3OTOE

Crystal structure of the 30s ribosomal subunit from a ksga mutant of thermus thermophilus (hb8)
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
150
structure length
150
Chain Sequence
b'DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title Modification of 16S ribosomal RNA by the KsgA methyltransferase restructures the 30S subunit to optimize ribosome function.
pubmed doi rcsb
molecule tags Ribosome
total genus 36
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2010-09-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 3otoE01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 3otoE02
5GMEA 4DR6E 1XNQI 2HFUA 1NHHA 4USMA 4DR4E 3C4BA 2XEXA 3J7AM 4YY3E 1UEKA 3K17A 1UILA 2MDRA 4PRVA 3ZZUA 2UUCI 4B3SI 4LF5E 3QT8A 1PIEA 1YYOA 1HNXI 1I94E 2YT4A 1N33E 1ZXNA 4B3RE 3B8HA 4HACB 4LF4E 2VF3A 2HKEA 2L2KB 1QZRA 3HTXA 1H7SA 1WUUA 4WYQB 1A6FA 4UTGA 1KTVA 4AQYI 1X47A 4USKA 3ADGA 2V2QA 2E1RA 4DV6I 3J81Q 1Z0BA 2NPFA 4NXNE 1PKPA 1QU6A 5IWAE 5FLXQ 4JV5E 4DPXA 5LMNI 4X62I 1Z5CA 2ZM6E 2UXDE 5CFFE 4WUCA 3WU6A 3OTOE 4DR1I 5BR8E 1FI4A 2NA2A 2LJPA 3T1YE 2F4VI 3VYXA 3H4LA 4XTJA 4DKKA 1XNRE 3ADJA 4JI5I 2HKJA 4DV7I 2V34A 4P52A 2HHHE 4ZVIA 1T4LB 1N36I 4DV5I 3Q1QA 4DUZE 1RR9A 1X48A 2DB2A 1HR0I 4WUBA 1H72C 2N3HA 2NUEA 4LFCE 4JI0I 1DARA 4DV3I 1N0VC 3F0NA 3LLHA 3LTOA 4DR6I 4KQVA 5LMUI 4JI1E 4NXME 4LFBE 2DEIA 1Z0CA 4LF5I 2L33A 1N32E 4X64I 2UUBE 2E5LE 3PYEA 4MYTA 2X36A 2HK3A 4JI6I 4JG4A 1KVKA 1Z59A 1MG7A 1IBKE 2R3VA 1I94I 4GKKE 2J7KA 3D4JA 1DI2A 1N33I 2B3TB 4JI3E 1VISA 4B3RI 2UU9E 4DR7E 3B82A 4JI8E 1D6TA 4OOGC 1ZM4A 3V2UC 4B3MI 4DV4E 4PU9A 4NXNI 4DUYI 3QT7A 5IT9C 1FWKA 2EZ6A 4X8WA 4DV1E 4LF6E 4HY1A 4LF9I 2LTSA 3CWVA 4B3TE 2UXDI 4JI7E 4DR2I 1MU5A 3QT5A 3OTOI 4M30A 3T1HE 4LF8E 1XMQE 4I3HA 2V8PA 2EFGA 3WU5A 1XNRI 3V5RA 5GMDA 1N34E 1STUA 2NUFA 4K0KE 1ZM9A 1XNQE 2LUQA 4WFTA 4JI4I 2VQEE 3PYDA 3JAMQ 3B78A 4FWGA 1O0WA 4YHHE 4LF7E 1XMOI 1NHJA 3ADLA 3LNUA 2LBSB 1S16A 4NXMI 3M6AA 4LFBI 1Z0EA 4JYAI 4HYMA 3ZZ0A 2VQFE 4LFAE 2UUBI 2E5LI 2JVAA 1S4EA 1BKNA 4DR5E 1H74A 1XHKA 1J5EE 4GKKI 1WHQA 4DU7A 2UU9I 1Z0GA 4AQYE 4FW9A 4JI2E 4X66E 4DV6E 4HXZA 3ZM7A 2LTRA 2A2CA 2UUAE 4DPWA 3J7Yp 2UXCE 4KHPE 2HFSA 4Z7CA 3C4TA 4DR4I 1ZM2A 4YY3I 4OX9E 3J81C 4DR3E 1X49A 1RC7A 3ZKDA 4X62E 4Z7YA 4DV2E 1IBME 5FLXC 2CZ9A 1H73A 4FWHA 4DV1I 4DPTA 2F4VE 2A2DA 1YZ9A 4B3TI 4DXLA 4LF4I 2B7VA 4JI5E 2V2ZA 3JAMC 1EKZA 4DV7E 5LL6R 1MX0A 1PVGA 2ZBKB 2UXBE 4R1FA 1N36E 1XMQI 4DV5E 5A2QQ 2IHR1 2BV3A 2RTXA 1T4OA 1FJGE 2V2VA 1HNWE 1ZBTA 5IWAI 1HNZE 4RPFA 1N34I 1IBLE 4JV5I 3LPSA 4K0KI 4DPYA 4DV3E 5LMUE 4M2ZA 2ZM6I 2BM1A 2VQEI 1UHZA 2OI2A 4YHHI 2RSMA 5BR8I 4X64E 4LF7I 1B62A 4WUDA 3T1YI 4JI6E 2L3CA 2LJHA 2LUPB 4FWDA 4GKJE 1NHIA 4DV0E 4DU8A 2DEJA 1GQEA 2HHHI 3PYFA 2DMYA 2VQFI 4LFAI 3PYGA 1FWLA 2Q2EB 4DR5I 3VYYA 2R42A 4DUZI 4X65E 1J5EI 3WU3A 3J80Q 1OJ4A 1EI1A 4B3ME 4JI2I 4X66I 2UUCE 4B3SE 4LFCI 1Z0TA 1KIJA 4DUYE 4URLA 1RREA 2UUAI 1HNXE 2X7IA 2UXCI 4JI1I 4KHPI 1T4NA 5A2QC 2HK2A 4MYUA 4OX9I 4DR3I 4UT4A 3GONA 2RS6A 4LF9E 4ED4A 1N32I 4DV2I 1IBMI 3WU4A 4DR2E 2RS7A 3ZKBA 1IBKI 4JI3I 1FNMA 2L3JA 1J26A 4DR7I 2LRSA 4HACA 4JI8I 1Z5AA 2UXBI 3QT6A 1KKHA 4DPUA 5IT9Q 1YYWA 4M1KA 1YYKA 1EA6A 1Z0VA 1ZXMA 3J7AG 5LMNE 2WW4A 2B7TA 2ZITA 4DV4I 1Z5BA 1FKAE 4PRXA 4JI4E 5L3JA 1FJGI 1HNWI 1K47A 1NZ0A 1RQ0A 1WHNA 1HNZI 4DR1E 1IBLI 1ZM3A 3K1JA 2N3GA 3J80C 4LF6I 2NUGA 1XMOE 2BM0A 2GS8A 3P1XA 4JI7I 2L2MA 1U2RA 4JYAE 3T1HI 1N0UA 4LF8I 2L2NA 4EMDA 4FN5A 4GKJI 4DV0I 1H7UA 2KHXA 3ZZTA 2DIXA 3HULA 1HR0E 4P7AA 2CPNA 1B63A 1Z0WA 4JI0E 1ELOA 3ADIA 2AJ4A 2JY9A 4X65I
chains in the Genus database with same CATH superfamily
5GMEA 5A6AA 3RMPA 4DR6E 2EQ1A 4P7DA 2JT2A 3P3GA 3UHMA 2HFUA 1XNQI 1NHHA 2DLKA 4USMA 1T39A 4DR4E 3C4BA 2XEXA 2Z5EA 4LCGA 3J7AM 4YY3E 1UEKA 3K17A 2WNRA 1UILA 4BA1B 1IQSA 2MDRA 4PRVA 3ZZUA 2UUCI 4B3SI 1X6HA 4LF5E 1TN9A 4L5NC 3QT8A 1PIEA 1YYOA 4TUIA 1HNXI 4ZYEA 1Y4UA 1A1IA 2YTGA 3Q6MA 5EKWA 4LPFA 1I94E 2YT4A 2EPNA 2PO1B 4J3DA 1N33E 1ZXNA 2BA1G 2WP8B 4B3RE 5TSEA 5AC5A 3B8HA 2B9DA 2NN6D 2G7HA 4HACB 4LF4E 2VF3A 2HKEA 2BBGA 1ZU1A 2EM7A 2L2KB 1QZRA 2EMGA 4J8ZA 3HTXA 3H09A 1H7SA 1WUUA 1OYRA 2LCEA 1PJTA 2EMLA 2YWQA 4WYQB 1A6FA 1KTVA 3PRYA 4UTGA 4AQYI 1X47A 5K36F 4USKA 3ADGA 5KL3A 2V2QA 2E1RA 4DV6I 3J81Q 1Z0BA 1LLMC 2GLIA 2NPFA 4NXNE 1PKPA 2AE8A 1QU6A 4AIMA 2NN6A 4Q28A 1MGTA 4AIDA 2IERA 4BA2A 4HEIA 4MLQA 5F3WA 5IWAE 5FLXQ 5KL2A 1IMUA 4JV5E 4DPXA 2M4IA 4QNJA 4NHRA 5LMNI 2V89A 4X62I 2EN1A 4R2CA 4IFDB 2JR1A 2LO3A 2EOEA 1Z5CA 2CG9A 3M85G 2ZM6E 2UXDE 5AE1A 5CFFE 4OZEA 3BBGA 4WUCA 4FK5C 2DRPA 2WBSA 3WU6A 3C6MA 3EQ1A 3OTOE 1A1FA 3K85A 4DR1I 4IFDC 5BR8E 1BBGA 1FI4A 2NA2A 2EOMA 2LJPA 2E72A 3T1YE 2F4VI 5A6BD 3VYXA 3H4LA 4LCFA 4XTJA 2YTEA 2EPZA 4DKKA 1XNRE 3ADJA 4IS1C 4JI5I 4R03A 2ELYA 2MDGA 2HKJA 2V34A 2YTPA 4DV7I 2EJ4A 4OO1D 4P52A 1R6LA 2HHHE 1UDNA 4WXDA 4ZVIA 4WSGA 1T4LB 1A1HA 1JK1A 1N36I 1E3PA 1YH8A 2LV2A 1UDOA 4DV5I 3Q1QA 5AC4A 4BS9A 4DUZE 1RR9A 4IJDA 2MC5A 2HJJA 1PJSA 2FGGA 2ODRD 5A6BA 1X48A 2EM3A 2DB2A 2YZTA 4F6NA 4IFDF 4NZVA 1HR0I 4WUBA 3AV0A 1H72C 2K4VA 2N3HA 2NUEA 4N3OA 4OO1A 4LFCE 1E3HA 4JI0I 2YRMA 1F2IG 1DARA 2CSHA 4MDTA 1Z1BA 2V85A 1A1LA 2EPAA 3LLHA 1N0VC 3F0NA 3LTOA 4DV3I 4DR6I 4KQVA 2J65A 1KYQA 4JI1E 4GEQB 4KZSA 5LMUI 4NXME 1P47A 4LFBE 4HTGA 2DEIA 4O5GA 2JEBB 1P42A 1Z0CA 4WXCA 2F1DA 2H36X 4LF5I 4IFDE 2L33A 1N32E 4MU0A 5AE3A 2PO2B 2UUBE 2E5LE 4TUGA 3PYEA 4MYTA 2X36A 2EMKA 4X64I 2HK3A 3PS3A 4JI6I 4JG4A 1KVKA 1Z59A 4R2EA 1MG7A 1MEYC 2EOOA 1IBKE 2BA1D 2R3VA 1I94I 4GKKE 2J7KA 2YSPA 4RHBB 4R2SA 3PS2A 4LTYA 1DI2A 3D4JA 5JEAA 2Z5BA 2B3TB 2RSIA 4JI3E 2M9AA 2UU9E 1VISA 4B3RI 1N33I 2ENHA 4ZYGA 2LE2A 2GHFA 2JXPA 1DGCA 2NN6B 2DSYA 2YU5A 4DR7E 1YHCA 2J7JA 2PNLA 3B82A 2Z5CA 4BA2B 4JI8E 1OYSA 3F6HA 5A69A 2EP3A 1D6TA 2KOUA 1RHYA 4OOGC 3CDJA 2R76A 1NCSA 5DRQA 1USVA 1ZM4A 2NN6C 3HJCA 4F2JC 2E1MA 4MQYA 3EPLA 3V2UC 4B3MI 4DV4E 5C0XD 2V83A 4PU9A 4NXNI 4DUYI 3QT7A 2YTNA 1YUJA 4IZJD 5IT9C 1YSAC 2EOZA 2V8QB 1Y6ZA 1YPNA 2EN7A 3U1KA 1FWKA 2EZ6A 2O1TA 2O1UA 4X8WA 4BHCA 3VK6A 1TF6A 4DV1E 2VESA 4AM3A 4LF6E 2C37A 4R2RA 4HY1A 2EL5A 2O1WA 4LF9I 2LTSA 3CWVA 4B3TE 4FW4A 2UXDI 2YPNA 4I8OA 4JI7E 4DR2I 5C0XA 1MU5A 2RQLA 1AH5A 3QT5A 3GLLA 4FW7A 3OTOI 4M30A 3JU0A 3T1HE 4LF8E 1YUIA 2K7IA 4IZJA 2EMFA 1XMQE 4I3HA 2BA0G 2V8PA 2EFGA 3WU5A 1XNRI 2PRTA 2L92A 2CT1A 3UK3C 3C6KA 4BBYA 4BC7A 3CDIA 3V5RA 1G2DC 2EN6A 4OO1B 3M99B 2EM4A 2LVHA 5GMDA 2EM9A 2NN6E 3IWCA 1N34E 1STUA 2VRDA 3P76A 3KWRA 4M9VC 5FWKA 2NUFA 4K0KE 4OO1C 1ZM9A 1XNQE 2LUQA 5K36D 3BF2A 4WFTA 1YFHA 1OYPA 3HPZA 4MU1A 4JI4I 2A25A 4O4KA 2VQEE 2EQ3A 3PYDA 3B78A 4FWGA 3JAMQ 1O0WA 4YHHE 4WSPA 3KZZA 2FTXB 4QNKA 4FW3A 1Y60A 4IZKA 2PNZB 4R2PA 5DRRA 4LF7E 2ODRC 2GQ0A 2BR2A 2EOYA 2M1SA 4MU3A 1XMOI 1NHJA 3ADLA 3LNUA 3M7NG 2Z5BB 2N8XA 2JOXA 2LBSB 4WPYA 2DMIA 1S16A 3M6AA 4NXMI 4LFBI 2CVEA 2JYAA 1Z0EA 5A6JA 2EPLX 2EQ0A 2EPOA 2EE8A 4JYAI 5K36A 4HYMA 3ZZ0A 2VQFE 2Z5CB 2CTDA 3TQMA 2KONA 4LFAE 2UUBI 2YTJA 2JVAA 2EPCA 2YTDA 1UN6B 2E5LI 2F8BA 1S4EA 1WRJA 1BKNA 4DR5E 1H74A 2EL6A 4ZYDA 1XHKA 1VI7A 3DJWA 1J5EE 4GKKI 2WNRB 2EPKX 2R1FA 1WHQA 4DU7A 3GMEA 2UU9I 2EMWA 4AQYE 1Z0GA 3IWDA 4FW9A 5DNXA 1PJQA 4JI2E 3EPHA 4X66E 4DV6E 1Y5YA 2IOQA 4FW6A 4HXZA 3ZM7A 2PO1A 3L7ZA 3PS1A 1XXEA 2LTRA 2MC6A 1DQ3A 2UUAE 1RMDA 2MKDA 2A2CA 4OO1E 5JEAD 4DPWA 2GPIA 3ECRA 2PO0A 2IESA 3J7Yp 2IOPA 2UXCE 4OKGA 4KHPE 2HFSA 2EPUA 3C4TA 4Z7CA 4DR4I 4BC9A 1ZM2A 4YY3I 4OX9E 3KZYA 3J81C 1X49A 4LU9A 4L8NA 4DR3E 1RC7A 3ZKDA 2EMBA 2EMXA 4X62E 4Z7YA 2VE7C 5C0XB 4MU4A 3KRNA 3P3EA 4DV2E 2WBUA 4M0VA 1IBME 5FLXC 1ZAAC 4IZJB 2PNMA 2CZ9A 1ZR9A 4MLVA 1H73A 4FWHA 3F6GA 2YRHA 2RPCA 1X6FA 3BGHA 5C0XC 1B69A 4DV1I 3BIDA 4DPTA 2F4VE 2A2DA 2JEAA 1YZ9A 2L6MA 4B3TI 4DXLA 4LF4I 2B7VA 3JAMC 4JI5E 2V2ZA 1EKZA 4O24A 3H1CA 4IFDA 4DV7E 5LL6R 2EM5A 1MX0A 2C38A 4WX9A 1AAYA 2I13A 2I9IA 1PVGA 2ZBKB 2YTOA 2UXBE 4R1FA 2BA0D 2EMZA 3AUZA 1N36E 2O3ZA 1XMQI 2EMHA 2EMYA 2EM2A 4DV5E 1A1JA 4FW5A 5EL9A 4U3DA 4R2AA 2JE6A 5A2QQ 3THNA 1HK7A 2HC5A 4LCHA 2HGHA 2IHR1 2BV3A 4R2DA 2RTXA 1N3GA 2D9HA 1T4OA 1BBOA 1FJGE 2V2VA 1NEIA 1HNWE 1ZBTA 5IWAI 4GZNC 2BR2B 3FIGA 1HNZE 4RPFA 1IBLE 1N34I 4JV5I 3L00A 3THOB 3DD6A 2BB8A 3LPSA 3M85D 4K0KI 4DPYA 4DMIA 3DF6A 4F9CB 4DV3E 2YSOA 5KL5A 5LMUE 4M2ZA 4X9JA 5K36B 1X5WA 2V86A 2DGCA 2ZM6I 1SR9A 2V87A 2BM1A 2VQEI 1TF3A 1UHZA 2NN6F 2EM0A 2OI2A 4YHHI 3MHSC 1X6EA 1A1KA 2RSMA 1GTKA 4F6MA 5BR8I 2EM8A 3GCMA 4X64E 5C0XE 1B62A 4WUDA 4LF7I 3M7ND 3T1YI 5K36C 4R8OA 4JI6E 2C39A 2L3CA 2LJHA 2LUPB 5DNYA 2GO4A 2VF1A 5KL4A 4FWDA 4GKJE 1NHIA 4DV0E 4DU8A 2FV4B 2JOBA 2DEJA 1GQEA 2HHHI 2EN4A 3PYFA 2EPRA 2DMYA 1BB8A 2VQFI 4LOMA 3L7ZB 4LFAI 2EMCA 2JEBA 3PYGA 1FWLA 2Q2EB 2EWLA 2PO0B 4DR5I 3VYYA 2R42A 2PO2A 4DUZI 4X65E 1J5EI 2JP9A 2O1VA 3WU3A 1A1GA 3U1YA 3J80Q 4BCAA 1OJ4A 2NABA 4U3BA 2EPPA 1IQOA 3K6QA 1Y4SA 5IV8B 1EI1A 5DNLA 2ADRA 4B3ME 4JI2I 4X66I 5KL6A 2GO3A 2EL4A 2UUCE 4B3SE 4LFCI 3HPSA 1KIJA 1Z0TA 4DUYE 4URLA 1RREA 2UUAI 1HNXE 4BMJA 2X7IA 1SFEA 4GQUA 5JEAB 4JI1I 4KHPI 2UXCI 1KJKA 1T4NA 2JEAB 5A2QC 2HK2A 2EOJA 1T38A 4MYUA 1UDSA 4DR3I 4OX9I 1PDAA 5ELWA 3GONA 4UT4A 2RS6A 4LF9E 4ED4A 1N32I 2C38B 2EMAA 4P78A 5JEAC 4OO1F 2YTQA 3NZKA 2EOIA 2EOHA 4BA1A 4DV2I 2EPXA 3WU4A 1IBMI 2LMZA 5K36E 4DR2E 2MKNA 2RS7A 2YRKA 2CGEA 3ZKBA 1IBKI 3HQ1A 2EN2A 2JE6B 2YU8A 4F54A 4JI3I 1UBDC 1EH8A 2JPAA 1FNMA 4NBQA 2EMIA 2EPMX 2L3JA 1J26A 3P3CA 1L4SA 2WP8A 3EPKA 4DR7I 3ZOQB 1QNTA 5ADZA 2LRSA 4HACA 4JI8I 2M7QA 1Z5AA 2WZOA 1USUA 4ISAA 2UXBI 3QT6A 1KKHA 1G2FC 4RH8A 2DLQA 1WXRA 1YYWA 5DROA 4M1KA 2C37B 4DPUA 5JEAF 1YYKA 5IT9Q 1EA6A 1Z0VA 1ZXMA 4IFDD 3J7AG 5LMNE 2WW4A 2B7TA 2ZITA 4DV4I 2EN8A 3QG5C 4N4RB 1Z5BA 1FKAE 4PRXA 5DRPA 4IS9A 4JI4E 5L3JA 1FJGI 4O43A 1HNWI 1K47A 1NZ0A 1RQ0A 3Q6NA 1WHNA 3MSWA 1HNZI 4DR1E 2C39B 1ZM3A 3P06A 2LJUA 2EM6A 1IBLI 2EORA 3K1JA 3MHHC 1X3CA 3EPJA 2N3GA 3J80C 5IXMB 4LF6I 5A6KA 2ELZA 2NUGA 1XMOE 2BM0A 2GS8A 2EN3A 5JEAE 2WBTA 3HKMA 5KL7A 3OMLA 1EH6A 3P1XA 5T6JA 4JI7I 1WJPA 2L2MA 3IWBA 1U2RA 4JYAE 1R6MA 1JK2A 3T1HI 1ZBQA 2YTFA 1N0UA 4LF8I 1UDQA 2Q8UA 3JTZA 3LMLA 2L2NA 4EMDA 4BHBA 5AASA 2EOQA 4ZYHA 3VHTB 4Q35B 2WCC3 2L8TA 5AE2A 2PNZA 4F9AB 4FN5A 4DV0I 2V88A 1H7UA 4GKJI 2KHXA 2LT7A 3ZZTA 2DIXA 3HULA 2EOXA 3HXLA 1GZ6A 2YTIA 2EOSA 1EH7A 4R2QA 1HR0E 5C0XF 4IZKB 4P7AA 2CPNA 2EOFA 1B63A 1Z0WA 2ENAA 4F9BB 3B4TA 2JWOA 2ENCA 4JI0E 5LLQA 1ELOA 3ADIA 2AJ4A 2JY9A 4X65I 4KWYA
chains in the Genus database with same CATH topology
5GMEA 4DR6E 3RMPA 4P7DA 1XNQI 2HFUA 1NHHA 4USMA 4DR4E 3C4BA 2XEXA 2Z5EA 3J7AM 4YY3E 1UEKA 3K17A 1UILA 2MDRA 4PRVA 3ZZUA 2UUCI 4B3SI 4LF5E 4L5NC 3QT8A 1PIEA 1YYOA 4TUIA 1HNXI 1Y4UA 3Q6MA 1I94E 2YT4A 1N33E 1ZXNA 4B3RE 3B8HA 2B9DA 2G7HA 4HACB 4LF4E 2VF3A 2HKEA 2L2KB 1QZRA 4J8ZA 3HTXA 3H09A 1H7SA 1WUUA 4WYQB 1A6FA 3PRYA 4UTGA 1KTVA 4AQYI 1X47A 4USKA 3ADGA 2V2QA 2E1RA 4DV6I 3J81Q 1Z0BA 2NPFA 4NXNE 1PKPA 1QU6A 4Q28A 5F3WA 5IWAE 5FLXQ 4JV5E 4DPXA 2M4IA 5LMNI 2V89A 4X62I 2JR1A 1Z5CA 2CG9A 2ZM6E 2UXDE 5AE1A 5CFFE 4WUCA 3WU6A 3OTOE 3K85A 4DR1I 5BR8E 1FI4A 2NA2A 2LJPA 3T1YE 2F4VI 3VYXA 3H4LA 4XTJA 4DKKA 1XNRE 3ADJA 4JI5I 4R03A 2HKJA 4DV7I 2V34A 4P52A 2HHHE 4ZVIA 1T4LB 1N36I 4DV5I 3Q1QA 4BS9A 4DUZE 1RR9A 2MC5A 2FGGA 2ODRD 1X48A 2DB2A 2YZTA 1HR0I 4WUBA 3AV0A 1H72C 2K4VA 2N3HA 2NUEA 4N3OA 4LFCE 4JI0I 1DARA 4DV3I 2V85A 1N0VC 3LLHA 3F0NA 3LTOA 4DR6I 4KQVA 5LMUI 4JI1E 4GEQB 4KZSA 4NXME 4LFBE 2DEIA 1Z0CA 2H36X 4LF5I 2L33A 1N32E 5AE3A 4X64I 2UUBE 2E5LE 4TUGA 3PYEA 4MYTA 2X36A 2HK3A 4JI6I 4JG4A 1KVKA 1Z59A 1MG7A 1IBKE 2R3VA 1I94I 4GKKE 2J7KA 4LTYA 1DI2A 3D4JA 2Z5BA 2B3TB 4JI3E 1VISA 4B3RI 2UU9E 1N33I 2LE2A 2DSYA 4DR7E 3B82A 2PNLA 2Z5CA 4JI8E 3F6HA 1D6TA 2KOUA 4OOGC 1USVA 1ZM4A 3HJCA 2E1MA 3V2UC 4B3MI 4DV4E 2V83A 4PU9A 4NXNI 4DUYI 3QT7A 4IZJD 5IT9C 2V8QB 1Y6ZA 1FWKA 2EZ6A 2O1TA 2O1UA 4X8WA 3VK6A 4DV1E 4LF6E 4HY1A 2O1WA 4LF9I 2LTSA 3CWVA 4B3TE 2UXDI 4I8OA 4JI7E 4DR2I 1MU5A 3QT5A 3OTOI 4M30A 3JU0A 3T1HE 4LF8E 4IZJA 1XMQE 4I3HA 2V8PA 2EFGA 3WU5A 1XNRI 2L92A 4BBYA 4BC7A 3V5RA 5GMDA 3IWCA 1N34E 1STUA 3KWRA 5FWKA 2NUFA 4K0KE 1ZM9A 1XNQE 2LUQA 4WFTA 4JI4I 3HPZA 2VQEE 3PYDA 3JAMQ 3B78A 4FWGA 1O0WA 4YHHE 4WSPA 2FTXB 4IZKA 4LF7E 2ODRC 2GQ0A 2M1SA 1XMOI 1NHJA 3ADLA 3LNUA 2Z5BB 2JOXA 2LBSB 4WPYA 1S16A 3M6AA 4NXMI 4LFBI 1Z0EA 4JYAI 4HYMA 3ZZ0A 2VQFE 2Z5CB 2KONA 4LFAE 2UUBI 2E5LI 2JVAA 2F8BA 1S4EA 1BKNA 4DR5E 1H74A 1XHKA 3DJWA 1J5EE 4GKKI 1WHQA 4DU7A 2UU9I 1Z0GA 4AQYE 3IWDA 4FW9A 2IOQA 4JI2E 4X66E 4DV6E 4HXZA 3ZM7A 2LTRA 2MC6A 1DQ3A 2UUAE 2A2CA 4DPWA 3J7Yp 2IOPA 2UXCE 4KHPE 2HFSA 4Z7CA 3C4TA 4DR4I 4BC9A 1ZM2A 4YY3I 4OX9E 3J81C 4DR3E 1X49A 4LU9A 4L8NA 1RC7A 3ZKDA 4X62E 4Z7YA 2VE7C 4DV2E 4M0VA 1IBME 5FLXC 4IZJB 2PNMA 2CZ9A 1H73A 4FWHA 3F6GA 4DV1I 4DPTA 2F4VE 2A2DA 1YZ9A 2L6MA 4B3TI 4DXLA 4LF4I 2B7VA 3JAMC 4JI5E 2V2ZA 1EKZA 4DV7E 5LL6R 1MX0A 1PVGA 2ZBKB 2UXBE 4R1FA 3AUZA 1N36E 1XMQI 4DV5E 5A2QQ 1HK7A 2IHR1 2BV3A 2RTXA 1T4OA 1FJGE 2V2VA 1HNWE 1ZBTA 5IWAI 3FIGA 1HNZE 4RPFA 1IBLE 1N34I 4JV5I 3LPSA 4K0KI 4DPYA 4DMIA 3DF6A 4F9CB 4DV3E 5LMUE 4M2ZA 2V86A 2ZM6I 1SR9A 2V87A 2BM1A 2VQEI 1UHZA 2OI2A 4YHHI 2RSMA 5BR8I 4X64E 4LF7I 1B62A 4WUDA 3T1YI 4R8OA 4JI6E 2L3CA 2LJHA 2LUPB 5DNYA 2VF1A 4FWDA 4GKJE 1NHIA 4DV0E 4DU8A 2FV4B 2JOBA 2DEJA 1GQEA 2HHHI 3PYFA 2DMYA 2VQFI 4LFAI 3PYGA 1FWLA 2Q2EB 2EWLA 4DR5I 3VYYA 2R42A 4DUZI 4X65E 1J5EI 2O1VA 3WU3A 3J80Q 4BCAA 1OJ4A 1Y4SA 3K6QA 1EI1A 4B3ME 4JI2I 4X66I 2UUCE 4B3SE 4LFCI 3HPSA 1KIJA 1Z0TA 4DUYE 4URLA 1RREA 2UUAI 1HNXE 4BMJA 2X7IA 2UXCI 4JI1I 4KHPI 1T4NA 5A2QC 2HK2A 4MYUA 4OX9I 4DR3I 4UT4A 3GONA 2RS6A 4LF9E 4ED4A 1N32I 4P78A 4DV2I 1IBMI 3WU4A 2LMZA 4DR2E 2RS7A 2CGEA 3ZKBA 1IBKI 3HQ1A 4F54A 4JI3I 1FNMA 2L3JA 1J26A 4DR7I 3ZOQB 5ADZA 2LRSA 4HACA 4JI8I 2M7QA 1Z5AA 2WZOA 1USUA 2UXBI 3QT6A 1KKHA 4DPUA 1WXRA 1YYWA 5IT9Q 4M1KA 1YYKA 1EA6A 1Z0VA 1ZXMA 3J7AG 5LMNE 2WW4A 2B7TA 2ZITA 4DV4I 1Z5BA 1FKAE 4PRXA 4JI4E 5L3JA 1FJGI 1HNWI 1K47A 1NZ0A 1RQ0A 3Q6NA 1WHNA 3MSWA 1HNZI 4DR1E 1IBLI 1ZM3A 3P06A 3K1JA 2N3GA 3J80C 4LF6I 2NUGA 1XMOE 2BM0A 2GS8A 3OMLA 5T6JA 3P1XA 4JI7I 2L2MA 3IWBA 1U2RA 4JYAE 3T1HI 1ZBQA 1N0UA 4LF8I 3JTZA 3LMLA 2L2NA 4EMDA 5AASA 2L8TA 5AE2A 4FN5A 4F9AB 4GKJI 4DV0I 2V88A 1H7UA 2KHXA 3ZZTA 2DIXA 3HULA 3HXLA 1GZ6A 1HR0E 4IZKB 4P7AA 2CPNA 1B63A 1Z0WA 4F9BB 2JWOA 4JI0E 1ELOA 3ADIA 2AJ4A 2JY9A 4X65I
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5GME A;  4DR6 E;  1XNQ I;  2HFU A;  1NHH A;  4USM A;  4DR4 E;  3C4B A;  2XEX A;  3J7A M;  4YY3 E;  1UEK A;  3K17 A;  1UIL A;  2MDR A;  4PRV A;  3ZZU A;  2UUC I;  4B3S I;  4LF5 E;  3QT8 A;  1PIE A;  1YYO A;  1HNX I;  1I94 E;  2YT4 A;  1N33 E;  1ZXN A;  4B3R E;  3B8H A;  4HAC B;  4LF4 E;  2VF3 A;  2HKE A;  2L2K B;  1QZR A;  3HTX A;  1H7S A;  1WUU A;  4WYQ B;  1A6F A;  4UTG A;  1KTV A;  4AQY I;  1X47 A;  4USK A;  3ADG A;  2V2Q A;  2E1R A;  4DV6 I;  3J81 Q;  1Z0B A;  2NPF A;  4NXN E;  1PKP A;  1QU6 A;  5IWA E;  5FLX Q;  4JV5 E;  4DPX A;  5LMN I;  4X62 I;  1Z5C A;  2ZM6 E;  2UXD E;  5CFF E;  4WUC A;  3WU6 A;  3OTO E;  4DR1 I;  5BR8 E;  1FI4 A;  2NA2 A;  2LJP A;  3T1Y E;  2F4V I;  3VYX A;  3H4L A;  4XTJ A;  4DKK A;  1XNR E;  3ADJ A;  4JI5 I;  2HKJ A;  4DV7 I;  2V34 A;  4P52 A;  2HHH E;  4ZVI A;  1T4L B;  1N36 I;  4DV5 I;  3Q1Q A;  4DUZ E;  1RR9 A;  1X48 A;  2DB2 A;  1HR0 I;  4WUB A;  1H72 C;  2N3H A;  2NUE A;  4LFC E;  4JI0 I;  1DAR A;  4DV3 I;  1N0V C;  3F0N A;  3LLH A;  3LTO A;  4DR6 I;  4KQV A;  5LMU I;  4JI1 E;  4NXM E;  4LFB E;  2DEI A;  1Z0C A;  4LF5 I;  2L33 A;  1N32 E;  4X64 I;  2UUB E;  2E5L E;  3PYE A;  4MYT A;  2X36 A;  2HK3 A;  4JI6 I;  4JG4 A;  1KVK A;  1Z59 A;  1MG7 A;  1IBK E;  2R3V A;  1I94 I;  4GKK E;  2J7K A;  3D4J A;  1DI2 A;  1N33 I;  2B3T B;  4JI3 E;  1VIS A;  4B3R I;  2UU9 E;  4DR7 E;  3B82 A;  4JI8 E;  1D6T A;  4OOG C;  1ZM4 A;  3V2U C;  4B3M I;  4DV4 E;  4PU9 A;  4NXN I;  4DUY I;  3QT7 A;  5IT9 C;  1FWK A;  2EZ6 A;  4X8W A;  4DV1 E;  4LF6 E;  4HY1 A;  4LF9 I;  2LTS A;  3CWV A;  4B3T E;  2UXD I;  4JI7 E;  4DR2 I;  1MU5 A;  3QT5 A;  3OTO I;  4M30 A;  3T1H E;  4LF8 E;  1XMQ E;  4I3H A;  2V8P A;  2EFG A;  3WU5 A;  1XNR I;  3V5R A;  5GMD A;  1N34 E;  1STU A;  2NUF A;  4K0K E;  1ZM9 A;  1XNQ E;  2LUQ A;  4WFT A;  4JI4 I;  2VQE E;  3PYD A;  3JAM Q;  3B78 A;  4FWG A;  1O0W A;  4YHH E;  4LF7 E;  1XMO I;  1NHJ A;  3ADL A;  3LNU A;  2LBS B;  1S16 A;  4NXM I;  3M6A A;  4LFB I;  1Z0E A;  4JYA I;  4HYM A;  3ZZ0 A;  2VQF E;  4LFA E;  2UUB I;  2E5L I;  2JVA A;  1S4E A;  1BKN A;  4DR5 E;  1H74 A;  1XHK A;  1J5E E;  4GKK I;  1WHQ A;  4DU7 A;  2UU9 I;  1Z0G A;  4AQY E;  4FW9 A;  4JI2 E;  4X66 E;  4DV6 E;  4HXZ A;  3ZM7 A;  2LTR A;  2A2C A;  2UUA E;  4DPW A;  3J7Y p;  2UXC E;  4KHP E;  2HFS A;  4Z7C A;  3C4T A;  4DR4 I;  1ZM2 A;  4YY3 I;  4OX9 E;  3J81 C;  4DR3 E;  1X49 A;  1RC7 A;  3ZKD A;  4X62 E;  4Z7Y A;  4DV2 E;  1IBM E;  5FLX C;  2CZ9 A;  1H73 A;  4FWH A;  4DV1 I;  4DPT A;  2F4V E;  2A2D A;  1YZ9 A;  4B3T I;  4DXL A;  4LF4 I;  2B7V A;  4JI5 E;  2V2Z A;  3JAM C;  1EKZ A;  4DV7 E;  5LL6 R;  1MX0 A;  1PVG A;  2ZBK B;  2UXB E;  4R1F A;  1N36 E;  1XMQ I;  4DV5 E;  5A2Q Q;  2IHR 1;  2BV3 A;  2RTX A;  1T4O A;  1FJG E;  2V2V A;  1HNW E;  1ZBT A;  5IWA I;  1HNZ E;  4RPF A;  1N34 I;  1IBL E;  4JV5 I;  3LPS A;  4K0K I;  4DPY A;  4DV3 E;  5LMU E;  4M2Z A;  2ZM6 I;  2BM1 A;  2VQE I;  1UHZ A;  2OI2 A;  4YHH I;  2RSM A;  5BR8 I;  4X64 E;  4LF7 I;  1B62 A;  4WUD A;  3T1Y I;  4JI6 E;  2L3C A;  2LJH A;  2LUP B;  4FWD A;  4GKJ E;  1NHI A;  4DV0 E;  4DU8 A;  2DEJ A;  1GQE A;  2HHH I;  3PYF A;  2DMY A;  2VQF I;  4LFA I;  3PYG A;  1FWL A;  2Q2E B;  4DR5 I;  3VYY A;  2R42 A;  4DUZ I;  4X65 E;  1J5E I;  3WU3 A;  3J80 Q;  1OJ4 A;  1EI1 A;  4B3M E;  4JI2 I;  4X66 I;  2UUC E;  4B3S E;  4LFC I;  1Z0T A;  1KIJ A;  4DUY E;  4URL A;  1RRE A;  2UUA I;  1HNX E;  2X7I A;  2UXC I;  4JI1 I;  4KHP I;  1T4N A;  5A2Q C;  2HK2 A;  4MYU A;  4OX9 I;  4DR3 I;  4UT4 A;  3GON A;  2RS6 A;  4LF9 E;  4ED4 A;  1N32 I;  4DV2 I;  1IBM I;  3WU4 A;  4DR2 E;  2RS7 A;  3ZKB A;  1IBK I;  4JI3 I;  1FNM A;  2L3J A;  1J26 A;  4DR7 I;  2LRS A;  4HAC A;  4JI8 I;  1Z5A A;  2UXB I;  3QT6 A;  1KKH A;  4DPU A;  5IT9 Q;  1YYW A;  4M1K A;  1YYK A;  1EA6 A;  1Z0V A;  1ZXM A;  3J7A G;  5LMN E;  2WW4 A;  2B7T A;  2ZIT A;  4DV4 I;  1Z5B A;  1FKA E;  4PRX A;  4JI4 E;  5L3J A;  1FJG I;  1HNW I;  1K47 A;  1NZ0 A;  1RQ0 A;  1WHN A;  1HNZ I;  4DR1 E;  1IBL I;  1ZM3 A;  3K1J A;  2N3G A;  3J80 C;  4LF6 I;  2NUG A;  1XMO E;  2BM0 A;  2GS8 A;  3P1X A;  4JI7 I;  2L2M A;  1U2R A;  4JYA E;  3T1H I;  1N0U A;  4LF8 I;  2L2N A;  4EMD A;  4FN5 A;  4GKJ I;  4DV0 I;  1H7U A;  2KHX A;  3ZZT A;  2DIX A;  3HUL A;  1HR0 E;  4P7A A;  2CPN A;  1B63 A;  1Z0W A;  4JI0 E;  1ELO A;  3ADI A;  2AJ4 A;  2JY9 A;  4X65 I; 
#chains in the Genus database with same CATH topology
 5GME A;  5A6A A;  3RMP A;  4DR6 E;  2EQ1 A;  4P7D A;  2JT2 A;  3P3G A;  3UHM A;  2HFU A;  1XNQ I;  1NHH A;  2DLK A;  4USM A;  1T39 A;  4DR4 E;  3C4B A;  2XEX A;  2Z5E A;  4LCG A;  3J7A M;  4YY3 E;  1UEK A;  3K17 A;  2WNR A;  1UIL A;  4BA1 B;  1IQS A;  2MDR A;  4PRV A;  3ZZU A;  2UUC I;  4B3S I;  1X6H A;  4LF5 E;  1TN9 A;  4L5N C;  3QT8 A;  1PIE A;  1YYO A;  4TUI A;  1HNX I;  4ZYE A;  1Y4U A;  1A1I A;  2YTG A;  3Q6M A;  5EKW A;  4LPF A;  1I94 E;  2YT4 A;  2EPN A;  2PO1 B;  4J3D A;  1N33 E;  1ZXN A;  2BA1 G;  2WP8 B;  4B3R E;  5TSE A;  5AC5 A;  3B8H A;  2B9D A;  2NN6 D;  2G7H A;  4HAC B;  4LF4 E;  2VF3 A;  2HKE A;  2BBG A;  1ZU1 A;  2EM7 A;  2L2K B;  1QZR A;  2EMG A;  4J8Z A;  3HTX A;  3H09 A;  1H7S A;  1WUU A;  1OYR A;  2LCE A;  1PJT A;  2EML A;  2YWQ A;  4WYQ B;  1A6F A;  1KTV A;  3PRY A;  4UTG A;  4AQY I;  1X47 A;  5K36 F;  4USK A;  3ADG A;  5KL3 A;  2V2Q A;  2E1R A;  4DV6 I;  3J81 Q;  1Z0B A;  1LLM C;  2GLI A;  2NPF A;  4NXN E;  1PKP A;  2AE8 A;  1QU6 A;  4AIM A;  2NN6 A;  4Q28 A;  1MGT A;  4AID A;  2IER A;  4BA2 A;  4HEI A;  4MLQ A;  5F3W A;  5IWA E;  5FLX Q;  5KL2 A;  1IMU A;  4JV5 E;  4DPX A;  2M4I A;  4QNJ A;  4NHR A;  5LMN I;  2V89 A;  4X62 I;  2EN1 A;  4R2C A;  4IFD B;  2JR1 A;  2LO3 A;  2EOE A;  1Z5C A;  2CG9 A;  3M85 G;  2ZM6 E;  2UXD E;  5AE1 A;  5CFF E;  4OZE A;  3BBG A;  4WUC A;  4FK5 C;  2DRP A;  2WBS A;  3WU6 A;  3C6M A;  3EQ1 A;  3OTO E;  1A1F A;  3K85 A;  4DR1 I;  4IFD C;  5BR8 E;  1BBG A;  1FI4 A;  2NA2 A;  2EOM A;  2LJP A;  2E72 A;  3T1Y E;  2F4V I;  5A6B D;  3VYX A;  3H4L A;  4LCF A;  4XTJ A;  2YTE A;  2EPZ A;  4DKK A;  1XNR E;  3ADJ A;  4IS1 C;  4JI5 I;  4R03 A;  2ELY A;  2MDG A;  2HKJ A;  2V34 A;  2YTP A;  4DV7 I;  2EJ4 A;  4OO1 D;  4P52 A;  1R6L A;  2HHH E;  1UDN A;  4WXD A;  4ZVI A;  4WSG A;  1T4L B;  1A1H A;  1JK1 A;  1N36 I;  1E3P A;  1YH8 A;  2LV2 A;  1UDO A;  4DV5 I;  3Q1Q A;  5AC4 A;  4BS9 A;  4DUZ E;  1RR9 A;  4IJD A;  2MC5 A;  2HJJ A;  1PJS A;  2FGG A;  2ODR D;  5A6B A;  1X48 A;  2EM3 A;  2DB2 A;  2YZT A;  4F6N A;  4IFD F;  4NZV A;  1HR0 I;  4WUB A;  3AV0 A;  1H72 C;  2K4V A;  2N3H A;  2NUE A;  4N3O A;  4OO1 A;  4LFC E;  1E3H A;  4JI0 I;  2YRM A;  1F2I G;  1DAR A;  2CSH A;  4MDT A;  1Z1B A;  2V85 A;  1A1L A;  2EPA A;  3LLH A;  1N0V C;  3F0N A;  3LTO A;  4DV3 I;  4DR6 I;  4KQV A;  2J65 A;  1KYQ A;  4JI1 E;  4GEQ B;  4KZS A;  5LMU I;  4NXM E;  1P47 A;  4LFB E;  4HTG A;  2DEI A;  4O5G A;  2JEB B;  1P42 A;  1Z0C A;  4WXC A;  2F1D A;  2H36 X;  4LF5 I;  4IFD E;  2L33 A;  1N32 E;  4MU0 A;  5AE3 A;  2PO2 B;  2UUB E;  2E5L E;  4TUG A;  3PYE A;  4MYT A;  2X36 A;  2EMK A;  4X64 I;  2HK3 A;  3PS3 A;  4JI6 I;  4JG4 A;  1KVK A;  1Z59 A;  4R2E A;  1MG7 A;  1MEY C;  2EOO A;  1IBK E;  2BA1 D;  2R3V A;  1I94 I;  4GKK E;  2J7K A;  2YSP A;  4RHB B;  4R2S A;  3PS2 A;  4LTY A;  1DI2 A;  3D4J A;  5JEA A;  2Z5B A;  2B3T B;  2RSI A;  4JI3 E;  2M9A A;  2UU9 E;  1VIS A;  4B3R I;  1N33 I;  2ENH A;  4ZYG A;  2LE2 A;  2GHF A;  2JXP A;  1DGC A;  2NN6 B;  2DSY A;  2YU5 A;  4DR7 E;  1YHC A;  2J7J A;  2PNL A;  3B82 A;  2Z5C A;  4BA2 B;  4JI8 E;  1OYS A;  3F6H A;  5A69 A;  2EP3 A;  1D6T A;  2KOU A;  1RHY A;  4OOG C;  3CDJ A;  2R76 A;  1NCS A;  5DRQ A;  1USV A;  1ZM4 A;  2NN6 C;  3HJC A;  4F2J C;  2E1M A;  4MQY A;  3EPL A;  3V2U C;  4B3M I;  4DV4 E;  5C0X D;  2V83 A;  4PU9 A;  4NXN I;  4DUY I;  3QT7 A;  2YTN A;  1YUJ A;  4IZJ D;  5IT9 C;  1YSA C;  2EOZ A;  2V8Q B;  1Y6Z A;  1YPN A;  2EN7 A;  3U1K A;  1FWK A;  2EZ6 A;  2O1T A;  2O1U A;  4X8W A;  4BHC A;  3VK6 A;  1TF6 A;  4DV1 E;  2VES A;  4AM3 A;  4LF6 E;  2C37 A;  4R2R A;  4HY1 A;  2EL5 A;  2O1W A;  4LF9 I;  2LTS A;  3CWV A;  4B3T E;  4FW4 A;  2UXD I;  2YPN A;  4I8O A;  4JI7 E;  4DR2 I;  5C0X A;  1MU5 A;  2RQL A;  1AH5 A;  3QT5 A;  3GLL A;  4FW7 A;  3OTO I;  4M30 A;  3JU0 A;  3T1H E;  4LF8 E;  1YUI A;  2K7I A;  4IZJ A;  2EMF A;  1XMQ E;  4I3H A;  2BA0 G;  2V8P A;  2EFG A;  3WU5 A;  1XNR I;  2PRT A;  2L92 A;  2CT1 A;  3UK3 C;  3C6K A;  4BBY A;  4BC7 A;  3CDI A;  3V5R A;  1G2D C;  2EN6 A;  4OO1 B;  3M99 B;  2EM4 A;  2LVH A;  5GMD A;  2EM9 A;  2NN6 E;  3IWC A;  1N34 E;  1STU A;  2VRD A;  3P76 A;  3KWR A;  4M9V C;  5FWK A;  2NUF A;  4K0K E;  4OO1 C;  1ZM9 A;  1XNQ E;  2LUQ A;  5K36 D;  3BF2 A;  4WFT A;  1YFH A;  1OYP A;  3HPZ A;  4MU1 A;  4JI4 I;  2A25 A;  4O4K A;  2VQE E;  2EQ3 A;  3PYD A;  3B78 A;  4FWG A;  3JAM Q;  1O0W A;  4YHH E;  4WSP A;  3KZZ A;  2FTX B;  4QNK A;  4FW3 A;  1Y60 A;  4IZK A;  2PNZ B;  4R2P A;  5DRR A;  4LF7 E;  2ODR C;  2GQ0 A;  2BR2 A;  2EOY A;  2M1S A;  4MU3 A;  1XMO I;  1NHJ A;  3ADL A;  3LNU A;  3M7N G;  2Z5B B;  2N8X A;  2JOX A;  2LBS B;  4WPY A;  2DMI A;  1S16 A;  3M6A A;  4NXM I;  4LFB I;  2CVE A;  2JYA A;  1Z0E A;  5A6J A;  2EPL X;  2EQ0 A;  2EPO A;  2EE8 A;  4JYA I;  5K36 A;  4HYM A;  3ZZ0 A;  2VQF E;  2Z5C B;  2CTD A;  3TQM A;  2KON A;  4LFA E;  2UUB I;  2YTJ A;  2JVA A;  2EPC A;  2YTD A;  1UN6 B;  2E5L I;  2F8B A;  1S4E A;  1WRJ A;  1BKN A;  4DR5 E;  1H74 A;  2EL6 A;  4ZYD A;  1XHK A;  1VI7 A;  3DJW A;  1J5E E;  4GKK I;  2WNR B;  2EPK X;  2R1F A;  1WHQ A;  4DU7 A;  3GME A;  2UU9 I;  2EMW A;  4AQY E;  1Z0G A;  3IWD A;  4FW9 A;  5DNX A;  1PJQ A;  4JI2 E;  3EPH A;  4X66 E;  4DV6 E;  1Y5Y A;  2IOQ A;  4FW6 A;  4HXZ A;  3ZM7 A;  2PO1 A;  3L7Z A;  3PS1 A;  1XXE A;  2LTR A;  2MC6 A;  1DQ3 A;  2UUA E;  1RMD A;  2MKD A;  2A2C A;  4OO1 E;  5JEA D;  4DPW A;  2GPI A;  3ECR A;  2PO0 A;  2IES A;  3J7Y p;  2IOP A;  2UXC E;  4OKG A;  4KHP E;  2HFS A;  2EPU A;  3C4T A;  4Z7C A;  4DR4 I;  4BC9 A;  1ZM2 A;  4YY3 I;  4OX9 E;  3KZY A;  3J81 C;  1X49 A;  4LU9 A;  4L8N A;  4DR3 E;  1RC7 A;  3ZKD A;  2EMB A;  2EMX A;  4X62 E;  4Z7Y A;  2VE7 C;  5C0X B;  4MU4 A;  3KRN A;  3P3E A;  4DV2 E;  2WBU A;  4M0V A;  1IBM E;  5FLX C;  1ZAA C;  4IZJ B;  2PNM A;  2CZ9 A;  1ZR9 A;  4MLV A;  1H73 A;  4FWH A;  3F6G A;  2YRH A;  2RPC A;  1X6F A;  3BGH A;  5C0X C;  1B69 A;  4DV1 I;  3BID A;  4DPT A;  2F4V E;  2A2D A;  2JEA A;  1YZ9 A;  2L6M A;  4B3T I;  4DXL A;  4LF4 I;  2B7V A;  3JAM C;  4JI5 E;  2V2Z A;  1EKZ A;  4O24 A;  3H1C A;  4IFD A;  4DV7 E;  5LL6 R;  2EM5 A;  1MX0 A;  2C38 A;  4WX9 A;  1AAY A;  2I13 A;  2I9I A;  1PVG A;  2ZBK B;  2YTO A;  2UXB E;  4R1F A;  2BA0 D;  2EMZ A;  3AUZ A;  1N36 E;  2O3Z A;  1XMQ I;  2EMH A;  2EMY A;  2EM2 A;  4DV5 E;  1A1J A;  4FW5 A;  5EL9 A;  4U3D A;  4R2A A;  2JE6 A;  5A2Q Q;  3THN A;  1HK7 A;  2HC5 A;  4LCH A;  2HGH A;  2IHR 1;  2BV3 A;  4R2D A;  2RTX A;  1N3G A;  2D9H A;  1T4O A;  1BBO A;  1FJG E;  2V2V A;  1NEI A;  1HNW E;  1ZBT A;  5IWA I;  4GZN C;  2BR2 B;  3FIG A;  1HNZ E;  4RPF A;  1IBL E;  1N34 I;  4JV5 I;  3L00 A;  3THO B;  3DD6 A;  2BB8 A;  3LPS A;  3M85 D;  4K0K I;  4DPY A;  4DMI A;  3DF6 A;  4F9C B;  4DV3 E;  2YSO A;  5KL5 A;  5LMU E;  4M2Z A;  4X9J A;  5K36 B;  1X5W A;  2V86 A;  2DGC A;  2ZM6 I;  1SR9 A;  2V87 A;  2BM1 A;  2VQE I;  1TF3 A;  1UHZ A;  2NN6 F;  2EM0 A;  2OI2 A;  4YHH I;  3MHS C;  1X6E A;  1A1K A;  2RSM A;  1GTK A;  4F6M A;  5BR8 I;  2EM8 A;  3GCM A;  4X64 E;  5C0X E;  1B62 A;  4WUD A;  4LF7 I;  3M7N D;  3T1Y I;  5K36 C;  4R8O A;  4JI6 E;  2C39 A;  2L3C A;  2LJH A;  2LUP B;  5DNY A;  2GO4 A;  2VF1 A;  5KL4 A;  4FWD A;  4GKJ E;  1NHI A;  4DV0 E;  4DU8 A;  2FV4 B;  2JOB A;  2DEJ A;  1GQE A;  2HHH I;  2EN4 A;  3PYF A;  2EPR A;  2DMY A;  1BB8 A;  2VQF I;  4LOM A;  3L7Z B;  4LFA I;  2EMC A;  2JEB A;  3PYG A;  1FWL A;  2Q2E B;  2EWL A;  2PO0 B;  4DR5 I;  3VYY A;  2R42 A;  2PO2 A;  4DUZ I;  4X65 E;  1J5E I;  2JP9 A;  2O1V A;  3WU3 A;  1A1G A;  3U1Y A;  3J80 Q;  4BCA A;  1OJ4 A;  2NAB A;  4U3B A;  2EPP A;  1IQO A;  3K6Q A;  1Y4S A;  5IV8 B;  1EI1 A;  5DNL A;  2ADR A;  4B3M E;  4JI2 I;  4X66 I;  5KL6 A;  2GO3 A;  2EL4 A;  2UUC E;  4B3S E;  4LFC I;  3HPS A;  1KIJ A;  1Z0T A;  4DUY E;  4URL A;  1RRE A;  2UUA I;  1HNX E;  4BMJ A;  2X7I A;  1SFE A;  4GQU A;  5JEA B;  4JI1 I;  4KHP I;  2UXC I;  1KJK A;  1T4N A;  2JEA B;  5A2Q C;  2HK2 A;  2EOJ A;  1T38 A;  4MYU A;  1UDS A;  4DR3 I;  4OX9 I;  1PDA A;  5ELW A;  3GON A;  4UT4 A;  2RS6 A;  4LF9 E;  4ED4 A;  1N32 I;  2C38 B;  2EMA A;  4P78 A;  5JEA C;  4OO1 F;  2YTQ A;  3NZK A;  2EOI A;  2EOH A;  4BA1 A;  4DV2 I;  2EPX A;  3WU4 A;  1IBM I;  2LMZ A;  5K36 E;  4DR2 E;  2MKN A;  2RS7 A;  2YRK A;  2CGE A;  3ZKB A;  1IBK I;  3HQ1 A;  2EN2 A;  2JE6 B;  2YU8 A;  4F54 A;  4JI3 I;  1UBD C;  1EH8 A;  2JPA A;  1FNM A;  4NBQ A;  2EMI A;  2EPM X;  2L3J A;  1J26 A;  3P3C A;  1L4S A;  2WP8 A;  3EPK A;  4DR7 I;  3ZOQ B;  1QNT A;  5ADZ A;  2LRS A;  4HAC A;  4JI8 I;  2M7Q A;  1Z5A A;  2WZO A;  1USU A;  4ISA A;  2UXB I;  3QT6 A;  1KKH A;  1G2F C;  4RH8 A;  2DLQ A;  1WXR A;  1YYW A;  5DRO A;  4M1K A;  2C37 B;  4DPU A;  5JEA F;  1YYK A;  5IT9 Q;  1EA6 A;  1Z0V A;  1ZXM A;  4IFD D;  3J7A G;  5LMN E;  2WW4 A;  2B7T A;  2ZIT A;  4DV4 I;  2EN8 A;  3QG5 C;  4N4R B;  1Z5B A;  1FKA E;  4PRX A;  5DRP A;  4IS9 A;  4JI4 E;  5L3J A;  1FJG I;  4O43 A;  1HNW I;  1K47 A;  1NZ0 A;  1RQ0 A;  3Q6N A;  1WHN A;  3MSW A;  1HNZ I;  4DR1 E;  2C39 B;  1ZM3 A;  3P06 A;  2LJU A;  2EM6 A;  1IBL I;  2EOR A;  3K1J A;  3MHH C;  1X3C A;  3EPJ A;  2N3G A;  3J80 C;  5IXM B;  4LF6 I;  5A6K A;  2ELZ A;  2NUG A;  1XMO E;  2BM0 A;  2GS8 A;  2EN3 A;  5JEA E;  2WBT A;  3HKM A;  5KL7 A;  3OML A;  1EH6 A;  3P1X A;  5T6J A;  4JI7 I;  1WJP A;  2L2M A;  3IWB A;  1U2R A;  4JYA E;  1R6M A;  1JK2 A;  3T1H I;  1ZBQ A;  2YTF A;  1N0U A;  4LF8 I;  1UDQ A;  2Q8U A;  3JTZ A;  3LML A;  2L2N A;  4EMD A;  4BHB A;  5AAS A;  2EOQ A;  4ZYH A;  3VHT B;  4Q35 B;  2WCC 3;  2L8T A;  5AE2 A;  2PNZ A;  4F9A B;  4FN5 A;  4DV0 I;  2V88 A;  1H7U A;  4GKJ I;  2KHX A;  2LT7 A;  3ZZT A;  2DIX A;  3HUL A;  2EOX A;  3HXL A;  1GZ6 A;  2YTI A;  2EOS A;  1EH7 A;  4R2Q A;  1HR0 E;  5C0X F;  4IZK B;  4P7A A;  2CPN A;  2EOF A;  1B63 A;  1Z0W A;  2ENA A;  4F9B B;  3B4T A;  2JWO A;  2ENC A;  4JI0 E;  5LLQ A;  1ELO A;  3ADI A;  2AJ4 A;  2JY9 A;  4X65 I;  4KWY A; 
#chains in the Genus database with same CATH homology
 5GME A;  4DR6 E;  3RMP A;  4P7D A;  1XNQ I;  2HFU A;  1NHH A;  4USM A;  4DR4 E;  3C4B A;  2XEX A;  2Z5E A;  3J7A M;  4YY3 E;  1UEK A;  3K17 A;  1UIL A;  2MDR A;  4PRV A;  3ZZU A;  2UUC I;  4B3S I;  4LF5 E;  4L5N C;  3QT8 A;  1PIE A;  1YYO A;  4TUI A;  1HNX I;  1Y4U A;  3Q6M A;  1I94 E;  2YT4 A;  1N33 E;  1ZXN A;  4B3R E;  3B8H A;  2B9D A;  2G7H A;  4HAC B;  4LF4 E;  2VF3 A;  2HKE A;  2L2K B;  1QZR A;  4J8Z A;  3HTX A;  3H09 A;  1H7S A;  1WUU A;  4WYQ B;  1A6F A;  3PRY A;  4UTG A;  1KTV A;  4AQY I;  1X47 A;  4USK A;  3ADG A;  2V2Q A;  2E1R A;  4DV6 I;  3J81 Q;  1Z0B A;  2NPF A;  4NXN E;  1PKP A;  1QU6 A;  4Q28 A;  5F3W A;  5IWA E;  5FLX Q;  4JV5 E;  4DPX A;  2M4I A;  5LMN I;  2V89 A;  4X62 I;  2JR1 A;  1Z5C A;  2CG9 A;  2ZM6 E;  2UXD E;  5AE1 A;  5CFF E;  4WUC A;  3WU6 A;  3OTO E;  3K85 A;  4DR1 I;  5BR8 E;  1FI4 A;  2NA2 A;  2LJP A;  3T1Y E;  2F4V I;  3VYX A;  3H4L A;  4XTJ A;  4DKK A;  1XNR E;  3ADJ A;  4JI5 I;  4R03 A;  2HKJ A;  4DV7 I;  2V34 A;  4P52 A;  2HHH E;  4ZVI A;  1T4L B;  1N36 I;  4DV5 I;  3Q1Q A;  4BS9 A;  4DUZ E;  1RR9 A;  2MC5 A;  2FGG A;  2ODR D;  1X48 A;  2DB2 A;  2YZT A;  1HR0 I;  4WUB A;  3AV0 A;  1H72 C;  2K4V A;  2N3H A;  2NUE A;  4N3O A;  4LFC E;  4JI0 I;  1DAR A;  4DV3 I;  2V85 A;  1N0V C;  3LLH A;  3F0N A;  3LTO A;  4DR6 I;  4KQV A;  5LMU I;  4JI1 E;  4GEQ B;  4KZS A;  4NXM E;  4LFB E;  2DEI A;  1Z0C A;  2H36 X;  4LF5 I;  2L33 A;  1N32 E;  5AE3 A;  4X64 I;  2UUB E;  2E5L E;  4TUG A;  3PYE A;  4MYT A;  2X36 A;  2HK3 A;  4JI6 I;  4JG4 A;  1KVK A;  1Z59 A;  1MG7 A;  1IBK E;  2R3V A;  1I94 I;  4GKK E;  2J7K A;  4LTY A;  1DI2 A;  3D4J A;  2Z5B A;  2B3T B;  4JI3 E;  1VIS A;  4B3R I;  2UU9 E;  1N33 I;  2LE2 A;  2DSY A;  4DR7 E;  3B82 A;  2PNL A;  2Z5C A;  4JI8 E;  3F6H A;  1D6T A;  2KOU A;  4OOG C;  1USV A;  1ZM4 A;  3HJC A;  2E1M A;  3V2U C;  4B3M I;  4DV4 E;  2V83 A;  4PU9 A;  4NXN I;  4DUY I;  3QT7 A;  4IZJ D;  5IT9 C;  2V8Q B;  1Y6Z A;  1FWK A;  2EZ6 A;  2O1T A;  2O1U A;  4X8W A;  3VK6 A;  4DV1 E;  4LF6 E;  4HY1 A;  2O1W A;  4LF9 I;  2LTS A;  3CWV A;  4B3T E;  2UXD I;  4I8O A;  4JI7 E;  4DR2 I;  1MU5 A;  3QT5 A;  3OTO I;  4M30 A;  3JU0 A;  3T1H E;  4LF8 E;  4IZJ A;  1XMQ E;  4I3H A;  2V8P A;  2EFG A;  3WU5 A;  1XNR I;  2L92 A;  4BBY A;  4BC7 A;  3V5R A;  5GMD A;  3IWC A;  1N34 E;  1STU A;  3KWR A;  5FWK A;  2NUF A;  4K0K E;  1ZM9 A;  1XNQ E;  2LUQ A;  4WFT A;  4JI4 I;  3HPZ A;  2VQE E;  3PYD A;  3JAM Q;  3B78 A;  4FWG A;  1O0W A;  4YHH E;  4WSP A;  2FTX B;  4IZK A;  4LF7 E;  2ODR C;  2GQ0 A;  2M1S A;  1XMO I;  1NHJ A;  3ADL A;  3LNU A;  2Z5B B;  2JOX A;  2LBS B;  4WPY A;  1S16 A;  3M6A A;  4NXM I;  4LFB I;  1Z0E A;  4JYA I;  4HYM A;  3ZZ0 A;  2VQF E;  2Z5C B;  2KON A;  4LFA E;  2UUB I;  2E5L I;  2JVA A;  2F8B A;  1S4E A;  1BKN A;  4DR5 E;  1H74 A;  1XHK A;  3DJW A;  1J5E E;  4GKK I;  1WHQ A;  4DU7 A;  2UU9 I;  1Z0G A;  4AQY E;  3IWD A;  4FW9 A;  2IOQ A;  4JI2 E;  4X66 E;  4DV6 E;  4HXZ A;  3ZM7 A;  2LTR A;  2MC6 A;  1DQ3 A;  2UUA E;  2A2C A;  4DPW A;  3J7Y p;  2IOP A;  2UXC E;  4KHP E;  2HFS A;  4Z7C A;  3C4T A;  4DR4 I;  4BC9 A;  1ZM2 A;  4YY3 I;  4OX9 E;  3J81 C;  4DR3 E;  1X49 A;  4LU9 A;  4L8N A;  1RC7 A;  3ZKD A;  4X62 E;  4Z7Y A;  2VE7 C;  4DV2 E;  4M0V A;  1IBM E;  5FLX C;  4IZJ B;  2PNM A;  2CZ9 A;  1H73 A;  4FWH A;  3F6G A;  4DV1 I;  4DPT A;  2F4V E;  2A2D A;  1YZ9 A;  2L6M A;  4B3T I;  4DXL A;  4LF4 I;  2B7V A;  3JAM C;  4JI5 E;  2V2Z A;  1EKZ A;  4DV7 E;  5LL6 R;  1MX0 A;  1PVG A;  2ZBK B;  2UXB E;  4R1F A;  3AUZ A;  1N36 E;  1XMQ I;  4DV5 E;  5A2Q Q;  1HK7 A;  2IHR 1;  2BV3 A;  2RTX A;  1T4O A;  1FJG E;  2V2V A;  1HNW E;  1ZBT A;  5IWA I;  3FIG A;  1HNZ E;  4RPF A;  1IBL E;  1N34 I;  4JV5 I;  3LPS A;  4K0K I;  4DPY A;  4DMI A;  3DF6 A;  4F9C B;  4DV3 E;  5LMU E;  4M2Z A;  2V86 A;  2ZM6 I;  1SR9 A;  2V87 A;  2BM1 A;  2VQE I;  1UHZ A;  2OI2 A;  4YHH I;  2RSM A;  5BR8 I;  4X64 E;  4LF7 I;  1B62 A;  4WUD A;  3T1Y I;  4R8O A;  4JI6 E;  2L3C A;  2LJH A;  2LUP B;  5DNY A;  2VF1 A;  4FWD A;  4GKJ E;  1NHI A;  4DV0 E;  4DU8 A;  2FV4 B;  2JOB A;  2DEJ A;  1GQE A;  2HHH I;  3PYF A;  2DMY A;  2VQF I;  4LFA I;  3PYG A;  1FWL A;  2Q2E B;  2EWL A;  4DR5 I;  3VYY A;  2R42 A;  4DUZ I;  4X65 E;  1J5E I;  2O1V A;  3WU3 A;  3J80 Q;  4BCA A;  1OJ4 A;  1Y4S A;  3K6Q A;  1EI1 A;  4B3M E;  4JI2 I;  4X66 I;  2UUC E;  4B3S E;  4LFC I;  3HPS A;  1KIJ A;  1Z0T A;  4DUY E;  4URL A;  1RRE A;  2UUA I;  1HNX E;  4BMJ A;  2X7I A;  2UXC I;  4JI1 I;  4KHP I;  1T4N A;  5A2Q C;  2HK2 A;  4MYU A;  4OX9 I;  4DR3 I;  4UT4 A;  3GON A;  2RS6 A;  4LF9 E;  4ED4 A;  1N32 I;  4P78 A;  4DV2 I;  1IBM I;  3WU4 A;  2LMZ A;  4DR2 E;  2RS7 A;  2CGE A;  3ZKB A;  1IBK I;  3HQ1 A;  4F54 A;  4JI3 I;  1FNM A;  2L3J A;  1J26 A;  4DR7 I;  3ZOQ B;  5ADZ A;  2LRS A;  4HAC A;  4JI8 I;  2M7Q A;  1Z5A A;  2WZO A;  1USU A;  2UXB I;  3QT6 A;  1KKH A;  4DPU A;  1WXR A;  1YYW A;  5IT9 Q;  4M1K A;  1YYK A;  1EA6 A;  1Z0V A;  1ZXM A;  3J7A G;  5LMN E;  2WW4 A;  2B7T A;  2ZIT A;  4DV4 I;  1Z5B A;  1FKA E;  4PRX A;  4JI4 E;  5L3J A;  1FJG I;  1HNW I;  1K47 A;  1NZ0 A;  1RQ0 A;  3Q6N A;  1WHN A;  3MSW A;  1HNZ I;  4DR1 E;  1IBL I;  1ZM3 A;  3P06 A;  3K1J A;  2N3G A;  3J80 C;  4LF6 I;  2NUG A;  1XMO E;  2BM0 A;  2GS8 A;  3OML A;  5T6J A;  3P1X A;  4JI7 I;  2L2M A;  3IWB A;  1U2R A;  4JYA E;  3T1H I;  1ZBQ A;  1N0U A;  4LF8 I;  3JTZ A;  3LML A;  2L2N A;  4EMD A;  5AAS A;  2L8T A;  5AE2 A;  4FN5 A;  4F9A B;  4GKJ I;  4DV0 I;  2V88 A;  1H7U A;  2KHX A;  3ZZT A;  2DIX A;  3HUL A;  3HXL A;  1GZ6 A;  1HR0 E;  4IZK B;  4P7A A;  2CPN A;  1B63 A;  1Z0W A;  4F9B B;  2JWO A;  4JI0 E;  1ELO A;  3ADI A;  2AJ4 A;  2JY9 A;  4X65 I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...