3OTJE

A crystal structure of trypsin complexed with bpti (bovine pancreatic trypsin inhibitor) by x-ray/neutron joint refinement
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
223
structure length
223
Chain Sequence
b'IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cationic trypsin
publication title X-ray and neutron protein crystallographic analysis of the trypsin-BPTI complex.
pubmed doi rcsb
source organism Bos taurus
molecule tags Hydrolase/hydrolase inhibitor
total genus 57
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2010-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3otjE01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3otjE02
2ZKSA 3Q3XA 2OCVB 2ODQA 1WYKA 1K1MA 3RC4A 1THSH 1UK4A 4FUGA 2SGDE 1VITG 1ELGA 1A3BH 4K1SA 1F2SE 2A7CA 5CHAB 2A4GA 5F6MA 1C5WB 1ZHRA 2BD8A 3T27A 1O2SA 5A0AE 1GI2A 1GJ9B 1UVSH 1AUTC 1S6FA 1GJAB 1TIOA 2VGCC 2EA3A 1AB9B 2VH0A 3RXFA 1AWFH 1NO9H 4MPUA 3KIDU 1BJVA 4UEHH 1ZLRA 1MKWK 2BYAX 2B5TB 1E37B 3Q3YA 1NU7B 1AKSA 1L1NA 2A5AA 1OS8A 2FP7B 1SOTA 1EZSC 3LGYA 4CRCA 4X1RU 1XMNB 1W11U 2ZTZA 1XM1A 1TPSA 5DP7A 2OP9A 3D49H 3LU9B 1MTNC 1P2NA 5FPTA 1GI4A 1W13U 5AF9H 1W10U 1UTMA 1XVOA 1AU8A 2BX4A 4YT7H 2XWAA 5T3HA 4A92A 3MU8A 2SNWA 1OWDA 1EAIA 1BRCE 3SNCA 3FP6E 4NWKA 4ZHLU 1MTVA 5A8ZA 1M9UA 1EUFA 2QY0B 1LQDB 2ZU4A 2ODYB 1L2EA 5CHAC 2D2DA 2OC0A 3K6ZA 3AAUA 3D23A 4B1TA 2ZDKA 1P09A 2ZGJA 1S85A 2AMDA 4Z6AH 4JYVH 2ZFFH 2V3HH 2G5VA 1BTWA 2FPZA 2W26A 3ZZAA 3M7TA 3O8BA 1GMCF 3E0PB 2GDDA 3GCHB 2NU2E 1AB9C 1GHBF 1QHRB 1NRQH 3SU6A 4DG4A 4MQAA 2IN2A 2EI6A 4ABBA 5AFYH 1T4UH 1AD8H 4J1YA 3RXJA 1VCPA 1V2RT 2QYIA 2TIOA 3F68H 1YGCH 1VITH 2GKVE 1Y3WA 4B2CA 4DOQA 3RXUA 2TGPZ 4AFUA 3P6ZB 1GI7B 1S0RA 1A0LA 2OBOA 3ATWA 2PFEA 1O3IA 1C5UA 1QBOA 1GJCB 1C2MA 4GAWA 2XBVA 1YPJH 3M5OA 1JMOH 1TRNA 3LH1A 2JH0D 2ZQ1A 2V0BA 1PJPA 2BDAA 4O03A 3PMHB 1W0ZU 3KCGH 4FUCA 4MG3A 1SGFA 5TCAA 4HFPB 2ZGHA 2PKAB 1LKBA 1OWHA 1RIWB 4MPXA 1P0SH 4D7GA 4ZMAH 1HAXB 4OS6A 1ZMNA 1PYTC 2D26C 2H2ZA 1C2GA 1ELBA 2AIQA 4TPIZ 1BQYA 1BTUA 1PQ7A 2Y80A 3MU5A 5C20A 1JWTA 1MKXK 1O5DH 2G55A 4WMEA 1Y5AT 2Y5HA 4YTAA 1PPFE 3M37A 4XE4A 1J8AA 4U01A 5JYIA 1EQ9A 2BD3A 3SZNA 1WU1A 3W94A 3RXPA 1V2WT 1ZMLA 2DUCA 2WPLS 1S84A 3UIRA 2ZCLP 3EQ0H 1HAZB 2BVSH 4OS7A 3MH4A 1WQVH 1V2ST 4B2BA 2IPHA 4KTSA 1QIXB 2JH5D 2Y5FA 1GI1A 9ESTA 1IQGA 1GI5A 3A88A 4NA9H 2WV5A 2ZGXH 1DOJA 1GGDB 2FLBH 2WUCA 2Q1JA 2NU0E 3EA8A 1P12E 1P9UA 3SNDA 1K1PA 5E2OA 1RFNA 2C4FH 3U8RH 3CS0A 1AY6H 4CRBA 4MNWA 1LHFH 2OXSA 1GHXH 4CBNA 4INHA 1A2CH 1KLIH 3SI3H 5C67A 2J92A 2ASUB 2ZGCA 3U69H 1B0FA 2ZDVH 3QLPH 4Y6DA 4NIXA 3VGCC 4WF8A 1QGFA 3VPKA 4ZROA 3Q76A 2BY9X 1HDTH 2YNBA 1BTYA 2P93A 4MNXA 1TX6A 1LCYA 3RM2H 1HAOH 2GGVB 2A31A 3LGUA 1VCWA 1YPHC 3PWCA 3TLOA 2BLQA 3GCNA 3VEQB 2H9TH 2R3YA 5C1UA 2XC0A 1A5GH 2AMPA 1TA6A 4XDEA 1YP9A 1C5OH 1ZTJA 2GCTB 3QX5H 2PGQB 1IHSH 1FN8A 1XUJA 1GCTB 3U8TH 1YC0A 2UUFB 4D76A 4I31A 2K1QA 2STAE 4GCHG 1TALA 3ATLA 3O8DA 1TNJA 2O8MA 3TGIE 1O3OA 2ZHQH 4IS5A 1GGDC 3T26A 1CSOE 2IJOB 4CH2B 1EJMA 1LO6A 3SV9A 1D9IA 1BZXE 1BTZA 3A8AA 1BTHH 3RMNH 3RLWH 3A8BA 2WV4A 4JK5A 1TMTH 4E06H 1P2OA 1F0RA 1SGFG 2ZU2A 1V2PT 4RSPA 1QA0A 2WPIS 3KQEA 5JDUB 3T5FH 2QXHA 1HCGA 1ZSLA 1UTNA 2ESTE 3BG4B 1E35B 4IC6A 5DP8A 1O3HA 2C93B 1Z71A 2TRMA 1QCPA 4ABDA 3BF6H 1Z8RA 3UOPA 1O2GH 2O8TA 5GDSH 1CBWC 1V2LT 1N6YA 1ELCA 1MTUA 1ELDE 1FDPA 4X1QU 3AW0A 4UD9H 1G36A 4X0WU 3I77A 6ESTA 1V6DA 1H8IH 4ZXXH 1LVOA 2GCTC 1V2UT 1QQUA 3UNSA 5EPNA 1IQIA 1GCTC 2F9PA 4LK4A 4X6PA 3GY4A 2FYQA 2QXJA 4YZUA 1FAKH 5SGAE 1MKWH 1O5AB 1C1VH 1F5RA 1VZQH 1Q3XA 5HYOA 1HIAA 3R3GB 3ZVEA 4A1TA 4KTUA 1T32A 2FODA 2Z7FE 3NCLA 4DJZB 4X2VA 2FYRA 2ANKH 2GMTB 1FZZA 1UJ1A 2ZCHP 1G2LA 1KXBA 1K2I1 4JYUH 4XSKU 4K2YA 1IAUA 3RXOA 2BB4A 2GDEH 4ZKSU 3I29A 1SGDE 1CHOG 4X6NA 1O3GA 1O0DH 1ZRBA 3LGVA 2QC2A 2FM2A 2BY5X 5J4SA 1QFKH 5GIBA 3C1KA 1GMDF 2XBXA 1NU9A 3MYWA 3BN9A 3SUEA 4AYVB 1HJAB 2FS8A 1V2KT 2BOHB 2HGTH 1O2TA 1C4V2 1IOEA 4IBLH 1DICA 3P95A 3GISB 1AHTH 5F8TA 1DLKB 3FVFB 1KXFA 1VJ9U 1FV9A 1TYNA 4B75A 2Z3CA 3RUOA 4ASHA 3BG8A 1RS0A 3LT3A 1Z8IB 2ANMH 1CT2E 1F7ZA 3SJ9A 5HM2A 2F9OA 2J2UA 1DVAH 5JBTA 1C2JA 5JB9S 2QXGA 3TVJB 1OWIA 2Z3EA 4Y11E 1QL7A 1ZSJA 4JZDH 1DITH 1EAXA 3M35A 4JZFH 1DXPA 2BQ6B 1HXFH 2JH6D 3UR6A 2THFB 3BTQE 2Y7ZA 4D7FA 1HIAB 1S6HA 3SHCH 1FIZA 3GICB 1DWCH 4A1VA 3PLPA 1AWHB 2GMTC 1O3DA 1Y3UA 2FS9A 3P70B 1O30A 1AZ8A 1GCDA 5LPRA 1HB0B 2GCHG 2G4UA 3ENSB 5E0GA 4YLQH 1P11E 1H9LB 4BOHA 1BT7A 1KDQB 2FOEA 3IWMA 2ZECA 3RXRA 5C1XA 2XWBI 3FZDA 1V2MT 4DY7B 1SVPA 2C8WB 3MO3A 3GDVA 1TGNA 5DJ7A 1GJ4H 1BITA 2ZDAH 4H6SB 2W5EA 3EYDA 2VIOA 3TK6A 3PROA 2AGEX 4D8NA 2BZ6H 2VWOA 3ZVCA 1PPEE 2VIVA 1HAVA 2CGAA 1AMHA 5ETXA 3SUGA 3F6UH 4A1XA 1FY4A 6LPRA 4AORA 4Y7AA 1H1BA 1GBFA 1MKXH 1DUEA 3QTVH 1WSSH 3U98H 1NRPH 1Y5BT 3SW2B 2PLXA 3SHAH 4HI3A 3GCTF 1L1JA 2ZU5A 3BTKE 1SB1H 4I8JA 4NCYA 3RXDA 1ETTH 4YOGA 5J4QA 1J17T 1L4ZA 4UE7H 2ZHDA 2G51A 1TFXA 3PTNA 2HOBA 1EATA 2FMJA 3E0NB 3RMMH 3VB3A 1O2MA 1J15A 4AOQA 2ZFSA 4RN6A 1TBRH 2BDCA 3UUZA 1EB2A 1ZRKA 4K8BA 1EOLA 3NKKA 1EX3A 2XNIA 1NROH 1F0SA 1HV7A 2PTCE 3UOUA 3GY8A 1LPZB 1O2OA 3Q00A 3O8RA 1K1OA 1O2ZA 1MU6B 4IN2A 3UNRA 2Q6FA 1AO5A 2VWLA 3VXEH 1TRMA 2ANYA 1L4DA 1VR1H 1BRUP 3UREA 1TAWA 3RXVA 2ILNA 1OSSA 3ATIA 3SV7A 3GYLB 2ZGBH 3U1IB 1BB0B 1T8MA 1F92A 1T8OA 2OINA 1MQ6A 3OSYA 4NA8A 3JZ1B 1QRXA 2VGCB 4ABFA 1A61H 4IC5A 3P92A 2TGDA 1P9SA 3TPIZ 2HNTF 1CT0E 1GBLA 1N1LA 4B71A 3EE0B 4CBOA 3DUXH 1IQNA 1MAYA 1Y3XA 4GSOA 1AUJA 2R0LA 1IQJA 1XXFA 5FCKA 3NWUA 5CE1A 1ZR0A 3PO1B 2PW8H 1YF4A 2ALVA 5F03A 1O2WA 3A7TA 1C2HA 4FU8A 2J38A 3TGJE 3W95A 2VIWA 4GLYA 4FUBA 1SBWA 1MTNB 1MBQA 1SSXA 3A8DA 1TLDA 1G3CA 4KKDA 4TPYA 2BDGA 2EI8A 4DURA 1HJ9A 3RMOH 2VIPA 3SNEA 3FANA 3KNXA 3SQHE 4I33A 2UWOA 2WYJA 2B8OH 5FX6A 5FAHA 3IG6B 1GPZA 2H9EH 1O3KA 4ZHMU 2BXTH 3GY6A 1FMGA 1Q31A 1FQ3A 1YM0A 1TABE 2ZA5A 4NZLA 1TBZH 1LHDH 4UONA 1THRH 1O2UA 2ZF0H 1DT2A 1MZDA 1C1UH 2Z9JA 3S7HB 3E1XB 1UVUH 3LC5A 4Q7XA 5HGGA 1MUEB 5H4IB 1K1JA 1P04A 1ANBA 1SOZA 3A84A 1QY6A 1JIMA 4DGJA 2BQWB 4I32A 1SL3A 5LGOA 1E36B 3LONA 3P8NA 4CR5A 3TJOA 5JBCS 1Y5UT 1XXDA 1Z8JB 2CHAB 3PO1C 5DPAA 2BDYA 2A4RA 1HAHH 4BTTB 3S0NA 7GCHG 1T8LA 4KELA 1BMAA 1C1NA 2O8WA 1ZPCA 1J9CH 3ITIA 1GI3A 3TGKE 3V12A 1NFWA 8GCHG 4INLA 5A0CA 2GTBA 3ZVGA 1GBIA 2BLVA 3S69A 1HAPH 1BMMH 5EG4A 3RLYH 1P06A 1O2XA 3ZZ5A 1IHTH 2BLOA 1NZQH 1A0HB 3RM0H 1C5NH 1UO6A 2WPJS 3KF2A 4HGCA 1QURH 2Y81A 3M61U 3RXQA 1A4WH 2KAIA 2XW9A 4TY6A 1QRWA 4R8TB 1O5FH 1QNJA 4DVAU 2BY7X 3V7TA 5JB8S 5K0HA 3V3MA 4YESB 2PUQH 5C3NA 1OWJA 4KP0A 4NIVA 4B73A 3OY6U 1PPHE 5DP9A 1C1SA 3RU4E 1AI8H 1S83A 3V0XA 1O33A 2FO9A 1TX7A 2XYAA 1ZOMA 2WINI 4X2XA 1P02A 4XOJA 1S5SA 4WH8A 3ODFA 1AKSB 3BTME 2XTTB 4ZXYH 1N8OB 2A7JA 2ZDMA 3A7XA 4A5TS 2ODPA 3ODDA 2CHAC 1CU1A 1XUGA 1C9PA 5L30H 3Q3KA 4AN7A 2AGIX 2WPMS 1KTSB 1GHAG 3VXFH 3RC5A 3D62A 1C4U2 5C2ZA 3SV8A 1ZHPA 2Z94A 1CA0B 1WCZA 1THPB 4JZEH 3E8LA 3N7OA 1AVXA 1MQ5A 4X8VH 3S7KB 2BOKA 1SQTA 1C1WH 1QJ1B 2J4IA 1BMNH 1TX8A 3SV2H 1V2OT 3LGWA 4K69A 3TU7H 3KN2A 2ZHFH 2FLRH 3RXIA 2FX4A 2GCHF 1AGJA 3HKJB 1P2MA 1EXFA 1ZGIA 3L3TA 1ZTKA 1EJNA 1HAYB 2BDHA 2SGEE 4ZKOU 4OS5A 4ZH8A 1SGPE 5DO4H 5GWZA 3VGCB 1ZYOA 2A0QB 2VJ1A 2VVUA 5FBEA 3LC3A 2KAIB 3B23B 1FY1A 1W14U 5EQQA 3URCA 3VB7A 2OBQA 4Q7ZA 4XFQA 1EJAA 3PWBA 2ZU3A 1OOKB 3S9AA 1O5GH 3NZIA 5DG6A 1O5CB 2D8WA 1TOCB 2FXRA 3ZVAA 2XCFA 1GJ6A 2P3UB 1TQ0B 1GMHG 4AFQA 5PTPA 4IW4E 3MTYA 2P94A 4MTBA 1N8OC 2FEQH 3MNBA 3A82A 1BTXA 3GY2A 1GI8B 1YPMH 2R0KA 2VVCA 1UTLM 5B6OA 1UCYK 4BANB 3UR9A 3QZRA 1QB9A 4OS1A 4E05H 3PYHA 5EOKA 3SV6A 4WXIA 2H5DA 1DS2E 5K7RA 1WBGB 1CA0C 5GCHF 1SGCA 5FBIA 3T28A 1BIOA 2RCEA 1P2JA 1O38A 3ZYDA 1RGQA 2R2WU 2SGQE 1J16A 2ZNKH 4AG1A 4I8LA 4RKJB 1P2KA 2A32A 1C4Y2 2IOTA 5E2PA 1DUAA 1Z6EA 5ESTE 5JBBS 1TRYA 6GCHG 3C27B 2Y7XA 4K1EA 4Y79A 5FHTA 4ESTE 3H7TA 1HUTH 3BIVH 2XRCA 3TH2H 2UUKB 1MD7A 1Y8TA 1Y3YA 4ABEA 2XBWA 2CMYA 1LDTT 5DP3A 2H9HA 2OD3B 1ANCA 2Q6DA 4X1SU 5FPSA 1YCPK 2C3SA 1CBWB 1TPPA 3ZZ9A 2P95A 3DFLA 2R3UA 1C5XB 1YLDA 5HMAA 1HGTH 5FCRA 1C9TA 1GDUA 2GZ7A 2ZWLH 5EW2H 1G3BA 3GCOA 3GDUA 1S81A 1GBJA 1NRNH 2C90B 1LQEA 4NSYA 1HYLA 5L2ZH 4ISNA 2ZC9H 2BD5A 4NZQA 5JBAS 1C5PA 3A7YA 1BBRE 1C2IA 2TGTA 3KEEA 3ZV9A 1D6RA 2A7HA 3BV9B 1TMBH 1EPTA 4BNRA 2PWXA 2ZZUH 2RA3A 2PTNA 3A86A 1EAUA 2OC7A 4WWYA 1NPMA 1P2IA 3QN7A 1DLEA 2NU3E 3STIA 1ZJDA 4BXSA 1UTQA 1KLJH 2ZFTA 3LOXA 1PYTD 4CRDA 3AAVA 1ZHMA 1GG6B 3ESTA 2BQ7B 2QIQA 4WMDA 4BTIB 5DK1A 1GVZA 5A2MH 5LPEA 2AMQA 3TJNA 3MHWU 4RKOB 5EQSA 3ELAH 1ZMJA 3M3SA 2G52A 1B5GH 2W3IA 1TPAE 1GI0A 1VITF 1DE7H 4MNYA 3DHKH 1DWBH 2VIDA 3OU0A 3UQVA 4X8UH 3K6YA 1C1QA 4XBBA 4YOIA 3RXGA 4I8KA 3RXEA 3L33A 1C5VA 4MVNA 2VU8E 2Y5GA 1O31A 2PKSC 3KHVA 2BVXH 1GBMA 3B9FH 2P16A 1DPOA 5TCCA 4K3JA 4MPVA 3MNXA 4HZHA 5EXNA 5F8XA 2FX6A 1K1NA 1E38B 2NWNA 1V2NT 1UVTH 1MTWA 4FU9A 1W7XH 3KGPA 3UWJH 3RU4T 1GJBB 3HGNA 1ELEE 1C1OA 9LPRA 4Y71A 1UHBA 4DW2U 2BD2A 2A2QH 2AEIH 3ZV8A 2XBYA 3BTEE 1TONA 3AVZA 4DCDA 2B9LA 1HAGE 1GVKB 2V3OH 4TYDA 1SFQB 4YLUA 1SG8B 2B0FA 2H6MA 1X7AC 4K1TA 3TH4H 3BEFB 8GCHF 1GG6C 5EODA 1P57B 2BZAA 3NUMA 4Z0KA 1RTFB 2QV1A 1JRSA 1C5RA 3EA9A 3SJKA 1TQ7B 1SGRE 1FNIA 1O37A 4JK6A 1V2QT 2CXVA 2FOFA 4KGAA 4U30A 3H5CB 4X6OA 1P2QA 4AGKA 2ZPSA 1DSUA 1JOUB 4NG9H 1GBAA 1KYNA 3PM3A 4FVBA 4YM9A 1WV7H 4A7IB 2ZP0H 3BIUH 1SGNE 1AQ7A 1ESTA 2B7DH 1P3CA 1U6QA 5FX5A 3TH3H 1FAXA 4FUFA 2JETC 7ESTE 2VIQA 1DY9A 5C5NA 3A83A 1Y3VA 2C8YB 1SHHB 2F83A 3LJJA 3UY9A 1OXGA 1QL9A 2W7UA 3PLKA 4NWLA 1LVBA 2P8OB 1G37A 3EAJA 3HK3B 2H5CA 2FTLE 2Z9KA 4AG2A 1EPTC 2RA0A 1C2EA 4X2WA 1PPBH 1TGSZ 3P8OA 4JMYA 1NRRH 2PV9B 4NA7A 4I8GA 3SJ8A 3ZZDA 3SI4H 2BTCE 1PPZA 1O3CA 2J95A 1O5EH 1W8BH 1P8VC 5DKMA 3TNTA 2SNVA 3T29A 1V3XA 3SJOA 3PB1E 3T2NA 3UWIA 5G4BA 4CH8B 1YCPM 3ZZCA 1CA8B 1T7CA 3MNCA 3L6PA 2DE9A 3SGQE 5FPYA 1BHXB 2SFAA 1V2JT 2ZFPH 1NN6A 2G5NA 4B76A 2I6QA 1EZUC 3LKWA 1LHGH 3IITA 1BRAA 2ZTYA 1TNLA 1GDQA 2G8TA 4ZKNU 1FY5A 3E6PH 3D65E 5F8ZA 2V6NA 5AFZH 4X2YA 1F0TA 2BX3A 1UCYE 2XC4A 1XUKA 2Y82A 5CMXH 1DM4B 1CO7E 4NFFA 2WYGA 3B8JA 3LJOA 1INCA 1TGCA 4GPGA 3SUFA 3GY3A 1C5SA 1P10A 2P8OC 4NFEA 1NFUA 1OYQA 3NK8A 2A4QA 4BAOB 1A5HA 4Y8XA 1D3PB 2FI5E 2JKHA 1GVLA 1T4VH 2F9NA 1CQQA 1NC6A 1YPGH 1K1IA 1GBEA 5L6NH 5BPEA 3V13A 1UCYH 2R9PA 4F49A 1GDNA 5LPFA 3A7ZA 3U1JB 2PR3A 1K21H 4SGAE 1XVMA 3G01A 4WJG2 2GZ9A 2WUBA 5A8YA 1BRBE 3MU1A 2Z9IA 3HKIB 3M5LA 1Z7KA 1NFXA 1DY8A 3EDXB 1BCUH 3MI4A 4BAQB 4AB8A 3VB4A 3ZVDA 1ELVA 3JZ2B 5L2YH 4Y8YA 1ZZZA 4NIYA 5LH8A 4X1NU 1QL8A 2FDAA 2NU4E 1GJ5H 1C1RA 1AVGH 2BDBA 1AE8H 1NS3A 1PQAA 2OQ5A 1LHCH 2EEKA 1BJUA 4I7YH 2ALPA 1VCQA 1DWDH 1H4WA 2YOLA 5EGMA 3R0FA 4MPWA 3TJVA 6CHAC 5EW1H 1SLVB 1HAVB 3M5MA 2F9BH 3KQCA 5E8EH 1YYY1 3F9GA 1L1GA 3DFJA 1YCPH 2EI7A 3QZQA 3ZZ6A 5I46H 1P01A 1W7GH 1D3QB 2AERH 1WUNH 5JPMH 2HALA 2F9VA 1FONA 4CHAB 4LOYH 3E16B 4TY7A 2BD9A 3SGBE 1E0FD 1S0QA 1CT4E 2PGBB 4GCHF 4WMFA 1E34B 1Y59T 1FJSA 1GBBA 3WY8A 1CGHA 1LTOA 3MMGA 1HXEH 4D9QA 1ZJKA 7KMEH 1RD3B 1O2IA 4H42U 1BBRK 2OTVA 2VWMA 1P05A 2M5TA 1EZXC 2OQUA 3QUMP 1BDAA 1OWKA 2P3TB 3NPSA 1KIGH 3A7WA 3BTTE 4O97A 1GI9B 1TGBA 4AFSA 1MMJN 4FUHA 3UPEA 1ANEA 1IQHA 1KSNA 4MLFB 1AIXH 1O2HA 1Z8GA 1O2QA 2A2XH 1UTKA 1L0ZA 1ABJH 3F9EA 1FLEE 3FAOA 3SO3A 1G32B 3A87A 1VGCC 1T8NA 4ISLA 4UDWH 1WTGH 3ATKA 1UK3A 1TNHA 2GT8A 2BDIA 4I8HA 1SGQE 3SU3A 3A80A 1CHGA 4ZKRU 2OLGA 8ESTE 3PV4A 1AE5A 4LZ4B 4GHTA 1EOJA 2ZO3H 1NTPA 1RRKA 3MH5A 4O9VA 1TMUH 1DWEH 1G30B 2G00A 3SOSA 4CHAC 4E7RG 3K2UA 1GBKA 3OX7U 4H4FA 3RXBA 3F9HA 4K8YA 1HNEE 3RXLA 2VB0A 1FIWA 1O2PA 2H1UA 1C2KA 1QR3E 3MFJA 3TITA 1LMWB 4ISOA 1EZQA 2ANWA 1A0JA 4JZIA 2GV7A 4TWWA 4A6LA 2HRVA 1TNGA 3SJIA 1KXAA 2ZQ2A 1MH0A 3FP7E 4MNVA 4KTCA 1TOMH 2LPRA 1JIRA 1MU8B 4BAHB 5ESBA 3CENA 1ZSKA 2QF3A 4DT7B 1GHYH 2FOHA 1C1PA 3UQOA 1S82A 2XXLA 1CHOF 2PSYA 2QAAA 4F4OC 4Q2KA 2BY8X 1GI6A 4XBCA 1HFDA 1W12U 1HPGA 4XBDA 3SU1A 1MD8A 2BMGB 1BUIA 1FPCH 2BHGA 1TBQH 4Y7BA 1F5LA 1WAYB 3ZVBA 1OPHB 5E0HA 1O34A 3QK1A 2QF0A 2TPIZ 1EAWA 1UTPA 3TIUA 2PKAA 1O35A 1C2FA 1GL1A 1HAIH 2YNAA 4WH6A 2NU1E 2P3FH 1Z1JA 4FXGH 3GY5A 1NY22 4INKA 1MTSA 4NSVA 2TGAA 3T62A 3ZYEA 1GHZA 3RP2A 3FP8E 5I25A 1A5IA 1GMDG 5TJXA 1AFQB 2RG3A 4E7NA 3PMJA 4X1PU 3RDZA 2A5KA 1O3JA 1KTTB 3F1SB 1IQLA 3SORA 2UUYA 3SU2A 1C5LH 1W2KH 5EQRA 4DIIH 1UK2A 5DP4A 1K22H 4OGYA 1G3DA 1MBMA 2C8ZB 4ISHH 4JCNA 3MH6A 4AGJA 2HWLB 2QGRA 4ABAA 1N6XA 2G4TA 5HXFA 4AZ2B 1ELTA 3P17H 4FUDA 4MDSA 5A09A 3ZVFA 3RU4D 1YPLH 2BD4A 3STJA 2GZ8A 2Z9GA 2F9UA 2UWPA 1GBTA 3RXTA 3SNAA 3MO6A 1YPEH 2WPHS 3M3TA 1SLXB 3S9CA 1QA7A 1NM6A 2ZG0H 1W0YH 1D3DB 2W3KA 2CF9H 1O2YA 2UWLA 1O36A 3U9AH 1FY3A 3LGTA 3GYMA 1O2LA 2ZIQH 1SQAA 3HATH 1XUHA 3CS7A 3BTGE 1TE0A 1V2VT 1OWEA 1HJ8A 3F9FA 2WPKS 1Z6JH 1XKBC 3K65B 1AFQC 4GVUA 1UVOA 2FZZA 5EXLA 3PMAB 4ABIA 4VGCB 2J9NA 3GCHC 1SLWB 2QA9E 1G3EA 1H9IE 3MNSA 4TWYA 5AHGH 4D9RA 4ABJA 2ZU1A 1G2MA 1UMAH 2RDLA 3A8CA 3O8CA 1K1LA 2ZFQH 1ELAA 5DP6A 1PQ8A 1OP8A 4ZAEA 3SU5A 1LHEH 1XUIA 4YO9A 1IQFA 1ELFA 1PPGE 4CRAA 3A7VA 3GCTG 1SHYA 1EP6A 1ABIH 1BTPA 3LH3A 4H6TA 4THNH 2FOMB 1PQ5A 4ABGA 3P8GA 1UVPA 3KL6A 1OP2A 1BHXF 5GJ4B 2CV3A 3RXAA 4BTUB 1PPCE 4PROA 1NESE 1QRZA 5E0JA 1B0EA 1SFIA 1QQ4A 1TA2A 4ZHAA 2G81E 3BTHE 3UNQA 1FUJA 1SGEE 3H7OA 1O3AA 1ZPZA 4UFEH 2GD4B 4DIHH 2ZPQA 1KXEA 1NFYA 2PKSB 4BXWA 1W3CA 3GOVB 1RIWC 3PLBA 3A85A 3E91A 7LPRA 2HVXA 1O39A 4K60A 4R0IA 1A3EH 1ACBE 4CREA 1C1MA 1EKBB 1ARBA 1A1RA 2QCYA 4AFZA 1MCTA 2AS9A 1TNIA 2PHBA 2Z3DA 1IQMA 1H8DH 1GBHA 2A45B 4VGCC 3AW1A 2O9QA 5EU8A 1SGYE 1C1TA 1OKXA 1ARCA 4JZ1A 8KME2 1IQEA 2FOCA 3E90B 1HLTH 1SLUB 1OYTH 1C5TA 1D6WA 3GY7A 1GHWH 2HNTC 3URDA 2STBE 3LIWA 3OY5U 4ISIH 3MU4A 1BOQA 4IGDA 3OYPA 2FTMA 4IN1A 5ABWA 1C5QA 3DA9B 3ZZ4A 1QB1A 4GUXA 3BEUA 1K28D 5T6GA 1JRTA 1BBRH 3HK6B 2GX4A 1D3TB 2OUAA 2ULLA 2Y6TA 3BTFE 4M7GA 1T31A 1AVWA 1QJ7B 3M7QA 1O2JA 1DANH 8LPRA 1YBWA 4X8TH 2V35A 1K9OE 1NT1A 1KXCA 3LPRA 3U8OH 1F0UA 3SUDA 3SN8A 1KXDA 3S9BA 2JETB 2ZHEH 1RJXB 2FOGA 3ZZ7A 2R2MB 1ETRH 3TJUA 2F3CE 4UFGH 1DDJA 1ZPBA 4Y10E 1Q2WA 3BTDE 4IMZA 3BSQA 1O2KA 1UTOA 3FFGA 4U2WA 2CF8H 1SGIB 2I6SA 5AVDA 1YPHE 3ZZBA 1GJDB 2ZHWH 1EPTB 1RTKA 7GCHF 2HPQH 3BEIB 5C1YA 2A4OA 1O3MA 1EP5A 1WTHD 3MO9A 4HTCH 5EPYA 2CJIA 1JXPA 2HNTE 2XC5A 1ZGVA 2GT7A 1ETSH 1D4PB 1WQSA 4OGXA 1O5BB 1O2NA 3RMLH 5A0BA 4BAMB 2EC9H 2VINA 2ZPRA 4X8SH 1Z1IA 3QGNB 1KY9A 1FXYA 3SNBA 1MCVA 1YKTA 4J2YB 1GJ7B 1JBUH 1YLCA 1QB6A 4YT6H 1TB6H 4NIWA 4OS2A 4Q80A 2AYWA 1KDQA 1P3EA 3ZZ8A 1LVMA 3BG4C 1O3FA 3GDSA 4FVDA 1P03A 1LKAA 3TNSA 3RXSA 1WOFA 2Q6GA 3KQBA 3MH7A 1CGJE 1UHBB 1SI5H 4UFDH 1LVYA 1ORFA 4CRFA 1G9IE 2BD7A 1GMCG 2PUXB 3K9XB 5C5OA 3VB5A 1GHBG 2TBSA 1O3PB 1FN6A 1GHAF 1DX5M 1XX9A 1QBVH 2UUJB 3LGIA 1GL0E 1C2LA 1SPJA 1DXWA 2FESH 2O8UA 2FWWA 1O3NA 3T25A 2F91A 4Y8ZA 1C2DA 3MWIU 4WY3A 2GVFA 2ZCKP 4B2AA 1OX1A 1HRTH 3BTWE 2AGGX 5HM9A 3RC6A 2A5IA 1O2RA 1CE5A 2GV6A 3EGKH 3I78A 1J14A 2ZTXA 5BRRE 1GBCA 3SU0A 3QO6A 1B7XB 3A81A 2BLWA 3FZZA 1O3LA 1C5MD 1VJAU 2BXUH 2QXIA 4WXVA 1F5KU 3QDZB 3Q77A 4Q7YA 1BMLA 2AFQB 5DGJA 2Z9LA 4JYTA 3QWCH 1FPHH 5A8XA 1AFEH 1SR5C 2J94A 1GHVH 2DE8A 3PMBB 5FXLA 6CHAB 1IQKA 4AX9H 3ZZ3A 1TPOA 1GMHF 1RTLA 1LPGB 3M3VA 4SGBE 1XUFA 4X6MA 4FU7A 3RXHA 4O3TA 1HJAC 1NRSH 2PSXA 4CRGA 2HPPH 4ZUHA 2OC8A 5IDKA 3M36A 2LNCA 3EA7A 2CN0H 3MOCA 4FUIA 2A1DB 2ZFRH 3A89A 1EASA 1EB1H 2P59A 1TGTA 2XCNA 1ID5H 1QBNA 3SBKA 5T6DA 3SGAE 4U32A 2VVVA 1RXPA 1SC8U 1PFXC 3RXKA 2HLCA 2GP9B 3PTBA 1ANDA 1A7SA 4Y76A 4CR9A 1ESBA 1GBDA 1DFPA 1ZTLA 1LPKB 4B74A 2ZEBA 3NXPA 2C8XB 1XKAC 2QN5T 2SGPE 1YPKH 2FOBA 5GCHG 6GCHF 1V2TT 3SU4A 3MU0A 1TNKA 5GXPA 4FUJA 1FI8A 1AN1E 1SQOA 4LXBH 5DP5A 3ATMA 2J34A 3LDXH 2ZDNA 3SQEE 1VGCB 1KLTA 1MAXA 2OC1A 4WVPE 2BVRH 5IYTA 2AIPA 2VH6A 1MZAA 4FUEA 3TK5A 1C5YB 4O3UA 2ZI2H 3UFAA 4UFFH 5T6FA 3DT0H 3P8FA 1A46H 2FOAA 3RXCA 1GJ8B 2FI4E 2O8LA 4AYYB 2FI3E 4Y0YE 1O3EA 3AASA 3M5NA 2FIRH 4ABHA 3M7UA 3CP7A 1H9HE 1QJ6B 3E3TA 1CVWH 1BA8B 1TWXB 4NGAH 1DSTA 2D1JA 1OP0A 2ZDLA 3QGJA 1ESAA 3HPTB 3QTOH 4AB9A 4YOJA 2SGAA 1CGIE 1O32A 5GPIB 2Z6BD 2BM2A 4OS4A 1UTJA 1QTFA 1SGTA 4QT8C 3DD2H 2SGFE 3UTUH 3VB6A 3HGPA 1O2VA 1C5ZB 1HBTH 1FY8E 1O3BA 4Y0ZE 2BY6X 3KQDA 3OTJE 3TK9A 1AZZA 1SMFE 2AH4X 5EXMA 2VNTA 4BAKB 4GHQA 4K5ZA 4IMQA 3RXMA 4LZ1H 2W7SA 2VWNA 3VFEA 1GWAA
chains in the Genus database with same CATH superfamily
2ZKSA 3Q3XA 2OCVB 2ODQA 1WYKA 4Q63A 1K1MA 3RC4A 1THSH 1UK4A 4FUGA 2SGDE 1VITG 1ELGA 3UAIC 1A3BH 4K1SA 1F2SE 2A7CA 5CHAB 2A4GA 2V3MA 5F6MA 1C5WB 1ZHRA 2BD8A 3T27A 1O2SA 5A0AE 1GI2A 1GJ9B 1UVSH 2AHME 1AUTC 1S6FA 1GJAB 1TIOA 2VGCC 2EA3A 1AB9B 2VH0A 3RXFA 1AWFH 1NO9H 4MPUA 3KIDU 1BJVA 4UEHH 1ZLRA 1MKWK 2BYAX 2B5TB 1E37B 3Q3YA 1NU7B 1AKSA 1L1NA 2A5AA 1OS8A 2FP7B 1SOTA 1EZSC 3LGYA 1YY3A 4CRCA 4X1RU 1XMNB 1W11U 2ZTZA 1XM1A 2L6OA 1TPSA 5DP7A 2OP9A 3D49H 3LU9B 1MTNC 1P2NA 5FPTA 1GI4A 1W13U 5AF9H 1W10U 1UTMA 1XVOA 4FETA 1AU8A 2BX4A 4YT7H 2XWAA 5T3HA 4A92A 3MU8A 2SNWA 1OWDA 5EJ1A 1EAIA 1BRCE 3SNCA 3FP6E 4NWKA 4ZHLU 1MTVA 5A8ZA 1M9UA 1EUFA 2QY0B 1KMHB 1LQDB 2ZU4A 2ODYB 1L2EA 5CHAC 3DSPA 2D2DA 2OC0A 3K6ZA 3AAUA 3D23A 4B1TA 2ZDKA 1P09A 2ZGJA 1S85A 2AMDA 4Z6AH 5KECA 4JYVH 2ZFFH 2QE7D 2V3HH 2G5VA 1BTWA 2FPZA 2W26A 3ZZAA 3M7TA 3O8BA 1GMCF 3E0PB 2GDDA 3GCHB 2NU2E 1AB9C 1GHBF 3WW7A 1QHRB 1NRQH 3SU6A 4DG4A 4MQAA 2IN2A 2EI6A 4TT3D 4ABBA 4I86A 5AFYH 1T4UH 2KCPA 1AD8H 4J1YA 3RXJA 1VCPA 1V2RT 2QYIA 2TIOA 3F68H 1YGCH 3OTPA 1VITH 2GKVE 1Y3WA 4B2CA 4DOQA 3RXUA 2TGPZ 4AFUA 3P6ZB 1GI7B 1S0RA 1A0LA 2OBOA 3ATWA 2PFEA 1O3IA 1C5UA 1QBOA 1GJCB 1C2MA 4GAWA 2XBVA 1YPJH 3M5OA 1JMOH 1TRNA 3LH1A 5EJLA 2JH0D 2ZQ1A 2V0BA 1PJPA 2BDAA 4O03A 3PMHB 1W0ZU 3KCGH 4FUCA 4MG3A 1SGFA 5TCAA 4HFPB 2ZGHA 2PKAB 1LKBA 1OWHA 1RIWB 4MPXA 1P0SH 4D7GA 4ZMAH 1HAXB 4OS6A 1ZMNA 1PYTC 2D26C 2H2ZA 1C2GA 1ELBA 2AIQA 4TPIZ 1BQYA 1BTUA 1PQ7A 2Y80A 3MU5A 5C20A 1JWTA 1MKXK 4HG6A 1O5DH 4RT1A 2G55A 4WMEA 1Y5AT 2Y5HA 4YTAA 1PPFE 3M37A 4XE4A 1J8AA 4U01A 5JYIA 2YMSB 1EQ9A 2BD3A 3SZNA 1WU1A 3W94A 3RXPA 1V2WT 1ZMLA 2DUCA 2WPLS 1S84A 3UIRA 2LP6A 2WSSD 2ZCLP 3EQ0H 1HAZB 2BVSH 4OS7A 2XOKD 3MH4A 1WQVH 1V2ST 4B2BA 2IPHA 4KTSA 1QIXB 2JH5D 2Y5FA 2J98A 1GI1A 9ESTA 1IQGA 1GI5A 3A88A 4NA9H 2WV5A 2ZGXH 5C0UA 1DOJA 1GGDB 2FLBH 2WUCA 2Q1JA 2NU0E 3EA8A 1P12E 1P9UA 3SNDA 1K1PA 5E2OA 1RFNA 2C4FH 3U8RH 3CS0A 1AY6H 4CRBA 4MNWA 1LHFH 2OXSA 1GHXH 4CBNA 4INHA 1A2CH 1KLIH 3SI3H 5C67A 2J92A 2ASUB 2ZGCA 3U69H 1B0FA 2ZDVH 3QLPH 4Y6DA 4NIXA 3VGCC 4WF8A 1QGFA 3VPKA 4ZROA 3Q76A 2BY9X 1HDTH 2YNBA 1BTYA 3OFND 2P93A 4MNXA 1TX6A 1LCYA 3RM2H 1HAOH 2GGVB 2A31A 3LGUA 1VCWA 1YPHC 3PWCA 3TLOA 2BLQA 3GCNA 3VEQB 2H9TH 2R3YA 5C1UA 2XC0A 1A5GH 1YWUA 2AMPA 1TA6A 4XDEA 2KFWA 1YP9A 3ZIAD 1C5OH 1ZTJA 2GCTB 3QX5H 2PGQB 2WV9A 1IHSH 1FN8A 1XUJA 1GCTB 3U8TH 1YC0A 2UUFB 4D76A 4I31A 3VG8A 2K1QA 4TSFD 2STAE 4GCHG 1TALA 3ATLA 3EE7A 3O8DA 1TNJA 2O8MA 3TGIE 1O3OA 2ZHQH 4IS5A 1GGDC 2J98B 3T26A 4XD7D 1VKYA 1CSOE 2IJOB 4CH2B 1EJMA 1LO6A 3SV9A 1D9IA 1BZXE 1BTZA 3A8AA 1BTHH 3RMNH 3RLWH 3A8BA 2WV4A 2HVYB 4JK5A 1TMTH 4E06H 1P2OA 1F0RA 1SGFG 2ZU2A 1V2PT 4RSPA 1QA0A 2WPIS 3KQEA 5JDUB 3T5FH 2QXHA 1HCGA 1ZSLA 1UTNA 2ESTE 3BG4B 1E35B 4IC6A 5DP8A 1O3HA 1QZ8A 2C93B 1Z71A 2TRMA 1QCPA 4ABDA 3BF6H 1Z8RA 3UOPA 1O2GH 2O8TA 5GDSH 1CBWC 1V2LT 3WWFA 1N6YA 2F43B 1ELCA 1MTUA 1ELDE 1FDPA 4X1QU 3AW0A 4UD9H 1G36A 4X0WU 3I77A 6ESTA 1V6DA 1H8IH 4ZXXH 1LVOA 2GCTC 1V2UT 1QQUA 3UNSA 5EPNA 1IQIA 1GCTC 2F9PA 4LK4A 3U28C 4X6PA 3GY4A 2FYQA 2QXJA 2QF4A 1FAKH 4YZUA 1MKWH 5SGAE 1O5AB 1C1VH 1F5RA 1VZQH 1Q3XA 5HYOA 1HIAA 3R3GB 3ZVEA 4A1TA 4KTUA 1T32A 2FODA 2Z7FE 3NCLA 4DJZB 4X2VA 2FYRA 2ANKH 2GMTB 1FZZA 1UJ1A 2ZCHP 1G2LA 1KXBA 1K2I1 4JYUH 4XSKU 3DSGA 4K2YA 1IAUA 3RXOA 2BB4A 1NBMD 2GDEH 4ZKSU 3I29A 1SGDE 1CHOG 4X6NA 1O3GA 4P02A 1O0DH 1ZRBA 3LGVA 2YMSD 2QC2A 5HKKD 2FM2A 2BY5X 5J4SA 1QFKH 5GIBA 4B6EA 3C1KA 1GMDF 2XBXA 1NU9A 3MYWA 3BN9A 3SUEA 4AYVB 1HJAB 2FS8A 1V2KT 2BOHB 2HGTH 1O2TA 1C4V2 1IOEA 4IBLH 1DICA 3P95A 3GISB 1AHTH 5F8TA 1DLKB 3FVFB 1KXFA 1VJ9U 1FV9A 1TYNA 4B75A 2Z3CA 3RUOA 4ASHA 3BG8A 1RS0A 3LT3A 1Z8IB 2ANMH 1CT2E 1F7ZA 3SJ9A 5HM2A 2F9OA 2J2UA 1DVAH 5JBTA 1C2JA 5JB9S 2QXGA 3TVJB 1OWIA 2Z3EA 4Y11E 1QL7A 1ZSJA 4JZDH 1DITH 1EAXA 3M35A 4JZFH 1DXPA 2BQ6B 1HXFH 2JH6D 3UR6A 3WWBA 2THFB 1COWD 3BTQE 2Y7ZA 2LELA 4D7FA 1HIAB 1S6HA 3SHCH 1FIZA 3GICB 1DWCH 4A1VA 3PLPA 1AWHB 2GMTC 1O3DA 1Y3UA 2FS9A 3P70B 1O30A 1AZ8A 1GCDA 5LPRA 1HB0B 2GCHG 2G4UA 3ENSB 5E0GA 4YLQH 3W1EA 1P11E 1H9LB 4BOHA 1BT7A 1KDQB 2FOEA 3IWMA 2ZECA 3RXRA 5C1XA 2XWBI 3FZDA 1V2MT 4DY7B 1SVPA 2C8WB 3MO3A 3GDVA 1TGNA 5DJ7A 1GJ4H 1BITA 2ZDAH 4H6SB 2W5EA 3EYDA 2VIOA 3TK6A 3PROA 2AGEX 4D8NA 2BZ6H 2VWOA 3ZVCA 1PPEE 2VIVA 1HAVA 2JDID 2CGAA 1AMHA 5ETXA 2QF5A 3F6UH 3SUGA 4A1XA 1FY4A 6LPRA 4AORA 4Y7AA 1H1BA 1GBFA 1MKXH 1DUEA 3QTVH 1WSSH 3U98H 1NRPH 1Y5BT 3SW2B 2PLXA 3SHAH 4HI3A 5KGOA 3GCTF 1L1JA 2ZU5A 3BTKE 1SB1H 4I8JA 4NCYA 3RXDA 1ETTH 4YOGA 5J4QA 1J17T 1L4ZA 5DSFA 4UE7H 2ZHDA 2G51A 1TFXA 3PTNA 2HOBA 4AC9A 1EATA 2FMJA 3E0NB 3RMMH 3VB3A 1O2MA 1J15A 4AOQA 2ZFSA 2KR7A 4RN6A 1TBRH 2BDCA 3UUZA 5HIYA 1EB2A 1ZRKA 4K8BA 1EOLA 3NKKA 1EX3A 2XNIA 3SZEA 5GNDA 1NROH 1F0SA 1HV7A 2PTCE 3UOUA 3GY8A 1LPZB 1O2OA 3Q00A 3O8RA 1K1OA 1O2ZA 1MU6B 4IN2A 3UNRA 2Q6FA 1AO5A 4OM9A 2VWLA 3VXEH 4P00A 1TRMA 3UB0A 2ANYA 2M2AA 1L4DA 1VR1H 1BRUP 3UREA 1TAWA 3RXVA 2ILNA 1OSSA 3ATIA 3SV7A 3GYLB 2ZGBH 3U1IB 1BB0B 1T8MA 5EIYA 1F92A 1T8OA 2OINA 1MQ6A 3OSYA 4NA8A 3JZ1B 5FL7D 1QRXA 2VGCB 4ABFA 1A61H 4IC5A 3P92A 2TGDA 3FN8A 1P9SA 3DCLA 2HNTF 3TPIZ 1CT0E 1GBLA 1N1LA 4B71A 3EE0B 4CBOA 3DUXH 1IQNA 1MAYA 1Y3XA 4GSOA 1AUJA 2R0LA 1IQJA 1XXFA 3N7EA 5FCKA 3NWUA 5CE1A 1ZR0A 3PO1B 2PW8H 1YF4A 2ALVA 1OHHD 1SKYE 5F03A 1O2WA 3A7TA 1C2HA 4FU8A 2J38A 4RI0A 3TGJE 3W95A 2VIWA 2HLDD 4GLYA 4FUBA 1SBWA 1MTNB 1MBQA 1SSXA 3A8DA 1TLDA 1E1RD 1G3CA 4KKDA 1K0HA 4Z1MD 4TPYA 2BDGA 2EI8A 4DURA 1HJ9A 3RMOH 2VIPA 3SNEA 3FANA 3KNXA 3SQHE 4I33A 2UWOA 2WYJA 2B8OH 5FX6A 5FAHA 3IG6B 1GPZA 2H9EH 1O3KA 4ZHMU 2BXTH 3GY6A 1FMGA 1Q31A 1FQ3A 1YM0A 1TABE 2ZA5A 4NZLA 5EJZA 1TBZH 1LHDH 4UONA 1THRH 1O2UA 3OAAD 2ZF0H 1DT2A 1MZDA 1C1UH 2Z9JA 3S7HB 3E1XB 1UVUH 3LC5A 4Q7XA 5HGGA 1MUEB 5H4IB 1K1JA 1P04A 1ANBA 1SOZA 3A84A 1QY6A 2OK5A 1JIMA 4DGJA 2BQWB 4I32A 1SL3A 5LGOA 1E36B 3LONA 3P8NA 4CR5A 2L74A 3TJOA 5JBCS 1Y5UT 1XXDA 1Z8JB 2CHAB 3PO1C 5DPAA 2BDYA 2A4RA 1HAHH 4BTTB 3S0NA 7GCHG 1T8LA 4KELA 1BMAA 1C1NA 2O8WA 1ZPCA 1J9CH 3ITIA 1GI3A 3TGKE 3V12A 1NFWA 8GCHG 4INLA 5A0CA 2GTBA 3ZVGA 1GBIA 2BLVA 3S69A 1HAPH 1BMMH 5EG4A 3RLYH 1P06A 1O2XA 3ZZ5A 3F3BA 1IHTH 2BLOA 1NZQH 1A0HB 3RM0H 4ASUD 1C5NH 1UO6A 2WPJS 3KF2A 3PRDA 4HGCA 1QURH 2Y81A 3M61U 1WDIA 3RXQA 1A4WH 2KAIA 2XW9A 4TY6A 1QRWA 4R8TB 1O5FH 1QNJA 4DVAU 2BY7X 3V7TA 5JB8S 5K0HA 3V3MA 4YESB 2PUQH 5C3NA 1OWJA 4KP0A 4NIVA 4B73A 3OY6U 1PPHE 5DP9A 1C1SA 3RU4E 1AI8H 1S83A 3V0XA 1O33A 2FO9A 1TX7A 2XYAA 1ZOMA 2WINI 4X2XA 1P02A 4XOJA 1S5SA 4WH8A 3ODFA 1AKSB 3BTME 2XTTB 4ZXYH 1N8OB 2A7JA 2ZDMA 3A7XA 4A5TS 2ODPA 3ODDA 2CHAC 1CU1A 1XUGA 1C9PA 5L30H 3Q3KA 4AN7A 2AGIX 2WPMS 1KTSB 1GHAG 3VXFH 3RC5A 3D62A 1C4U2 5C2ZA 3SV8A 1ZHPA 2Z94A 1CA0B 1WCZA 1THPB 4JZEH 3E8LA 3N7OA 1AVXA 1MQ5A 4X8VH 3S7KB 2BOKA 1SQTA 1C1WH 1QJ1B 2J4IA 1BMNH 1TX8A 3SV2H 1E1QD 1V2OT 3LGWA 4K69A 3TU7H 2PP6A 3KN2A 2ZHFH 2FLRH 3RXIA 2FX4A 2GCHF 1AGJA 3HKJB 1P2MA 1EXFA 1ZGIA 3L3TA 1ZTKA 1EJNA 1HAYB 2BDHA 2SGEE 4ZKOU 4OS5A 4ZH8A 1SGPE 5DO4H 5GWZA 3VGCB 1ZYOA 2A0QB 2VJ1A 4XRNA 2VVUA 5FBEA 4F48B 3LC3A 2KAIB 3B23B 1FY1A 1W14U 5EQQA 3URCA 3VB7A 2OBQA 4Q7ZA 4XFQA 1EJAA 3PWBA 2ZU3A 1OOKB 3S9AA 1O5GH 3NZIA 5DG6A 5HIZA 1O5CB 2D8WA 1TOCB 2FXRA 3ZVAA 2XCFA 1GJ6A 2P3UB 1TQ0B 1GMHG 4AFQA 5PTPA 4IW4E 3MTYA 2P94A 4MTBA 3F2GA 1N8OC 2FEQH 3MNBA 3A82A 1BTXA 3GY2A 1GI8B 1YPMH 2R0KA 2VVCA 1UTLM 5B6OA 1UCYK 4BANB 3UR9A 3QZRA 1QB9A 4OS1A 4E05H 3PYHA 5EOKA 3SV6A 4WXIA 2H5DA 1DS2E 5K7RA 1WBGB 1CA0C 5GCHF 1SGCA 5FBIA 3T28A 1BIOA 2RCEA 1P2JA 1O38A 3ZYDA 1RGQA 2R2WU 2SGQE 1J16A 2ZNKH 4AG1A 4I8LA 4RKJB 1P2KA 5KEDA 2A32A 1C4Y2 2IOTA 5E2PA 1DUAA 1Z6EA 5ESTE 5JBBS 1TRYA 6GCHG 3C27B 2Y7XA 4K1EA 4Y79A 5B6LA 5FHTA 4ESTE 3H7TA 1HUTH 3BIVH 2XRCA 2WZQA 3TH2H 2UUKB 2GJGA 1MD7A 1Y8TA 1SQRA 1Y3YA 4ABEA 2XBWA 2CMYA 1LDTT 5DP3A 2H9HA 2OD3B 1ANCA 2Q6DA 4X1SU 5FPSA 1YCPK 2C3SA 1CBWB 1TPPA 3ZZ9A 2P95A 3DFLA 2R3UA 1C5XB 1YLDA 5HMAA 1HGTH 5FCRA 1C9TA 1GDUA 2GZ7A 2ZWLH 5EW2H 1E79D 1G3BA 3GCOA 3GDUA 1S81A 1GBJA 1NRNH 2C90B 1LQEA 4NSYA 1HYLA 5L2ZH 4ISNA 2ZC9H 2BD5A 4NZQA 5JBAS 1C5PA 3A7YA 1BBRE 1C2IA 2TGTA 3KEEA 3ZV9A 1D6RA 2A7HA 3BV9B 5C94A 1TMBH 3F0OA 1EPTA 4BNRA 2PWXA 2ZZUH 2RA3A 2PTNA 3A86A 1EAUA 2OC7A 4WWYA 1NPMA 1P2IA 3QN7A 1DLEA 2NU3E 3STIA 1ZJDA 4BXSA 5C17A 1UTQA 1KLJH 2ZFTA 3LOXA 1PYTD 4CRDA 3AAVA 1ZHMA 1GG6B 3ESTA 2BQ7B 2QIQA 2RDEA 4WMDA 4BTIB 5DK1A 1GVZA 5A2MH 5LPEA 2AMQA 3TJNA 3MHWU 4RKOB 5EQSA 3ELAH 1ZMJA 3M3SA 2G52A 1B5GH 2W3IA 1TPAE 1GI0A 1VITF 1DE7H 4MNYA 3DHKH 1DWBH 2VIDA 3OU0A 3UQVA 4X8UH 3K6YA 1C1QA 4XBBA 4YOIA 3RXGA 4I8KA 3RXEA 3L33A 1C5VA 4MVNA 2VU8E 2Y5GA 1O31A 2PKSC 3KHVA 2BVXH 1GBMA 3B9FH 2P16A 1DPOA 5TCCA 4K3JA 4MPVA 3MNXA 4HZHA 5EXNA 5F8XA 2FX6A 1K1NA 1E38B 2NWNA 1V2NT 1UVTH 1MTWA 4FU9A 1W7XH 3KGPA 3UWJH 3RU4T 1GJBB 3HGNA 1ELEE 1C1OA 9LPRA 4Y71A 1UHBA 2KCYA 2BD2A 4DW2U 2A2QH 2AEIH 3ZV8A 2XBYA 3BTEE 1TONA 3AVZA 4DCDA 2B9LA 1HAGE 1GVKB 2V3OH 4TYDA 1SFQB 1NBME 4YLUA 1SG8B 2B0FA 2H6MA 2IPQX 1X7AC 4K1TA 3TH4H 3BEFB 8GCHF 1GG6C 5EODA 1P57B 2BZAA 3NUMA 4Z0KA 1RTFB 2QV1A 2WPDD 1JRSA 1C5RA 3EA9A 3SJKA 1TQ7B 1SGRE 1FNIA 1O37A 4JK6A 1V2QT 2CXVA 2FOFA 4KGAA 4U30A 3H5CB 4X6OA 1P2QA 4AGKA 1W0JD 2ZPSA 1DSUA 1JOUB 4NG9H 1GBAA 1KYNA 3PM3A 4FVBA 4YM9A 1WV7H 4A7IB 2ZP0H 3BIUH 1SGNE 1AQ7A 1ESTA 2B7DH 1P3CA 1U6QA 5FX5A 3TH3H 1FAXA 4FUFA 2JETC 7ESTE 2VIQA 1DY9A 5C5NA 3A83A 1Y3VA 2C8YB 1SHHB 2F83A 3LJJA 3UY9A 4ZCNA 1OXGA 1QL9A 2W7UA 3PLKA 4NWLA 1LVBA 2P8OB 1G37A 3EAJA 3HK3B 2H5CA 2FTLE 2Z9KA 4AG2A 1EPTC 2RA0A 1C2EA 4X2WA 1PPBH 1TGSZ 3P8OA 4JMYA 1NRRH 2PV9B 4NA7A 4I8GA 3FOAA 3SJ8A 3ZZDA 3SI4H 2BTCE 1PPZA 2W6JD 1O3CA 2J95A 1O5EH 1W8BH 1P8VC 5DKMA 3TNTA 2SNVA 2KX4A 3T29A 1V3XA 3SJOA 3PB1E 3T2NA 3UWIA 5G4BA 4CH8B 1YCPM 3ZZCA 1CA8B 1T7CA 3MNCA 3L6PA 2DE9A 3SGQE 5FPYA 1BHXB 2SFAA 1V2JT 2ZFPH 1NN6A 2G5NA 4B76A 2I6QA 1EZUC 3LKWA 1LHGH 3IITA 1BRAA 3GS9A 2ZTYA 1TNLA 1GDQA 2G8TA 4ZKNU 1FY5A 3E6PH 3D65E 5F8ZA 2V6NA 5AFZH 4X2YA 1F0TA 2BX3A 1UCYE 2XC4A 1XUKA 2Y82A 5CMXH 1DM4B 1CO7E 4NFFA 1H8HD 2WYGA 3B8JA 3LJOA 1INCA 1TGCA 4F55A 4GPGA 3SUFA 3GY3A 1C5SA 1P10A 2P8OC 4NFEA 1NFUA 1OYQA 1UW7A 2A4QA 3NK8A 4BAOB 1A5HA 4Y8XA 2KCOA 1D3PB 2FI5E 2JKHA 1GVLA 1T4VH 3FKSD 2F9NA 1CQQA 1NC6A 1YPGH 1K1IA 1GBEA 5L6NH 5BPEA 3V13A 1UCYH 2R9PA 4F49A 1GDNA 5LPFA 3A7ZA 3U1JB 2PR3A 1K21H 4SGAE 1XVMA 3G01A 4WJG2 2GZ9A 2WUBA 5A8YA 1BRBE 3MU1A 2Z9IA 3HKIB 2JJ1D 3M5LA 1Z7KA 1NFXA 4DT4A 1DY8A 3EDXB 1BCUH 3MI4A 4BAQB 4AB8A 3VB4A 3ZVDA 1ELVA 3JZ2B 5L2YH 4Y8YA 1ZZZA 4NIYA 5LH8A 4X1NU 1QL8A 2FDAA 2NU4E 1GJ5H 1C1RA 1AVGH 2BDBA 2CK3D 1AE8H 1NS3A 1PQAA 2OQ5A 2JJ2D 1LHCH 2EEKA 1BJUA 3F2HA 4I7YH 2ALPA 1VCQA 1DWDH 1H4WA 2YOLA 5EGMA 3R0FA 4MPWA 3TJVA 6CHAC 5EW1H 4Q4LA 1SLVB 1HAVB 3M5MA 2F9BH 3KQCA 5E8EH 1YYY1 3F9GA 1L1GA 3DFJA 1YCPH 2EI7A 3QZQA 3ZZ6A 5I46H 1P01A 1W7GH 1D3QB 2AERH 1WUNH 5JPMH 2HALA 2F9VA 1FONA 4CHAB 4LOYH 3E16B 4TY7A 2BD9A 3SGBE 1E0FD 1S0QA 1CT4E 2PGBB 4GCHF 4WMFA 1E34B 1EFRD 1Y59T 1FJSA 1GBBA 3WY8A 3N99A 1CGHA 1LTOA 3MMGA 1HXEH 4D9QA 1ZJKA 7KMEH 1RD3B 1O2IA 4H42U 1BBRK 2KCAA 2OTVA 2VWMA 1P05A 2M5TA 1EZXC 2OQUA 3QUMP 1BDAA 1OWKA 2P3TB 3NPSA 1KIGH 3A7WA 3BTTE 4O97A 1GI9B 1TGBA 4AFSA 1MMJN 4FUHA 3UPEA 1ANEA 1IQHA 3AK5A 1KSNA 4MLFB 1AIXH 1O2HA 1Z8GA 1O2QA 2A2XH 1UTKA 1L0ZA 4RT0A 1ABJH 3F9EA 1FLEE 3FAOA 3SO3A 1G32B 3A87A 1VGCC 1T8NA 4ISLA 4UDWH 1WTGH 3ATKA 1UK3A 1TNHA 2GT8A 2BDIA 4I8HA 1SGQE 2K0QA 3SU3A 3A80A 1CHGA 4ZKRU 2OLGA 8ESTE 3PV4A 1AE5A 4LZ4B 4GHTA 1EOJA 2ZO3H 1NTPA 1WXRA 1RRKA 3MH5A 4O9VA 1TMUH 1DWEH 1G30B 2G00A 3SOSA 4YXWD 4CHAC 4E7RG 3K2UA 1GBKA 3OX7U 4H4FA 2J97A 3RXBA 3F9HA 4K8YA 1HNEE 3RXLA 2VB0A 1FIWA 1O2PA 2H1UA 1C2KA 1QR3E 3MFJA 3TITA 1LMWB 4ISOA 1EZQA 2ANWA 1A0JA 4JZIA 2GV7A 4TWWA 4A6LA 2HRVA 2K8IA 2EQNA 1TNGA 3SJIA 1KXAA 2ZQ2A 1MH0A 3FP7E 4MNVA 4KTCA 1TOMH 2LPRA 1JIRA 1MU8B 4BAHB 5ESBA 3CENA 1ZSKA 2QF3A 4DT7B 1GHYH 2FOHA 5CDFE 1C1PA 3UQOA 1S82A 2XXLA 1CHOF 2PSYA 2QAAA 4F4OC 4Q2KA 2BY8X 1GI6A 4XBCA 1HFDA 1W12U 1HPGA 4XBDA 3SU1A 1MD8A 2BMGB 1BUIA 1FPCH 2BHGA 1TBQH 4Y7BA 1F5LA 2EY4C 1WAYB 3ZVBA 1OPHB 5E0HA 1O34A 3QK1A 5C0TA 2QF0A 2TPIZ 1H8ED 1EAWA 1UTPA 3TIUA 2PKAA 1O35A 1C2FA 1GL1A 1HAIH 2YNAA 4WH6A 2NU1E 2P3FH 1Z1JA 4FXGH 2V7QD 3GY5A 1NY22 1BMFD 4INKA 1MTSA 4NSVA 2TGAA 3T62A 3ZYEA 1GHZA 3RP2A 3FP8E 5I25A 1A5IA 1GMDG 5TJXA 1AFQB 2RG3A 4E7NA 3PMJA 4X1PU 3RDZA 2A5KA 1O3JA 1KTTB 3F1SB 1IQLA 3SORA 2UUYA 2W6ID 3SU2A 1C5LH 1W2KH 5EQRA 4DIIH 1UK2A 5DP4A 1K22H 4OGYA 1G3DA 1MBMA 2C8ZB 4ISHH 4JCNA 3MH6A 4AGJA 2HWLB 2QGRA 3PRBA 4ABAA 1N6XA 2G4TA 5HXFA 1S6LA 1ELTA 4AZ2B 3P17H 4FUDA 4MDSA 5A09A 3ZVFA 3RU4D 1YPLH 2BD4A 3STJA 2GZ8A 2Z9GA 2F9UA 2UWPA 1GBTA 3RXTA 3SNAA 3MO6A 1YPEH 2WPHS 3M3TA 1SLXB 3S9CA 1QA7A 1NM6A 2ZG0H 1W0YH 1D3DB 2W3KA 2CF9H 1O2YA 2UWLA 1O36A 3U9AH 1FY3A 4ACBA 3LGTA 3GYMA 1O2LA 2KM0A 2ZIQH 1SQAA 3HATH 1XUHA 3CS7A 3BTGE 1TE0A 1V2VT 3H09A 1OWEA 1HJ8A 3F9FA 2WPKS 1Z6JH 4FOUC 1XKBC 3K65B 1AFQC 4GVUA 3SYJA 1UVOA 2FZZA 5EXLA 3PMAB 4ABIA 4VGCB 2J9NA 3GCHC 1SLWB 2QA9E 1G3EA 1H9IE 3MNSA 3OEED 4TWYA 5AHGH 4D9RA 4B6FA 4ABJA 2ZU1A 1G2MA 1UMAH 2RDLA 3A8CA 3O8CA 1K1LA 2ZFQH 1ELAA 5DP6A 1PQ8A 1OP8A 4ZAEA 3SU5A 1LHEH 1XUIA 4YO9A 1IQFA 1ELFA 1PPGE 4CRAA 3MQKC 3A7VA 3OEHD 3GCTG 1SHYA 1EP6A 1ABIH 1BTPA 3LH3A 4H6TA 4THNH 2FOMB 1PQ5A 4ABGA 3P8GA 1UVPA 3KL6A 1OP2A 1BHXF 5GJ4B 2CV3A 1YLNA 3RXAA 4BTUB 1PPCE 3PV2A 4PROA 1NESE 1QRZA 5E0JA 1B0EA 1SFIA 1QQ4A 3KQ5A 1TA2A 4ZHAA 2G81E 3BTHE 3UNQA 1FUJA 1SGEE 1FX0B 3H7OA 1O3AA 1ZPZA 4UFEH 2GD4B 4DIHH 2ZPQA 1KXEA 1NFYA 2PKSB 4BXWA 1W3CA 3GOVB 1RIWC 3PLBA 3A85A 3E91A 7LPRA 2HVXA 1O39A 2XNDD 4K60A 4R0IA 1A3EH 1ACBE 4CREA 1C1MA 1EKBB 1ARBA 1A1RA 2QCYA 3OE7D 1MCTA 4AFZA 2AS9A 1TNIA 2PHBA 2Z3DA 1IQMA 1H8DH 1GBHA 2A45B 4VGCC 3AW1A 2O9QA 5EU8A 1SGYE 1C1TA 1OKXA 1ARCA 4JZ1A 8KME2 1IQEA 2WHXA 2FOCA 3E90B 1HLTH 1SLUB 1OYTH 1C5TA 3F2FA 2YMSC 1D6WA 3GY7A 1GHWH 2HNTC 3URDA 2JIZD 2STBE 3LIWA 3OY5U 4ISIH 3MU4A 1BOQA 4IGDA 3OYPA 2FTMA 4IN1A 5ABWA 1C5QA 3DA9B 3ZZ4A 1QB1A 4GUXA 3BEUA 1K28D 5T6GA 1JRTA 1BBRH 3HK6B 2GX4A 1D3TB 3N7DA 2OUAA 2ULLA 2Y6TA 3BTFE 4M7GA 1T31A 1AVWA 3PV5A 1QJ7B 3M7QA 1O2JA 1DANH 8LPRA 1YBWA 4X8TH 2V35A 1K9OE 1NT1A 1KXCA 3LPRA 3U8OH 1F0UA 3SUDA 3SN8A 1KXDA 3S9BA 2JETB 4M9FA 2ZHEH 1RJXB 2FOGA 3ZZ7A 2R2MB 1ETRH 3TJUA 2F3CE 4UFGH 1DDJA 1ZPBA 4Y10E 1Q2WA 3BTDE 4IMZA 3BSQA 1O2KA 1UTOA 3FFGA 4U2WA 2CF8H 1SGIB 2I6SA 5AVDA 5T1VA 1YPHE 3ZZBA 1GJDB 2ZHWH 1EPTB 1RTKA 7GCHF 2HPQH 3BEIB 5C1YA 2A4OA 1O3MA 1EP5A 1WTHD 3MO9A 4HTCH 5EPYA 2CJIA 1JXPA 2HNTE 2XC5A 1ZGVA 2GT7A 1ETSH 1D4PB 1WQSA 4OGXA 1O5BB 1O2NA 2KZ4A 3RMLH 5A0BA 4BAMB 2EC9H 2VINA 2ZPRA 2IJD1 4X8SH 1Z1IA 3QGNB 1KY9A 1FXYA 3SNBA 1MCVA 1YKTA 4J2YB 1GJ7B 1JBUH 1YLCA 1QB6A 4YT6H 1TB6H 4NIWA 4OS2A 4Q80A 2AYWA 1KDQA 1P3EA 3ZZ8A 1LVMA 2VBCA 3BG4C 1O3FA 3GDSA 4FVDA 1P03A 1LKAA 3TNSA 4ACAA 3RXSA 1WOFA 2Q6GA 3KQBA 3MH7A 1CGJE 1UHBB 1SI5H 4UFDH 1LVYA 1ORFA 4CRFA 1G9IE 2BD7A 1GMCG 2PUXB 3K9XB 5C5OA 3VB5A 1GHBG 2TBSA 1O3PB 1FN6A 1GHAF 1DX5M 1XX9A 1QBVH 2UUJB 3LGIA 1GL0E 1C2LA 1SPJA 1DXWA 2FESH 2O8UA 2FWWA 1MABB 1O3NA 3T25A 2F91A 4Y8ZA 1C2DA 3MWIU 4WY3A 2GVFA 2ZCKP 1W0KD 4B2AA 1OX1A 1HRTH 3BTWE 2AGGX 5HM9A 3RC6A 2A5IA 1O2RA 1CE5A 2GV6A 3EGKH 3I78A 1J14A 2ZTXA 5BRRE 5IK2D 1GBCA 3SU0A 3QO6A 1B7XB 3A81A 2BLWA 3FZZA 1O3LA 1C5MD 1VJAU 2BXUH 2QXIA 4WXVA 1F5KU 3QDZB 3Q77A 4Q7YA 1BMLA 2AFQB 2J5UA 5DN6D 5DGJA 2Z9LA 4JYTA 3QWCH 1FPHH 5A8XA 3F0PA 5CHBA 3NRLA 1AFEH 1SR5C 2J94A 1GHVH 2DE8A 3PMBB 5FXLA 6CHAB 1IQKA 4AX9H 3ZZ3A 1TPOA 1GMHF 1RTLA 1LPGB 3M3VA 4SGBE 1XUFA 4X6MA 4FU7A 3RXHA 4O3TA 1HJAC 1NRSH 2PSXA 4CRGA 2HPPH 3KYGA 4ZUHA 2OC8A 5IDKA 3M36A 3DSOA 2LNCA 3EA7A 2CN0H 3MOCA 4FUIA 2A1DB 2ZFRH 3A89A 1EASA 1EB1H 2P59A 1TGTA 2XCNA 1ID5H 1QBNA 3SBKA 5T6DA 3SGAE 4U32A 2VVVA 1RXPA 1SC8U 1PFXC 3RXKA 2HLCA 2GP9B 3PTBA 1ANDA 1A7SA 4Y76A 4CR9A 1ESBA 1GBDA 1DFPA 1ZTLA 1LPKB 4B74A 2ZEBA 3NXPA 2C8XB 1XKAC 2QN5T 2SGPE 1YPKH 2FOBA 5GCHG 6GCHF 1V2TT 3SU4A 3MU0A 1TNKA 5GXPA 4FUJA 1FI8A 1AN1E 1SQOA 4LXBH 5DP5A 3ATMA 2J34A 3LDXH 2ZDNA 3SQEE 1VGCB 1KLTA 1MAXA 2OC1A 2F4LA 3CNRA 4WVPE 2RFKC 2BVRH 5IYTA 2AIPA 2VH6A 1MZAA 4FUEA 3TK5A 1C5YB 4O3UA 2ZI2H 3UFAA 4UFFH 5T6FA 3DT0H 3P8FA 1A46H 2FOAA 3RXCA 1GJ8B 2FI4E 2O8LA 4AYYB 2FI3E 4Y0YE 1O3EA 3AASA 3M5NA 2FIRH 4ABHA 3M7UA 3CP7A 1H9HE 1QJ6B 3E3TA 1CVWH 1BA8B 1TWXB 4NGAH 1DSTA 2D1JA 1OP0A 2ZDLA 3QGJA 1ESAA 3HPTB 3QTOH 4AB9A 4YOJA 2SGAA 1CGIE 1O32A 5GPIB 5F53A 2Z6BD 2BM2A 4OS4A 1UTJA 1QTFA 1SGTA 4QT8C 3DD2H 2SGFE 3UTUH 3VB6A 3HGPA 1O2VA 1C5ZB 1HBTH 1FY8E 1O3BA 4Y0ZE 2BY6X 3KYFA 3KQDA 3OTJE 3TK9A 1AZZA 3FO8D 1SMFE 2AH4X 5EXMA 2VNTA 4BAKB 4GHQA 4K5ZA 4IMQA 3RXMA 4LZ1H 2W7SA 2VWNA 3VFEA 1GWAA
chains in the Genus database with same CATH topology
2ZKSA 3Q3XA 2OCVB 2ODQA 1WYKA 1K1MA 3RC4A 1THSH 1UK4A 4FUGA 2SGDE 1VITG 1ELGA 1A3BH 4K1SA 1F2SE 2A7CA 5CHAB 2A4GA 5F6MA 1C5WB 1ZHRA 2BD8A 3T27A 1O2SA 5A0AE 1GI2A 1GJ9B 1UVSH 1AUTC 1S6FA 1GJAB 1TIOA 2VGCC 2EA3A 1AB9B 2VH0A 3RXFA 1AWFH 1NO9H 4MPUA 3KIDU 1BJVA 4UEHH 1ZLRA 1MKWK 2BYAX 2B5TB 1E37B 3Q3YA 1NU7B 1AKSA 1L1NA 2A5AA 1OS8A 2FP7B 1SOTA 1EZSC 3LGYA 4CRCA 4X1RU 1XMNB 1W11U 2ZTZA 1XM1A 1TPSA 5DP7A 2OP9A 3D49H 3LU9B 1MTNC 1P2NA 5FPTA 1GI4A 1W13U 5AF9H 1W10U 1UTMA 1XVOA 1AU8A 2BX4A 4YT7H 2XWAA 5T3HA 4A92A 3MU8A 2SNWA 1OWDA 1EAIA 1BRCE 3SNCA 3FP6E 4NWKA 4ZHLU 1MTVA 5A8ZA 1M9UA 1EUFA 2QY0B 1LQDB 2ZU4A 2ODYB 1L2EA 5CHAC 2D2DA 2OC0A 3K6ZA 3AAUA 3D23A 4B1TA 2ZDKA 1P09A 2ZGJA 1S85A 2AMDA 4Z6AH 4JYVH 2ZFFH 2V3HH 2G5VA 1BTWA 2FPZA 2W26A 3ZZAA 3M7TA 3O8BA 1GMCF 3E0PB 2GDDA 3GCHB 2NU2E 1AB9C 1GHBF 1QHRB 1NRQH 3SU6A 4DG4A 4MQAA 2IN2A 2EI6A 4ABBA 5AFYH 1T4UH 1AD8H 4J1YA 3RXJA 1VCPA 1V2RT 2QYIA 2TIOA 3F68H 1YGCH 1VITH 2GKVE 1Y3WA 4B2CA 4DOQA 3RXUA 2TGPZ 4AFUA 3P6ZB 1GI7B 1S0RA 1A0LA 2OBOA 3ATWA 2PFEA 1O3IA 1C5UA 1QBOA 1GJCB 1C2MA 4GAWA 2XBVA 1YPJH 3M5OA 1JMOH 1TRNA 3LH1A 2JH0D 2ZQ1A 2V0BA 1PJPA 2BDAA 4O03A 3PMHB 1W0ZU 3KCGH 4FUCA 4MG3A 1SGFA 5TCAA 4HFPB 2ZGHA 2PKAB 1LKBA 1OWHA 1RIWB 4MPXA 1P0SH 4D7GA 4ZMAH 1HAXB 4OS6A 1ZMNA 1PYTC 2D26C 2H2ZA 1C2GA 1ELBA 2AIQA 4TPIZ 1BQYA 1BTUA 1PQ7A 2Y80A 3MU5A 5C20A 1JWTA 1MKXK 1O5DH 2G55A 4WMEA 1Y5AT 2Y5HA 4YTAA 1PPFE 3M37A 4XE4A 1J8AA 4U01A 5JYIA 1EQ9A 2BD3A 3SZNA 1WU1A 3W94A 3RXPA 1V2WT 1ZMLA 2DUCA 2WPLS 1S84A 3UIRA 2ZCLP 3EQ0H 1HAZB 2BVSH 4OS7A 3MH4A 1WQVH 1V2ST 4B2BA 2IPHA 4KTSA 1QIXB 2JH5D 2Y5FA 1GI1A 9ESTA 1IQGA 1GI5A 3A88A 4NA9H 2WV5A 2ZGXH 1DOJA 1GGDB 2FLBH 2WUCA 2Q1JA 2NU0E 3EA8A 1P12E 1P9UA 3SNDA 1K1PA 5E2OA 1RFNA 2C4FH 3U8RH 3CS0A 1AY6H 4CRBA 4MNWA 1LHFH 2OXSA 1GHXH 4CBNA 4INHA 1A2CH 1KLIH 3SI3H 5C67A 2J92A 2ASUB 2ZGCA 3U69H 1B0FA 2ZDVH 3QLPH 4Y6DA 4NIXA 3VGCC 4WF8A 1QGFA 3VPKA 4ZROA 3Q76A 2BY9X 1HDTH 2YNBA 1BTYA 2P93A 4MNXA 1TX6A 1LCYA 3RM2H 1HAOH 2GGVB 2A31A 3LGUA 1VCWA 1YPHC 3PWCA 3TLOA 2BLQA 3GCNA 3VEQB 2H9TH 2R3YA 5C1UA 2XC0A 1A5GH 2AMPA 1TA6A 4XDEA 1YP9A 1C5OH 1ZTJA 2GCTB 3QX5H 2PGQB 1IHSH 1FN8A 1XUJA 1GCTB 3U8TH 1YC0A 2UUFB 4D76A 4I31A 2K1QA 2STAE 4GCHG 1TALA 3ATLA 3O8DA 1TNJA 2O8MA 3TGIE 1O3OA 2ZHQH 4IS5A 1GGDC 3T26A 1CSOE 2IJOB 4CH2B 1EJMA 1LO6A 3SV9A 1D9IA 1BZXE 1BTZA 3A8AA 1BTHH 3RMNH 3RLWH 3A8BA 2WV4A 4JK5A 1TMTH 4E06H 1P2OA 1F0RA 1SGFG 2ZU2A 1V2PT 4RSPA 1QA0A 2WPIS 3KQEA 5JDUB 3T5FH 2QXHA 1HCGA 1ZSLA 1UTNA 2ESTE 3BG4B 1E35B 4IC6A 5DP8A 1O3HA 2C93B 1Z71A 2TRMA 1QCPA 4ABDA 3BF6H 1Z8RA 3UOPA 1O2GH 2O8TA 5GDSH 1CBWC 1V2LT 1N6YA 1ELCA 1MTUA 1ELDE 1FDPA 4X1QU 3AW0A 4UD9H 1G36A 4X0WU 3I77A 6ESTA 1V6DA 1H8IH 4ZXXH 1LVOA 2GCTC 1V2UT 1QQUA 3UNSA 5EPNA 1IQIA 1GCTC 2F9PA 4LK4A 4X6PA 3GY4A 2FYQA 2QXJA 4YZUA 1FAKH 5SGAE 1MKWH 1O5AB 1C1VH 1F5RA 1VZQH 1Q3XA 5HYOA 1HIAA 3R3GB 3ZVEA 4A1TA 4KTUA 1T32A 2FODA 2Z7FE 3NCLA 4DJZB 4X2VA 2FYRA 2ANKH 2GMTB 1FZZA 1UJ1A 2ZCHP 1G2LA 1KXBA 1K2I1 4JYUH 4XSKU 4K2YA 1IAUA 3RXOA 2BB4A 2GDEH 4ZKSU 3I29A 1SGDE 1CHOG 4X6NA 1O3GA 1O0DH 1ZRBA 3LGVA 2QC2A 2FM2A 2BY5X 5J4SA 1QFKH 5GIBA 3C1KA 1GMDF 2XBXA 1NU9A 3MYWA 3BN9A 3SUEA 4AYVB 1HJAB 2FS8A 1V2KT 2BOHB 2HGTH 1O2TA 1C4V2 1IOEA 4IBLH 1DICA 3P95A 3GISB 1AHTH 5F8TA 1DLKB 3FVFB 1KXFA 1VJ9U 1FV9A 1TYNA 4B75A 2Z3CA 3RUOA 4ASHA 3BG8A 1RS0A 3LT3A 1Z8IB 2ANMH 1CT2E 1F7ZA 3SJ9A 5HM2A 2F9OA 2J2UA 1DVAH 5JBTA 1C2JA 5JB9S 2QXGA 3TVJB 1OWIA 2Z3EA 4Y11E 1QL7A 1ZSJA 4JZDH 1DITH 1EAXA 3M35A 4JZFH 1DXPA 2BQ6B 1HXFH 2JH6D 3UR6A 2THFB 3BTQE 2Y7ZA 4D7FA 1HIAB 1S6HA 3SHCH 1FIZA 3GICB 1DWCH 4A1VA 3PLPA 1AWHB 2GMTC 1O3DA 1Y3UA 2FS9A 3P70B 1O30A 1AZ8A 1GCDA 5LPRA 1HB0B 2GCHG 2G4UA 3ENSB 5E0GA 4YLQH 1P11E 1H9LB 4BOHA 1BT7A 1KDQB 2FOEA 3IWMA 2ZECA 3RXRA 5C1XA 2XWBI 3FZDA 1V2MT 4DY7B 1SVPA 2C8WB 3MO3A 3GDVA 1TGNA 5DJ7A 1GJ4H 1BITA 2ZDAH 4H6SB 2W5EA 3EYDA 2VIOA 3TK6A 3PROA 2AGEX 4D8NA 2BZ6H 2VWOA 3ZVCA 1PPEE 2VIVA 1HAVA 2CGAA 1AMHA 5ETXA 3SUGA 3F6UH 4A1XA 1FY4A 6LPRA 4AORA 4Y7AA 1H1BA 1GBFA 1MKXH 1DUEA 3QTVH 1WSSH 3U98H 1NRPH 1Y5BT 3SW2B 2PLXA 3SHAH 4HI3A 3GCTF 1L1JA 2ZU5A 3BTKE 1SB1H 4I8JA 4NCYA 3RXDA 1ETTH 4YOGA 5J4QA 1J17T 1L4ZA 4UE7H 2ZHDA 2G51A 1TFXA 3PTNA 2HOBA 1EATA 2FMJA 3E0NB 3RMMH 3VB3A 1O2MA 1J15A 4AOQA 2ZFSA 4RN6A 1TBRH 2BDCA 3UUZA 1EB2A 1ZRKA 4K8BA 1EOLA 3NKKA 1EX3A 2XNIA 1NROH 1F0SA 1HV7A 2PTCE 3UOUA 3GY8A 1LPZB 1O2OA 3Q00A 3O8RA 1K1OA 1O2ZA 1MU6B 4IN2A 3UNRA 2Q6FA 1AO5A 2VWLA 3VXEH 1TRMA 2ANYA 1L4DA 1VR1H 1BRUP 3UREA 1TAWA 3RXVA 2ILNA 1OSSA 3ATIA 3SV7A 3GYLB 2ZGBH 3U1IB 1BB0B 1T8MA 1F92A 1T8OA 2OINA 1MQ6A 3OSYA 4NA8A 3JZ1B 1QRXA 2VGCB 4ABFA 1A61H 4IC5A 3P92A 2TGDA 1P9SA 3TPIZ 2HNTF 1CT0E 1GBLA 1N1LA 4B71A 3EE0B 4CBOA 3DUXH 1IQNA 1MAYA 1Y3XA 4GSOA 1AUJA 2R0LA 1IQJA 1XXFA 5FCKA 3NWUA 5CE1A 1ZR0A 3PO1B 2PW8H 1YF4A 2ALVA 5F03A 1O2WA 3A7TA 1C2HA 4FU8A 2J38A 3TGJE 3W95A 2VIWA 4GLYA 4FUBA 1SBWA 1MTNB 1MBQA 1SSXA 3A8DA 1TLDA 1G3CA 4KKDA 4TPYA 2BDGA 2EI8A 4DURA 1HJ9A 3RMOH 2VIPA 3SNEA 3FANA 3KNXA 3SQHE 4I33A 2UWOA 2WYJA 2B8OH 5FX6A 5FAHA 3IG6B 1GPZA 2H9EH 1O3KA 4ZHMU 2BXTH 3GY6A 1FMGA 1Q31A 1FQ3A 1YM0A 1TABE 2ZA5A 4NZLA 1TBZH 1LHDH 4UONA 1THRH 1O2UA 2ZF0H 1DT2A 1MZDA 1C1UH 2Z9JA 3S7HB 3E1XB 1UVUH 3LC5A 4Q7XA 5HGGA 1MUEB 5H4IB 1K1JA 1P04A 1ANBA 1SOZA 3A84A 1QY6A 1JIMA 4DGJA 2BQWB 4I32A 1SL3A 5LGOA 1E36B 3LONA 3P8NA 4CR5A 3TJOA 5JBCS 1Y5UT 1XXDA 1Z8JB 2CHAB 3PO1C 5DPAA 2BDYA 2A4RA 1HAHH 4BTTB 3S0NA 7GCHG 1T8LA 4KELA 1BMAA 1C1NA 2O8WA 1ZPCA 1J9CH 3ITIA 1GI3A 3TGKE 3V12A 1NFWA 8GCHG 4INLA 5A0CA 2GTBA 3ZVGA 1GBIA 2BLVA 3S69A 1HAPH 1BMMH 5EG4A 3RLYH 1P06A 1O2XA 3ZZ5A 1IHTH 2BLOA 1NZQH 1A0HB 3RM0H 1C5NH 1UO6A 2WPJS 3KF2A 4HGCA 1QURH 2Y81A 3M61U 3RXQA 1A4WH 2KAIA 2XW9A 4TY6A 1QRWA 4R8TB 1O5FH 1QNJA 4DVAU 2BY7X 3V7TA 5JB8S 5K0HA 3V3MA 4YESB 2PUQH 5C3NA 1OWJA 4KP0A 4NIVA 4B73A 3OY6U 1PPHE 5DP9A 1C1SA 3RU4E 1AI8H 1S83A 3V0XA 1O33A 2FO9A 1TX7A 2XYAA 1ZOMA 2WINI 4X2XA 1P02A 4XOJA 1S5SA 4WH8A 3ODFA 1AKSB 3BTME 2XTTB 4ZXYH 1N8OB 2A7JA 2ZDMA 3A7XA 4A5TS 2ODPA 3ODDA 2CHAC 1CU1A 1XUGA 1C9PA 5L30H 3Q3KA 4AN7A 2AGIX 2WPMS 1KTSB 1GHAG 3VXFH 3RC5A 3D62A 1C4U2 5C2ZA 3SV8A 1ZHPA 2Z94A 1CA0B 1WCZA 1THPB 4JZEH 3E8LA 3N7OA 1AVXA 1MQ5A 4X8VH 3S7KB 2BOKA 1SQTA 1C1WH 1QJ1B 2J4IA 1BMNH 1TX8A 3SV2H 1V2OT 3LGWA 4K69A 3TU7H 3KN2A 2ZHFH 2FLRH 3RXIA 2FX4A 2GCHF 1AGJA 3HKJB 1P2MA 1EXFA 1ZGIA 3L3TA 1ZTKA 1EJNA 1HAYB 2BDHA 2SGEE 4ZKOU 4OS5A 4ZH8A 1SGPE 5DO4H 5GWZA 3VGCB 1ZYOA 2A0QB 2VJ1A 2VVUA 5FBEA 3LC3A 2KAIB 3B23B 1FY1A 1W14U 5EQQA 3URCA 3VB7A 2OBQA 4Q7ZA 4XFQA 1EJAA 3PWBA 2ZU3A 1OOKB 3S9AA 1O5GH 3NZIA 5DG6A 1O5CB 2D8WA 1TOCB 2FXRA 3ZVAA 2XCFA 1GJ6A 2P3UB 1TQ0B 1GMHG 4AFQA 5PTPA 4IW4E 3MTYA 2P94A 4MTBA 1N8OC 2FEQH 3MNBA 3A82A 1BTXA 3GY2A 1GI8B 1YPMH 2R0KA 2VVCA 1UTLM 5B6OA 1UCYK 4BANB 3UR9A 3QZRA 1QB9A 4OS1A 4E05H 3PYHA 5EOKA 3SV6A 4WXIA 2H5DA 1DS2E 5K7RA 1WBGB 1CA0C 5GCHF 1SGCA 5FBIA 3T28A 1BIOA 2RCEA 1P2JA 1O38A 3ZYDA 1RGQA 2R2WU 2SGQE 1J16A 2ZNKH 4AG1A 4I8LA 4RKJB 1P2KA 2A32A 1C4Y2 2IOTA 5E2PA 1DUAA 1Z6EA 5ESTE 5JBBS 1TRYA 6GCHG 3C27B 2Y7XA 4K1EA 4Y79A 5FHTA 4ESTE 3H7TA 1HUTH 3BIVH 2XRCA 3TH2H 2UUKB 1MD7A 1Y8TA 1Y3YA 4ABEA 2XBWA 2CMYA 1LDTT 5DP3A 2H9HA 2OD3B 1ANCA 2Q6DA 4X1SU 5FPSA 1YCPK 2C3SA 1CBWB 1TPPA 3ZZ9A 2P95A 3DFLA 2R3UA 1C5XB 1YLDA 5HMAA 1HGTH 5FCRA 1C9TA 1GDUA 2GZ7A 2ZWLH 5EW2H 1G3BA 3GCOA 3GDUA 1S81A 1GBJA 1NRNH 2C90B 1LQEA 4NSYA 1HYLA 5L2ZH 4ISNA 2ZC9H 2BD5A 4NZQA 5JBAS 1C5PA 3A7YA 1BBRE 1C2IA 2TGTA 3KEEA 3ZV9A 1D6RA 2A7HA 3BV9B 1TMBH 1EPTA 4BNRA 2PWXA 2ZZUH 2RA3A 2PTNA 3A86A 1EAUA 2OC7A 4WWYA 1NPMA 1P2IA 3QN7A 1DLEA 2NU3E 3STIA 1ZJDA 4BXSA 1UTQA 1KLJH 2ZFTA 3LOXA 1PYTD 4CRDA 3AAVA 1ZHMA 1GG6B 3ESTA 2BQ7B 2QIQA 4WMDA 4BTIB 5DK1A 1GVZA 5A2MH 5LPEA 2AMQA 3TJNA 3MHWU 4RKOB 5EQSA 3ELAH 1ZMJA 3M3SA 2G52A 1B5GH 2W3IA 1TPAE 1GI0A 1VITF 1DE7H 4MNYA 3DHKH 1DWBH 2VIDA 3OU0A 3UQVA 4X8UH 3K6YA