3OTOE

Crystal structure of the 30s ribosomal subunit from a ksga mutant of thermus thermophilus (hb8)
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
150
structure length
150
Chain Sequence
DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title Modification of 16S ribosomal RNA by the KsgA methyltransferase restructures the 30S subunit to optimize ribosome function.
pubmed doi rcsb
molecule tags Ribosome
total genus 36
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2010-09-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 3otoE01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 3otoE02
4FN5A 4HACA 4PU9A 4FWGA 4JI8I 1ZM2A 1IBKI 4GKJI 4DU7A 1NHJA 4ZVIA 4UTGA 4DUZE 4DR1I 1ZM4A 3M6AA 4P52A 1Z5CA 2VQEE 1I94E 3D4JA 3VYYA 2RS6A 3B82A 2RS7A 4P7AA 3ADIA 4ED4A 4LFAI 1XMOE 1X49A 3T1HE 2L3JA 2V2VA 4DUYI 2HHHI 2DEIA 2B3TB 4DPWA 5L3JA 1MX0A 2N3GA 4KHPE 2L33A 4B3SI 1O0WA 3ADJA 5IWAE 4M2ZA 4KQVA 4JI7I 4LFBE 3ZZ0A 2XEXA 4LFCE 2A2CA 1X48A 4JI0E 2HK3A 2V2ZA 1PKPA 4DV1E 1Z0GA 4KHPI 4RPFA 4WUBA 4X62E 4X66E 1S4EA 4JI4E 2JVAA 2E5LE 4JI1E 1KIJA 2V2QA 1FKAE 4JV5E 2DEJA 2MDRA 4HACB 4JI0I 4WYQB 1UEKA 1N34E 4B3ME 5IT9C 4B3RE 1KTVA 4OX9I 4LF7I 3VYXA 4MYUA 4DV7E 4URLA 4LF4I 3T1YI 1FI4A 3OTOE 5BR8E 4NXMI 2UUAE 4DR2I 4DV6I 2UXCI 4JYAE 3ZKDA 4K0KE 2UU9E 4DV0E 1NZ0A 1ZXMA 4Z7CA 5GMDA 1N32I 4DR3I 4LF8E 1PVGA 3C4BA 1ELOA 2LRSA 3J7AG 4JI8E 4JYAI 1IBKE 2UUCE 1UILA 5LL6R 4USMA 2BM1A 4JI5I 4DR1E 2HK2A 3K17A 1RREA 3ADLA 3Q1QA 4XTJA 4EMDA 2GS8A 1Z0VA 1BKNA 2UXDE 3LPSA 3LLHA 4LFAE 4DV2I 2UUCI 4FWHA 4WUCA 3ZKBA 4LF9I 4DUYE 2HHHE 4OOGC 4AQYE 2L2KB 1XNRI 3QT6A 4B3SE 5CFFE 3CWVA 3LTOA 1YYWA 1H74A 1S16A 4JI7E 2UXDI 2V8PA 4LF6I 4DR6I 2VF3A 4HYMA 2OI2A 3V2UC 1T4NA 1ZM9A 1FJGI 4AQYI 1N33I 3WU5A 2VQFI 4DV3E 4DR5I 4HXZA 4DR7E 3WU4A 4DKKA 2ZITA 4YHHI 1DI2A 1EI1A 1KVKA 5LMNI 2CZ9A 2BM0A 4OX9E 4LF7E 1UHZA 2ZM6I 3ZM7A 3QT8A 1N36I 3HTXA 4DV3I 5LMUI 4LF4E 3T1YE 1HNWI 4LF5I 1H7UA 4NXME 2X36A 4DR2E 4DV6E 4DR7I 1IBMI 2UXCE 2E1RA 2HKJA 5FLXC 1RC7A 1YYOA 4DR4I 1XMQI 3PYDA 2L3CA 1NHIA 2WW4A 1N32E 4DR3E 4JI3I 2F4VI 1H73A 1HNXI 2UUBI 2ZBKB 3JAMC 4B3TE 4USKA 4NXNI 1XNQI 3LNUA 4DPXA 3B78A 4JI2I 1ZBTA 4YY3I 4JI5E 2N3HA 1EA6A 2NUEA 4X64I 1KKHA 1Z0TA 1IBLI 3PYEA 2LTRA 3F0NA 5IT9Q 5GMEA 4B3TI 4DPYA 4PRXA 4Z7YA 2J7KA 4DV2E 2UXBI 2JY9A 4FW9A 2LBSB 1RQ0A 4LF9E 4I3HA 1HR0I 1MU5A 3JAMQ 2EFGA 2HFUA 3J7Yp 1XNRE 4DPTA 4X65I 4GKKI 1OJ4A 2IHR1 2NUGA 4X8WA 4DV5I 3P1XA 2B7VA 1QU6A 4LF6E 4DR6E 3H4LA 5A2QC 2RSMA 1Z0WA 4FWDA 3PYFA 2DIXA 2NPFA 1XHKA 2Q2EB 2V34A 1FJGE 1RR9A 1N33E 1FWLA 2VQFE 1ZXNA 4DXLA 4DV4I 4DR5E 3PYGA 1YYKA 2BV3A 2LUPB 4YHHE 3WU3A 3C4TA 1FWKA 2KHXA 5LMNE 4JI6E 1PIEA 1STUA 3J81C 1T4OA 1MG7A 1HNZI 1NHHA 2ZM6E 1N36E 1QZRA 1J5EI 1H72C 5LMUE 1HNWE 1A6FA 2LJHA 5A2QQ 1Z59A 4LF5E 3ZZTA 1IBME 4DR4E 1XMQE 4JI6I 4M30A 4DUZI 1WHNA 4JI3E 4R1FA 2F4VE 4UT4A 2VQEI 1HNXE 2UUBE 1VISA 1I94I 2HFSA 3J7AM 3J81Q 2LTSA 4HY1A 4WUDA 2NUFA 4NXNE 3GONA 1XMOI 2HKEA 1XNQE 3T1HI 4JI2E 1N0UA 4YY3E 1WUUA 2LJPA 4X64E 4MYTA 1D6TA 2NA2A 1WHQA 3K1JA 3ZZUA 2B7TA 1IBLE 1J26A 1Z5BA 5IWAI 3ADGA 2CPNA 4LFBI 1Z0CA 4LFCI 1X47A 3HULA 3J80C 2UXBE 2R3VA 2RTXA 2AJ4A 1HR0E 3WU6A 1B63A 4DV1I 2LUQA 4X65E 4X62I 4X66I 5FLXQ 4GKKE 4DU8A 4JI4I 1Z0EA 1EKZA 2DB2A 2E5LI 4DV5E 4JI1I 4JV5I 3QT7A 3V5RA 2A2DA 4DPUA 1DARA 1Z0BA 1N34I 1B62A 4B3MI 4B3RI 1GQEA 1H7SA 3B8HA 2L2MA 4DV7I 4DV4E 4WFTA 1U2RA 1ZM3A 3J80Q 3OTOI 5BR8I 2R42A 4M1KA 2UUAI 1T4LB 1YZ9A 2DMYA 2L2NA 3QT5A 4PRVA 4K0KI 4JG4A 4GKJE 2UU9I 4DV0I 1Z5AA 2X7IA 1K47A 1FNMA 1HNZE 4LF8I 2EZ6A 1N0VC 1J5EE 2YT4A
chains in the Genus database with same CATH superfamily
3EPJA 3HJCA 4FN5A 4HACA 3AUZA 5K36F 4PU9A 3F6HA 4FWGA 1KYQA 4TUGA 4JI8I 2O1TA 2DRPA 1ZM2A 1E3PA 1F2IG 1IBKI 2CVEA 4GKJI 3U1KA 4MQYA 4DU7A 5JEAF 1ZBQA 4IZJA 1NHJA 4ZVIA 4UTGA 4O4KA 4DUZE 4N3OA 4IZKB 4DR1I 4BHBA 4R2QA 5K36D 1ZM4A 3M6AA 4MU4A 4P52A 1AAYA 1Z5CA 3K6QA 2A25A 4OO1C 2VQEE 2V86A 4IS1C 5K36A 2EWLA 3M99B 3KZYA 4DMIA 1G2FC 4WSPA 1I94E 3D4JA 3VYYA 2EOSA 1UDNA 2RS6A 3B82A 2RS7A 4P7AA 3ADIA 2MC5A 1SR9A 4ED4A 4LFAI 1XMOE 4I8OA 2EM3A 1WRJA 1X49A 2LCEA 4OZEA 3T1HE 4OKGA 2L3JA 2GPIA 2V2VA 3THNA 5DRRA 2GQ0A 4DUYI 2HHHI 4R2DA 2DEIA 2B3TB 4ZYEA 4F6MA 1IMUA 4DPWA 2BR2A 5L3JA 2YSOA 1MX0A 1P42A 1MGTA 2N3GA 4KHPE 1PDAA 2EQ1A 2FV4B 4BA2A 4OO1D 1EH6A 2L33A 3P3CA 3BIDA 2H36X 2PO0B 4B3SI 2YTJA 4FK5C 4FW6A 1TN9A 1O0WA 3ADJA 3DJWA 5IWAE 4M2ZA 4IFDE 2EPKX 4KQVA 4JI7I 4LFBE 4OO1A 3ZZ0A 2XEXA 4LFCE 2A2CA 2BB8A 2WP8B 1X48A 4R2SA 1KJKA 1UBDC 2EN4A 4R03A 4JI0E 2HK3A 2V2ZA 5T6JA 1PKPA 4FW3A 3M85D 3DF6A 2WBSA 2CGEA 4IS9A 1NCSA 4DV1E 3KZZA 3RMPA 1Z0GA 4FW7A 1Y5YA 4GZNC 4KHPI 4RPFA 4WUBA 4X62E 4X66E 5C0XB 3U1YA 4IJDA 1S4EA 4JI4E 3MHSC 2JVAA 2EOIA 1YHCA 2E5LE 4JI1E 1KIJA 1Y4UA 4O43A 1FKAE 2ADRA 4JV5E 2DEJA 2J65A 2CSHA 2JWOA 5KL7A 2MDRA 2NN6C 4HACB 5DROA 4IZKA 2L6MA 2YTIA 2LE2A 1WXRA 2C37A 2O1VA 1GTKA 4WYQB 1UEKA 1N34E 4F2JC 4B3ME 5IT9C 4B3RE 1KTVA 2JE6A 2EE8A 4OX9I 4LF7I 2NN6F 3VYXA 4J3DA 4MYUA 5K36E 1UDSA 4DV7E 4LTYA 4F54A 4URLA 2M1SA 4LF4I 5A6JA 3T1YI 2L8TA 1FI4A 3OTOE 5BR8E 3HPSA 2IOQA 4NXMI 4IFDC 2UUAE 4DR2I 4DV6I 2YTPA 2UXCI 4JYAE 5JEAE 3ZKDA 4L8NA 4K0KE 2R76A 2NN6D 2Z5EA 5K36B 3CDIA 3NZKA 5DNLA 2IESA 2LMZA 2UU9E 2EPMX 4DV0E 2EP3A 2ODRD 4QNKA 1NZ0A 2NN6A 1ZXMA 4Z7CA 5GMDA 3HXLA 1N32I 4MDTA 3QG5C 4JI0I 2EOMA 4WSGA 5FWKA 4DR3I 4LF8E 1PVGA 3C4BA 1ELOA 2EOYA 4N4RB 3UHMA 2VESA 1G2DC 2LRSA 2EPPA 2BR2B 4IFDD 3J7AG 4TUIA 4M9VC 2NABA 4JI8E 4JYAI 3MHHC 2JYAA 4L5NC 3EPHA 2JEBA 3P76A 2EM7A 2K4VA 2YPNA 4IFDA 1IBKE 3L7ZA 2UUCE 2YSPA 4OO1B 1UILA 5LL6R 4USMA 2EMGA 2EPAA 2BM1A 4JI5I 2I13A 3ZOQB 4DR1E 1NEIA 1A1GA 5K36C 2HK2A 3K17A 4LCGA 5ELWA 1RREA 3GLLA 3ADLA 1N36I 3Q1QA 2YWQA 2YTNA 4XTJA 1OYRA 2JPAA 4EMDA 4GQUA 2JXPA 2C39B 2Z5CB 2GS8A 1DQ3A 1Z0VA 1PJQA 5JEAC 1ZU1A 2EL6A 1DGCA 1BKNA 2UXDE 1QNTA 1ZR9A 3LPSA 3LLHA 3KRNA 2CTDA 1JK1A 4LFAE 4DV2I 1USUA 2GO4A 2UUCI 2EMXA 4FWHA 2ELYA 4WUCA 1T39A 3ZKBA 2VE7C 4LF9I 2EL5A 4DUYE 2HHHE 4R2PA 4MU3A 2N8XA 4OOGC 2C37B 4AQYE 3C6MA 2C38A 4P78A 2L2KB 2JE6B 1XNRI 4MLVA 3QT6A 2EPNA 2V8QB 4B3SE 5CFFE 3CWVA 3LTOA 2YU5A 1YYWA 5JEAD 1H74A 1S16A 4JI7E 4BBYA 1A1JA 2UXDI 4HEIA 1WJPA 3GMEA 2V8PA 4NZVA 2DGCA 4LF6I 4KWYA 4DR6I 4WXCA 2EMCA 2IERA 2NN6E 2EMFA 4LU9A 2VF3A 4HYMA 1PJTA 2OI2A 4FW4A 5JEAA 2F8BA 5IV8B 2CT1A 3V2UC 1T4NA 3IWBA 1ZM9A 1FJGI 2EM0A 1Y4SA 4AQYI 2WZOA 1N33I 5DRQA 4BS9A 3WU5A 2VQFI 2HC5A 2EM5A 4NHRA 4DV3E 2O1WA 2NN6B 4DR5I 2WNRA 2EQ0A 3IWDA 5EL9A 4HXZA 1A1IA 2EOFA 2JOXA 4DR7E 3WU4A 4DKKA 2ZITA 4AIMA 4YHHI 2EPZA 2EL4A 1DI2A 2LV2A 1EI1A 2DSYA 2M9AA 3HPZA 1KVKA 2EN7A 2CZ9A 2BM0A 4F9CB 3P3EA 5LMNI 2JEBB 3HQ1A 3PS2A 2L92A 4IFDB 4OX9E 3UK3C 4LF7E 2F1DA 3L7ZB 1UHZA 2EPXA 2ZM6I 2EOEA 2C39A 2Z5CA 2LVHA 2EMKA 2EOQA 2MC6A 3QT8A 4MU1A 1BBGA 3HTXA 3IWCA 4R2AA 3PS1A 2EPCA 2YTFA 4DV3I 5LMUI 4LF4E 3T1YE 1A1LA 5KL3A 4FW5A 1HNWI 3BF2A 3P06A 4LF5I 2K7IA 4BMJA 1H7UA 4NXME 2X36A 4DR2E 3EPLA 4DV6E 4DR7I 1IBMI 2EPLX 2UXCE 2PO2B 2E1RA 5FLXC 2HKJA 1RC7A 1YYOA 2Z5BA 4DR4I 1TF3A 2RQLA 1XMQI 2DLKA 5AC5A 3PYDA 2PO1A 2L3CA 2ODRC 1NHIA 5A6BD 2WW4A 2PNMA 3CDJA 2JEAA 2EMIA 4KZSA 5AE1A 2JP9A 2EQ3A 2WBUA 1N32E 5EKWA 2E72A 4DR3E 3ZM7A 4JI3I 5A6BA 3GCMA 2F4VI 1H73A 1HNXI 2KONA 2R1FA 1T38A 5DNXA 2UUBI 2ZBKB 3JAMC 4MLQA 2C38B 2LJUA 3HKMA 5KL6A 2FTXB 1ZAAC 1UDOA 4WXDA 3Q6NA 2Q8UA 4B3TE 4USKA 1USVA 4M0VA 3P3GA 2YRKA 5LLQA 5F3WA 4NXNI 1B69A 1XNQI 3LNUA 1X5WA 3B78A 4DPXA 1ZBTA 2M7QA 2EMZA 4YY3I 4JI2I 4JI5E 3F6GA 1A1FA 4Q28A 2N3HA 2EMLA 1EA6A 2NUEA 5AC4A 4X64I 2YZTA 5JEAB 2JR1A 4ZYDA 1SFEA 2HGHA 1KKHA 1Z0TA 2EOOA 5AASA 2EPRA 1IBLI 3PYEA 1X3CA 1UN6B 2YU8A 1Y6ZA 2EPOA 2B9DA 2ENAA 2LTRA 1A1HA 2IOPA 2O3ZA 2WNRB 3F0NA 5GMEA 4B3TI 2EN2A 5IT9Q 4DPYA 4PRXA 2I9IA 4LCHA 4Z7YA 3TQMA 2J7KA 4DV2E 2UXBI 2JY9A 3JTZA 5A6AA 1YUJA 3BGHA 2EM9A 3VHTB 1P47A 2LBSB 4FW9A 1RQ0A 4LOMA 2D9HA 4LF9E 2EN6A 4I3HA 1HR0I 1MU5A 2EMWA 5C0XF 3JAMQ 1A1KA 3B4TA 2BA1G 2V83A 2EFGA 2HFUA 3J7Yp 1R6LA 1XNRE 4QNJA 4DPTA 4X65I 4U3BA 2PO2A 4GKKI 2GLIA 1UDQA 1EH7A 1OJ4A 2BA0G 2IHR1 4F9AB 4X8WA 2NUGA 4DV5I 2GHFA 2E1MA 2EM6A 3P1XA 3M7NG 2B7VA 1YFHA 1QU6A 4LF6E 4DR6E 3H4LA 5A2QC 3THOB 2KOUA 2RSMA 1Z0WA 2M4IA 3PS3A 4FWDA 5IXMB 3PYFA 2EOXA 4ISAA 2EJ4A 4WX9A 2DIXA 2Z5BB 2NPFA 1XHKA 2Q2EB 2V34A 1FJGE 1RR9A 4AIDA 1N33E 2PO1B 1FWLA 4ZYGA 2VQFE 1ZXNA 4DXLA 4DV4I 2EM2A 3EQ1A 2JEAB 4DR5E 3M7ND 3PYGA 2YTDA 3K85A 1OYSA 2ELZA 1E3HA 4O5GA 1GZ6A 4BC7A 1JK2A 1YYKA 2YTQA 3Q6MA 1YSAC 2BV3A 2LUPB 4IZJD 4YHHE 4LPFA 3WU3A 2WCC3 3C4TA 4O24A 1FWKA 2KHXA 5LMNE 1X6HA 1TF6A 4JI6E 1PIEA 1STUA 5DNYA 2RPCA 3J81C 2JT2A 2V85A 1T4OA 1MG7A 1HNZI 1NHHA 2ZM6E 1IQSA 1N36E 2PNZA 1QZRA 1J5EI 3VK6A 1H72C 5LMUE 1HNWE 1A6FA 2EMHA 2LJHA 1VI7A 5A2QQ 3LMLA 4BC9A 1Z59A 4LF5E 2ENCA 4WPYA 3ZZTA 1X6EA 2BBGA 1IBME 3EPKA 2ENHA 5KL4A 4OO1F 3AV0A 4DR4E 2EMAA 2LT7A 2V87A 1XMQE 3H09A 2MKNA 4NBQA 2DLQA 4JI6I 2WBTA 4BCAA 1YPNA 3L00A 4J8ZA 4M30A 1BB8A 4DUZI 1N3GA 2J7JA 4Q35B 1WHNA 4JI3E 4R1FA 2F4VE 4ZYHA 3M85G 4UT4A 2VQEI 1HNXE 2RSIA 1MEYC 2UUBE 1VISA 3KWRA 3OMLA 1I94I 4GEQB 4R2CA 3H1CA 3PRYA 2HFSA 3J7AM 3J81Q 2LTSA 4HY1A 4WUDA 2NUFA 4NXNE 3GONA 1XMOI 2HKEA 1XNQE 1Y60A 5C0XE 2JOBA 3T1HI 2YTGA 4JI2E 4YY3E 1N0UA 1WUUA 2LJPA 1RMDA 5TSEA 1LLMC 4X64E 4F6NA 4MYTA 5A69A 1OYPA 2EN8A 1D6TA 2NA2A 2PNLA 1WHQA 3K1JA 3ZZUA 1RHYA 2B7TA 4BA1B 1IBLE 2YRMA 2MDGA 1J26A 2MKDA 2GO3A 1Z5BA 5IWAI 3ADGA 4F9BB 2CPNA 4LFBI 3BBGA 5AE3A 1Z0CA 3FIGA 4LFCI 1YH8A 4RH8A 1HK7A 1X47A 2EOHA 3HULA 3J80C 2EN1A 2UXBE 3MSWA 2R3VA 4HTGA 1PJSA 2RTXA 5KL2A 2AJ4A 1HR0E 3WU6A 5KL5A 1Z1BA 1B63A 3DD6A 4MU0A 4DV1I 1XXEA 2LUQA 3C6KA 4IZJB 4X65E 4X62I 4X66I 2YTEA 5FLXQ 3ECRA 4BHCA 4GKKE 4DU8A 4JI4I 1Z0EA 2V2QA 2V89A 2PRTA 5AE2A 2EMBA 2PNZB 1EKZA 2DB2A 2YRHA 5A6KA 4DV5E 4JI1I 2E5LI 4JV5I 4X9JA 1X6FA 2EORA 5C0XC 3QT7A 3V5RA 2A2DA 1L4SA 4IFDF 1BBOA 4DPUA 2G7HA 1YUIA 1DARA 1B62A 1Z0BA 1N34I 1GQEA 2VRDA 1H7SA 3B8HA 4U3DA 4B3MI 2FGGA 4B3RI 2L2MA 2HJJA 3JU0A 1R6MA 4R8OA 2PO0A 4DV7I 4DV4E 4WFTA 2EM4A 4R2RA 1U2RA 1ZM3A 4OO1E 2AE8A 3J80Q 2WP8A 3OTOI 5BR8I 2R42A 4M1KA 4AM3A 2UUAI 1AH5A 2EMYA 1T4LB 1EH8A 2V88A 2DMYA 2EOJA 2L2NA 2YTOA 1YZ9A 3QT5A 1IQOA 4LCFA 4PRVA 4BA2B 4K0KI 5C0XD 4JG4A 4GKJE 2BA1D 4P7DA 5DRPA 2UU9I 5ADZA 4DV0I 1Z5AA 2O1UA 2X7IA 2EM8A 2CG9A 2VF1A 2EOZA 1K47A 5C0XA 1FNMA 2EPUA 4BA1A 2DMIA 1HNZE 2LO3A 2BA0D 4RHBB 4R2EA 4LF8I 2EZ6A 1N0VC 1J5EE 2EN3A 2YT4A
chains in the Genus database with same CATH topology
3HJCA 4FN5A 4HACA 3AUZA 4PU9A 3F6HA 4FWGA 4TUGA 4JI8I 2O1TA 1ZM2A 1IBKI 4GKJI 4DU7A 1ZBQA 4IZJA 1NHJA 4ZVIA 4UTGA 4DUZE 4N3OA 4IZKB 4DR1I 1ZM4A 3M6AA 4P52A 1Z5CA 3K6QA 2VQEE 2V86A 2EWLA 4DMIA 4WSPA 1I94E 3D4JA 3VYYA 2RS6A 3B82A 2RS7A 4P7AA 3ADIA 2MC5A 1SR9A 4ED4A 4LFAI 1XMOE 4I8OA 1X49A 3T1HE 2L3JA 2V2VA 4DUYI 2GQ0A 2HHHI 2DEIA 2B3TB 4DPWA 5L3JA 1MX0A 2N3GA 4KHPE 2FV4B 2L33A 4B3SI 2H36X 1O0WA 3ADJA 3DJWA 5IWAE 4M2ZA 4KQVA 4JI7I 4LFBE 3ZZ0A 2XEXA 4LFCE 2A2CA 1X48A 4JI0E 4R03A 2HK3A 2V2ZA 5T6JA 1PKPA 3DF6A 2CGEA 4DV1E 3RMPA 1Z0GA 4KHPI 4RPFA 4WUBA 4X62E 4X66E 1S4EA 4JI4E 2JVAA 2E5LE 4JI1E 1KIJA 1Y4UA 1FKAE 2DEJA 4JV5E 2V2QA 2JWOA 2MDRA 4HACB 4IZKA 2L6MA 4JI0I 2LE2A 1WXRA 2O1VA 4WYQB 1UEKA 1N34E 4B3ME 5IT9C 4B3RE 1KTVA 4OX9I 4LF7I 3VYXA 4MYUA 4DV7E 4LTYA 4F54A 4URLA 2M1SA 4LF4I 3T1YI 2L8TA 1FI4A 3OTOE 5BR8E 3HPSA 2IOQA 4NXMI 2UUAE 4DR2I 4DV6I 2UXCI 4JYAE 3ZKDA 4L8NA 4K0KE 2Z5EA 2LMZA 2UU9E 4DV0E 2ODRD 1NZ0A 1ZXMA 4Z7CA 5GMDA 3HXLA 1N32I 5FWKA 4DR3I 4LF8E 1PVGA 3C4BA 1ELOA 2LRSA 3J7AG 4TUIA 4JI8E 4JYAI 4L5NC 2K4VA 1IBKE 2UUCE 1UILA 5LL6R 4USMA 2BM1A 4JI5I 3ZOQB 4DR1E 2HK2A 3K17A 1RREA 3ADLA 3Q1QA 4XTJA 4EMDA 2Z5CB 2GS8A 1DQ3A 1Z0VA 1BKNA 2UXDE 3LPSA 3LLHA 4LFAE 4DV2I 1USUA 2UUCI 4FWHA 4WUCA 3ZKBA 2VE7C 4LF9I 4DUYE 2HHHE 4OOGC 4AQYE 4P78A 2L2KB 1XNRI 3QT6A 2V8QB 4B3SE 5CFFE 3CWVA 3LTOA 1YYWA 1H74A 1S16A 4JI7E 4BBYA 2UXDI 2V8PA 4LF6I 4DR6I 4LU9A 2VF3A 4HYMA 2OI2A 2F8BA 3V2UC 1T4NA 3IWBA 1ZM9A 1FJGI 1Y4SA 4AQYI 2WZOA 1N33I 3WU5A 4BS9A 2VQFI 2O1WA 4DV3E 4DR5I 3IWDA 4HXZA 2JOXA 4DR7E 3WU4A 4DKKA 2ZITA 4YHHI 1DI2A 1EI1A 2DSYA 3HPZA 1KVKA 5LMNI 2CZ9A 2BM0A 4F9CB 3HQ1A 2L92A 4OX9E 4LF7E 1UHZA 2ZM6I 2Z5CA 3ZM7A 2MC6A 3QT8A 1N36I 3HTXA 4DV3I 3IWCA 5LMUI 4LF4E 3T1YE 1HNWI 3P06A 4LF5I 4BMJA 1H7UA 4NXME 2X36A 4DR2E 4DV6E 4DR7I 1IBMI 2UXCE 2E1RA 5FLXC 2HKJA 1RC7A 1YYOA 2Z5BA 4DR4I 1XMQI 3PYDA 2L3CA 2ODRC 1NHIA 2WW4A 2PNMA 4KZSA 5AE1A 1N32E 4DR3E 4JI3I 2F4VI 1H73A 1HNXI 2KONA 2UUBI 2ZBKB 3JAMC 2FTXB 3Q6NA 4B3TE 4USKA 1USVA 4M0VA 5F3WA 4NXNI 1XNQI 3LNUA 4DPXA 3B78A 4JI2I 1ZBTA 2M7QA 4YY3I 4JI5E 3F6GA 4Q28A 2N3HA 1EA6A 2NUEA 4X64I 2YZTA 2JR1A 1KKHA 1Z0TA 5AASA 1IBLI 3PYEA 1Y6ZA 2B9DA 2LTRA 2IOPA 3F0NA 5GMEA 4B3TI 5IT9Q 4DPYA 4PRXA 4Z7YA 2J7KA 4DV2E 2UXBI 2JY9A 3JTZA 4FW9A 2LBSB 1RQ0A 4LF9E 4I3HA 1HR0I 1MU5A 3JAMQ 2EFGA 2V83A 2HFUA 3J7Yp 1XNRE 4DPTA 4X65I 4GKKI 1OJ4A 2IHR1 4F9AB 4X8WA 2NUGA 4DV5I 2E1MA 3P1XA 2B7VA 1QU6A 4LF6E 4DR6E 3H4LA 5A2QC 2KOUA 2RSMA 1Z0WA 2M4IA 4FWDA 3PYFA 2DIXA 2Z5BB 2NPFA 1XHKA 2Q2EB 2V34A 1FJGE 1RR9A 1N33E 1FWLA 2VQFE 1ZXNA 4DXLA 4DV4I 4DR5E 3PYGA 3K85A 1GZ6A 4BC7A 1YYKA 3Q6MA 2BV3A 2LUPB 4IZJD 4YHHE 3WU3A 3C4TA 1FWKA 2KHXA 5LMNE 4JI6E 1PIEA 1STUA 5DNYA 3J81C 2V85A 1T4OA 1MG7A 1HNZI 1NHHA 2ZM6E 1N36E 1QZRA 1J5EI 3VK6A 1H72C 5LMUE 1HNWE 1A6FA 2LJHA 5A2QQ 3LMLA 4BC9A 1Z59A 4LF5E 4WPYA 3ZZTA 1IBME 3AV0A 4DR4E 2V87A 1XMQE 3H09A 4JI6I 4BCAA 4J8ZA 4M30A 4DUZI 1WHNA 4JI3E 4R1FA 2F4VE 4UT4A 2VQEI 1HNXE 2UUBE 1VISA 3KWRA 3OMLA 1I94I 4GEQB 3PRYA 2HFSA 3J7AM 3J81Q 2LTSA 4HY1A 4WUDA 2NUFA 4NXNE 3GONA 1XMOI 2HKEA 1XNQE 2JOBA 3T1HI 4JI2E 1N0UA 4YY3E 1WUUA 2LJPA 4X64E 4MYTA 1D6TA 2NA2A 2PNLA 1WHQA 3K1JA 3ZZUA 2B7TA 1IBLE 1J26A 1Z5BA 5IWAI 3ADGA 4F9BB 2CPNA 4LFBI 5AE3A 1Z0CA 3FIGA 4LFCI 1HK7A 1X47A 3HULA 3J80C 2UXBE 3MSWA 2R3VA 2RTXA 2AJ4A 1HR0E 3WU6A 1B63A 4DV1I 2LUQA 4IZJB 4X65E 4X62I 4X66I 5FLXQ 4GKKE 4DU8A 4JI4I 1Z0EA 2V89A 5AE2A 1EKZA 2DB2A 2E5LI 4DV5E 4JI1I 4JV5I 3QT7A 3V5RA 2A2DA 4DPUA 2G7HA 1DARA 1Z0BA 1B62A 1N34I 4B3MI 1GQEA 1H7SA 3B8HA 4B3RI 2FGGA 2L2MA 3JU0A 4R8OA 4DV7I 4DV4E 4WFTA 1U2RA 1ZM3A 3J80Q 3OTOI 5BR8I 2R42A 4M1KA 2UUAI 1T4LB 1YZ9A 2V88A 2DMYA 2L2NA 3QT5A 4PRVA 4K0KI 4JG4A 4GKJE 4P7DA 2UU9I 5ADZA 4DV0I 1Z5AA 2O1UA 2X7IA 2CG9A 2VF1A 1K47A 1FNMA 1HNZE 4LF8I 2EZ6A 1N0VC 1J5EE 2YT4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FN5 A;  4HAC A;  4PU9 A;  4FWG A;  4JI8 I;  1ZM2 A;  1IBK I;  4GKJ I;  4DU7 A;  1NHJ A;  4ZVI A;  4UTG A;  4DUZ E;  4DR1 I;  1ZM4 A;  3M6A A;  4P52 A;  1Z5C A;  2VQE E;  1I94 E;  3D4J A;  3VYY A;  2RS6 A;  3B82 A;  2RS7 A;  4P7A A;  3ADI A;  4ED4 A;  4LFA I;  1XMO E;  1X49 A;  3T1H E;  2L3J A;  2V2V A;  4DUY I;  2HHH I;  2DEI A;  2B3T B;  4DPW A;  5L3J A;  1MX0 A;  2N3G A;  4KHP E;  2L33 A;  4B3S I;  1O0W A;  3ADJ A;  5IWA E;  4M2Z A;  4KQV A;  4JI7 I;  4LFB E;  3ZZ0 A;  2XEX A;  4LFC E;  2A2C A;  1X48 A;  4JI0 E;  2HK3 A;  2V2Z A;  1PKP A;  4DV1 E;  1Z0G A;  4KHP I;  4RPF A;  4WUB A;  4X62 E;  4X66 E;  1S4E A;  4JI4 E;  2JVA A;  2E5L E;  4JI1 E;  1KIJ A;  2V2Q A;  1FKA E;  4JV5 E;  2DEJ A;  2MDR A;  4HAC B;  4JI0 I;  4WYQ B;  1UEK A;  1N34 E;  4B3M E;  5IT9 C;  4B3R E;  1KTV A;  4OX9 I;  4LF7 I;  3VYX A;  4MYU A;  4DV7 E;  4URL A;  4LF4 I;  3T1Y I;  1FI4 A;  3OTO E;  5BR8 E;  4NXM I;  2UUA E;  4DR2 I;  4DV6 I;  2UXC I;  4JYA E;  3ZKD A;  4K0K E;  2UU9 E;  4DV0 E;  1NZ0 A;  1ZXM A;  4Z7C A;  5GMD A;  1N32 I;  4DR3 I;  4LF8 E;  1PVG A;  3C4B A;  1ELO A;  2LRS A;  3J7A G;  4JI8 E;  4JYA I;  1IBK E;  2UUC E;  1UIL A;  5LL6 R;  4USM A;  2BM1 A;  4JI5 I;  4DR1 E;  2HK2 A;  3K17 A;  1RRE A;  3ADL A;  3Q1Q A;  4XTJ A;  4EMD A;  2GS8 A;  1Z0V A;  1BKN A;  2UXD E;  3LPS A;  3LLH A;  4LFA E;  4DV2 I;  2UUC I;  4FWH A;  4WUC A;  3ZKB A;  4LF9 I;  4DUY E;  2HHH E;  4OOG C;  4AQY E;  2L2K B;  1XNR I;  3QT6 A;  4B3S E;  5CFF E;  3CWV A;  3LTO A;  1YYW A;  1H74 A;  1S16 A;  4JI7 E;  2UXD I;  2V8P A;  4LF6 I;  4DR6 I;  2VF3 A;  4HYM A;  2OI2 A;  3V2U C;  1T4N A;  1ZM9 A;  1FJG I;  4AQY I;  1N33 I;  3WU5 A;  2VQF I;  4DV3 E;  4DR5 I;  4HXZ A;  4DR7 E;  3WU4 A;  4DKK A;  2ZIT A;  4YHH I;  1DI2 A;  1EI1 A;  1KVK A;  5LMN I;  2CZ9 A;  2BM0 A;  4OX9 E;  4LF7 E;  1UHZ A;  2ZM6 I;  3ZM7 A;  3QT8 A;  1N36 I;  3HTX A;  4DV3 I;  5LMU I;  4LF4 E;  3T1Y E;  1HNW I;  4LF5 I;  1H7U A;  4NXM E;  2X36 A;  4DR2 E;  4DV6 E;  4DR7 I;  1IBM I;  2UXC E;  2E1R A;  2HKJ A;  5FLX C;  1RC7 A;  1YYO A;  4DR4 I;  1XMQ I;  3PYD A;  2L3C A;  1NHI A;  2WW4 A;  1N32 E;  4DR3 E;  4JI3 I;  2F4V I;  1H73 A;  1HNX I;  2UUB I;  2ZBK B;  3JAM C;  4B3T E;  4USK A;  4NXN I;  1XNQ I;  3LNU A;  4DPX A;  3B78 A;  4JI2 I;  1ZBT A;  4YY3 I;  4JI5 E;  2N3H A;  1EA6 A;  2NUE A;  4X64 I;  1KKH A;  1Z0T A;  1IBL I;  3PYE A;  2LTR A;  3F0N A;  5IT9 Q;  5GME A;  4B3T I;  4DPY A;  4PRX A;  4Z7Y A;  2J7K A;  4DV2 E;  2UXB I;  2JY9 A;  4FW9 A;  2LBS B;  1RQ0 A;  4LF9 E;  4I3H A;  1HR0 I;  1MU5 A;  3JAM Q;  2EFG A;  2HFU A;  3J7Y p;  1XNR E;  4DPT A;  4X65 I;  4GKK I;  1OJ4 A;  2IHR 1;  2NUG A;  4X8W A;  4DV5 I;  3P1X A;  2B7V A;  1QU6 A;  4LF6 E;  4DR6 E;  3H4L A;  5A2Q C;  2RSM A;  1Z0W A;  4FWD A;  3PYF A;  2DIX A;  2NPF A;  1XHK A;  2Q2E B;  2V34 A;  1FJG E;  1RR9 A;  1N33 E;  1FWL A;  2VQF E;  1ZXN A;  4DXL A;  4DV4 I;  4DR5 E;  3PYG A;  1YYK A;  2BV3 A;  2LUP B;  4YHH E;  3WU3 A;  3C4T A;  1FWK A;  2KHX A;  5LMN E;  4JI6 E;  1PIE A;  1STU A;  3J81 C;  1T4O A;  1MG7 A;  1HNZ I;  1NHH A;  2ZM6 E;  1N36 E;  1QZR A;  1J5E I;  1H72 C;  5LMU E;  1HNW E;  1A6F A;  2LJH A;  5A2Q Q;  1Z59 A;  4LF5 E;  3ZZT A;  1IBM E;  4DR4 E;  1XMQ E;  4JI6 I;  4M30 A;  4DUZ I;  1WHN A;  4JI3 E;  4R1F A;  2F4V E;  4UT4 A;  2VQE I;  1HNX E;  2UUB E;  1VIS A;  1I94 I;  2HFS A;  3J7A M;  3J81 Q;  2LTS A;  4HY1 A;  4WUD A;  2NUF A;  4NXN E;  3GON A;  1XMO I;  2HKE A;  1XNQ E;  3T1H I;  4JI2 E;  1N0U A;  4YY3 E;  1WUU A;  2LJP A;  4X64 E;  4MYT A;  1D6T A;  2NA2 A;  1WHQ A;  3K1J A;  3ZZU A;  2B7T A;  1IBL E;  1J26 A;  1Z5B A;  5IWA I;  3ADG A;  2CPN A;  4LFB I;  1Z0C A;  4LFC I;  1X47 A;  3HUL A;  3J80 C;  2UXB E;  2R3V A;  2RTX A;  2AJ4 A;  1HR0 E;  3WU6 A;  1B63 A;  4DV1 I;  2LUQ A;  4X65 E;  4X62 I;  4X66 I;  5FLX Q;  4GKK E;  4DU8 A;  4JI4 I;  1Z0E A;  1EKZ A;  2DB2 A;  2E5L I;  4DV5 E;  4JI1 I;  4JV5 I;  3QT7 A;  3V5R A;  2A2D A;  4DPU A;  1DAR A;  1Z0B A;  1N34 I;  1B62 A;  4B3M I;  4B3R I;  1GQE A;  1H7S A;  3B8H A;  2L2M A;  4DV7 I;  4DV4 E;  4WFT A;  1U2R A;  1ZM3 A;  3J80 Q;  3OTO I;  5BR8 I;  2R42 A;  4M1K A;  2UUA I;  1T4L B;  1YZ9 A;  2DMY A;  2L2N A;  3QT5 A;  4PRV A;  4K0K I;  4JG4 A;  4GKJ E;  2UU9 I;  4DV0 I;  1Z5A A;  2X7I A;  1K47 A;  1FNM A;  1HNZ E;  4LF8 I;  2EZ6 A;  1N0V C;  1J5E E;  2YT4 A; 
#chains in the Genus database with same CATH topology
 3EPJ A;  3HJC A;  4FN5 A;  4HAC A;  3AUZ A;  5K36 F;  4PU9 A;  3F6H A;  4FWG A;  1KYQ A;  4TUG A;  4JI8 I;  2O1T A;  2DRP A;  1ZM2 A;  1E3P A;  1F2I G;  1IBK I;  2CVE A;  4GKJ I;  3U1K A;  4MQY A;  4DU7 A;  5JEA F;  1ZBQ A;  4IZJ A;  1NHJ A;  4ZVI A;  4UTG A;  4O4K A;  4DUZ E;  4N3O A;  4IZK B;  4DR1 I;  4BHB A;  4R2Q A;  5K36 D;  1ZM4 A;  3M6A A;  4MU4 A;  4P52 A;  1AAY A;  1Z5C A;  3K6Q A;  2A25 A;  4OO1 C;  2VQE E;  2V86 A;  4IS1 C;  5K36 A;  2EWL A;  3M99 B;  3KZY A;  4DMI A;  1G2F C;  4WSP A;  1I94 E;  3D4J A;  3VYY A;  2EOS A;  1UDN A;  2RS6 A;  3B82 A;  2RS7 A;  4P7A A;  3ADI A;  2MC5 A;  1SR9 A;  4ED4 A;  4LFA I;  1XMO E;  4I8O A;  2EM3 A;  1WRJ A;  1X49 A;  2LCE A;  4OZE A;  3T1H E;  4OKG A;  2L3J A;  2GPI A;  2V2V A;  3THN A;  5DRR A;  2GQ0 A;  4DUY I;  2HHH I;  4R2D A;  2DEI A;  2B3T B;  4ZYE A;  4F6M A;  1IMU A;  4DPW A;  2BR2 A;  5L3J A;  2YSO A;  1MX0 A;  1P42 A;  1MGT A;  2N3G A;  4KHP E;  1PDA A;  2EQ1 A;  2FV4 B;  4BA2 A;  4OO1 D;  1EH6 A;  2L33 A;  3P3C A;  3BID A;  2H36 X;  2PO0 B;  4B3S I;  2YTJ A;  4FK5 C;  4FW6 A;  1TN9 A;  1O0W A;  3ADJ A;  3DJW A;  5IWA E;  4M2Z A;  4IFD E;  2EPK X;  4KQV A;  4JI7 I;  4LFB E;  4OO1 A;  3ZZ0 A;  2XEX A;  4LFC E;  2A2C A;  2BB8 A;  2WP8 B;  1X48 A;  4R2S A;  1KJK A;  1UBD C;  2EN4 A;  4R03 A;  4JI0 E;  2HK3 A;  2V2Z A;  5T6J A;  1PKP A;  4FW3 A;  3M85 D;  3DF6 A;  2WBS A;  2CGE A;  4IS9 A;  1NCS A;  4DV1 E;  3KZZ A;  3RMP A;  1Z0G A;  4FW7 A;  1Y5Y A;  4GZN C;  4KHP I;  4RPF A;  4WUB A;  4X62 E;  4X66 E;  5C0X B;  3U1Y A;  4IJD A;  1S4E A;  4JI4 E;  3MHS C;  2JVA A;  2EOI A;  1YHC A;  2E5L E;  4JI1 E;  1KIJ A;  1Y4U A;  4O43 A;  1FKA E;  2ADR A;  4JV5 E;  2DEJ A;  2J65 A;  2CSH A;  2JWO A;  5KL7 A;  2MDR A;  2NN6 C;  4HAC B;  5DRO A;  4IZK A;  2L6M A;  2YTI A;  2LE2 A;  1WXR A;  2C37 A;  2O1V A;  1GTK A;  4WYQ B;  1UEK A;  1N34 E;  4F2J C;  4B3M E;  5IT9 C;  4B3R E;  1KTV A;  2JE6 A;  2EE8 A;  4OX9 I;  4LF7 I;  2NN6 F;  3VYX A;  4J3D A;  4MYU A;  5K36 E;  1UDS A;  4DV7 E;  4LTY A;  4F54 A;  4URL A;  2M1S A;  4LF4 I;  5A6J A;  3T1Y I;  2L8T A;  1FI4 A;  3OTO E;  5BR8 E;  3HPS A;  2IOQ A;  4NXM I;  4IFD C;  2UUA E;  4DR2 I;  4DV6 I;  2YTP A;  2UXC I;  4JYA E;  5JEA E;  3ZKD A;  4L8N A;  4K0K E;  2R76 A;  2NN6 D;  2Z5E A;  5K36 B;  3CDI A;  3NZK A;  5DNL A;  2IES A;  2LMZ A;  2UU9 E;  2EPM X;  4DV0 E;  2EP3 A;  2ODR D;  4QNK A;  1NZ0 A;  2NN6 A;  1ZXM A;  4Z7C A;  5GMD A;  3HXL A;  1N32 I;  4MDT A;  3QG5 C;  4JI0 I;  2EOM A;  4WSG A;  5FWK A;  4DR3 I;  4LF8 E;  1PVG A;  3C4B A;  1ELO A;  2EOY A;  4N4R B;  3UHM A;  2VES A;  1G2D C;  2LRS A;  2EPP A;  2BR2 B;  4IFD D;  3J7A G;  4TUI A;  4M9V C;  2NAB A;  4JI8 E;  4JYA I;  3MHH C;  2JYA A;  4L5N C;  3EPH A;  2JEB A;  3P76 A;  2EM7 A;  2K4V A;  2YPN A;  4IFD A;  1IBK E;  3L7Z A;  2UUC E;  2YSP A;  4OO1 B;  1UIL A;  5LL6 R;  4USM A;  2EMG A;  2EPA A;  2BM1 A;  4JI5 I;  2I13 A;  3ZOQ B;  4DR1 E;  1NEI A;  1A1G A;  5K36 C;  2HK2 A;  3K17 A;  4LCG A;  5ELW A;  1RRE A;  3GLL A;  3ADL A;  1N36 I;  3Q1Q A;  2YWQ A;  2YTN A;  4XTJ A;  1OYR A;  2JPA A;  4EMD A;  4GQU A;  2JXP A;  2C39 B;  2Z5C B;  2GS8 A;  1DQ3 A;  1Z0V A;  1PJQ A;  5JEA C;  1ZU1 A;  2EL6 A;  1DGC A;  1BKN A;  2UXD E;  1QNT A;  1ZR9 A;  3LPS A;  3LLH A;  3KRN A;  2CTD A;  1JK1 A;  4LFA E;  4DV2 I;  1USU A;  2GO4 A;  2UUC I;  2EMX A;  4FWH A;  2ELY A;  4WUC A;  1T39 A;  3ZKB A;  2VE7 C;  4LF9 I;  2EL5 A;  4DUY E;  2HHH E;  4R2P A;  4MU3 A;  2N8X A;  4OOG C;  2C37 B;  4AQY E;  3C6M A;  2C38 A;  4P78 A;  2L2K B;  2JE6 B;  1XNR I;  4MLV A;  3QT6 A;  2EPN A;  2V8Q B;  4B3S E;  5CFF E;  3CWV A;  3LTO A;  2YU5 A;  1YYW A;  5JEA D;  1H74 A;  1S16 A;  4JI7 E;  4BBY A;  1A1J A;  2UXD I;  4HEI A;  1WJP A;  3GME A;  2V8P A;  4NZV A;  2DGC A;  4LF6 I;  4KWY A;  4DR6 I;  4WXC A;  2EMC A;  2IER A;  2NN6 E;  2EMF A;  4LU9 A;  2VF3 A;  4HYM A;  1PJT A;  2OI2 A;  4FW4 A;  5JEA A;  2F8B A;  5IV8 B;  2CT1 A;  3V2U C;  1T4N A;  3IWB A;  1ZM9 A;  1FJG I;  2EM0 A;  1Y4S A;  4AQY I;  2WZO A;  1N33 I;  5DRQ A;  4BS9 A;  3WU5 A;  2VQF I;  2HC5 A;  2EM5 A;  4NHR A;  4DV3 E;  2O1W A;  2NN6 B;  4DR5 I;  2WNR A;  2EQ0 A;  3IWD A;  5EL9 A;  4HXZ A;  1A1I A;  2EOF A;  2JOX A;  4DR7 E;  3WU4 A;  4DKK A;  2ZIT A;  4AIM A;  4YHH I;  2EPZ A;  2EL4 A;  1DI2 A;  2LV2 A;  1EI1 A;  2DSY A;  2M9A A;  3HPZ A;  1KVK A;  2EN7 A;  2CZ9 A;  2BM0 A;  4F9C B;  3P3E A;  5LMN I;  2JEB B;  3HQ1 A;  3PS2 A;  2L92 A;  4IFD B;  4OX9 E;  3UK3 C;  4LF7 E;  2F1D A;  3L7Z B;  1UHZ A;  2EPX A;  2ZM6 I;  2EOE A;  2C39 A;  2Z5C A;  2LVH A;  2EMK A;  2EOQ A;  2MC6 A;  3QT8 A;  4MU1 A;  1BBG A;  3HTX A;  3IWC A;  4R2A A;  3PS1 A;  2EPC A;  2YTF A;  4DV3 I;  5LMU I;  4LF4 E;  3T1Y E;  1A1L A;  5KL3 A;  4FW5 A;  1HNW I;  3BF2 A;  3P06 A;  4LF5 I;  2K7I A;  4BMJ A;  1H7U A;  4NXM E;  2X36 A;  4DR2 E;  3EPL A;  4DV6 E;  4DR7 I;  1IBM I;  2EPL X;  2UXC E;  2PO2 B;  2E1R A;  5FLX C;  2HKJ A;  1RC7 A;  1YYO A;  2Z5B A;  4DR4 I;  1TF3 A;  2RQL A;  1XMQ I;  2DLK A;  5AC5 A;  3PYD A;  2PO1 A;  2L3C A;  2ODR C;  1NHI A;  5A6B D;  2WW4 A;  2PNM A;  3CDJ A;  2JEA A;  2EMI A;  4KZS A;  5AE1 A;  2JP9 A;  2EQ3 A;  2WBU A;  1N32 E;  5EKW A;  2E72 A;  4DR3 E;  3ZM7 A;  4JI3 I;  5A6B A;  3GCM A;  2F4V I;  1H73 A;  1HNX I;  2KON A;  2R1F A;  1T38 A;  5DNX A;  2UUB I;  2ZBK B;  3JAM C;  4MLQ A;  2C38 B;  2LJU A;  3HKM A;  5KL6 A;  2FTX B;  1ZAA C;  1UDO A;  4WXD A;  3Q6N A;  2Q8U A;  4B3T E;  4USK A;  1USV A;  4M0V A;  3P3G A;  2YRK A;  5LLQ A;  5F3W A;  4NXN I;  1B69 A;  1XNQ I;  3LNU A;  1X5W A;  3B78 A;  4DPX A;  1ZBT A;  2M7Q A;  2EMZ A;  4YY3 I;  4JI2 I;  4JI5 E;  3F6G A;  1A1F A;  4Q28 A;  2N3H A;  2EML A;  1EA6 A;  2NUE A;  5AC4 A;  4X64 I;  2YZT A;  5JEA B;  2JR1 A;  4ZYD A;  1SFE A;  2HGH A;  1KKH A;  1Z0T A;  2EOO A;  5AAS A;  2EPR A;  1IBL I;  3PYE A;  1X3C A;  1UN6 B;  2YU8 A;  1Y6Z A;  2EPO A;  2B9D A;  2ENA A;  2LTR A;  1A1H A;  2IOP A;  2O3Z A;  2WNR B;  3F0N A;  5GME A;  4B3T I;  2EN2 A;  5IT9 Q;  4DPY A;  4PRX A;  2I9I A;  4LCH A;  4Z7Y A;  3TQM A;  2J7K A;  4DV2 E;  2UXB I;  2JY9 A;  3JTZ A;  5A6A A;  1YUJ A;  3BGH A;  2EM9 A;  3VHT B;  1P47 A;  2LBS B;  4FW9 A;  1RQ0 A;  4LOM A;  2D9H A;  4LF9 E;  2EN6 A;  4I3H A;  1HR0 I;  1MU5 A;  2EMW A;  5C0X F;  3JAM Q;  1A1K A;  3B4T A;  2BA1 G;  2V83 A;  2EFG A;  2HFU A;  3J7Y p;  1R6L A;  1XNR E;  4QNJ A;  4DPT A;  4X65 I;  4U3B A;  2PO2 A;  4GKK I;  2GLI A;  1UDQ A;  1EH7 A;  1OJ4 A;  2BA0 G;  2IHR 1;  4F9A B;  4X8W A;  2NUG A;  4DV5 I;  2GHF A;  2E1M A;  2EM6 A;  3P1X A;  3M7N G;  2B7V A;  1YFH A;  1QU6 A;  4LF6 E;  4DR6 E;  3H4L A;  5A2Q C;  3THO B;  2KOU A;  2RSM A;  1Z0W A;  2M4I A;  3PS3 A;  4FWD A;  5IXM B;  3PYF A;  2EOX A;  4ISA A;  2EJ4 A;  4WX9 A;  2DIX A;  2Z5B B;  2NPF A;  1XHK A;  2Q2E B;  2V34 A;  1FJG E;  1RR9 A;  4AID A;  1N33 E;  2PO1 B;  1FWL A;  4ZYG A;  2VQF E;  1ZXN A;  4DXL A;  4DV4 I;  2EM2 A;  3EQ1 A;  2JEA B;  4DR5 E;  3M7N D;  3PYG A;  2YTD A;  3K85 A;  1OYS A;  2ELZ A;  1E3H A;  4O5G A;  1GZ6 A;  4BC7 A;  1JK2 A;  1YYK A;  2YTQ A;  3Q6M A;  1YSA C;  2BV3 A;  2LUP B;  4IZJ D;  4YHH E;  4LPF A;  3WU3 A;  2WCC 3;  3C4T A;  4O24 A;  1FWK A;  2KHX A;  5LMN E;  1X6H A;  1TF6 A;  4JI6 E;  1PIE A;  1STU A;  5DNY A;  2RPC A;  3J81 C;  2JT2 A;  2V85 A;  1T4O A;  1MG7 A;  1HNZ I;  1NHH A;  2ZM6 E;  1IQS A;  1N36 E;  2PNZ A;  1QZR A;  1J5E I;  3VK6 A;  1H72 C;  5LMU E;  1HNW E;  1A6F A;  2EMH A;  2LJH A;  1VI7 A;  5A2Q Q;  3LML A;  4BC9 A;  1Z59 A;  4LF5 E;  2ENC A;  4WPY A;  3ZZT A;  1X6E A;  2BBG A;  1IBM E;  3EPK A;  2ENH A;  5KL4 A;  4OO1 F;  3AV0 A;  4DR4 E;  2EMA A;  2LT7 A;  2V87 A;  1XMQ E;  3H09 A;  2MKN A;  4NBQ A;  2DLQ A;  4JI6 I;  2WBT A;  4BCA A;  1YPN A;  3L00 A;  4J8Z A;  4M30 A;  1BB8 A;  4DUZ I;  1N3G A;  2J7J A;  4Q35 B;  1WHN A;  4JI3 E;  4R1F A;  2F4V E;  4ZYH A;  3M85 G;  4UT4 A;  2VQE I;  1HNX E;  2RSI A;  1MEY C;  2UUB E;  1VIS A;  3KWR A;  3OML A;  1I94 I;  4GEQ B;  4R2C A;  3H1C A;  3PRY A;  2HFS A;  3J7A M;  3J81 Q;  2LTS A;  4HY1 A;  4WUD A;  2NUF A;  4NXN E;  3GON A;  1XMO I;  2HKE A;  1XNQ E;  1Y60 A;  5C0X E;  2JOB A;  3T1H I;  2YTG A;  4JI2 E;  4YY3 E;  1N0U A;  1WUU A;  2LJP A;  1RMD A;  5TSE A;  1LLM C;  4X64 E;  4F6N A;  4MYT A;  5A69 A;  1OYP A;  2EN8 A;  1D6T A;  2NA2 A;  2PNL A;  1WHQ A;  3K1J A;  3ZZU A;  1RHY A;  2B7T A;  4BA1 B;  1IBL E;  2YRM A;  2MDG A;  1J26 A;  2MKD A;  2GO3 A;  1Z5B A;  5IWA I;  3ADG A;  4F9B B;  2CPN A;  4LFB I;  3BBG A;  5AE3 A;  1Z0C A;  3FIG A;  4LFC I;  1YH8 A;  4RH8 A;  1HK7 A;  1X47 A;  2EOH A;  3HUL A;  3J80 C;  2EN1 A;  2UXB E;  3MSW A;  2R3V A;  4HTG A;  1PJS A;  2RTX A;  5KL2 A;  2AJ4 A;  1HR0 E;  3WU6 A;  5KL5 A;  1Z1B A;  1B63 A;  3DD6 A;  4MU0 A;  4DV1 I;  1XXE A;  2LUQ A;  3C6K A;  4IZJ B;  4X65 E;  4X62 I;  4X66 I;  2YTE A;  5FLX Q;  3ECR A;  4BHC A;  4GKK E;  4DU8 A;  4JI4 I;  1Z0E A;  2V2Q A;  2V89 A;  2PRT A;  5AE2 A;  2EMB A;  2PNZ B;  1EKZ A;  2DB2 A;  2YRH A;  5A6K A;  4DV5 E;  4JI1 I;  2E5L I;  4JV5 I;  4X9J A;  1X6F A;  2EOR A;  5C0X C;  3QT7 A;  3V5R A;  2A2D A;  1L4S A;  4IFD F;  1BBO A;  4DPU A;  2G7H A;  1YUI A;  1DAR A;  1B62 A;  1Z0B A;  1N34 I;  1GQE A;  2VRD A;  1H7S A;  3B8H A;  4U3D A;  4B3M I;  2FGG A;  4B3R I;  2L2M A;  2HJJ A;  3JU0 A;  1R6M A;  4R8O A;  2PO0 A;  4DV7 I;  4DV4 E;  4WFT A;  2EM4 A;  4R2R A;  1U2R A;  1ZM3 A;  4OO1 E;  2AE8 A;  3J80 Q;  2WP8 A;  3OTO I;  5BR8 I;  2R42 A;  4M1K A;  4AM3 A;  2UUA I;  1AH5 A;  2EMY A;  1T4L B;  1EH8 A;  2V88 A;  2DMY A;  2EOJ A;  2L2N A;  2YTO A;  1YZ9 A;  3QT5 A;  1IQO A;  4LCF A;  4PRV A;  4BA2 B;  4K0K I;  5C0X D;  4JG4 A;  4GKJ E;  2BA1 D;  4P7D A;  5DRP A;  2UU9 I;  5ADZ A;  4DV0 I;  1Z5A A;  2O1U A;  2X7I A;  2EM8 A;  2CG9 A;  2VF1 A;  2EOZ A;  1K47 A;  5C0X A;  1FNM A;  2EPU A;  4BA1 A;  2DMI A;  1HNZ E;  2LO3 A;  2BA0 D;  4RHB B;  4R2E A;  4LF8 I;  2EZ6 A;  1N0V C;  1J5E E;  2EN3 A;  2YT4 A; 
#chains in the Genus database with same CATH homology
 3HJC A;  4FN5 A;  4HAC A;  3AUZ A;  4PU9 A;  3F6H A;  4FWG A;  4TUG A;  4JI8 I;  2O1T A;  1ZM2 A;  1IBK I;  4GKJ I;  4DU7 A;  1ZBQ A;  4IZJ A;  1NHJ A;  4ZVI A;  4UTG A;  4DUZ E;  4N3O A;  4IZK B;  4DR1 I;  1ZM4 A;  3M6A A;  4P52 A;  1Z5C A;  3K6Q A;  2VQE E;  2V86 A;  2EWL A;  4DMI A;  4WSP A;  1I94 E;  3D4J A;  3VYY A;  2RS6 A;  3B82 A;  2RS7 A;  4P7A A;  3ADI A;  2MC5 A;  1SR9 A;  4ED4 A;  4LFA I;  1XMO E;  4I8O A;  1X49 A;  3T1H E;  2L3J A;  2V2V A;  4DUY I;  2GQ0 A;  2HHH I;  2DEI A;  2B3T B;  4DPW A;  5L3J A;  1MX0 A;  2N3G A;  4KHP E;  2FV4 B;  2L33 A;  4B3S I;  2H36 X;  1O0W A;  3ADJ A;  3DJW A;  5IWA E;  4M2Z A;  4KQV A;  4JI7 I;  4LFB E;  3ZZ0 A;  2XEX A;  4LFC E;  2A2C A;  1X48 A;  4JI0 E;  4R03 A;  2HK3 A;  2V2Z A;  5T6J A;  1PKP A;  3DF6 A;  2CGE A;  4DV1 E;  3RMP A;  1Z0G A;  4KHP I;  4RPF A;  4WUB A;  4X62 E;  4X66 E;  1S4E A;  4JI4 E;  2JVA A;  2E5L E;  4JI1 E;  1KIJ A;  1Y4U A;  1FKA E;  2DEJ A;  4JV5 E;  2V2Q A;  2JWO A;  2MDR A;  4HAC B;  4IZK A;  2L6M A;  4JI0 I;  2LE2 A;  1WXR A;  2O1V A;  4WYQ B;  1UEK A;  1N34 E;  4B3M E;  5IT9 C;  4B3R E;  1KTV A;  4OX9 I;  4LF7 I;  3VYX A;  4MYU A;  4DV7 E;  4LTY A;  4F54 A;  4URL A;  2M1S A;  4LF4 I;  3T1Y I;  2L8T A;  1FI4 A;  3OTO E;  5BR8 E;  3HPS A;  2IOQ A;  4NXM I;  2UUA E;  4DR2 I;  4DV6 I;  2UXC I;  4JYA E;  3ZKD A;  4L8N A;  4K0K E;  2Z5E A;  2LMZ A;  2UU9 E;  4DV0 E;  2ODR D;  1NZ0 A;  1ZXM A;  4Z7C A;  5GMD A;  3HXL A;  1N32 I;  5FWK A;  4DR3 I;  4LF8 E;  1PVG A;  3C4B A;  1ELO A;  2LRS A;  3J7A G;  4TUI A;  4JI8 E;  4JYA I;  4L5N C;  2K4V A;  1IBK E;  2UUC E;  1UIL A;  5LL6 R;  4USM A;  2BM1 A;  4JI5 I;  3ZOQ B;  4DR1 E;  2HK2 A;  3K17 A;  1RRE A;  3ADL A;  3Q1Q A;  4XTJ A;  4EMD A;  2Z5C B;  2GS8 A;  1DQ3 A;  1Z0V A;  1BKN A;  2UXD E;  3LPS A;  3LLH A;  4LFA E;  4DV2 I;  1USU A;  2UUC I;  4FWH A;  4WUC A;  3ZKB A;  2VE7 C;  4LF9 I;  4DUY E;  2HHH E;  4OOG C;  4AQY E;  4P78 A;  2L2K B;  1XNR I;  3QT6 A;  2V8Q B;  4B3S E;  5CFF E;  3CWV A;  3LTO A;  1YYW A;  1H74 A;  1S16 A;  4JI7 E;  4BBY A;  2UXD I;  2V8P A;  4LF6 I;  4DR6 I;  4LU9 A;  2VF3 A;  4HYM A;  2OI2 A;  2F8B A;  3V2U C;  1T4N A;  3IWB A;  1ZM9 A;  1FJG I;  1Y4S A;  4AQY I;  2WZO A;  1N33 I;  3WU5 A;  4BS9 A;  2VQF I;  2O1W A;  4DV3 E;  4DR5 I;  3IWD A;  4HXZ A;  2JOX A;  4DR7 E;  3WU4 A;  4DKK A;  2ZIT A;  4YHH I;  1DI2 A;  1EI1 A;  2DSY A;  3HPZ A;  1KVK A;  5LMN I;  2CZ9 A;  2BM0 A;  4F9C B;  3HQ1 A;  2L92 A;  4OX9 E;  4LF7 E;  1UHZ A;  2ZM6 I;  2Z5C A;  3ZM7 A;  2MC6 A;  3QT8 A;  1N36 I;  3HTX A;  4DV3 I;  3IWC A;  5LMU I;  4LF4 E;  3T1Y E;  1HNW I;  3P06 A;  4LF5 I;  4BMJ A;  1H7U A;  4NXM E;  2X36 A;  4DR2 E;  4DV6 E;  4DR7 I;  1IBM I;  2UXC E;  2E1R A;  5FLX C;  2HKJ A;  1RC7 A;  1YYO A;  2Z5B A;  4DR4 I;  1XMQ I;  3PYD A;  2L3C A;  2ODR C;  1NHI A;  2WW4 A;  2PNM A;  4KZS A;  5AE1 A;  1N32 E;  4DR3 E;  4JI3 I;  2F4V I;  1H73 A;  1HNX I;  2KON A;  2UUB I;  2ZBK B;  3JAM C;  2FTX B;  3Q6N A;  4B3T E;  4USK A;  1USV A;  4M0V A;  5F3W A;  4NXN I;  1XNQ I;  3LNU A;  4DPX A;  3B78 A;  4JI2 I;  1ZBT A;  2M7Q A;  4YY3 I;  4JI5 E;  3F6G A;  4Q28 A;  2N3H A;  1EA6 A;  2NUE A;  4X64 I;  2YZT A;  2JR1 A;  1KKH A;  1Z0T A;  5AAS A;  1IBL I;  3PYE A;  1Y6Z A;  2B9D A;  2LTR A;  2IOP A;  3F0N A;  5GME A;  4B3T I;  5IT9 Q;  4DPY A;  4PRX A;  4Z7Y A;  2J7K A;  4DV2 E;  2UXB I;  2JY9 A;  3JTZ A;  4FW9 A;  2LBS B;  1RQ0 A;  4LF9 E;  4I3H A;  1HR0 I;  1MU5 A;  3JAM Q;  2EFG A;  2V83 A;  2HFU A;  3J7Y p;  1XNR E;  4DPT A;  4X65 I;  4GKK I;  1OJ4 A;  2IHR 1;  4F9A B;  4X8W A;  2NUG A;  4DV5 I;  2E1M A;  3P1X A;  2B7V A;  1QU6 A;  4LF6 E;  4DR6 E;  3H4L A;  5A2Q C;  2KOU A;  2RSM A;  1Z0W A;  2M4I A;  4FWD A;  3PYF A;  2DIX A;  2Z5B B;  2NPF A;  1XHK A;  2Q2E B;  2V34 A;  1FJG E;  1RR9 A;  1N33 E;  1FWL A;  2VQF E;  1ZXN A;  4DXL A;  4DV4 I;  4DR5 E;  3PYG A;  3K85 A;  1GZ6 A;  4BC7 A;  1YYK A;  3Q6M A;  2BV3 A;  2LUP B;  4IZJ D;  4YHH E;  3WU3 A;  3C4T A;  1FWK A;  2KHX A;  5LMN E;  4JI6 E;  1PIE A;  1STU A;  5DNY A;  3J81 C;  2V85 A;  1T4O A;  1MG7 A;  1HNZ I;  1NHH A;  2ZM6 E;  1N36 E;  1QZR A;  1J5E I;  3VK6 A;  1H72 C;  5LMU E;  1HNW E;  1A6F A;  2LJH A;  5A2Q Q;  3LML A;  4BC9 A;  1Z59 A;  4LF5 E;  4WPY A;  3ZZT A;  1IBM E;  3AV0 A;  4DR4 E;  2V87 A;  1XMQ E;  3H09 A;  4JI6 I;  4BCA A;  4J8Z A;  4M30 A;  4DUZ I;  1WHN A;  4JI3 E;  4R1F A;  2F4V E;  4UT4 A;  2VQE I;  1HNX E;  2UUB E;  1VIS A;  3KWR A;  3OML A;  1I94 I;  4GEQ B;  3PRY A;  2HFS A;  3J7A M;  3J81 Q;  2LTS A;  4HY1 A;  4WUD A;  2NUF A;  4NXN E;  3GON A;  1XMO I;  2HKE A;  1XNQ E;  2JOB A;  3T1H I;  4JI2 E;  1N0U A;  4YY3 E;  1WUU A;  2LJP A;  4X64 E;  4MYT A;  1D6T A;  2NA2 A;  2PNL A;  1WHQ A;  3K1J A;  3ZZU A;  2B7T A;  1IBL E;  1J26 A;  1Z5B A;  5IWA I;  3ADG A;  4F9B B;  2CPN A;  4LFB I;  5AE3 A;  1Z0C A;  3FIG A;  4LFC I;  1HK7 A;  1X47 A;  3HUL A;  3J80 C;  2UXB E;  3MSW A;  2R3V A;  2RTX A;  2AJ4 A;  1HR0 E;  3WU6 A;  1B63 A;  4DV1 I;  2LUQ A;  4IZJ B;  4X65 E;  4X62 I;  4X66 I;  5FLX Q;  4GKK E;  4DU8 A;  4JI4 I;  1Z0E A;  2V89 A;  5AE2 A;  1EKZ A;  2DB2 A;  2E5L I;  4DV5 E;  4JI1 I;  4JV5 I;  3QT7 A;  3V5R A;  2A2D A;  4DPU A;  2G7H A;  1DAR A;  1Z0B A;  1B62 A;  1N34 I;  4B3M I;  1GQE A;  1H7S A;  3B8H A;  4B3R I;  2FGG A;  2L2M A;  3JU0 A;  4R8O A;  4DV7 I;  4DV4 E;  4WFT A;  1U2R A;  1ZM3 A;  3J80 Q;  3OTO I;  5BR8 I;  2R42 A;  4M1K A;  2UUA I;  1T4L B;  1YZ9 A;  2V88 A;  2DMY A;  2L2N A;  3QT5 A;  4PRV A;  4K0K I;  4JG4 A;  4GKJ E;  4P7D A;  2UU9 I;  5ADZ A;  4DV0 I;  1Z5A A;  2O1U A;  2X7I A;  2CG9 A;  2VF1 A;  1K47 A;  1FNM A;  1HNZ E;  4LF8 I;  2EZ6 A;  1N0V C;  1J5E E;  2YT4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...