;  5I42 B;  2IM3 A;  3K89 A;  2EBE A;  1JLA B;  3OVB A;  3KLV A;  1DQ9 A;  5D4P A;  3IAS 9;  2H48 B;  3ILL A;  2VKZ G;  4Y2K A;  3LP2 B;  2BAN B;  5H9E K;  4F25 A;  2ZOM A;  5D3G A;  4CO4 A;  1S1T B;  1IKV A;  4O0N A;  4X4O A;  1CJT B;  1WKK A;  1YBA A;  5B0A A;  2YNG B;  2ZH9 A;  3KLF A;  5M2U A;  2SXL A;  2P9E A;  5H9F K;  4ZP9 A;  3CCW A;  4DL2 A;  3C6T B;  3A52 A;  4ZJQ A;  2XSJ B;  2FHJ A;  1IWA A;  3DFE A;  1O0P A;  4DR4 J;  4DQP A;  2RDI A;  2GIR A;  1X4D A;  5L8R C;  2R7R A;  1U02 A;  3IXQ A;  4Y2A A;  1IXK A;  2EFQ A;  1FD8 A;  2DNN A;  2IVM A;  4FZV A;  3V4I B;  5FII A;  3H42 A;  3D0I E;  4UY8 T;  4J9U E;  2LA6 A;  3CCZ A;  1RAA B;  5ETL A;  3ZNU A;  1C1B B;  1N5S A;  2HK2 A;  1HHQ A;  1OYE A;  3MR2 A;  1FXL A;  2C42 A;  1P49 A;  4DF8 A;  3M1V B;  3DLJ A;  1KOO A;  4UOR A;  1HBO B;  2O01 C;  4QR1 A;  5L0B A;  4FDJ A;  3LWL A;  2M7S A;  4PYD A;  4JI8 F;  4OYP A;  4ZVP B;  2GNK A;  3CDE A;  1MWZ A;  4OYX A;  3A1Y G;  4TLR A;  2VBW A;  1YJ7 A;  2MHN A;  3DLL Q;  1X5O A;  3R8Y A;  2ERR A;  3Q83 A;  2UXB F;  1WHY A;  4MH8 A;  5AXL A;  4V19 X;  4FF3 A;  1F5B A;  3KK1 B;  3TA1 A;  4TN0 A;  1S4E A;  2AX1 A;  3Q2S C;  3ZZ0 A;  2HVI A;  4C3M A;  4ED6 A;  1V3R A;  3CCM S;  3QAT A;  2B8Q A;  2WOM A;  1ZA2 B;  3DLK A;  3I0R A;  4KH0 B;  1S72 S;  3A3N B;  5KFB A;  4EWT A;  2R7W A;  2HQC A;  4R0J A;  4UT4 A;  1X7V A;  1KQS R;  4LF1 A;  1GTE A;  3ZTS A;  2H9Z A;  4XDC A;  3ZTP A;  3H2V E;  1MG7 A;  3WC2 A;  2E29 A;  2MXY A;  3JTO A;  1S6O A;  2MGZ A;  4M5K A;  3QJJ A;  3QID A;  3QYY A;  2C2E A;  1V3Z A;  4KGZ B;  1X4C A;  3EZO A;  5F41 A;  3PM9 A;  2GJ2 A;  2BAB A;  3MEC A;  2Q6B A;  3V5R A;  2KL8 A;  1FSU A;  4G1Q B;  5IJS A;  4K50 A;  1RWK B;  5ETO A;  3ZO7 A;  3K57 A;  2OD6 A;  3UDV A;  3GTY X;  2MQO A;  1Q8B A;  2C2D A;  3GV7 B;  4CM0 A;  2OSQ A;  2MSS A;  1M5O C;  3DOM A;  3UCZ P;  2KFN A;  2VL1 A;  4MKB A;  3DRP A;  4WFX A;  4HI1 A;  3K5O A;  1HNX J;  2W5T A;  2V94 A;  2V0N A;  3T1A A;  3VAL A;  2K7J A;  1EJ7 L;  1UET A;  3E2D A;  3KDN A;  2BOP A;  4X4V A;  3CJ5 A;  1Q8K A;  1FRH A;  2JVR A;  1ZED A;  2BX6 A;  2J9C A;  2AX0 A;  1NSP A;  3GFX A;  3M2U B;  2YKO A;  4DR1 F;  2E5H A;  1RT2 A;  2ZBI A;  2QV6 A;  3ISZ A;  1IBK J;  1KWM A;  2HHT A;  2Z30 B;  3KHL A;  2V4R A;  3SFU A;  1U8W A;  1HR0 J;  4DR6 J;  3M6U A;  5INH A;  1QAJ A;  1KSP A;  4ILR A;  4XPC A;  2Y8Y A;  1F5C A;  1KR4 A;  4ECU A;  3PHE A;  2YKN A;  1ELZ A;  1PAE X;  2MQP A;  1UFL A;  2IA6 A;  1PIL A;  5IC6 B;  4F3O A;  1ZM4 A;  1RWN B;  1IJE B;  3A8E A;  2C2Z B;  3AY0 A;  4ED7 A;  3QT5 A;  1HQU A;  4IYQ A;  2DCU B;  3WC0 A;  1FFS B;  1KEK A;  2HHH J;  1HJK A;  1HQ2 A;  2R4F A;  5KT2 A;  3RW6 A;  3GFH A;  5AXM A;  3VZH A;  1T05 B;  4I7F A;  2COL A;  3ET6 B;  3RUB L;  4WFA Q;  3G6V A;  4JBC A;  4WWS A;  4I6W A;  1AUK A;  4YME A;  1HLW A;  4F4A A;  2W8K A;  5LT5 A;  4UQG A;  3V81 A;  5D78 A;  1HPZ A;  2GLQ A;  1S10 A;  5IJQ A;  2A2D A;  3FSY A;  1D0E A;  1LWC A;  3UNY A;  2B4V A;  3MZI A;  5F3Z A;  4CO0 A;  4JI6 F;  1RTZ A;  1RYR A;  1P9Y A;  3M2R A;  1R3N A;  2ZH6 A;  2F40 A;  1UZH A;  5HBM A;  2YTC A;  2CJX B;  1TFW A;  1Y6V A;  2BDP A;  4LF9 F;  4F2S A;  2ZDO A;  3FGV A;  2AYG A;  2JFK A;  1MU2 A;  3J7Y U;  5HMY A;  4QWE A;  1TK8 A;  4DV5 F;  2W2O P;  4I2Q A;  1E6Y A;  2Y1L B;  4ID5 B;  3G8S A;  3MMC B;  3VF0 B;  3HVA A;  3N0V A;  2ZIT A;  3KK2 A;  4WP8 A;  1RAB B;  3FQK A;  1SKS A;  3OFE A;  2X7I A;  2CQ4 A;  2JHE A;  4YB1 P;  4A8O A;  4FDI A;  1YKW A;  2XR9 A;  1N5V A;  3EGN A;  2XMM A;  3HHL C;  2BW7 A;  1B0V A;  4EUV A;  4CIO A;  5EHH A;  3KMS A;  3TVY A;  3MED A;  3VGS A;  2I8E A;  1KLN A;  4RBT A;  2K2P A;  1KH4 A;  1U45 A;  3PR5 B;  4I6Y A;  2RH6 A;  2MEW A;  4O3O A;  2HZA A;  3TYT A;  3CSK A;  4C8L A;  2HRU A;  2J0Q D;  1HFE L;  3KLH B;  1FJG J;  2ZKT A;  2DHG A;  1B70 B;  4MK7 A;  2VUG A;  2WON B;  5DLV A;  1RZM A;  2OEL A;  2IY5 B;  2NYI A;  2HS3 A;  3LTO A;  5KFF A;  4UQT A;  3UCG A;  4CYU B;  3K5N A;  1RHU B;  5L0K A;  4M94 A;  5I3P A;  5LL6 d;  2XY5 A;  2HGM A;  1FXD A;  1VR6 A;  4PG8 A;  5ITH A;  4LFA F;  1FWK A;  4ECQ A;  3FVY A;  3BR9 A;  2W5R A;  4U7C A;  3QRP A;  5A0Y A;  4OZ5 A;  4CM2 A;  2GQQ A;  4A8Q A;  2J7W A;  2WZ1 A;  3SDE B;  1NPR A;  1J5O A;  2DK2 A;  3VZI A;  3QMQ A;  3WBH A;  5I3U B;  3H25 A;  3QWU A;  3Q8P B;  2ZM6 F;  3M7V A;  3PYG A;  3GIJ A;  2MJN A;  3UN3 A;  2R7S A;  4QYZ J;  2FC9 A;  4QU6 A;  4NLS A;  1FES A;  4C8Y A;  4OYM A;  4KFB A;  1LQ9 A;  3IAM 9;  3BKT A;  3EDQ B;  1MNE A;  2HFU A;  3KKF A;  3H0P A;  1JJC B;  3U02 A;  3PR4 A;  3E51 A;  4ZOS A;  1F2G A;  5H1S V;  2M0G B;  3R27 A;  3JAM U;  3HLU A;  4AQY F;  2P9C A;  4LF6 J;  5L9X A;  4FYX B;  1KLM A;  3UPF A;  3C2P A;  2BJ8 A;  5J1E A;  2JSX A;  5KFE A;  3W64 A;  3K59 A;  1GT8 A;  4QZV B;  4P52 A;  3C3L A;  3IWX A;  2AGO A;  4RW4 B;  4DV4 F;  4DS4 A;  1F0X A;  1FEH A;  4DX8 H;  4X4Q A;  1T11 A;  4DUT A;  4F04 B;  3JS9 A;  1D8Y A;  1HQE A;  3ICL A;  4YR1 A;  1YGY A;  3RB4 A;  2P8I A;  1E6V A; 
#chains in the Genus database with same CATH homology
 2IUC B;  1ZED A;  1O99 A;  3NKP A;  5LQQ A;  4LRD A;  1ELX A;  3CMR A;  2GLQ A;  1AJA A;  2X98 A;  4QAX A;  4KAY A;  1O98 A;  3M8Y A;  1EW9 A;  4FDI A;  3BDG A;  3WBH A;  5IJQ A;  1EW8 A;  5TJ3 A;  1URA A;  4UOO A;  4ZG6 A;  3M8Z A;  1KH7 A;  2XR9 A;  4KAV A;  4CXK A;  3M7V A;  3T02 A;  2GSU A;  3BDF A;  5K4P A;  3UN5 A;  1SHN A;  3UN3 A;  3UNY A;  4UPK A;  5LIA A;  2VQR A;  1EJJ A;  5EGH A;  3NKO A;  1KHJ A;  1KHN A;  5AJ9 A;  1ALK A;  5L0E A;  4LRF A;  1URB A;  2XRG A;  4KJG A;  1ALI A;  1AJB A;  2W5X A;  3IGY B;  2W5W A;  5C66 A;  1KH9 A;  3IDD A;  4UPL A;  4MIV A;  1KH5 A;  2ANH A;  4UPI A;  3TWZ A;  4LR7 A;  1P49 A;  1E1Z P;  4GTX A;  4CYS A;  1E33 P;  1HQA A;  5INH A;  2G9Y A;  1KH4 A;  3B5Q A;  4LRE A;  5DLW A;  4UOR A;  2W5V A;  3M8W A;  4UPH A;  2RH6 A;  4LRC A;  4B56 A;  2W8S A;  1N2K A;  3IGZ B;  2GSO A;  5L0B A;  3NKQ A;  1KHL A;  4FDJ A;  3NKR A;  3MK2 A;  2D1G A;  5GOV A;  4MY4 A;  1EW2 A;  1Y6V A;  3BDG B;  1ELZ A;  4KJD A;  1AJD A;  4NWX A;  1ZEB A;  5DLT A;  3MK1 A;  3UO0 A;  3LXQ A;  4GTW A;  4CXU A;  2ZKT A;  3T01 A;  1ED8 A;  5LRN A;  1ANJ A;  1E2S P;  5HRT A;  5DLV A;  1FSU A;  2GSN A;  5IJS A;  3WAV A;  4CYR A;  3WAY A;  4KM4 A;  2IUC A;  4LR2 A;  3WAX A;  5GRR A;  1Y7A A;  1KHK A;  4CXS A;  3TG0 A;  1B8J A;  5L0K A;  3NKN A;  4UOP A;  2W8D A;  2QZU A;  1AJC A;  1ANI A;  1ELY A;  3NKM A;  1ED9 A;  1HJK A;  4N7T A;  5LRM A;  3T00 A;  3A52 A;  3DPC A;  4ZG7 A;  4GTY A;  1HDH A;  4LR8 A;  2W5S A;  1EI6 A;  4ZGA A;  3SZY A;  4TN0 A;  3UN2 A;  2IFY A;  2W5T A;  2W5R A;  3TX0 A;  3OT9 A;  3SZZ A;  4LR9 A;  1ZEF A;  3MK0 A;  3DYC A;  1SHQ A;  3Q3Q A;  3WAW A;  3KD8 A;  3NVL A;  2W5Q A;  1EQJ A;  1ALH A;  5EGE A;  5KXA A;  4LQY A;  1N2L A;  4LRA A;  3E2D A;  4NWJ A;  4LRB A;  4ZG9 A;  1ALJ A;  4MHX A;  4YR1 A;  1K7H A;  1E3C P;  3BDH A;  2GA3 A;  1AUK A;  3ED4 A;  4GTZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...