3OTOE

Crystal structure of the 30s ribosomal subunit from a ksga mutant of thermus thermophilus (hb8)
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
150
structure length
150
Chain Sequence
DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Modification of 16S ribosomal RNA by the KsgA methyltransferase restructures the 30S subunit to optimize ribosome function.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S rRNA
total genus 36
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2010-09-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 3otoE01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 3otoE02
3CWVA 4PRXA 3ZM7A 5IWAE 3JAMC 4DUZI 3P1XA 1T4NA 1IBKI 3J7AM 1NHHA 2LUQA 2R3VA 4UT4A 1XMOI 3QT6A 1QZRA 3LTOA 1H7SA 2KHXA 1RQ0A 3PYGA 4X66I 4DUYE 1N0UA 4ZVIA 4WUBA 4JI6I 4JI8I 5A2QC 2E5LE 3ZZUA 1XMQE 3K1JA 2V34A 1FJGE 1X48A 5BR8E 4X65E 1D6TA 2L2KB 2OI2A 4JI7E 1IBLI 4DR6I 4LFAE 4LF4I 4M30A 4LFBI 3WU6A 2B3TB 1HNWI 4DR5I 2CZ9A 4LF8I 4KQVA 4X64I 2UXCI 2NA2A 1PVGA 1RR9A 2V2VA 1ZM2A 1KVKA 1ZM4A 2BM0A 1Z5BA 2UUCI 4WUDA 1YYKA 1ZM3A 2RSMA 4MYUA 2J7KA 4DKKA 1FWLA 1NHIA 5LMUI 2V2QA 1N32I 4RPFA 2VQFE 1N36E 2UU9I 2ZM6I 1WHQA 4B3TI 1N34E 4ED4A 1WUUA 4NXMI 5L3JA 1S16A 1B63A 4URLA 3HULA 1XNQE 3B78A 3WU4A 1GQEA 2E1RA 4JI1E 1YZ9A 1ZM9A 1FNMA 3J80C 2L2MA 1Z59A 2DMYA 4DPXA 2A2DA 2LRSA 1B62A 2EZ6A 4M2ZA 1NZ0A 1UILA 4DV1E 1U2RA 3J80Q 1XHKA 2UXCE 3OTOI 4OX9E 1N33I 4JI2I 4DR7I 2UUCE 1ZXMA 4YY3I 4DV6I 4DV4I 4DV5E 4HXZA 1Z0VA 2LTSA 4X65I 3T1YE 4YHHE 3WU5A 1Z0BA 1VISA 4DR1E 4DR6E 4LF7I 2UXDI 3K17A 1NHJA 4JI0E 4FWHA 2LTRA 4B3RI 4JYAI 1ELOA 2X7IA 5CFFE 4LF5E 3C4TA 2NUEA 4JI3E 2DEIA 2DB2A 1HNZI 2A2CA 2WW4A 4JI5E 1YYWA 2VQEE 4DV2E 2HHHI 2E5LI 4AQYE 4I3HA 4JI4I 1HR0I 1EA6A 2HFUA 1MU5A 3VYYA 4OX9I 4P7AA 4JI2E 2ZITA 4Z7CA 4LFCE 4JG4A 4M1KA 2F4VE 1X49A 2MDRA 4LF8E 1ZXNA 4DV6E 5FLXQ 5IWAI 4DPUA 2R42A 1J5EE 2L2NA 1XNQI 1EI1A 3B82A 1PKPA 1PIEA 3D4JA 2V2ZA 1Z0GA 1I94I 2NUFA 4FWGA 3Q1QA 3ADGA 4KHPI 2HK2A 1N0VC 4NXNE 4X62I 4DR3E 3GONA 4B3TE 2CPNA 4JI7I 4JYAE 4LF4E 2ZBKB 3J7Yp 4FW9A 5LMUE 2X36A 3V2UC 3ZKDA 1YYOA 2GS8A 1KKHA 5GMDA 1T4OA 1FKAE 4HY1A 1DARA 2UXBE 2HHHE 3LNUA 1IBMI 3V5RA 4DR2E 1OJ4A 3F0NA 1Z5CA 1RREA 3VYXA 4LFBE 4JI8E 4EMDA 1UEKA 2L33A 4DV3E 1J26A 1FI4A 1H72C 1KTVA 1HNXI 1S4EA 5LL6R 1Z5AA 4K0KI 2XEXA 3ZKBA 4DXLA 4DUZE 4DV1I 1Z0CA 4DV7E 1H7UA 4DR5E 4DR4E 2JVAA 1Z0TA 4LF9E 4B3RE 2UUBE 3H4LA 5A2QQ 4LFAI 4Z7YA 2EFGA 1HNZE 4JI3I 1H73A 3J81Q 2L3CA 1STUA 4GKKI 4HACA 3T1YI 4DV0I 2B7TA 1ZBTA 4B3ME 3QT5A 4DPTA 1RC7A 1XMQI 4DR1I 4MYTA 4LF6I 4GKJI 2L3JA 2HKEA 4JI6E 1XMOE 4WYQB 4P52A 4HACB 1N34I 4OOGC 1H74A 1IBME 4DPYA 4LF7E 1HNWE 4WFTA 1N33E 4DU8A 5LMNI 2VQEI 4DV2I 4JV5I 1HNXE 1IBLE 2V8PA 4X8WA 4K0KE 4JI4E 2VF3A 3LPSA 1X47A 2LJPA 1XNRI 4NXNI 4DPWA 3PYFA 4LF9I 2BM1A 2UXDE 3T1HE 2VQFI 1N36I 2UUAI 4GKKE 2N3GA 2DIXA 3ZZTA 4R1FA 4X66E 3PYDA 2BV3A 4DUYI 5IT9Q 1N32E 1MG7A 4X62E 1MX0A 4FWDA 1DI2A 1FJGI 4YY3E 5IT9C 5FLXC 1FWKA 2IHR1 5BR8I 1KIJA 1WHNA 2ZM6E 1K47A 4HYMA 4DU7A 4JI5I 4UTGA 4PU9A 3QT8A 2UXBI 1T4LB 1IBKE 1O0WA 4AQYI 2JY9A 3OTOE 2NUGA 2NPFA 4DV3I 4X64E 4LF5I 4NXME 3LLHA 3J81C 4GKJE 4DR2I 1I94E 3C4BA 4USMA 2RS7A 4DV7I 2LBSB 4KHPE 1EKZA 1A6FA 4B3SE 3B8HA 4DR4I 2AJ4A 3J7AG 2F4VI 5GMEA 2HKJA 2N3HA 3QT7A 1UHZA 2YT4A 3ADJA 4USKA 3ZZ0A 4YHHI 4XTJA 2B7VA 2LUPB 3JAMQ 1J5EI 3PYEA 4LF6E 2HK3A 3T1HI 5LMNE 1QU6A 2RTXA 2DEJA 4DR3I 2LJHA 1Z0WA 4WUCA 1HR0E 1BKNA 2UU9E 4JI0I 4PRVA 3WU3A 4B3SI 4FN5A 1Z0EA 4DV4E 4B3MI 4JV5E 4DV5I 3ADLA 2HFSA 3M6AA 3HTXA 2Q2EB 2RS6A 2UUAE 4DR7E 4JI1I 4LFCI 1XNRE 4DV0E 2UUBI 3ADIA
chains in the Genus database with same CATH superfamily
5JEAA 3CWVA 4OO1B 4PRXA 3HQ1A 3ZM7A 5IWAE 1DGCA 3JAMC 5JEAD 4DUZI 3P1XA 1T4NA 1OYSA 1IBKI 3J7AM 4LTYA 2EPXA 4ISAA 3MSWA 1RMDA 2YZTA 4X9JA 1NHHA 2LUQA 2R3VA 4UT4A 2MC5A 1XMOI 4R2PA 2BBGA 3QT6A 1QZRA 3LTOA 1H7SA 3P3GA 4MU3A 2KHXA 2VF1A 2CT1A 1RQ0A 3PYGA 4X66I 1YUIA 2O3ZA 4DUYE 1N0UA 4ZVIA 2L8TA 3PRYA 4WUBA 4JI6I 3F6HA 5EKWA 4JI8I 5K36E 1A1JA 3UHMA 5A2QC 2E5LE 2PNZA 5DNLA 4F54A 3PS2A 3JU0A 3ZZUA 1ZBQA 5DRRA 1XMQE 2DGCA 3K1JA 4TUIA 1R6MA 2ENAA 1FJGE 2V34A 1X48A 2EPZA 2EPOA 2V8QB 3AUZA 2M7QA 5BR8E 2JOXA 4X65E 2EM3A 2L2KB 1D6TA 1X3CA 4RH8A 5JEAC 2OI2A 4WX9A 2JEAA 3AV0A 2Z5BB 2MKDA 2ADRA 4O4KA 4JI7E 2HC5A 2GO3A 1IBLI 4DR6I 5K36F 4LFAE 4FW7A 2V83A 4LF4I 2EM9A 5C0XA 4M30A 1EH6A 2YSOA 1B69A 5TSEA 4LFBI 3WU6A 2BA1G 2B3TB 1HNWI 2LCEA 4DR5I 2EOMA 4N3OA 2EL5A 3MHHC 3BF2A 2CZ9A 4QNJA 2EPCA 2YTQA 1QNTA 3LMLA 4LF8I 4KQVA 1IQSA 4X64I 2EQ1A 2AE8A 2EL6A 2WBUA 2NA2A 1PVGA 4R2RA 2UXCI 3IWCA 5AASA 1RR9A 1ZM2A 2CVEA 2V2VA 1KVKA 3Q6NA 1ZM4A 2BM0A 1Z5BA 2VRDA 2YU8A 2UUCI 4WPYA 5IXMB 5AE2A 4WUDA 4FW3A 1YYKA 2EPLX 3EPJA 1ZM3A 2RSMA 4MYUA 4AIDA 3FIGA 2ODRC 2J7KA 4DKKA 1FWLA 1NHIA 1OYPA 5LMUI 2V2QA 1N32I 1YFHA 2YTJA 4LOMA 4RPFA 5DRPA 2V85A 4HTGA 2VQFE 1N36E 2UU9I 1MEYC 1UDQA 2V89A 5F3WA 4N4RB 4IS9A 2ZM6I 2EOHA 4GZNC 1WHQA 4B3TI 3H1CA 1N34E 4ED4A 2KONA 2E1MA 2M4IA 4R2QA 3PS3A 1WUUA 1USVA 2NN6A 2GLIA 5L3JA 4NXMI 1S16A 2LVHA 1B63A 2WBTA 1BBOA 4URLA 3HULA 4ZYGA 1XNQE 3B78A 2FV4B 4BHCA 3WU4A 1GQEA 2BB8A 2E1RA 2PO1B 3K85A 4JI1E 1YZ9A 1ZM9A 2YRHA 1X5WA 1IQOA 1FNMA 2EM0A 4WXCA 3J80C 4IFDB 2L2MA 1WRJA 1Z59A 2JE6A 4IFDD 2DMYA 4IZJD 4DPXA 3BIDA 1T39A 2LRSA 2A2DA 1B62A 3CDIA 2CTDA 4WSGA 2YTPA 3EPLA 3HKMA 2EZ6A 4M2ZA 1NZ0A 1UILA 4DV1E 1U2RA 3J80Q 1XHKA 2EPNA 2UXCE 3OTOI 4OX9E 1N33I 2JE6B 2ELYA 2YTNA 4R03A 4JI2I 4DR7I 1YH8A 2EJ4A 2UUCE 2EMKA 1ZXMA 4YY3I 4DV6I 4DV4I 4R8OA 2LJUA 2PO0B 4DV5E 2WBSA 4OO1C 4HXZA 1Z0VA 2GHFA 2EPMX 4KZSA 2GQ0A 2LTSA 2FGGA 4X65I 4MDTA 4J8ZA 3T1YE 4YHHE 4BC9A 3WU5A 2EOZA 2I9IA 1P42A 1Z0BA 4AM3A 1VISA 4DR1E 2EMXA 2NN6F 4DR6E 4F6MA 3U1KA 1YHCA 5A6JA 5C0XE 1NEIA 2ELZA 5DNYA 2GO4A 2O1UA 3U1YA 4LF7I 2UXDI 3K17A 1NHJA 3PS1A 3THNA 1Y6ZA 2MC6A 4JI0E 2I13A 4FWHA 2LTRA 4B3RI 5JEAB 4JYAI 1ELOA 2IERA 1ZU1A 2X7IA 2F8BA 2O1VA 5CFFE 4LF5E 3C4TA 2NUEA 4R2DA 2EOQA 4JI3E 2DEIA 2DB2A 1HNZI 3M85G 2A2CA 2NN6D 1AAYA 2L92A 2WW4A 4JI5E 4BBYA 5IV8B 2EM5A 1YYWA 2A25A 1ZAAC 4LCFA 5JEAF 2YU5A 2VQEE 4DV2E 2HHHI 4I8OA 4F2JC 2EQ0A 4GQUA 2E5LI 5C0XC 1PJSA 2EMGA 3GMEA 4AQYE 4TUGA 4I3HA 4JI4I 1UBDC 1HR0I 1EA6A 2HFUA 1MU5A 2EL4A 2Q8UA 1SR9A 3VYYA 4OX9I 4P7AA 4JI2E 1KJKA 3DJWA 2BR2B 2ZITA 4Z7CA 5FWKA 4LFCE 2YTDA 3BGHA 3HPZA 2F4VE 4JG4A 1X49A 2ENCA 2MDRA 4LF8E 1ZXNA 4LCGA 4M1KA 5C0XF 4DV6E 2DSYA 2NN6E 4BA1A 5FLXQ 2PNMA 4DPUA 5IWAI 5KL7A 1T38A 1A1IA 5A6BD 2CSHA 2EP3A 1J5EE 2R42A 2YTEA 3HJCA 4MU4A 2L2NA 2FTXB 1XNQI 1EI1A 3B82A 4OZEA 1PKPA 1PIEA 4ZYHA 2BR2A 1GZ6A 3D4JA 2LMZA 2V2ZA 4P78A 2YSPA 2EMIA 2C39A 1Z0GA 4BHBA 5DRQA 1BBGA 4BA1B 1I94I 2NUFA 5DROA 5C0XD 4FWGA 3QG5C 3ADGA 4MU0A 2HK2A 3Q1QA 1N0VC 4NXNE 1E3PA 4X62I 4KHPI 4FW4A 3JTZA 5K36B 4DR3E 3GONA 4B3TE 2CPNA 2J7JA 4JI7I 4JYAE 4IFDC 2NN6C 5A69A 4ZYDA 4IJDA 4LF4E 2ZBKB 2K4VA 5T6JA 2EOSA 2EOXA 3J7Yp 1YSAC 2LO3A 1UDOA 4FW9A 5AC4A 2EMAA 5LMUE 2X36A 3V2UC 3TQMA 1YYOA 3ZKDA 3C6KA 3HXLA 4P7DA 1USUA 2H36X 2VE7C 2YTOA 1KKHA 2GS8A 3ZOQB 5GMDA 2Z5EA 3EQ1A 1T4OA 4U3BA 1FKAE 5K36A 3L7ZB 1DARA 2UXBE 2JEBB 2HHHE 3LNUA 4HY1A 4LCHA 5EL9A 3V5RA 1IBMI 4DR2E 2IOPA 2PO2A 4AIMA 2D9HA 1A1GA 1OJ4A 3DD6A 2EMBA 3F0NA 4OKGA 4WXDA 1Z5CA 1RREA 2EM4A 3VYXA 3OMLA 4LFBE 4JI8E 1WXRA 1UEKA 2WNRA 4EMDA 2M1SA 2L33A 4DV3E 1J26A 1JK1A 1FI4A 2JYAA 1H72C 1KTVA 4U3DA 1HNXI 1S4EA 5LL6R 1Z5AA 4K0KI 2V86A 2XEXA 3ZKBA 4DXLA 2JEBA 2R1FA 2EN7A 4DUZE 3IWBA 1RHYA 1TN9A 4DV1I 5A6KA 1Z0CA 1YUJA 4DV7E 1H7UA 4DR5E 1PJTA 3KZYA 2DLQA 1Z1BA 4DR4E 5JEAE 2JVAA 1Z0TA 2LV2A 2BA1D 4LF9E 4B3RE 2UUBE 5DNXA 4BMJA 3H4LA 5A2QQ 4LFAI 3P3EA 4Z7YA 5ADZA 4BS9A 2EFGA 1HNZE 4JI3I 2YRKA 1A1HA 1X6FA 3H09A 2L3CA 1H73A 1STUA 3KZZA 1VI7A 2C38A 3J81Q 4GKKI 5K36C 2L6MA 4HACA 3T1YI 4DV0I 2B7TA 1ZBTA 1KYQA 2G7HA 4B3ME 3QT5A 4DPTA 1RC7A 2E72A 1XMQI 4DR1I 2EMHA 4MYTA 4LF6I 1EH7A 1WJPA 2JWOA 2Z5CB 3M7NG 4GKJI 2L3JA 3KWRA 2HKEA 2IOQA 1DQ3A 2EOIA 3THOB 3VK6A 4JI6E 3M7ND 1XMOE 4WYQB 4IZKB 2O1TA 4HACB 4P52A 1N34I 4FW5A 2EPKX 3M99B 4OOGC 1H74A 3P76A 4J3DA 3GLLA 5ELWA 1IBME 4R2CA 2EOEA 4DPYA 2EM8A 4LF7E 4F6NA 1TF3A 1HNWE 4RHBB 4WFTA 1N33E 3P06A 4DU8A 1X6EA 5LMNI 2EN3A 1BB8A 4IZKA 3ECRA 1MGTA 2VQEI 4DV2I 4JV5I 3P3CA 1HNXE 1IBLE 2CG9A 2O1WA 2V8PA 5K36D 4X8WA 2V87A 4K0KE 4JI4E 4BCAA 5A6AA 2VF3A 3LPSA 1X47A 2YRMA 2EPAA 2LJPA 1XNRI 2M9AA 4NHRA 4NXNI 4DPWA 1Y60A 3PYFA 3KRNA 2K7IA 4QNKA 1GTKA 4M0VA 4LU9A 4LF9I 3EPKA 1A1KA 2JP9A 2BM1A 2UXDE 3T1HE 2VQFI 1N36I 2EN6A 2UUAI 4R2EA 4GKKE 1ZR9A 2N3GA 3MHSC 2DMIA 2KOUA 2HGHA 2DIXA 4OO1D 2EM2A 2VESA 2PNZB 2LE2A 4R1FA 3ZZTA 1X6HA 4X66E 3PYDA 2BV3A 2RQLA 2N8XA 4DUYI 2YTGA 2EOJA 2RPCA 4MQYA 4IFDE 1PDAA 2EMCA 1N32E 5IT9Q 4R2AA 1MG7A 4X62E 1A1LA 1MX0A 2YTIA 4FWDA 4IS1C 2JEAB 2Z5BA 1A1FA 1DI2A 4BA2A 2LT7A 4YY3E 2WZOA 5IT9C 1FJGI 1SFEA 5FLXC 1FWKA 2IHR1 4F9BB 2B9DA 5BR8I 2EPPA 5C0XB 2HJJA 3BBGA 4FK5C 2WP8A 4BC7A 1KIJA 2EMFA 1WHNA 2V88A 2ZM6E 1PJQA 4DMIA 4O43A 5KL6A 1K47A 4HYMA 4DU7A 1EH8A 2ODRD 2JOBA 2BA0D 4PU9A 4UTGA 4JI5I 4OO1F 2JXPA 1NCSA 2JR1A 2C39B 2EMYA 3QT8A 2UXBI 1T4LB 4BA2B 1IBKE 5AE1A 1O0WA 4MLQA 2JY9A 3L00A 4AQYI 2EN8A 3OTOE 2NUGA 3EPHA 4WSPA 1E3HA 2IESA 2WP8B 5AE3A 1N3GA 2NPFA 4ZYEA 1Y5YA 2EMZA 4DV3I 2NABA 4X64E 4FW6A 4LF5I 2R76A 4NXME 3LLHA 2EOFA 2EOYA 3J81C 4GKJE 3GCMA 4R2SA 4DR2I 1I94E 3C4BA 1OYRA 5KL2A 4USMA 1G2FC 2RS7A 2JT2A 4KWYA 4DV7I 2LBSB 2YWQA 1EKZA 4KHPE 1A6FA 4B3SE 4M9VC 3B8HA 4DR4I 2EN2A 2MDGA 4F9CB 2AJ4A 3L7ZA 3J7AG 2F4VI 2EMLA 5GMEA 2HKJA 2N3HA 3CDJA 2PO2B 1F2IG 3QT7A 2CGEA 2EPUA 1HK7A 1UN6B 2NN6B 1UHZA 1YPNA 2EORA 2YPNA 2YT4A 4IZJB 3ADJA 2RSIA 4HEIA 2WNRB 2PRTA 4USKA 3M85D 3ZZ0A 2EN4A 4YHHI 4XTJA 1UDNA 2EOOA 2PO1A 2B7VA 3F6GA 2DRPA 2LUPB 3DF6A 1AH5A 2EM7A 4IFDA 1LLMC 3JAMQ 2EQ3A 3Q6MA 1UDSA 4IZJA 4NBQA 1JK2A 1J5EI 1TF6A 2DLKA 3PYEA 2GPIA 4Q28A 2EE8A 2EM6A 1P47A 4OO1E 2EN1A 3NZKA 4GEQB 4LF6E 5KL3A 1Y4SA 2F1DA 2C38B 2HK3A 1Y4UA 5AC5A 3UK3C 3T1HI 1IMUA 2EPRA 3B4TA 5LMNE 1QU6A 3VHTB 3RMPA 2RTXA 2C37B 2DEJA 4DR3I 4L8NA 2LJHA 3K6QA 2Z5CA 1Z0WA 2PO0A 4IFDF 3IWDA 4WUCA 2ENHA 4O24A 1HR0E 1BKNA 1R6LA 2PNLA 2UU9E 4Q35B 1G2DC 2JPAA 4JI0I 4PRVA 3C6MA 1XXEA 3WU3A 4LPFA 4MU1A 2EMWA 4FN5A 2YTFA 1Z0EA 5KL5A 2C37A 2J65A 4DV4E 4OO1A 4B3SI 4L5NC 4B3MI 4JV5E 2BA0G 4DV5I 2EWLA 2WCC3 3ADLA 5KL4A 2HFSA 4O5GA 3M6AA 5A6BA 3HTXA 2Q2EB 2RS6A 1L4SA 5LLQA 2MKNA 3HPSA 4F9AB 4NZVA 2UUAE 4MLVA 4DR7E 4JI1I 4LFCI 1XNRE 4DV0E 2UUBI 3ADIA
chains in the Genus database with same CATH topology
3CWVA 4PRXA 3HQ1A 3ZM7A 5IWAE 3JAMC 4DUZI 3P1XA 1T4NA 1IBKI 3J7AM 4LTYA 3MSWA 2YZTA 1NHHA 2LUQA 2R3VA 4UT4A 2MC5A 1XMOI 3QT6A 1QZRA 3LTOA 1H7SA 2KHXA 2VF1A 1RQ0A 3PYGA 4X66I 4DUYE 1N0UA 4ZVIA 2L8TA 3PRYA 4WUBA 4JI6I 3F6HA 4JI8I 5A2QC 2E5LE 4F54A 3JU0A 3ZZUA 1ZBQA 1XMQE 3K1JA 4TUIA 2V34A 1FJGE 1X48A 2V8QB 3AUZA 2M7QA 5BR8E 2JOXA 4X65E 1D6TA 2L2KB 2OI2A 3AV0A 2Z5BB 4JI7E 1IBLI 4DR6I 4LFAE 2V83A 4LF4I 4M30A 4LFBI 3WU6A 2B3TB 1HNWI 4DR5I 4N3OA 2CZ9A 3LMLA 4LF8I 4KQVA 4X64I 2UXCI 2NA2A 1PVGA 3IWCA 5AASA 1RR9A 1ZM2A 2V2VA 1KVKA 3Q6NA 1ZM4A 2BM0A 1Z5BA 2UUCI 4WPYA 5AE2A 4WUDA 1YYKA 1ZM3A 2RSMA 4MYUA 3FIGA 2ODRC 2J7KA 4DKKA 1FWLA 1NHIA 5LMUI 2V2QA 1N32I 4RPFA 2V85A 2VQFE 1N36E 2UU9I 2V89A 5F3WA 2ZM6I 1WHQA 4B3TI 1N34E 4ED4A 2KONA 2E1MA 2M4IA 1WUUA 1USVA 4NXMI 5L3JA 1S16A 1B63A 4URLA 3HULA 1XNQE 3B78A 2FV4B 3WU4A 1GQEA 2E1RA 3K85A 4JI1E 1YZ9A 1ZM9A 1FNMA 3J80C 2L2MA 1Z59A 2DMYA 4IZJD 4DPXA 2A2DA 2LRSA 1B62A 2EZ6A 4M2ZA 1NZ0A 1UILA 4DV1E 1U2RA 3J80Q 1XHKA 2UXCE 3OTOI 4OX9E 1N33I 4R03A 4JI2I 4DR7I 2UUCE 1ZXMA 4YY3I 4DV6I 4DV4I 4R8OA 4DV5E 4HXZA 1Z0VA 4KZSA 2GQ0A 2LTSA 2FGGA 4X65I 4J8ZA 3T1YE 4YHHE 4BC9A 3WU5A 1Z0BA 1VISA 4DR1E 4DR6E 4LF7I 2O1UA 5DNYA 2UXDI 3K17A 1NHJA 1Y6ZA 2MC6A 4JI0E 4FWHA 2LTRA 4B3RI 4JYAI 1ELOA 2X7IA 2F8BA 2O1VA 5CFFE 4LF5E 3C4TA 2NUEA 4JI3E 2DEIA 2DB2A 1HNZI 2A2CA 2L92A 2WW4A 4JI5E 4BBYA 1YYWA 2VQEE 4DV2E 2HHHI 4I8OA 2E5LI 4AQYE 4TUGA 4I3HA 4JI4I 1HR0I 1EA6A 2HFUA 1MU5A 1SR9A 3VYYA 4OX9I 4P7AA 4JI2E 3DJWA 2ZITA 4Z7CA 5FWKA 4LFCE 2F4VE 3HPZA 4JG4A 1X49A 2MDRA 4LF8E 1ZXNA 4M1KA 4DV6E 2DSYA 5FLXQ 2PNMA 4DPUA 5IWAI 2R42A 3HJCA 1J5EE 2L2NA 2FTXB 1XNQI 1EI1A 3B82A 1PKPA 1PIEA 1GZ6A 3D4JA 2LMZA 2V2ZA 4P78A 1Z0GA 1I94I 2NUFA 4FWGA 3Q1QA 3ADGA 4KHPI 2HK2A 1N0VC 4NXNE 4X62I 3JTZA 4DR3E 3GONA 4B3TE 2CPNA 4JI7I 4JYAE 4LF4E 2ZBKB 2K4VA 5T6JA 3J7Yp 4FW9A 5LMUE 2X36A 3V2UC 3ZKDA 1YYOA 3HXLA 4P7DA 1USUA 2GS8A 2H36X 2VE7C 1KKHA 3ZOQB 5GMDA 2Z5EA 1T4OA 1FKAE 4HY1A 1DARA 2UXBE 2HHHE 3LNUA 1IBMI 3V5RA 4DR2E 2IOPA 1OJ4A 3F0NA 1Z5CA 1RREA 3VYXA 3OMLA 4LFBE 4JI8E 1WXRA 1UEKA 4EMDA 2M1SA 2L33A 4DV3E 1J26A 1FI4A 1H72C 1KTVA 1HNXI 1S4EA 5LL6R 1Z5AA 4K0KI 2V86A 2XEXA 3ZKBA 4DXLA 4DUZE 3IWBA 4DV1I 1Z0CA 4DV7E 1H7UA 4DR5E 4DR4E 2JVAA 1Z0TA 4LF9E 4B3RE 2UUBE 4BMJA 3H4LA 5A2QQ 4LFAI 4Z7YA 5ADZA 4BS9A 2EFGA 1HNZE 4JI3I 1H73A 3H09A 3J81Q 2L3CA 1STUA 4GKKI 2L6MA 4HACA 3T1YI 4DV0I 2B7TA 1ZBTA 2G7HA 4B3ME 3QT5A 4DPTA 1RC7A 1XMQI 4DR1I 4MYTA 4LF6I 2JWOA 2Z5CB 4GKJI 2L3JA 3KWRA 2HKEA 2IOQA 1DQ3A 3VK6A 4JI6E 1XMOE 4WYQB 4IZKB 2O1TA 4HACB 4P52A 1N34I 4OOGC 1H74A 1IBME 4DPYA 4LF7E 1HNWE 4WFTA 1N33E 3P06A 4DU8A 5LMNI 4IZKA 2VQEI 4DV2I 4JV5I 1HNXE 1IBLE 2CG9A 2O1WA 2V8PA 4X8WA 2V87A 4K0KE 4JI4E 4BCAA 2VF3A 3LPSA 1X47A 2LJPA 1XNRI 4NXNI 4DPWA 3PYFA 4M0VA 4LU9A 4LF9I 2BM1A 2UXDE 3T1HE 2VQFI 1N36I 2UUAI 4GKKE 2N3GA 2KOUA 2DIXA 3ZZTA 2LE2A 4R1FA 4X66E 3PYDA 2BV3A 4DUYI 5IT9Q 1N32E 1MG7A 4X62E 1MX0A 4FWDA 2Z5BA 1DI2A 1FJGI 4YY3E 2WZOA 5IT9C 5FLXC 1FWKA 2IHR1 4F9BB 2B9DA 5BR8I 4BC7A 1KIJA 1WHNA 2V88A 2ZM6E 1K47A 4DMIA 4HYMA 4DU7A 2ODRD 2JOBA 4UTGA 4PU9A 4JI5I 2JR1A 3QT8A 2UXBI 1T4LB 1IBKE 5AE1A 1O0WA 4AQYI 2JY9A 3OTOE 2NUGA 2NPFA 4WSPA 5AE3A 4DV3I 4X64E 4LF5I 4NXME 3LLHA 3J81C 4GKJE 4DR2I 1I94E 3C4BA 4USMA 2RS7A 4DV7I 2LBSB 4KHPE 1EKZA 1A6FA 4B3SE 3B8HA 4DR4I 4F9CB 2AJ4A 3J7AG 2F4VI 5GMEA 2HKJA 2N3HA 3QT7A 2CGEA 1HK7A 1UHZA 2YT4A 4IZJB 3ADJA 4USKA 3ZZ0A 4YHHI 4XTJA 2B7VA 3F6GA 2LUPB 3DF6A 3JAMQ 3Q6MA 4IZJA 1J5EI 3PYEA 4Q28A 4GEQB 4LF6E 1Y4SA 2HK3A 1Y4UA 3T1HI 5LMNE 1QU6A 3RMPA 2RTXA 2DEJA 4DR3I 4L8NA 2LJHA 3K6QA 2Z5CA 1Z0WA 3IWDA 4WUCA 1HR0E 1BKNA 2PNLA 2UU9E 4JI0I 4PRVA 3WU3A 4B3SI 4FN5A 1Z0EA 4DV4E 4B3MI 4L5NC 4JV5E 4DV5I 2EWLA 3ADLA 2HFSA 3M6AA 3HTXA 2Q2EB 2RS6A 3HPSA 4F9AB 2UUAE 4DR7E 4JI1I 4LFCI 1XNRE 4DV0E 2UUBI 3ADIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CWV A;  4PRX A;  3ZM7 A;  5IWA E;  3JAM C;  4DUZ I;  3P1X A;  1T4N A;  1IBK I;  3J7A M;  1NHH A;  2LUQ A;  2R3V A;  4UT4 A;  1XMO I;  3QT6 A;  1QZR A;  3LTO A;  1H7S A;  2KHX A;  1RQ0 A;  3PYG A;  4X66 I;  4DUY E;  1N0U A;  4ZVI A;  4WUB A;  4JI6 I;  4JI8 I;  5A2Q C;  2E5L E;  3ZZU A;  1XMQ E;  3K1J A;  2V34 A;  1FJG E;  1X48 A;  5BR8 E;  4X65 E;  1D6T A;  2L2K B;  2OI2 A;  4JI7 E;  1IBL I;  4DR6 I;  4LFA E;  4LF4 I;  4M30 A;  4LFB I;  3WU6 A;  2B3T B;  1HNW I;  4DR5 I;  2CZ9 A;  4LF8 I;  4KQV A;  4X64 I;  2UXC I;  2NA2 A;  1PVG A;  1RR9 A;  2V2V A;  1ZM2 A;  1KVK A;  1ZM4 A;  2BM0 A;  1Z5B A;  2UUC I;  4WUD A;  1YYK A;  1ZM3 A;  2RSM A;  4MYU A;  2J7K A;  4DKK A;  1FWL A;  1NHI A;  5LMU I;  2V2Q A;  1N32 I;  4RPF A;  2VQF E;  1N36 E;  2UU9 I;  2ZM6 I;  1WHQ A;  4B3T I;  1N34 E;  4ED4 A;  1WUU A;  4NXM I;  5L3J A;  1S16 A;  1B63 A;  4URL A;  3HUL A;  1XNQ E;  3B78 A;  3WU4 A;  1GQE A;  2E1R A;  4JI1 E;  1YZ9 A;  1ZM9 A;  1FNM A;  3J80 C;  2L2M A;  1Z59 A;  2DMY A;  4DPX A;  2A2D A;  2LRS A;  1B62 A;  2EZ6 A;  4M2Z A;  1NZ0 A;  1UIL A;  4DV1 E;  1U2R A;  3J80 Q;  1XHK A;  2UXC E;  3OTO I;  4OX9 E;  1N33 I;  4JI2 I;  4DR7 I;  2UUC E;  1ZXM A;  4YY3 I;  4DV6 I;  4DV4 I;  4DV5 E;  4HXZ A;  1Z0V A;  2LTS A;  4X65 I;  3T1Y E;  4YHH E;  3WU5 A;  1Z0B A;  1VIS A;  4DR1 E;  4DR6 E;  4LF7 I;  2UXD I;  3K17 A;  1NHJ A;  4JI0 E;  4FWH A;  2LTR A;  4B3R I;  4JYA I;  1ELO A;  2X7I A;  5CFF E;  4LF5 E;  3C4T A;  2NUE A;  4JI3 E;  2DEI A;  2DB2 A;  1HNZ I;  2A2C A;  2WW4 A;  4JI5 E;  1YYW A;  2VQE E;  4DV2 E;  2HHH I;  2E5L I;  4AQY E;  4I3H A;  4JI4 I;  1HR0 I;  1EA6 A;  2HFU A;  1MU5 A;  3VYY A;  4OX9 I;  4P7A A;  4JI2 E;  2ZIT A;  4Z7C A;  4LFC E;  4JG4 A;  4M1K A;  2F4V E;  1X49 A;  2MDR A;  4LF8 E;  1ZXN A;  4DV6 E;  5FLX Q;  5IWA I;  4DPU A;  2R42 A;  1J5E E;  2L2N A;  1XNQ I;  1EI1 A;  3B82 A;  1PKP A;  1PIE A;  3D4J A;  2V2Z A;  1Z0G A;  1I94 I;  2NUF A;  4FWG A;  3Q1Q A;  3ADG A;  4KHP I;  2HK2 A;  1N0V C;  4NXN E;  4X62 I;  4DR3 E;  3GON A;  4B3T E;  2CPN A;  4JI7 I;  4JYA E;  4LF4 E;  2ZBK B;  3J7Y p;  4FW9 A;  5LMU E;  2X36 A;  3V2U C;  3ZKD A;  1YYO A;  2GS8 A;  1KKH A;  5GMD A;  1T4O A;  1FKA E;  4HY1 A;  1DAR A;  2UXB E;  2HHH E;  3LNU A;  1IBM I;  3V5R A;  4DR2 E;  1OJ4 A;  3F0N A;  1Z5C A;  1RRE A;  3VYX A;  4LFB E;  4JI8 E;  4EMD A;  1UEK A;  2L33 A;  4DV3 E;  1J26 A;  1FI4 A;  1H72 C;  1KTV A;  1HNX I;  1S4E A;  5LL6 R;  1Z5A A;  4K0K I;  2XEX A;  3ZKB A;  4DXL A;  4DUZ E;  4DV1 I;  1Z0C A;  4DV7 E;  1H7U A;  4DR5 E;  4DR4 E;  2JVA A;  1Z0T A;  4LF9 E;  4B3R E;  2UUB E;  3H4L A;  5A2Q Q;  4LFA I;  4Z7Y A;  2EFG A;  1HNZ E;  4JI3 I;  1H73 A;  3J81 Q;  2L3C A;  1STU A;  4GKK I;  4HAC A;  3T1Y I;  4DV0 I;  2B7T A;  1ZBT A;  4B3M E;  3QT5 A;  4DPT A;  1RC7 A;  1XMQ I;  4DR1 I;  4MYT A;  4LF6 I;  4GKJ I;  2L3J A;  2HKE A;  4JI6 E;  1XMO E;  4WYQ B;  4P52 A;  4HAC B;  1N34 I;  4OOG C;  1H74 A;  1IBM E;  4DPY A;  4LF7 E;  1HNW E;  4WFT A;  1N33 E;  4DU8 A;  5LMN I;  2VQE I;  4DV2 I;  4JV5 I;  1HNX E;  1IBL E;  2V8P A;  4X8W A;  4K0K E;  4JI4 E;  2VF3 A;  3LPS A;  1X47 A;  2LJP A;  1XNR I;  4NXN I;  4DPW A;  3PYF A;  4LF9 I;  2BM1 A;  2UXD E;  3T1H E;  2VQF I;  1N36 I;  2UUA I;  4GKK E;  2N3G A;  2DIX A;  3ZZT A;  4R1F A;  4X66 E;  3PYD A;  2BV3 A;  4DUY I;  5IT9 Q;  1N32 E;  1MG7 A;  4X62 E;  1MX0 A;  4FWD A;  1DI2 A;  1FJG I;  4YY3 E;  5IT9 C;  5FLX C;  1FWK A;  2IHR 1;  5BR8 I;  1KIJ A;  1WHN A;  2ZM6 E;  1K47 A;  4HYM A;  4DU7 A;  4JI5 I;  4UTG A;  4PU9 A;  3QT8 A;  2UXB I;  1T4L B;  1IBK E;  1O0W A;  4AQY I;  2JY9 A;  3OTO E;  2NUG A;  2NPF A;  4DV3 I;  4X64 E;  4LF5 I;  4NXM E;  3LLH A;  3J81 C;  4GKJ E;  4DR2 I;  1I94 E;  3C4B A;  4USM A;  2RS7 A;  4DV7 I;  2LBS B;  4KHP E;  1EKZ A;  1A6F A;  4B3S E;  3B8H A;  4DR4 I;  2AJ4 A;  3J7A G;  2F4V I;  5GME A;  2HKJ A;  2N3H A;  3QT7 A;  1UHZ A;  2YT4 A;  3ADJ A;  4USK A;  3ZZ0 A;  4YHH I;  4XTJ A;  2B7V A;  2LUP B;  3JAM Q;  1J5E I;  3PYE A;  4LF6 E;  2HK3 A;  3T1H I;  5LMN E;  1QU6 A;  2RTX A;  2DEJ A;  4DR3 I;  2LJH A;  1Z0W A;  4WUC A;  1HR0 E;  1BKN A;  2UU9 E;  4JI0 I;  4PRV A;  3WU3 A;  4B3S I;  4FN5 A;  1Z0E A;  4DV4 E;  4B3M I;  4JV5 E;  4DV5 I;  3ADL A;  2HFS A;  3M6A A;  3HTX A;  2Q2E B;  2RS6 A;  2UUA E;  4DR7 E;  4JI1 I;  4LFC I;  1XNR E;  4DV0 E;  2UUB I;  3ADI A; 
#chains in the Genus database with same CATH topology
 5JEA A;  3CWV A;  4OO1 B;  4PRX A;  3HQ1 A;  3ZM7 A;  5IWA E;  1DGC A;  3JAM C;  5JEA D;  4DUZ I;  3P1X A;  1T4N A;  1OYS A;  1IBK I;  3J7A M;  4LTY A;  2EPX A;  4ISA A;  3MSW A;  1RMD A;  2YZT A;  4X9J A;  1NHH A;  2LUQ A;  2R3V A;  4UT4 A;  2MC5 A;  1XMO I;  4R2P A;  2BBG A;  3QT6 A;  1QZR A;  3LTO A;  1H7S A;  3P3G A;  4MU3 A;  2KHX A;  2VF1 A;  2CT1 A;  1RQ0 A;  3PYG A;  4X66 I;  1YUI A;  2O3Z A;  4DUY E;  1N0U A;  4ZVI A;  2L8T A;  3PRY A;  4WUB A;  4JI6 I;  3F6H A;  5EKW A;  4JI8 I;  5K36 E;  1A1J A;  3UHM A;  5A2Q C;  2E5L E;  2PNZ A;  5DNL A;  4F54 A;  3PS2 A;  3JU0 A;  3ZZU A;  1ZBQ A;  5DRR A;  1XMQ E;  2DGC A;  3K1J A;  4TUI A;  1R6M A;  2ENA A;  1FJG E;  2V34 A;  1X48 A;  2EPZ A;  2EPO A;  2V8Q B;  3AUZ A;  2M7Q A;  5BR8 E;  2JOX A;  4X65 E;  2EM3 A;  2L2K B;  1D6T A;  1X3C A;  4RH8 A;  5JEA C;  2OI2 A;  4WX9 A;  2JEA A;  3AV0 A;  2Z5B B;  2MKD A;  2ADR A;  4O4K A;  4JI7 E;  2HC5 A;  2GO3 A;  1IBL I;  4DR6 I;  5K36 F;  4LFA E;  4FW7 A;  2V83 A;  4LF4 I;  2EM9 A;  5C0X A;  4M30 A;  1EH6 A;  2YSO A;  1B69 A;  5TSE A;  4LFB I;  3WU6 A;  2BA1 G;  2B3T B;  1HNW I;  2LCE A;  4DR5 I;  2EOM A;  4N3O A;  2EL5 A;  3MHH C;  3BF2 A;  2CZ9 A;  4QNJ A;  2EPC A;  2YTQ A;  1QNT A;  3LML A;  4LF8 I;  4KQV A;  1IQS A;  4X64 I;  2EQ1 A;  2AE8 A;  2EL6 A;  2WBU A;  2NA2 A;  1PVG A;  4R2R A;  2UXC I;  3IWC A;  5AAS A;  1RR9 A;  1ZM2 A;  2CVE A;  2V2V A;  1KVK A;  3Q6N A;  1ZM4 A;  2BM0 A;  1Z5B A;  2VRD A;  2YU8 A;  2UUC I;  4WPY A;  5IXM B;  5AE2 A;  4WUD A;  4FW3 A;  1YYK A;  2EPL X;  3EPJ A;  1ZM3 A;  2RSM A;  4MYU A;  4AID A;  3FIG A;  2ODR C;  2J7K A;  4DKK A;  1FWL A;  1NHI A;  1OYP A;  5LMU I;  2V2Q A;  1N32 I;  1YFH A;  2YTJ A;  4LOM A;  4RPF A;  5DRP A;  2V85 A;  4HTG A;  2VQF E;  1N36 E;  2UU9 I;  1MEY C;  1UDQ A;  2V89 A;  5F3W A;  4N4R B;  4IS9 A;  2ZM6 I;  2EOH A;  4GZN C;  1WHQ A;  4B3T I;  3H1C A;  1N34 E;  4ED4 A;  2KON A;  2E1M A;  2M4I A;  4R2Q A;  3PS3 A;  1WUU A;  1USV A;  2NN6 A;  2GLI A;  5L3J A;  4NXM I;  1S16 A;  2LVH A;  1B63 A;  2WBT A;  1BBO A;  4URL A;  3HUL A;  4ZYG A;  1XNQ E;  3B78 A;  2FV4 B;  4BHC A;  3WU4 A;  1GQE A;  2BB8 A;  2E1R A;  2PO1 B;  3K85 A;  4JI1 E;  1YZ9 A;  1ZM9 A;  2YRH A;  1X5W A;  1IQO A;  1FNM A;  2EM0 A;  4WXC A;  3J80 C;  4IFD B;  2L2M A;  1WRJ A;  1Z59 A;  2JE6 A;  4IFD D;  2DMY A;  4IZJ D;  4DPX A;  3BID A;  1T39 A;  2LRS A;  2A2D A;  1B62 A;  3CDI A;  2CTD A;  4WSG A;  2YTP A;  3EPL A;  3HKM A;  2EZ6 A;  4M2Z A;  1NZ0 A;  1UIL A;  4DV1 E;  1U2R A;  3J80 Q;  1XHK A;  2EPN A;  2UXC E;  3OTO I;  4OX9 E;  1N33 I;  2JE6 B;  2ELY A;  2YTN A;  4R03 A;  4JI2 I;  4DR7 I;  1YH8 A;  2EJ4 A;  2UUC E;  2EMK A;  1ZXM A;  4YY3 I;  4DV6 I;  4DV4 I;  4R8O A;  2LJU A;  2PO0 B;  4DV5 E;  2WBS A;  4OO1 C;  4HXZ A;  1Z0V A;  2GHF A;  2EPM X;  4KZS A;  2GQ0 A;  2LTS A;  2FGG A;  4X65 I;  4MDT A;  4J8Z A;  3T1Y E;  4YHH E;  4BC9 A;  3WU5 A;  2EOZ A;  2I9I A;  1P42 A;  1Z0B A;  4AM3 A;  1VIS A;  4DR1 E;  2EMX A;  2NN6 F;  4DR6 E;  4F6M A;  3U1K A;  1YHC A;  5A6J A;  5C0X E;  1NEI A;  2ELZ A;  5DNY A;  2GO4 A;  2O1U A;  3U1Y A;  4LF7 I;  2UXD I;  3K17 A;  1NHJ A;  3PS1 A;  3THN A;  1Y6Z A;  2MC6 A;  4JI0 E;  2I13 A;  4FWH A;  2LTR A;  4B3R I;  5JEA B;  4JYA I;  1ELO A;  2IER A;  1ZU1 A;  2X7I A;  2F8B A;  2O1V A;  5CFF E;  4LF5 E;  3C4T A;  2NUE A;  4R2D A;  2EOQ A;  4JI3 E;  2DEI A;  2DB2 A;  1HNZ I;  3M85 G;  2A2C A;  2NN6 D;  1AAY A;  2L92 A;  2WW4 A;  4JI5 E;  4BBY A;  5IV8 B;  2EM5 A;  1YYW A;  2A25 A;  1ZAA C;  4LCF A;  5JEA F;  2YU5 A;  2VQE E;  4DV2 E;  2HHH I;  4I8O A;  4F2J C;  2EQ0 A;  4GQU A;  2E5L I;  5C0X C;  1PJS A;  2EMG A;  3GME A;  4AQY E;  4TUG A;  4I3H A;  4JI4 I;  1UBD C;  1HR0 I;  1EA6 A;  2HFU A;  1MU5 A;  2EL4 A;  2Q8U A;  1SR9 A;  3VYY A;  4OX9 I;  4P7A A;  4JI2 E;  1KJK A;  3DJW A;  2BR2 B;  2ZIT A;  4Z7C A;  5FWK A;  4LFC E;  2YTD A;  3BGH A;  3HPZ A;  2F4V E;  4JG4 A;  1X49 A;  2ENC A;  2MDR A;  4LF8 E;  1ZXN A;  4LCG A;  4M1K A;  5C0X F;  4DV6 E;  2DSY A;  2NN6 E;  4BA1 A;  5FLX Q;  2PNM A;  4DPU A;  5IWA I;  5KL7 A;  1T38 A;  1A1I A;  5A6B D;  2CSH A;  2EP3 A;  1J5E E;  2R42 A;  2YTE A;  3HJC A;  4MU4 A;  2L2N A;  2FTX B;  1XNQ I;  1EI1 A;  3B82 A;  4OZE A;  1PKP A;  1PIE A;  4ZYH A;  2BR2 A;  1GZ6 A;  3D4J A;  2LMZ A;  2V2Z A;  4P78 A;  2YSP A;  2EMI A;  2C39 A;  1Z0G A;  4BHB A;  5DRQ A;  1BBG A;  4BA1 B;  1I94 I;  2NUF A;  5DRO A;  5C0X D;  4FWG A;  3QG5 C;  3ADG A;  4MU0 A;  2HK2 A;  3Q1Q A;  1N0V C;  4NXN E;  1E3P A;  4X62 I;  4KHP I;  4FW4 A;  3JTZ A;  5K36 B;  4DR3 E;  3GON A;  4B3T E;  2CPN A;  2J7J A;  4JI7 I;  4JYA E;  4IFD C;  2NN6 C;  5A69 A;  4ZYD A;  4IJD A;  4LF4 E;  2ZBK B;  2K4V A;  5T6J A;  2EOS A;  2EOX A;  3J7Y p;  1YSA C;  2LO3 A;  1UDO A;  4FW9 A;  5AC4 A;  2EMA A;  5LMU E;  2X36 A;  3V2U C;  3TQM A;  1YYO A;  3ZKD A;  3C6K A;  3HXL A;  4P7D A;  1USU A;  2H36 X;  2VE7 C;  2YTO A;  1KKH A;  2GS8 A;  3ZOQ B;  5GMD A;  2Z5E A;  3EQ1 A;  1T4O A;  4U3B A;  1FKA E;  5K36 A;  3L7Z B;  1DAR A;  2UXB E;  2JEB B;  2HHH E;  3LNU A;  4HY1 A;  4LCH A;  5EL9 A;  3V5R A;  1IBM I;  4DR2 E;  2IOP A;  2PO2 A;  4AIM A;  2D9H A;  1A1G A;  1OJ4 A;  3DD6 A;  2EMB A;  3F0N A;  4OKG A;  4WXD A;  1Z5C A;  1RRE A;  2EM4 A;  3VYX A;  3OML A;  4LFB E;  4JI8 E;  1WXR A;  1UEK A;  2WNR A;  4EMD A;  2M1S A;  2L33 A;  4DV3 E;  1J26 A;  1JK1 A;  1FI4 A;  2JYA A;  1H72 C;  1KTV A;  4U3D A;  1HNX I;  1S4E A;  5LL6 R;  1Z5A A;  4K0K I;  2V86 A;  2XEX A;  3ZKB A;  4DXL A;  2JEB A;  2R1F A;  2EN7 A;  4DUZ E;  3IWB A;  1RHY A;  1TN9 A;  4DV1 I;  5A6K A;  1Z0C A;  1YUJ A;  4DV7 E;  1H7U A;  4DR5 E;  1PJT A;  3KZY A;  2DLQ A;  1Z1B A;  4DR4 E;  5JEA E;  2JVA A;  1Z0T A;  2LV2 A;  2BA1 D;  4LF9 E;  4B3R E;  2UUB E;  5DNX A;  4BMJ A;  3H4L A;  5A2Q Q;  4LFA I;  3P3E A;  4Z7Y A;  5ADZ A;  4BS9 A;  2EFG A;  1HNZ E;  4JI3 I;  2YRK A;  1A1H A;  1X6F A;  3H09 A;  2L3C A;  1H73 A;  1STU A;  3KZZ A;  1VI7 A;  2C38 A;  3J81 Q;  4GKK I;  5K36 C;  2L6M A;  4HAC A;  3T1Y I;  4DV0 I;  2B7T A;  1ZBT A;  1KYQ A;  2G7H A;  4B3M E;  3QT5 A;  4DPT A;  1RC7 A;  2E72 A;  1XMQ I;  4DR1 I;  2EMH A;  4MYT A;  4LF6 I;  1EH7 A;  1WJP A;  2JWO A;  2Z5C B;  3M7N G;  4GKJ I;  2L3J A;  3KWR A;  2HKE A;  2IOQ A;  1DQ3 A;  2EOI A;  3THO B;  3VK6 A;  4JI6 E;  3M7N D;  1XMO E;  4WYQ B;  4IZK B;  2O1T A;  4HAC B;  4P52 A;  1N34 I;  4FW5 A;  2EPK X;  3M99 B;  4OOG C;  1H74 A;  3P76 A;  4J3D A;  3GLL A;  5ELW A;  1IBM E;  4R2C A;  2EOE A;  4DPY A;  2EM8 A;  4LF7 E;  4F6N A;  1TF3 A;  1HNW E;  4RHB B;  4WFT A;  1N33 E;  3P06 A;  4DU8 A;  1X6E A;  5LMN I;  2EN3 A;  1BB8 A;  4IZK A;  3ECR A;  1MGT A;  2VQE I;  4DV2 I;  4JV5 I;  3P3C A;  1HNX E;  1IBL E;  2CG9 A;  2O1W A;  2V8P A;  5K36 D;  4X8W A;  2V87 A;  4K0K E;  4JI4 E;  4BCA A;  5A6A A;  2VF3 A;  3LPS A;  1X47 A;  2YRM A;  2EPA A;  2LJP A;  1XNR I;  2M9A A;  4NHR A;  4NXN I;  4DPW A;  1Y60 A;  3PYF A;  3KRN A;  2K7I A;  4QNK A;  1GTK A;  4M0V A;  4LU9 A;  4LF9 I;  3EPK A;  1A1K A;  2JP9 A;  2BM1 A;  2UXD E;  3T1H E;  2VQF I;  1N36 I;  2EN6 A;  2UUA I;  4R2E A;  4GKK E;  1ZR9 A;  2N3G A;  3MHS C;  2DMI A;  2KOU A;  2HGH A;  2DIX A;  4OO1 D;  2EM2 A;  2VES A;  2PNZ B;  2LE2 A;  4R1F A;  3ZZT A;  1X6H A;  4X66 E;  3PYD A;  2BV3 A;  2RQL A;  2N8X A;  4DUY I;  2YTG A;  2EOJ A;  2RPC A;  4MQY A;  4IFD E;  1PDA A;  2EMC A;  1N32 E;  5IT9 Q;  4R2A A;  1MG7 A;  4X62 E;  1A1L A;  1MX0 A;  2YTI A;  4FWD A;  4IS1 C;  2JEA B;  2Z5B A;  1A1F A;  1DI2 A;  4BA2 A;  2LT7 A;  4YY3 E;  2WZO A;  5IT9 C;  1FJG I;  1SFE A;  5FLX C;  1FWK A;  2IHR 1;  4F9B B;  2B9D A;  5BR8 I;  2EPP A;  5C0X B;  2HJJ A;  3BBG A;  4FK5 C;  2WP8 A;  4BC7 A;  1KIJ A;  2EMF A;  1WHN A;  2V88 A;  2ZM6 E;  1PJQ A;  4DMI A;  4O43 A;  5KL6 A;  1K47 A;  4HYM A;  4DU7 A;  1EH8 A;  2ODR D;  2JOB A;  2BA0 D;  4PU9 A;  4UTG A;  4JI5 I;  4OO1 F;  2JXP A;  1NCS A;  2JR1 A;  2C39 B;  2EMY A;  3QT8 A;  2UXB I;  1T4L B;  4BA2 B;  1IBK E;  5AE1 A;  1O0W A;  4MLQ A;  2JY9 A;  3L00 A;  4AQY I;  2EN8 A;  3OTO E;  2NUG A;  3EPH A;  4WSP A;  1E3H A;  2IES A;  2WP8 B;  5AE3 A;  1N3G A;  2NPF A;  4ZYE A;  1Y5Y A;  2EMZ A;  4DV3 I;  2NAB A;  4X64 E;  4FW6 A;  4LF5 I;  2R76 A;  4NXM E;  3LLH A;  2EOF A;  2EOY A;  3J81 C;  4GKJ E;  3GCM A;  4R2S A;  4DR2 I;  1I94 E;  3C4B A;  1OYR A;  5KL2 A;  4USM A;  1G2F C;  2RS7 A;  2JT2 A;  4KWY A;  4DV7 I;  2LBS B;  2YWQ A;  1EKZ A;  4KHP E;  1A6F A;  4B3S E;  4M9V C;  3B8H A;  4DR4 I;  2EN2 A;  2MDG A;  4F9C B;  2AJ4 A;  3L7Z A;  3J7A G;  2F4V I;  2EML A;  5GME A;  2HKJ A;  2N3H A;  3CDJ A;  2PO2 B;  1F2I G;  3QT7 A;  2CGE A;  2EPU A;  1HK7 A;  1UN6 B;  2NN6 B;  1UHZ A;  1YPN A;  2EOR A;  2YPN A;  2YT4 A;  4IZJ B;  3ADJ A;  2RSI A;  4HEI A;  2WNR B;  2PRT A;  4USK A;  3M85 D;  3ZZ0 A;  2EN4 A;  4YHH I;  4XTJ A;  1UDN A;  2EOO A;  2PO1 A;  2B7V A;  3F6G A;  2DRP A;  2LUP B;  3DF6 A;  1AH5 A;  2EM7 A;  4IFD A;  1LLM C;  3JAM Q;  2EQ3 A;  3Q6M A;  1UDS A;  4IZJ A;  4NBQ A;  1JK2 A;  1J5E I;  1TF6 A;  2DLK A;  3PYE A;  2GPI A;  4Q28 A;  2EE8 A;  2EM6 A;  1P47 A;  4OO1 E;  2EN1 A;  3NZK A;  4GEQ B;  4LF6 E;  5KL3 A;  1Y4S A;  2F1D A;  2C38 B;  2HK3 A;  1Y4U A;  5AC5 A;  3UK3 C;  3T1H I;  1IMU A;  2EPR A;  3B4T A;  5LMN E;  1QU6 A;  3VHT B;  3RMP A;  2RTX A;  2C37 B;  2DEJ A;  4DR3 I;  4L8N A;  2LJH A;  3K6Q A;  2Z5C A;  1Z0W A;  2PO0 A;  4IFD F;  3IWD A;  4WUC A;  2ENH A;  4O24 A;  1HR0 E;  1BKN A;  1R6L A;  2PNL A;  2UU9 E;  4Q35 B;  1G2D C;  2JPA A;  4JI0 I;  4PRV A;  3C6M A;  1XXE A;  3WU3 A;  4LPF A;  4MU1 A;  2EMW A;  4FN5 A;  2YTF A;  1Z0E A;  5KL5 A;  2C37 A;  2J65 A;  4DV4 E;  4OO1 A;  4B3S I;  4L5N C;  4B3M I;  4JV5 E;  2BA0 G;  4DV5 I;  2EWL A;  2WCC 3;  3ADL A;  5KL4 A;  2HFS A;  4O5G A;  3M6A A;  5A6B A;  3HTX A;  2Q2E B;  2RS6 A;  1L4S A;  5LLQ A;  2MKN A;  3HPS A;  4F9A B;  4NZV A;  2UUA E;  4MLV A;  4DR7 E;  4JI1 I;  4LFC I;  1XNR E;  4DV0 E;  2UUB I;  3ADI A; 
#chains in the Genus database with same CATH homology
 3CWV A;  4PRX A;  3HQ1 A;  3ZM7 A;  5IWA E;  3JAM C;  4DUZ I;  3P1X A;  1T4N A;  1IBK I;  3J7A M;  4LTY A;  3MSW A;  2YZT A;  1NHH A;  2LUQ A;  2R3V A;  4UT4 A;  2MC5 A;  1XMO I;  3QT6 A;  1QZR A;  3LTO A;  1H7S A;  2KHX A;  2VF1 A;  1RQ0 A;  3PYG A;  4X66 I;  4DUY E;  1N0U A;  4ZVI A;  2L8T A;  3PRY A;  4WUB A;  4JI6 I;  3F6H A;  4JI8 I;  5A2Q C;  2E5L E;  4F54 A;  3JU0 A;  3ZZU A;  1ZBQ A;  1XMQ E;  3K1J A;  4TUI A;  2V34 A;  1FJG E;  1X48 A;  2V8Q B;  3AUZ A;  2M7Q A;  5BR8 E;  2JOX A;  4X65 E;  1D6T A;  2L2K B;  2OI2 A;  3AV0 A;  2Z5B B;  4JI7 E;  1IBL I;  4DR6 I;  4LFA E;  2V83 A;  4LF4 I;  4M30 A;  4LFB I;  3WU6 A;  2B3T B;  1HNW I;  4DR5 I;  4N3O A;  2CZ9 A;  3LML A;  4LF8 I;  4KQV A;  4X64 I;  2UXC I;  2NA2 A;  1PVG A;  3IWC A;  5AAS A;  1RR9 A;  1ZM2 A;  2V2V A;  1KVK A;  3Q6N A;  1ZM4 A;  2BM0 A;  1Z5B A;  2UUC I;  4WPY A;  5AE2 A;  4WUD A;  1YYK A;  1ZM3 A;  2RSM A;  4MYU A;  3FIG A;  2ODR C;  2J7K A;  4DKK A;  1FWL A;  1NHI A;  5LMU I;  2V2Q A;  1N32 I;  4RPF A;  2V85 A;  2VQF E;  1N36 E;  2UU9 I;  2V89 A;  5F3W A;  2ZM6 I;  1WHQ A;  4B3T I;  1N34 E;  4ED4 A;  2KON A;  2E1M A;  2M4I A;  1WUU A;  1USV A;  4NXM I;  5L3J A;  1S16 A;  1B63 A;  4URL A;  3HUL A;  1XNQ E;  3B78 A;  2FV4 B;  3WU4 A;  1GQE A;  2E1R A;  3K85 A;  4JI1 E;  1YZ9 A;  1ZM9 A;  1FNM A;  3J80 C;  2L2M A;  1Z59 A;  2DMY A;  4IZJ D;  4DPX A;  2A2D A;  2LRS A;  1B62 A;  2EZ6 A;  4M2Z A;  1NZ0 A;  1UIL A;  4DV1 E;  1U2R A;  3J80 Q;  1XHK A;  2UXC E;  3OTO I;  4OX9 E;  1N33 I;  4R03 A;  4JI2 I;  4DR7 I;  2UUC E;  1ZXM A;  4YY3 I;  4DV6 I;  4DV4 I;  4R8O A;  4DV5 E;  4HXZ A;  1Z0V A;  4KZS A;  2GQ0 A;  2LTS A;  2FGG A;  4X65 I;  4J8Z A;  3T1Y E;  4YHH E;  4BC9 A;  3WU5 A;  1Z0B A;  1VIS A;  4DR1 E;  4DR6 E;  4LF7 I;  2O1U A;  5DNY A;  2UXD I;  3K17 A;  1NHJ A;  1Y6Z A;  2MC6 A;  4JI0 E;  4FWH A;  2LTR A;  4B3R I;  4JYA I;  1ELO A;  2X7I A;  2F8B A;  2O1V A;  5CFF E;  4LF5 E;  3C4T A;  2NUE A;  4JI3 E;  2DEI A;  2DB2 A;  1HNZ I;  2A2C A;  2L92 A;  2WW4 A;  4JI5 E;  4BBY A;  1YYW A;  2VQE E;  4DV2 E;  2HHH I;  4I8O A;  2E5L I;  4AQY E;  4TUG A;  4I3H A;  4JI4 I;  1HR0 I;  1EA6 A;  2HFU A;  1MU5 A;  1SR9 A;  3VYY A;  4OX9 I;  4P7A A;  4JI2 E;  3DJW A;  2ZIT A;  4Z7C A;  5FWK A;  4LFC E;  2F4V E;  3HPZ A;  4JG4 A;  1X49 A;  2MDR A;  4LF8 E;  1ZXN A;  4M1K A;  4DV6 E;  2DSY A;  5FLX Q;  2PNM A;  4DPU A;  5IWA I;  2R42 A;  3HJC A;  1J5E E;  2L2N A;  2FTX B;  1XNQ I;  1EI1 A;  3B82 A;  1PKP A;  1PIE A;  1GZ6 A;  3D4J A;  2LMZ A;  2V2Z A;  4P78 A;  1Z0G A;  1I94 I;  2NUF A;  4FWG A;  3Q1Q A;  3ADG A;  4KHP I;  2HK2 A;  1N0V C;  4NXN E;  4X62 I;  3JTZ A;  4DR3 E;  3GON A;  4B3T E;  2CPN A;  4JI7 I;  4JYA E;  4LF4 E;  2ZBK B;  2K4V A;  5T6J A;  3J7Y p;  4FW9 A;  5LMU E;  2X36 A;  3V2U C;  3ZKD A;  1YYO A;  3HXL A;  4P7D A;  1USU A;  2GS8 A;  2H36 X;  2VE7 C;  1KKH A;  3ZOQ B;  5GMD A;  2Z5E A;  1T4O A;  1FKA E;  4HY1 A;  1DAR A;  2UXB E;  2HHH E;  3LNU A;  1IBM I;  3V5R A;  4DR2 E;  2IOP A;  1OJ4 A;  3F0N A;  1Z5C A;  1RRE A;  3VYX A;  3OML A;  4LFB E;  4JI8 E;  1WXR A;  1UEK A;  4EMD A;  2M1S A;  2L33 A;  4DV3 E;  1J26 A;  1FI4 A;  1H72 C;  1KTV A;  1HNX I;  1S4E A;  5LL6 R;  1Z5A A;  4K0K I;  2V86 A;  2XEX A;  3ZKB A;  4DXL A;  4DUZ E;  3IWB A;  4DV1 I;  1Z0C A;  4DV7 E;  1H7U A;  4DR5 E;  4DR4 E;  2JVA A;  1Z0T A;  4LF9 E;  4B3R E;  2UUB E;  4BMJ A;  3H4L A;  5A2Q Q;  4LFA I;  4Z7Y A;  5ADZ A;  4BS9 A;  2EFG A;  1HNZ E;  4JI3 I;  1H73 A;  3H09 A;  3J81 Q;  2L3C A;  1STU A;  4GKK I;  2L6M A;  4HAC A;  3T1Y I;  4DV0 I;  2B7T A;  1ZBT A;  2G7H A;  4B3M E;  3QT5 A;  4DPT A;  1RC7 A;  1XMQ I;  4DR1 I;  4MYT A;  4LF6 I;  2JWO A;  2Z5C B;  4GKJ I;  2L3J A;  3KWR A;  2HKE A;  2IOQ A;  1DQ3 A;  3VK6 A;  4JI6 E;  1XMO E;  4WYQ B;  4IZK B;  2O1T A;  4HAC B;  4P52 A;  1N34 I;  4OOG C;  1H74 A;  1IBM E;  4DPY A;  4LF7 E;  1HNW E;  4WFT A;  1N33 E;  3P06 A;  4DU8 A;  5LMN I;  4IZK A;  2VQE I;  4DV2 I;  4JV5 I;  1HNX E;  1IBL E;  2CG9 A;  2O1W A;  2V8P A;  4X8W A;  2V87 A;  4K0K E;  4JI4 E;  4BCA A;  2VF3 A;  3LPS A;  1X47 A;  2LJP A;  1XNR I;  4NXN I;  4DPW A;  3PYF A;  4M0V A;  4LU9 A;  4LF9 I;  2BM1 A;  2UXD E;  3T1H E;  2VQF I;  1N36 I;  2UUA I;  4GKK E;  2N3G A;  2KOU A;  2DIX A;  3ZZT A;  2LE2 A;  4R1F A;  4X66 E;  3PYD A;  2BV3 A;  4DUY I;  5IT9 Q;  1N32 E;  1MG7 A;  4X62 E;  1MX0 A;  4FWD A;  2Z5B A;  1DI2 A;  1FJG I;  4YY3 E;  2WZO A;  5IT9 C;  5FLX C;  1FWK A;  2IHR 1;  4F9B B;  2B9D A;  5BR8 I;  4BC7 A;  1KIJ A;  1WHN A;  2V88 A;  2ZM6 E;  1K47 A;  4DMI A;  4HYM A;  4DU7 A;  2ODR D;  2JOB A;  4UTG A;  4PU9 A;  4JI5 I;  2JR1 A;  3QT8 A;  2UXB I;  1T4L B;  1IBK E;  5AE1 A;  1O0W A;  4AQY I;  2JY9 A;  3OTO E;  2NUG A;  2NPF A;  4WSP A;  5AE3 A;  4DV3 I;  4X64 E;  4LF5 I;  4NXM E;  3LLH A;  3J81 C;  4GKJ E;  4DR2 I;  1I94 E;  3C4B A;  4USM A;  2RS7 A;  4DV7 I;  2LBS B;  4KHP E;  1EKZ A;  1A6F A;  4B3S E;  3B8H A;  4DR4 I;  4F9C B;  2AJ4 A;  3J7A G;  2F4V I;  5GME A;  2HKJ A;  2N3H A;  3QT7 A;  2CGE A;  1HK7 A;  1UHZ A;  2YT4 A;  4IZJ B;  3ADJ A;  4USK A;  3ZZ0 A;  4YHH I;  4XTJ A;  2B7V A;  3F6G A;  2LUP B;  3DF6 A;  3JAM Q;  3Q6M A;  4IZJ A;  1J5E I;  3PYE A;  4Q28 A;  4GEQ B;  4LF6 E;  1Y4S A;  2HK3 A;  1Y4U A;  3T1H I;  5LMN E;  1QU6 A;  3RMP A;  2RTX A;  2DEJ A;  4DR3 I;  4L8N A;  2LJH A;  3K6Q A;  2Z5C A;  1Z0W A;  3IWD A;  4WUC A;  1HR0 E;  1BKN A;  2PNL A;  2UU9 E;  4JI0 I;  4PRV A;  3WU3 A;  4B3S I;  4FN5 A;  1Z0E A;  4DV4 E;  4B3M I;  4L5N C;  4JV5 E;  4DV5 I;  2EWL A;  3ADL A;  2HFS A;  3M6A A;  3HTX A;  2Q2E B;  2RS6 A;  3HPS A;  4F9A B;  2UUA E;  4DR7 E;  4JI1 I;  4LFC I;  1XNR E;  4DV0 E;  2UUB I;  3ADI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...