3OT9A

Phosphopentomutase from bacillus cereus bound to glucose-1,6-bisphosphate
Total Genus 141
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
141
Knots found
sequence length
391
structure length
390
Chain Sequence
NKYKRIFLVVMDSVGIGEAPDAEQFGDLGSDTIGHIAEHMNGLQMPNMVKLGLGNIREMKGISKVEKPLGYYTKMQEKSTGKDMTGHWEIMGLYIDTPFQVFPEGFPKELLDELEEKTGRKIIGNKPASGTEILDELGQEQMETGSLIVYTSADSVLQIAAHEEVVPLDELYKICKIARELTLDEKYMVGRVIARPFVGEPGNFTRTPNRHDYALKPFGRTVMNELKDSDYDVIAIGKISDIYDGEGVTESLRTKSNMDGMDKLVDTLNMDFTGLSFLNLVDFDALFGHRRDPQGYGEALQEYDARLPEVFAKLKEDDLLLITADHGNDPIHPGTDHTREYVPLLAYSPSMKEGGQELPLRQTFADIGATVAENFGVKMPEYGTSFLNEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Bacillus cereus Phosphopentomutase Is an Alkaline Phosphatase Family Member That Exhibits an Altered Entry Point into the Catalytic Cycle.
pubmed doi rcsb
source organism Bacillus cereus
molecule tags Isomerase
molecule keywords Phosphopentomutase
total genus 141
structure length 390
sequence length 391
chains with identical sequence B, C
other databases KnotProt 2.0: S +31
ec nomenclature ec 5.4.2.7: Phosphopentomutase.
pdb deposition date 2010-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01676 Metalloenzyme Metalloenzyme superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1250 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Phosphopentomutase 3ot9A02
3.40.720.10 Alpha Beta 3-Layer(aba) Sandwich Alkaline Phosphatase, subunit A Alkaline Phosphatase, subunit A 3ot9A01
2GA3A 1AJDA 2G9YA 3SZZA 2W8DA 1AJBA 1ALKA 3NKMA 3DPCA 3MK2A 5TJ3A 3BDGA 1ED9A 3M8YA 4CYRA 4UOOA 4MHXA 2IFYA 1E1ZP 1E33P 1ZEDA 1KH4A 3MK0A 3BDHA 3IDDA 5DLTA 5KXAA 4CXSA 1KH9A 5L0BA 1O98A 3UN2A 3OT9A 4LRBA 1KHNA 1KH7A 1EW2A 2GSOA 2W5SA 4LR7A 5L0KA 4N7TA 1URAA 2QZUA 5LRMA 1FSUA 2X98A 3NKOA 4LREA 3WAYA 3T01A 1P49A 2IUCB 5INHA 4LR2A 4KJDA 5GRRA 4GTYA 3UN5A 3TX0A 1HDHA 2GSUA 4TN0A 4YR1A 4UPIA 4ZGAA 2W5WA 2W5RA 1SHNA 4KM4A 5L0EA 3SZYA 3TG0A 3LXQA 1ELXA 1AJCA 4KAVA 3MK1A 3TWZA 2ANHA 3T02A 3UN3A 4UPHA 3BDFA 2W5VA 3M7VA 2IUCA 5GOVA 3M8WA 3NKQA 5EGHA 1HJKA 4UPLA 1AJAA 5K4PA 5DLWA 1Y6VA 4GTXA 4LRAA 2ZKTA 1EI6A 3WAWA 3UO0A 1B8JA 5LRNA 1O99A 4ZG6A 4FDJA 3WBHA 3DYCA 3IGZB 3IGYB 4ZG7A 1ALJA 1ED8A 1HQAA 3CMRA 2W5QA 2W5XA 4ZG9A 3ED4A 1ALHA 4LRCA 3Q3QA 4LR9A 3M8ZA 1EW9A 3WAXA 1ANIA 3KD8A 1EJJA 4GTZA 1KHLA 4UORA 5IJQA 2RH6A 1ANJA 1K7HA 3B5QA 4LRFA 4MIVA 1N2LA 1Y7AA 3NKNA 4MY4A 3UNYA 2W8SA 3NVLA 4KAYA 4CYSA 3NKRA 5DLVA 4NWJA 2D1GA 5LQQA 1KHJA 1SHQA 5HRTA 3A52A 2GLQA 4QAXA 3WAVA 2XR9A 4KJGA 1ELZA 1AUKA 1ZEBA 1N2KA 1URBA 4LR8A 3BDGB 4UPKA 5AJ9A 4B56A 4UOPA 4CXKA 1KH5A 4LQYA 1ELYA 1E2SP 5C66A 2W5TA 1EW8A 4NWXA 5EGEA 4CXUA 5IJSA 2GSNA 3E2DA 5LIAA 4LRDA 3NKPA 3T00A 2VQRA 1EQJA 1KHKA 1ALIA 4GTWA 1ZEFA 2XRGA 1E3CP 4FDIA
chains in the Genus database with same CATH superfamily
4ZCKA 2GA7A 2MKHA 3D5MA 1WTFA 4K2JA 4RW6A 5DDPC 3K7RA 3T9ZA 4WP3A 4DFMA 3C66A 3CD7A 4WK1A 1Q8KA 3ONQA 4IQMA 3DOMB 3A1YG 1F3VA 1SV5A 4HVZA 4PQUB 2JJ4D 5KOXA 3UQSA 1SQGA 4JV2A 2UU9J 3QO9B 2N7YA 5J2NB 1WC0A 4LSLA 2FB0A 2N3OA 1TL3B 2XLJA 1VC6A 5GAHI 2YX7A 5CYQB 3KJVA 3O6QA 3OJSA 3MTJA 1S1UA 1SV5B 3PJWA 2VH7A 3VGVA 3RW6A 2JEFA 2AP6A 5IQ6A 3QWUA 2UU9F 2DIUA 3BGUA 1UMJA 4IH7A 4P10A 5L0KA 2FTRA 2MYFA 2KRBA 5KT4A 1DQAA 3R6LB 4QR1A 5KT7A 5L1KA 3NKOA 1JKHA 2BRLA 1ZYQA 2DYAA 2M8HA 2UUTA 4C8NA 2CNLB 3DOKB 1WC5A 2ILZA 3RYLA 6AT1B 3WIUA 3OUYA 4GTYA 2QL9B 5KFAA 1O0PA 4ZPCA 4YDDB 4J9QA 4ANEA 4CO4A 2D3OR 2CQ2A 2C2RA 1M5VC 1ZAVA 1QAIA 2CQBA 3M05A 1LWCA 1Q8BA 1U2CA 3DXSX 4H4OA 4HEA9 3AJ2A 2F5GA 1S76D 3ZTOA 3KK3A 5HQ8A 3BSCA 3RBEA 3EVMA 2L9WA 2H65B 1U6FA 3E01A 3O5TB 3SSSA 2Z4PA 5U47A 3MM6A 1VIOA 4PXBA 4X64F 3DMJA 3KLFB 4DSIA 1HNWF 1HW9A 3MK1A 3T02A 2MTLA 3R7SB 1CQNA 4CLUA 3CF5Q 1R89A 4Y00A 3M32A 1TQLA 1N5SA 2V4RA 2CQDA 2DNYA 3FBEA 5DLGA 1WHVA 2RDDA 2V50A 4K4ZA 2LQJA 1B3TA 3GPAA 3OV7A 1HJKA 2C2EA 4LR2A 1UZHA 3CCWA 4Z2XA 2AYEA 3FFIB 5HJYA 3OHAA 2VZ9A 2VG5A 4C3MA 3QT5A 5KFKA 3DI6B 1N5YB 2Y3YA 2C2DA 4X66J 3I4PA 1U1NA 4X4SA 4ZG6A 1W2BR 3EUNA 2G9OA 3JAMY 2HS4A 2AGQA 3DLEB 1S1WB 4X2BA 5F0UA 1UEKA 1EQMA 5KFOA 2RT3A 4FKXA 1VHIA 3OHBA 2ZDOA 4ZKAA 5A8KA 3J7ZT 2UVRA 4K0KJ 1HQAA 2W5QA 2CQ0A 3MAQA 4X62F 2FGCA 2M2BA 2YXLA 4I2QB 1FDBA 3HI9A 2GIRA 3DM2B 1JIHA 4LRCA 1CQMA 5RUBA 1JXLA 3QBCA 1VQLS 3C3LA 2XS5A 1HD1A 3MEGB 5KFDA 4DN9A 1N2LA 1LQ9A 5C2GA 4KBIA 5KOWA 2ZH1A 1R8BA 2XMVA 1TKZA 3BM7A 3L9ZA 3ZTRA 3BO2A 1S1TA 4C8ZA 4ZDNA 3FUYA 1FDNA 4A8XA 3GILA 1YJ9S 2R7SA 3R5GA 1NJIT 4HR2A 1NK8A 1N5QA 1YZ6A 1I1GA 4OV6A 1MN7A 1RABB 2ZOMA 1RT1B 1UEVA 3CMAS 2BACA 4CDIA 5DG8A 2YH1A 5CYQA 4MFBB 1UVNA 3DLKB 2RRNA 2MKIA 2R8KA 1MWQA 3LH2S 5I3QA 2IYGA 4Q8EA 2KT2A 4CXKA 3W9JA 2E7WA 1U25A 4U7UD 4LQYA 1DTQB 3H2VE 1CC7A 3IC1A 4ES3A 3I0RB 3R7BB 1L3TA 3R27A 5THWA 4UQGA 3MMAB 3N79A 4DX5A 3W66A 2NREA 4OJHA 4USUA 5F3ZA 2W8KA 2E9RX 1RSCA 3UWTA 2LQ5A 5HQLA 1SL1A 1T7PA 3RRHA 2OPSA 2VJUA 2RS2A 3RW7A 5F8MA 4AL5A 4J9VA 2UUCF 5SZTA 1SC6A 1J5OB 3LP1B 1BQMB 1EZZB 1UTAA 1Y11A 1OS5A 2VFSA 1YJWS 2RDJA 3VF0B 1Q5VA 4QIVA 5M2RA 3ISND 1PKUA 4ECZA 1GXTA 1RLDA 3C16B 4QQBA 3HHLD 2C3UA 1O5JA 2H1YA 3QGIA 4QPTA 2CZ4A 2ZBQA 3VGUA 3K59A 4OI6A 1OO0B 1ZEDA 2KU7A 4DZ6A 3IDDA 3RJMB 2NXUA 1NBEB 3CJ5A 5T7LA 1VBXA 2DR7A 2XS2A 2VPWB 1RBOB 2B56A 1RTDA 1SJ1A 4LR7A 3CJSA 3JYTA 1KHWA 4CYUB 4WP8A 4J37A 5IS2A 4OYAA 4ZPDA 2OEJA 2MZQA 4AE5A 1IWGA 4EEYA 3NBPB 2KYZA 4BWJA 4HI2A 3G2XA 3GFHA 3JTOA 1F9EB 2IMOA 1UPMB 3H8YA 3KFWX 4RBUA 4TU9A 2IPOB 2UZAA 4DUYJ 3V4IA 2BQUA 1HNXJ 3D9BA 2LYVA 1AXQA 3W3SA 1C0UA 3QJJA 4R8UA 1CS4A 3BR8A 5DGAA 1QSYA 3UI3A 2C3MA 4KFBB 4DWIA 4IFVA 1JLCA 3CUNA 2HHWA 1ZM9A 3TWZA 3RBZA 3D67A 3SDEA 4FNIA 3FCVA 1X7VA 4DOZA 2WVEA 2EG2A 3FVYA 4DS5A 1Q81T 2J6TA 3EE3A 1RCXB 4WE1A 3HHKA 2V4QA 4ECYA 3NGDA 2XGQA 4ED8A 3AJDA 4GO7X 4CH1A 4DFJA 2H4WB 2KJWA 1NLKL 1YJRA 4JI7J 4M8LA 2WAQD 4ZN1A 3EPGA 3L7OA 5BJRA 3R6GB 4KGMA 4ILMA 3DOLA 3MECA 2OSRA 3DLKA 1N88A 3HVTA 2WVBA 2BBEA 2N4DA 3FCHA 5HO4A 1D09B 1VK8A 1HNZF 1PYSB 2B4VA 5IT9Y 4RJVA 2HWTA 3OTDA 2DNHA 2F65A 5MAOA 4ZG7A 1LWFA 3ZC4A 3HKZD 1JLGA 4FF3A 3T5LA 5E3PA 1FWLA 2JX2A 4HI1A 1U09A 2W5VA 4WFAQ 3V6HA 4ECXA 4PG7A 1UWAA 3TQ1A 5LM7E 2XI3A 3OD2A 4AQYF 2JVOA 4PYAA 4Q0BA 3N4WA 3V6DB 4JI4J 4DS4A 5J2NA 1KHLA 2RH6A 3OR2B 1UW9A 1FRMA 1TUGB 1Z2LA 3A13A 3IRXB 3NKYA 4HHJA 2XZDB 1IJFB 2LDIA 1IM6A 2B6AA 4F3OA 2QLBB 3O3LA 4OHXA 2YH0A 3MEDA 3EYZA 1K47A 3KLHB 4X65F 1FI4A 2NSBA 2DPIA 1ITPA 4NXMF 3WAVA 3TX8A 1S10A 4LF2A 3HJFA 3QATA 5B0FA 3UPFA 5BXIA 4JI0F 2KTQA 3KYLA 3Q22A 3ZTPA 2ERRA 2BDPA 2ZKUA 4UPKA 1RUSA 3IFEA 2HZVA 3WQPA 4LVOP 4DSEA 3QLHB 2ZNYA 2IBKA 1OSDA 1CJUA 3UDLA 5ETQA 2ZM6F 3CJQA 2OTJS 1NMEB 3I9ZA 4Z7CA 2RQMA 4P2MA 5EN1A 2HHHJ 4BS2A 3MPUB 2UP1A 1EAYC 2QA1A 3BDEA 3K0JA 3E01B 4C3LA 4A8SA 1WELA 3KTQA 3JSBA 1EIYB 2QLFB 3D6MB 1NPRA 2F9DA 4YR3A 4C11B 1QTNB 1VQYA 3AQOA 4W98A 4WIQA 5L1IA 4NXNJ 1FEHA 5BYRA 2YPYA 3ULHA 4P2SA 3IO1A 5EWFA 1AJDA 1HPZA 4ED3A 1UP1A 3THPA 2P9EA 2WB1D 3W60A 1QVGR 4LFAF 4LF9F 4X66F 4DUYF 3LPEA 4ZS6A 2G2YA 2V69A 1HI0P 1JKHB 1YJUA 5A0YA 2V9KA 4DSKA 1AB8A 1EHWA 3P3DA 2W5SA 3V6KA 2LXUA 1N33J 3M6XA 2OIHA 4K0KF 1Q4RA 3ZZRA 5F41A 3C2PA 1SIWB 3SI8A 2BW2A 2HHSA 3VVTA 4UTGA 2YKMA 2XYPB 1SIZA 1TKTB 3IAS9 3M8SA 1QSSA 3T01A 3U1NA 1U0HB 5A2QY 1U8WA 1UVJA 5K14A 1RTHA 3AAWB 5B0CA 2KFZA 2J9CA 4L72B 4O3OA 4WIIA 2GSUA 1S77D 2JLEA 2DCUB 2RRBA 2YWFA 3GE9A 2YKMB 3HSZA 3Q89A 2IYIA 1C1CA 1RTIA 2E5HA 3TRGA 5T7LB 1F9HA 4USHA 4NZ0A 4LF8J 1HW8A 1HD0A 3JTNA 3MM5B 2ZH9A 3Q23A 2DVIA 2VV5A 1IKVA 4B9TA 3UN3A 2HAFA 4HTJA 3HHLC 2BR0A 4NCAA 2R7RA 4USIA 3OXLA 2MSSA 2YNIA 2GQQA 3CDAA 3MAHA 2BANB 1D9AA 2RQKA 4ILLA 4C4WA 4CNZA 2P2CB 3QZ7A 2I5JA 1JLQA 2VKRA 4QIFA 5DLWA 1XR6A 1I6JA 4A8WA 4USMA 2BJ3A 4DFKA 4CO0A 4AQYJ 4ETXA 5DZ6A 2GO8A 2XZWA 2DNLA 5KG3A 3M9OB 3LWLA 4URGA 1HHSA 1WEZA 2KM8C 3QGPA 3PW4A 3CULA 2C3PA 1TTHB 2WBMA 3C14B 4FNHA 3WBHA 2QMUB 1PAEX 2QLJB 3MDFA 2ZC3A 3AXKA 2APOA 5GMKa 2I2YA 1PJ7A 2ROEA 1I3OB 3GIRA 3I4HX 3M8PA 5EHHA 3OTOF 1C4AA 1G6BA 3M2VA 4X65J 1IBMF 1BLUA 4TU7A 3NAHA 3L3CA 2HGNA 4LJMA 3Q3QA 2B8PA 5EWEA 1QAJA 1WD6A 2YNFA 4NMXA 1HQ2A 4ID5A 2R4FA 3C6UB 1ZA2B 4RW4B 4F67A 1HFEL 5B08A 4JI0J 4LFCJ 5IJQA 3Q8VA 3GG0A 1S0NA 1V6HA 1NK6A 3CB4A 5D0RA 1YBTA 2CQ1A 5D8HB 5A8RA 3BKTA 2RQ4A 1HQUA 1S6QB 3TAMA 3DRPA 1FK9A 3AXMA 4XDCA 3UE2A 3J7Z5 4X64J 3BH6B 3PVXA 4V19J 3LGHA 1B0PA 2LMIA 1RAAB 9RUBA 4DUTA 1B7YB 3O1LA 1RJJA 5JUMA 4X4QA 3V6JA 1RA6A 4DHVA 1RAOA 2YY3A 1JLFA 3TAMB 1D8YA 3ADAC 4O0IA 1YG0A 2CWKA 2KXHA 3JQJA 3CCRS 3DDIA 4YS2A 2X51A 4K4UA 3KJFB 4A8KA 4B3SF 1I51B 5AJ9A 1DAXA 5HSPA 1R6YA 2VQEF 1NCLA 1VMBA 4GC7A 3R5AA 5C66A 2ZJPQ 1TR0A 2NZ4A 4B9SA 4TNOA 5HMWA 2J8SA 3NGRA 4RWXA 1PYTA 4UUXA 1WC6A 2JLGA 2J0QD 3MOJB 2GGPA 3DHWC 2W9BA 4LF1A 3K57A 1X5SA 1FD2A 4QIEA 2XQCA 1Z4UA 2OGUA 1R43A 2AMCB 2EFPA 3H0PA 2CNKB 2OAUA 3IM8A 3KWMA 3P5TL 4K8RA 3ILOA 4IOCQ 2XHWA 3PDNA 1NJXA 4JV5J 4JI3F 1F1BB 1E6VB 3OXGA 4EFAC 2CNOB 4GMKA 3OL7A 4NLGA 4NA1A 3PY8A 3HX9A 2WTFA 3DPCA 1Q53A 2W9BB 5F3TA 4RR5A 2C2MB 2W9CB 3VVUA 3KK3B 4ZOSA 3L4BC 4HKQA 1GQEA 3AHPA 2WOMA 4P9SA 1CJUB 4HTIA 1GMUA 4DPWA 4RZRA 3VGTA 4HH1A 2KRRA 2FGOA 1T95A 4WFZA 2YVSA 4C0HA 2PI5A 1DQ8A 2E9TA 2E1MC 2VPZB 4F2SA 1TL7A 1X4FA 2XY5A 2BJ7A 1OPZA 4TY8B 4JUZA 3TA1A 4F0MA 1SKWA 4ED5A 2X7IA 1KHNA 3VV2B 4GKKF 1H0HB 5IV3A 2ZWPA 4PZVA 3QLHA 4DV5J 1QTMA 3SYZA 2YKNB 2GW8A 3R1HA 4LF4F 3BYRA 3N9UC 2NUUG 4N76A 1ZPVA 1CJTB 4GKKJ 2X98A 3A3PB 1WEXA 5EWGA 2QLXA 2B5JB 2JFKA 3HF5A 1Q86T 1KRPA 3OW2R 2AQ4A 3BQ2A 2ZE2B 4KY3A 1LK7A 2P6SA 2J9EA 3JSMB 1AUDA 1M1HA 2Z58B 1U1OA 1DZ5A 4JI1F 2DGSA 2OFHX 1VJWA 2CKWA 3MTKA 4Z7YA 3BBCA 2JC1A 2ZVSA 5ETPA 3OLAA 2CZVC 5C24B 2CUYA 2EKYA 4WXWA 2NQPA 3UCUP 3QQCD 4YOEA 4A46A 5KTQA 2IAJA 5IJSA 2QO3A 2XSFA 1E6VA 3TARA 2R9LA 2DK2A 3QO9A 5IM0A 4RKUC 3M8RA 3W9IA 2OPPB 2YPZA 2CDRB 3CIZA 1Y9OA 4KV8B 3H42A 3HVRA 2IUCA 1O51A 1QM9A 2HHQA 1L5UA 5HLFA 1YVFA 2OSQA 3KLEB 4ZIWA 4ID5B 1FDDA 2CG8A 1C0TB 3H5XA 2Z2ZA 4K2XA 1RT3A 2J0XA 2NS1B 4GVBB 4HACB 4TQRA 4DV1J 2KI2A 3TVZA 3TZWA 4NPOA 4DMZA 3M6UA 5C25A 3S8SA 4YQWA 2FHJA 4Y3CA 4ETZA 3TR5A 4YEAA 3KLFA 3RGIA 3IBCB 3MFIA 1FO1A 1H6KX 3GB0A 2CPZA 3VAGA 3C6TB 2XMKA 3SCLE 4ECSA 1VFJA 2DNGA 2JC0A 2VBWA 1T9VA 2W5XA 1NRKA 1KQFB 1OYEA 2K3IA 2CPXA 3AD9C 3TJAA 4DJBA 5DM7Q 2WSCC 3K2YA 3Q83A 4CO5A 4QWCA 2MLZA 3AH6A 3SMZA 2OD6A 2HZCA 2GMLA 4CNYA 4DR2F 3PZPA 3MEEA 3PV8A 1YWXA 2EK1A 3NLCA 1V5VA 1B0VA 5DLVA 3BH7B 1NHVA 4G1QA 2CVEA 3UVJA 4A4JA 4CLWA 1SHQA 1AYEA 1RWNB 4M5MA 1TVRB 3IG1A 4O3SA 5HRTA 2MQPA 3FQKA 1U02A 1GEHA 1DTTA 2HQCA 3EGZA 3FRYA 3MFHA 5LOQA 4RUBA 2RDIA 2BKPA 4CLKA 4DX6A 4EBDA 2VA2A 1XN9A 4JI7F 4G1QB 2H5IB 3DI6A 4OX7A 4YR2A 5D4NA 2UXDF 1RAIB 2QTWA 3QMQA 4UOPA 2U1AA 2MY7A 2WVCA 2HWHA 4PG4A 3CDBA 4PXDA 3VAFA 2CWXA 3TANA 2OP5A 2XYGB 1RTDB 3C46A 3TOQA 2HRYA 2PDAA 2W5TA 1QUPA 4OZ1A 2FJBB 4BLGA 4RLEA 2IRUA 3HVAA 3MR2A 1FTRA 1UEUA 2F4FA 2QL5B 2QMXA 2PMHA 3LAKA 3MAAB 2A3JA 4KHMA 4M5LA 4OQJA 2N7CA 5D0HA 4Q45A 2BOPA 3DLBA 1PC4A 2E29A 5E2QA 5AXMA 1Y5IB 3LUYA 3IWLA 3QSYB 4NLDA 1E3CP 5I3UA 4UW2A 1X4EA 4ZP6A 4TQSA 3G4SS 4X4NA 2DR6A 1RAFB 3UCGA 3MK2A 2HSEB 4Z37A 2ADBA 5T14A 2HS3A 2XZTB 3GZ7A 3T5KA 1UVMA 1R0AA 2MZ1A 3ISZA 4CO1A 1NHKL 3NGTA 3PKMA 2X1AA 1WUUA 2EFOA 3NGSA 4ES2A 3ETOA 1N8RT 4WZMA 4C11A 3I55S 1UAWA 4IO1A 3H4BA 4KPYA 2W8LA 2RKIA 5FDLB 1GMWD 4NRTA 1RT7B 1SJQA 1TV6B 1O98A 4XK8C 3PHTA 1XK8A 3P8BB 2NPFA 5D78A 4DSLA 4BC7A 3NL0A 1FNOA 4QW9A 2B4UA 1DTQA 4IR9A 3MUTP 3ITHB 3A3OB 4NLXA 3KJVB 3KHHA 4OL8A 1AFJA 2FDNA 1RHRB 2YWHA 4FS1A 4OFZA 7FD1A 4C0OC 2XB2D 3RG6A 2BRKA 2JWNA 2R2TA 1Q82T 3ZTQA 1VR6A 1XTZA 3OLBA 1RWMB 4UQTA 4DR1J 3V81B 3QFHA 2XGPA 4OYZA 3RB6A 3QRRA 2A1BA 2Z2LA 3EICA 4ZVRB 4J9PA 1WKLA 4TN0A 1HQUB 1S6QA 4Y2IA 3PNIA 3ISNC 2XO7A 5LMNF 4ZGAA 4LSNB 5HQMA 3L7PA 1TL5A 3T6JA 8AT1B 3EZOA 3JQMA 5D6GA 1TK8A 1J5OA 4LIRA 3LXQA 3CC7S 3K5MA 4BC9A 3MR7A 5J2MA 3D0HE 4OZJA 1EARA 2ZHAA 1CSJA 4ED0A 1NU4A 1UA0A 2DNOA 1HMVA 2GIQA 3H5UA 1Y00A 1N4LA 1UZDA 1PCAA 3M7VA 4OJ1A 3EZ5A 4DR3F 4IQXA 2F4VJ 5GOVA 3M6WA 3MMJA 4MIAA 1KR4A 4ZHRB 2NXJA 2MQQA 1HWJA 4DI6A 1V3RA 4FBTA 2XG8A 4DQPA 2ZKTA 1FWPA 2W2QP 2E5GA 1BQNB 1HBNA 3EDRB 2RUGA 4NWBA 5D15A 2ZH5A 2HNDA 4DR2J 1SB6A 1D1UA 2F4VF 4DR4J 3AT1B 3RR8A 4MH8A 3V4MA 4MKBA 4IR1A 2IM2A 3MCOA 3X3UA 4Q44A 3C8YA 3FFIA 3IGZB 3IGYB 1DRZA 1LW0B 2R3VA 1QLNA 3UD3P 1LWEA 2CPEA 5CYJA 2FVQA 1HNIB 2ZUGA 3D7SB 4DR4F 3OFHA 2YNGA 3WAXA 1VLYA 3MGJA 1UVLA 2H5EA 4O3QA 2VQFF 2Z30B 3PTWA 3GR0A 4U8YA 4FF4A 2G2ZA 1PBAA 1HIYA 3SSQA 2Q79A 3R8YA 1F5AA 2JH3A 1PC5A 1WEYA 4IG0B 3OR1A 4LF6F 3ZNUA 1HR0F 2HZAA 2PIIA 1HARA 1RWXB 3PYFA 3GWCA 2P9GA 3EGNA 1QE1A 3KXDA 1H72C 1QUVA 3LALA 2ZNZA 4LBPA 4MMOA 2DGWA 4DV6J 1HWIA 2HBQB 2M0GB 4DEZA 1F9FA 3KLGA 1RAHB 4DLGA 2AX1A 1FVQA 4KH0B 4B08A 5DG9A 1VISA 3DRPB 3MCMA 4RU9A 2D69A 1KFSA 1G1XA 4JI5J 3BN4A 4DL0C 1B99A 4U9RA 3EX7B 1S4EA 1VI7A 2WRMA 2YKOA 4OHWA 4P2XA 3CJ3A 4NLQA 4QBUA 3Q8SB 4KO0A 1NNDA 5BR8F 3JB9k 1QSLA 3H5SA 1ELYA 4CCHA 4MYTA 1LWFB 4NWXA 3I96A 1VIXA 2BOAA 4TYAA 2C28A 5DG7A 4EO6A 5KFUA 3OBIA 2MKCA 3A3NB 1WF1A 1YRUA 1TZ0A 3R9LA 3BQ1A 4DSJA 1HYSB 3W65A 1MWYA 1ALIA 5HROA 1KHKA 1C2PA 5HMZA 1NK0A 4LFBF 1P8GA 2DRBA 1P9YA 3P4UB 1N32F 3M8QA 3DXBA 1LWCB 4H4OB 4YB5A 4LFCF 4RBVA 4UOCA 2DO4A 2VICA 4DN0A 4DR6J 3VAKA 2CAJA 2GJ2A 2XS7A 3RBDA 2MZTA 4WU3A 3P96A 5GAHU 1HYSA 3QSIA 3HULA 5CYMB 3PO4A 1IBKJ 1G2EA 5KFJA 2DGQA 3NCRA 3O2IA 4L73A 4Y2CA 1NK5A 1N32J 1CJVB 1UFKA 1FT8A 2KHCA 3TZZA 1FD8A 3HSGA 2RVJA 3BPDA 3D6TB 4DV3F 5LMUJ 2NYIA 4ZJOA 2YQ1A 4OYMA 2R7UA 3DKDA 5KFFA 1HBMA 3B4DA 5ETNA 1M1KT 2K7JA 3VAHA 3BQ0A 2DGVA 2PGCA 3V4IB 3TAPA 2BE2B 3HPOA 4OX6A 2QZUA 4Y2KA 4AFFA 1LWXA 1X4AA 2BUNA 3NGKA 4M5DA 4XIUA 2W9AA 5LMUF 3W63A 4DX8H 4LF7J 4G65A 2IJFA 2CPIA 5ETMA 4ZJQA 2PE8A 2MSTA 2JOQA 4PYDA 5HMYA 5D0GA 1TL3A 5M2UA 2YWKA 2EFGA 4RNNA 3IRXA 1MG7A 3MWBA 3QIDA 3FMWA 1ZA1B 1S0VA 1DJ0A 3IS9B 4DR7F 2RILA 4OLPA 1P6TA 4JI3J 2ZD1A 4QWEA 5LJ5Y 2FHMA 1A9NB 5A0YB 1VQNS 3VAIA 1VQ4S 4C98A 4KAVA 1JLEB 3DLEA 4M5GA 1IKXA 2QT7A 3TI0A 1NSQA 5H9FJ 1TKZB 2PFFB 2MLYA 1K9MT 3IS9A 1TELA 4KIAA 3T41A 5C25B 3LTOA 3MURP 2HAIA 1OJ4A 1FRKA 1MMLA 2DEIA 1RXOB 3NKQA 2IC3B 1VOMA 4WF9Q 1L3KA 5JVGQ 5G0RA 1JJ2R 2G1DA 4KKOA 4PPZA 5GAEI 2QEXS 4LQ3A 3MMCB 2D9OA 2Y8WA 1ZTTA 4YHHF 3N6LA 1SUQB 4O44B 4DV0J 2FYXA 2OTLS 4K5RA 4MK7A 4DR7J 1OQ3A 2RNEA 2WW4A 4M5KA 4BBYA 2FLPA 1O99A 4HT5A 1LV5A 3DRYA 3IR6B 4KGVB 2DB1A 1IJEB 1HMVB 2MQMA 3QFWA 2D7SA 2W25A 4GO5X 1RKIA 3K5NA 1RACB 2BX6A 3CIMA 1EW9A 4J9UE 2MHNA 4NCGA 5I42A 5B0BA 1M5HA 3M1VA 4PABA 5F8HA 3J80Y 3AOCA 1D8ZA 3B5QA 3CJ4A 2HQDA 3MM5A 2VBYA 2X3GA 4IG3A 5IC4B 1F6TA 2VG6A 5DQGA 1M5PC 5D4OA 2J5AA 2D41A 1WOPA 1V3ZA 1IR0A 1BWVA 1TKXB 1BD6A 1PBUA 1S4FA 1UKUA 4KJDA 4RWWA 2D3UA 4FPRA 4USWA 4G6VB 4ZP9A 2R2UA 3TUJC 3CCVS 4RUAA 5A8KB 2LEPA 2EC0A 2M8DB 2R7VA 1FX4A 1Q16B 2RU9A 4ZJLA 5C2CA 2R2RA 2A0FB 1N34J 4WWSA 4ERDA 3ZO7A 2VODA 5HN0A 4ZVQB 2V67A 3B8HA 3UR0A 5CXTA 1XNQJ 4PG5A 4DX7A 5IV4A 2LFVA 5KFQA 3EZUA 3GCWP 4FBUA 2XMJA 2E66A 3VWSA 2B8QA 4YB7A 1VRUA 1CJTA 1XR7A 3G8QA 3OQ2A 1LWEB 1S9GA 2HQIA 4M5DB 4TY9A 5CZXA 2ZH6A 1RWKB 2E44A 3GJQB 2GHPA 3TVYA 4DUZJ 2J6SA 5J2PB 2RE1A 1T9YA 4GKJJ 4J9LA 1NUEA 2ZBRA 3KLGB 3VCDA 3H5YA 2XRGA 2MKYA 4KHRA 3IGNA 1FERA 4FDIA 3E8OA 5IWAF 2ROGA 2L9NA 3W5XA 2DGOA 4W92B 4WU2A 3THTA 3BDGA 1SH0A 3CCES 1ZS6A 3MXHP 4NI2B 1XNRF 1QAXA 3BREA 5CAAA 3LP0B 3HD1A 4IFYB 5IT0A 2YKQA 4K59A 2QSFA 4XPCA 1BC6A 1S99A 2CA9A 2HKEA 1Q95G 4WE1B 3MUMP 5DLTA 4MYUA 1R3NA 1D0EA 3BDHA 2VBXA 1U26A 1ZAWA 3CC4S 3UDVA 2XLKA 5L0BA 1BE4A 2Z2YB 3GJTB 3UN2A 1NM2A 1NZAA 4ED7A 1XEZA 4NMLA 2V63A 3SCIE 1RISA 2IAJB 3CEDA 2ZZTA 2UVWA 2MHEA 1URAA 1H74A 2PFDA 3OFEA 3RAMA 3MR6A 4DFPA 2GO9A 2O5DA 1BXNA 2AGOA 3SIPB 2M3DA 2I9SA 1CULA 3CPWR 3NG8A 4TLRA 1U49A 3G87A 1U6BA 5INHA 2V0NA 4NX9A 5HBMB 3KLIA 1IKWA 3QYYA 2LA6A 3UN5A 5HROB 4F4AA 2DGXA 2DKOB 4YR1A 4PG8A 2LP4A 5KFIA 1RT2B 1JLAA 2M9KA 2HGMA 4LF6J 1WF2A 2NLWA 2CIMA 4R0EA 5K8MA 4RW9A 3BS9A 4ZVPB 3TEGA 4LSZB 3BGRB 1H98A 3ETMA 4DU8A 1YKWA 1EP4B 2LLZA 2MZRA 1X5OA 2PD1A 2MKKA 2R8GA 1X4DA 1W26A 4OYOA 1XIQA 2GHVC 4B3OB 1U2FA 1VHFA 2HFVA 4JI6F 1KQGB 3GCXP 2QA4G 5FJ4A 4OZ3A 4FP9A 1AJAA 1FDAA 1RU2A 2BQ3A 2FLLA 5ETKA 1AUSL 3SSRA 4Q8FA 2IVMA 3BN7A 4YN3B 1HPZB 1IWAA 2BKNA 4PEOA 3KUHA 5KFSA 4A8OA 5A8WA 4I67A 1FXLA 3T1YF 3M2VB 1NDKA 2QLWA 2M52A 1HHTP 5LRNA 2BW7A 5KG4A 2UXBF 2FJEB 2OPSB 1T94A 1HBUB 3LANA 1S49A 2QG9B 5ETTA 4L74A 2ZOGA 5L1LA 1N52B 1RLCL 5E5NA 3M8QB 2BJ1A 1ED8A 2YQ0A 5DQIA 3GP9A 5KG0A 3HO1A 3LP2B 4AYBD 3NNHA 2RD5C 5K9FA 1FFGB 1KTVA 1F2HA 1C0UB 1GXLA 1H7XA 1WHYA 2DHHA 2XSJB 1N5TA 3KLEA 4J90A 4HH0A 4ER8A 4KKOB 1CJKB 1GX5A 3G6YA 5F0WA 4RX6A 4UORA 4O4GB 2BJ8A 3BSNA 4IFVB 4LVNP 1JLBA 2AYMA 3TA0A 2HHTA 2WONB 3W62A 1QAYA 1APSA 1FESA 3D28A 4LQ9A 1NJWA 4X4PA 1GTHA 2AF6A 2XCAA 3KKFA 3S1TA 3GYNA 4ZVOB 2OD4A 1FF2A 1RI7A 2VDHA 2U2FA 2HHVA 1NSPA 2ZBCA 4I1TA 4M1KA 2A18A 4DR3J 2BYCA 1WG1A 3DLHA 2DISA 4R25A 4CLTA 2V8VA 1S1TB 1VK3A 3S01A 3RBXA 4CP5A 2GS8A 3CCMS 1RTZA 3IBWA 4K7QA 2GVZB 4P52A 4YFUA 2B9XA 1FKAF 3W1YC 4ZMMA 4MKYA 1B0TA 1JLFB 4WFXA 1U1PA 1HWKA 3DDNA 3IA0A 3WC2A 4QOTA 4CXUA 2GSNA 1X9WA 3NKPA 3OL9A 3DLGA 1FJGF 2RJZA 1CULB 2MKJA 3A8EA 2EK6A 3PCOB 1KEKA 4B3MF 2YTCA 1T3OA 3DLJA 1FJ7A 1TK5A 2GHWA 1H73A 3ZFVA 2A2CA 5JVHQ 4PXEA 2BA9A 1RT2A 2YKPA 3J7A1 2VQFJ 5TJ3A 3POTB 1HKAA 4RW7A 5EUHA 4LBIA 4NLTA 5D0EA 1IBLJ 3B4MA 3K5OA 2V8DA 4WPAA 2W4DA 3TNVA 1C4CA 4MHXA 1OY9A 4PAAA 1MMDA 2WB4A 3IWNC 2P8IA 4ZVEA 2DHGA 1N54B 2HHPA 1W7WA 2H3EB 2WZ1A 2LXFA 2PO4A 3HDSA 1RU1A 3AB2B 3OTEA 3R5DA 2J0WA 4ZVFA 4ZVSB 2BQRA 3MR5A 1IBLF 2VUGA 4YMEA 4M5IA 4OI2A 3W8PA 4F4KA 3WHIA 4HDHA 4K5SA 2C2NA 4DL7A 1EW2A 1YIJS 4IOBA 1YJTA 2W24A 1R8PA 1YK9A 3T6BA 4P73A 5DM6Q 1SXLA 1FHTA 2M88A 4C97A 2JSXA 3BR9A 2RQCA 1KBRA 3D1OA 1CS4B 4WFYA 3W5ZA 1SH3A 2ADCA 3I5BA 1KLMA 2MQ8A 2CADA 2ZHBA 3ILLA 2XCPA 1RZMA 2I8EA 5KG2A 3B6BA 2HWIA 4HYKA 2XY6A 1IKXB 4WKRA 1VQKS 4ILRA 3SV3A 3CJTA 2R2SA 3PW5A 3CCJS 3H40A 4QYRA 5A6WA 5KFWA 3GTYX 2QX0A 2R7OA 4I2PB 1AJCA 4OX9F 2GMHA 2DNMA 3P45B 4F26A 3NNCA 1S7IA 3I82A 3D1HA 4N56A 4NE9C 2BKOA 1FK9B 2F8EX 3I0SB 1IVZA 2O01C 3ZZUA 3NS6A 5L39A 4Y2AA 3DRXA 4ZLPA 1KVKA 1JNZB 4I2QA 3T19A 4KGZB 1RT7A 1TV6A 3GFZA 3V6DA 5KT6A 1M5KC 3KLIB 4ZLJA 2YNFB 3MPYA 1WTBA 1CEZA 3PX4A 5J1EB 5H1SV 4OIXA 4LF8F 3QIPA 5KFRA 1NK4A 3I56S 3UO0A 4D3GA 2ZH4A 1TAQA 5L38A 2HMIA 1O6XA 5HANA 3KK2A 4CLFA 2LCWA 3DGPB 4UOHA 1QE1B 2VDIA 4JV0A 4J9MA 2EPIA 2YWEA 3AD8C 2H54B 5K20B 4P74A 1VQ8S 2AYGA 1FEEA 3R5BA 3JS9A 3FBCA 1EX8A 4NL5A 1SJ3P 1KN6A 1XQIA 1JXEA 1YGYA 2EBGA 1G4CA 1LNQA 4FXVA 1BQXA 4ZVGA 3MPDA 1NSKL 1L3UA 2RB7A 4LR9A 2C3OA 1PYOB 3K5PA 2F8MA 5I3PA 2YWGA 3BYPA 4DBQA 1NJYA 5H9FK 1X4GA 4GTZA 1LFWA 1ZM3A 4IFYA 4ZPBA 3GQCA 1RTJB 3HHLA 1T8EA 2MGZA 4MIVA 1HHQA 3LP1A 4ITSA 3MM6B 1IR1A 3CCLS 1HQEB 3BO3A 4RPFA 3WDOA 4XO0A 1EKRA 2RHQB 3MZIA 4B3OA 3PRBA 5IZHA 5KFPA 2CNNB 4DV2F 2D1GA 1X4CA 2COLA 4LF9J 3B82A 4BCAA 5CQGA 2HVDA 3G82B 4QZVB 2QE5A 4Q43A 3DLLQ 4KJGA 1HI1A 1D3WA 2V2QA 1Y5NB 3SCKE 3Q0AA 2MXYA 2JEIA 3B54A 3CT9A 2IM3A 3P6YC 1LW2B 3VAJA 3OJUA 3CDEA 4NA3A 1KFDA 5JMNA 1YRTA 2GCFA 2VFRA 3FC9A 5HBMA 2H4YB 3M30A 2W7PA 4DV0F 2B3TB 4Q2LA 1K7HA 3Q2SC 4I6WA 2HVEA 3CO0P 2UV8A 2LU2A 1X0FA 2PI4A 2DHXA 4KYZA 1T11A 1LW2A 1YITS 1T03B 5LIAA 1DLOA 2HFNA 3DM2A 3FRZA 5K8PA 4GTWA 1NB2A 1Q0NA 2WVFA 3VALA 1VBZA 1RHUB 1EKSA 1XMOJ 3TUZC 3HJVA 1P1LA 2BJ9A 2JZ5A 5FD1A 2PEBA 4USKA 3TA2A 4YB1P 1RGVA 1T03A 2EEYA 3KUGA 4FVMA 3CCQS 2XWXA 1VC0A 4UOOA 1JLQB 2CQIA 1Q7LB 3C15A 2ZFHA 1IXKA 2FJDB 3DU6A 3MMBA 4P2FA 1RTJA 3HHLB 4ID8A 1C1BA 1HBOB 2DNZA 4RW6B 3VQSA 5AJ3J 4JI2J 1E33P 5I4MA 5HJXA 3FZ2A 4OJ3A 2FLOA 2X1FA 1VQOS 2KB2A 3PHEA 1KH9A 3LA0A 2WBRA 4F25A 1RT4B 3GV5B 1S9EA 4F4XA 3ENWA 3J81Y 3SZ2A 1B64A 2W5RA 2V68A 1K0TA 3DOLB 3MECB 4DV6F 2CJKA 2HIYA 4URQU 1JLCB 5IC6B 4CI0B 3SCJE 5CCMA 5AJ3F 2V5HG 4DV7J 7AT1B 3FSYA 3M6VA 3AD7C 5LRMA 1U1LA 2AKWB 2YNHA 2XSJA 1N5VA 3R5CA 5CYMA 4F4YA 2KZMA 2QL7B 3OTOJ 5KT5A 2IUCB 1NH8A 5J1NA 5AE1A 1HNWJ 5G0RB 4JBCA 1WNEA 4HT7A 3HD2A 2ZM6J 3LGMA 2HIQA 3UR3C 3N28A 4D3HA 1CLFA 1IQZA 2XMWA 2V2VA 4E98A 1REVB 4O23A 1BUXA 4EI2A 2MQOA 2HMIB 4OX8A 1G3OA 5EDWA 1DLOB 3G71S 2ZH8A 3N6NA 4ZN3A 2IY5B 4KPCA 1CC8A 4WJBA 3OL8A 2YKNA 3TQEA 2CQHA 3GFXA 3BDPA 2NZCA 1JLGB 2ZJQQ 2P6TA 1S9FA 2B4PA 2AEMA 1JK9B 2EFQA 3FMBA 4QR2A 4JB8B 3OVAA 1JB0C 1HA1A 3HZEA 1BWEA 3D4JA 3OSNA 5LJ3Y 2FVSA 1W25A 1GK8A 2ROPA 4CM0A 4G1PA 5IFMA 2AEJA 1EI6A 1SH2A 2DRDA 2KFYA 2GFFA 3LP2A 2HVIA 3PJXA 5A2QU 3KHRA 3NMAA 1TK0A 4R0JA 5AE3A 6FD1A 3QGHA 2GMJA 4ZVUB 5DDRC 2GNKA 5BYSA 3QT7A 4KGKA 2XC9A 5A76A 5E41A 2B0GA 4DPXA 1WKKA 2C1EB 2YX1A 4UZCA 1MNEA 5IXUA 1AA1B 4AL6A 1N6QB 4RU2A 2HVZA 2WONA 1NJZA 3NGUA 3X1LB 4UPLA 2K3KA 2CYYA 2DGUA 4W90B 2RS8A 1U4BA 3DCAA 3J7YI 1YX2A 1JQGA 2HK2A 5DDOC 2V2KA 3KDNA 2HGLA 5CD4H 2CQCA 4BDPA 3NKNA 1R6VA 3DYAB 4NYZA 2J7UA 1ZBTA 4N8NA 4OI1A 3NKRA 5FIIA 1N0UA 4CLPA 4C7QA 4YY3J 4JOUA 3DGPA 5EX0A 2W7OA 3SBMA 4USVA 1RQ0A 2SXLA 3I0RA 3I9V9 3JYTB 3CD6S 2R7TA 1GNKA 2KVIA 4GVBA 4HACA 4WTYA 1N2KA 2DPJA 3GONA 3W61A 2YNIB 3FNNA 3AY0A 1F5BA 1T05B 2NR0A 1RDRA 3JSMA 2ZBPA 3NNAA 3T1YJ 4I69A 3PEHA 1E2SP 1DBDA 2R8HA 2OEKA 1F60B 4I68A 1VJQA 2XHCA 4NLRA 5EGEA 4M63A 1VRTA 2V8GA 3E2DA 4N5SA 3NS5A 4NXMJ 5E7OB 2PEHA 3FBBA 2VQRA 4CXSA 3CWJA 3EM1A 1RYRA 2F7VA 3MM7A 1XERA 3CC2S 3T5JA 1KDNA 2G1HA 2QZ8A 2ZWOA 4V19X 3VTIA 2W8DA 3S7RA 2AJ2A 1JLAB 2M7SA 4ICLA 3SXLA 3ZZOA 4G3IA 2WK4A 1R8AA 4BWMA 3W64A 2FHOB 2Q6CA 1SCJB 1Q8IA 4UOFA 3M8YA 4GC6A 1OIAA 4CIOA 3M30B 1KONA 2HHHF 2W2MP 3DRRA 2LQ8A 4Y0FA 2UUCJ 3IXQA 1NB7A 3D66A 3I5CA 1MU2B 1X5TA 1FJCA 2AWZA 1F0XA 2AIRB 4M5HA 2HHXA 1JMTA 3DGVA 4KAIA 1FTCA 2DXDA 2PC6A 1YQHA 1HI8A 1SPBP 4DG1A 1NDLA 5AT1B 3PFOA 4MK8A 2OHDA 1BQNA 3AOAA 2LXIA 2WVDA 1F5CA 2YX4A 3HMJG 2XBPA 2AD9A 4BHQA 4CO3A 3OTCA 4L76A 5FLXU 2E1RA 5C24A 2XY7A 4H4MA 5GAGI 3OPKA 2B51A 5GRRA 4ZHRA 1TUVA 1LFPA 2PA8D 3HFVA 4RL1A 2IRXA 4DL4A 1SKSA 2OPRB 4KTQA 2ZHOA 3KK1A 4WYLA 5HMXA 3RR7A 3TG0A 1LXNA 4DV2J 4ENOA 2Q43A 5DQHA 4IKAA 3FZBA 3BKUA 2R8JA 2IFXA 3LF0A 3MMCA 4ATNA 1DFDA 4UPHA 2KT3A 2NXEA 2ZD1B 4FYYB 9ATCB 4KSEB 4P7TA 3GIIA 2HNYB 3RAQA 2HLTA 2Y1JA 4F7VA 2NXNA 5DS7A 1MLAA 2FVCA 4X62J 3C6UA 1TMMA 2NCKL 2DR8A 2XO6A 2B43A 5LSOA 2RIJA 4F8RA 1VQ5S 3WAWA 1NH7A 3E51A 3W2WB 2XMTA 3OR1B 3R97A 2VOPA 1PJ5A 1TL7B 3AODA 3HFKA 4LF5J 3MM9B 2C2KB 3CJ8A 4OI4A 5D3GB 3T1AA 3D54A 2ZOFA 2CVIA 3BZQA 3FKBA 1S79A 3QPIA 5IQQA 4RUHA 3NCQA 2UVVA 2CJYB 1GTEA 4C8LA 3D3CJ 2E1PA 2GAGC 2DNRA 4ZG9A 1TU0B 4FKYA 3ZNJ1 3OSPA 4B3RF 1Y0HA 2QV6A 3F44A 2LVWA 3M8ZA 3DC2A 3WX8A 4AL7A 4H4KA 1KQSR 3NY0A 4DPTA 3CMES 1M5SA 1WSVA 1QJHA 3W9HA 5C5JA 4DLEA 4JI1J 3MR3A 1C1BB 1HBOA 2JVRA 1PG5B 2YWWA 3IR7B 1N36J 3HLUA 2RSQA 3UNYA 1E6YA 3ET6B 2G0JA 4W4MA 4OX9J 5E3RA 1P9QC 5ETLA 1Q78A 1T3NA 3GSDA 1KHJA 2W4CA 2RF2B 1WC4A 1R0CB 4X4VA 3NWRA 1TMJA 1YRXA 3N5BA 3TZYA 2DTJA 2GLQA 1R8HA 4KFBA 2EFNA 3GFYA 4GRSA 4ELTA 1PSDA 2VF3A 4YP3A 1AUKA 4HHUA 1P27B 3W2VA 5IT4A 4X84A 5AXNA 2ATCB 3MEDB 4LR8A 1KHVA 3GJRB 4DXLA 4A48A 4DPOA 5K14B 2IC3A 2XM3A 3PW2A 4KGXB 2H5JB 1WHWA 1PIEA 1NKCA 3MEKA 4ED4A 3RB4A 1N6QA 1S48A 4ELVA 2DY9A 4IH5A 4U7UK 2FZCB 2MKSA 1RWVB 1UETA 1YDLA 3KMSA 2HFOA 3SV4A 1VQMS 3DOMA 3US5A 1F3FA 1OQ6A 4ANDA 1ZEFA 3CSKA 4EO8A 1JJ4A 3G9CA 2KH9A 3EGWB 2VC0A 4WXOA 7FDRA 3TW0A 1KNZA 1JLBB 1M0SA 2K8GA 2HURA 4Q7AA 4ZA1A 1OY6A 1K44A 2I0XA 1GXUA 4ZPTR 2QYGA 4CYRA 1TAUA 2B5JA 2CRLA 2F9JA 4MKAA 3WC0A 4OHYA 4NLVA 4IUFA 2DCLA 1N33F 3OXFA 2MGZB 4DL2A 2F3JA 2QJ3A 3IBFB 2Y1RI 4N8OA 5KXAA 3DFEA 4JV5F 3RB0A 1FNMA 1U8SA 4I7FB 4IDKB 4NLWA 2FHJD 2C42A 2QA2A 2KJVA 2IMWP 3NWGA 4JI8F 5GMDA 2XLIA 2OLWA 1S6PA 2MJUA 2VFUA 3BGOP 3HVTB 3M2RA 3QAEA 4JP8A 4OI3A 4OYXA 5ETRA 1AZSA 4NLOA 2D74B 1FSUA 2YNGB 2UXDJ 1C1CB 2Y1LB 5KFHA 2Q66A 3LAMA 4CTAB 1Y3JA 2NUHA 4WFBQ 2V9WA 1WI8A 4L3NA 1KS2A 2DNQA 4NLYA 1T9XA 4NYOA 4QPXA 4ECRA 1D9FA 1IKYB 1J2VA 1ZPWX 4DSFA 1HDHA 2V8HA 2B7CB 4CH7A 3SZYA 1TL4A 1TKTA 4EUVA 1XMOF 1L3VA 2OMLA 4DCJB 2HBZB 2UV8G 1SKUB 3ZZZA 5J2PA 2VIHA 5KT3A 1RT1A 4LF4J 4KE5A 3MM9A 4QU7A 1T0TV 2G9YA 2IVFB 1FKPB 3VGSA 4EBCA 2RAQA 2MDAA 3QRQA 5DETA 3ILJA 3NBPA 2YBVA 4E8UA 1YJ7A 4Y6IA 3H2LA 1Y5LB 2RH3A 3CVKA 2KFNA 3AJ1A 4Q5VA 1S97A 3G6ES 2Z0GA 3GLJA 5F8GA 3H90A 3T5HA 1FFWB 3RAXA 1SVDA 2ZZNA 2GV1A 1U1KA 4J9KA 1GH8A 4R5PA 2DNPA 2BV3A 3QJPA 1TKXA 2KXNB 2E7XA 1RA7A 4ZCIA 3HHNB 2FPHX 2D9PA 2YQ3A 1A0OB 1NSAA 2G0IA 3JTPA 3O8WA 4LUBA 1NKBA 2F40A 4M94A 1ZAXA 3ED4A 4ZCMA 4USJC 3B78A 1PGZA 4LFBJ 5F8NA 3SQGB 5C42B 2YNHB 1XWLA 4F3MA 2OO4A 4X4RA 2Y0BB 4I64A 4PWUA 4DF8A 1KOHA 4DCPB 5GADU 3G96A 3MOZA 1SL2A 1Y7AA 4OYIA 2HFZA 2J9DA 3NVLA 4DL3A 1RAJA 3FEZA 4WCEQ 4X4TA 1U1QA 5ETSA 1IBKF 2G0CA 4B3SJ 1NO8A 2FC8A 4NA2A 1S1XB 5AXLA 4PR6A 2VFVA 2JLFA 5KG6A 1PO6A 1FRHA 2DEJA 1WJ9A 3H4DA 1LKZA 2I6WA 3M2UA 3KHGA 2FVPA 1K0VA 1IKVB 1Y10A 2AZ1A 4DPYA 3QIPB 4IDKA 2AJFE 2UVUA 3T00A 4ED1A 3DLGB 2IDLA 1RWOB 5MLCV 1JX4A 4AD6A 1B8JA 3R1LA 2DHAA 4F02A 3HSJA 1M5OC 5CCLA 2GQCA 1RBLA 5F9LA 3M9NB 3HZGA 4A8FA 1EW8A 2QGFB 4LRDA 1UFLA 3L95X 4HHHA 3PYEA 1U0HA 4XPEA 1VRQC 4DCOB 4UOGA 5KFEA 3TO8A 4RNOA 3I31A 2FIUA 2OPQA 3G82A 1ZOTA 3CW2C 4NEYA 3AA8A 4LFAJ 1H2VZ 2H9ZA 2IIHA 2XMMA 1AROP 4PWDA 3SZZA 2MJNA 2OELA 4LSNA 2W4PA 4IYQA 4IG3B 4JI8J 3D0GE 4ZLNA 2QIFA 3NS7B 3U1MA 1HNVA 2VD3A 3MI7X 1GMVA 2KL8A 5KFCA 3MD3A 2AGPA 3D1QA 5KFXA 4UUWA 5AXKA 1H2UX 2CJAA 5KFBA 3HP6A 1S57A 2KT5A 1DTTB 3FGVA 4CH0S 4EGLA 5H9EJ 4DQRA 3T3FA 1T9WA 3F0NA 3J7YU 4M5NA 1NKEA 2AJ0A 2CFXA 3A8JA 5A6PA 1GAOA 1REVA 3OT9A 3BSOA 2ASLA 3IP0A 5HVGA 2A10A 3N6MA 4WK3A 3SEOA 1Q8LA 1WC3A 1X5PA 2PSZA 3DMJB 2HNDB 1RP5A 4FXWA 4KQZA 1NZ8A 2CXEA 4DDFA 5GMEA 4R8UB 4MT1A 1P49A 2V4JA 3NP5A 1TFYA 1ZH5A 1LW0A 4OZ0A 2I5JB 1NK7A 5DGBA 2DRAA 1ICEB 3IMQJ 2PMZD 1N36F 2ASDA 5L0EA 2W5WA 3FEXB 5HVFA 1S0OA 1SHNA 4EZ6A 3HHEA 2B9WA 2RF2A 3FSXA 2DD8S 2GGPB 3HVWA 1S9EB 4KV8A 4URSA 3ZZTA 3JSRA 4DU7A 4KHPJ 1AT1B 3BGLA 4TLQA 2DO0A 4WFNQ 4K4YA 4MIWA 1HLWA 1SQEA 2EFVA 1UJ6A 1ROFA 3HM9A 1EB0A 4OI0A 4PWDB 1XBWA 1W2IA 3BPSP 3CJKB 3VHQA 4J9RA 4F4WA 4U8VA 4P7VA 2QYCA 1KQKA 5HVHA 3H2UB 3MPWA 3W2WA 2MPUA 4X4OA 3M8WA 4ALZA 4C3KA 3J81U 1J5EF 3JSYA 2E5LF 1KSPA 3MHYA 2E5JA 3GV7B 1T9UA 4QJVA 5L46A 1RADB 5HP1A 4FYDA 3MEGA 3Q8RB 5K4PA 4RW4A 4L6V3 8ATCB 2IA0A 4GTXA 3D2WA 4A8MP 3UD5A 3FCWA 1RYSA 3BO4A 2E5IA 2LQBA 4ZVHA 2CPYA 1FVSA 1Q79A 1M1GA 2EVZA 3NRBA 4FYXB 4J7CA 4KB7A 2GVZA 4ZPWR 3GIJA 3K89A 4NZ6A 5HI7A 5HP1B 2CPJA 5KFVA 2MY8A 2GC8A 2I1RA 4C0BA 1SJ4P 2G4BA 3DNCA 4RNFA 3Q8UA 4C48A 1RAGB 3KNAA 4K4VA 1DURA 3JQKA 3F56A 3KJQB 4ED2A 1B70B 1VLOA 2E7VA 2W01A 3H98A 4P6QA 4TYBA 2HNZB 1K1SA 4H54A 5BYQA 1BHNA 2K2PA 5B0DA 4FS2A 3VZHA 2VASA 1XMQF 3CE8A 1X9MA 3DRSB 1KLMB 2LA4A 5B0AA 4UY8T 2YKAA 3UDEA 4MY4A 2Y1IA 1O8BA 2GAHC 2J8AA 4UF4A 2N82B 5LXRA 2K06A 2C22A 4OMFG 1R8CA 2C2OB 2HK3A 1TFWA 1X0PA 2MZJA 5JXSA 1S1WA 2DH9A 2Y8YA 1XMQJ 1ZM2A 4WZQA 4PKDB 4B17A 1VQ6S 3ENAA 4LT6A 5J1PA 3BKFA 4KRWA 1KWMA 4DQIA 2CPFA 4PG6A 4QAXA 4EBEA 1OY8A 1E6YB 2XI2A 1VGYA 1MW7A 3ET6A 3R5JB 3QAUA 5DO2A 2HS0A 1S0MA 2VG5B 5CZVA 4F2RA 3BV8A 2V8PA 4OHZA 2L08A 4AXIA 2QSWA 4RW7B 1CJKA 4Y65A 2PA3A 4IH6A 1DHMA 2AJ1A 2FZKB 4CTAA 5H9EK 2H48B 1HR0J 3MD1A 3EVWA 3M4XA 4OYPA 1VYAA 3CNQP 5I3UB 5ADZA 1D9DA 4QWBA 4DR6F 1UL3A 2X1GA 1RTIB 2HEKA 2KVQE 2OUGA 4MK9A 3G6XA 1EJJA 4UZBA 2NXCA 1U1RA 4WYWA 1VQSA 1UPPA 3BGRA 3KK2B 2HYIB 1Y7PA 2MEWA 4RW8B 4B56A 4B3RJ 2RRAA 2KHDA 4J9NA 2CJXB 1UWBA 3THVA 1S12A 3FQLA 2NYHA 4ZVTB 3KK1B 2HLUA 1AFIA 2A6OA 3NKMA 3AA9A 3FK4A 2FUG9 3MAAA 5BR8J 4K4XA 5DLFA 1UJ5A 3PXGa 3TP2A 1ED9A 2JRSA 2VPXB 2EKNA 3AQPA 3PO5A 1LK5A 2LU1A 4CZCA 2DH8A 4H4MB 3G8SA 4X4UA 1FRXA 2OH2A 4K4TA 1E1ZP 2L41A 1HWLA 5CD4A 1SC1B 3HKWA 5DRKA 1RT5B 2L9DA 4FN5A 3LWMA 2WSEC 5GAEU 1UCNA 4CWBA 1AW0A 1MROB 3UVJB 2VG7B 2R7XA 4FZVA 2OPQB 4DR1F 3U27A 2XMUA 2DNNA 4EU0A 3KMQA 3W8GA 1CPZA 2GSOA 1BQMA 4ZITA 5F8JA 1IBMJ 3ELHA 4YB6A 3SFUA 3W5YA 2LEAA 3RZAA 5B7WA 2KM8B 3ICLA 4C8MA 1VBYA 2FLNA 1GMWA 2PT0A 4LREA 1WDDA 5ETOA 2Y9HA 1P1TA 3NOGA 1SJFA 2BEFA 4O4GA 2HPUA 4FYVB 2AJQA 2ZBIA 4HDGA 2Z56B 4WP9A 4DV3J 1MU2A 2HQFA 2DIVA 2GQ2A 2PMWA 2DH7A 2BZ2A 2HFUA 5KG1A 1N0VC 3TX0A 3IN5A 1HL6A 2H51B 3H20A 3OFGA 2HNZA 4ANCA 3GV8B 2UUAF 2CQGA 4DUZF 2BANA 2J6UA 1OPIA 1TL1B 2ALYB 4ZLLA 4B9NA 1ELXA 1S1VA 4CT8A 1I5OB 3PR5B 1OMSA 2EXUA 5M2PA 1YJNS 2AV5A 2GX8A 2C3YA 4EMDA 3IWXA 4B02A 5D3GA 4ECUA 4FVCA 1FRLA 5GAGU 2DXEA 5L1JA 4I56A 4LF7F 2B6AB 3JXOA 4CM2A 5KG7A 2HBYB 3H59A 2X1BA 1RT6B 2O1PA 3CO9A 3QRPA 6FDRA 3U7JA 3CJRA 4R5PB 4KO0B 2O66A 2B9YA 2VQEJ 2B7BB 3ZZYA 4DQSA 2CPDA 4RNHA 4RUCA 5L9NA 1VC5A 1Y6VA 3IM9A 4QWAA 2KZZA 4NZ7A 1FE4A 4PXCA 3PM9A 4A47A 4FPIA 2KKHA 2LDYA 5ITHA 2ASYA 2ZC4A 3EMTA 3N01A 4HL9A 4EK2A 3U02A 4UT4A 3KOAA 2VG7A 3J7AN 2FHKA 4CLSA 2R8IA 5CA5A 3KHLA 2RU3A 1H7WA 4TVAB 3CTRA 1L3SA 2D1CA 4Q2MA 2HW3A 2GVDB 3HT3A 1YHQS 1WOOA 2AYBA 4IRDA 1YJVA 5A8RB 1RAEB 4IG0A 4P72A 4PUOB 3OVSA 2OPRA 5ETVA 1QVFR 4NLPA 4TXSA 3EVOA 2XNRA 2CJQA 1IN0A 2MMYA 2IHR1 4IO9Q 2M4MA 4C8OA 2O3DA 3V81A 1RKJA 2F63A 1PJ6A 1Q5YA 2DJWA 4LRFA 3FEYB 1MWZA 1TUWA 1IKYA 1NDCA 1X4HA 3KUEA 2DT9A 2L3MA 3O44A 5HL7Q 2KDOA 2BVZA 5CABA 4EYIB 2VA3A 4WBFA 1S7HA 4A8QA 4ECQA 1R31A 3LGNA 1WORA 1S1VB 4RBTA 2LECA 1SKRA 3A52A 4ELUA 1B4SA 3MF5A 1UJ4A 3J81j 4DV5F 2FVRA 1RHJB 2RKIB 3MMAA 1RT3B 1RHMB 3PACA 4OYWA 1SUQA 5FDLA 3PIPQ 3CDUA 5G4DA 4O0NA 3BDGB 3M1VB 2OI2A 4QW8A 2K7KA 3I32A 3HSDA 1WI6A 1XJWB 2EBEA 1H3DA 2AU0A 2V6AA 1LEOA 2CJBA 1R0AB 2MQLA 4FYWB 4U67Q 4ZCLA 2E9ZA 2KYXA 3L09A 3TEHB 4MFBA 4U7CA 4DL5A 2BJEA 5T41A 4OV1A 3DDKA 2XMAA 5J2QB 3GMGA 4N41A 4K4SA 2IM0A 4XTTA 2CQ3A 4OLOA 1RWWB 1XMBA 2Z2MA 3A8IA 4NCBA 1EQ0A 2ACYA 1KOOA 1R27B 1I94J 1GFWB 1R0BG 1N34F 4FXDA 2GA3A 2M5YA 1T9TA 1TKDA 2OKQA 4TKTA 3M9MB 3MEEB 1WF0A 1JWWA 2R7QA 5KFNA 1J5EJ 2DNKA 2HRUA 4LBHA 4F0KA 2E5LJ 4C8KA 4NYPA 4YDXA 4FF1A 3RTVA 2VFTA 3QGGA 2Z8QA 3E3XA 3G6VA 4U96A 4QU6A 1IKWB 4DV1F 5DJBA 1KH4A 2VKZG 3SFGA 1ZZNA 2XWYA 1S6OA 3PJ9A 3IAM9 5E3QA 2VONA 3WZ0A 1S5ZA 3EXYA 2JFDA 4RW8A 4LRBA 1KH7A 3EPIA 3CCZA 2UUBJ 4Y28C 4V1Ak 1KTQA 4KC5A 3M2UB 4QIWD 5KFYA 3BJYA 3NOCA 2WW8A 2AZ3A 4DQQA 1IR2A 1J27A 1FKOA 2EC2A 5D4PA 1N5YA 4IRCA 3PRDA 3MCNA 3TUIC 3EDQB 4F50A 5DZ7A 4O3RA 4G1IA 4U6PA 3PG9A 3WAYA 1RT6A 3VZIA 3C15B 3MMBB 1VS3A 1UW4A 5CH7B 3NXZA 2M70A 3M8PB 3JAMU 1JJHA 3GYGA 1UA1A 3K17A 3Q8PB 4JYAF 3Q8YA 2V94A 4NOHA 3BGFA 1VCTA 1SQFA 2POKA 3K8WA 3ZZ0A 2AT1B 1KVIA 2G2OA 2J7WA 5KFLA 3T1HF 1FX2A 2Y0SD 4JYAJ 2VL1A 3MM8B 2GIFA 2GVDA 2N3LA 4F36A 1NXIA 4H4KC 2WSFC 4L75A 4CLZA 1CBKA 2HG4A 2J9DE 2KO1A 2IJNA 3DOKA 3OUYB 5EGHA 2GJFA 3ZTSA 3Q24A 4OZLA 3OL6A 4B3TF 3T1HJ 3SDEB 8RUCA 2KXFA 2D3ZA 4LRAA 4ZPVR 1UVIA 2QFJA 2OPPA 5AE2A 1KD1T 4KM4A 2HBRB 2W2NP 1X60A 2Q3PA 4FDFA 4FDJA 2ZH3A 3OTBA 2CJ9A 3C19A 3IGVA 4HLBA 2R42A 4B3TJ 1YBAA 4O3PA 4JI6J 3DYCA 1UWBB 1HBMB 1WKJA 5KFMA 1ANIA 1RTHB 4P75A 5HK4A 3KDOA 4YHHJ 2J7KA 5J2QA 1ALJA 2FC9A 1VBKA 1WG5A 1HQEA 1NPPA 1OWXA 2JL9A 2CPHA 1FXRA 4OJGA 3TVKA 5F9NA 1VQ7S 1MSWD 2C2ZB 1Y3KA 2J76E 4AT1B 2LQ9A 4PQUA 1OSCA 1TL1A 1MN9A 2EI5A 3SQOP 1CG2A 4JI5F 3IR5B 2XNQA 5E0OA 4KR0B 5JJBA 1YTYA 2W8SA 4NASA 1TP7A 2B9EA 5L9XA 4ZP7A 4CYSA 1QD1A 1KP6A 3K8VA 2HQGA 3TZXA 3M32B 2G13A 4L3KA 4NCGB 3W2VB 1U7LA 2A6MA 2MLXA 5I42B 1VQPS 3OFFA 4F4ZA 2ABYA 5F8IA 1S6PB 2FJVA 3Q86A 1NEEA 4B9UA 2F1FA 4A8YA 5GVQA 1ELOA 5LSLA 1ELZA 3P5BP 2K1RB 1RHKB 2IRYA 2VJVA 2BM1A 1V3SA 3PEJA 3CMQA 4UY85 3R2CJ 1BMQB 1K1QA 2FJAB 4DV4J 4C9DA 2IM1A 2AJ4A 1KH5A 2EWHA 1NDPA 3G8TA 1UFWA 1UVKA 3LQVA 1EETA 3TJ8A 1WC1A 4CLLA 2F8HA 5J1EA 4PWWA 2UUAJ 1G7CB 1U6ZA 4YR0A 2HHUA 4I0WA 1XNQF 4DZDA 4DV4F 3RB3A 1EQJA 5SUHA 3PFEA 3L7UA 5IOLA 1KLNA 2XEXA 3VQTA 3NAIA 1ACMB 3P49B 1Z2ZA 2V2ZA 2ASJA 1ALKA 3I6PA 1S9GB 3DN9A 1QY7A 1RT5A 4OYBA 1YZ7A 5K8NA 1URRA 4Y34A 2Q1LA 3GIKA 1FRJA 2D3O1 2ZEJA 3F41A 4I2PA 1H2TZ 3BB5A 1X4BA 1YBUA 2VB6A 1M90T 1Q7YT 1U48A 1VRTB 3HXMA 3EJMA 5DDQC 1X9SA 5B09A 2NSCA 3ITHA 3R2DJ 1Q1KA 4LMZA 1XNRJ 2FY8A 3C14A 3GR1A 1NHUA 1NAQA 3N5FA 2AEFA 3VAMA 2XYHB 3UNGC 1XC9A 3GSIA 1DQ9A 3PX6A 4MIBA 1FA0A 1SC4B 4ECVA 1FJEB 5KFZA 2Q6BA 3UCZP 1V9OA 2BABA 3A12A 3AB4B 3BF4A 1RWPB 5KG5A 1NPKA 2LKZA 5LT5A 3A4TA 1SJRA 3FSIA 2L48A 4XDDA 1CJVA 3BEGB 1V5IB 1N56A 1KC8T 1IBCB 3V5RA 2HQ3A 1FNXH 2MB0B 1U0SA 1YLXA 3KG1A 3R3TA 2B4OA 5LL6d 5LMNJ 1DARA 1MMNA 3DU5A 4CLYA 1S59A 3GJSB 4LIWA 4MJKA 1WG4A 4DG1B 4K4WA 3LO3A 3KG4A 1HWUA 3Q8QB 1SL0A 1FKOB 4I4BA 1FE0A 4NLSA 3UD4P 1H38A 3HK2A 3J80U 1WDTA 2BJDA 4ZP8A 4KT0C 2UXCF 1HBNB 2PN6A 4QIGA 2V4JB 5CHCB 3PYGA 2IDEA 4J91A 3KLVA 3KLHA 3H25A 2RHSB 4QR0A 4DF4A 2UXBJ 1FFSB 3RU0A 1IM4A 2E1AA 2FD2A 3ZXWA 3PR4A 1WHXA 2MZSA 1X8DA 1REGX 3CGIA 3LP0A 4O4RA 3D68A 4JI2F 3W7BA 2HFSA 1DY3A 3OR2A 4AUKA 4QWDA 3WX4A 3GIMA 3K5LA 2ZH2A 3BBFA 4M5JA 4RO0A 3T9NA 3WBZA 4CYUA 4ES1A 4ECTA 3KNGA 1JLEA 2DBBA 2BM0A 4Y2MA 2ACMA 3ZZPA 1TVRA 2WHOA 3IG1B 4E0DA 4IRKA 3CJ2A 2A2DA 2VBZA 3ENQA 4DV7F 2P5VA 3BSAA 4DL6A 2DR9A 3TUPA 1ALHA 5KFTA 2HNYA 1SC3B 2O67A 3TYTA 1RWUA 2AX0A 1GT8A 2P9CA 5B0EA 4KHPF 3LPYA 4CT9A 1ANJA 4OZ2A 3HHDA 2AW0A 4OHVA 1FXDA 4KAYA 4WKYA 3CJKA 2QN6B 4ZIVA 3I0SA 4IOAQ 1GX6A 4TY8A 4MAKA 3A8KA 4OZNA 4AXJA 4C6AA 3QJLA 3MPVA 4OZ5A 3S6EA 2IA6A 2GJIA 3D0IE 2JEJA 2QC3A 5IM0B 2UUBF 4B9VA 2I38A 1ULRA 4LSLB 2OFGX 3U1LA 3UFCX 4C2MA 2FJWA 3CJ0A 3CCSS 4QCLA 1IUJA 2CDQA 4I7FA 3LOUA 3MCSA 4O44A 1FJGJ 1S1XA 1FRIA 3PW0A 5B0GA 2ATLA 2FY1A 2UUWA 5HAOA 4B3MJ 5HATA 3QNWB 3CD5A 3N0VA 4PPDA 4E2FB 3AOBA 3D3BJ 3QWPA 3I5AA 4ECWA 2J0SD 2ALZA 2JEGA 4O3NA 1RB0A 4KH1B 5A8WB 4NRUA 3C6TA 3BBBA 4CRJA 5GADI 5K5MA 1EJ7L 2ZH7A 4DR5J 1JJCB 2ILYA 5D77A 4J5OA 3I87A 4USTA 5FLXY 4ED6A 1RT4A 3HT0A 2E1CA 4B9MA 4DPUA 2IJRA 3KG0A 5E3CA 3DHXA 4J9SA 3DRRB 1YI2S 3UDCA 1ZZFA 1AJBA 2QMWA 1R7IA 3RRGA 4CQ1A 3D6HB 4FF2A 3KJNB 4QYZK 1CVJA 1BY9A 3SQGA 5C42A 3GU0A 5HLFB 2DY1A 4WTOB 4RNMA 2QRRA 4I6YA 2EG1A 2IFYA 2MQNA 1X31C 1SI9A 4TU8A 3PIOQ 1RBAA 3POTA 3MK0A 3LW5C 3UW1A 2BE2A 1LOUA 2QA4S 2DR5A 5IT9U 4YY3F 2EW9A 4F0HA 5EGYA 3NMRA 3PX0A 4RW9B 4C8YA 4NEZA 1JNRB 5K8OA 5LSRA 3CDWA 1F2GA 1BGXT 1FCAA 3V2UC 2ZUAA 3PKYA 4N7TA 2VU5A 4N47A 4NLUA 1WSRA 1WACA 2CZ9A 2KG1A 3VR1A 3MUVP 1T05A 2IBOA 2KN4A 4ZK7M 3IRWP 2UXCJ 4JV1A 4Q0BB 2KG0A 3EXCX 2Z57B 1VQ9S 4XAKA 2N4CA 1S6UA 1Y4ZB 3ILIA 4K50A 4ZPAA 4I6AA 2JNJA 2HRTA 1HNIA 2W7AA 1RE1B 2JHEA 5KFGA 2LEBA 1K8AT 5L8RC 1I94F 4JI4F 4UPIA 5LXYA 1PAUB 1RCOB 1XR5A 2VPYB 3NEKA 3RRKA 4NI2A 2CQPA 3AFGA 1URNA 2OEMA 2WCXA 3WIVA 1U1MA 1HBUA 3QT8A 1C0TA 2ANHA 4M95A 3E2EA 1WWHA 2W1BA 2XULA 1ZM4A 3BDFA 1ZETA 3TJ9A 3RUBL 2BXJA 2DHSA 2ZVIA 1MROA 2BMBA 2RUSA 5KAKA 3FDSA 2JDJA 4B9LA 3Q2TC 5E3AA 1VRUB 4EYHB 1KVJA 3M2RB 2BE7D 4PQAA 2CQ4A 3TAQA 1LXJA 1OYDA 1U24A 4MTPA 4YUDA 2OMOA 1VDHA 3HFZB 2FJXA 5E33A 1ZTWA 1S72S 1PILA 4GKJF 2GZOA 2R7WA 1EP4A 1QDUB 3QT6A 2X3DA 5C7PA 3CXCR 3DRSA 1JXVA 1YSJA 5F8LA 5IWAJ 2VHGA 3EWGA 1RHQB 2V34A 1U47A 3CMRA 3H7HB 1U45A 2VG6B 1SBRA 1IQTA 3CD0A 4S0MA 4J9OA 1FWKA 3HCXA 3MM7B 4U95A 5D4LA 4CO2A 4TN2A 4EZ9A 3KD8A 2ZDPA 2DGTA 2ZE2A 4NXNF 3PW7A 1N48A 4ICLB 3G86A 4P71A 3OVBA 1HNXF 2ZITA 2ZJRQ 1HNVB 1FKPA 3FBFA 1RK8A 4N77A 4NWJA 1S1UB 3GYXB 5LQQA 3GG1A 3ENVA 2ZZMA 1T02A 1U2RA 2FZGB 1K73T 4PCQA 4EWTA 2FQQB 4MKVA 1A6LA 3CCTA 4DR5F 2VOOA 4QYZJ 2DXFA 2VC1A 2XR9A 2RMLA 3K58A 1AZSB 3MM8A 1EETB 3D6FB 3PRVA 3PYDA 2AHOB 2BE9B 3NCPA 4F3QA 1ZEBA 1URBA 2W9CA 1B7FA 5EX3A 4PRFA 2QFIA 3F73A 4GVLA 5KT2A 3C16A 2WOMB 3DYAA 4F04B 2HVHA 3FJ2A 1WOSA 2K1RA 3R7NB 2W2PP 2XTJP 1NK9A 1A7GE 2IVYA 2CG4A 1HNZJ 1Z1ZA 4PUOA 1KKHA 3EGVA 4LF5F 3CCUS 5J2MB 2W2OP 4KJIA 3QZ8A 2OJ3A 2DITA 2NPIA
chains in the Genus database with same CATH topology
2GA3A 1AJDA 2G9YA 3SZZA 2W8DA 1AJBA 1ALKA 3NKMA 3DPCA 3MK2A 5TJ3A 3BDGA 1ED9A 3M8YA 4CYRA 4UOOA 4MHXA 2IFYA 1E1ZP 1E33P 1ZEDA 1KH4A 3MK0A 3BDHA 3IDDA 5DLTA 5KXAA 4CXSA 1KH9A 5L0BA 1O98A 3UN2A 3OT9A 4LRBA 1KHNA 1KH7A 1EW2A 2GSOA 2W5SA 4LR7A 5L0KA 4N7TA 1URAA 2QZUA 5LRMA 1FSUA 2X98A 3NKOA 4LREA 3WAYA 3T01A 1P49A 2IUCB 5INHA 4LR2A 4KJDA 5GRRA 4GTYA 3UN5A 3TX0A 1HDHA 2GSUA 4TN0A 4YR1A 4UPIA 4ZGAA 2W5WA 2W5RA 1SHNA 4KM4A 5L0EA 3SZYA 3TG0A 3LXQA 1ELXA 1AJCA 4KAVA 3MK1A 3TWZA 2ANHA 3T02A 3UN3A 4UPHA 3BDFA 2W5VA 3M7VA 2IUCA 5GOVA 3M8WA 3NKQA 5EGHA 1HJKA 4UPLA 1AJAA 5K4PA 5DLWA 1Y6VA 4GTXA 4LRAA 2ZKTA 1EI6A 3WAWA 3UO0A 1B8JA 5LRNA 1O99A 4ZG6A 4FDJA 3WBHA 3DYCA 3IGZB 3IGYB 4ZG7A 1ALJA 1ED8A 1HQAA 3CMRA 2W5QA 2W5XA 4ZG9A 3ED4A 1ALHA 4LRCA 3Q3QA 4LR9A 3M8ZA 1EW9A 3WAXA 1ANIA 3KD8A 1EJJA 4GTZA 1KHLA 4UORA 5IJQA 2RH6A 1ANJA 1K7HA 3B5QA 4LRFA 4MIVA 1N2LA 1Y7AA 3NKNA 4MY4A 3UNYA 2W8SA 3NVLA 4KAYA 4CYSA 3NKRA 5DLVA 4NWJA 2D1GA 5LQQA 1KHJA 1SHQA 5HRTA 3A52A 2GLQA 4QAXA 3WAVA 2XR9A 4KJGA 1ELZA 1AUKA 1ZEBA 1N2KA 1URBA 4LR8A 3BDGB 4UPKA 5AJ9A 4B56A 4UOPA 4CXKA 1KH5A 4LQYA 1ELYA 1E2SP 5C66A 2W5TA 1EW8A 4NWXA 5EGEA 4CXUA 5IJSA 2GSNA 3E2DA 5LIAA 4LRDA 3NKPA 3T00A 2VQRA 1EQJA 1KHKA 1ALIA 4GTWA 1ZEFA 2XRGA 1E3CP 4FDIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GA3 A;  1AJD A;  2G9Y A;  3SZZ A;  2W8D A;  1AJB A;  1ALK A;  3NKM A;  3DPC A;  3MK2 A;  5TJ3 A;  3BDG A;  1ED9 A;  3M8Y A;  4CYR A;  4UOO A;  4MHX A;  2IFY A;  1E1Z P;  1E33 P;  1ZED A;  1KH4 A;  3MK0 A;  3BDH A;  3IDD A;  5DLT A;  5KXA A;  4CXS A;  1KH9 A;  5L0B A;  1O98 A;  3UN2 A;  3OT9 A;  4LRB A;  1KHN A;  1KH7 A;  1EW2 A;  2GSO A;  2W5S A;  4LR7 A;  5L0K A;  4N7T A;  1URA A;  2QZU A;  5LRM A;  1FSU A;  2X98 A;  3NKO A;  4LRE A;  3WAY A;  3T01 A;  1P49 A;  2IUC B;  5INH A;  4LR2 A;  4KJD A;  5GRR A;  4GTY A;  3UN5 A;  3TX0 A;  1HDH A;  2GSU A;  4TN0 A;  4YR1 A;  4UPI A;  4ZGA A;  2W5W A;  2W5R A;  1SHN A;  4KM4 A;  5L0E A;  3SZY A;  3TG0 A;  3LXQ A;  1ELX A;  1AJC A;  4KAV A;  3MK1 A;  3TWZ A;  2ANH A;  3T02 A;  3UN3 A;  4UPH A;  3BDF A;  2W5V A;  3M7V A;  2IUC A;  5GOV A;  3M8W A;  3NKQ A;  5EGH A;  1HJK A;  4UPL A;  1AJA A;  5K4P A;  5DLW A;  1Y6V A;  4GTX A;  4LRA A;  2ZKT A;  1EI6 A;  3WAW A;  3UO0 A;  1B8J A;  5LRN A;  1O99 A;  4ZG6 A;  4FDJ A;  3WBH A;  3DYC A;  3IGZ B;  3IGY B;  4ZG7 A;  1ALJ A;  1ED8 A;  1HQA A;  3CMR A;  2W5Q A;  2W5X A;  4ZG9 A;  3ED4 A;  1ALH A;  4LRC A;  3Q3Q A;  4LR9 A;  3M8Z A;  1EW9 A;  3WAX A;  1ANI A;  3KD8 A;  1EJJ A;  4GTZ A;  1KHL A;  4UOR A;  5IJQ A;  2RH6 A;  1ANJ A;  1K7H A;  3B5Q A;  4LRF A;  4MIV A;  1N2L A;  1Y7A A;  3NKN A;  4MY4 A;  3UNY A;  2W8S A;  3NVL A;  4KAY A;  4CYS A;  3NKR A;  5DLV A;  4NWJ A;  2D1G A;  5LQQ A;  1KHJ A;  1SHQ A;  5HRT A;  3A52 A;  2GLQ A;  4QAX A;  3WAV A;  2XR9 A;  4KJG A;  1ELZ A;  1AUK A;  1ZEB A;  1N2K A;  1URB A;  4LR8 A;  3BDG B;  4UPK A;  5AJ9 A;  4B56 A;  4UOP A;  4CXK A;  1KH5 A;  4LQY A;  1ELY A;  1E2S P;  5C66 A;  2W5T A;  1EW8 A;  4NWX A;  5EGE A;  4CXU A;  5IJS A;  2GSN A;  3E2D A;  5LIA A;  4LRD A;  3NKP A;  3T00 A;  2VQR A;  1EQJ A;  1KHK A;  1ALI A;  4GTW A;  1ZEF A;  2XRG A;  1E3C P;  4FDI A; 
#chains in the Genus database with same CATH topology
 4ZCK A;  2GA7 A;  2MKH A;  3D5M A;  1WTF A;  4K2J A;  4RW6 A;  5DDP C;  3K7R A;  3T9Z A;  4WP3 A;  4DFM A;  3C66 A;  3CD7 A;  4WK1 A;  1Q8K A;  3ONQ A;  4IQM A;  3DOM B;  3A1Y G;  1F3V A;  1SV5 A;  4HVZ A;  4PQU B;  2JJ4 D;  5KOX A;  3UQS A;  1SQG A;  4JV2 A;  2UU9 J;  3QO9 B;  2N7Y A;  5J2N B;  1WC0 A;  4LSL A;  2FB0 A;  2N3O A;  1TL3 B;  2XLJ A;  1VC6 A;  5GAH I;  2YX7 A;  5CYQ B;  3KJV A;  3O6Q A;  3OJS A;  3MTJ A;  1S1U A;  1SV5 B;  3PJW A;  2VH7 A;  3VGV A;  3RW6 A;  2JEF A;  2AP6 A;  5IQ6 A;  3QWU A;  2UU9 F;  2DIU A;  3BGU A;  1UMJ A;  4IH7 A;  4P10 A;  5L0K A;  2FTR A;  2MYF A;  2KRB A;  5KT4 A;  1DQA A;  3R6L B;  4QR1 A;  5KT7 A;  5L1K A;  3NKO A;  1JKH A;  2BRL A;  1ZYQ A;  2DYA A;  2M8H A;  2UUT A;  4C8N A;  2CNL B;  3DOK B;  1WC5 A;  2ILZ A;  3RYL A;  6AT1 B;  3WIU A;  3OUY A;  4GTY A;  2QL9 B;  5KFA A;  1O0P A;  4ZPC A;  4YDD B;  4J9Q A;  4ANE A;  4CO4 A;  2D3O R;  2CQ2 A;  2C2R A;  1M5V C;  1ZAV A;  1QAI A;  2CQB A;  3M05 A;  1LWC A;  1Q8B A;  1U2C A;  3DXS X;  4H4O A;  4HEA 9;  3AJ2 A;  2F5G A;  1S76 D;  3ZTO A;  3KK3 A;  5HQ8 A;  3BSC A;  3RBE A;  3EVM A;  2L9W A;  2H65 B;  1U6F A;  3E01 A;  3O5T B;  3SSS A;  2Z4P A;  5U47 A;  3MM6 A;  1VIO A;  4PXB A;  4X64 F;  3DMJ A;  3KLF B;  4DSI A;  1HNW F;  1HW9 A;  3MK1 A;  3T02 A;  2MTL A;  3R7S B;  1CQN A;  4CLU A;  3CF5 Q;  1R89 A;  4Y00 A;  3M32 A;  1TQL A;  1N5S A;  2V4R A;  2CQD A;  2DNY A;  3FBE A;  5DLG A;  1WHV A;  2RDD A;  2V50 A;  4K4Z A;  2LQJ A;  1B3T A;  3GPA A;  3OV7 A;  1HJK A;  2C2E A;  4LR2 A;  1UZH A;  3CCW A;  4Z2X A;  2AYE A;  3FFI B;  5HJY A;  3OHA A;  2VZ9 A;  2VG5 A;  4C3M A;  3QT5 A;  5KFK A;  3DI6 B;  1N5Y B;  2Y3Y A;  2C2D A;  4X66 J;  3I4P A;  1U1N A;  4X4S A;  4ZG6 A;  1W2B R;  3EUN A;  2G9O A;  3JAM Y;  2HS4 A;  2AGQ A;  3DLE B;  1S1W B;  4X2B A;  5F0U A;  1UEK A;  1EQM A;  5KFO A;  2RT3 A;  4FKX A;  1VHI A;  3OHB A;  2ZDO A;  4ZKA A;  5A8K A;  3J7Z T;  2UVR A;  4K0K J;  1HQA A;  2W5Q A;  2CQ0 A;  3MAQ A;  4X62 F;  2FGC A;  2M2B A;  2YXL A;  4I2Q B;  1FDB A;  3HI9 A;  2GIR A;  3DM2 B;  1JIH A;  4LRC A;  1CQM A;  5RUB A;  1JXL A;  3QBC A;  1VQL S;  3C3L A;  2XS5 A;  1HD1 A;  3MEG B;  5KFD A;  4DN9 A;  1N2L A;  1LQ9 A;  5C2G A;  4KBI A;  5KOW A;  2ZH1 A;  1R8B A;  2XMV A;  1TKZ A;  3BM7 A;  3L9Z A;  3ZTR A;  3BO2 A;  1S1T A;  4C8Z A;  4ZDN A;  3FUY A;  1FDN A;  4A8X A;  3GIL A;  1YJ9 S;  2R7S A;  3R5G A;  1NJI T;  4HR2 A;  1NK8 A;  1N5Q A;  1YZ6 A;  1I1G A;  4OV6 A;  1MN7 A;  1RAB B;  2ZOM A;  1RT1 B;  1UEV A;  3CMA S;  2BAC A;  4CDI A;  5DG8 A;  2YH1 A;  5CYQ A;  4MFB B;  1UVN A;  3DLK B;  2RRN A;  2MKI A;  2R8K A;  1MWQ A;  3LH2 S;  5I3Q A;  2IYG A;  4Q8E A;  2KT2 A;  4CXK A;  3W9J A;  2E7W A;  1U25 A;  4U7U D;  4LQY A;  1DTQ B;  3H2V E;  1CC7 A;  3IC1 A;  4ES3 A;  3I0R B;  3R7B B;  1L3T A;  3R27 A;  5THW A;  4UQG A;  3MMA B;  3N79 A;  4DX5 A;  3W66 A;  2NRE A;  4OJH A;  4USU A;  5F3Z A;  2W8K A;  2E9R X;  1RSC A;  3UWT A;  2LQ5 A;  5HQL A;  1SL1 A;  1T7P A;  3RRH A;  2OPS A;  2VJU A;  2RS2 A;  3RW7 A;  5F8M A;  4AL5 A;  4J9V A;  2UUC F;  5SZT A;  1SC6 A;  1J5O B;  3LP1 B;  1BQM B;  1EZZ B;  1UTA A;  1Y11 A;  1OS5 A;  2VFS A;  1YJW S;  2RDJ A;  3VF0 B;  1Q5V A;  4QIV A;  5M2R A;  3ISN D;  1PKU A;  4ECZ A;  1GXT A;  1RLD A;  3C16 B;  4QQB A;  3HHL D;  2C3U A;  1O5J A;  2H1Y A;  3QGI A;  4QPT A;  2CZ4 A;  2ZBQ A;  3VGU A;  3K59 A;  4OI6 A;  1OO0 B;  1ZED A;  2KU7 A;  4DZ6 A;  3IDD A;  3RJM B;  2NXU A;  1NBE B;  3CJ5 A;  5T7L A;  1VBX A;  2DR7 A;  2XS2 A;  2VPW B;  1RBO B;  2B56 A;  1RTD A;  1SJ1 A;  4LR7 A;  3CJS A;  3JYT A;  1KHW A;  4CYU B;  4WP8 A;  4J37 A;  5IS2 A;  4OYA A;  4ZPD A;  2OEJ A;  2MZQ A;  4AE5 A;  1IWG A;  4EEY A;  3NBP B;  2KYZ A;  4BWJ A;  4HI2 A;  3G2X A;  3GFH A;  3JTO A;  1F9E B;  2IMO A;  1UPM B;  3H8Y A;  3KFW X;  4RBU A;  4TU9 A;  2IPO B;  2UZA A;  4DUY J;  3V4I A;  2BQU A;  1HNX J;  3D9B A;  2LYV A;  1AXQ A;  3W3S A;  1C0U A;  3QJJ A;  4R8U A;  1CS4 A;  3BR8 A;  5DGA A;  1QSY A;  3UI3 A;  2C3M A;  4KFB B;  4DWI A;  4IFV A;  1JLC A;  3CUN A;  2HHW A;  1ZM9 A;  3TWZ A;  3RBZ A;  3D67 A;  3SDE A;  4FNI A;  3FCV A;  1X7V A;  4DOZ A;  2WVE A;  2EG2 A;  3FVY A;  4DS5 A;  1Q81 T;  2J6T A;  3EE3 A;  1RCX B;  4WE1 A;  3HHK A;  2V4Q A;  4ECY A;  3NGD A;  2XGQ A;  4ED8 A;  3AJD A;  4GO7 X;  4CH1 A;  4DFJ A;  2H4W B;  2KJW A;  1NLK L;  1YJR A;  4JI7 J;  4M8L A;  2WAQ D;  4ZN1 A;  3EPG A;  3L7O A;  5BJR A;  3R6G B;  4KGM A;  4ILM A;  3DOL A;  3MEC A;  2OSR A;  3DLK A;  1N88 A;  3HVT A;  2WVB A;  2BBE A;  2N4D A;  3FCH A;  5HO4 A;  1D09 B;  1VK8 A;  1HNZ F;  1PYS B;  2B4V A;  5IT9 Y;  4RJV A;  2HWT A;  3OTD A;  2DNH A;  2F65 A;  5MAO A;  4ZG7 A;  1LWF A;  3ZC4 A;  3HKZ D;  1JLG A;  4FF3 A;  3T5L A;  5E3P A;  1FWL A;  2JX2 A;  4HI1 A;  1U09 A;  2W5V A;  4WFA Q;  3V6H A;  4ECX A;  4PG7 A;  1UWA A;  3TQ1 A;  5LM7 E;  2XI3 A;  3OD2 A;  4AQY F;  2JVO A;  4PYA A;  4Q0B A;  3N4W A;  3V6D B;  4JI4 J;  4DS4 A;  5J2N A;  1KHL A;  2RH6 A;  3OR2 B;  1UW9 A;  1FRM A;  1TUG B;  1Z2L A;  3A13 A;  3IRX B;  3NKY A;  4HHJ A;  2XZD B;  1IJF B;  2LDI A;  1IM6 A;  2B6A A;  4F3O A;  2QLB B;  3O3L A;  4OHX A;  2YH0 A;  3MED A;  3EYZ A;  1K47 A;  3KLH B;  4X65 F;  1FI4 A;  2NSB A;  2DPI A;  1ITP A;  4NXM F;  3WAV A;  3TX8 A;  1S10 A;  4LF2 A;  3HJF A;  3QAT A;  5B0F A;  3UPF A;  5BXI A;  4JI0 F;  2KTQ A;  3KYL A;  3Q22 A;  3ZTP A;  2ERR A;  2BDP A;  2ZKU A;  4UPK A;  1RUS A;  3IFE A;  2HZV A;  3WQP A;  4LVO P;  4DSE A;  3QLH B;  2ZNY A;  2IBK A;  1OSD A;  1CJU A;  3UDL A;  5ETQ A;  2ZM6 F;  3CJQ A;  2OTJ S;  1NME B;  3I9Z A;  4Z7C A;  2RQM A;  4P2M A;  5EN1 A;  2HHH J;  4BS2 A;  3MPU B;  2UP1 A;  1EAY C;  2QA1 A;  3BDE A;  3K0J A;  3E01 B;  4C3L A;  4A8S A;  1WEL A;  3KTQ A;  3JSB A;  1EIY B;  2QLF B;  3D6M B;  1NPR A;  2F9D A;  4YR3 A;  4C11 B;  1QTN B;  1VQY A;  3AQO A;  4W98 A;  4WIQ A;  5L1I A;  4NXN J;  1FEH A;  5BYR A;  2YPY A;  3ULH A;  4P2S A;  3IO1 A;  5EWF A;  1AJD A;  1HPZ A;  4ED3 A;  1UP1 A;  3THP A;  2P9E A;  2WB1 D;  3W60 A;  1QVG R;  4LFA F;  4LF9 F;  4X66 F;  4DUY F;  3LPE A;  4ZS6 A;  2G2Y A;  2V69 A;  1HI0 P;  1JKH B;  1YJU A;  5A0Y A;  2V9K A;  4DSK A;  1AB8 A;  1EHW A;  3P3D A;  2W5S A;  3V6K A;  2LXU A;  1N33 J;  3M6X A;  2OIH A;  4K0K F;  1Q4R A;  3ZZR A;  5F41 A;  3C2P A;  1SIW B;  3SI8 A;  2BW2 A;  2HHS A;  3VVT A;  4UTG A;  2YKM A;  2XYP B;  1SIZ A;  1TKT B;  3IAS 9;  3M8S A;  1QSS A;  3T01 A;  3U1N A;  1U0H B;  5A2Q Y;  1U8W A;  1UVJ A;  5K14 A;  1RTH A;  3AAW B;  5B0C A;  2KFZ A;  2J9C A;  4L72 B;  4O3O A;  4WII A;  2GSU A;  1S77 D;  2JLE A;  2DCU B;  2RRB A;  2YWF A;  3GE9 A;  2YKM B;  3HSZ A;  3Q89 A;  2IYI A;  1C1C A;  1RTI A;  2E5H A;  3TRG A;  5T7L B;  1F9H A;  4USH A;  4NZ0 A;  4LF8 J;  1HW8 A;  1HD0 A;  3JTN A;  3MM5 B;  2ZH9 A;  3Q23 A;  2DVI A;  2VV5 A;  1IKV A;  4B9T A;  3UN3 A;  2HAF A;  4HTJ A;  3HHL C;  2BR0 A;  4NCA A;  2R7R A;  4USI A;  3OXL A;  2MSS A;  2YNI A;  2GQQ A;  3CDA A;  3MAH A;  2BAN B;  1D9A A;  2RQK A;  4ILL A;  4C4W A;  4CNZ A;  2P2C B;  3QZ7 A;  2I5J A;  1JLQ A;  2VKR A;  4QIF A;  5DLW A;  1XR6 A;  1I6J A;  4A8W A;  4USM A;  2BJ3 A;  4DFK A;  4CO0 A;  4AQY J;  4ETX A;  5DZ6 A;  2GO8 A;  2XZW A;  2DNL A;  5KG3 A;  3M9O B;  3LWL A;  4URG A;  1HHS A;  1WEZ A;  2KM8 C;  3QGP A;  3PW4 A;  3CUL A;  2C3P A;  1TTH B;  2WBM A;  3C14 B;  4FNH A;  3WBH A;  2QMU B;  1PAE X;  2QLJ B;  3MDF A;  2ZC3 A;  3AXK A;  2APO A;  5GMK a;  2I2Y A;  1PJ7 A;  2ROE A;  1I3O B;  3GIR A;  3I4H X;  3M8P A;  5EHH A;  3OTO F;  1C4A A;  1G6B A;  3M2V A;  4X65 J;  1IBM F;  1BLU A;  4TU7 A;  3NAH A;  3L3C A;  2HGN A;  4LJM A;  3Q3Q A;  2B8P A;  5EWE A;  1QAJ A;  1WD6 A;  2YNF A;  4NMX A;  1HQ2 A;  4ID5 A;  2R4F A;  3C6U B;  1ZA2 B;  4RW4 B;  4F67 A;  1HFE L;  5B08 A;  4JI0 J;  4LFC J;  5IJQ A;  3Q8V A;  3GG0 A;  1S0N A;  1V6H A;  1NK6 A;  3CB4 A;  5D0R A;  1YBT A;  2CQ1 A;  5D8H B;  5A8R A;  3BKT A;  2RQ4 A;  1HQU A;  1S6Q B;  3TAM A;  3DRP A;  1FK9 A;  3AXM A;  4XDC A;  3UE2 A;  3J7Z 5;  4X64 J;  3BH6 B;  3PVX A;  4V19 J;  3LGH A;  1B0P A;  2LMI A;  1RAA B;  9RUB A;  4DUT A;  1B7Y B;  3O1L A;  1RJJ A;  5JUM A;  4X4Q A;  3V6J A;  1RA6 A;  4DHV A;  1RAO A;  2YY3 A;  1JLF A;  3TAM B;  1D8Y A;  3ADA C;  4O0I A;  1YG0 A;  2CWK A;  2KXH A;  3JQJ A;  3CCR S;  3DDI A;  4YS2 A;  2X51 A;  4K4U A;  3KJF B;  4A8K A;  4B3S F;  1I51 B;  5AJ9 A;  1DAX A;  5HSP A;  1R6Y A;  2VQE F;  1NCL A;  1VMB A;  4GC7 A;  3R5A A;  5C66 A;  2ZJP Q;  1TR0 A;  2NZ4 A;  4B9S A;  4TNO A;  5HMW A;  2J8S A;  3NGR A;  4RWX A;  1PYT A;  4UUX A;  1WC6 A;  2JLG A;  2J0Q D;  3MOJ B;  2GGP A;  3DHW C;  2W9B A;  4LF1 A;  3K57 A;  1X5S A;  1FD2 A;  4QIE A;  2XQC A;  1Z4U A;  2OGU A;  1R43 A;  2AMC B;  2EFP A;  3H0P A;  2CNK B;  2OAU A;  3IM8 A;  3KWM A;  3P5T L;  4K8R A;  3ILO A;  4IOC Q;  2XHW A;  3PDN A;  1NJX A;  4JV5 J;  4JI3 F;  1F1B B;  1E6V B;  3OXG A;  4EFA C;  2CNO B;  4GMK A;  3OL7 A;  4NLG A;  4NA1 A;  3PY8 A;  3HX9 A;  2WTF A;  3DPC A;  1Q53 A;  2W9B B;  5F3T A;  4RR5 A;  2C2M B;  2W9C B;  3VVU A;  3KK3 B;  4ZOS A;  3L4B C;  4HKQ A;  1GQE A;  3AHP A;  2WOM A;  4P9S A;  1CJU B;  4HTI A;  1GMU A;  4DPW A;  4RZR A;  3VGT A;  4HH1 A;  2KRR A;  2FGO A;  1T95 A;  4WFZ A;  2YVS A;  4C0H A;  2PI5 A;  1DQ8 A;  2E9T A;  2E1M C;  2VPZ B;  4F2S A;  1TL7 A;  1X4F A;  2XY5 A;  2BJ7 A;  1OPZ A;  4TY8 B;  4JUZ A;  3TA1 A;  4F0M A;  1SKW A;  4ED5 A;  2X7I A;  1KHN A;  3VV2 B;  4GKK F;  1H0H B;  5IV3 A;  2ZWP A;  4PZV A;  3QLH A;  4DV5 J;  1QTM A;  3SYZ A;  2YKN B;  2GW8 A;  3R1H A;  4LF4 F;  3BYR A;  3N9U C;  2NUU G;  4N76 A;  1ZPV A;  1CJT B;  4GKK J;  2X98 A;  3A3P B;  1WEX A;  5EWG A;  2QLX A;  2B5J B;  2JFK A;  3HF5 A;  1Q86 T;  1KRP A;  3OW2 R;  2AQ4 A;  3BQ2 A;  2ZE2 B;  4KY3 A;  1LK7 A;  2P6S A;  2J9E A;  3JSM B;  1AUD A;  1M1H A;  2Z58 B;  1U1O A;  1DZ5 A;  4JI1 F;  2DGS A;  2OFH X;  1VJW A;  2CKW A;  3MTK A;  4Z7Y A;  3BBC A;  2JC1 A;  2ZVS A;  5ETP A;  3OLA A;  2CZV C;  5C24 B;  2CUY A;  2EKY A;  4WXW A;  2NQP A;  3UCU P;  3QQC D;  4YOE A;  4A46 A;  5KTQ A;  2IAJ A;  5IJS A;  2QO3 A;  2XSF A;  1E6V A;  3TAR A;  2R9L A;  2DK2 A;  3QO9 A;  5IM0 A;  4RKU C;  3M8R A;  3W9I A;  2OPP B;  2YPZ A;  2CDR B;  3CIZ A;  1Y9O A;  4KV8 B;  3H42 A;  3HVR A;  2IUC A;  1O51 A;  1QM9 A;  2HHQ A;  1L5U A;  5HLF A;  1YVF A;  2OSQ A;  3KLE B;  4ZIW A;  4ID5 B;  1FDD A;  2CG8 A;  1C0T B;  3H5X A;  2Z2Z A;  4K2X A;  1RT3 A;  2J0X A;  2NS1 B;  4GVB B;  4HAC B;  4TQR A;  4DV1 J;  2KI2 A;  3TVZ A;  3TZW A;  4NPO A;  4DMZ A;  3M6U A;  5C25 A;  3S8S A;  4YQW A;  2FHJ A;  4Y3C A;  4ETZ A;  3TR5 A;  4YEA A;  3KLF A;  3RGI A;  3IBC B;  3MFI A;  1FO1 A;  1H6K X;  3GB0 A;  2CPZ A;  3VAG A;  3C6T B;  2XMK A;  3SCL E;  4ECS A;  1VFJ A;  2DNG A;  2JC0 A;  2VBW A;  1T9V A;  2W5X A;  1NRK A;  1KQF B;  1OYE A;  2K3I A;  2CPX A;  3AD9 C;  3TJA A;  4DJB A;  5DM7 Q;  2WSC C;  3K2Y A;  3Q83 A;  4CO5 A;  4QWC A;  2MLZ A;  3AH6 A;  3SMZ A;  2OD6 A;  2HZC A;  2GML A;  4CNY A;  4DR2 F;  3PZP A;  3MEE A;  3PV8 A;  1YWX A;  2EK1 A;  3NLC A;  1V5V A;  1B0V A;  5DLV A;  3BH7 B;  1NHV A;  4G1Q A;  2CVE A;  3UVJ A;  4A4J A;  4CLW A;  1SHQ A;  1AYE A;  1RWN B;  4M5M A;  1TVR B;  3IG1 A;  4O3S A;  5HRT A;  2MQP A;  3FQK A;  1U02 A;  1GEH A;  1DTT A;  2HQC A;  3EGZ A;  3FRY A;  3MFH A;  5LOQ A;  4RUB A;  2RDI A;  2BKP A;  4CLK A;  4DX6 A;  4EBD A;  2VA2 A;  1XN9 A;  4JI7 F;  4G1Q B;  2H5I B;  3DI6 A;  4OX7 A;  4YR2 A;  5D4N A;  2UXD F;  1RAI B;  2QTW A;  3QMQ A;  4UOP A;  2U1A A;  2MY7 A;  2WVC A;  2HWH A;  4PG4 A;  3CDB A;  4PXD A;  3VAF A;  2CWX A;  3TAN A;  2OP5 A;  2XYG B;  1RTD B;  3C46 A;  3TOQ A;  2HRY A;  2PDA A;  2W5T A;  1QUP A;  4OZ1 A;  2FJB B;  4BLG A;  4RLE A;  2IRU A;  3HVA A;  3MR2 A;  1FTR A;  1UEU A;  2F4F A;  2QL5 B;  2QMX A;  2PMH A;  3LAK A;  3MAA B;  2A3J A;  4KHM A;  4M5L A;  4OQJ A;  2N7C A;  5D0H A;  4Q45 A;  2BOP A;  3DLB A;  1PC4 A;  2E29 A;  5E2Q A;  5AXM A;  1Y5I B;  3LUY A;  3IWL A;  3QSY B;  4NLD A;  1E3C P;  5I3U A;  4UW2 A;  1X4E A;  4ZP6 A;  4TQS A;  3G4S S;  4X4N A;  2DR6 A;  1RAF B;  3UCG A;  3MK2 A;  2HSE B;  4Z37 A;  2ADB A;  5T14 A;  2HS3 A;  2XZT B;  3GZ7 A;  3T5K A;  1UVM A;  1R0A A;  2MZ1 A;  3ISZ A;  4CO1 A;  1NHK L;  3NGT A;  3PKM A;  2X1A A;  1WUU A;  2EFO A;  3NGS A;  4ES2 A;  3ETO A;  1N8R T;  4WZM A;  4C11 A;  3I55 S;  1UAW A;  4IO1 A;  3H4B A;  4KPY A;  2W8L A;  2RKI A;  5FDL B;  1GMW D;  4NRT A;  1RT7 B;  1SJQ A;  1TV6 B;  1O98 A;  4XK8 C;  3PHT A;  1XK8 A;  3P8B B;  2NPF A;  5D78 A;  4DSL A;  4BC7 A;  3NL0 A;  1FNO A;  4QW9 A;  2B4U A;  1DTQ A;  4IR9 A;  3MUT P;  3ITH B;  3A3O B;  4NLX A;  3KJV B;  3KHH A;  4OL8 A;  1AFJ A;  2FDN A;  1RHR B;  2YWH A;  4FS1 A;  4OFZ A;  7FD1 A;  4C0O C;  2XB2 D;  3RG6 A;  2BRK A;  2JWN A;  2R2T A;  1Q82 T;  3ZTQ A;  1VR6 A;  1XTZ A;  3OLB A;  1RWM B;  4UQT A;  4DR1 J;  3V81 B;  3QFH A;  2XGP A;  4OYZ A;  3RB6 A;  3QRR A;  2A1B A;  2Z2L A;  3EIC A;  4ZVR B;  4J9P A;  1WKL A;  4TN0 A;  1HQU B;  1S6Q A;  4Y2I A;  3PNI A;  3ISN C;  2XO7 A;  5LMN F;  4ZGA A;  4LSN B;  5HQM A;  3L7P A;  1TL5 A;  3T6J A;  8AT1 B;  3EZO A;  3JQM A;  5D6G A;  1TK8 A;  1J5O A;  4LIR A;  3LXQ A;  3CC7 S;  3K5M A;  4BC9 A;  3MR7 A;  5J2M A;  3D0H E;  4OZJ A;  1EAR A;  2ZHA A;  1CSJ A;  4ED0 A;  1NU4 A;  1UA0 A;  2DNO A;  1HMV A;  2GIQ A;  3H5U A;  1Y00 A;  1N4L A;  1UZD A;  1PCA A;  3M7V A;  4OJ1 A;  3EZ5 A;  4DR3 F;  4IQX A;  2F4V J;  5GOV A;  3M6W A;  3MMJ A;  4MIA A;  1KR4 A;  4ZHR B;  2NXJ A;  2MQQ A;  1HWJ A;  4DI6 A;  1V3R A;  4FBT A;  2XG8 A;  4DQP A;  2ZKT A;  1FWP A;  2W2Q P;  2E5G A;  1BQN B;  1HBN A;  3EDR B;  2RUG A;  4NWB A;  5D15 A;  2ZH5 A;  2HND A;  4DR2 J;  1SB6 A;  1D1U A;  2F4V F;  4DR4 J;  3AT1 B;  3RR8 A;  4MH8 A;  3V4M A;  4MKB A;  4IR1 A;  2IM2 A;  3MCO A;  3X3U A;  4Q44 A;  3C8Y A;  3FFI A;  3IGZ B;  3IGY B;  1DRZ A;  1LW0 B;  2R3V A;  1QLN A;  3UD3 P;  1LWE A;  2CPE A;  5CYJ A;  2FVQ A;  1HNI B;  2ZUG A;  3D7S B;  4DR4 F;  3OFH A;  2YNG A;  3WAX A;  1VLY A;  3MGJ A;  1UVL A;  2H5E A;  4O3Q A;  2VQF F;  2Z30 B;  3PTW A;  3GR0 A;  4U8Y A;  4FF4 A;  2G2Z A;  1PBA A;  1HIY A;  3SSQ A;  2Q79 A;  3R8Y A;  1F5A A;  2JH3 A;  1PC5 A;  1WEY A;  4IG0 B;  3OR1 A;  4LF6 F;  3ZNU A;  1HR0 F;  2HZA A;  2PII A;  1HAR A;  1RWX B;  3PYF A;  3GWC A;  2P9G A;  3EGN A;  1QE1 A;  3KXD A;  1H72 C;  1QUV A;  3LAL A;  2ZNZ A;  4LBP A;  4MMO A;  2DGW A;  4DV6 J;  1HWI A;  2HBQ B;  2M0G B;  4DEZ A;  1F9F A;  3KLG A;  1RAH B;  4DLG A;  2AX1 A;  1FVQ A;  4KH0 B;  4B08 A;  5DG9 A;  1VIS A;  3DRP B;  3MCM A;  4RU9 A;  2D69 A;  1KFS A;  1G1X A;  4JI5 J;  3BN4 A;  4DL0 C;  1B99 A;  4U9R A;  3EX7 B;  1S4E A;  1VI7 A;  2WRM A;  2YKO A;  4OHW A;  4P2X A;  3CJ3 A;  4NLQ A;  4QBU A;  3Q8S B;  4KO0 A;  1NND A;  5BR8 F;  3JB9 k;  1QSL A;  3H5S A;  1ELY A;  4CCH A;  4MYT A;  1LWF B;  4NWX A;  3I96 A;  1VIX A;  2BOA A;  4TYA A;  2C28 A;  5DG7 A;  4EO6 A;  5KFU A;  3OBI A;  2MKC A;  3A3N B;  1WF1 A;  1YRU A;  1TZ0 A;  3R9L A;  3BQ1 A;  4DSJ A;  1HYS B;  3W65 A;  1MWY A;  1ALI A;  5HRO A;  1KHK A;  1C2P A;  5HMZ A;  1NK0 A;  4LFB F;  1P8G A;  2DRB A;  1P9Y A;  3P4U B;  1N32 F;  3M8Q A;  3DXB A;  1LWC B;  4H4O B;  4YB5 A;  4LFC F;  4RBV A;  4UOC A;  2DO4 A;  2VIC A;  4DN0 A;  4DR6 J;  3VAK A;  2CAJ A;  2GJ2 A;  2XS7 A;  3RBD A;  2MZT A;  4WU3 A;  3P96 A;  5GAH U;  1HYS A;  3QSI A;  3HUL A;  5CYM B;  3PO4 A;  1IBK J;  1G2E A;  5KFJ A;  2DGQ A;  3NCR A;  3O2I A;  4L73 A;  4Y2C A;  1NK5 A;  1N32 J;  1CJV B;  1UFK A;  1FT8 A;  2KHC A;  3TZZ A;  1FD8 A;  3HSG A;  2RVJ A;  3BPD A;  3D6T B;  4DV3 F;  5LMU J;  2NYI A;  4ZJO A;  2YQ1 A;  4OYM A;  2R7U A;  3DKD A;  5KFF A;  1HBM A;  3B4D A;  5ETN A;  1M1K T;  2K7J A;  3VAH A;  3BQ0 A;  2DGV A;  2PGC A;  3V4I B;  3TAP A;  2BE2 B;  3HPO A;  4OX6 A;  2QZU A;  4Y2K A;  4AFF A;  1LWX A;  1X4A A;  2BUN A;  3NGK A;  4M5D A;  4XIU A;  2W9A A;  5LMU F;  3W63 A;  4DX8 H;  4LF7 J;  4G65 A;  2IJF A;  2CPI A;  5ETM A;  4ZJQ A;  2PE8 A;  2MST A;  2JOQ A;  4PYD A;  5HMY A;  5D0G A;  1TL3 A;  5M2U A;  2YWK A;  2EFG A;  4RNN A;  3IRX A;  1MG7 A;  3MWB A;  3QID A;  3FMW A;  1ZA1 B;  1S0V A;  1DJ0 A;  3IS9 B;  4DR7 F;  2RIL A;  4OLP A;  1P6T A;  4JI3 J;  2ZD1 A;  4QWE A;  5LJ5 Y;  2FHM A;  1A9N B;  5A0Y B;  1VQN S;  3VAI A;  1VQ4 S;  4C98 A;  4KAV A;  1JLE B;  3DLE A;  4M5G A;  1IKX A;  2QT7 A;  3TI0 A;  1NSQ A;  5H9F J;  1TKZ B;  2PFF B;  2MLY A;  1K9M T;  3IS9 A;  1TEL A;  4KIA A;  3T41 A;  5C25 B;  3LTO A;  3MUR P;  2HAI A;  1OJ4 A;  1FRK A;  1MML A;  2DEI A;  1RXO B;  3NKQ A;  2IC3 B;  1VOM A;  4WF9 Q;  1L3K A;  5JVG Q;  5G0R A;  1JJ2 R;  2G1D A;  4KKO A;  4PPZ A;  5GAE I;  2QEX S;  4LQ3 A;  3MMC B;  2D9O A;  2Y8W A;  1ZTT A;  4YHH F;  3N6L A;  1SUQ B;  4O44 B;  4DV0 J;  2FYX A;  2OTL S;  4K5R A;  4MK7 A;  4DR7 J;  1OQ3 A;  2RNE A;  2WW4 A;  4M5K A;  4BBY A;  2FLP A;  1O99 A;  4HT5 A;  1LV5 A;  3DRY A;  3IR6 B;  4KGV B;  2DB1 A;  1IJE B;  1HMV B;  2MQM A;  3QFW A;  2D7S A;  2W25 A;  4GO5 X;  1RKI A;  3K5N A;  1RAC B;  2BX6 A;  3CIM A;  1EW9 A;  4J9U E;  2MHN A;  4NCG A;  5I42 A;  5B0B A;  1M5H A;  3M1V A;  4PAB A;  5F8H A;  3J80 Y;  3AOC A;  1D8Z A;  3B5Q A;  3CJ4 A;  2HQD A;  3MM5 A;  2VBY A;  2X3G A;  4IG3 A;  5IC4 B;  1F6T A;  2VG6 A;  5DQG A;  1M5P C;  5D4O A;  2J5A A;  2D41 A;  1WOP A;  1V3Z A;  1IR0 A;  1BWV A;  1TKX B;  1BD6 A;  1PBU A;  1S4F A;  1UKU A;  4KJD A;  4RWW A;  2D3U A;  4FPR A;  4USW A;  4G6V B;  4ZP9 A;  2R2U A;  3TUJ C;  3CCV S;  4RUA A;  5A8K B;  2LEP A;  2EC0 A;  2M8D B;  2R7V A;  1FX4 A;  1Q16 B;  2RU9 A;  4ZJL A;  5C2C A;  2R2R A;  2A0F B;  1N34 J;  4WWS A;  4ERD A;  3ZO7 A;  2VOD A;  5HN0 A;  4ZVQ B;  2V67 A;  3B8H A;  3UR0 A;  5CXT A;  1XNQ J;  4PG5 A;  4DX7 A;  5IV4 A;  2LFV A;  5KFQ A;  3EZU A;  3GCW P;  4FBU A;  2XMJ A;  2E66 A;  3VWS A;  2B8Q A;  4YB7 A;  1VRU A;  1CJT A;  1XR7 A;  3G8Q A;  3OQ2 A;  1LWE B;  1S9G A;  2HQI A;  4M5D B;  4TY9 A;  5CZX A;  2ZH6 A;  1RWK B;  2E44 A;  3GJQ B;  2GHP A;  3TVY A;  4DUZ J;  2J6S A;  5J2P B;  2RE1 A;  1T9Y A;  4GKJ J;  4J9L A;  1NUE A;  2ZBR A;  3KLG B;  3VCD A;  3H5Y A;  2XRG A;  2MKY A;  4KHR A;  3IGN A;  1FER A;  4FDI A;  3E8O A;  5IWA F;  2ROG A;  2L9N A;  3W5X A;  2DGO A;  4W92 B;  4WU2 A;  3THT A;  3BDG A;  1SH0 A;  3CCE S;  1ZS6 A;  3MXH P;  4NI2 B;  1XNR F;  1QAX A;  3BRE A;  5CAA A;  3LP0 B;  3HD1 A;  4IFY B;  5IT0 A;  2YKQ A;  4K59 A;  2QSF A;  4XPC A;  1BC6 A;  1S99 A;  2CA9 A;  2HKE A;  1Q95 G;  4WE1 B;  3MUM P;  5DLT A;  4MYU A;  1R3N A;  1D0E A;  3BDH A;  2VBX A;  1U26 A;  1ZAW A;  3CC4 S;  3UDV A;  2XLK A;  5L0B A;  1BE4 A;  2Z2Y B;  3GJT B;  3UN2 A;  1NM2 A;  1NZA A;  4ED7 A;  1XEZ A;  4NML A;  2V63 A;  3SCI E;  1RIS A;  2IAJ B;  3CED A;  2ZZT A;  2UVW A;  2MHE A;  1URA A;  1H74 A;  2PFD A;  3OFE A;  3RAM A;  3MR6 A;  4DFP A;  2GO9 A;  2O5D A;  1BXN A;  2AGO A;  3SIP B;  2M3D A;  2I9S A;  1CUL A;  3CPW R;  3NG8 A;  4TLR A;  1U49 A;  3G87 A;  1U6B A;  5INH A;  2V0N A;  4NX9 A;  5HBM B;  3KLI A;  1IKW A;  3QYY A;  2LA6 A;  3UN5 A;  5HRO B;  4F4A A;  2DGX A;  2DKO B;  4YR1 A;  4PG8 A;  2LP4 A;  5KFI A;  1RT2 B;  1JLA A;  2M9K A;  2HGM A;  4LF6 J;  1WF2 A;  2NLW A;  2CIM A;  4R0E A;  5K8M A;  4RW9 A;  3BS9 A;  4ZVP B;  3TEG A;  4LSZ B;  3BGR B;  1H98 A;  3ETM A;  4DU8 A;  1YKW A;  1EP4 B;  2LLZ A;  2MZR A;  1X5O A;  2PD1 A;  2MKK A;  2R8G A;  1X4D A;  1W26 A;  4OYO A;  1XIQ A;  2GHV C;  4B3O B;  1U2F A;  1VHF A;  2HFV A;  4JI6 F;  1KQG B;  3GCX P;  2QA4 G;  5FJ4 A;  4OZ3 A;  4FP9 A;  1AJA A;  1FDA A;  1RU2 A;  2BQ3 A;  2FLL A;  5ETK A;  1AUS L;  3SSR A;  4Q8F A;  2IVM A;  3BN7 A;  4YN3 B;  1HPZ B;  1IWA A;  2BKN A;  4PEO A;  3KUH A;  5KFS A;  4A8O A;  5A8W A;  4I67 A;  1FXL A;  3T1Y F;  3M2V B;  1NDK A;  2QLW A;  2M52 A;  1HHT P;  5LRN A;  2BW7 A;  5KG4 A;  2UXB F;  2FJE B;  2OPS B;  1T94 A;  1HBU B;  3LAN A;  1S49 A;  2QG9 B;  5ETT A;  4L74 A;  2ZOG A;  5L1L A;  1N52 B;  1RLC L;  5E5N A;  3M8Q B;  2BJ1 A;  1ED8 A;  2YQ0 A;  5DQI A;  3GP9 A;  5KG0 A;  3HO1 A;  3LP2 B;  4AYB D;  3NNH A;  2RD5 C;  5K9F A;  1FFG B;  1KTV A;  1F2H A;  1C0U B;  1GXL A;  1H7X A;  1WHY A;  2DHH A;  2XSJ B;  1N5T A;  3KLE A;  4J90 A;  4HH0 A;  4ER8 A;  4KKO B;  1CJK B;  1GX5 A;  3G6Y A;  5F0W A;  4RX6 A;  4UOR A;  4O4G B;  2BJ8 A;  3BSN A;  4IFV B;  4LVN P;  1JLB A;  2AYM A;  3TA0 A;  2HHT A;  2WON B;  3W62 A;  1QAY A;  1APS A;  1FES A;  3D28 A;  4LQ9 A;  1NJW A;  4X4P A;  1GTH A;  2AF6 A;  2XCA A;  3KKF A;  3S1T A;  3GYN A;  4ZVO B;  2OD4 A;  1FF2 A;  1RI7 A;  2VDH A;  2U2F A;  2HHV A;  1NSP A;  2ZBC A;  4I1T A;  4M1K A;  2A18 A;  4DR3 J;  2BYC A;  1WG1 A;  3DLH A;  2DIS A;  4R25 A;  4CLT A;  2V8V A;  1S1T B;  1VK3 A;  3S01 A;  3RBX A;  4CP5 A;  2GS8 A;  3CCM S;  1RTZ A;  3IBW A;  4K7Q A;  2GVZ B;  4P52 A;  4YFU A;  2B9X A;  1FKA F;  3W1Y C;  4ZMM A;  4MKY A;  1B0T A;  1JLF B;  4WFX A;  1U1P A;  1HWK A;  3DDN A;  3IA0 A;  3WC2 A;  4QOT A;  4CXU A;  2GSN A;  1X9W A;  3NKP A;  3OL9 A;  3DLG A;  1FJG F;  2RJZ A;  1CUL B;  2MKJ A;  3A8E A;  2EK6 A;  3PCO B;  1KEK A;  4B3M F;  2YTC A;  1T3O A;  3DLJ A;  1FJ7 A;  1TK5 A;  2GHW A;  1H73 A;  3ZFV A;  2A2C A;  5JVH Q;  4PXE A;  2BA9 A;  1RT2 A;  2YKP A;  3J7A 1;  2VQF J;  5TJ3 A;  3POT B;  1HKA A;  4RW7 A;  5EUH A;  4LBI A;  4NLT A;  5D0E A;  1IBL J;  3B4M A;  3K5O A;  2V8D A;  4WPA A;  2W4D A;  3TNV A;  1C4C A;  4MHX A;  1OY9 A;  4PAA A;  1MMD A;  2WB4 A;  3IWN C;  2P8I A;  4ZVE A;  2DHG A;  1N54 B;  2HHP A;  1W7W A;  2H3E B;  2WZ1 A;  2LXF A;  2PO4 A;  3HDS A;  1RU1 A;  3AB2 B;  3OTE A;  3R5D A;  2J0W A;  4ZVF A;  4ZVS B;  2BQR A;  3MR5 A;  1IBL F;  2VUG A;  4YME A;  4M5I A;  4OI2 A;  3W8P A;  4F4K A;  3WHI A;  4HDH A;  4K5S A;  2C2N A;  4DL7 A;  1EW2 A;  1YIJ S;  4IOB A;  1YJT A;  2W24 A;  1R8P A;  1YK9 A;  3T6B A;  4P73 A;  5DM6 Q;  1SXL A;  1FHT A;  2M88 A;  4C97 A;  2JSX A;  3BR9 A;  2RQC A;  1KBR A;  3D1O A;  1CS4 B;  4WFY A;  3W5Z A;  1SH3 A;  2ADC A;  3I5B A;  1KLM A;  2MQ8 A;  2CAD A;  2ZHB A;  3ILL A;  2XCP A;  1RZM A;  2I8E A;  5KG2 A;  3B6B A;  2HWI A;  4HYK A;  2XY6 A;  1IKX B;  4WKR A;  1VQK S;  4ILR A;  3SV3 A;  3CJT A;  2R2S A;  3PW5 A;  3CCJ S;  3H40 A;  4QYR A;  5A6W A;  5KFW A;  3GTY X;  2QX0 A;  2R7O A;  4I2P B;  1AJC A;  4OX9 F;  2GMH A;  2DNM A;  3P45 B;  4F26 A;  3NNC A;  1S7I A;  3I82 A;  3D1H A;  4N56 A;  4NE9 C;  2BKO A;  1FK9 B;  2F8E X;  3I0S B;  1IVZ A;  2O01 C;  3ZZU A;  3NS6 A;  5L39 A;  4Y2A A;  3DRX A;  4ZLP A;  1KVK A;  1JNZ B;  4I2Q A;  3T19 A;  4KGZ B;  1RT7 A;  1TV6 A;  3GFZ A;  3V6D A;  5KT6 A;  1M5K C;  3KLI B;  4ZLJ A;  2YNF B;  3MPY A;  1WTB A;  1CEZ A;  3PX4 A;  5J1E B;  5H1S V;  4OIX A;  4LF8 F;  3QIP A;  5KFR A;  1NK4 A;  3I56 S;  3UO0 A;  4D3G A;  2ZH4 A;  1TAQ A;  5L38 A;  2HMI A;  1O6X A;  5HAN A;  3KK2 A;  4CLF A;  2LCW A;  3DGP B;  4UOH A;  1QE1 B;  2VDI A;  4JV0 A;  4J9M A;  2EPI A;  2YWE A;  3AD8 C;  2H54 B;  5K20 B;  4P74 A;  1VQ8 S;  2AYG A;  1FEE A;  3R5B A;  3JS9 A;  3FBC A;  1EX8 A;  4NL5 A;  1SJ3 P;  1KN6 A;  1XQI A;  1JXE A;  1YGY A;  2EBG A;  1G4C A;  1LNQ A;  4FXV A;  1BQX A;  4ZVG A;  3MPD A;  1NSK L;  1L3U A;  2RB7 A;  4LR9 A;  2C3O A;  1PYO B;  3K5P A;  2F8M A;  5I3P A;  2YWG A;  3BYP A;  4DBQ A;  1NJY A;  5H9F K;  1X4G A;  4GTZ A;  1LFW A;  1ZM3 A;  4IFY A;  4ZPB A;  3GQC A;  1RTJ B;  3HHL A;  1T8E A;  2MGZ A;  4MIV A;  1HHQ A;  3LP1 A;  4ITS A;  3MM6 B;  1IR1 A;  3CCL S;  1HQE B;  3BO3 A;  4RPF A;  3WDO A;  4XO0 A;  1EKR A;  2RHQ B;  3MZI A;  4B3O A;  3PRB A;  5IZH A;  5KFP A;  2CNN B;  4DV2 F;  2D1G A;  1X4C A;  2COL A;  4LF9 J;  3B82 A;  4BCA A;  5CQG A;  2HVD A;  3G82 B;  4QZV B;  2QE5 A;  4Q43 A;  3DLL Q;  4KJG A;  1HI1 A;  1D3W A;  2V2Q A;  1Y5N B;  3SCK E;  3Q0A A;  2MXY A;  2JEI A;  3B54 A;  3CT9 A;  2IM3 A;  3P6Y C;  1LW2 B;  3VAJ A;  3OJU A;  3CDE A;  4NA3 A;  1KFD A;  5JMN A;  1YRT A;  2GCF A;  2VFR A;  3FC9 A;  5HBM A;  2H4Y B;  3M30 A;  2W7P A;  4DV0 F;  2B3T B;  4Q2L A;  1K7H A;  3Q2S C;  4I6W A;  2HVE A;  3CO0 P;  2UV8 A;  2LU2 A;  1X0F A;  2PI4 A;  2DHX A;  4KYZ A;  1T11 A;  1LW2 A;  1YIT S;  1T03 B;  5LIA A;  1DLO A;  2HFN A;  3DM2 A;  3FRZ A;  5K8P A;  4GTW A;  1NB2 A;  1Q0N A;  2WVF A;  3VAL A;  1VBZ A;  1RHU B;  1EKS A;  1XMO J;  3TUZ C;  3HJV A;  1P1L A;  2BJ9 A;  2JZ5 A;  5FD1 A;  2PEB A;  4USK A;  3TA2 A;  4YB1 P;  1RGV A;  1T03 A;  2EEY A;  3KUG A;  4FVM A;  3CCQ S;  2XWX A;  1VC0 A;  4UOO A;  1JLQ B;  2CQI A;  1Q7L B;  3C15 A;  2ZFH A;  1IXK A;  2FJD B;  3DU6 A;  3MMB A;  4P2F A;  1RTJ A;  3HHL B;  4ID8 A;  1C1B A;  1HBO B;  2DNZ A;  4RW6 B;  3VQS A;  5AJ3 J;  4JI2 J;  1E33 P;  5I4M A;  5HJX A;  3FZ2 A;  4OJ3 A;  2FLO A;  2X1F A;  1VQO S;  2KB2 A;  3PHE A;  1KH9 A;  3LA0 A;  2WBR A;  4F25 A;  1RT4 B;  3GV5 B;  1S9E A;  4F4X A;  3ENW A;  3J81 Y;  3SZ2 A;  1B64 A;  2W5R A;  2V68 A;  1K0T A;  3DOL B;  3MEC B;  4DV6 F;  2CJK A;  2HIY A;  4URQ U;  1JLC B;  5IC6 B;  4CI0 B;  3SCJ E;  5CCM A;  5AJ3 F;  2V5H G;  4DV7 J;  7AT1 B;  3FSY A;  3M6V A;  3AD7 C;  5LRM A;  1U1L A;  2AKW B;  2YNH A;  2XSJ A;  1N5V A;  3R5C A;  5CYM A;  4F4Y A;  2KZM A;  2QL7 B;  3OTO J;  5KT5 A;  2IUC B;  1NH8 A;  5J1N A;  5AE1 A;  1HNW J;  5G0R B;  4JBC A;  1WNE A;  4HT7 A;  3HD2 A;  2ZM6 J;  3LGM A;  2HIQ A;  3UR3 C;  3N28 A;  4D3H A;  1CLF A;  1IQZ A;  2XMW A;  2V2V A;  4E98 A;  1REV B;  4O23 A;  1BUX A;  4EI2 A;  2MQO A;  2HMI B;  4OX8 A;  1G3O A;  5EDW A;  1DLO B;  3G71 S;  2ZH8 A;  3N6N A;  4ZN3 A;  2IY5 B;  4KPC A;  1CC8 A;  4WJB A;  3OL8 A;  2YKN A;  3TQE A;  2CQH A;  3GFX A;  3BDP A;  2NZC A;  1JLG B;  2ZJQ Q;  2P6T A;  1S9F A;  2B4P A;  2AEM A;  1JK9 B;  2EFQ A;  3FMB A;  4QR2 A;  4JB8 B;  3OVA A;  1JB0 C;  1HA1 A;  3HZE A;  1BWE A;  3D4J A;  3OSN A;  5LJ3 Y;  2FVS A;  1W25 A;  1GK8 A;  2ROP A;  4CM0 A;  4G1P A;  5IFM A;  2AEJ A;  1EI6 A;  1SH2 A;  2DRD A;  2KFY A;  2GFF A;  3LP2 A;  2HVI A;  3PJX A;  5A2Q U;  3KHR A;  3NMA A;  1TK0 A;  4R0J A;  5AE3 A;  6FD1 A;  3QGH A;  2GMJ A;  4ZVU B;  5DDR C;  2GNK A;  5BYS A;  3QT7 A;  4KGK A;  2XC9 A;  5A76 A;  5E41 A;  2B0G A;  4DPX A;  1WKK A;  2C1E B;  2YX1 A;  4UZC A;  1MNE A;  5IXU A;  1AA1 B;  4AL6 A;  1N6Q B;  4RU2 A;  2HVZ A;  2WON A;  1NJZ A;  3NGU A;  3X1L B;  4UPL A;  2K3K A;  2CYY A;  2DGU A;  4W90 B;  2RS8 A;  1U4B A;  3DCA A;  3J7Y I;  1YX2 A;  1JQG A;  2HK2 A;  5DDO C;  2V2K A;  3KDN A;  2HGL A;  5CD4 H;  2CQC A;  4BDP A;  3NKN A;  1R6V A;  3DYA B;  4NYZ A;  2J7U A;  1ZBT A;  4N8N A;  4OI1 A;  3NKR A;  5FII A;  1N0U A;  4CLP A;  4C7Q A;  4YY3 J;  4JOU A;  3DGP A;  5EX0 A;  2W7O A;  3SBM A;  4USV A;  1RQ0 A;  2SXL A;  3I0R A;  3I9V 9;  3JYT B;  3CD6 S;  2R7T A;  1GNK A;  2KVI A;  4GVB A;  4HAC A;  4WTY A;  1N2K A;  2DPJ A;  3GON A;  3W61 A;  2YNI B;  3FNN A;  3AY0 A;  1F5B A;  1T05 B;  2NR0 A;  1RDR A;  3JSM A;  2ZBP A;  3NNA A;  3T1Y J;  4I69 A;  3PEH A;  1E2S P;  1DBD A;  2R8H A;  2OEK A;  1F60 B;  4I68 A;  1VJQ A;  2XHC A;  4NLR A;  5EGE A;  4M63 A;  1VRT A;  2V8G A;  3E2D A;  4N5S A;  3NS5 A;  4NXM J;  5E7O B;  2PEH A;  3FBB A;  2VQR A;  4CXS A;  3CWJ A;  3EM1 A;  1RYR A;  2F7V A;  3MM7 A;  1XER A;  3CC2 S;  3T5J A;  1KDN A;  2G1H A;  2QZ8 A;  2ZWO A;  4V19 X;  3VTI A;  2W8D A;  3S7R A;  2AJ2 A;  1JLA B;  2M7S A;  4ICL A;  3SXL A;  3ZZO A;  4G3I A;  2WK4 A;  1R8A A;  4BWM A;  3W64 A;  2FHO B;  2Q6C A;  1SCJ B;  1Q8I A;  4UOF A;  3M8Y A;  4GC6 A;  1OIA A;  4CIO A;  3M30 B;  1KON A;  2HHH F;  2W2M P;  3DRR A;  2LQ8 A;  4Y0F A;  2UUC J;  3IXQ A;  1NB7 A;  3D66 A;  3I5C A;  1MU2 B;  1X5T A;  1FJC A;  2AWZ A;  1F0X A;  2AIR B;  4M5H A;  2HHX A;  1JMT A;  3DGV A;  4KAI A;  1FTC A;  2DXD A;  2PC6 A;  1YQH A;  1HI8 A;  1SPB P;  4DG1 A;  1NDL A;  5AT1 B;  3PFO A;  4MK8 A;  2OHD A;  1BQN A;  3AOA A;  2LXI A;  2WVD A;  1F5C A;  2YX4 A;  3HMJ G;  2XBP A;  2AD9 A;  4BHQ A;  4CO3 A;  3OTC A;  4L76 A;  5FLX U;  2E1R A;  5C24 A;  2XY7 A;  4H4M A;  5GAG I;  3OPK A;  2B51 A;  5GRR A;  4ZHR A;  1TUV A;  1LFP A;  2PA8 D;  3HFV A;  4RL1 A;  2IRX A;  4DL4 A;  1SKS A;  2OPR B;  4KTQ A;  2ZHO A;  3KK1 A;  4WYL A;  5HMX A;  3RR7 A;  3TG0 A;  1LXN A;  4DV2 J;  4ENO A;  2Q43 A;  5DQH A;  4IKA A;  3FZB A;  3BKU A;  2R8J A;  2IFX A;  3LF0 A;  3MMC A;  4ATN A;  1DFD A;  4UPH A;  2KT3 A;  2NXE A;  2ZD1 B;  4FYY B;  9ATC B;  4KSE B;  4P7T A;  3GII A;  2HNY B;  3RAQ A;  2HLT A;  2Y1J A;  4F7V A;  2NXN A;  5DS7 A;  1MLA A;  2FVC A;  4X62 J;  3C6U A;  1TMM A;  2NCK L;  2DR8 A;  2XO6 A;  2B43 A;  5LSO A;  2RIJ A;  4F8R A;  1VQ5 S;  3WAW A;  1NH7 A;  3E51 A;  3W2W B;  2XMT A;  3OR1 B;  3R97 A;  2VOP A;  1PJ5 A;  1TL7 B;  3AOD A;  3HFK A;  4LF5 J;  3MM9 B;  2C2K B;  3CJ8 A;  4OI4 A;  5D3G B;  3T1A A;  3D54 A;  2ZOF A;  2CVI A;  3BZQ A;  3FKB A;  1S79 A;  3QPI A;  5IQQ A;  4RUH A;  3NCQ A;  2UVV A;  2CJY B;  1GTE A;  4C8L A;  3D3C J;  2E1P A;  2GAG C;  2DNR A;  4ZG9 A;  1TU0 B;  4FKY A;  3ZNJ 1;  3OSP A;  4B3R F;  1Y0H A;  2QV6 A;  3F44 A;  2LVW A;  3M8Z A;  3DC2 A;  3WX8 A;  4AL7 A;  4H4K A;  1KQS R;  3NY0 A;  4DPT A;  3CME S;  1M5S A;  1WSV A;  1QJH A;  3W9H A;  5C5J A;  4DLE A;  4JI1 J;  3MR3 A;  1C1B B;  1HBO A;  2JVR A;  1PG5 B;  2YWW A;  3IR7 B;  1N36 J;  3HLU A;  2RSQ A;  3UNY A;  1E6Y A;  3ET6 B;  2G0J A;  4W4M A;  4OX9 J;  5E3R A;  1P9Q C;  5ETL A;  1Q78 A;  1T3N A;  3GSD A;  1KHJ A;  2W4C A;  2RF2 B;  1WC4 A;  1R0C B;  4X4V A;  3NWR A;  1TMJ A;  1YRX A;  3N5B A;  3TZY A;  2DTJ A;  2GLQ A;  1R8H A;  4KFB A;  2EFN A;  3GFY A;  4GRS A;  4ELT A;  1PSD A;  2VF3 A;  4YP3 A;  1AUK A;  4HHU A;  1P27 B;  3W2V A;  5IT4 A;  4X84 A;  5AXN A;  2ATC B;  3MED B;  4LR8 A;  1KHV A;  3GJR B;  4DXL A;  4A48 A;  4DPO A;  5K14 B;  2IC3 A;  2XM3 A;  3PW2 A;  4KGX B;  2H5J B;  1WHW A;  1PIE A;  1NKC A;  3MEK A;  4ED4 A;  3RB4 A;  1N6Q A;  1S48 A;  4ELV A;  2DY9 A;  4IH5 A;  4U7U K;  2FZC B;  2MKS A;  1RWV B;  1UET A;  1YDL A;  3KMS A;  2HFO A;  3SV4 A;  1VQM S;  3DOM A;  3US5 A;  1F3F A;  1OQ6 A;  4AND A;  1ZEF A;  3CSK A;  4EO8 A;  1JJ4 A;  3G9C A;  2KH9 A;  3EGW B;  2VC0 A;  4WXO A;  7FDR A;  3TW0 A;  1KNZ A;  1JLB B;  1M0S A;  2K8G A;  2HUR A;  4Q7A A;  4ZA1 A;  1OY6 A;  1K44 A;  2I0X A;  1GXU A;  4ZPT R;  2QYG A;  4CYR A;  1TAU A;  2B5J A;  2CRL A;  2F9J A;  4MKA A;  3WC0 A;  4OHY A;  4NLV A;  4IUF A;  2DCL A;  1N33 F;  3OXF A;  2MGZ B;  4DL2 A;  2F3J A;  2QJ3 A;  3IBF B;  2Y1R I;  4N8O A;  5KXA A;  3DFE A;  4JV5 F;  3RB0 A;  1FNM A;  1U8S A;  4I7F B;  4IDK B;  4NLW A;  2FHJ D;  2C42 A;  2QA2 A;  2KJV A;  2IMW P;  3NWG A;  4JI8 F;  5GMD A;  2XLI A;  2OLW A;  1S6P A;  2MJU A;  2VFU A;  3BGO P;  3HVT B;  3M2R A;  3QAE A;  4JP8 A;  4OI3 A;  4OYX A;  5ETR A;  1AZS A;  4NLO A;  2D74 B;  1FSU A;  2YNG B;  2UXD J;  1C1C B;  2Y1L B;  5KFH A;  2Q66 A;  3LAM A;  4CTA B;  1Y3J A;  2NUH A;  4WFB Q;  2V9W A;  1WI8 A;  4L3N A;  1KS2 A;  2DNQ A;  4NLY A;  1T9X A;  4NYO A;  4QPX A;  4ECR A;  1D9F A;  1IKY B;  1J2V A;  1ZPW X;  4DSF A;  1HDH A;  2V8H A;  2B7C B;  4CH7 A;  3SZY A;  1TL4 A;  1TKT A;  4EUV A;  1XMO F;  1L3V A;  2OML A;  4DCJ B;  2HBZ B;  2UV8 G;  1SKU B;  3ZZZ A;  5J2P A;  2VIH A;  5KT3 A;  1RT1 A;  4LF4 J;  4KE5 A;  3MM9 A;  4QU7 A;  1T0T V;  2G9Y A;  2IVF B;  1FKP B;  3VGS A;  4EBC A;  2RAQ A;  2MDA A;  3QRQ A;  5DET A;  3ILJ A;  3NBP A;  2YBV A;  4E8U A;  1YJ7 A;  4Y6I A;  3H2L A;  1Y5L B;  2RH3 A;  3CVK A;  2KFN A;  3AJ1 A;  4Q5V A;  1S97 A;  3G6E S;  2Z0G A;  3GLJ A;  5F8G A;  3H90 A;  3T5H A;  1FFW B;  3RAX A;  1SVD A;  2ZZN A;  2GV1 A;  1U1K A;  4J9K A;  1GH8 A;  4R5P A;  2DNP A;  2BV3 A;  3QJP A;  1TKX A;  2KXN B;  2E7X A;  1RA7 A;  4ZCI A;  3HHN B;  2FPH X;  2D9P A;  2YQ3 A;  1A0O B;  1NSA A;  2G0I A;  3JTP A;  3O8W A;  4LUB A;  1NKB A;  2F40 A;  4M94 A;  1ZAX A;  3ED4 A;  4ZCM A;  4USJ C;  3B78 A;  1PGZ A;  4LFB J;  5F8N A;  3SQG B;  5C42 B;  2YNH B;  1XWL A;  4F3M A;  2OO4 A;  4X4R A;  2Y0B B;  4I64 A;  4PWU A;  4DF8 A;  1KOH A;  4DCP B;  5GAD U;  3G96 A;  3MOZ A;  1SL2 A;  1Y7A A;  4OYI A;  2HFZ A;  2J9D A;  3NVL A;  4DL3 A;  1RAJ A;  3FEZ A;  4WCE Q;  4X4T A;  1U1Q A;  5ETS A;  1IBK F;  2G0C A;  4B3S J;  1NO8 A;  2FC8 A;  4NA2 A;  1S1X B;  5AXL A;  4PR6 A;  2VFV A;  2JLF A;  5KG6 A;  1PO6 A;  1FRH A;  2DEJ A;  1WJ9 A;  3H4D A;  1LKZ A;  2I6W A;  3M2U A;  3KHG A;  2FVP A;  1K0V A;  1IKV B;  1Y10 A;  2AZ1 A;  4DPY A;  3QIP B;  4IDK A;  2AJF E;  2UVU A;  3T00 A;  4ED1 A;  3DLG B;  2IDL A;  1RWO B;  5MLC V;  1JX4 A;  4AD6 A;  1B8J A;  3R1L A;  2DHA A;  4F02 A;  3HSJ A;  1M5O C;  5CCL A;  2GQC A;  1RBL A;  5F9L A;  3M9N B;  3HZG A;  4A8F A;  1EW8 A;  2QGF B;  4LRD A;  1UFL A;  3L95 X;  4HHH A;  3PYE A;  1U0H A;  4XPE A;  1VRQ C;  4DCO B;  4UOG A;  5KFE A;  3TO8 A;  4RNO A;  3I31 A;  2FIU A;  2OPQ A;  3G82 A;  1ZOT A;  3CW2 C;  4NEY A;  3AA8 A;  4LFA J;  1H2V Z;  2H9Z A;  2IIH A;  2XMM A;  1ARO P;  4PWD A;  3SZZ A;  2MJN A;  2OEL A;  4LSN A;  2W4P A;  4IYQ A;  4IG3 B;  4JI8 J;  3D0G E;  4ZLN A;  2QIF A;  3NS7 B;  3U1M A;  1HNV A;  2VD3 A;  3MI7 X;  1GMV A;  2KL8 A;  5KFC A;  3MD3 A;  2AGP A;  3D1Q A;  5KFX A;  4UUW A;  5AXK A;  1H2U X;  2CJA A;  5KFB A;  3HP6 A;  1S57 A;  2KT5 A;  1DTT B;  3FGV A;  4CH0 S;  4EGL A;  5H9E J;  4DQR A;  3T3F A;  1T9W A;  3F0N A;  3J7Y U;  4M5N A;  1NKE A;  2AJ0 A;  2CFX A;  3A8J A;  5A6P A;  1GAO A;  1REV A;  3OT9 A;  3BSO A;  2ASL A;  3IP0 A;  5HVG A;  2A10 A;  3N6M A;  4WK3 A;  3SEO A;  1Q8L A;  1WC3 A;  1X5P A;  2PSZ A;  3DMJ B;  2HND B;  1RP5 A;  4FXW A;  4KQZ A;  1NZ8 A;  2CXE A;  4DDF A;  5GME A;  4R8U B;  4MT1 A;  1P49 A;  2V4J A;  3NP5 A;  1TFY A;  1ZH5 A;  1LW0 A;  4OZ0 A;  2I5J B;  1NK7 A;  5DGB A;  2DRA A;  1ICE B;  3IMQ J;  2PMZ D;  1N36 F;  2ASD A;  5L0E A;  2W5W A;  3FEX B;  5HVF A;  1S0O A;  1SHN A;  4EZ6 A;  3HHE A;  2B9W A;  2RF2 A;  3FSX A;  2DD8 S;  2GGP B;  3HVW A;  1S9E B;  4KV8 A;  4URS A;  3ZZT A;  3JSR A;  4DU7 A;  4KHP J;  1AT1 B;  3BGL A;  4TLQ A;  2DO0 A;  4WFN Q;  4K4Y A;  4MIW A;  1HLW A;  1SQE A;  2EFV A;  1UJ6 A;  1ROF A;  3HM9 A;  1EB0 A;  4OI0 A;  4PWD B;  1XBW A;  1W2I A;  3BPS P;  3CJK B;  3VHQ A;  4J9R A;  4F4W A;  4U8V A;  4P7V A;  2QYC A;  1KQK A;  5HVH A;  3H2U B;  3MPW A;  3W2W A;  2MPU A;  4X4O A;  3M8W A;  4ALZ A;  4C3K A;  3J81 U;  1J5E F;  3JSY A;  2E5L F;  1KSP A;  3MHY A;  2E5J A;  3GV7 B;  1T9U A;  4QJV A;  5L46 A;  1RAD B;  5HP1 A;  4FYD A;  3MEG A;  3Q8R B;  5K4P A;  4RW4 A;  4L6V 3;  8ATC B;  2IA0 A;  4GTX A;  3D2W A;  4A8M P;  3UD5 A;  3FCW A;  1RYS A;  3BO4 A;  2E5I A;  2LQB A;  4ZVH A;  2CPY A;  1FVS A;  1Q79 A;  1M1G A;  2EVZ A;  3NRB A;  4FYX B;  4J7C A;  4KB7 A;  2GVZ A;  4ZPW R;  3GIJ A;  3K89 A;  4NZ6 A;  5HI7 A;  5HP1 B;  2CPJ A;  5KFV A;  2MY8 A;  2GC8 A;  2I1R A;  4C0B A;  1SJ4 P;  2G4B A;  3DNC A;  4RNF A;  3Q8U A;  4C48 A;  1RAG B;  3KNA A;  4K4V A;  1DUR A;  3JQK A;  3F56 A;  3KJQ B;  4ED2 A;  1B70 B;  1VLO A;  2E7V A;  2W01 A;  3H98 A;  4P6Q A;  4TYB A;  2HNZ B;  1K1S A;  4H54 A;  5BYQ A;  1BHN A;  2K2P A;  5B0D A;  4FS2 A;  3VZH A;  2VAS A;  1XMQ F;  3CE8 A;  1X9M A;  3DRS B;  1KLM B;  2LA4 A;  5B0A A;  4UY8 T;  2YKA A;  3UDE A;  4MY4 A;  2Y1I A;  1O8B A;  2GAH C;  2J8A A;  4UF4 A;  2N82 B;  5LXR A;  2K06 A;  2C22 A;  4OMF G;  1R8C A;  2C2O B;  2HK3 A;  1TFW A;  1X0P A;  2MZJ A;  5JXS A;  1S1W A;  2DH9 A;  2Y8Y A;  1XMQ J;  1ZM2 A;  4WZQ A;  4PKD B;  4B17 A;  1VQ6 S;  3ENA A;  4LT6 A;  5J1P A;  3BKF A;  4KRW A;  1KWM A;  4DQI A;  2CPF A;  4PG6 A;  4QAX A;  4EBE A;  1OY8 A;  1E6Y B;  2XI2 A;  1VGY A;  1MW7 A;  3ET6 A;  3R5J B;  3QAU A;  5DO2 A;  2HS0 A;  1S0M A;  2VG5 B;  5CZV A;  4F2R A;  3BV8 A;  2V8P A;  4OHZ A;  2L08 A;  4AXI A;  2QSW A;  4RW7 B;  1CJK A;  4Y65 A;  2PA3 A;  4IH6 A;  1DHM A;  2AJ1 A;  2FZK B;  4CTA A;  5H9E K;  2H48 B;  1HR0 J;  3MD1 A;  3EVW A;  3M4X A;  4OYP A;  1VYA A;  3CNQ P;  5I3U B;  5ADZ A;  1D9D A;  4QWB A;  4DR6 F;  1UL3 A;  2X1G A;  1RTI B;  2HEK A;  2KVQ E;  2OUG A;  4MK9 A;  3G6X A;  1EJJ A;  4UZB A;  2NXC A;  1U1R A;  4WYW A;  1VQS A;  1UPP A;  3BGR A;  3KK2 B;  2HYI B;  1Y7P A;  2MEW A;  4RW8 B;  4B56 A;  4B3R J;  2RRA A;  2KHD A;  4J9N A;  2CJX B;  1UWB A;  3THV A;  1S12 A;  3FQL A;  2NYH A;  4ZVT B;  3KK1 B;  2HLU A;  1AFI A;  2A6O A;  3NKM A;  3AA9 A;  3FK4 A;  2FUG 9;  3MAA A;  5BR8 J;  4K4X A;  5DLF A;  1UJ5 A;  3PXG a;  3TP2 A;  1ED9 A;  2JRS A;  2VPX B;  2EKN A;  3AQP A;  3PO5 A;  1LK5 A;  2LU1 A;  4CZC A;  2DH8 A;  4H4M B;  3G8S A;  4X4U A;  1FRX A;  2OH2 A;  4K4T A;  1E1Z P;  2L41 A;  1HWL A;  5CD4 A;  1SC1 B;  3HKW A;  5DRK A;  1RT5 B;  2L9D A;  4FN5 A;  3LWM A;  2WSE C;  5GAE U;  1UCN A;  4CWB A;  1AW0 A;  1MRO B;  3UVJ B;  2VG7 B;  2R7X A;  4FZV A;  2OPQ B;  4DR1 F;  3U27 A;  2XMU A;  2DNN A;  4EU0 A;  3KMQ A;  3W8G A;  1CPZ A;  2GSO A;  1BQM A;  4ZIT A;  5F8J A;  1IBM J;  3ELH A;  4YB6 A;  3SFU A;  3W5Y A;  2LEA A;  3RZA A;  5B7W A;  2KM8 B;  3ICL A;  4C8M A;  1VBY A;  2FLN A;  1GMW A;  2PT0 A;  4LRE A;  1WDD A;  5ETO A;  2Y9H A;  1P1T A;  3NOG A;  1SJF A;  2BEF A;  4O4G A;  2HPU A;  4FYV B;  2AJQ A;  2ZBI A;  4HDG A;  2Z56 B;  4WP9 A;  4DV3 J;  1MU2 A;  2HQF A;  2DIV A;  2GQ2 A;  2PMW A;  2DH7 A;  2BZ2 A;  2HFU A;  5KG1 A;  1N0V C;  3TX0 A;  3IN5 A;  1HL6 A;  2H51 B;  3H20 A;  3OFG A;  2HNZ A;  4ANC A;  3GV8 B;  2UUA F;  2CQG A;  4DUZ F;  2BAN A;  2J6U A;  1OPI A;  1TL1 B;  2ALY B;  4ZLL A;  4B9N A;  1ELX A;  1S1V A;  4CT8 A;  1I5O B;  3PR5 B;  1OMS A;  2EXU A;  5M2P A;  1YJN S;  2AV5 A;  2GX8 A;  2C3Y A;  4EMD A;  3IWX A;  4B02 A;  5D3G A;  4ECU A;  4FVC A;  1FRL A;  5GAG U;  2DXE A;  5L1J A;  4I56 A;  4LF7 F;  2B6A B;  3JXO A;  4CM2 A;  5KG7 A;  2HBY B;  3H59 A;  2X1B A;  1RT6 B;  2O1P A;  3CO9 A;  3QRP A;  6FDR A;  3U7J A;  3CJR A;  4R5P B;  4KO0 B;  2O66 A;  2B9Y A;  2VQE J;  2B7B B;  3ZZY A;  4DQS A;  2CPD A;  4RNH A;  4RUC A;  5L9N A;  1VC5 A;  1Y6V A;  3IM9 A;  4QWA A;  2KZZ A;  4NZ7 A;  1FE4 A;  4PXC A;  3PM9 A;  4A47 A;  4FPI A;  2KKH A;  2LDY A;  5ITH A;  2ASY A;  2ZC4 A;  3EMT A;  3N01 A;  4HL9 A;  4EK2 A;  3U02 A;  4UT4 A;  3KOA A;  2VG7 A;  3J7A N;  2FHK A;  4CLS A;  2R8I A;  5CA5 A;  3KHL A;  2RU3 A;  1H7W A;  4TVA B;  3CTR A;  1L3S A;  2D1C A;  4Q2M A;  2HW3 A;  2GVD B;  3HT3 A;  1YHQ S;  1WOO A;  2AYB A;  4IRD A;  1YJV A;  5A8R B;  1RAE B;  4IG0 A;  4P72 A;  4PUO B;  3OVS A;  2OPR A;  5ETV A;  1QVF R;  4NLP A;  4TXS A;  3EVO A;  2XNR A;  2CJQ A;  1IN0 A;  2MMY A;  2IHR 1;  4IO9 Q;  2M4M A;  4C8O A;  2O3D A;  3V81 A;  1RKJ A;  2F63 A;  1PJ6 A;  1Q5Y A;  2DJW A;  4LRF A;  3FEY B;  1MWZ A;  1TUW A;  1IKY A;  1NDC A;  1X4H A;  3KUE A;  2DT9 A;  2L3M A;  3O44 A;  5HL7 Q;  2KDO A;  2BVZ A;  5CAB A;  4EYI B;  2VA3 A;  4WBF A;  1S7H A;  4A8Q A;  4ECQ A;  1R31 A;  3LGN A;  1WOR A;  1S1V B;  4RBT A;  2LEC A;  1SKR A;  3A52 A;  4ELU A;  1B4S A;  3MF5 A;  1UJ4 A;  3J81 j;  4DV5 F;  2FVR A;  1RHJ B;  2RKI B;  3MMA A;  1RT3 B;  1RHM B;  3PAC A;  4OYW A;  1SUQ A;  5FDL A;  3PIP Q;  3CDU A;  5G4D A;  4O0N A;  3BDG B;  3M1V B;  2OI2 A;  4QW8 A;  2K7K A;  3I32 A;  3HSD A;  1WI6 A;  1XJW B;  2EBE A;  1H3D A;  2AU0 A;  2V6A A;  1LEO A;  2CJB A;  1R0A B;  2MQL A;  4FYW B;  4U67 Q;  4ZCL A;  2E9Z A;  2KYX A;  3L09 A;  3TEH B;  4MFB A;  4U7C A;  4DL5 A;  2BJE A;  5T41 A;  4OV1 A;  3DDK A;  2XMA A;  5J2Q B;  3GMG A;  4N41 A;  4K4S A;  2IM0 A;  4XTT A;  2CQ3 A;  4OLO A;  1RWW B;  1XMB A;  2Z2M A;  3A8I A;  4NCB A;  1EQ0 A;  2ACY A;  1KOO A;  1R27 B;  1I94 J;  1GFW B;  1R0B G;  1N34 F;  4FXD A;  2GA3 A;  2M5Y A;  1T9T A;  1TKD A;  2OKQ A;  4TKT A;  3M9M B;  3MEE B;  1WF0 A;  1JWW A;  2R7Q A;  5KFN A;  1J5E J;  2DNK A;  2HRU A;  4LBH A;  4F0K A;  2E5L J;  4C8K A;  4NYP A;  4YDX A;  4FF1 A;  3RTV A;  2VFT A;  3QGG A;  2Z8Q A;  3E3X A;  3G6V A;  4U96 A;  4QU6 A;  1IKW B;  4DV1 F;  5DJB A;  1KH4 A;  2VKZ G;  3SFG A;  1ZZN A;  2XWY A;  1S6O A;  3PJ9 A;  3IAM 9;  5E3Q A;  2VON A;  3WZ0 A;  1S5Z A;  3EXY A;  2JFD A;  4RW8 A;  4LRB A;  1KH7 A;  3EPI A;  3CCZ A;  2UUB J;  4Y28 C;  4V1A k;  1KTQ A;  4KC5 A;  3M2U B;  4QIW D;  5KFY A;  3BJY A;  3NOC A;  2WW8 A;  2AZ3 A;  4DQQ A;  1IR2 A;  1J27 A;  1FKO A;  2EC2 A;  5D4P A;  1N5Y A;  4IRC A;  3PRD A;  3MCN A;  3TUI C;  3EDQ B;  4F50 A;  5DZ7 A;  4O3R A;  4G1I A;  4U6P A;  3PG9 A;  3WAY A;  1RT6 A;  3VZI A;  3C15 B;  3MMB B;  1VS3 A;  1UW4 A;  5CH7 B;  3NXZ A;  2M70 A;  3M8P B;  3JAM U;  1JJH A;  3GYG A;  1UA1 A;  3K17 A;  3Q8P B;  4JYA F;  3Q8Y A;  2V94 A;  4NOH A;  3BGF A;  1VCT A;  1SQF A;  2POK A;  3K8W A;  3ZZ0 A;  2AT1 B;  1KVI A;  2G2O A;  2J7W A;  5KFL A;  3T1H F;  1FX2 A;  2Y0S D;  4JYA J;  2VL1 A;  3MM8 B;  2GIF A;  2GVD A;  2N3L A;  4F36 A;  1NXI A;  4H4K C;  2WSF C;  4L75 A;  4CLZ A;  1CBK A;  2HG4 A;  2J9D E;  2KO1 A;  2IJN A;  3DOK A;  3OUY B;  5EGH A;  2GJF A;  3ZTS A;  3Q24 A;  4OZL A;  3OL6 A;  4B3T F;  3T1H J;  3SDE B;  8RUC A;  2KXF A;  2D3Z A;  4LRA A;  4ZPV R;  1UVI A;  2QFJ A;  2OPP A;  5AE2 A;  1KD1 T;  4KM4 A;  2HBR B;  2W2N P;  1X60 A;  2Q3P A;  4FDF A;  4FDJ A;  2ZH3 A;  3OTB A;  2CJ9 A;  3C19 A;  3IGV A;  4HLB A;  2R42 A;  4B3T J;  1YBA A;  4O3P A;  4JI6 J;  3DYC A;  1UWB B;  1HBM B;  1WKJ A;  5KFM A;  1ANI A;  1RTH B;  4P75 A;  5HK4 A;  3KDO A;  4YHH J;  2J7K A;  5J2Q A;  1ALJ A;  2FC9 A;  1VBK A;  1WG5 A;  1HQE A;  1NPP A;  1OWX A;  2JL9 A;  2CPH A;  1FXR A;  4OJG A;  3TVK A;  5F9N A;  1VQ7 S;  1MSW D;  2C2Z B;  1Y3K A;  2J76 E;  4AT1 B;  2LQ9 A;  4PQU A;  1OSC A;  1TL1 A;  1MN9 A;  2EI5 A;  3SQO P;  1CG2 A;  4JI5 F;  3IR5 B;  2XNQ A;  5E0O A;  4KR0 B;  5JJB A;  1YTY A;  2W8S A;  4NAS A;  1TP7 A;  2B9E A;  5L9X A;  4ZP7 A;  4CYS A;  1QD1 A;  1KP6 A;  3K8V A;  2HQG A;  3TZX A;  3M32 B;  2G13 A;  4L3K A;  4NCG B;  3W2V B;  1U7L A;  2A6M A;  2MLX A;  5I42 B;  1VQP S;  3OFF A;  4F4Z A;  2ABY A;  5F8I A;  1S6P B;  2FJV A;  3Q86 A;  1NEE A;  4B9U A;  2F1F A;  4A8Y A;  5GVQ A;  1ELO A;  5LSL A;  1ELZ A;  3P5B P;  2K1R B;  1RHK B;  2IRY A;  2VJV A;  2BM1 A;  1V3S A;  3PEJ A;  3CMQ A;  4UY8 5;  3R2C J;  1BMQ B;  1K1Q A;  2FJA B;  4DV4 J;  4C9D A;  2IM1 A;  2AJ4 A;  1KH5 A;  2EWH A;  1NDP A;  3G8T A;  1UFW A;  1UVK A;  3LQV A;  1EET A;  3TJ8 A;  1WC1 A;  4CLL A;  2F8H A;  5J1E A;  4PWW A;  2UUA J;  1G7C B;  1U6Z A;  4YR0 A;  2HHU A;  4I0W A;  1XNQ F;  4DZD A;  4DV4 F;  3RB3 A;  1EQJ A;  5SUH A;  3PFE A;  3L7U A;  5IOL A;  1KLN A;  2XEX A;  3VQT A;  3NAI A;  1ACM B;  3P49 B;  1Z2Z A;  2V2Z A;  2ASJ A;  1ALK A;  3I6P A;  1S9G B;  3DN9 A;  1QY7 A;  1RT5 A;  4OYB A;  1YZ7 A;  5K8N A;  1URR A;  4Y34 A;  2Q1L A;  3GIK A;  1FRJ A;  2D3O 1;  2ZEJ A;  3F41 A;  4I2P A;  1H2T Z;  3BB5 A;  1X4B A;  1YBU A;  2VB6 A;  1M90 T;  1Q7Y T;  1U48 A;  1VRT B;  3HXM A;  3EJM A;  5DDQ C;  1X9S A;  5B09 A;  2NSC A;  3ITH A;  3R2D J;  1Q1K A;  4LMZ A;  1XNR J;  2FY8 A;  3C14 A;  3GR1 A;  1NHU A;  1NAQ A;  3N5F A;  2AEF A;  3VAM A;  2XYH B;  3UNG C;  1XC9 A;  3GSI A;  1DQ9 A;  3PX6 A;  4MIB A;  1FA0 A;  1SC4 B;  4ECV A;  1FJE B;  5KFZ A;  2Q6B A;  3UCZ P;  1V9O A;  2BAB A;  3A12 A;  3AB4 B;  3BF4 A;  1RWP B;  5KG5 A;  1NPK A;  2LKZ A;  5LT5 A;  3A4T A;  1SJR A;  3FSI A;  2L48 A;  4XDD A;  1CJV A;  3BEG B;  1V5I B;  1N56 A;  1KC8 T;  1IBC B;  3V5R A;  2HQ3 A;  1FNX H;  2MB0 B;  1U0S A;  1YLX A;  3KG1 A;  3R3T A;  2B4O A;  5LL6 d;  5LMN J;  1DAR A;  1MMN A;  3DU5 A;  4CLY A;  1S59 A;  3GJS B;  4LIW A;  4MJK A;  1WG4 A;  4DG1 B;  4K4W A;  3LO3 A;  3KG4 A;  1HWU A;  3Q8Q B;  1SL0 A;  1FKO B;  4I4B A;  1FE0 A;  4NLS A;  3UD4 P;  1H38 A;  3HK2 A;  3J80 U;  1WDT A;  2BJD A;  4ZP8 A;  4KT0 C;  2UXC F;  1HBN B;  2PN6 A;  4QIG A;  2V4J B;  5CHC B;  3PYG A;  2IDE A;  4J91 A;  3KLV A;  3KLH A;  3H25 A;  2RHS B;  4QR0 A;  4DF4 A;  2UXB J;  1FFS B;  3RU0 A;  1IM4 A;  2E1A A;  2FD2 A;  3ZXW A;  3PR4 A;  1WHX A;  2MZS A;  1X8D A;  1REG X;  3CGI A;  3LP0 A;  4O4R A;  3D68 A;  4JI2 F;  3W7B A;  2HFS A;  1DY3 A;  3OR2 A;  4AUK A;  4QWD A;  3WX4 A;  3GIM A;  3K5L A;  2ZH2 A;  3BBF A;  4M5J A;  4RO0 A;  3T9N A;  3WBZ A;  4CYU A;  4ES1 A;  4ECT A;  3KNG A;  1JLE A;  2DBB A;  2BM0 A;  4Y2M A;  2ACM A;  3ZZP A;  1TVR A;  2WHO A;  3IG1 B;  4E0D A;  4IRK A;  3CJ2 A;  2A2D A;  2VBZ A;  3ENQ A;  4DV7 F;  2P5V A;  3BSA A;  4DL6 A;  2DR9 A;  3TUP A;  1ALH A;  5KFT A;  2HNY A;  1SC3 B;  2O67 A;  3TYT A;  1RWU A;  2AX0 A;  1GT8 A;  2P9C A;  5B0E A;  4KHP F;  3LPY A;  4CT9 A;  1ANJ A;  4OZ2 A;  3HHD A;  2AW0 A;  4OHV A;  1FXD A;  4KAY A;  4WKY A;  3CJK A;  2QN6 B;  4ZIV A;  3I0S A;  4IOA Q;  1GX6 A;  4TY8 A;  4MAK A;  3A8K A;  4OZN A;  4AXJ A;  4C6A A;  3QJL A;  3MPV A;  4OZ5 A;  3S6E A;  2IA6 A;  2GJI A;  3D0I E;  2JEJ A;  2QC3 A;  5IM0 B;  2UUB F;  4B9V A;  2I38 A;  1ULR A;  4LSL B;  2OFG X;  3U1L A;  3UFC X;  4C2M A;  2FJW A;  3CJ0 A;  3CCS S;  4QCL A;  1IUJ A;  2CDQ A;  4I7F A;  3LOU A;  3MCS A;  4O44 A;  1FJG J;  1S1X A;  1FRI A;  3PW0 A;  5B0G A;  2ATL A;  2FY1 A;  2UUW A;  5HAO A;  4B3M J;  5HAT A;  3QNW B;  3CD5 A;  3N0V A;  4PPD A;  4E2F B;  3AOB A;  3D3B J;  3QWP A;  3I5A A;  4ECW A;  2J0S D;  2ALZ A;  2JEG A;  4O3N A;  1RB0 A;  4KH1 B;  5A8W B;  4NRU A;  3C6T A;  3BBB A;  4CRJ A;  5GAD I;  5K5M A;  1EJ7 L;  2ZH7 A;  4DR5 J;  1JJC B;  2ILY A;  5D77 A;  4J5O A;  3I87 A;  4UST A;  5FLX Y;  4ED6 A;  1RT4 A;  3HT0 A;  2E1C A;  4B9M A;  4DPU A;  2IJR A;  3KG0 A;  5E3C A;  3DHX A;  4J9S A;  3DRR B;  1YI2 S;  3UDC A;  1ZZF A;  1AJB A;  2QMW A;  1R7I A;  3RRG A;  4CQ1 A;  3D6H B;  4FF2 A;  3KJN B;  4QYZ K;  1CVJ A;  1BY9 A;  3SQG A;  5C42 A;  3GU0 A;  5HLF B;  2DY1 A;  4WTO B;  4RNM A;  2QRR A;  4I6Y A;  2EG1 A;  2IFY A;  2MQN A;  1X31 C;  1SI9 A;  4TU8 A;  3PIO Q;  1RBA A;  3POT A;  3MK0 A;  3LW5 C;  3UW1 A;  2BE2 A;  1LOU A;  2QA4 S;  2DR5 A;  5IT9 U;  4YY3 F;  2EW9 A;  4F0H A;  5EGY A;  3NMR A;  3PX0 A;  4RW9 B;  4C8Y A;  4NEZ A;  1JNR B;  5K8O A;  5LSR A;  3CDW A;  1F2G A;  1BGX T;  1FCA A;  3V2U C;  2ZUA A;  3PKY A;  4N7T A;  2VU5 A;  4N47 A;  4NLU A;  1WSR A;  1WAC A;  2CZ9 A;  2KG1 A;  3VR1 A;  3MUV P;  1T05 A;  2IBO A;  2KN4 A;  4ZK7 M;  3IRW P;  2UXC J;  4JV1 A;  4Q0B B;  2KG0 A;  3EXC X;  2Z57 B;  1VQ9 S;  4XAK A;  2N4C A;  1S6U A;  1Y4Z B;  3ILI A;  4K50 A;  4ZPA A;  4I6A A;  2JNJ A;  2HRT A;  1HNI A;  2W7A A;  1RE1 B;  2JHE A;  5KFG A;  2LEB A;  1K8A T;  5L8R C;  1I94 F;  4JI4 F;  4UPI A;  5LXY A;  1PAU B;  1RCO B;  1XR5 A;  2VPY B;  3NEK A;  3RRK A;  4NI2 A;  2CQP A;  3AFG A;  1URN A;  2OEM A;  2WCX A;  3WIV A;  1U1M A;  1HBU A;  3QT8 A;  1C0T A;  2ANH A;  4M95 A;  3E2E A;  1WWH A;  2W1B A;  2XUL A;  1ZM4 A;  3BDF A;  1ZET A;  3TJ9 A;  3RUB L;  2BXJ A;  2DHS A;  2ZVI A;  1MRO A;  2BMB A;  2RUS A;  5KAK A;  3FDS A;  2JDJ A;  4B9L A;  3Q2T C;  5E3A A;  1VRU B;  4EYH B;  1KVJ A;  3M2R B;  2BE7 D;  4PQA A;  2CQ4 A;  3TAQ A;  1LXJ A;  1OYD A;  1U24 A;  4MTP A;  4YUD A;  2OMO A;  1VDH A;  3HFZ B;  2FJX A;  5E33 A;  1ZTW A;  1S72 S;  1PIL A;  4GKJ F;  2GZO A;  2R7W A;  1EP4 A;  1QDU B;  3QT6 A;  2X3D A;  5C7P A;  3CXC R;  3DRS A;  1JXV A;  1YSJ A;  5F8L A;  5IWA J;  2VHG A;  3EWG A;  1RHQ B;  2V34 A;  1U47 A;  3CMR A;  3H7H B;  1U45 A;  2VG6 B;  1SBR A;  1IQT A;  3CD0 A;  4S0M A;  4J9O A;  1FWK A;  3HCX A;  3MM7 B;  4U95 A;  5D4L A;  4CO2 A;  4TN2 A;  4EZ9 A;  3KD8 A;  2ZDP A;  2DGT A;  2ZE2 A;  4NXN F;  3PW7 A;  1N48 A;  4ICL B;  3G86 A;  4P71 A;  3OVB A;  1HNX F;  2ZIT A;  2ZJR Q;  1HNV B;  1FKP A;  3FBF A;  1RK8 A;  4N77 A;  4NWJ A;  1S1U B;  3GYX B;  5LQQ A;  3GG1 A;  3ENV A;  2ZZM A;  1T02 A;  1U2R A;  2FZG B;  1K73 T;  4PCQ A;  4EWT A;  2FQQ B;  4MKV A;  1A6L A;  3CCT A;  4DR5 F;  2VOO A;  4QYZ J;  2DXF A;  2VC1 A;  2XR9 A;  2RML A;  3K58 A;  1AZS B;  3MM8 A;  1EET B;  3D6F B;  3PRV A;  3PYD A;  2AHO B;  2BE9 B;  3NCP A;  4F3Q A;  1ZEB A;  1URB A;  2W9C A;  1B7F A;  5EX3 A;  4PRF A;  2QFI A;  3F73 A;  4GVL A;  5KT2 A;  3C16 A;  2WOM B;  3DYA A;  4F04 B;  2HVH A;  3FJ2 A;  1WOS A;  2K1R A;  3R7N B;  2W2P P;  2XTJ P;  1NK9 A;  1A7G E;  2IVY A;  2CG4 A;  1HNZ J;  1Z1Z A;  4PUO A;  1KKH A;  3EGV A;  4LF5 F;  3CCU S;  5J2M B;  2W2O P;  4KJI A;  3QZ8 A;  2OJ3 A;  2DIT A;  2NPI A; 
#chains in the Genus database with same CATH homology
 2GA3 A;  1AJD A;  2G9Y A;  3SZZ A;  2W8D A;  1AJB A;  1ALK A;  3NKM A;  3DPC A;  3MK2 A;  5TJ3 A;  3BDG A;  1ED9 A;  3M8Y A;  4CYR A;  4UOO A;  4MHX A;  2IFY A;  1E1Z P;  1E33 P;  1ZED A;  1KH4 A;  3MK0 A;  3BDH A;  3IDD A;  5DLT A;  5KXA A;  4CXS A;  1KH9 A;  5L0B A;  1O98 A;  3UN2 A;  3OT9 A;  4LRB A;  1KHN A;  1KH7 A;  1EW2 A;  2GSO A;  2W5S A;  4LR7 A;  5L0K A;  4N7T A;  1URA A;  2QZU A;  5LRM A;  1FSU A;  2X98 A;  3NKO A;  4LRE A;  3WAY A;  3T01 A;  1P49 A;  2IUC B;  5INH A;  4LR2 A;  4KJD A;  5GRR A;  4GTY A;  3UN5 A;  3TX0 A;  1HDH A;  2GSU A;  4TN0 A;  4YR1 A;  4UPI A;  4ZGA A;  2W5W A;  2W5R A;  1SHN A;  4KM4 A;  5L0E A;  3SZY A;  3TG0 A;  3LXQ A;  1ELX A;  1AJC A;  4KAV A;  3MK1 A;  3TWZ A;  2ANH A;  3T02 A;  3UN3 A;  4UPH A;  3BDF A;  2W5V A;  3M7V A;  2IUC A;  5GOV A;  3M8W A;  3NKQ A;  5EGH A;  1HJK A;  4UPL A;  1AJA A;  5K4P A;  5DLW A;  1Y6V A;  4GTX A;  4LRA A;  2ZKT A;  1EI6 A;  3WAW A;  3UO0 A;  1B8J A;  5LRN A;  1O99 A;  4ZG6 A;  4FDJ A;  3WBH A;  3DYC A;  3IGZ B;  3IGY B;  4ZG7 A;  1ALJ A;  1ED8 A;  1HQA A;  3CMR A;  2W5Q A;  2W5X A;  4ZG9 A;  3ED4 A;  1ALH A;  4LRC A;  3Q3Q A;  4LR9 A;  3M8Z A;  1EW9 A;  3WAX A;  1ANI A;  3KD8 A;  1EJJ A;  4GTZ A;  1KHL A;  4UOR A;  5IJQ A;  2RH6 A;  1ANJ A;  1K7H A;  3B5Q A;  4LRF A;  4MIV A;  1N2L A;  1Y7A A;  3NKN A;  4MY4 A;  3UNY A;  2W8S A;  3NVL A;  4KAY A;  4CYS A;  3NKR A;  5DLV A;  4NWJ A;  2D1G A;  5LQQ A;  1KHJ A;  1SHQ A;  5HRT A;  3A52 A;  2GLQ A;  4QAX A;  3WAV A;  2XR9 A;  4KJG A;  1ELZ A;  1AUK A;  1ZEB A;  1N2K A;  1URB A;  4LR8 A;  3BDG B;  4UPK A;  5AJ9 A;  4B56 A;  4UOP A;  4CXK A;  1KH5 A;  4LQY A;  1ELY A;  1E2S P;  5C66 A;  2W5T A;  1EW8 A;  4NWX A;  5EGE A;  4CXU A;  5IJS A;  2GSN A;  3E2D A;  5LIA A;  4LRD A;  3NKP A;  3T00 A;  2VQR A;  1EQJ A;  1KHK A;  1ALI A;  4GTW A;  1ZEF A;  2XRG A;  1E3C P;  4FDI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...