3OT9A

Phosphopentomutase from bacillus cereus bound to glucose-1,6-bisphosphate
Total Genus 141
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
141
Knots found
sequence length
391
structure length
390
Chain Sequence
NKYKRIFLVVMDSVGIGEAPDAEQFGDLGSDTIGHIAEHMNGLQMPNMVKLGLGNIREMKGISKVEKPLGYYTKMQEKSTGKDMTGHWEIMGLYIDTPFQVFPEGFPKELLDELEEKTGRKIIGNKPASGTEILDELGQEQMETGSLIVYTSADSVLQIAAHEEVVPLDELYKICKIARELTLDEKYMVGRVIARPFVGEPGNFTRTPNRHDYALKPFGRTVMNELKDSDYDVIAIGKISDIYDGEGVTESLRTKSNMDGMDKLVDTLNMDFTGLSFLNLVDFDALFGHRRDPQGYGEALQEYDARLPEVFAKLKEDDLLLITADHGNDPIHPGTDHTREYVPLLAYSPSMKEGGQELPLRQTFADIGATVAENFGVKMPEYGTSFLNEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Bacillus cereus Phosphopentomutase Is an Alkaline Phosphatase Family Member That Exhibits an Altered Entry Point into the Catalytic Cycle.
pubmed doi rcsb
source organism Bacillus cereus
molecule tags Isomerase
molecule keywords Phosphopentomutase
total genus 141
structure length 390
sequence length 391
chains with identical sequence B, C
other databases KnotProt 2.0: S +31
ec nomenclature ec 5.4.2.7: Phosphopentomutase.
pdb deposition date 2010-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01676 Metalloenzyme Metalloenzyme superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1250 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Phosphopentomutase 3ot9A02
3.40.720.10 Alpha Beta 3-Layer(aba) Sandwich Alkaline Phosphatase, subunit A Alkaline Phosphatase, subunit A 3ot9A01
4LRBA 4FDIA 2QZUA 3T01A 4ZG9A 1AJDA 2W5QA 4KJDA 4CYSA 1B8JA 1AUKA 4KM4A 5AJ9A 4UPHA 1AJCA 1SHQA 3SZZA 2IFYA 3MK2A 3SZYA 4YR1A 4ZGAA 1ED8A 4MHXA 4CXKA 3A52A 3BDFA 3IGZB 2RH6A 4NWJA 5DLVA 3BDGB 3NKMA 2W5TA 5DLTA 2GSOA 2W8DA 3T00A 3M7VA 3CMRA 5K4PA 4ZG6A 5LRNA 1EI6A 5INHA 5TJ3A 3WAWA 4N7TA 3NKOA 4UPIA 3TX0A 2XRGA 5L0EA 3IDDA 3NKNA 2XR9A 5LQQA 2W5XA 3WAVA 4LRAA 2W8SA 4CXSA 1KHKA 1AJAA 5KXAA 4UORA 1E33P 1URBA 4KJGA 2VQRA 4LR2A 1O99A 3UN2A 3M8ZA 4QAXA 2D1GA 1ED9A 4NWXA 3NKQA 1Y6VA 1ZEDA 4UOOA 1ALHA 1ANIA 4LRCA 1Y7AA 1KH4A 1URAA 2IUCA 3NKRA 3NKPA 4LR8A 3TG0A 1EQJA 1N2LA 1KH9A 4LR9A 1K7HA 4FDJA 3OT9A 4TN0A 1ELZA 2G9YA 2W5VA 5IJSA 1ALKA 1ELYA 1O98A 1E2SP 5IJQA 4B56A 2GSUA 5L0KA 5GOVA 1HQAA 3Q3QA 3LXQA 1AJBA 3M8WA 3MK1A 5C66A 2IUCB 3DYCA 5EGEA 1E1ZP 1ALIA 4LQYA 5L0BA 2GA3A 1E3CP 2ANHA 1EW8A 4LRFA 2GLQA 3B5QA 1ZEFA 1ELXA 3UN3A 1KH5A 3WBHA 4LR7A 3T02A 1EJJA 1SHNA 4GTZA 4UPLA 3TWZA 3DPCA 4MIVA 3MK0A 1HJKA 4GTYA 2W5WA 1EW2A 4CYRA 1FSUA 4LRDA 4UOPA 3ED4A 4KAVA 4CXUA 1EW9A 1ZEBA 1ANJA 1KHLA 1KH7A 1KHJA 2W5SA 2ZKTA 4MY4A 2W5RA 5DLWA 4ZG7A 3UO0A 1P49A 1N2KA 2X98A 3UN5A 3BDGA 3BDHA 4GTXA 5LRMA 5GRRA 3E2DA 3WAYA 2GSNA 1KHNA 4GTWA 1ALJA 3UNYA 5LIAA 4KAYA 4LREA 3NVLA 5HRTA 3KD8A 3WAXA 1HDHA 3M8YA 5EGHA 4UPKA 3IGYB
chains in the Genus database with same CATH superfamily
2BJ8A 2CJKA 4F3MA 1NLKL 1DQAA 2N4CA 3PG9A 3CJKB 5A0YB 4AL6A 4UF4A 4DL0C 5D3GA 1YSJA 3MDFA 1IM6A 2XMUA 1GXUA 1Q1KA 2CPJA 1FRHA 5B0DA 1QSYA 1ZM2A 3RAMA 4U95A 4EEYA 4QYZJ 3SZYA 4YR1A 1HNIB 3BGLA 2UVVA 1BC6A 4R0JA 1J27A 4B9MA 3POTA 1WG5A 1MU2A 1KHWA 2XCPA 1HQUB 3FFIA 3NEKA 4EBCA 1TVRA 4HH1A 2E7WA 3CCMS 3D0GE 1JLAA 4DQPA 2E66A 2CUYA 2OD4A 2RF2B 3MOZA 2J5AA 5BYRA 3CCSS 3JB9k 3FUYA 5D0EA 2UUCJ 2ZD1A 4X62J 2DGTA 4JBCA 3UVJB 2NREA 4MMOA 1R6YA 5K8NA 4X4NA 3OVSA 1EETB 3T5KA 2ZOFA 4HYKA 4KO0B 3CSKA 3HZEA 4IKAA 1Q5YA 2ACYA 4TNOA 2QZ8A 2H51B 1NSKL 1CJVA 4FN5A 2K3IA 4TY8A 2JNJA 4ZPAA 5AXLA 1N36F 1QUPA 4ICLB 2GC8A 1Q86T 4LFAJ 4B17A 3RB4A 1B0TA 1XR7A 2ZOMA 1VOMA 4RBTA 1NK5A 2CQ4A 4F0HA 4FF3A 4KJGA 5KOXA 4RW8B 5KT7A 3DRSB 1IBKF 4XAKA 5ETMA 5I42B 2BJ7A 2RKIB 2YKPA 1QLNA 4I64A 2EFOA 3I0RB 3EPGA 4NLUA 7AT1B 4EYIB 1S48A 2AYEA 3K5LA 4MKAA 1B4SA 4N77A 4PG6A 4PG5A 3HHEA 3P45B 1T0TV 2XC9A 1QY7A 2ZUAA 2D7SA 2ILZA 2G0IA 4AT1B 3M9NB 1M5VC 2CQBA 4LF5J 4WFBQ 4HDHA 1U26A 3IAM9 3OJUA 4N76A 3HZGA 4FXDA 4K4TA 3LF0A 3FEYB 3TEGA 2HNDB 3T5HA 1RKIA 1X5OA 2RT3A 2Y1LB 3ITHB 3QGIA 5IWAJ 2HHPA 2V68A 4OHYA 2JVOA 4P71A 1ZETA 1EP4A 3NP5A 3A8KA 1Q5VA 4UOGA 3KHLA 1WSVA 2W2NP 4CNYA 4DCJB 4FYDA 2YQ1A 2R9LA 3DYCA 3K57A 1F2GA 2ZEJA 5H9FJ 3ISND 3S7RA 3ZZRA 1HBMA 1HPZA 2VA3A 3N9UC 1SV5B 3DLJA 1P8GA 1WKJA 1WHWA 3SCLE 1J5EF 2AW0A 4KAIA 2NQPA 4JI8F 5L1JA 1PBUA 1FJGJ 1X0PA 3HVTB 5FLXU 3EYZA 2DNGA 3DLGB 3UI3A 3BDPA 4L3KA 4DWIA 3DRPB 1VC0A 1SHNA 3R8YA 1XC9A 2IYIA 4F2SA 2MKYA 4A48A 4F25A 1IKVA 4KHRA 3CPWR 2HHQA 5IC6B 5IOLA 4GC7A 2W5WA 3BGRA 2R8GA 2FHMA 3NG8A 3QIDA 3ZZPA 3RR7A 2OPRB 4ECZA 2ZHAA 2QA4G 4QOTA 4MK7A 1HA1A 2NXUA 3WX4A 4FZVA 4O0IA 5KG2A 3NKOA 2ALYB 3AA9A 1TL7A 1VRUB 2ZJRQ 1TFWA 3DM2A 3IBCB 3GONA 1RADB 3BV8A 4Y2CA 4UW2A 3M32B 2MQOA 2HS4A 2HQCA 4S0MA 1HR0F 1UL3A 2DNLA 1EX8A 1ZOTA 2BXJA 2LLZA 5LXRA 1ULRA 2VDHA 1J5EJ 4KY3A 2FJBB 4ILRA 1M1GA 3MMCA 4OHZA 1H0HB 1YJRA 3U1LA 3JAMU 5E2QA 2HQ3A 1NKBA 2DKOB 4F67A 1OY9A 3JTPA 5J1EA 1FKAF 5K8MA 3KLVA 2XG8A 2CPFA 2YWFA 3N5BA 1VC6A 2WVEA 2DEIA 2V9KA 3CC4S 3D1HA 1S4EA 2XZDB 3LP0A 3BS9A 1EZZB 4KKOA 4QIWD 2B7CB 5EX3A 4A4JA 3T5LA 1B8JA 2JJ4D 3HLUA 1A0OB 1S0MA 3IFEA 4JI6J 3MGJA 2JFDA 4LSNB 4ED0A 1JLBA 1RT5A 3NCRA 3V4IB 2MKJA 3JXOA 5JXSA 4E0DA 1SH0A 2LMIA 3A52A 1SL2A 2W1BA 1AFJA 4AE5A 1MN9A 1NAQA 3C6UB 3BSOA 3NKMA 1YJ9S 2E44A 2VPYB 4PPZA 3W5XA 1JLEB 4DV0J 4WP3A 5F8NA 4F4WA 2O1PA 3M32A 1GMUA 5C42B 2FVCA 4M5MA 4NLVA 1HWIA 2Q3PA 2C3MA 3SSQA 4ZCKA 5A2QU 5C24B 3G6ES 2O3DA 3CJ8A 4I69A 3TAQA 1R8AA 3WAWA 3PRDA 3DN9A 4HI2A 4DQRA 2E9TA 3V6HA 2JOQA 2OPRA 5DZ6A 3GTYX 1V3SA 5ETQA 5BYSA 3IDDA 1C0TB 1OJ4A 2MZTA 1TUWA 2VJVA 1B99A 3JYTB 2P8IA 1TKXB 2JLGA 2WBRA 2HWTA 3D1OA 2UVRA 9ATCB 5AT1B 3R1HA 3DGVA 2DXFA 3LGHA 3R5CA 3U1NA 4U96A 5K8PA 3LAKA 1LW2B 3V6JA 3SMZA 4LFCJ 2XS5A 2BJ9A 4QR1A 3IMQJ 3QO9B 1FO1A 3RGIA 1NDCA 2C2NA 2O01C 1WKKA 2XI2A 1RXOB 3H98A 4WZMA 1RT3A 2ERRA 2YPZA 2HWHA 4LF9F 3ITHA 2Q6CA 2HNDA 2DJWA 5B09A 3MAHA 1G4CA 4RUBA 1O98A 1TP7A 2M4MA 1X4DA 1AB8A 2DTJA 2GMLA 3SSRA 2VQEF 1N6QA 4ZJOA 2APOA 1RUSA 2EFGA 2V5HG 2J7UA 2C2KB 1IBMJ 5L0KA 2H5JB 2HQDA 2A6OA 4B3RF 1AJBA 5BXIA 2NLWA 5KFNA 2JEJA 2AMCB 3FSXA 1EARA 3I0RA 1GFWB 3NOGA 1ROFA 2B9WA 3AQOA 4NRTA 1LFPA 1RTIB 2CPEA 3RU0A 4KGZB 2RKIA 3D68A 3JSMB 5D15A 4KPYA 3TUPA 2I38A 3HHLB 3JSBA 1UPPA 3MM6B 5ETTA 3G6VA 4ILMA 2R7SA 1S57A 1TMMA 2I5JB 2WCXA 4OZ1A 3TNVA 2GS8A 1VC5A 3MM6A 2DNKA 2D74B 3OVAA 1X4EA 1TKTA 1QTNB 2L41A 1ZBTA 2HHSA 4ZVEA 1UMJA 3BEGB 2W4PA 1S7IA 3M1VA 3VQSA 2HBRB 3FSIA 2Y8WA 4CT8A 1L3TA 4O3PA 6AT1B 3EDRB 3CDWA 3OTBA 4XK8C 2DH7A 3FMBA 2CPZA 1IVZA 1FK9A 4NX9A 2ZHOA 5C25B 2IMWP 2MKHA 3NMRA 1H2TZ 3IS9B 2MLYA 5GMDA 3K59A 4GMKA 1HFEL 2YXLA 5DGBA 2YWWA 1F2HA 1JLAB 1WEXA 4NLRA 2YNIA 4KH1B 1RT3B 2I1RA 3P8BB 4FXVA 2MQPA 1A7GE 1D9DA 1K1SA 2HNYA 4ZOSA 3FQLA 4CLTA 4YFUA 4GTXA 1DARA 4Q0BB 4KFBB 3UCZP 2PA3A 2ZWOA 3MMBB 5HRTA 2NXEA 2IRUA 4DS4A 2AWZA 1UA0A 1SKUB 5EGHA 4OX7A 1P6TA 1CG2A 3KMSA 1ZAVA 2RRAA 2F8HA 4NLPA 4UUXA 1P9QC 4EO8A 4YR2A 1KWMA 1ICEB 3N4WA 1UWBA 2F4VJ 2B4PA 4K5RA 1CC8A 1RK8A 2J9DA 1AJCA 3PEJA 3A3OB 1CSJA 1S7HA 2HS3A 3NKYA 4OYWA 2IM3A 4K4SA 3JTOA 1Y3JA 1HNWJ 2AEFA 2DY1A 4RL1A 1YVFA 3MXHP 4OV1A 1GXTA 4DFJA 2HHWA 3N6MA 2RH6A 1U47A 3Q2TC 4X66J 5T14A 3D6FB 2LCWA 3AFGA 2XS7A 4K4UA 4JOUA 1Q95G 2H4YB 4Q2MA 3IC1A 3DOMB 3LP1A 4P10A 2D3O1 3C16B 2W8DA 1Q53A 1S12A 1WHVA 2H4WB 3BYPA 2HGMA 4DR4J 4ZPDA 3VAKA 2VG6B 3QYYA 3RBEA 1ZYQA 2KVIA 4DJBA 1U1NA 4B3OB 1JLEA 4JI3J 3KLFA 2VZ9A 1H2VZ 1JX4A 5DDQC 2RSQA 4YN3B 3NWRA 4A8OA 4ZITA 1CQMA 1G3OA 1VBYA 2YKQA 4RW7A 3W2WA 2LXFA 4DN0A 2AGOA 1GTHA 1HBUA 3UR0A 2DH9A 1CJUB 4CH7A 2HHTA 2IA0A 1RAFB 4ZKAA 2UU9J 4MH8A 3CE8A 4E98A 3MTKA 4ETZA 3ET6A 1UVLA 1Q78A 5H1SV 1S4FA 5D8HB 2HGLA 3EX7B 4D3HA 5J1EB 3VGVA 3EGZA 4EZ6A 1RTJB 2KG0A 2G2YA 2NUUG 2WVBA 2GIRA 2H1YA 4NLDA 5HL7Q 2MZ1A 2CQ2A 1Q16B 2HFUA 4X84A 3T9ZA 3TG0A 2AZ1A 5B0AA 4UY85 2F9DA 1M1HA 4KT0C 3O8WA 5JMNA 2LA6A 3BGOP 3DC2A 3M8PB 1OSDA 3R7SB 3ZTOA 3RW6A 1NBEB 2MDAA 3TI0A 5DDPC 4NXNF 2LQ9A 1FDBA 2XCAA 4F3OA 3M2VB 3KKFA 2I9SA 3W66A 3DLKA 3QIPA 1MN7A 1XK8A 4ZN1A 1XN9A 1RWXB 3CJ0A 2QFJA 4Z2XA 3GFHA 4ZPVR 3NNCA 1RT4B 1TZ0A 4DPWA 2EXUA 4USTA 5GOVA 2NZ4A 4ECXA 1U45A 5KT6A 2CQPA 2K8GA 4TU9A 1RT7B 3NGTA 3PYGA 4NLOA 1NSAA 4P74A 3ZZOA 1UFLA 1P1LA 1RAAB 1I94J 2IM2A 4URGA 1RDRA 3H40A 5IT9Y 2F40A 4NI2A 2XBPA 3ENQA 4DSFA 5I3PA 1E3CP 1X31C 3VAGA 2BANA 2HLUA 2QN6B 3I0SB 3MFHA 3HVTA 3TA1A 1GK8A 1JIHA 1GMVA 1S9GB 1WF1A 4DV0F 2KJVA 1NEEA 3FQKA 1EAYC 1GQEA 3JSYA 1ZTWA 2CG8A 1RHRB 5I3UA 3N5FA 2KYXA 3QT6A 1HI1A 4P6QA 2QC3A 5E7OB 2VD3A 4LF8F 3SCKE 1DQ8A 1U2CA 3TYTA 3BB5A 1TUVA 2B6AA 4OX6A 3FRYA 4CTAA 1UJ5A 3BQ1A 4J9SA 2U2FA 4ZA1A 4I7FB 1SC6A 1KVKA 3PM9A 4MIBA 3WX8A 5HMYA 5M2RA 1YJUA 2MY8A 3MM8A 1XJWB 4IO1A 2FLPA 2BR0A 1HKAA 2X3GA 1QUVA 2KT3A 4JI1F 4PUOA 5LOQA 2AGQA 4XIUA 3KHGA 1IBCB 1DJ0A 2P9EA 1A6LA 3KK2B 2AEMA 2G13A 4Y65A 4M5GA 2XLJA 2E29A 1IKWB 1KDNA 3SDEA 3WQPA 5A76A 4PUOB 4FP9A 4LF4J 5GRRA 1LW0B 1WHYA 2CJBA 2VQFJ 1FNOA 2WSFC 4P75A 2ZH6A 3QT7A 2GVZB 2OELA 2KVQE 4NMLA 1Y5NB 2YKNB 3DRSA 4HLBA 5HO4A 4V19X 4Q7AA 3OHAA 4RW8A 1HL6A 3TR5A 1F6TA 1WF0A 2X1GA 4B56A 2ZJQQ 2AZ3A 2OMLA 3IGYB 4LBPA 4NL5A 4U8VA 1TKDA 1UEUA 3MD1A 1ZZNA 4NYOA 2F8MA 2VA2A 4CTAB 1YIJS 2R42A 1KONA 3FBFA 2NCKL 4P9SA 2EK1A 1SQEA 5T41A 4N41A 2IFYA 4MHXA 3T6BA 2DH8A 2Y8YA 5F41A 2RILA 5KG4A 1RJJA 4WKYA 4HDGA 3PEHA 2IC3A 4ANDA 4KYZA 2ZD1B 4X4QA 3P3DA 3PYEA 4J9MA 1RB0A 2X51A 4OZLA 4ZP7A 5T7LA 1X4BA 2AX1A 3OXLA 2V2VA 3M7VA 1KRPA 2FY8A 2VV5A 5LL6d 2ROGA 3TX8A 1JJCB 2KU7A 4JI1J 1HWKA 4KBIA 3HJVA 4X4VA 2D1GA 4P73A 4DLEA 3NAHA 4JI5J 3ZZTA 1JMTA 2XSJB 1LWFA 3I82A 4QWCA 4OI0A 1NPPA 2MXYA 3H59A 2AF6A 5KAKA 3K5PA 1YJ7A 2IDEA 1U25A 4DV5J 1SJ1A 3O2IA 3UDLA 4JI2F 4K4WA 4O3OA 2ZNZA 4TYBA 3ZTRA 3D2WA 4B3SJ 2A1BA 3FRZA 3OFGA 4RW4A 5KXAA 4YEAA 3J7A1 3K17A 3M8PA 5HP1B 1QAYA 3THPA 1FWLA 3HF5A 4ZDNA 3EVOA 4RU9A 4RR5A 3L7PA 1AZSB 4ZVOB 2BX6A 3KK3A 5B0FA 3NKQA 2UUWA 3R5GA 4NWBA 1SH3A 2FHJD 1DY3A 1FERA 2GMHA 5A6WA 4ED4A 5GADI 4Q43A 1IUJA 1DBDA 2XI3A 3KLHA 2J0WA 2RDDA 2Z2YB 8AT1B 3NS5A 1KH9A 2HK2A 1MNEA 1MW7A 3SI8A 3CD7A 5HLFB 1PC4A 3WIVA 3LALA 5KT3A 3I4HX 2HSEB 2CZ9A 3BH7B 3FEZA 2NR0A 2J7WA 1EB0A 3ADAC 5IJSA 1NHUA 2WONB 4IH6A 4W98A 3UCUP 4X65F 1FFWB 2QV6A 3I6PA 1NMEB 3CT9A 2J76E 2VBXA 4PXDA 4CI0B 2W9CB 5HMZA 5KFLA 3K8VA 2MLXA 2FVSA 4ANEA 2KZMA 5IT9U 4H4OB 2VOPA 1TV6A 2B6AB 1Y11A 3EVMA 4L76A 4JI5F 2FHOB 1DURA 1RBOB 1YWXA 1BQXA 2DITA 3ILOA 3W62A 2FVPA 5EGEA 5C66A 1VQ5S 2IYGA 3W9HA 1HBOA 3ZC4A 2B4UA 1FHTA 3NL0A 4MT1A 1FD2A 1VFJA 1SQGA 3OL8A 2H5IB 3D5MA 4ELUA 4OJGA 1FEEA 3EGNA 5A6PA 2RH3A 2CDRB 1JJ2R 1KD1T 3TJ8A 4I67A 2FZCB 1U02A 2W9BB 2L3MA 2CNOB 3C15B 3DPCA 2A2DA 3I9ZA 4LBIA 5L1IA 1IBMF 2YX7A 3F44A 3A3PB 3GR1A 5ETSA 4DUYJ 4PWDA 2ZBPA 1PCAA 2MTLA 3D1QA 3GV5B 1JK9B 1MG7A 1DFDA 4ID5B 3VZHA 1ZEBA 4B9SA 3ICLA 3DDIA 4N8OA 4WIQA 3PR5B 3MUVP 4HR2A 3G8SA 2XNRA 4HKQA 4WKRA 2DNRA 1U1LA 4KFBA 3CMES 1WC0A 1FRMA 3GP9A 4O44B 4DX7A 1XMOJ 4QU6A 2HVHA 3NY0A 5A8WA 4HHHA 4MAKA 3K5OA 5EX0A 1PBAA 3D3CJ 1VISA 1CJTA 1YRXA 1S6PA 1GH8A 2Y1JA 3VVUA 1BLUA 3KLIB 5IQQA 2H65B 2A3JA 4IR1A 2GFFA 1I51B 1S6OA 4Q8FA 3GV8B 2GSNA 4QBUA 4MYUA 2HZCA 2UXDF 4RJVA 3V81B 3HKWA 5G0RB 2ZBCA 2FVQA 3PO4A 4WF9Q 2DY9A 2DHAA 3PFOA 1CJKA 3R5AA 3VQTA 4CQ1A 4UZCA 3GWCA 1I1GA 2CQ3A 3AD7C 1XMBA 2M2BA 5F0UA 4LF2A 2Q43A 3BREA 4CYSA 4ID8A 2GIFA 5DO2A 4DV2F 2B0GA 3SSSA 1X9MA 3M1VB 3QWUA 3SZZA 4DR1J 4CO1A 4PRFA 4DMZA 2WAQD 3B78A 1KBRA 1FESA 3MMAA 4IG3B 1FWKA 1D8ZA 2F4FA 4NEZA 5J2NB 3S8SA 4NWJA 1TK5A 3K89A 3FZBA 2V50A 4J9PA 3OLAA 2WW8A 4I0WA 4I2QA 3T00A 3QNWB 5KG7A 1H74A 4ZLJA 2I0XA 2IM0A 2K1RB 2BOAA 2YNFB 4HI1A 3DCAA 1XMOF 5INHA 1KLNA 3Q8VA 2PE8A 4FNHA 4DCPB 2OTJS 2VDIA 4KQZA 4U6PA 1SL0A 2OKQA 4W92B 3Q89A 2E1MC 3MAQA 3GSDA 3NBPA 2KZZA 2CJYB 2IAJA 4CM2A 4HT5A 2V4JA 4ECVA 1T9XA 3FDSA 4YP3A 2FJWA 1SXLA 2RU3A 4EBEA 2W5XA 1RZMA 1AA1B 1RWMB 1U0SA 2MHNA 3CDEA 1HARA 1SJRA 4Y2IA 2EKYA 4JV0A 3BH6B 2PGCA 4XPCA 3I32A 4DUZJ 4QR0A 2FJXA 3A12A 3D3BJ 3M8ZA 4GVLA 3Q86A 2EI5A 5E33A 1HNVB 3RRHA 5IFMA 4RNMA 3MR3A 5F8MA 1R8BA 4Q0BA 4YY3J 3CMQA 1TMJA 2HNYB 3M8QA 4LR8A 1D3WA 4USVA 3CB4A 3J7AN 4NZ6A 3HFVA 2B3TB 2YNIB 4X4SA 1JLQA 5EWEA 3G4SS 1RP5A 2UXBF 1XMQF 2KL8A 2P9GA 5CABA 4F8RA 1N34J 3W9IA 3GV7B 3QGGA 2FZGB 2IAJB 1ZA1B 3M30B 2GSUA 4PCQA 1XWLA 3RG6A 1AW0A 4O3QA 2MZJA 1VQKS 4URQU 3O1LA 4OJHA 3MWBA 4CO0A 2COLA 5L38A 1GXLA 2K1RA 2HEKA 4QIEA 4WXWA 5HSPA 2RMLA 2VL1A 1RAEB 5C42A 1VLOA 2GLQA 3PW5A 1MWYA 3MEEB 1GEHA 1LKZA 1XIQA 1VQ8S 1Q8KA 4DPTA 3OR2B 1FWPA 3R6GB 5KFDA 4IG3A 2WSEC 4JV5J 5E0OA 2CQIA 3UDCA 1HIYA 3G82B 4QWDA 5EUHA 3LWLA 2UUAF 3HULA 2BEFA 1XERA 1IKXA 3IWLA 4W90B 5M2PA 2HK3A 1T02A 5D4OA 1S1TA 2Z56B 1XR5A 1FNXH 1F0XA 4OHWA 4M94A 3ED4A 2V2QA 1FKOA 1X4CA 3ISNC 3PW4A 1UEVA 1JKHA 4ED7A 5G0RA 4H54A 1BQNB 1P9YA 5CYQB 3UO0A 1HWUA 2F65A 1OMSA 2KI2A 4NLTA 2JX2A 2CPXA 3AHPA 3S01A 3R7NB 4YB5A 5BYQA 4RNNA 2DXDA 1RGVA 4JB8B 4D3GA 1NM2A 3CCJS 2GO8A 2XNQA 4OX8A 1G2EA 4WFAQ 1LW2A 3CTRA 5J2MA 3KJVA 2QLJB 2FTRA 1UVKA 1KP6A 2G1DA 3BM7A 3O3LA 1IWGA 4OZ0A 3IN5A 3M8YA 4J9QA 5L9NA 2K3KA 4ECYA 4DX5A 3Q8PB 1IKYB 4DZDA 2RS8A 2JSXA 3BGRB 3RR8A 1T9WA 5D78A 3MR6A 1JNZB 1NZAA 3Q83A 3BO2A 1SHQA 1ED8A 4F26A 4DXLA 4CXKA 4H4KC 3Q0AA 2CZ4A 4AXJA 3MAAA 4OX9F 4X64J 1K44A 2DNHA 3BKTA 1E6VA 2XQCA 4LF4F 2W5TA 5J2QB 3ZZ0A 2QO3A 3WC0A 2XMMA 3KNAA 1S1VA 4LJMA 2JEGA 2LFVA 2XGPA 1O0PA 4ZG6A 1OYDA 2XMVA 2AHOB 5A8KB 2J0XA 3T1HJ 3TANA 3W61A 1K8AT 1FRKA 2XHCA 1Y00A 3GYGA 1AT1B 2IRXA 4IFYB 4A47A 1Y9OA 2VG5B 3MCOA 2ZZMA 4B3RJ 4Y2KA 1QVFR 3UDEA 4J9NA 2BJEA 2GAGC 3KDOA 1FA0A 5HVFA 6FDRA 3IG1B 2ZFHA 4CLSA 1NJXA 1LNQA 4NRUA 5KG1A 1TFYA 2CPYA 3FCHA 3B82A 3WHIA 3DFEA 1VJQA 2V2KA 3N28A 4KKOB 1FE0A 4DR3F 2B51A 4RW9A 4WK1A 4WWSA 1BGXT 2GO9A 3H2VE 3T1YJ 3OSPA 1BE4A 2KDOA 5L39A 2ADBA 4WU2A 3W9JA 5FDLA 3PJ9A 1ED9A 4NWXA 3Q8QB 2C3PA 1ZS6A 2K7JA 2HFSA 4UOFA 1ANIA 1RA7A 3GG0A 1X4FA 2QA1A 2VFTA 3EM1A 2ASLA 1L3UA 3H90A 2HZVA 1S49A 3NKPA 3ILIA 2OIHA 1M1KT 4EBDA 1QTMA 4F50A 1IXKA 1WOSA 3CD5A 3FBCA 3PNIA 4RW4B 4ZCLA 3TO8A 2PI5A 2NXJA 3A8EA 4BWMA 4Y3CA 4R8UA 1RT1A 2LECA 2W5VA 3PW7A 2ZC4A 5IWAF 4JI2J 2YNGA 1ELYA 3TUJC 4CRJA 2AKWB 1N88A 2OTLS 1RI7A 1TL5A 1C4AA 2BABA 1OPZA 3DNCA 2GJIA 1WUUA 3VVTA 3CEDA 1RWUA 2HKEA 2RUGA 1T03B 1I6JA 3CC7S 3H5YA 1TVRB 2BE2A 5HQ8A 2ZH8A 3WC2A 3OQ2A 4CLKA 1PILA 1MU2B 3E51A 2OEKA 3IRXB 4CO4A 4DPOA 3GR0A 5KFVA 2LDYA 2JRSA 1HBMB 1Q8IA 2F9JA 4F7VA 5DQHA 4ZVQB 2DGXA 3PRVA 5ETPA 4C2MA 3J7YU 4ELVA 2BRKA 2W2QP 2UV8A 4TN2A 4CLUA 5K20B 5ETOA 2BM0A 2CRLA 2MMYA 2XMWA 3AOBA 4Y00A 1EP4B 2XB2D 2FHKA 2GHVC 3KFWX 4FBTA 4LF6F 1JB0C 4YDDB 3FEXB 1K9MT 2DO4A 4CLPA 4MK8A 1VCTA 3AT1B 2R7TA 3LQVA 4FF1A 2ASYA 1HD0A 1U0HB 2LP4A 4ZJQA 2ZKUA 5AXNA 2HURA 3KHRA 1TL4A 1R0CB 2BACA 4RW6B 1N56A 2W7PA 2M7SA 3FSYA 4PZVA 4U8YA 4CO5A 2XGQA 1NDPA 1IKWA 2RB7A 3KYLA 1OY6A 1H73A 4ZHRB 1VQNS 3F41A 2R7UA 1NHKL 2W7OA 8RUCA 1DHMA 3CO9A 3M2UA 4PWWA 1ZZFA 2UUBF 1T94A 1Q7YT 3HSGA 5LRMA 2RDIA 3UW1A 2MQQA 5KFKA 4OYIA 1UPMB 3VZIA 1UW9A 2HBYB 2X3DA 3DRXA 2P6SA 3J7YI 4Q44A 3OR1A 2W9AA 3AB2B 2YKOA 3MM8B 4KB7A 3PHTA 1DTQA 2NXNA 2C2EA 4KHPJ 2EG1A 4CWBA 2RE1A 1YJVA 5K5MA 3IWXA 4DV4J 4Y2MA 4X65J 3C19A 5F3ZA 1EKRA 1BMQB 1LWXA 3A4TA 3DGPA 3BGUA 3RW7A 4DV6J 4PYAA 3HT3A 1OY8A 4MK9A 4P2XA 2CPHA 2G9OA 3QSIA 3NRBA 3TA0A 4OI2A 1FF2A 5KFAA 3HCXA 3VWSA 3S1TA 5JVGQ 5KFXA 1H6KX 1LWEB 1B0PA 3LP2A 2LQ8A 3SCIE 3DDKA 5KFUA 2E9RX 4ANCA 1FNMA 4HEA9 2R2TA 1W7WA 2ZVIA 4M95A 2B5JA 1RBLA 2BJ1A 4BS2A 2J8SA 2QL5B 3MPDA 4DQIA 5HVHA 1C2PA 1T05B 2N7CA 1KFSA 2DK2A 3HX9A 3TX0A 2L48A 4BLGA 3OTOJ 2D3OR 3Q22A 3OVBA 4IRDA 2V63A 3HFKA 2XR9A 1CPZA 5HATA 3D6TB 3DLKB 3QIPB 4NYPA 3QWPA 5DDOC 3BO4A 4DV3F 1YHQS 3MPUB 2AQ4A 4H4KA 5HI7A 3DRYA 2E1AA 3AJDA 3KXDA 4F36A 1VJWA 4NA1A 4WYWA 3NWGA 4C0OC 2DHXA 2GHPA 5EDWA 2XO7A 1DLOA 4LSLB 4UOHA 1YRTA 3UN2A 1MSWD 1CULB 1WC4A 4A8YA 4ED1A 1SKWA 1C0UB 1C4CA 4DS5A 5LMNF 3LUYA 2B4OA 4ENOA 3I87A 1K0TA 3EZUA 4CO3A 4M5NA 4LF7F 4L3NA 3R9LA 3P5TL 3TUIC 4ZK7M 5HN0A 3C66A 2E5JA 1UFKA 2YNHB 2FLNA 3RB6A 2EBGA 1WC6A 1JJHA 2YBVA 4OYMA 4CO2A 2KFYA 1HBUB 2FYXA 4IUFA 1VBXA 5DGAA 4AL5A 5IC4B 1PO6A 1W2IA 2Y1RI 1S1WB 1KKHA 1HHSA 4DL2A 2EC0A 1YBTA 4ZPBA 2ZH4A 3PZPA 2XY6A 2MJNA 2IUCB 3OR1B 2VG6A 4Y28C 4CZCA 1ZH5A 3LWMA 2IY5B 5L0BA 3M8SA 4J5OA 1V3RA 1B70B 2OD6A 2AJ4A 2QFIA 4LIRA 3MECB 5A8RA 4R5PB 4LFCF 4QYZK 4MKVA 2H3EB 2QIFA 2CKWA 3H5UA 4X66F 3KK1B 4YOEA 2XZTB 3HJFA 1FXDA 1M5SA 1N54B 1OS5A 2Y0BB 3HHLC 4RWXA 3R97A 4WXOA 3TOQA 4A8XA 3ELHA 4AD6A 4DOZA 2C42A 4EO6A 3I55S 1HNXF 1KEKA 1WC3A 4A8SA 1CQNA 2RQMA 1F60B 5L9XA 3MK0A 3L9ZA 4NCGA 4JI4J 2J0SD 2MB0B 4LRDA 1RWPB 1VQYA 3ZO7A 2ROPA 4CDIA 5KG5A 2DISA 4KAVA 4QJVA 2W4DA 4OHXA 2Q79A 3BR8A 6FD1A 2LYVA 1WORA 1RTDB 4RUAA 5DJBA 3T6JA 1FTRA 2HQIA 2DXEA 1KSPA 4OI3A 4NLYA 4RZRA 1T9VA 1O8BA 1WNEA 1RU2A 3PYFA 1QM9A 2VPXB 4QYRA 3J80Y 1N5YB 1N0VC 1HQEA 3UD4P 3MEGB 1VQ9S 1S9EA 3IR5B 3BDGA 2C2MB 3KLGB 2UVUA 1X60A 2HYIB 4K4ZA 1KHNA 2R7WA 3OHBA 1SL1A 1R0AA 3QLHA 1I94F 4FYVB 4GKJJ 2DR5A 4LFBF 4O23A 2MYFA 3M6WA 5C25A 4I2PB 3ZTPA 3MHYA 1FK9B 4KJIA 4QPTA 4LRBA 4MKBA 1Q7LB 4ZPTR 3QRQA 5CYJA 3CVKA 1TELA 2P5VA 3FBEA 4QZVB 2OLWA 3AA8A 3HMJG 1YBAA 4P2SA 3M9OB 3N01A 4IYQA 1P27B 3D28A 1HNXJ 3SV4A 4TVAB 4RWWA 2P2CB 3NGKA 1S1UA 1CS4A 3G87A 4LIWA 4K4XA 2FLLA 2R8KA 2UUAJ 1RT6B 3KLEA 4FF2A 1WC5A 1WKLA 1KOHA 2D3UA 2OEMA 3IR7B 3ULHA 4WZQA 2ZBIA 3W65A 3DLLQ 4CCHA 4JI3F 4DDFA 2UV8G 3L09A 5FD1A 2L08A 1CBKA 3AQPA 3WZ0A 4J9UE 2H54B 4WFXA 3HHKA 1V6HA 2QE5A 4YQWA 5D4NA 2MKSA 2XTJP 2PC6A 4BCAA 5L0EA 4DG1A 2WBMA 1NCLA 1NRKA 3CD0A 2LU2A 2PI4A 4USIA 5C5JA 3E8OA 1RAGB 3DMJB 4Y2AA 4YHHJ 3H8YA 4EUVA 5B7WA 1SJQA 4ZCMA 1C1BB 1N32J 4CXSA 1N34F 4U7UD 2B9EA 3JSRA 2QYGA 3TVKA 3BN4A 4YS2A 1V3ZA 2VG5A 4M5DB 1IN0A 4USWA 4UORA 4KIAA 3D54A 2HQFA 5GAEU 1BWVA 1S1XA 3TP2A 4WBFA 3PW2A 3QO9A 2KG1A 1ZEDA 1NSPA 3BBBA 2QMXA 2ZOGA 4LRCA 1LWCB 2OPQA 4Q8EA 1URAA 2HHXA 3O6QA 2HMIB 5HMWA 1DAXA 3DOLA 1LK7A 4AYBD 1W2BR 3BF4A 2ADCA 1B3TA 4DUZF 1UAWA 4RBUA 1QAIA 2YWHA 5E3AA 1GMWA 2FPHX 4N8NA 3BR9A 5C7PA 5DQGA 4PEOA 2R2SA 1NKCA 2GMJA 3ENWA 4EWTA 2QL7B 4OI1A 4KHMA 1WTFA 4K8RA 2XM3A 4FYYB 1SJ4P 1XNRJ 2X1AA 3O5TB 1VYAA 3DYAB 1MLAA 3CMAS 3OFHA 4USJC 3EPIA 3EMTA 2DR7A 3D4JA 3RB0A 2CZVC 4L75A 2I6WA 3TRGA 5ITHA 2WK4A 4F0MA 2HHHJ 5J2MB 4RNHA 2DPIA 4ZN3A 1X9SA 3AD8C 3W60A 1JLCA 4RPFA 2QLFB 1QJHA 2NXCA 3GJTB 3NCPA 3PYDA 4O4GA 3L3CA 4EK2A 5CAAA 1S1XB 4P7VA 4BC9A 1R27B 2HVIA 2HNZA 1FDNA 1MMLA 4ZLLA 4WFNQ 4J37A 3PIPQ 2OUGA 2RQKA 2Y1IA 3IXQA 1Y0HA 2BW2A 2VHGA 2RU9A 1J5OA 1DZ5A 3TWZA 3RZAA 3GMGA 5GAGI 5F8JA 2EWHA 1TAUA 4UQTA 2OP5A 1EJ7L 3AJ1A 1OQ6A 2ZM6J 3GZ7A 3BBFA 3UR3C 5J2PB 3GSIA 5HVGA 1D1UA 3IO1A 4LF5F 3N6NA 3KNGA 1ANJA 2DGVA 4TQSA 4GKKF 1TL1B 4I4BA 2LEAA 2ZKTA 3BDEA 2AYMA 1YGYA 2MEWA 2VG7A 5I4MA 5KFOA 3J7Z5 4K4YA 1RWWB 4ZG7A 2R7OA 2CXEA 5KG0A 3HP6A 2GNKA 3LGMA 1VQPS 3KLEB 2XMTA 3LGNA 1H3DA 5KFPA 2B43A 1HR0J 2DHHA 3M2RA 4OZNA 2G4BA 1G1XA 4LF1A 2BYCA 4ES3A 5C2CA 2FB0A 1JLCB 4BWJA 5D77A 4ZIWA 2ZHBA 1BXNA 3DM2B 1T8EA 3R27A 1RTZA 1L5UA 3NVLA 1F1BB 3L95X 2KHCA 4ZP6A 4OIXA 1URNA 2FGCA 2F63A 4WJBA 2AGPA 1B7YB 1U1QA 2DRAA 4KJDA 2UZAA 5J1NA 4Q5VA 4EYHB 1Q79A 1RHJB 2OJ3A 4I2PA 2W5QA 4DN9A 4ECRA 4G3IA 2VONA 3M30A 3R6LB 3SEOA 3EVWA 3EXYA 2B8PA 5SUHA 3BO3A 1TQLA 3TQ1A 2VODA 4WCEQ 4KM4A 2C1EB 2PEHA 4C8MA 4KHPF 1V5VA 4IOCQ 3BDFA 5AE2A 1U49A 3J81j 5ETLA 4B9LA 1MROB 4OJ3A 1MWQA 3MEGA 1CLFA 2GSOA 4F2RA 1ZAWA 1GTEA 1PYSB 3M8QB 4PXBA 3SQOP 3W63A 4XPEA 1N5YA 2IBOA 1U48A 2QEXS 3CJ5A 3KG4A 3CMRA 1KQKA 2FJAB 3DDNA 3PJXA 1REVA 2JH3A 5CA5A 2V9WA 5TJ3A 4YUDA 1VRTB 2J6TA 3C46A 1D9FA 4O3NA 1TKZA 3NLCA 4J9LA 2XRGA 3CNQP 4DV1F 3SQGA 4DQQA 1TK8A 4NCGB 3OLBA 2DHSA 4ECTA 5GADU 3CUNA 4LF6J 5CH7B 1ZM3A 3R2DJ 1DTTB 4KSEB 1J2VA 2O66A 3GYNA 1VR6A 3OW2R 2B56A 3KUGA 3DXSX 2CQGA 2OI2A 3JQKA 2H5EA 3MEDA 3GYXB 2VICA 2CDQA 4XDDA 5A8RB 3NCQA 4GO7X 3G6XA 4NXNJ 4QAXA 3LPYA 3T1AA 3V5RA 1L3VA 1U6BA 1FJCA 1WEYA 3CXCR 1WDDA 5BR8F 1FKPB 2DGUA 4QW9A 2ZH9A 3NKRA 1IR0A 1N2LA 2FVRA 4HACB 4ZVTB 4DR7J 3GFZA 5CYMB 2XHWA 1WTBA 4L73A 1HHQA 2BW7A 2DCLA 2MZQA 1C1CA 3IR6B 9RUBA 4OL8A 4W4MA 3CJQA 1WJ9A 5ETNA 3CC2S 4DV4F 2ABYA 1SKRA 3CDUA 4YMEA 4KC5A 3NXZA 5KFCA 2NUHA 4QIFA 2DNZA 3J80U 1HQAA 1RTHA 1YDLA 4ETXA 4C11A 1CJKB 2GQ2A 1N8RT 1PJ5A 2U1AA 4R0EA 3QSYB 1AROP 4OMFG 2D69A 3U27A 1S10A 1X4GA 1UETA 1WELA 1RYRA 1UVMA 3PJWA 2E7VA 3HM9A 3FFIB 3EZ5A 1DLOB 4LSLA 3MCNA 1S9EB 4WE1B 4M1KA 4RKUC 3IWNC 1RT2A 2FUG9 1HQEB 5LM7E 4Y34A 5A8WB 1KH5A 2AX0A 1HNIA 3IGNA 3MPWA 2PEBA 3C14A 4F4ZA 3SYZA 3HHLD 3IAS9 3L4BC 3MTJA 2DO0A 4DR3J 3RB3A 3NNHA 1U4BA 5D3GB 3LANA 4B3MF 2E1PA 2R2RA 1RTDA 2YWGA 1XNRF 1RABB 2A0FB 4ZP9A 1TTHB 3KMQA 4UOPA 1WOPA 1FFGB 1ZM4A 2BKNA 2ZE2B 3MUMP 5HJYA 3E3XA 3V81A 2KHDA 1REGX 3QAUA 4M63A 4ZVGA 3T01A 3J81Y 2KRBA 1YZ7A 2Y9HA 2JEIA 1QE1B 2GJ2A 1QVGR 1CC7A 2UXBJ 2W9BA 2IVYA 1OQ3A 4QWAA 2OPSB 1X9WA 2M70A 3FCWA 2M5YA 1WWHA 3RRKA 3MUTP 3MZIA 1HBNA 3A13A 3OPKA 2H48B 1N2KA 1F3VA 2KB2A 2C28A 5DG8A 3DHXA 2NSCA 4ALZA 3ZNUA 1R8PA 4L74A 4WU3A 3MFIA 3F73A 2Z58B 1TK0A 1KNZA 3FMWA 3R2CJ 4K0KF 3E2DA 2E1CA 4IOBA 1RLDA 5DG9A 7FD1A 2XO6A 5DLFA 2C2DA 3DLEA 2PMWA 3KD8A 3SCJE 1VBZA 3MR7A 3WAXA 1U1MA 4UPKA 1W26A 1RWOB 2IDLA 4MFBB 1U7LA 1F9HA 4ZG9A 2BE9B 2PA8D 2FZKB 1S1WA 4FNIA 4MFBA 2GVDA 2A6MA 2N7YA 2HRYA 2WONA 3A8IA 4KGMA 2ZH2A 3L7OA 2HPUA 2J8AA 2Y3YA 1L3KA 2QMWA 2YNHA 3LH2S 3GILA 4DV7J 4ED8A 4DR6F 3OTCA 4E2FB 2CWKA 4LMZA 3AAWB 1B0VA 1HBNB 3EWGA 1RHMB 3MI7X 4HVZA 3GCWP 4KGXB 3SIPB 3W8PA 3DI6A 2VB6A 3KLHB 4FPRA 4CYUA 5KFEA 3QAEA 1Y5IB 3I31A 5C2GA 2EFVA 1U0HA 5DDRC 1IJEB 2CFXA 1HMVA 2YTCA 1SIWB 2PD1A 2M3DA 3VCDA 3IP0A 2CVEA 4NOHA 4A8FA 2W2MP 2HWIA 2ROEA 4B9TA 1F5CA 4LFAF 4NLGA 5HROB 4OZJA 1K73T 3UDVA 1X5SA 1GX6A 2V8GA 2V2ZA 5E3PA 2Z2ZA 2HBZB 4WTYA 1RWNB 4JI4F 1H98A 1U09A 4P7TA 4IG0B 3NGDA 1ITPA 3KUHA 2ATLA 5AE3A 4CNZA 1PAUB 4YDXA 2MKKA 1LWFB 3SZ2A 1KHKA 4OJ1A 3QZ7A 1Z1ZA 4P2FA 4X4TA 4NEYA 4I6YA 2FQQB 1JJ4A 1CEZA 2CJ9A 2QG9B 3A8JA 3DXBA 4HTIA 2V4QA 3VTIA 2DPJA 4J9VA 3GCXP 4LUBA 4PQUA 1Y6VA 2BBEA 2HVEA 1UJ6A 3RTVA 1T03A 1ALHA 5T7LB 1O6XA 1YK9A 3H5XA 2IFXA 2IC3B 2LVWA 3HHNB 2DR6A 1RTHB 4FPIA 3OT9A 4YB1P 3H25A 1WSRA 3OXFA 4IDKA 5MLCV 4CLWA 3HPOA 2G9YA 1UKUA 1NNDA 3FKBA 1N32F 2B9XA 1ALKA 2YKMA 2DGOA 5E5NA 1KN6A 1Y3KA 4HL9A 4OHVA 1KFDA 4DCOB 2N3OA 3LXQA 1HLWA 5FJ4A 5CYMA 2UXCF 1RWVB 3MURP 1LQ9A 1FKPA 1YQHA 3TJAA 1FXLA 2YKNA 4N47A 2DVIA 3DU6A 2V8VA 4DI6A 4K7QA 1LW0A 3GG1A 3RRGA 4FF4A 2D1CA 2W25A 2EFNA 4I6WA 2PN6A 2LEPA 4LRFA 1RE1B 3ZTSA 3T5JA 5L46A 4NXMF 3KK2A 2RDJA 3TEHB 2VFSA 3MEDB 4MYTA 4ZVRB 3W8GA 4USMA 1LEOA 2POKA 5KT2A 3WBHA 2G2ZA 2Z8QA 3CCLS 2BQ3A 5DLVA 5J1PA 4FKYA 3H4BA 2EK6A 3AOCA 3IG1A 4B3SF 3VV2B 4DSJA 1URRA 3THVA 4FBUA 2C3UA 3R3TA 3OUYA 3SQGB 5AXKA 1Y10A 3I5CA 3OD2A 1GNKA 2GGPB 1FFSB 4GVBB 4U9RA 4QWEA 3H2UB 1RHUB 3JQMA 2E5LF 4LF7J 2NPIA 5CD4H 4C0HA 2Q66A 3M6XA 1P49A 2W7AA 3D6HB 2JDJA 3CDAA 3HKZD 4J90A 1E6VB 1S9GA 2DEJA 4OI4A 3W5ZA 1MROA 3OFFA 5HJXA 1PG5B 1RA6A 3CD6S 1IR1A 4AXIA 1RCXB 5ETVA 4EFAC 1FX4A 3Q8YA 2B8QA 2GHWA 2V4RA 4DLGA 3GQCA 2ZDOA 3NAIA 4NZ7A 1JXLA 5EN1A 3PY8A 3DHWC 2DHGA 1MMNA 4FDIA 1IR2A 3I5BA 3W7BA 4IG0A 3S6EA 2YH0A 3C2PA 4UPHA 2N82B 4DV1J 2ZBRA 2EEYA 3MK2A 1RT1B 4ZGAA 2KYZA 3K5MA 3M2RB 2GV1A 3SBMA 5KFTA 2UXDJ 4C8KA 1AYEA 3ISZA 1QAXA 4F0KA 1SUQB 4UTGA 5CQGA 5DLTA 3D0IE 2BMBA 2CJQA 1NXIA 3PTWA 3TAMB 1FT8A 2DNPA 2EW9A 3MM7A 3FZ2A 2QL9B 1O5JA 1EQ0A 3W5YA 3DI6B 2FJEB 3QFHA 5FDLB 4F02A 4NASA 4QIVA 3D7SB 3LAMA 4ECQA 4RW9B 1U6ZA 4HHJA 2FD2A 2OO4A 3ET6B 5J2PA 2CNLB 2NSBA 2UUBJ 2OH2A 2FJDB 3KUEA 5LMUF 3UD3P 1SIZA 3KG1A 3H5SA 4WTOB 1CJUA 1OYEA 1KTVA 2QSFA 2ZNYA 4G1QA 3PHEA 3TA2A 4DR5J 4DR2J 3MOJB 5LMUJ 5LSRA 2YKAA 3PX4A 1LXJA 1J5OB 5JVHQ 4RNOA 5AXMA 1XMQJ 2EPIA 4LF9J 5KG6A 1H7XA 2HVDA 1RQ0A 2GQCA 2HNZB 4IFYA 3KLFB 1JXVA 1NU4A 1PAEX 4GKJF 3MEEA 1OSCA 1YI2S 2ZITA 3MEKA 3BGFA 1QSSA 2FY1A 4O4GB 5LMNJ 1NH8A 1YJTA 2ZDPA 1NJIT 1KC8T 1BQMA 2X7IA 4KE5A 1D0EA 4UOOA 4YR0A 1M5OC 3DOMA 2CPDA 1UEKA 1ACMB 3ZZZA 2RRBA 1N48A 1S6QA 5J2QA 1Y7AA 1D9AA 3KG0A 1F9EB 4CH0S 1RHKB 4PABA 5EWGA 3C8YA 4PQAA 4CLYA 4AQYF 2WOMA 2PMHA 2MKIA 2I8EA 1N4LA 2J7KA 4FYWB 3PVXA 2DB1A 2HG4A 2ZVSA 3NS7B 3AJ2A 3G71S 1IBLF 3Q8SB 2FC8A 4TQRA 4DUTA 3CCZA 3AD9C 1S77D 3DOLB 4NCAA 1FCAA 1FRXA 2HIYA 3VAHA 2QSWA 4WIIA 1XEZA 1VK3A 3MMBA 3ILJA 2OMOA 2DIUA 1KLMA 1LOUA 1VBKA 1W25A 3C14B 5EWFA 3HXMA 2HBQB 4C0BA 1K0VA 4MJKA 4URSA 4ZPCA 4J9OA 3KTQA 3QGPA 1NPRA 2BJ3A 2L9WA 1YZ6A 3MR5A 2C2RA 4F4AA 2WB1D 3FK4A 1X8DA 2O67A 2HHHF 2DR8A 2OHDA 2V8HA 4B3TF 3TZWA 4DL4A 2NYIA 3MPYA 3KDNA 2DNNA 3NBPB 4ZJLA 4DV6F 3AY0A 3D6MB 3GPAA 1JLGA 4JV1A 1HJKA 2YQ0A 3GIMA 1XNQF 3M6VA 4N5SA 2F5GA 2VKZG 4TKTA 2IVFB 1N33J 1RWKB 1JWWA 1VRQC 2RD5C 4PR6A 1X5TA 1MMDA 2KJWA 3RAXA 2YNFA 1IKXB 1N5SA 1KH7A 2P6TA 4IFVB 3PKMA 1O51A 2VKRA 2EG2A 1R43A 3QT5A 4KRWA 4UUWA 2VJUA 2W5SA 2W5RA 5F9LA 5DLWA 5DLGA 4XTTA 1E6YA 1XR6A 2I5JA 3OR2A 3HD1A 4FXWA 4HACA 4G1PA 1SPBP 3CCTA 5J2NA 3V6DA 4JP8A 1UJ4A 4ZVPB 4JV5F 3ONQA 1FI4A 1Q0NA 1I3OB 4OX9J 3O44A 4IFVA 5D4LA 1JLFA 3UNYA 1AUDA 1WG4A 4ZVFA 4BDPA 1FVQA 2WVDA 1Z2LA 1NB7A 2N3LA 3CJ2A 3VGUA 3GFXA 3NGSA 1NZ8A 2GZOA 2F4VF 2BE7D 3QFWA 5K14B 3P5BP 3JS9A 1JLGB 1XNQJ 5KFQA 4OV6A 2M0GB 1AUKA 3OV7A 5JJBA 1WI8A 1NO8A 2MY7A 3QLHB 3R5BA 3VR1A 1U6FA 5H9EJ 1NJZA 4ED5A 3M05A 2N4DA 4RNFA 1JLQB 5DETA 2RS2A 3CO0P 4RLEA 5KFYA 2X1BA 3TJ9A 4I1TA 2PFFB 3BDGB 2IRYA 4OYPA 4YY3F 4PXCA 4ECWA 1REVB 2MSSA 4AFFA 2ASDA 2MGZB 1T9YA 4O44A 2NPFA 2MHEA 4TLQA 4M5HA 1N5TA 4DSEA 3UE2A 2CQ1A 1SI9A 4ID5A 4K50A 2JZ5A 3QGHA 4L72B 1ZTTA 1T3NA 2HGNA 3MCSA 1QDUB 5HK4A 3WIUA 4O3SA 1NJWA 3QPIA 4NMXA 3J7ZT 4BBYA 4QU7A 5B0BA 2B4VA 2VBZA 4QW8A 2IBKA 3D0HE 4PKDB 3JYTA 2KRRA 2WOMB 4OLPA 3WAVA 3GLJA 1C0TA 3EUNA 1R7IA 2QTWA 3KK1A 4LFBJ 4PXEA 5GVQA 2BKPA 4DL5A 3MECA 1S6QB 2QA2A 4KH0B 4OFZA 3BSCA 3GB0A 3UQSA 2EVZA 2BV3A 4G1IA 4I2QB 3N79A 1I5OB 4A46A 2IUCA 3EZOA 1WG1A 3V6DB 2IMOA 3I9V9 3V2UC 4LR9A 3A3NB 3OJSA 3H2LA 3ENVA 4H4OA 3MMAB 1E6YB 4TXSA 3CCUS 5CCLA 3T1YF 3RAQA 2KFZA 2R7XA 4FDJA 1WD6A 2A10A 3BSAA 2G0JA 1NK9A 3CJTA 1EHWA 3EXCX 2KXFA 3JTNA 4LSNA 4G6VB 3X1LB 3MM5A 1A9NB 4X2BA 3HSZA 1U24A 3AOAA 3H0PA 3Q2SC 1RU1A 3TZYA 5HLFA 1WC1A 5DQIA 3HFZB 3MF5A 2GQQA 2KN4A 4I68A 5FIIA 4DFPA 4LQ9A 3TVYA 4ILLA 2CNKB 2WRMA 1TUGB 1ZA2B 3PDNA 4HHUA 1UZHA 2UUCF 2D3ZA 2VQFF 3OBIA 1ALIA 1SC4B 2ACMA 3CJSA 3MMCB 4JI0J 4V1Ak 2Z57B 3TAMA 5JUMA 1NDLA 3KLIA 1EW8A 1AUSL 1EQMA 5SZTA 2CJAA 1S6PB 1YRUA 4JI0F 2ZZTA 3QATA 2DYAA 2AJFE 1BHNA 4P72A 1KQGB 4RUCA 3M9MB 1R8HA 3HVAA 3N0VA 4FS1A 2FJVA 3C3LA 1EJJA 1JNRB 2QJ3A 2IM1A 2VFVA 2YWKA 1IJFB 2JFKA 2CWXA 1S0VA 4USHA 3CGIA 1IM4A 5KT5A 3CCES 1BWEA 4DR5F 1HNZJ 5CD4A 3K7RA 3DYAA 1LXNA 1SC1B 2YX1A 2UVWA 3QT8A 5BJRA 2B5JB 2J9EA 4LVNP 1F3FA 3U1MA 4TU7A 2ATCB 2BQRA 4F4YA 2OGUA 2IJRA 3C15A 4DX6A 5GMKa 3K5NA 2CADA 3B4DA 3LP2B 3LA0A 4EU0A 1U1OA 3WDOA 2J0QD 1B7FA 2YWEA 3AB4B 3QBCA 5IZHA 2QRRA 2P9CA 2G0CA 3HDSA 4TYAA 3MMJA 4DPUA 2AYGA 2DNQA 3FJ2A 4P2MA 1LWCA 2OPQB 1HBOB 2QLBB 5GAHI 1HW9A 2EC2A 1XBWA 3AXKA 3P4UB 4PG8A 1BQMB 1VQ6S 1B64A 4C97A 4ZMMA 4M5JA 4OYXA 1S0OA 4KAYA 3HD2A 4IH7A 3OL7A 5LIAA 4DSLA 1T95A 4GVBA 3KJFB 4PG7A 1NKEA 2F1FA 1TV6B 2KXNB 2QA4S 4RO0A 4XO0A 2AU0A 3QJJA 5D0GA 1TR0A 1N33F 2QZUA 4ATNA 2W9CA 1C1BA 2RHSB 2J6SA 1S99A 4G1QB 2GVZA 4J7CA 1PJ7A 1PKUA 1PJ6A 2HS0A 4F4XA 1UA1A 2KTQA 4DG1B 3SDEB 5RUBA 4DF4A 2AJ0A 4LVOP 2DR9A 3CJ3A 4DR7F 2VFUA 2WB4A 1RLCL 2DGQA 4ZHRA 1GMWD 4QWBA 5IT0A 1R8CA 2V6AA 2KM8C 4CIOA 1VIOA 4RW6A 4WP9A 2Z2LA 3MM7B 1TL3B 4QR2A 4RX6A 5LRNA 3GIRA 2JWNA 4DR6J 1SUQA 2EBEA 2AJ1A 3OL9A 3NOCA 4NLSA 5F8HA 1PSDA 3HHDA 2V69A 4QIGA 4DBQA 1PIEA 3CIMA 1CS4B 1S76D 2BM1A 2IJFA 5CHCB 2ZBQA 4ELTA 2WTFA 2GIQA 1QSLA 4OI6A 3QRRA 4DZ6A 1GAOA 2YKMB 5DG7A 2HLTA 1RHQB 1VS3A 2RRNA 5KT4A 3G6YA 1P1TA 1YKWA 4KO0A 2IJNA 1CVJA 3P6YC 4J9KA 1EETA 2DNOA 2DIVA 2XWXA 2E9ZA 2DGSA 4NLWA 3TQEA 3UVJA 3SV3A 1E33P 4LR2A 3TARA 1VQOS 3ENAA 2PMZD 2BANB 2XYHB 4JI8J 1FJGF 3RUBL 2BOPA 1YBUA 4J9RA 5L8RC 1H2UX 1M5PC 3W3SA 2Q6BA 3OSNA 4DL6A 2IHR1 2CYYA 1RT7A 1VQ4S 2R8IA 1FD8A 1HI8A 3OTDA 2Y0SD 1SKSA 3HI9A 4M8LA 1QD1A 1HW8A 1RT4A 2KXHA 3VAMA 1ELZA 4C8OA 1SQFA 1NB2A 1Q4RA 2YNGB 1ZPVA 5KFMA 3GIIA 4ES1A 4R8UB 5KFFA 3CJKA 2HHUA 2BRLA 4NA3A 1HI0P 2OSQA 2MQMA 2XSFA 1T9TA 2W8LA 2R3VA 2IA6A 2WVFA 3OUYB 2HQGA 3VAFA 3VALA 4LF8J 3M8WA 1FDDA 4ED3A 4KV8A 5KFRA 1WOOA 3E01B 1TL3A 1E1ZP 5THWA 4J91A 4A8MP 2HFOA 2WVCA 1VLYA 2QX0A 3FCVA 1UVNA 1RTJA 3B5QA 2CQCA 3NGUA 1S9FA 1FJEB 3Q8UA 4O3RA 3BKUA 4JYAF 1ZEFA 3AH6A 2CNNB 2A2CA 1RAIB 4EZ9A 3K0JA 4K2JA 4PG4A 2LXIA 1KQFB 1VQ7S 1FRLA 2HVZA 3QJLA 1UVIA 2HMIA 2CJXB 1IQZA 1WDTA 4YR3A 2B7BB 4MIVA 4CLLA 3X3UA 2CG4A 4DV3J 2DBBA 1NK6A 1HQ2A 2GVDB 1NJYA 4DV5F 1EW2A 4NLQA 1Q82T 2FC9A 1NSQA 2HHVA 2CPIA 4CXUA 4B9NA 1N52B 1R3NA 1SCJB 1V5IB 2XMAA 4B3OA 3TZXA 2BDPA 4F3QA 3B4MA 1KHLA 4ZPWR 2MPUA 4E8UA 5LSLA 1VHIA 2V67A 3VHQA 4F04B 1R89A 1SB6A 4Q45A 3TAPA 3I5AA 5I3UB 1F5BA 1DQ9A 2XYGB 1N0UA 4JUZA 2MJUA 2CIMA 3BDHA 3T9NA 2AYBA 2HIQA 3I0SA 5D0HA 1S79A 4N56A 1UZDA 2R8HA 4YB7A 4WFZA 3G96A 4I56A 2IIHA 5CZXA 5E3QA 2DNMA 1QE1A 3G86A 1S72S 2M9KA 1FRJA 3DLBA 1UP1A 2YQ3A 3I96A 4A8QA 2CQHA 1IKYA 3BYRA 5FLXY 3HSJA 5KFJA 2GCFA 1VQLS 1U8SA 1AJDA 1HNZF 1IBLJ 1UW4A 2EFQA 2W24A 1YLXA 4GO5X 4DUYF 4B9UA 2VF3A 2I2YA 1VI7A 1K1QA 2FHJA 2H9ZA 3NGRA 1KHVA 1RCOB 2E5IA 1RYSA 2DRBA 3IBWA 1RAJA 4PYDA 4CLZA 4X62F 5HROA 3IGZB 4DHVA 5KFHA 2MQLA 2XMJA 1S59A 4GC6A 1T3OA 5B0EA 1VIXA 1APSA 5IT4A 2X1FA 2B9YA 2BKOA 3J81U 1ZAXA 1HMVB 5CZVA 1Q81T 5ETKA 5CYQA 3CW2C 5EHHA 4H4MA 1KR4A 2L9DA 2Z4PA 1BQNA 5LJ3Y 5GAHU 3OL6A 1IQTA 2FLOA 2R7QA 2ZC3A 1LFWA 2AIRB 2PT0A 4OQJA 3IM9A 1V9OA 2HFNA 2ZWPA 2QT7A 1NUEA 3K2YA 4FDFA 5GMEA 5DRKA 5E3RA 4C11B 2FDNA 1FKOB 1H7WA 4UPIA 1HHTP 3HT0A 2UXCJ 2AEJA 2OPPA 3ZZYA 1S5ZA 2NZCA 2W4CA 3DKDA 4NZ0A 5DS7A 2E1RA 3WBZA 3MM5B 2VQEJ 4C8ZA 3IRWP 3ZXWA 1OIAA 2RUSA 3P96A 4KGKA 2C3OA 4RW7B 5F3TA 2DD8S 3G82A 4DPYA 3NMAA 3F56A 3JQJA 4UZBA 3H4DA 3BQ0A 1U1PA 1AJAA 4DX8H 4X4UA 1EIYB 2VQRA 1RSCA 1OPIA 1RISA 2XULA 3D67A 4RUHA 3P49B 1O99A 1D09B 3JSMA 2PSZA 1R0BG 2GW8A 3BPSP 1RTIA 3IA0A 3MPVA 1VHFA 3M2UB 4CP5A 2LDIA 4LT6A 2KH9A 1URBA 3QZ8A 2LKZA 4NE9C 3BZQA 2JL9A 4A8KA 2OPSA 4TN0A 1UTAA 4LBHA 4ECSA 1N6QB 3OTEA 2CQDA 4FS2A 3TW0A 2ZH7A 1YG0A 1E2SP 4WPAA 5IJQA 1UWBB 2MZSA 4EMDA 3EICA 1KTQA 1S0NA 1TKZB 1YJNS 2V8DA 1H38A 2QMUB 5B0CA 3V6KA 1VRTA 3IGVA 3BPDA 2KM8B 1PGZA 4ZVHA 4KGVB 2GA3A 4IQXA 3DU5A 2MGZA 1HNVA 1PYOB 1ZM9A 4ZVSB 5KFSA 3FNNA 5HQMA 3IRXA 4X4RA 3D9BA 1RT2B 1WACA 3FBBA 3QRPA 4WE1A 3UN3A 1IBKJ 3UPFA 2KKHA 4Z37A 2BE2B 3CCVS 2M52A 3NS6A 3GU0A 3T02A 4DL7A 3LW5C 4GTZA 2OSRA 1TKXA 4EGLA 5CXTA 3PFEA 2BQUA 1DRZA 4C4WA 3M4XA 2DRDA 2SXLA 3IS9A 5GAGU 2J6UA 3GJQB 4DEZA 5IM0A 5K14A 3SFUA 1FSUA 1VMBA 3HK2A 1ZPWX 2BJDA 3DLHA 5KFIA 3LO3A 2LQJA 2PDAA 5K4PA 5F8IA 4C3LA 3H42A 5U47A 4V19J 3EJMA 1N5VA 3UWTA 5C24A 4QPXA 5D6GA 1JLFB 4IRCA 4DF8A 1C1CB 2RHQB 1TKTB 1FE4A 1YX2A 3FGVA 2L9NA 1KHJA 4MY4A 2O5DA 1LK5A 3KJNB 4CLFA 3KHHA 1BUXA 3JAMY 4K0KJ 3C6TA 3R7BB 3GE9A 5HBMA 3SFGA 1M90T 2RNEA 3IBFB 2XLKA 3A1YG 3PV8A 3HHLA 1AXQA 4UT4A 4GTWA 5KTQA 5KOWA 2BZ2A 4WFYA 3W2VB 1JLBB 1RT5B 1M0SA 1PC5A 4U7CA 5KFZA 2R2UA 4GKKJ 3GJSB 4HH0A 4ES2A 5EGYA 2OFGX 1HDHA 1TAQA 2VFRA 2JLEA 2RQ4A 2MQNA 3ZNJ1 4F4KA 3CULA 3LP0B 2DT9A 4QQBA 4DU7A 5IQ6A 1HYSB 3FVYA 5K8OA 2MKCA 5HAOA 2XMKA 2VIHA 1DTTA 4HTJA 3PCOB 4KR0B 3BN7A 5AJ9A 3TVZA 3VF0B 2D9PA 4C7QA 1FX2A 5KFBA 2R7VA 3CF5Q 4OYOA 2GAHC 3LTOA 2XS2A 3W64A 1R6VA 2V94A 3MR2A 1SJ3P 2F7VA 2M8DB 4ERDA 5GAEI 1G7CB 3F0NA 5A8KA 1WHXA 4MTPA 4CM0A 3GIKA 5DM7Q 1D8YA 3G9CA 1S97A 1KLMB 4FKXA 2FIUA 2ILYA 4DFMA 3VAJA 1S1VB 1TL7B 1VRUA 2BVZA 2LA4A 2RJZA 3DRRA 4I6AA 3PR4A 2E5LJ 4FYXB 3K58A 1G6BA 2VC0A 4DR1F 3MAAB 2WSCC 4LSZB 1ELOA 3UFCX 3LPEA 3TUZC 4PWDB 3QMQA 3NKNA 2AV5A 4JI6F 3HVWA 1VQSA 3IM8A 2IVMA 1YITS 1UWAA 2QGFB 1IKVB 1S6UA 4MIWA 3Q23A 1NHVA 4DSIA 1HNWF 5LQQA 4LRAA 5HANA 3M8RA 1VQMS 1GT8A 2GJFA 5B0GA 2AD9A 4M5IA 2QLWA 4O0NA 3G8QA 5IS2A 3CIZA 1Y5LB 3DRRB 2XWYA 1SV5A 2UUTA 3KJVB 1X0FA 1U1KA 1F5AA 4OLOA 3UCGA 3PIOQ 2GX8A 3K8WA 2LEBA 2CA9A 3VGSA 2AJQA 2PFDA 3CCWA 5KFWA 4ED6A 7FDRA 2M88A 5F8LA 4HT7A 3C6UA 4ZP8A 4M5DA 5G4DA 1SBRA 5DM6Q 4ZS6A 4DSKA 2VG7B 5LSOA 4ZLPA 4PWUA 3BKFA 1UVJA 3V4IA 1TL1A 1FTCA 2QLXA 1N36J 2NYHA 4NPOA 2RIJA 4K2XA 2ZH3A 4P52A 1JKHB 4IR9A 5H9FK 3V4MA 1HYSA 3CDBA 4B08A 1HWJA 3PW0A 2V34A 2JLFA 2ZUGA 3MCMA 4RU2A 1AFIA 1FRIA 3PRBA 5IV3A 1M5KC 1S1TB 2MQ8A 3MK1A 4CT9A 2OFHX 1U2FA 4C8YA 4C6AA 4WK3A 1RACB 3W2VA 4FVMA 2HFZA 5IV4A 2VOOA 4LQYA 1UCNA 3G2XA 3KWMA 4OZ3A 1AZSA 4NXMJ 2QYCA 1WF2A 1Y7PA 1NH7A 4IRKA 5H9EK 3H7HB 4ZCIA 1RT6A 4Z7CA 5HBMB 5HP1A 1ELXA 4C3MA 3C6TB 4ZIVA 3VAIA 1NK0A 1SVDA 4C8LA 2LXUA 1S1UB 4X64F 1VDHA 4LR7A 3E2EA 2KT2A 2C2ZB 4K4VA 3GJRB 4IO9Q 2VH7A 1YTYA 1CJVB 4TY8B 1FXRA 4Z7YA 5E3CA 4AUKA 4X4PA 2YH1A 4IOAQ 3FC9A 5I3QA 3GFYA 1IWAA 1FEHA 1WI6A 2FGOA 2XZWA 2IPOB 2F3JA 3MD3A 3PO5A 4CYRA 5MAOA 2VBWA 2XSJA 8ATCB 2JC0A 3BBCA 4G65A 1FJ7A 4C98A 3PXGa 4FVCA 5IM0B 5AJ3F 1EW9A 3OTOF 2D41A 5ETRA 4Q2LA 4K5SA 1K47A 1RBAA 2RF2A 2MSTA 5D4PA 3DRPA 1YJWS 4ITSA 3OXGA 4U7UK 5IXUA 3DLGA 2Z30B 5KG3A 3KLGA 1HQUA 3CJ4A 4JI7F 3PX0A 4BC7A 2OEJA 4OYAA 4Y0FA 2X98A 3UN5A 2R7RA 1PYTA 4AL7A 3R5JB 5ADZA 4JI7J 1HPZB 4LQ3A 3Q24A 4GTYA 2VASA 2XY5A 4LREA 4DPXA 3ETOA 3L7UA 4YB6A 4B02A 4ER8A 2YVSA 4EI2A 2LU1A 3HO1A 4X4OA 2GGPA 4DU8A 4USUA 3GIJA 1L3SA 2KO1A 4NA2A 3W1YC 3QJPA 3VGTA 1KOOA 1U2RA 2W8KA 1QAJA 2EKNA 1JQGA 1VK8A 2V4JB 1RKJA 3M6UA 3RBZA 3DMJA 3MM9A 3RJMB 4AQYJ 3ZTQA 4NLXA 2BUNA 4NYZA 1FDAA 5D0RA 4KPCA 1KVJA 1HWLA 1F9FA 1UFWA 1X4HA 2J9CA 2CQ0A 4R5PA 5BR8J 1SC3B 4WYLA 2ZZNA 4U67Q 2JEFA 1NK4A 1JXEA 4JYAJ 1U8WA 2HRTA 2W01A 3PACA 4L6V3 4RBVA 2R4FA 3T19A 3US5A 3I56S 1T9UA 4TLRA 5I42A 2K7KA 2C3YA 1XTZA 4UY8T 1EI6A 4N7TA 4OZ2A 4PAAA 2EFPA 4C3KA 5AE1A 2UP1A 3AXMA 1M5HA 3N6LA 3OFEA 3ETMA 3T41A 4DV7F 2MZRA 4I7FA 2UU9F 1RAHB 3NNAA 4ICLA 5F0WA 3QQCD 4ED2A 1X7VA 1EKSA 2HW3A 4DR2F 2A18A 4YHHF 2W2OP 2VC1A 1T11A 1Q8BA 2W8SA 1Z2ZA 4IDKB 4K59A 4OYZA 4MKYA 1OO0B 2CAJA 2OPPB 3I4PA 2DGWA 2RQCA 5M2UA 5L1LA 3T1HF 2OAUA 4DFKA 3CCRS 2G2OA 4C8NA 4ZLNA 3BSNA 5B08A 2YY3A 1R0AB 1Y4ZB 4DR4F 4Y6IA 2ASJA 4NI2B 4C48A 1K7HA 1RAOA 4H4MB 2ALZA 5L1KA 1CULA 4MIAA 2YX4A 4PQUB 4B9VA 1KH4A 2K2PA 2Z2MA 1EQJA 3BQ2A 2J9DE 1CJTB 2AT1B 5CCMA 2C22A 3POTB 3H20A 2VPWB 4PPDA 1NK7A 1SJFA 4XDCA 1OWXA 1WEZA 1Q8LA 2CVIA 2MLZA 3LOUA 1NPKA 5A2QY 3PX6A 3T3FA 4OZ5A 3EDQB 3CJRA 2RVJA 2DCUB 2HAIA 2F8EX 3R1LA 5A0YA 3M2VA 2RAQA 3HVRA 3RBDA 1NDKA 2AJ2A 1HD1A 4M5LA 2V0NA 2XLIA 4UQGA 2ZH5A 4UOCA 2VBYA 4QCLA 4B3MJ 2V8PA 1T05A 3Q3QA 2LQBA 3UNGC 5DZ7A 2HFVA 4B3TJ 1X4AA 1Z4UA 5LJ5Y 3B8HA 5F9NA 2WZ1A 4C9DA 2D9OA 5HMXA 1KVIA 5LXYA 3EGVA 4BHQA 4CYUB 1MWZA 2ANHA 2GA7A 3RYLA 4JV2A 3R5DA 2M8HA 2R8JA 1LWEA 3ZFVA 3KJQB 5F8GA 4USKA 1N5QA 1XQIA 3RBXA 3U02A 4ECUA 3U7JA 1KQSR 3EE3A 2E7XA 3DOKB 3HSDA 5K9FA 2KFNA 2ZJPQ 4UPLA 1H72C 2HAFA 2XYPB 3DGPB 2PO4A 1LV5A 2E5GA 2VUGA 2G1HA 3B6BA 3W2WB 5AJ3J 3CCQS 1SH2A 4DV2J 4DL3A 4IH5A 2WHOA 2ZM6F 1U1RA 2JVRA 1R31A 1X5PA 2DNYA 4ZVUB 1NK8A 2PIIA 3BJYA 2XEXA 1T7PA 2KT5A 4R25A 3THTA 4NCBA 2HRUA 1DTQB 2XY7A 4IQMA 3DLEB 3ZZUA 2VPZB 4CH1A 4KTQA 2BA9A 2HZAA 2YPYA 2W2PP 1BY9A 3DOKA 4M5KA 5E41A 2Z0GA 3PKYA 3C16A 4DQSA 5LT5A 3LP1B 2C2OB 2K06A 3EGWB 3TZZA 3KOAA 2VU5A 3B54A 3ILLA 2WW4A 2ZH1A 3AODA 2LQ5A 4WP8A 3CWJA 3G8TA 2JHEA 3UD5A 4TU8A 3WAYA 4GRSA 4A8WA 1GX5A 1C0UA 1ALJA 3MM9B 4TY9A 3SXLA 3E01A 2E5HA 3D66A 4KV8B 1BD6A 1VGYA 3KK3B 1TU0B 1FVSA 2AP6A 5HQLA 4OYBA 1KS2A 5KFGA 2JC1A 2Q1LA 2ZE2A 4O4RA 3Q8RB 2NS1B
chains in the Genus database with same CATH topology
4LRBA 4FDIA 2QZUA 3T01A 4ZG9A 1AJDA 2W5QA 4KJDA 4CYSA 1B8JA 1AUKA 4KM4A 5AJ9A 4UPHA 1AJCA 1SHQA 3SZZA 2IFYA 3MK2A 3SZYA 4YR1A 4ZGAA 1ED8A 4MHXA 4CXKA 3A52A 3BDFA 3IGZB 2RH6A 4NWJA 5DLVA 3BDGB 3NKMA 2W5TA 5DLTA 2GSOA 2W8DA 3T00A 3M7VA 3CMRA 5K4PA 4ZG6A 5LRNA 1EI6A 5INHA 5TJ3A 3WAWA 4N7TA 3NKOA 4UPIA 3TX0A 2XRGA 5L0EA 3IDDA 3NKNA 2XR9A 5LQQA 2W5XA 3WAVA 4LRAA 2W8SA 4CXSA 1KHKA 1AJAA 5KXAA 4UORA 1E33P 1URBA 4KJGA 2VQRA 4LR2A 1O99A 3UN2A 3M8ZA 4QAXA 2D1GA 1ED9A 4NWXA 3NKQA 1Y6VA 1ZEDA 4UOOA 1ALHA 1ANIA 4LRCA 1Y7AA 1KH4A 1URAA 2IUCA 3NKRA 3NKPA 4LR8A 3TG0A 1EQJA 1N2LA 1KH9A 4LR9A 1K7HA 4FDJA 3OT9A 4TN0A 1ELZA 2G9YA 2W5VA 5IJSA 1ALKA 1ELYA 1O98A 1E2SP 5IJQA 4B56A 2GSUA 5L0KA 5GOVA 1HQAA 3Q3QA 3LXQA 1AJBA 3M8WA 3MK1A 5C66A 2IUCB 3DYCA 5EGEA 1E1ZP 1ALIA 4LQYA 5L0BA 2GA3A 1E3CP 2ANHA 1EW8A 4LRFA 2GLQA 3B5QA 1ZEFA 1ELXA 3UN3A 1KH5A 3WBHA 4LR7A 3T02A 1EJJA 1SHNA 4GTZA 4UPLA 3TWZA 3DPCA 4MIVA 3MK0A 1HJKA 4GTYA 2W5WA 1EW2A 4CYRA 1FSUA 4LRDA 4UOPA 3ED4A 4KAVA 4CXUA 1EW9A 1ZEBA 1ANJA 1KHLA 1KH7A 1KHJA 2W5SA 2ZKTA 4MY4A 2W5RA 5DLWA 4ZG7A 3UO0A 1P49A 1N2KA 2X98A 3UN5A 3BDGA 3BDHA 4GTXA 5LRMA 5GRRA 3E2DA 3WAYA 2GSNA 1KHNA 4GTWA 1ALJA 3UNYA 5LIAA 4KAYA 4LREA 3NVLA 5HRTA 3KD8A 3WAXA 1HDHA 3M8YA 5EGHA 4UPKA 3IGYB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LRB A;  4FDI A;  2QZU A;  3T01 A;  4ZG9 A;  1AJD A;  2W5Q A;  4KJD A;  4CYS A;  1B8J A;  1AUK A;  4KM4 A;  5AJ9 A;  4UPH A;  1AJC A;  1SHQ A;  3SZZ A;  2IFY A;  3MK2 A;  3SZY A;  4YR1 A;  4ZGA A;  1ED8 A;  4MHX A;  4CXK A;  3A52 A;  3BDF A;  3IGZ B;  2RH6 A;  4NWJ A;  5DLV A;  3BDG B;  3NKM A;  2W5T A;  5DLT A;  2GSO A;  2W8D A;  3T00 A;  3M7V A;  3CMR A;  5K4P A;  4ZG6 A;  5LRN A;  1EI6 A;  5INH A;  5TJ3 A;  3WAW A;  4N7T A;  3NKO A;  4UPI A;  3TX0 A;  2XRG A;  5L0E A;  3IDD A;  3NKN A;  2XR9 A;  5LQQ A;  2W5X A;  3WAV A;  4LRA A;  2W8S A;  4CXS A;  1KHK A;  1AJA A;  5KXA A;  4UOR A;  1E33 P;  1URB A;  4KJG A;  2VQR A;  4LR2 A;  1O99 A;  3UN2 A;  3M8Z A;  4QAX A;  2D1G A;  1ED9 A;  4NWX A;  3NKQ A;  1Y6V A;  1ZED A;  4UOO A;  1ALH A;  1ANI A;  4LRC A;  1Y7A A;  1KH4 A;  1URA A;  2IUC A;  3NKR A;  3NKP A;  4LR8 A;  3TG0 A;  1EQJ A;  1N2L A;  1KH9 A;  4LR9 A;  1K7H A;  4FDJ A;  3OT9 A;  4TN0 A;  1ELZ A;  2G9Y A;  2W5V A;  5IJS A;  1ALK A;  1ELY A;  1O98 A;  1E2S P;  5IJQ A;  4B56 A;  2GSU A;  5L0K A;  5GOV A;  1HQA A;  3Q3Q A;  3LXQ A;  1AJB A;  3M8W A;  3MK1 A;  5C66 A;  2IUC B;  3DYC A;  5EGE A;  1E1Z P;  1ALI A;  4LQY A;  5L0B A;  2GA3 A;  1E3C P;  2ANH A;  1EW8 A;  4LRF A;  2GLQ A;  3B5Q A;  1ZEF A;  1ELX A;  3UN3 A;  1KH5 A;  3WBH A;  4LR7 A;  3T02 A;  1EJJ A;  1SHN A;  4GTZ A;  4UPL A;  3TWZ A;  3DPC A;  4MIV A;  3MK0 A;  1HJK A;  4GTY A;  2W5W A;  1EW2 A;  4CYR A;  1FSU A;  4LRD A;  4UOP A;  3ED4 A;  4KAV A;  4CXU A;  1EW9 A;  1ZEB A;  1ANJ A;  1KHL A;  1KH7 A;  1KHJ A;  2W5S A;  2ZKT A;  4MY4 A;  2W5R A;  5DLW A;  4ZG7 A;  3UO0 A;  1P49 A;  1N2K A;  2X98 A;  3UN5 A;  3BDG A;  3BDH A;  4GTX A;  5LRM A;  5GRR A;  3E2D A;  3WAY A;  2GSN A;  1KHN A;  4GTW A;  1ALJ A;  3UNY A;  5LIA A;  4KAY A;  4LRE A;  3NVL A;  5HRT A;  3KD8 A;  3WAX A;  1HDH A;  3M8Y A;  5EGH A;  4UPK A;  3IGY B; 
#chains in the Genus database with same CATH topology
 2BJ8 A;  2CJK A;  4F3M A;  1NLK L;  1DQA A;  2N4C A;  3PG9 A;  3CJK B;  5A0Y B;  4AL6 A;  4UF4 A;  4DL0 C;  5D3G A;  1YSJ A;  3MDF A;  1IM6 A;  2XMU A;  1GXU A;  1Q1K A;  2CPJ A;  1FRH A;  5B0D A;  1QSY A;  1ZM2 A;  3RAM A;  4U95 A;  4EEY A;  4QYZ J;  3SZY A;  4YR1 A;  1HNI B;  3BGL A;  2UVV A;  1BC6 A;  4R0J A;  1J27 A;  4B9M A;  3POT A;  1WG5 A;  1MU2 A;  1KHW A;  2XCP A;  1HQU B;  3FFI A;  3NEK A;  4EBC A;  1TVR A;  4HH1 A;  2E7W A;  3CCM S;  3D0G E;  1JLA A;  4DQP A;  2E66 A;  2CUY A;  2OD4 A;  2RF2 B;  3MOZ A;  2J5A A;  5BYR A;  3CCS S;  3JB9 k;  3FUY A;  5D0E A;  2UUC J;  2ZD1 A;  4X62 J;  2DGT A;  4JBC A;  3UVJ B;  2NRE A;  4MMO A;  1R6Y A;  5K8N A;  4X4N A;  3OVS A;  1EET B;  3T5K A;  2ZOF A;  4HYK A;  4KO0 B;  3CSK A;  3HZE A;  4IKA A;  1Q5Y A;  2ACY A;  4TNO A;  2QZ8 A;  2H51 B;  1NSK L;  1CJV A;  4FN5 A;  2K3I A;  4TY8 A;  2JNJ A;  4ZPA A;  5AXL A;  1N36 F;  1QUP A;  4ICL B;  2GC8 A;  1Q86 T;  4LFA J;  4B17 A;  3RB4 A;  1B0T A;  1XR7 A;  2ZOM A;  1VOM A;  4RBT A;  1NK5 A;  2CQ4 A;  4F0H A;  4FF3 A;  4KJG A;  5KOX A;  4RW8 B;  5KT7 A;  3DRS B;  1IBK F;  4XAK A;  5ETM A;  5I42 B;  2BJ7 A;  2RKI B;  2YKP A;  1QLN A;  4I64 A;  2EFO A;  3I0R B;  3EPG A;  4NLU A;  7AT1 B;  4EYI B;  1S48 A;  2AYE A;  3K5L A;  4MKA A;  1B4S A;  4N77 A;  4PG6 A;  4PG5 A;  3HHE A;  3P45 B;  1T0T V;  2XC9 A;  1QY7 A;  2ZUA A;  2D7S A;  2ILZ A;  2G0I A;  4AT1 B;  3M9N B;  1M5V C;  2CQB A;  4LF5 J;  4WFB Q;  4HDH A;  1U26 A;  3IAM 9;  3OJU A;  4N76 A;  3HZG A;  4FXD A;  4K4T A;  3LF0 A;  3FEY B;  3TEG A;  2HND B;  3T5H A;  1RKI A;  1X5O A;  2RT3 A;  2Y1L B;  3ITH B;  3QGI A;  5IWA J;  2HHP A;  2V68 A;  4OHY A;  2JVO A;  4P71 A;  1ZET A;  1EP4 A;  3NP5 A;  3A8K A;  1Q5V A;  4UOG A;  3KHL A;  1WSV A;  2W2N P;  4CNY A;  4DCJ B;  4FYD A;  2YQ1 A;  2R9L A;  3DYC A;  3K57 A;  1F2G A;  2ZEJ A;  5H9F J;  3ISN D;  3S7R A;  3ZZR A;  1HBM A;  1HPZ A;  2VA3 A;  3N9U C;  1SV5 B;  3DLJ A;  1P8G A;  1WKJ A;  1WHW A;  3SCL E;  1J5E F;  2AW0 A;  4KAI A;  2NQP A;  4JI8 F;  5L1J A;  1PBU A;  1FJG J;  1X0P A;  3HVT B;  5FLX U;  3EYZ A;  2DNG A;  3DLG B;  3UI3 A;  3BDP A;  4L3K A;  4DWI A;  3DRP B;  1VC0 A;  1SHN A;  3R8Y A;  1XC9 A;  2IYI A;  4F2S A;  2MKY A;  4A48 A;  4F25 A;  1IKV A;  4KHR A;  3CPW R;  2HHQ A;  5IC6 B;  5IOL A;  4GC7 A;  2W5W A;  3BGR A;  2R8G A;  2FHM A;  3NG8 A;  3QID A;  3ZZP A;  3RR7 A;  2OPR B;  4ECZ A;  2ZHA A;  2QA4 G;  4QOT A;  4MK7 A;  1HA1 A;  2NXU A;  3WX4 A;  4FZV A;  4O0I A;  5KG2 A;  3NKO A;  2ALY B;  3AA9 A;  1TL7 A;  1VRU B;  2ZJR Q;  1TFW A;  3DM2 A;  3IBC B;  3GON A;  1RAD B;  3BV8 A;  4Y2C A;  4UW2 A;  3M32 B;  2MQO A;  2HS4 A;  2HQC A;  4S0M A;  1HR0 F;  1UL3 A;  2DNL A;  1EX8 A;  1ZOT A;  2BXJ A;  2LLZ A;  5LXR A;  1ULR A;  2VDH A;  1J5E J;  4KY3 A;  2FJB B;  4ILR A;  1M1G A;  3MMC A;  4OHZ A;  1H0H B;  1YJR A;  3U1L A;  3JAM U;  5E2Q A;  2HQ3 A;  1NKB A;  2DKO B;  4F67 A;  1OY9 A;  3JTP A;  5J1E A;  1FKA F;  5K8M A;  3KLV A;  2XG8 A;  2CPF A;  2YWF A;  3N5B A;  1VC6 A;  2WVE A;  2DEI A;  2V9K A;  3CC4 S;  3D1H A;  1S4E A;  2XZD B;  3LP0 A;  3BS9 A;  1EZZ B;  4KKO A;  4QIW D;  2B7C B;  5EX3 A;  4A4J A;  3T5L A;  1B8J A;  2JJ4 D;  3HLU A;  1A0O B;  1S0M A;  3IFE A;  4JI6 J;  3MGJ A;  2JFD A;  4LSN B;  4ED0 A;  1JLB A;  1RT5 A;  3NCR A;  3V4I B;  2MKJ A;  3JXO A;  5JXS A;  4E0D A;  1SH0 A;  2LMI A;  3A52 A;  1SL2 A;  2W1B A;  1AFJ A;  4AE5 A;  1MN9 A;  1NAQ A;  3C6U B;  3BSO A;  3NKM A;  1YJ9 S;  2E44 A;  2VPY B;  4PPZ A;  3W5X A;  1JLE B;  4DV0 J;  4WP3 A;  5F8N A;  4F4W A;  2O1P A;  3M32 A;  1GMU A;  5C42 B;  2FVC A;  4M5M A;  4NLV A;  1HWI A;  2Q3P A;  2C3M A;  3SSQ A;  4ZCK A;  5A2Q U;  5C24 B;  3G6E S;  2O3D A;  3CJ8 A;  4I69 A;  3TAQ A;  1R8A A;  3WAW A;  3PRD A;  3DN9 A;  4HI2 A;  4DQR A;  2E9T A;  3V6H A;  2JOQ A;  2OPR A;  5DZ6 A;  3GTY X;  1V3S A;  5ETQ A;  5BYS A;  3IDD A;  1C0T B;  1OJ4 A;  2MZT A;  1TUW A;  2VJV A;  1B99 A;  3JYT B;  2P8I A;  1TKX B;  2JLG A;  2WBR A;  2HWT A;  3D1O A;  2UVR A;  9ATC B;  5AT1 B;  3R1H A;  3DGV A;  2DXF A;  3LGH A;  3R5C A;  3U1N A;  4U96 A;  5K8P A;  3LAK A;  1LW2 B;  3V6J A;  3SMZ A;  4LFC J;  2XS5 A;  2BJ9 A;  4QR1 A;  3IMQ J;  3QO9 B;  1FO1 A;  3RGI A;  1NDC A;  2C2N A;  2O01 C;  1WKK A;  2XI2 A;  1RXO B;  3H98 A;  4WZM A;  1RT3 A;  2ERR A;  2YPZ A;  2HWH A;  4LF9 F;  3ITH A;  2Q6C A;  2HND A;  2DJW A;  5B09 A;  3MAH A;  1G4C A;  4RUB A;  1O98 A;  1TP7 A;  2M4M A;  1X4D A;  1AB8 A;  2DTJ A;  2GML A;  3SSR A;  2VQE F;  1N6Q A;  4ZJO A;  2APO A;  1RUS A;  2EFG A;  2V5H G;  2J7U A;  2C2K B;  1IBM J;  5L0K A;  2H5J B;  2HQD A;  2A6O A;  4B3R F;  1AJB A;  5BXI A;  2NLW A;  5KFN A;  2JEJ A;  2AMC B;  3FSX A;  1EAR A;  3I0R A;  1GFW B;  3NOG A;  1ROF A;  2B9W A;  3AQO A;  4NRT A;  1LFP A;  1RTI B;  2CPE A;  3RU0 A;  4KGZ B;  2RKI A;  3D68 A;  3JSM B;  5D15 A;  4KPY A;  3TUP A;  2I38 A;  3HHL B;  3JSB A;  1UPP A;  3MM6 B;  5ETT A;  3G6V A;  4ILM A;  2R7S A;  1S57 A;  1TMM A;  2I5J B;  2WCX A;  4OZ1 A;  3TNV A;  2GS8 A;  1VC5 A;  3MM6 A;  2DNK A;  2D74 B;  3OVA A;  1X4E A;  1TKT A;  1QTN B;  2L41 A;  1ZBT A;  2HHS A;  4ZVE A;  1UMJ A;  3BEG B;  2W4P A;  1S7I A;  3M1V A;  3VQS A;  2HBR B;  3FSI A;  2Y8W A;  4CT8 A;  1L3T A;  4O3P A;  6AT1 B;  3EDR B;  3CDW A;  3OTB A;  4XK8 C;  2DH7 A;  3FMB A;  2CPZ A;  1IVZ A;  1FK9 A;  4NX9 A;  2ZHO A;  5C25 B;  2IMW P;  2MKH A;  3NMR A;  1H2T Z;  3IS9 B;  2MLY A;  5GMD A;  3K59 A;  4GMK A;  1HFE L;  2YXL A;  5DGB A;  2YWW A;  1F2H A;  1JLA B;  1WEX A;  4NLR A;  2YNI A;  4KH1 B;  1RT3 B;  2I1R A;  3P8B B;  4FXV A;  2MQP A;  1A7G E;  1D9D A;  1K1S A;  2HNY A;  4ZOS A;  3FQL A;  4CLT A;  4YFU A;  4GTX A;  1DAR A;  4Q0B B;  4KFB B;  3UCZ P;  2PA3 A;  2ZWO A;  3MMB B;  5HRT A;  2NXE A;  2IRU A;  4DS4 A;  2AWZ A;  1UA0 A;  1SKU B;  5EGH A;  4OX7 A;  1P6T A;  1CG2 A;  3KMS A;  1ZAV A;  2RRA A;  2F8H A;  4NLP A;  4UUX A;  1P9Q C;  4EO8 A;  4YR2 A;  1KWM A;  1ICE B;  3N4W A;  1UWB A;  2F4V J;  2B4P A;  4K5R A;  1CC8 A;  1RK8 A;  2J9D A;  1AJC A;  3PEJ A;  3A3O B;  1CSJ A;  1S7H A;  2HS3 A;  3NKY A;  4OYW A;  2IM3 A;  4K4S A;  3JTO A;  1Y3J A;  1HNW J;  2AEF A;  2DY1 A;  4RL1 A;  1YVF A;  3MXH P;  4OV1 A;  1GXT A;  4DFJ A;  2HHW A;  3N6M A;  2RH6 A;  1U47 A;  3Q2T C;  4X66 J;  5T14 A;  3D6F B;  2LCW A;  3AFG A;  2XS7 A;  4K4U A;  4JOU A;  1Q95 G;  2H4Y B;  4Q2M A;  3IC1 A;  3DOM B;  3LP1 A;  4P10 A;  2D3O 1;  3C16 B;  2W8D A;  1Q53 A;  1S12 A;  1WHV A;  2H4W B;  3BYP A;  2HGM A;  4DR4 J;  4ZPD A;  3VAK A;  2VG6 B;  3QYY A;  3RBE A;  1ZYQ A;  2KVI A;  4DJB A;  1U1N A;  4B3O B;  1JLE A;  4JI3 J;  3KLF A;  2VZ9 A;  1H2V Z;  1JX4 A;  5DDQ C;  2RSQ A;  4YN3 B;  3NWR A;  4A8O A;  4ZIT A;  1CQM A;  1G3O A;  1VBY A;  2YKQ A;  4RW7 A;  3W2W A;  2LXF A;  4DN0 A;  2AGO A;  1GTH A;  1HBU A;  3UR0 A;  2DH9 A;  1CJU B;  4CH7 A;  2HHT A;  2IA0 A;  1RAF B;  4ZKA A;  2UU9 J;  4MH8 A;  3CE8 A;  4E98 A;  3MTK A;  4ETZ A;  3ET6 A;  1UVL A;  1Q78 A;  5H1S V;  1S4F A;  5D8H B;  2HGL A;  3EX7 B;  4D3H A;  5J1E B;  3VGV A;  3EGZ A;  4EZ6 A;  1RTJ B;  2KG0 A;  2G2Y A;  2NUU G;  2WVB A;  2GIR A;  2H1Y A;  4NLD A;  5HL7 Q;  2MZ1 A;  2CQ2 A;  1Q16 B;  2HFU A;  4X84 A;  3T9Z A;  3TG0 A;  2AZ1 A;  5B0A A;  4UY8 5;  2F9D A;  1M1H A;  4KT0 C;  3O8W A;  5JMN A;  2LA6 A;  3BGO P;  3DC2 A;  3M8P B;  1OSD A;  3R7S B;  3ZTO A;  3RW6 A;  1NBE B;  2MDA A;  3TI0 A;  5DDP C;  4NXN F;  2LQ9 A;  1FDB A;  2XCA A;  4F3O A;  3M2V B;  3KKF A;  2I9S A;  3W66 A;  3DLK A;  3QIP A;  1MN7 A;  1XK8 A;  4ZN1 A;  1XN9 A;  1RWX B;  3CJ0 A;  2QFJ A;  4Z2X A;  3GFH A;  4ZPV R;  3NNC A;  1RT4 B;  1TZ0 A;  4DPW A;  2EXU A;  4UST A;  5GOV A;  2NZ4 A;  4ECX A;  1U45 A;  5KT6 A;  2CQP A;  2K8G A;  4TU9 A;  1RT7 B;  3NGT A;  3PYG A;  4NLO A;  1NSA A;  4P74 A;  3ZZO A;  1UFL A;  1P1L A;  1RAA B;  1I94 J;  2IM2 A;  4URG A;  1RDR A;  3H40 A;  5IT9 Y;  2F40 A;  4NI2 A;  2XBP A;  3ENQ A;  4DSF A;  5I3P A;  1E3C P;  1X31 C;  3VAG A;  2BAN A;  2HLU A;  2QN6 B;  3I0S B;  3MFH A;  3HVT A;  3TA1 A;  1GK8 A;  1JIH A;  1GMV A;  1S9G B;  1WF1 A;  4DV0 F;  2KJV A;  1NEE A;  3FQK A;  1EAY C;  1GQE A;  3JSY A;  1ZTW A;  2CG8 A;  1RHR B;  5I3U A;  3N5F A;  2KYX A;  3QT6 A;  1HI1 A;  4P6Q A;  2QC3 A;  5E7O B;  2VD3 A;  4LF8 F;  3SCK E;  1DQ8 A;  1U2C A;  3TYT A;  3BB5 A;  1TUV A;  2B6A A;  4OX6 A;  3FRY A;  4CTA A;  1UJ5 A;  3BQ1 A;  4J9S A;  2U2F A;  4ZA1 A;  4I7F B;  1SC6 A;  1KVK A;  3PM9 A;  4MIB A;  3WX8 A;  5HMY A;  5M2R A;  1YJU A;  2MY8 A;  3MM8 A;  1XJW B;  4IO1 A;  2FLP A;  2BR0 A;  1HKA A;  2X3G A;  1QUV A;  2KT3 A;  4JI1 F;  4PUO A;  5LOQ A;  2AGQ A;  4XIU A;  3KHG A;  1IBC B;  1DJ0 A;  2P9E A;  1A6L A;  3KK2 B;  2AEM A;  2G13 A;  4Y65 A;  4M5G A;  2XLJ A;  2E29 A;  1IKW B;  1KDN A;  3SDE A;  3WQP A;  5A76 A;  4PUO B;  4FP9 A;  4LF4 J;  5GRR A;  1LW0 B;  1WHY A;  2CJB A;  2VQF J;  1FNO A;  2WSF C;  4P75 A;  2ZH6 A;  3QT7 A;  2GVZ B;  2OEL A;  2KVQ E;  4NML A;  1Y5N B;  2YKN B;  3DRS A;  4HLB A;  5HO4 A;  4V19 X;  4Q7A A;  3OHA A;  4RW8 A;  1HL6 A;  3TR5 A;  1F6T A;  1WF0 A;  2X1G A;  4B56 A;  2ZJQ Q;  2AZ3 A;  2OML A;  3IGY B;  4LBP A;  4NL5 A;  4U8V A;  1TKD A;  1UEU A;  3MD1 A;  1ZZN A;  4NYO A;  2F8M A;  2VA2 A;  4CTA B;  1YIJ S;  2R42 A;  1KON A;  3FBF A;  2NCK L;  4P9S A;  2EK1 A;  1SQE A;  5T41 A;  4N41 A;  2IFY A;  4MHX A;  3T6B A;  2DH8 A;  2Y8Y A;  5F41 A;  2RIL A;  5KG4 A;  1RJJ A;  4WKY A;  4HDG A;  3PEH A;  2IC3 A;  4AND A;  4KYZ A;  2ZD1 B;  4X4Q A;  3P3D A;  3PYE A;  4J9M A;  1RB0 A;  2X51 A;  4OZL A;  4ZP7 A;  5T7L A;  1X4B A;  2AX1 A;  3OXL A;  2V2V A;  3M7V A;  1KRP A;  2FY8 A;  2VV5 A;  5LL6 d;  2ROG A;  3TX8 A;  1JJC B;  2KU7 A;  4JI1 J;  1HWK A;  4KBI A;  3HJV A;  4X4V A;  2D1G A;  4P73 A;  4DLE A;  3NAH A;  4JI5 J;  3ZZT A;  1JMT A;  2XSJ B;  1LWF A;  3I82 A;  4QWC A;  4OI0 A;  1NPP A;  2MXY A;  3H59 A;  2AF6 A;  5KAK A;  3K5P A;  1YJ7 A;  2IDE A;  1U25 A;  4DV5 J;  1SJ1 A;  3O2I A;  3UDL A;  4JI2 F;  4K4W A;  4O3O A;  2ZNZ A;  4TYB A;  3ZTR A;  3D2W A;  4B3S J;  2A1B A;  3FRZ A;  3OFG A;  4RW4 A;  5KXA A;  4YEA A;  3J7A 1;  3K17 A;  3M8P A;  5HP1 B;  1QAY A;  3THP A;  1FWL A;  3HF5 A;  4ZDN A;  3EVO A;  4RU9 A;  4RR5 A;  3L7P A;  1AZS B;  4ZVO B;  2BX6 A;  3KK3 A;  5B0F A;  3NKQ A;  2UUW A;  3R5G A;  4NWB A;  1SH3 A;  2FHJ D;  1DY3 A;  1FER A;  2GMH A;  5A6W A;  4ED4 A;  5GAD I;  4Q43 A;  1IUJ A;  1DBD A;  2XI3 A;  3KLH A;  2J0W A;  2RDD A;  2Z2Y B;  8AT1 B;  3NS5 A;  1KH9 A;  2HK2 A;  1MNE A;  1MW7 A;  3SI8 A;  3CD7 A;  5HLF B;  1PC4 A;  3WIV A;  3LAL A;  5KT3 A;  3I4H X;  2HSE B;  2CZ9 A;  3BH7 B;  3FEZ A;  2NR0 A;  2J7W A;  1EB0 A;  3ADA C;  5IJS A;  1NHU A;  2WON B;  4IH6 A;  4W98 A;  3UCU P;  4X65 F;  1FFW B;  2QV6 A;  3I6P A;  1NME B;  3CT9 A;  2J76 E;  2VBX A;  4PXD A;  4CI0 B;  2W9C B;  5HMZ A;  5KFL A;  3K8V A;  2MLX A;  2FVS A;  4ANE A;  2KZM A;  5IT9 U;  4H4O B;  2VOP A;  1TV6 A;  2B6A B;  1Y11 A;  3EVM A;  4L76 A;  4JI5 F;  2FHO B;  1DUR A;  1RBO B;  1YWX A;  1BQX A;  2DIT A;  3ILO A;  3W62 A;  2FVP A;  5EGE A;  5C66 A;  1VQ5 S;  2IYG A;  3W9H A;  1HBO A;  3ZC4 A;  2B4U A;  1FHT A;  3NL0 A;  4MT1 A;  1FD2 A;  1VFJ A;  1SQG A;  3OL8 A;  2H5I B;  3D5M A;  4ELU A;  4OJG A;  1FEE A;  3EGN A;  5A6P A;  2RH3 A;  2CDR B;  1JJ2 R;  1KD1 T;  3TJ8 A;  4I67 A;  2FZC B;  1U02 A;  2W9B B;  2L3M A;  2CNO B;  3C15 B;  3DPC A;  2A2D A;  3I9Z A;  4LBI A;  5L1I A;  1IBM F;  2YX7 A;  3F44 A;  3A3P B;  3GR1 A;  5ETS A;  4DUY J;  4PWD A;  2ZBP A;  1PCA A;  2MTL A;  3D1Q A;  3GV5 B;  1JK9 B;  1MG7 A;  1DFD A;  4ID5 B;  3VZH A;  1ZEB A;  4B9S A;  3ICL A;  3DDI A;  4N8O A;  4WIQ A;  3PR5 B;  3MUV P;  4HR2 A;  3G8S A;  2XNR A;  4HKQ A;  4WKR A;  2DNR A;  1U1L A;  4KFB A;  3CME S;  1WC0 A;  1FRM A;  3GP9 A;  4O44 B;  4DX7 A;  1XMO J;  4QU6 A;  2HVH A;  3NY0 A;  5A8W A;  4HHH A;  4MAK A;  3K5O A;  5EX0 A;  1PBA A;  3D3C J;  1VIS A;  1CJT A;  1YRX A;  1S6P A;  1GH8 A;  2Y1J A;  3VVU A;  1BLU A;  3KLI B;  5IQQ A;  2H65 B;  2A3J A;  4IR1 A;  2GFF A;  1I51 B;  1S6O A;  4Q8F A;  3GV8 B;  2GSN A;  4QBU A;  4MYU A;  2HZC A;  2UXD F;  4RJV A;  3V81 B;  3HKW A;  5G0R B;  2ZBC A;  2FVQ A;  3PO4 A;  4WF9 Q;  2DY9 A;  2DHA A;  3PFO A;  1CJK A;  3R5A A;  3VQT A;  4CQ1 A;  4UZC A;  3GWC A;  1I1G A;  2CQ3 A;  3AD7 C;  1XMB A;  2M2B A;  5F0U A;  4LF2 A;  2Q43 A;  3BRE A;  4CYS A;  4ID8 A;  2GIF A;  5DO2 A;  4DV2 F;  2B0G A;  3SSS A;  1X9M A;  3M1V B;  3QWU A;  3SZZ A;  4DR1 J;  4CO1 A;  4PRF A;  4DMZ A;  2WAQ D;  3B78 A;  1KBR A;  1FES A;  3MMA A;  4IG3 B;  1FWK A;  1D8Z A;  2F4F A;  4NEZ A;  5J2N B;  3S8S A;  4NWJ A;  1TK5 A;  3K89 A;  3FZB A;  2V50 A;  4J9P A;  3OLA A;  2WW8 A;  4I0W A;  4I2Q A;  3T00 A;  3QNW B;  5KG7 A;  1H74 A;  4ZLJ A;  2I0X A;  2IM0 A;  2K1R B;  2BOA A;  2YNF B;  4HI1 A;  3DCA A;  1XMO F;  5INH A;  1KLN A;  3Q8V A;  2PE8 A;  4FNH A;  4DCP B;  2OTJ S;  2VDI A;  4KQZ A;  4U6P A;  1SL0 A;  2OKQ A;  4W92 B;  3Q89 A;  2E1M C;  3MAQ A;  3GSD A;  3NBP A;  2KZZ A;  2CJY B;  2IAJ A;  4CM2 A;  4HT5 A;  2V4J A;  4ECV A;  1T9X A;  3FDS A;  4YP3 A;  2FJW A;  1SXL A;  2RU3 A;  4EBE A;  2W5X A;  1RZM A;  1AA1 B;  1RWM B;  1U0S A;  2MHN A;  3CDE A;  1HAR A;  1SJR A;  4Y2I A;  2EKY A;  4JV0 A;  3BH6 B;  2PGC A;  4XPC A;  3I32 A;  4DUZ J;  4QR0 A;  2FJX A;  3A12 A;  3D3B J;  3M8Z A;  4GVL A;  3Q86 A;  2EI5 A;  5E33 A;  1HNV B;  3RRH A;  5IFM A;  4RNM A;  3MR3 A;  5F8M A;  1R8B A;  4Q0B A;  4YY3 J;  3CMQ A;  1TMJ A;  2HNY B;  3M8Q A;  4LR8 A;  1D3W A;  4USV A;  3CB4 A;  3J7A N;  4NZ6 A;  3HFV A;  2B3T B;  2YNI B;  4X4S A;  1JLQ A;  5EWE A;  3G4S S;  1RP5 A;  2UXB F;  1XMQ F;  2KL8 A;  2P9G A;  5CAB A;  4F8R A;  1N34 J;  3W9I A;  3GV7 B;  3QGG A;  2FZG B;  2IAJ B;  1ZA1 B;  3M30 B;  2GSU A;  4PCQ A;  1XWL A;  3RG6 A;  1AW0 A;  4O3Q A;  2MZJ A;  1VQK S;  4URQ U;  3O1L A;  4OJH A;  3MWB A;  4CO0 A;  2COL A;  5L38 A;  1GXL A;  2K1R A;  2HEK A;  4QIE A;  4WXW A;  5HSP A;  2RML A;  2VL1 A;  1RAE B;  5C42 A;  1VLO A;  2GLQ A;  3PW5 A;  1MWY A;  3MEE B;  1GEH A;  1LKZ A;  1XIQ A;  1VQ8 S;  1Q8K A;  4DPT A;  3OR2 B;  1FWP A;  3R6G B;  5KFD A;  4IG3 A;  2WSE C;  4JV5 J;  5E0O A;  2CQI A;  3UDC A;  1HIY A;  3G82 B;  4QWD A;  5EUH A;  3LWL A;  2UUA F;  3HUL A;  2BEF A;  1XER A;  1IKX A;  3IWL A;  4W90 B;  5M2P A;  2HK3 A;  1T02 A;  5D4O A;  1S1T A;  2Z56 B;  1XR5 A;  1FNX H;  1F0X A;  4OHW A;  4M94 A;  3ED4 A;  2V2Q A;  1FKO A;  1X4C A;  3ISN C;  3PW4 A;  1UEV A;  1JKH A;  4ED7 A;  5G0R A;  4H54 A;  1BQN B;  1P9Y A;  5CYQ B;  3UO0 A;  1HWU A;  2F65 A;  1OMS A;  2KI2 A;  4NLT A;  2JX2 A;  2CPX A;  3AHP A;  3S01 A;  3R7N B;  4YB5 A;  5BYQ A;  4RNN A;  2DXD A;  1RGV A;  4JB8 B;  4D3G A;  1NM2 A;  3CCJ S;  2GO8 A;  2XNQ A;  4OX8 A;  1G2E A;  4WFA Q;  1LW2 A;  3CTR A;  5J2M A;  3KJV A;  2QLJ B;  2FTR A;  1UVK A;  1KP6 A;  2G1D A;  3BM7 A;  3O3L A;  1IWG A;  4OZ0 A;  3IN5 A;  3M8Y A;  4J9Q A;  5L9N A;  2K3K A;  4ECY A;  4DX5 A;  3Q8P B;  1IKY B;  4DZD A;  2RS8 A;  2JSX A;  3BGR B;  3RR8 A;  1T9W A;  5D78 A;  3MR6 A;  1JNZ B;  1NZA A;  3Q83 A;  3BO2 A;  1SHQ A;  1ED8 A;  4F26 A;  4DXL A;  4CXK A;  4H4K C;  3Q0A A;  2CZ4 A;  4AXJ A;  3MAA A;  4OX9 F;  4X64 J;  1K44 A;  2DNH A;  3BKT A;  1E6V A;  2XQC A;  4LF4 F;  2W5T A;  5J2Q B;  3ZZ0 A;  2QO3 A;  3WC0 A;  2XMM A;  3KNA A;  1S1V A;  4LJM A;  2JEG A;  2LFV A;  2XGP A;  1O0P A;  4ZG6 A;  1OYD A;  2XMV A;  2AHO B;  5A8K B;  2J0X A;  3T1H J;  3TAN A;  3W61 A;  1K8A T;  1FRK A;  2XHC A;  1Y00 A;  3GYG A;  1AT1 B;  2IRX A;  4IFY B;  4A47 A;  1Y9O A;  2VG5 B;  3MCO A;  2ZZM A;  4B3R J;  4Y2K A;  1QVF R;  3UDE A;  4J9N A;  2BJE A;  2GAG C;  3KDO A;  1FA0 A;  5HVF A;  6FDR A;  3IG1 B;  2ZFH A;  4CLS A;  1NJX A;  1LNQ A;  4NRU A;  5KG1 A;  1TFY A;  2CPY A;  3FCH A;  3B82 A;  3WHI A;  3DFE A;  1VJQ A;  2V2K A;  3N28 A;  4KKO B;  1FE0 A;  4DR3 F;  2B51 A;  4RW9 A;  4WK1 A;  4WWS A;  1BGX T;  2GO9 A;  3H2V E;  3T1Y J;  3OSP A;  1BE4 A;  2KDO A;  5L39 A;  2ADB A;  4WU2 A;  3W9J A;  5FDL A;  3PJ9 A;  1ED9 A;  4NWX A;  3Q8Q B;  2C3P A;  1ZS6 A;  2K7J A;  2HFS A;  4UOF A;  1ANI A;  1RA7 A;  3GG0 A;  1X4F A;  2QA1 A;  2VFT A;  3EM1 A;  2ASL A;  1L3U A;  3H90 A;  2HZV A;  1S49 A;  3NKP A;  3ILI A;  2OIH A;  1M1K T;  4EBD A;  1QTM A;  4F50 A;  1IXK A;  1WOS A;  3CD5 A;  3FBC A;  3PNI A;  4RW4 B;  4ZCL A;  3TO8 A;  2PI5 A;  2NXJ A;  3A8E A;  4BWM A;  4Y3C A;  4R8U A;  1RT1 A;  2LEC A;  2W5V A;  3PW7 A;  2ZC4 A;  5IWA F;  4JI2 J;  2YNG A;  1ELY A;  3TUJ C;  4CRJ A;  2AKW B;  1N88 A;  2OTL S;  1RI7 A;  1TL5 A;  1C4A A;  2BAB A;  1OPZ A;  3DNC A;  2GJI A;  1WUU A;  3VVT A;  3CED A;  1RWU A;  2HKE A;  2RUG A;  1T03 B;  1I6J A;  3CC7 S;  3H5Y A;  1TVR B;  2BE2 A;  5HQ8 A;  2ZH8 A;  3WC2 A;  3OQ2 A;  4CLK A;  1PIL A;  1MU2 B;  3E51 A;  2OEK A;  3IRX B;  4CO4 A;  4DPO A;  3GR0 A;  5KFV A;  2LDY A;  2JRS A;  1HBM B;  1Q8I A;  2F9J A;  4F7V A;  5DQH A;  4ZVQ B;  2DGX A;  3PRV A;  5ETP A;  4C2M A;  3J7Y U;  4ELV A;  2BRK A;  2W2Q P;  2UV8 A;  4TN2 A;  4CLU A;  5K20 B;  5ETO A;  2BM0 A;  2CRL A;  2MMY A;  2XMW A;  3AOB A;  4Y00 A;  1EP4 B;  2XB2 D;  2FHK A;  2GHV C;  3KFW X;  4FBT A;  4LF6 F;  1JB0 C;  4YDD B;  3FEX B;  1K9M T;  2DO4 A;  4CLP A;  4MK8 A;  1VCT A;  3AT1 B;  2R7T A;  3LQV A;  4FF1 A;  2ASY A;  1HD0 A;  1U0H B;  2LP4 A;  4ZJQ A;  2ZKU A;  5AXN A;  2HUR A;  3KHR A;  1TL4 A;  1R0C B;  2BAC A;  4RW6 B;  1N56 A;  2W7P A;  2M7S A;  3FSY A;  4PZV A;  4U8Y A;  4CO5 A;  2XGQ A;  1NDP A;  1IKW A;  2RB7 A;  3KYL A;  1OY6 A;  1H73 A;  4ZHR B;  1VQN S;  3F41 A;  2R7U A;  1NHK L;  2W7O A;  8RUC A;  1DHM A;  3CO9 A;  3M2U A;  4PWW A;  1ZZF A;  2UUB F;  1T94 A;  1Q7Y T;  3HSG A;  5LRM A;  2RDI A;  3UW1 A;  2MQQ A;  5KFK A;  4OYI A;  1UPM B;  3VZI A;  1UW9 A;  2HBY B;  2X3D A;  3DRX A;  2P6S A;  3J7Y I;  4Q44 A;  3OR1 A;  2W9A A;  3AB2 B;  2YKO A;  3MM8 B;  4KB7 A;  3PHT A;  1DTQ A;  2NXN A;  2C2E A;  4KHP J;  2EG1 A;  4CWB A;  2RE1 A;  1YJV A;  5K5M A;  3IWX A;  4DV4 J;  4Y2M A;  4X65 J;  3C19 A;  5F3Z A;  1EKR A;  1BMQ B;  1LWX A;  3A4T A;  3DGP A;  3BGU A;  3RW7 A;  4DV6 J;  4PYA A;  3HT3 A;  1OY8 A;  4MK9 A;  4P2X A;  2CPH A;  2G9O A;  3QSI A;  3NRB A;  3TA0 A;  4OI2 A;  1FF2 A;  5KFA A;  3HCX A;  3VWS A;  3S1T A;  5JVG Q;  5KFX A;  1H6K X;  1LWE B;  1B0P A;  3LP2 A;  2LQ8 A;  3SCI E;  3DDK A;  5KFU A;  2E9R X;  4ANC A;  1FNM A;  4HEA 9;  2R2T A;  1W7W A;  2ZVI A;  4M95 A;  2B5J A;  1RBL A;  2BJ1 A;  4BS2 A;  2J8S A;  2QL5 B;  3MPD A;  4DQI A;  5HVH A;  1C2P A;  1T05 B;  2N7C A;  1KFS A;  2DK2 A;  3HX9 A;  3TX0 A;  2L48 A;  4BLG A;  3OTO J;  2D3O R;  3Q22 A;  3OVB A;  4IRD A;  2V63 A;  3HFK A;  2XR9 A;  1CPZ A;  5HAT A;  3D6T B;  3DLK B;  3QIP B;  4NYP A;  3QWP A;  5DDO C;  3BO4 A;  4DV3 F;  1YHQ S;  3MPU B;  2AQ4 A;  4H4K A;  5HI7 A;  3DRY A;  2E1A A;  3AJD A;  3KXD A;  4F36 A;  1VJW A;  4NA1 A;  4WYW A;  3NWG A;  4C0O C;  2DHX A;  2GHP A;  5EDW A;  2XO7 A;  1DLO A;  4LSL B;  4UOH A;  1YRT A;  3UN2 A;  1MSW D;  1CUL B;  1WC4 A;  4A8Y A;  4ED1 A;  1SKW A;  1C0U B;  1C4C A;  4DS5 A;  5LMN F;  3LUY A;  2B4O A;  4ENO A;  3I87 A;  1K0T A;  3EZU A;  4CO3 A;  4M5N A;  4LF7 F;  4L3N A;  3R9L A;  3P5T L;  3TUI C;  4ZK7 M;  5HN0 A;  3C66 A;  2E5J A;  1UFK A;  2YNH B;  2FLN A;  3RB6 A;  2EBG A;  1WC6 A;  1JJH A;  2YBV A;  4OYM A;  4CO2 A;  2KFY A;  1HBU B;  2FYX A;  4IUF A;  1VBX A;  5DGA A;  4AL5 A;  5IC4 B;  1PO6 A;  1W2I A;  2Y1R I;  1S1W B;  1KKH A;  1HHS A;  4DL2 A;  2EC0 A;  1YBT A;  4ZPB A;  2ZH4 A;  3PZP A;  2XY6 A;  2MJN A;  2IUC B;  3OR1 B;  2VG6 A;  4Y28 C;  4CZC A;  1ZH5 A;  3LWM A;  2IY5 B;  5L0B A;  3M8S A;  4J5O A;  1V3R A;  1B70 B;  2OD6 A;  2AJ4 A;  2QFI A;  4LIR A;  3MEC B;  5A8R A;  4R5P B;  4LFC F;  4QYZ K;  4MKV A;  2H3E B;  2QIF A;  2CKW A;  3H5U A;  4X66 F;  3KK1 B;  4YOE A;  2XZT B;  3HJF A;  1FXD A;  1M5S A;  1N54 B;  1OS5 A;  2Y0B B;  3HHL C;  4RWX A;  3R97 A;  4WXO A;  3TOQ A;  4A8X A;  3ELH A;  4AD6 A;  4DOZ A;  2C42 A;  4EO6 A;  3I55 S;  1HNX F;  1KEK A;  1WC3 A;  4A8S A;  1CQN A;  2RQM A;  1F60 B;  5L9X A;  3MK0 A;  3L9Z A;  4NCG A;  4JI4 J;  2J0S D;  2MB0 B;  4LRD A;  1RWP B;  1VQY A;  3ZO7 A;  2ROP A;  4CDI A;  5KG5 A;  2DIS A;  4KAV A;  4QJV A;  2W4D A;  4OHX A;  2Q79 A;  3BR8 A;  6FD1 A;  2LYV A;  1WOR A;  1RTD B;  4RUA A;  5DJB A;  3T6J A;  1FTR A;  2HQI A;  2DXE A;  1KSP A;  4OI3 A;  4NLY A;  4RZR A;  1T9V A;  1O8B A;  1WNE A;  1RU2 A;  3PYF A;  1QM9 A;  2VPX B;  4QYR A;  3J80 Y;  1N5Y B;  1N0V C;  1HQE A;  3UD4 P;  3MEG B;  1VQ9 S;  1S9E A;  3IR5 B;  3BDG A;  2C2M B;  3KLG B;  2UVU A;  1X60 A;  2HYI B;  4K4Z A;  1KHN A;  2R7W A;  3OHB A;  1SL1 A;  1R0A A;  3QLH A;  1I94 F;  4FYV B;  4GKJ J;  2DR5 A;  4LFB F;  4O23 A;  2MYF A;  3M6W A;  5C25 A;  4I2P B;  3ZTP A;  3MHY A;  1FK9 B;  4KJI A;  4QPT A;  4LRB A;  4MKB A;  1Q7L B;  4ZPT R;  3QRQ A;  5CYJ A;  3CVK A;  1TEL A;  2P5V A;  3FBE A;  4QZV B;  2OLW A;  3AA8 A;  3HMJ G;  1YBA A;  4P2S A;  3M9O B;  3N01 A;  4IYQ A;  1P27 B;  3D28 A;  1HNX J;  3SV4 A;  4TVA B;  4RWW A;  2P2C B;  3NGK A;  1S1U A;  1CS4 A;  3G87 A;  4LIW A;  4K4X A;  2FLL A;  2R8K A;  2UUA J;  1RT6 B;  3KLE A;  4FF2 A;  1WC5 A;  1WKL A;  1KOH A;  2D3U A;  2OEM A;  3IR7 B;  3ULH A;  4WZQ A;  2ZBI A;  3W65 A;  3DLL Q;  4CCH A;  4JI3 F;  4DDF A;  2UV8 G;  3L09 A;  5FD1 A;  2L08 A;  1CBK A;  3AQP A;  3WZ0 A;  4J9U E;  2H54 B;  4WFX A;  3HHK A;  1V6H A;  2QE5 A;  4YQW A;  5D4N A;  2MKS A;  2XTJ P;  2PC6 A;  4BCA A;  5L0E A;  4DG1 A;  2WBM A;  1NCL A;  1NRK A;  3CD0 A;  2LU2 A;  2PI4 A;  4USI A;  5C5J A;  3E8O A;  1RAG B;  3DMJ B;  4Y2A A;  4YHH J;  3H8Y A;  4EUV A;  5B7W A;  1SJQ A;  4ZCM A;  1C1B B;  1N32 J;  4CXS A;  1N34 F;  4U7U D;  2B9E A;  3JSR A;  2QYG A;  3TVK A;  3BN4 A;  4YS2 A;  1V3Z A;  2VG5 A;  4M5D B;  1IN0 A;  4USW A;  4UOR A;  4KIA A;  3D54 A;  2HQF A;  5GAE U;  1BWV A;  1S1X A;  3TP2 A;  4WBF A;  3PW2 A;  3QO9 A;  2KG1 A;  1ZED A;  1NSP A;  3BBB A;  2QMX A;  2ZOG A;  4LRC A;  1LWC B;  2OPQ A;  4Q8E A;  1URA A;  2HHX A;  3O6Q A;  2HMI B;  5HMW A;  1DAX A;  3DOL A;  1LK7 A;  4AYB D;  1W2B R;  3BF4 A;  2ADC A;  1B3T A;  4DUZ F;  1UAW A;  4RBU A;  1QAI A;  2YWH A;  5E3A A;  1GMW A;  2FPH X;  4N8N A;  3BR9 A;  5C7P A;  5DQG A;  4PEO A;  2R2S A;  1NKC A;  2GMJ A;  3ENW A;  4EWT A;  2QL7 B;  4OI1 A;  4KHM A;  1WTF A;  4K8R A;  2XM3 A;  4FYY B;  1SJ4 P;  1XNR J;  2X1A A;  3O5T B;  1VYA A;  3DYA B;  1MLA A;  3CMA S;  3OFH A;  4USJ C;  3EPI A;  3EMT A;  2DR7 A;  3D4J A;  3RB0 A;  2CZV C;  4L75 A;  2I6W A;  3TRG A;  5ITH A;  2WK4 A;  4F0M A;  2HHH J;  5J2M B;  4RNH A;  2DPI A;  4ZN3 A;  1X9S A;  3AD8 C;  3W60 A;  1JLC A;  4RPF A;  2QLF B;  1QJH A;  2NXC A;  3GJT B;  3NCP A;  3PYD A;  4O4G A;  3L3C A;  4EK2 A;  5CAA A;  1S1X B;  4P7V A;  4BC9 A;  1R27 B;  2HVI A;  2HNZ A;  1FDN A;  1MML A;  4ZLL A;  4WFN Q;  4J37 A;  3PIP Q;  2OUG A;  2RQK A;  2Y1I A;  3IXQ A;  1Y0H A;  2BW2 A;  2VHG A;  2RU9 A;  1J5O A;  1DZ5 A;  3TWZ A;  3RZA A;  3GMG A;  5GAG I;  5F8J A;  2EWH A;  1TAU A;  4UQT A;  2OP5 A;  1EJ7 L;  3AJ1 A;  1OQ6 A;  2ZM6 J;  3GZ7 A;  3BBF A;  3UR3 C;  5J2P B;  3GSI A;  5HVG A;  1D1U A;  3IO1 A;  4LF5 F;  3N6N A;  3KNG A;  1ANJ A;  2DGV A;  4TQS A;  4GKK F;  1TL1 B;  4I4B A;  2LEA A;  2ZKT A;  3BDE A;  2AYM A;  1YGY A;  2MEW A;  2VG7 A;  5I4M A;  5KFO A;  3J7Z 5;  4K4Y A;  1RWW B;  4ZG7 A;  2R7O A;  2CXE A;  5KG0 A;  3HP6 A;  2GNK A;  3LGM A;  1VQP S;  3KLE B;  2XMT A;  3LGN A;  1H3D A;  5KFP A;  2B43 A;  1HR0 J;  2DHH A;  3M2R A;  4OZN A;  2G4B A;  1G1X A;  4LF1 A;  2BYC A;  4ES3 A;  5C2C A;  2FB0 A;  1JLC B;  4BWJ A;  5D77 A;  4ZIW A;  2ZHB A;  1BXN A;  3DM2 B;  1T8E A;  3R27 A;  1RTZ A;  1L5U A;  3NVL A;  1F1B B;  3L95 X;  2KHC A;  4ZP6 A;  4OIX A;  1URN A;  2FGC A;  2F63 A;  4WJB A;  2AGP A;  1B7Y B;  1U1Q A;  2DRA A;  4KJD A;  2UZA A;  5J1N A;  4Q5V A;  4EYH B;  1Q79 A;  1RHJ B;  2OJ3 A;  4I2P A;  2W5Q A;  4DN9 A;  4ECR A;  4G3I A;  2VON A;  3M30 A;  3R6L B;  3SEO A;  3EVW A;  3EXY A;  2B8P A;  5SUH A;  3BO3 A;  1TQL A;  3TQ1 A;  2VOD A;  4WCE Q;  4KM4 A;  2C1E B;  2PEH A;  4C8M A;  4KHP F;  1V5V A;  4IOC Q;  3BDF A;  5AE2 A;  1U49 A;  3J81 j;  5ETL A;  4B9L A;  1MRO B;  4OJ3 A;  1MWQ A;  3MEG A;  1CLF A;  2GSO A;  4F2R A;  1ZAW A;  1GTE A;  1PYS B;  3M8Q B;  4PXB A;  3SQO P;  3W63 A;  4XPE A;  1N5Y A;  2IBO A;  1U48 A;  2QEX S;  3CJ5 A;  3KG4 A;  3CMR A;  1KQK A;  2FJA B;  3DDN A;  3PJX A;  1REV A;  2JH3 A;  5CA5 A;  2V9W A;  5TJ3 A;  4YUD A;  1VRT B;  2J6T A;  3C46 A;  1D9F A;  4O3N A;  1TKZ A;  3NLC A;  4J9L A;  2XRG A;  3CNQ P;  4DV1 F;  3SQG A;  4DQQ A;  1TK8 A;  4NCG B;  3OLB A;  2DHS A;  4ECT A;  5GAD U;  3CUN A;  4LF6 J;  5CH7 B;  1ZM3 A;  3R2D J;  1DTT B;  4KSE B;  1J2V A;  2O66 A;  3GYN A;  1VR6 A;  3OW2 R;  2B56 A;  3KUG A;  3DXS X;  2CQG A;  2OI2 A;  3JQK A;  2H5E A;  3MED A;  3GYX B;  2VIC A;  2CDQ A;  4XDD A;  5A8R B;  3NCQ A;  4GO7 X;  3G6X A;  4NXN J;  4QAX A;  3LPY A;  3T1A A;  3V5R A;  1L3V A;  1U6B A;  1FJC A;  1WEY A;  3CXC R;  1WDD A;  5BR8 F;  1FKP B;  2DGU A;  4QW9 A;  2ZH9 A;  3NKR A;  1IR0 A;  1N2L A;  2FVR A;  4HAC B;  4ZVT B;  4DR7 J;  3GFZ A;  5CYM B;  2XHW A;  1WTB A;  4L73 A;  1HHQ A;  2BW7 A;  2DCL A;  2MZQ A;  1C1C A;  3IR6 B;  9RUB A;  4OL8 A;  4W4M A;  3CJQ A;  1WJ9 A;  5ETN A;  3CC2 S;  4DV4 F;  2ABY A;  1SKR A;  3CDU A;  4YME A;  4KC5 A;  3NXZ A;  5KFC A;  2NUH A;  4QIF A;  2DNZ A;  3J80 U;  1HQA A;  1RTH A;  1YDL A;  4ETX A;  4C11 A;  1CJK B;  2GQ2 A;  1N8R T;  1PJ5 A;  2U1A A;  4R0E A;  3QSY B;  1ARO P;  4OMF G;  2D69 A;  3U27 A;  1S10 A;  1X4G A;  1UET A;  1WEL A;  1RYR A;  1UVM A;  3PJW A;  2E7V A;  3HM9 A;  3FFI B;  3EZ5 A;  1DLO B;  4LSL A;  3MCN A;  1S9E B;  4WE1 B;  4M1K A;  4RKU C;  3IWN C;  1RT2 A;  2FUG 9;  1HQE B;  5LM7 E;  4Y34 A;  5A8W B;  1KH5 A;  2AX0 A;  1HNI A;  3IGN A;  3MPW A;  2PEB A;  3C14 A;  4F4Z A;  3SYZ A;  3HHL D;  3IAS 9;  3L4B C;  3MTJ A;  2DO0 A;  4DR3 J;  3RB3 A;  3NNH A;  1U4B A;  5D3G B;  3LAN A;  4B3M F;  2E1P A;  2R2R A;  1RTD A;  2YWG A;  1XNR F;  1RAB B;  2A0F B;  4ZP9 A;  1TTH B;  3KMQ A;  4UOP A;  1WOP A;  1FFG B;  1ZM4 A;  2BKN A;  2ZE2 B;  3MUM P;  5HJY A;  3E3X A;  3V81 A;  2KHD A;  1REG X;  3QAU A;  4M63 A;  4ZVG A;  3T01 A;  3J81 Y;  2KRB A;  1YZ7 A;  2Y9H A;  2JEI A;  1QE1 B;  2GJ2 A;  1QVG R;  1CC7 A;  2UXB J;  2W9B A;  2IVY A;  1OQ3 A;  4QWA A;  2OPS B;  1X9W A;  2M70 A;  3FCW A;  2M5Y A;  1WWH A;  3RRK A;  3MUT P;  3MZI A;  1HBN A;  3A13 A;  3OPK A;  2H48 B;  1N2K A;  1F3V A;  2KB2 A;  2C28 A;  5DG8 A;  3DHX A;  2NSC A;  4ALZ A;  3ZNU A;  1R8P A;  4L74 A;  4WU3 A;  3MFI A;  3F73 A;  2Z58 B;  1TK0 A;  1KNZ A;  3FMW A;  3R2C J;  4K0K F;  3E2D A;  2E1C A;  4IOB A;  1RLD A;  5DG9 A;  7FD1 A;  2XO6 A;  5DLF A;  2C2D A;  3DLE A;  2PMW A;  3KD8 A;  3SCJ E;  1VBZ A;  3MR7 A;  3WAX A;  1U1M A;  4UPK A;  1W26 A;  1RWO B;  2IDL A;  4MFB B;  1U7L A;  1F9H A;  4ZG9 A;  2BE9 B;  2PA8 D;  2FZK B;  1S1W A;  4FNI A;  4MFB A;  2GVD A;  2A6M A;  2N7Y A;  2HRY A;  2WON A;  3A8I A;  4KGM A;  2ZH2 A;  3L7O A;  2HPU A;  2J8A A;  2Y3Y A;  1L3K A;  2QMW A;  2YNH A;  3LH2 S;  3GIL A;  4DV7 J;  4ED8 A;  4DR6 F;  3OTC A;  4E2F B;  2CWK A;  4LMZ A;  3AAW B;  1B0V A;  1HBN B;  3EWG A;  1RHM B;  3MI7 X;  4HVZ A;  3GCW P;  4KGX B;  3SIP B;  3W8P A;  3DI6 A;  2VB6 A;  3KLH B;  4FPR A;  4CYU A;  5KFE A;  3QAE A;  1Y5I B;  3I31 A;  5C2G A;  2EFV A;  1U0H A;  5DDR C;  1IJE B;  2CFX A;  1HMV A;  2YTC A;  1SIW B;  2PD1 A;  2M3D A;  3VCD A;  3IP0 A;  2CVE A;  4NOH A;  4A8F A;  2W2M P;  2HWI A;  2ROE A;  4B9T A;  1F5C A;  4LFA F;  4NLG A;  5HRO B;  4OZJ A;  1K73 T;  3UDV A;  1X5S A;  1GX6 A;  2V8G A;  2V2Z A;  5E3P A;  2Z2Z A;  2HBZ B;  4WTY A;  1RWN B;  4JI4 F;  1H98 A;  1U09 A;  4P7T A;  4IG0 B;  3NGD A;  1ITP A;  3KUH A;  2ATL A;  5AE3 A;  4CNZ A;  1PAU B;  4YDX A;  2MKK A;  1LWF B;  3SZ2 A;  1KHK A;  4OJ1 A;  3QZ7 A;  1Z1Z A;  4P2F A;  4X4T A;  4NEY A;  4I6Y A;  2FQQ B;  1JJ4 A;  1CEZ A;  2CJ9 A;  2QG9 B;  3A8J A;  3DXB A;  4HTI A;  2V4Q A;  3VTI A;  2DPJ A;  4J9V A;  3GCX P;  4LUB A;  4PQU A;  1Y6V A;  2BBE A;  2HVE A;  1UJ6 A;  3RTV A;  1T03 A;  1ALH A;  5T7L B;  1O6X A;  1YK9 A;  3H5X A;  2IFX A;  2IC3 B;  2LVW A;  3HHN B;  2DR6 A;  1RTH B;  4FPI A;  3OT9 A;  4YB1 P;  3H25 A;  1WSR A;  3OXF A;  4IDK A;  5MLC V;  4CLW A;  3HPO A;  2G9Y A;  1UKU A;  1NND A;  3FKB A;  1N32 F;  2B9X A;  1ALK A;  2YKM A;  2DGO A;  5E5N A;  1KN6 A;  1Y3K A;  4HL9 A;  4OHV A;  1KFD A;  4DCO B;  2N3O A;  3LXQ A;  1HLW A;  5FJ4 A;  5CYM A;  2UXC F;  1RWV B;  3MUR P;  1LQ9 A;  1FKP A;  1YQH A;  3TJA A;  1FXL A;  2YKN A;  4N47 A;  2DVI A;  3DU6 A;  2V8V A;  4DI6 A;  4K7Q A;  1LW0 A;  3GG1 A;  3RRG A;  4FF4 A;  2D1C A;  2W25 A;  2EFN A;  4I6W A;  2PN6 A;  2LEP A;  4LRF A;  1RE1 B;  3ZTS A;  3T5J A;  5L46 A;  4NXM F;  3KK2 A;  2RDJ A;  3TEH B;  2VFS A;  3MED B;  4MYT A;  4ZVR B;  3W8G A;  4USM A;  1LEO A;  2POK A;  5KT2 A;  3WBH A;  2G2Z A;  2Z8Q A;  3CCL S;  2BQ3 A;  5DLV A;  5J1P A;  4FKY A;  3H4B A;  2EK6 A;  3AOC A;  3IG1 A;  4B3S F;  3VV2 B;  4DSJ A;  1URR A;  3THV A;  4FBU A;  2C3U A;  3R3T A;  3OUY A;  3SQG B;  5AXK A;  1Y10 A;  3I5C A;  3OD2 A;  1GNK A;  2GGP B;  1FFS B;  4GVB B;  4U9R A;  4QWE A;  3H2U B;  1RHU B;  3JQM A;  2E5L F;  4LF7 J;  2NPI A;  5CD4 H;  4C0H A;  2Q66 A;  3M6X A;  1P49 A;  2W7A A;  3D6H B;  2JDJ A;  3CDA A;  3HKZ D;  4J90 A;  1E6V B;  1S9G A;  2DEJ A;  4OI4 A;  3W5Z A;  1MRO A;  3OFF A;  5HJX A;  1PG5 B;  1RA6 A;  3CD6 S;  1IR1 A;  4AXI A;  1RCX B;  5ETV A;  4EFA C;  1FX4 A;  3Q8Y A;  2B8Q A;  2GHW A;  2V4R A;  4DLG A;  3GQC A;  2ZDO A;  3NAI A;  4NZ7 A;  1JXL A;  5EN1 A;  3PY8 A;  3DHW C;  2DHG A;  1MMN A;  4FDI A;  1IR2 A;  3I5B A;  3W7B A;  4IG0 A;  3S6E A;  2YH0 A;  3C2P A;  4UPH A;  2N82 B;  4DV1 J;  2ZBR A;  2EEY A;  3MK2 A;  1RT1 B;  4ZGA A;  2KYZ A;  3K5M A;  3M2R B;  2GV1 A;  3SBM A;  5KFT A;  2UXD J;  4C8K A;  1AYE A;  3ISZ A;  1QAX A;  4F0K A;  1SUQ B;  4UTG A;  5CQG A;  5DLT A;  3D0I E;  2BMB A;  2CJQ A;  1NXI A;  3PTW A;  3TAM B;  1FT8 A;  2DNP A;  2EW9 A;  3MM7 A;  3FZ2 A;  2QL9 B;  1O5J A;  1EQ0 A;  3W5Y A;  3DI6 B;  2FJE B;  3QFH A;  5FDL B;  4F02 A;  4NAS A;  4QIV A;  3D7S B;  3LAM A;  4ECQ A;  4RW9 B;  1U6Z A;  4HHJ A;  2FD2 A;  2OO4 A;  3ET6 B;  5J2P A;  2CNL B;  2NSB A;  2UUB J;  2OH2 A;  2FJD B;  3KUE A;  5LMU F;  3UD3 P;  1SIZ A;  3KG1 A;  3H5S A;  4WTO B;  1CJU A;  1OYE A;  1KTV A;  2QSF A;  2ZNY A;  4G1Q A;  3PHE A;  3TA2 A;  4DR5 J;  4DR2 J;  3MOJ B;  5LMU J;  5LSR A;  2YKA A;  3PX4 A;  1LXJ A;  1J5O B;  5JVH Q;  4RNO A;  5AXM A;  1XMQ J;  2EPI A;  4LF9 J;  5KG6 A;  1H7X A;  2HVD A;  1RQ0 A;  2GQC A;  2HNZ B;  4IFY A;  3KLF B;  1JXV A;  1NU4 A;  1PAE X;  4GKJ F;  3MEE A;  1OSC A;  1YI2 S;  2ZIT A;  3MEK A;  3BGF A;  1QSS A;  2FY1 A;  4O4G B;  5LMN J;  1NH8 A;  1YJT A;  2ZDP A;  1NJI T;  1KC8 T;  1BQM A;  2X7I A;  4KE5 A;  1D0E A;  4UOO A;  4YR0 A;  1M5O C;  3DOM A;  2CPD A;  1UEK A;  1ACM B;  3ZZZ A;  2RRB A;  1N48 A;  1S6Q A;  5J2Q A;  1Y7A A;  1D9A A;  3KG0 A;  1F9E B;  4CH0 S;  1RHK B;  4PAB A;  5EWG A;  3C8Y A;  4PQA A;  4CLY A;  4AQY F;  2WOM A;  2PMH A;  2MKI A;  2I8E A;  1N4L A;  2J7K A;  4FYW B;  3PVX A;  2DB1 A;  2HG4 A;  2ZVS A;  3NS7 B;  3AJ2 A;  3G71 S;  1IBL F;  3Q8S B;  2FC8 A;  4TQR A;  4DUT A;  3CCZ A;  3AD9 C;  1S77 D;  3DOL B;  4NCA A;  1FCA A;  1FRX A;  2HIY A;  3VAH A;  2QSW A;  4WII A;  1XEZ A;  1VK3 A;  3MMB A;  3ILJ A;  2OMO A;  2DIU A;  1KLM A;  1LOU A;  1VBK A;  1W25 A;  3C14 B;  5EWF A;  3HXM A;  2HBQ B;  4C0B A;  1K0V A;  4MJK A;  4URS A;  4ZPC A;  4J9O A;  3KTQ A;  3QGP A;  1NPR A;  2BJ3 A;  2L9W A;  1YZ6 A;  3MR5 A;  2C2R A;  4F4A A;  2WB1 D;  3FK4 A;  1X8D A;  2O67 A;  2HHH F;  2DR8 A;  2OHD A;  2V8H A;  4B3T F;  3TZW A;  4DL4 A;  2NYI A;  3MPY A;  3KDN A;  2DNN A;  3NBP B;  4ZJL A;  4DV6 F;  3AY0 A;  3D6M B;  3GPA A;  1JLG A;  4JV1 A;  1HJK A;  2YQ0 A;  3GIM A;  1XNQ F;  3M6V A;  4N5S A;  2F5G A;  2VKZ G;  4TKT A;  2IVF B;  1N33 J;  1RWK B;  1JWW A;  1VRQ C;  2RD5 C;  4PR6 A;  1X5T A;  1MMD A;  2KJW A;  3RAX A;  2YNF A;  1IKX B;  1N5S A;  1KH7 A;  2P6T A;  4IFV B;  3PKM A;  1O51 A;  2VKR A;  2EG2 A;  1R43 A;  3QT5 A;  4KRW A;  4UUW A;  2VJU A;  2W5S A;  2W5R A;  5F9L A;  5DLW A;  5DLG A;  4XTT A;  1E6Y A;  1XR6 A;  2I5J A;  3OR2 A;  3HD1 A;  4FXW A;  4HAC A;  4G1P A;  1SPB P;  3CCT A;  5J2N A;  3V6D A;  4JP8 A;  1UJ4 A;  4ZVP B;  4JV5 F;  3ONQ A;  1FI4 A;  1Q0N A;  1I3O B;  4OX9 J;  3O44 A;  4IFV A;  5D4L A;  1JLF A;  3UNY A;  1AUD A;  1WG4 A;  4ZVF A;  4BDP A;  1FVQ A;  2WVD A;  1Z2L A;  1NB7 A;  2N3L A;  3CJ2 A;  3VGU A;  3GFX A;  3NGS A;  1NZ8 A;  2GZO A;  2F4V F;  2BE7 D;  3QFW A;  5K14 B;  3P5B P;  3JS9 A;  1JLG B;  1XNQ J;  5KFQ A;  4OV6 A;  2M0G B;  1AUK A;  3OV7 A;  5JJB A;  1WI8 A;  1NO8 A;  2MY7 A;  3QLH B;  3R5B A;  3VR1 A;  1U6F A;  5H9E J;  1NJZ A;  4ED5 A;  3M05 A;  2N4D A;  4RNF A;  1JLQ B;  5DET A;  2RS2 A;  3CO0 P;  4RLE A;  5KFY A;  2X1B A;  3TJ9 A;  4I1T A;  2PFF B;  3BDG B;  2IRY A;  4OYP A;  4YY3 F;  4PXC A;  4ECW A;  1REV B;  2MSS A;  4AFF A;  2ASD A;  2MGZ B;  1T9Y A;  4O44 A;  2NPF A;  2MHE A;  4TLQ A;  4M5H A;  1N5T A;  4DSE A;  3UE2 A;  2CQ1 A;  1SI9 A;  4ID5 A;  4K50 A;  2JZ5 A;  3QGH A;  4L72 B;  1ZTT A;  1T3N A;  2HGN A;  3MCS A;  1QDU B;  5HK4 A;  3WIU A;  4O3S A;  1NJW A;  3QPI A;  4NMX A;  3J7Z T;  4BBY A;  4QU7 A;  5B0B A;  2B4V A;  2VBZ A;  4QW8 A;  2IBK A;  3D0H E;  4PKD B;  3JYT A;  2KRR A;  2WOM B;  4OLP A;  3WAV A;  3GLJ A;  1C0T A;  3EUN A;  1R7I A;  2QTW A;  3KK1 A;  4LFB J;  4PXE A;  5GVQ A;  2BKP A;  4DL5 A;  3MEC A;  1S6Q B;  2QA2 A;  4KH0 B;  4OFZ A;  3BSC A;  3GB0 A;  3UQS A;  2EVZ A;  2BV3 A;  4G1I A;  4I2Q B;  3N79 A;  1I5O B;  4A46 A;  2IUC A;  3EZO A;  1WG1 A;  3V6D B;  2IMO A;  3I9V 9;  3V2U C;  4LR9 A;  3A3N B;  3OJS A;  3H2L A;  3ENV A;  4H4O A;  3MMA B;  1E6Y B;  4TXS A;  3CCU S;  5CCL A;  3T1Y F;  3RAQ A;  2KFZ A;  2R7X A;  4FDJ A;  1WD6 A;  2A10 A;  3BSA A;  2G0J A;  1NK9 A;  3CJT A;  1EHW A;  3EXC X;  2KXF A;  3JTN A;  4LSN A;  4G6V B;  3X1L B;  3MM5 A;  1A9N B;  4X2B A;  3HSZ A;  1U24 A;  3AOA A;  3H0P A;  3Q2S C;  1RU1 A;  3TZY A;  5HLF A;  1WC1 A;  5DQI A;  3HFZ B;  3MF5 A;  2GQQ A;  2KN4 A;  4I68 A;  5FII A;  4DFP A;  4LQ9 A;  3TVY A;  4ILL A;  2CNK B;  2WRM A;  1TUG B;  1ZA2 B;  3PDN A;  4HHU A;  1UZH A;  2UUC F;  2D3Z A;  2VQF F;  3OBI A;  1ALI A;  1SC4 B;  2ACM A;  3CJS A;  3MMC B;  4JI0 J;  4V1A k;  2Z57 B;  3TAM A;  5JUM A;  1NDL A;  3KLI A;  1EW8 A;  1AUS L;  1EQM A;  5SZT A;  2CJA A;  1S6P B;  1YRU A;  4JI0 F;  2ZZT A;  3QAT A;  2DYA A;  2AJF E;  1BHN A;  4P72 A;  1KQG B;  4RUC A;  3M9M B;  1R8H A;  3HVA A;  3N0V A;  4FS1 A;  2FJV A;  3C3L A;  1EJJ A;  1JNR B;  2QJ3 A;  2IM1 A;  2VFV A;  2YWK A;  1IJF B;  2JFK A;  2CWX A;  1S0V A;  4USH A;  3CGI A;  1IM4 A;  5KT5 A;  3CCE S;  1BWE A;  4DR5 F;  1HNZ J;  5CD4 A;  3K7R A;  3DYA A;  1LXN A;  1SC1 B;  2YX1 A;  2UVW A;  3QT8 A;  5BJR A;  2B5J B;  2J9E A;  4LVN P;  1F3F A;  3U1M A;  4TU7 A;  2ATC B;  2BQR A;  4F4Y A;  2OGU A;  2IJR A;  3C15 A;  4DX6 A;  5GMK a;  3K5N A;  2CAD A;  3B4D A;  3LP2 B;  3LA0 A;  4EU0 A;  1U1O A;  3WDO A;  2J0Q D;  1B7F A;  2YWE A;  3AB4 B;  3QBC A;  5IZH A;  2QRR A;  2P9C A;  2G0C A;  3HDS A;  4TYA A;  3MMJ A;  4DPU A;  2AYG A;  2DNQ A;  3FJ2 A;  4P2M A;  1LWC A;  2OPQ B;  1HBO B;  2QLB B;  5GAH I;  1HW9 A;  2EC2 A;  1XBW A;  3AXK A;  3P4U B;  4PG8 A;  1BQM B;  1VQ6 S;  1B64 A;  4C97 A;  4ZMM A;  4M5J A;  4OYX A;  1S0O A;  4KAY A;  3HD2 A;  4IH7 A;  3OL7 A;  5LIA A;  4DSL A;  1T95 A;  4GVB A;  3KJF B;  4PG7 A;  1NKE A;  2F1F A;  1TV6 B;  2KXN B;  2QA4 S;  4RO0 A;  4XO0 A;  2AU0 A;  3QJJ A;  5D0G A;  1TR0 A;  1N33 F;  2QZU A;  4ATN A;  2W9C A;  1C1B A;  2RHS B;  2J6S A;  1S99 A;  4G1Q B;  2GVZ A;  4J7C A;  1PJ7 A;  1PKU A;  1PJ6 A;  2HS0 A;  4F4X A;  1UA1 A;  2KTQ A;  4DG1 B;  3SDE B;  5RUB A;  4DF4 A;  2AJ0 A;  4LVO P;  2DR9 A;  3CJ3 A;  4DR7 F;  2VFU A;  2WB4 A;  1RLC L;  2DGQ A;  4ZHR A;  1GMW D;  4QWB A;  5IT0 A;  1R8C A;  2V6A A;  2KM8 C;  4CIO A;  1VIO A;  4RW6 A;  4WP9 A;  2Z2L A;  3MM7 B;  1TL3 B;  4QR2 A;  4RX6 A;  5LRN A;  3GIR A;  2JWN A;  4DR6 J;  1SUQ A;  2EBE A;  2AJ1 A;  3OL9 A;  3NOC A;  4NLS A;  5F8H A;  1PSD A;  3HHD A;  2V69 A;  4QIG A;  4DBQ A;  1PIE A;  3CIM A;  1CS4 B;  1S76 D;  2BM1 A;  2IJF A;  5CHC B;  2ZBQ A;  4ELT A;  2WTF A;  2GIQ A;  1QSL A;  4OI6 A;  3QRR A;  4DZ6 A;  1GAO A;  2YKM B;  5DG7 A;  2HLT A;  1RHQ B;  1VS3 A;  2RRN A;  5KT4 A;  3G6Y A;  1P1T A;  1YKW A;  4KO0 A;  2IJN A;  1CVJ A;  3P6Y C;  4J9K A;  1EET A;  2DNO A;  2DIV A;  2XWX A;  2E9Z A;  2DGS A;  4NLW A;  3TQE A;  3UVJ A;  3SV3 A;  1E33 P;  4LR2 A;  3TAR A;  1VQO S;  3ENA A;  2PMZ D;  2BAN B;  2XYH B;  4JI8 J;  1FJG F;  3RUB L;  2BOP A;  1YBU A;  4J9R A;  5L8R C;  1H2U X;  1M5P C;  3W3S A;  2Q6B A;  3OSN A;  4DL6 A;  2IHR 1;  2CYY A;  1RT7 A;  1VQ4 S;  2R8I A;  1FD8 A;  1HI8 A;  3OTD A;  2Y0S D;  1SKS A;  3HI9 A;  4M8L A;  1QD1 A;  1HW8 A;  1RT4 A;  2KXH A;  3VAM A;  1ELZ A;  4C8O A;  1SQF A;  1NB2 A;  1Q4R A;  2YNG B;  1ZPV A;  5KFM A;  3GII A;  4ES1 A;  4R8U B;  5KFF A;  3CJK A;  2HHU A;  2BRL A;  4NA3 A;  1HI0 P;  2OSQ A;  2MQM A;  2XSF A;  1T9T A;  2W8L A;  2R3V A;  2IA6 A;  2WVF A;  3OUY B;  2HQG A;  3VAF A;  3VAL A;  4LF8 J;  3M8W A;  1FDD A;  4ED3 A;  4KV8 A;  5KFR A;  1WOO A;  3E01 B;  1TL3 A;  1E1Z P;  5THW A;  4J91 A;  4A8M P;  2HFO A;  2WVC A;  1VLY A;  2QX0 A;  3FCV A;  1UVN A;  1RTJ A;  3B5Q A;  2CQC A;  3NGU A;  1S9F A;  1FJE B;  3Q8U A;  4O3R A;  3BKU A;  4JYA F;  1ZEF A;  3AH6 A;  2CNN B;  2A2C A;  1RAI B;  4EZ9 A;  3K0J A;  4K2J A;  4PG4 A;  2LXI A;  1KQF B;  1VQ7 S;  1FRL A;  2HVZ A;  3QJL A;  1UVI A;  2HMI A;  2CJX B;  1IQZ A;  1WDT A;  4YR3 A;  2B7B B;  4MIV A;  4CLL A;  3X3U A;  2CG4 A;  4DV3 J;  2DBB A;  1NK6 A;  1HQ2 A;  2GVD B;  1NJY A;  4DV5 F;  1EW2 A;  4NLQ A;  1Q82 T;  2FC9 A;  1NSQ A;  2HHV A;  2CPI A;  4CXU A;  4B9N A;  1N52 B;  1R3N A;  1SCJ B;  1V5I B;  2XMA A;  4B3O A;  3TZX A;  2BDP A;  4F3Q A;  3B4M A;  1KHL A;  4ZPW R;  2MPU A;  4E8U A;  5LSL A;  1VHI A;  2V67 A;  3VHQ A;  4F04 B;  1R89 A;  1SB6 A;  4Q45 A;  3TAP A;  3I5A A;  5I3U B;  1F5B A;  1DQ9 A;  2XYG B;  1N0U A;  4JUZ A;  2MJU A;  2CIM A;  3BDH A;  3T9N A;  2AYB A;  2HIQ A;  3I0S A;  5D0H A;  1S79 A;  4N56 A;  1UZD A;  2R8H A;  4YB7 A;  4WFZ A;  3G96 A;  4I56 A;  2IIH A;  5CZX A;  5E3Q A;  2DNM A;  1QE1 A;  3G86 A;  1S72 S;  2M9K A;  1FRJ A;  3DLB A;  1UP1 A;  2YQ3 A;  3I96 A;  4A8Q A;  2CQH A;  1IKY A;  3BYR A;  5FLX Y;  3HSJ A;  5KFJ A;  2GCF A;  1VQL S;  1U8S A;  1AJD A;  1HNZ F;  1IBL J;  1UW4 A;  2EFQ A;  2W24 A;  1YLX A;  4GO5 X;  4DUY F;  4B9U A;  2VF3 A;  2I2Y A;  1VI7 A;  1K1Q A;  2FHJ A;  2H9Z A;  3NGR A;  1KHV A;  1RCO B;  2E5I A;  1RYS A;  2DRB A;  3IBW A;  1RAJ A;  4PYD A;  4CLZ A;  4X62 F;  5HRO A;  3IGZ B;  4DHV A;  5KFH A;  2MQL A;  2XMJ A;  1S59 A;  4GC6 A;  1T3O A;  5B0E A;  1VIX A;  1APS A;  5IT4 A;  2X1F A;  2B9Y A;  2BKO A;  3J81 U;  1ZAX A;  1HMV B;  5CZV A;  1Q81 T;  5ETK A;  5CYQ A;  3CW2 C;  5EHH A;  4H4M A;  1KR4 A;  2L9D A;  2Z4P A;  1BQN A;  5LJ3 Y;  5GAH U;  3OL6 A;  1IQT A;  2FLO A;  2R7Q A;  2ZC3 A;  1LFW A;  2AIR B;  2PT0 A;  4OQJ A;  3IM9 A;  1V9O A;  2HFN A;  2ZWP A;  2QT7 A;  1NUE A;  3K2Y A;  4FDF A;  5GME A;  5DRK A;  5E3R A;  4C11 B;  2FDN A;  1FKO B;  1H7W A;  4UPI A;  1HHT P;  3HT0 A;  2UXC J;  2AEJ A;  2OPP A;  3ZZY A;  1S5Z A;  2NZC A;  2W4C A;  3DKD A;  4NZ0 A;  5DS7 A;  2E1R A;  3WBZ A;  3MM5 B;  2VQE J;  4C8Z A;  3IRW P;  3ZXW A;  1OIA A;  2RUS A;  3P96 A;  4KGK A;  2C3O A;  4RW7 B;  5F3T A;  2DD8 S;  3G82 A;  4DPY A;  3NMA A;  3F56 A;  3JQJ A;  4UZB A;  3H4D A;  3BQ0 A;  1U1P A;  1AJA A;  4DX8 H;  4X4U A;  1EIY B;  2VQR A;  1RSC A;  1OPI A;  1RIS A;  2XUL A;  3D67 A;  4RUH A;  3P49 B;  1O99 A;  1D09 B;  3JSM A;  2PSZ A;  1R0B G;  2GW8 A;  3BPS P;  1RTI A;  3IA0 A;  3MPV A;  1VHF A;  3M2U B;  4CP5 A;  2LDI A;  4LT6 A;  2KH9 A;  1URB A;  3QZ8 A;  2LKZ A;  4NE9 C;  3BZQ A;  2JL9 A;  4A8K A;  2OPS A;  4TN0 A;  1UTA A;  4LBH A;  4ECS A;  1N6Q B;  3OTE A;  2CQD A;  4FS2 A;  3TW0 A;  2ZH7 A;  1YG0 A;  1E2S P;  4WPA A;  5IJQ A;  1UWB B;  2MZS A;  4EMD A;  3EIC A;  1KTQ A;  1S0N A;  1TKZ B;  1YJN S;  2V8D A;  1H38 A;  2QMU B;  5B0C A;  3V6K A;  1VRT A;  3IGV A;  3BPD A;  2KM8 B;  1PGZ A;  4ZVH A;  4KGV B;  2GA3 A;  4IQX A;  3DU5 A;  2MGZ A;  1HNV A;  1PYO B;  1ZM9 A;  4ZVS B;  5KFS A;  3FNN A;  5HQM A;  3IRX A;  4X4R A;  3D9B A;  1RT2 B;  1WAC A;  3FBB A;  3QRP A;  4WE1 A;  3UN3 A;  1IBK J;  3UPF A;  2KKH A;  4Z37 A;  2BE2 B;  3CCV S;  2M52 A;  3NS6 A;  3GU0 A;  3T02 A;  4DL7 A;  3LW5 C;  4GTZ A;  2OSR A;  1TKX A;  4EGL A;  5CXT A;  3PFE A;  2BQU A;  1DRZ A;  4C4W A;  3M4X A;  2DRD A;  2SXL A;  3IS9 A;  5GAG U;  2J6U A;  3GJQ B;  4DEZ A;  5IM0 A;  5K14 A;  3SFU A;  1FSU A;  1VMB A;  3HK2 A;  1ZPW X;  2BJD A;  3DLH A;  5KFI A;  3LO3 A;  2LQJ A;  2PDA A;  5K4P A;  5F8I A;  4C3L A;  3H42 A;  5U47 A;  4V19 J;  3EJM A;  1N5V A;  3UWT A;  5C24 A;  4QPX A;  5D6G A;  1JLF B;  4IRC A;  4DF8 A;  1C1C B;  2RHQ B;  1TKT B;  1FE4 A;  1YX2 A;  3FGV A;  2L9N A;  1KHJ A;  4MY4 A;  2O5D A;  1LK5 A;  3KJN B;  4CLF A;  3KHH A;  1BUX A;  3JAM Y;  4K0K J;  3C6T A;  3R7B B;  3GE9 A;  5HBM A;  3SFG A;  1M90 T;  2RNE A;  3IBF B;  2XLK A;  3A1Y G;  3PV8 A;  3HHL A;  1AXQ A;  4UT4 A;  4GTW A;  5KTQ A;  5KOW A;  2BZ2 A;  4WFY A;  3W2V B;  1JLB B;  1RT5 B;  1M0S A;  1PC5 A;  4U7C A;  5KFZ A;  2R2U A;  4GKK J;  3GJS B;  4HH0 A;  4ES2 A;  5EGY A;  2OFG X;  1HDH A;  1TAQ A;  2VFR A;  2JLE A;  2RQ4 A;  2MQN A;  3ZNJ 1;  4F4K A;  3CUL A;  3LP0 B;  2DT9 A;  4QQB A;  4DU7 A;  5IQ6 A;  1HYS B;  3FVY A;  5K8O A;  2MKC A;  5HAO A;  2XMK A;  2VIH A;  1DTT A;  4HTJ A;  3PCO B;  4KR0 B;  3BN7 A;  5AJ9 A;  3TVZ A;  3VF0 B;  2D9P A;  4C7Q A;  1FX2 A;  5KFB A;  2R7V A;  3CF5 Q;  4OYO A;  2GAH C;  3LTO A;  2XS2 A;  3W64 A;  1R6V A;  2V94 A;  3MR2 A;  1SJ3 P;  2F7V A;  2M8D B;  4ERD A;  5GAE I;  1G7C B;  3F0N A;  5A8K A;  1WHX A;  4MTP A;  4CM0 A;  3GIK A;  5DM7 Q;  1D8Y A;  3G9C A;  1S97 A;  1KLM B;  4FKX A;  2FIU A;  2ILY A;  4DFM A;  3VAJ A;  1S1V B;  1TL7 B;  1VRU A;  2BVZ A;  2LA4 A;  2RJZ A;  3DRR A;  4I6A A;  3PR4 A;  2E5L J;  4FYX B;  3K58 A;  1G6B A;  2VC0 A;  4DR1 F;  3MAA B;  2WSC C;  4LSZ B;  1ELO A;  3UFC X;  3LPE A;  3TUZ C;  4PWD B;  3QMQ A;  3NKN A;  2AV5 A;  4JI6 F;  3HVW A;  1VQS A;  3IM8 A;  2IVM A;  1YIT S;  1UWA A;  2QGF B;  1IKV B;  1S6U A;  4MIW A;  3Q23 A;  1NHV A;  4DSI A;  1HNW F;  5LQQ A;  4LRA A;  5HAN A;  3M8R A;  1VQM S;  1GT8 A;  2GJF A;  5B0G A;  2AD9 A;  4M5I A;  2QLW A;  4O0N A;  3G8Q A;  5IS2 A;  3CIZ A;  1Y5L B;  3DRR B;  2XWY A;  1SV5 A;  2UUT A;  3KJV B;  1X0F A;  1U1K A;  1F5A A;  4OLO A;  3UCG A;  3PIO Q;  2GX8 A;  3K8W A;  2LEB A;  2CA9 A;  3VGS A;  2AJQ A;  2PFD A;  3CCW A;  5KFW A;  4ED6 A;  7FDR A;  2M88 A;  5F8L A;  4HT7 A;  3C6U A;  4ZP8 A;  4M5D A;  5G4D A;  1SBR A;  5DM6 Q;  4ZS6 A;  4DSK A;  2VG7 B;  5LSO A;  4ZLP A;  4PWU A;  3BKF A;  1UVJ A;  3V4I A;  1TL1 A;  1FTC A;  2QLX A;  1N36 J;  2NYH A;  4NPO A;  2RIJ A;  4K2X A;  2ZH3 A;  4P52 A;  1JKH B;  4IR9 A;  5H9F K;  3V4M A;  1HYS A;  3CDB A;  4B08 A;  1HWJ A;  3PW0 A;  2V34 A;  2JLF A;  2ZUG A;  3MCM A;  4RU2 A;  1AFI A;  1FRI A;  3PRB A;  5IV3 A;  1M5K C;  1S1T B;  2MQ8 A;  3MK1 A;  4CT9 A;  2OFH X;  1U2F A;  4C8Y A;  4C6A A;  4WK3 A;  1RAC B;  3W2V A;  4FVM A;  2HFZ A;  5IV4 A;  2VOO A;  4LQY A;  1UCN A;  3G2X A;  3KWM A;  4OZ3 A;  1AZS A;  4NXM J;  2QYC A;  1WF2 A;  1Y7P A;  1NH7 A;  4IRK A;  5H9E K;  3H7H B;  4ZCI A;  1RT6 A;  4Z7C A;  5HBM B;  5HP1 A;  1ELX A;  4C3M A;  3C6T B;  4ZIV A;  3VAI A;  1NK0 A;  1SVD A;  4C8L A;  2LXU A;  1S1U B;  4X64 F;  1VDH A;  4LR7 A;  3E2E A;  2KT2 A;  2C2Z B;  4K4V A;  3GJR B;  4IO9 Q;  2VH7 A;  1YTY A;  1CJV B;  4TY8 B;  1FXR A;  4Z7Y A;  5E3C A;  4AUK A;  4X4P A;  2YH1 A;  4IOA Q;  3FC9 A;  5I3Q A;  3GFY A;  1IWA A;  1FEH A;  1WI6 A;  2FGO A;  2XZW A;  2IPO B;  2F3J A;  3MD3 A;  3PO5 A;  4CYR A;  5MAO A;  2VBW A;  2XSJ A;  8ATC B;  2JC0 A;  3BBC A;  4G65 A;  1FJ7 A;  4C98 A;  3PXG a;  4FVC A;  5IM0 B;  5AJ3 F;  1EW9 A;  3OTO F;  2D41 A;  5ETR A;  4Q2L A;  4K5S A;  1K47 A;  1RBA A;  2RF2 A;  2MST A;  5D4P A;  3DRP A;  1YJW S;  4ITS A;  3OXG A;  4U7U K;  5IXU A;  3DLG A;  2Z30 B;  5KG3 A;  3KLG A;  1HQU A;  3CJ4 A;  4JI7 F;  3PX0 A;  4BC7 A;  2OEJ A;  4OYA A;  4Y0F A;  2X98 A;  3UN5 A;  2R7R A;  1PYT A;  4AL7 A;  3R5J B;  5ADZ A;  4JI7 J;  1HPZ B;  4LQ3 A;  3Q24 A;  4GTY A;  2VAS A;  2XY5 A;  4LRE A;  4DPX A;  3ETO A;  3L7U A;  4YB6 A;  4B02 A;  4ER8 A;  2YVS A;  4EI2 A;  2LU1 A;  3HO1 A;  4X4O A;  2GGP A;  4DU8 A;  4USU A;  3GIJ A;  1L3S A;  2KO1 A;  4NA2 A;  3W1Y C;  3QJP A;  3VGT A;  1KOO A;  1U2R A;  2W8K A;  1QAJ A;  2EKN A;  1JQG A;  1VK8 A;  2V4J B;  1RKJ A;  3M6U A;  3RBZ A;  3DMJ A;  3MM9 A;  3RJM B;  4AQY J;  3ZTQ A;  4NLX A;  2BUN A;  4NYZ A;  1FDA A;  5D0R A;  4KPC A;  1KVJ A;  1HWL A;  1F9F A;  1UFW A;  1X4H A;  2J9C A;  2CQ0 A;  4R5P A;  5BR8 J;  1SC3 B;  4WYL A;  2ZZN A;  4U67 Q;  2JEF A;  1NK4 A;  1JXE A;  4JYA J;  1U8W A;  2HRT A;  2W01 A;  3PAC A;  4L6V 3;  4RBV A;  2R4F A;  3T19 A;  3US5 A;  3I56 S;  1T9U A;  4TLR A;  5I42 A;  2K7K A;  2C3Y A;  1XTZ A;  4UY8 T;  1EI6 A;  4N7T A;  4OZ2 A;  4PAA A;  2EFP A;  4C3K A;  5AE1 A;  2UP1 A;  3AXM A;  1M5H A;  3N6L A;  3OFE A;  3ETM A;  3T41 A;  4DV7 F;  2MZR A;  4I7F A;  2UU9 F;  1RAH B;  3NNA A;  4ICL A;  5F0W A;  3QQC D;  4ED2 A;  1X7V A;  1EKS A;  2HW3 A;  4DR2 F;  2A18 A;  4YHH F;  2W2O P;  2VC1 A;  1T11 A;  1Q8B A;  2W8S A;  1Z2Z A;  4IDK B;  4K59 A;  4OYZ A;  4MKY A;  1OO0 B;  2CAJ A;  2OPP B;  3I4P A;  2DGW A;  2RQC A;  5M2U A;  5L1L A;  3T1H F;  2OAU A;  4DFK A;  3CCR S;  2G2O A;  4C8N A;  4ZLN A;  3BSN A;  5B08 A;  2YY3 A;  1R0A B;  1Y4Z B;  4DR4 F;  4Y6I A;  2ASJ A;  4NI2 B;  4C48 A;  1K7H A;  1RAO A;  4H4M B;  2ALZ A;  5L1K A;  1CUL A;  4MIA A;  2YX4 A;  4PQU B;  4B9V A;  1KH4 A;  2K2P A;  2Z2M A;  1EQJ A;  3BQ2 A;  2J9D E;  1CJT B;  2AT1 B;  5CCM A;  2C22 A;  3POT B;  3H20 A;  2VPW B;  4PPD A;  1NK7 A;  1SJF A;  4XDC A;  1OWX A;  1WEZ A;  1Q8L A;  2CVI A;  2MLZ A;  3LOU A;  1NPK A;  5A2Q Y;  3PX6 A;  3T3F A;  4OZ5 A;  3EDQ B;  3CJR A;  2RVJ A;  2DCU B;  2HAI A;  2F8E X;  3R1L A;  5A0Y A;  3M2V A;  2RAQ A;  3HVR A;  3RBD A;  1NDK A;  2AJ2 A;  1HD1 A;  4M5L A;  2V0N A;  2XLI A;  4UQG A;  2ZH5 A;  4UOC A;  2VBY A;  4QCL A;  4B3M J;  2V8P A;  1T05 A;  3Q3Q A;  2LQB A;  3UNG C;  5DZ7 A;  2HFV A;  4B3T J;  1X4A A;  1Z4U A;  5LJ5 Y;  3B8H A;  5F9N A;  2WZ1 A;  4C9D A;  2D9O A;  5HMX A;  1KVI A;  5LXY A;  3EGV A;  4BHQ A;  4CYU B;  1MWZ A;  2ANH A;  2GA7 A;  3RYL A;  4JV2 A;  3R5D A;  2M8H A;  2R8J A;  1LWE A;  3ZFV A;  3KJQ B;  5F8G A;  4USK A;  1N5Q A;  1XQI A;  3RBX A;  3U02 A;  4ECU A;  3U7J A;  1KQS R;  3EE3 A;  2E7X A;  3DOK B;  3HSD A;  5K9F A;  2KFN A;  2ZJP Q;  4UPL A;  1H72 C;  2HAF A;  2XYP B;  3DGP B;  2PO4 A;  1LV5 A;  2E5G A;  2VUG A;  2G1H A;  3B6B A;  3W2W B;  5AJ3 J;  3CCQ S;  1SH2 A;  4DV2 J;  4DL3 A;  4IH5 A;  2WHO A;  2ZM6 F;  1U1R A;  2JVR A;  1R31 A;  1X5P A;  2DNY A;  4ZVU B;  1NK8 A;  2PII A;  3BJY A;  2XEX A;  1T7P A;  2KT5 A;  4R25 A;  3THT A;  4NCB A;  2HRU A;  1DTQ B;  2XY7 A;  4IQM A;  3DLE B;  3ZZU A;  2VPZ B;  4CH1 A;  4KTQ A;  2BA9 A;  2HZA A;  2YPY A;  2W2P P;  1BY9 A;  3DOK A;  4M5K A;  5E41 A;  2Z0G A;  3PKY A;  3C16 A;  4DQS A;  5LT5 A;  3LP1 B;  2C2O B;  2K06 A;  3EGW B;  3TZZ A;  3KOA A;  2VU5 A;  3B54 A;  3ILL A;  2WW4 A;  2ZH1 A;  3AOD A;  2LQ5 A;  4WP8 A;  3CWJ A;  3G8T A;  2JHE A;  3UD5 A;  4TU8 A;  3WAY A;  4GRS A;  4A8W A;  1GX5 A;  1C0U A;  1ALJ A;  3MM9 B;  4TY9 A;  3SXL A;  3E01 A;  2E5H A;  3D66 A;  4KV8 B;  1BD6 A;  1VGY A;  3KK3 B;  1TU0 B;  1FVS A;  2AP6 A;  5HQL A;  4OYB A;  1KS2 A;  5KFG A;  2JC1 A;  2Q1L A;  2ZE2 A;  4O4R A;  3Q8R B;  2NS1 B; 
#chains in the Genus database with same CATH homology
 4LRB A;  4FDI A;  2QZU A;  3T01 A;  4ZG9 A;  1AJD A;  2W5Q A;  4KJD A;  4CYS A;  1B8J A;  1AUK A;  4KM4 A;  5AJ9 A;  4UPH A;  1AJC A;  1SHQ A;  3SZZ A;  2IFY A;  3MK2 A;  3SZY A;  4YR1 A;  4ZGA A;  1ED8 A;  4MHX A;  4CXK A;  3A52 A;  3BDF A;  3IGZ B;  2RH6 A;  4NWJ A;  5DLV A;  3BDG B;  3NKM A;  2W5T A;  5DLT A;  2GSO A;  2W8D A;  3T00 A;  3M7V A;  3CMR A;  5K4P A;  4ZG6 A;  5LRN A;  1EI6 A;  5INH A;  5TJ3 A;  3WAW A;  4N7T A;  3NKO A;  4UPI A;  3TX0 A;  2XRG A;  5L0E A;  3IDD A;  3NKN A;  2XR9 A;  5LQQ A;  2W5X A;  3WAV A;  4LRA A;  2W8S A;  4CXS A;  1KHK A;  1AJA A;  5KXA A;  4UOR A;  1E33 P;  1URB A;  4KJG A;  2VQR A;  4LR2 A;  1O99 A;  3UN2 A;  3M8Z A;  4QAX A;  2D1G A;  1ED9 A;  4NWX A;  3NKQ A;  1Y6V A;  1ZED A;  4UOO A;  1ALH A;  1ANI A;  4LRC A;  1Y7A A;  1KH4 A;  1URA A;  2IUC A;  3NKR A;  3NKP A;  4LR8 A;  3TG0 A;  1EQJ A;  1N2L A;  1KH9 A;  4LR9 A;  1K7H A;  4FDJ A;  3OT9 A;  4TN0 A;  1ELZ A;  2G9Y A;  2W5V A;  5IJS A;  1ALK A;  1ELY A;  1O98 A;  1E2S P;  5IJQ A;  4B56 A;  2GSU A;  5L0K A;  5GOV A;  1HQA A;  3Q3Q A;  3LXQ A;  1AJB A;  3M8W A;  3MK1 A;  5C66 A;  2IUC B;  3DYC A;  5EGE A;  1E1Z P;  1ALI A;  4LQY A;  5L0B A;  2GA3 A;  1E3C P;  2ANH A;  1EW8 A;  4LRF A;  2GLQ A;  3B5Q A;  1ZEF A;  1ELX A;  3UN3 A;  1KH5 A;  3WBH A;  4LR7 A;  3T02 A;  1EJJ A;  1SHN A;  4GTZ A;  4UPL A;  3TWZ A;  3DPC A;  4MIV A;  3MK0 A;  1HJK A;  4GTY A;  2W5W A;  1EW2 A;  4CYR A;  1FSU A;  4LRD A;  4UOP A;  3ED4 A;  4KAV A;  4CXU A;  1EW9 A;  1ZEB A;  1ANJ A;  1KHL A;  1KH7 A;  1KHJ A;  2W5S A;  2ZKT A;  4MY4 A;  2W5R A;  5DLW A;  4ZG7 A;  3UO0 A;  1P49 A;  1N2K A;  2X98 A;  3UN5 A;  3BDG A;  3BDH A;  4GTX A;  5LRM A;  5GRR A;  3E2D A;  3WAY A;  2GSN A;  1KHN A;  4GTW A;  1ALJ A;  3UNY A;  5LIA A;  4KAY A;  4LRE A;  3NVL A;  5HRT A;  3KD8 A;  3WAX A;  1HDH A;  3M8Y A;  5EGH A;  4UPK A;  3IGY B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...