3OTOE

Crystal structure of the 30s ribosomal subunit from a ksga mutant of thermus thermophilus (hb8)
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
150
structure length
150
Chain Sequence
DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Modification of 16S ribosomal RNA by the KsgA methyltransferase restructures the 30S subunit to optimize ribosome function.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S rRNA
total genus 36
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2010-09-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 3otoE01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 3otoE02
3M6AA 2IHR1 2UUBI 1ZM9A 3PYFA 2E1RA 1YYWA 2LBSB 5LMUI 1T4NA 3C4TA 4AQYI 4LFBI 1RREA 1WUUA 4MYTA 3J7AM 2XEXA 4DU8A 3JAMC 2V34A 4NXMI 1N36I 3QT6A 2EZ6A 2RTXA 1XNQE 1ZM4A 4HY1A 4DV1I 3V2UC 4JI6E 4DV4I 4DUZE 2HKEA 3V5RA 3VYYA 4M1KA 1B62A 4LF5E 3P1XA 4FWGA 5IT9C 4LF7I 3QT8A 4YHHI 2UXCI 4USKA 3GONA 1YYOA 1KKHA 2N3GA 4DV2E 4JI3E 4JI5E 3J81Q 4X64I 4JI4I 1FNMA 3VYXA 2LJPA 2E5LE 4HACB 4X65I 4FWHA 1HR0E 2ZBKB 2UUAE 5FLXC 2EFGA 4HYMA 1UHZA 2N3HA 2HKJA 2DEJA 1PVGA 4B3SI 2BM0A 5IWAE 3ZM7A 2JY9A 4X62E 2X7IA 4MYUA 2E5LI 1FKAE 1ZXNA 3J7Yp 2NUGA 3ZZUA 4JI7E 3J80C 3PYGA 1UILA 1YZ9A 2UXBI 2L2MA 4R1FA 1T4OA 4KHPI 1J5EI 4ED4A 2LUQA 4WYQB 2AJ4A 5LMNI 4JI0E 2UUCE 4FN5A 1HNWE 2LUPB 5GMEA 4DV1E 1HNXE 4DR7I 4LF8E 5GMDA 4P52A 2UXBE 1EI1A 4USMA 4OX9E 1VISA 4B3MI 2Q2EB 3ADIA 2A2DA 3CWVA 4DR1I 1XMOE 1H7SA 4GKKI 1XNQI 5BR8I 4Z7CA 1RC7A 1Z5BA 1EA6A 4FWDA 3ZZ0A 2F4VE 1N34I 1XMQI 4LF4E 1DARA 3PYEA 1HNZE 4JI3I 4X66I 4JV5I 1QU6A 4FW9A 4B3ME 2ZM6I 4OX9I 1N33I 2R42A 4P7AA 4DPUA 2DB2A 2L3JA 4GKKE 1RQ0A 2NA2A 2HHHE 4HACA 2L33A 4JI2E 3QT5A 1OJ4A 4JI8I 2VQEI 1ELOA 1N34E 2F4VI 1I94I 5A2QQ 2VQFE 4M2ZA 4WFTA 1H7UA 4B3SE 1IBKE 1N33E 4HXZA 1IBLE 2B7VA 3JAMQ 4DV3E 3ZKDA 2L2KB 2OI2A 4DV7I 1IBMI 5LMUE 5IWAI 4X62I 2DEIA 3ZZTA 2CPNA 3J7AG 4NXNI 1QZRA 4DV0E 2V2QA 4NXME 4YY3E 2ZITA 4X65E 1D6TA 4LF9I 2RSMA 2UUCI 4LF6I 1NHHA 4DV7E 4JI6I 4WUDA 2R3VA 1NHIA 4DPTA 2UUBE 1S16A 4B3RI 3J80Q 4DV2I 1ZM3A 2DMYA 4X64E 4DXLA 1N0UA 4DPXA 1Z0VA 5A2QC 1H72C 3Q1QA 4DV5E 3ADLA 1MG7A 1N32E 4M30A 2YT4A 2UUAI 4URLA 1B63A 4JI4E 4DR6E 4GKJE 3T1YI 4DV6E 4JI1I 4B3RE 2NPFA 1J5EE 4AQYE 3WU3A 4WUCA 1N36E 3ZKBA 4LFCI 1N32I 4DU7A 3HTXA 1K47A 1HNZI 2NUFA 1Z0CA 1UEKA 2CZ9A 4LF7E 5FLXQ 1FWLA 2A2CA 1PIEA 4B3TE 2KHXA 1X48A 4KQVA 2LRSA 1ZXMA 1KTVA 4JYAE 1YYKA 1T4LB 4DR5I 4DR3I 4WUBA 1NZ0A 2HK2A 4LF8I 4XTJA 4JI5I 4LFBE 3D4JA 5LMNE 4YHHE 2UXCE 2V8PA 3OTOI 2V2ZA 1MU5A 2LTRA 1XMOI 3H4LA 2HFUA 4DR2I 5L3JA 3LLHA 2B3TB 4UTGA 4DPYA 4NXNE 3B82A 1FWKA 4DV0I 3WU4A 1Z59A 5LL6R 4UT4A 4LF5I 2RS6A 4DUYE 2UU9E 4RPFA 1DI2A 4Z7YA 4OOGC 1Z5AA 3LPSA 1H74A 4DKKA 2HHHI 4DR2E 3F0NA 1IBME 2L2NA 3PYDA 2B7TA 4X66E 4JV5E 2LTSA 3T1YE 4DR6I 1BKNA 3K17A 2VQFI 4DPWA 1XNRE 4JI0I 4K0KE 4DR4E 3LNUA 2BV3A 1WHNA 4GKJI 2UXDE 2LJHA 1Z0GA 3ADGA 1Z5CA 1U2RA 2NUEA 1S4EA 1FJGE 2L3CA 1EKZA 4PU9A 1HNWI 1MX0A 3B78A 5BR8E 2WW4A 4JI8E 2VQEE 1KIJA 2BM1A 4PRXA 1XMQE 1NHJA 4LFAE 2MDRA 4DV4E 1FI4A 4PRVA 2RS7A 1FJGI 1IBLI 2VF3A 1WHQA 1X47A 2HK3A 4DUZI 4JI2I 1STUA 3J81C 4EMDA 4X8WA 1IBKI 4DR7E 1I94E 2X36A 2V2VA 4JI1E 4LFAI 1J26A 3OTOE 4I3HA 3T1HE 3B8HA 4DV5I 4DV3I 2J7KA 1X49A 1A6FA 1Z0TA 4JYAI 4JG4A 1H73A 3K1JA 3LTOA 4LF6E 1Z0EA 3HULA 3QT7A 4ZVIA 3WU6A 3C4BA 1ZM2A 4KHPE 1O0WA 4DUYI 2UU9I 1XNRI 3T1HI 1XHKA 4LF9E 2ZM6E 1GQEA 2GS8A 1HR0I 5CFFE 1ZBTA 1PKPA 2JVAA 1Z0WA 4LF4I 1Z0BA 3WU5A 1HNXI 5IT9Q 1RR9A 2DIXA 2HFSA 1KVKA 4DV6I 4B3TI 3ADJA 4K0KI 4DR4I 4DR1E 4YY3I 2UXDI 1N0VC 4DR5E 4LFCE 4JI7I 4DR3E
chains in the Genus database with same CATH superfamily
2YU8A 5A6AA 3M6AA 2IHR1 3PS2A 2UUBI 1ZM9A 3PYFA 4L5NC 2EPUA 1ZBQA 1YYWA 2E1RA 2MC6A 2LBSB 2EMLA 2ENAA 1T4NA 2NN6C 2YRKA 3C4TA 5LMUI 4AQYI 3MHHC 4LFBI 1RREA 5A6JA 2EN6A 2EMXA 2EMHA 1WUUA 2EM7A 4MYTA 4IZKA 3J7AM 4MQYA 3AUZA 1Y6ZA 2XEXA 2ELYA 3JAMC 1TN9A 4DU8A 2V34A 4NXMI 2YTGA 1N36I 3QT6A 2EZ6A 2RTXA 1XNQE 1X6HA 1ZM4A 2O1WA 4HY1A 2WZOA 4O24A 5JEAC 4MU0A 5AE2A 1Z1BA 3V2UC 4DV1I 4IZJD 2JEAA 1RMDA 3NZKA 5DRQA 5K36E 5AC4A 4JI6E 4N4RB 2JEBA 4DUZE 2HKEA 4DV4I 5DNXA 3V5RA 3VYYA 2M1SA 4M1KA 1B62A 2HJJA 1UBDC 4LF5E 3P1XA 3KRNA 5IT9C 4FWGA 2JPAA 4JYAI 4R2QA 2R1FA 2EORA 4LF7I 3QT8A 2IOQA 4YHHI 2UXCI 1A1GA 2DRPA 2D9HA 4USKA 3AV0A 3GONA 2PO2B 5DROA 2EMFA 3EPHA 1BB8A 3F6GA 2L6MA 2EOJA 1YYOA 2DMIA 2N3GA 1KKHA 2V8QB 4DV2E 3VK6A 4JI3E 4JI5E 2JEBB 3J81Q 4X64I 4JI4I 2JR1A 1FNMA 2EJ4A 5C0XD 1YH8A 2ENHA 4MLQA 3VYXA 4NBQA 2V89A 2Z5BB 4KZSA 2HGHA 2LJPA 3P76A 2E5LE 4HACB 1PJQA 1HK7A 4X65I 2PRTA 3GLLA 2Z5EA 4FWHA 1HR0E 4BA1B 1A1KA 2ZBKB 2UUAE 4MU4A 4JG4A 2BA1G 5FLXC 5KL4A 4LCGA 2EFGA 2Z5CA 4HYMA 2LCEA 1UHZA 3M7NG 2N3HA 4F9BB 4HTGA 2HKJA 2E1MA 4Q28A 2DEJA 1PVGA 2GPIA 4B3SI 4M0VA 2JOXA 2BM0A 3M85G 5IWAE 3ZM7A 2JY9A 4X62E 3GCMA 2X7IA 4MYUA 1PDAA 2PO1B 1X6FA 3IWCA 2E5LI 4IFDA 2YSPA 1FKAE 2A25A 4Q35B 2NN6A 2EN8A 2EPRA 3M99B 1ZXNA 5TSEA 2MC5A 2K7IA 3J7Yp 2EN7A 2NUGA 1OYSA 2IESA 3DJWA 4OO1C 2I13A 3ZZUA 4JI7E 4DMIA 4IFDF 2FV4B 4LCHA 4OO1F 2ENCA 3J80C 1RHYA 4FW7A 3PYGA 1UILA 1YZ9A 5KL7A 2PNZA 2L2MA 2RSIA 1E3PA 4R1FA 2UXBI 2JT2A 1T4OA 3H09A 4KHPI 1YHCA 5AC5A 1J5EI 5K36F 2HC5A 1BBOA 1T38A 4ED4A 2LUQA 4WYQB 2AJ4A 5LMNI 3C6MA 4JI0E 2YPNA 1ZR9A 2UUCE 3DF6A 4FN5A 2CT1A 2EQ1A 1HNWE 3PS1A 2LUPB 4FW4A 5GMEA 4DV1E 1HNXE 4DR7I 2EPCA 2E72A 4LF8E 4IS1C 5GMDA 4P52A 2UXBE 1EI1A 2EPOA 2PO0A 5KL2A 4USMA 4OX9E 1VISA 4B3MI 2Q2EB 3ADIA 2EOXA 3OMLA 2A2DA 3CWVA 4DR1I 2KONA 3CDIA 2ADRA 2BA0G 1XMOE 4BS9A 1H7SA 5FWKA 1XNQI 4GKKI 5BR8I 3HPZA 4Z7CA 4F54A 1RC7A 2LO3A 1Z5BA 2Z5BA 1EA6A 5DNYA 1R6MA 2C37A 4X9JA 4FWDA 3ZZ0A 2F4VE 1N34I 2EPLX 1IQSA 1XMQI 3UK3C 4LF4E 2C38A 4M9VC 2YRMA 5A6BD 1DARA 3PYEA 1HNZE 4JI3I 4OO1B 4X66I 4JV5I 1QU6A 4AIMA 3M85D 4FW9A 4B3ME 2ZM6I 4OX9I 1N33I 2WCC3 2R42A 4IZJA 4P7AA 4DPUA 1MEYC 2DB2A 2EL6A 2EM9A 2L3JA 4GKKE 3THNA 1RQ0A 2NA2A 2HHHE 4HACA 5JEAA 2L33A 4JI2E 3QT5A 4WXDA 1OJ4A 2EPZA 2PO1A 4JI8I 2VQEI 1ELOA 1N34E 5DRRA 2F4VI 1I94I 1PJTA 2PNZB 5A2QQ 2LE2A 2VQFE 4M2ZA 4WFTA 1H7UA 5C0XE 4B3SE 3H1CA 2VF1A 2YTQA 1IBKE 1N33E 1DGCA 1OYRA 4HXZA 1IMUA 1IBLE 2B7VA 3JAMQ 4DV3E 4IFDC 1Y4SA 5C0XC 2N8XA 2O1TA 4L8NA 1P47A 3RMPA 2YSOA 3ECRA 3ZKDA 5JEAB 2L2KB 2H36X 1EH7A 2L8TA 2OI2A 4DV7I 2WP8A 4F9AB 1IBMI 5LMUE 5IWAI 5K36B 1YUJA 3UHMA 4AIDA 4X62I 2YWQA 1NEIA 4TUGA 2DEIA 2NN6D 2CPNA 3ZZTA 2PO2A 2BA0D 1AAYA 3HPSA 4WSPA 2EN2A 2G7HA 2EPKX 3J7AG 1OYPA 2L92A 4O43A 4NXNI 1QZRA 4LCFA 2YTDA 4GEQB 4DV0E 2V2QA 3B4TA 4NXME 4LTYA 4YY3E 2PO0B 2ZITA 5K36C 2R76A 4I8OA 4X65E 1D6TA 4F9CB 4LF9I 2RSMA 2EM2A 3L7ZA 2EPAA 3P06A 1WJPA 2UUCI 2EPPA 4LF6I 1NHHA 2EM0A 4DV7E 4JI6I 3EPLA 5C0XF 4R03A 4WUDA 1DQ3A 2R3VA 1NHIA 5K36D 2EMIA 4DPTA 3KWRA 2DGCA 2UUBE 1S16A 2O1VA 4B3RI 3MHSC 2CGEA 4WX9A 3J80Q 4DV2I 4O5GA 2RQLA 4R2PA 2DMYA 4X64E 1ZM3A 4DXLA 2EOFA 1N0UA 4IZKB 4DPXA 1Z0VA 5A2QC 1R6LA 2EWLA 1H72C 2NABA 4O4KA 3K85A 3Q1QA 4P7DA 2BA1D 4DV5E 2B9DA 2VESA 2RPCA 3M7ND 3ADLA 1MG7A 2EQ0A 1A1LA 1N32E 2GHFA 2YT4A 4M30A 2O1UA 4OO1A 2BB8A 2UUAI 4BA2A 4URLA 2EMBA 1B63A 4JI4E 4DR6E 4GKJE 3T1YI 1N3GA 4DV6E 1X3CA 4JI1I 5C0XB 4B3RE 2NPFA 2LJUA 3LMLA 5JEAE 2EOQA 1G2DC 1J5EE 2ODRC 4AQYE 2BR2B 3WU3A 1KYQA 2M7QA 3Q6MA 3U1YA 4WUCA 1N36E 2J7JA 2MDGA 4RH8A 2MKNA 4OZEA 3ZKBA 1LLMC 2EMKA 4ZYHA 2EOIA 4LFCI 2J65A 1TF6A 1N32I 5AASA 4DU7A 4LU9A 4WPYA 4BMJA 3HTXA 4P78A 1K47A 1HNZI 2NUFA 2BBGA 1Z0CA 2LV2A 3JU0A 4FW5A 2JOBA 2EM4A 3F6HA 2JE6B 4BHBA 1UEKA 4BC7A 2WNRB 2YTNA 2EL4A 5EL9A 2CZ9A 4F2JC 2EMWA 2YTIA 4LF7E 1FWLA 2A2CA 1PIEA 4B3TE 2KHXA 5FLXQ 2DLQA 1X48A 5K36A 4KQVA 1X5WA 2LRSA 2C39A 2EMAA 2YU5A 1P42A 2EP3A 2VE7C 1ZXMA 1KTVA 4JYAE 2C37B 2EMZA 2LT7A 1YYKA 2Z5CB 1T4LB 4DR5I 4BHCA 4R2RA 5JEAF 4DR3I 4WUBA 1GTKA 2EOSA 1NZ0A 2WBSA 2HK2A 1SFEA 3IWDA 4IZJB 4BBYA 5JEAD 5IV8B 4LF8I 5KL6A 4XTJA 4JI5I 4LFBE 3D4JA 2EOHA 5LMNE 4OO1D 2KOUA 2WBTA 1X6EA 4YHHE 2UXCE 2V8PA 3OTOI 2EOEA 2V2ZA 1MU5A 4J3DA 2EM6A 2LTRA 1Y5YA 2EMGA 2AE8A 1XMOI 3H4LA 2HFUA 3U1KA 4DR2I 4MU1A 3L7ZB 1NCSA 3HKMA 5L3JA 4QNKA 3JTZA 2M9AA 3LLHA 4QNJA 2B3TB 4UTGA 4IFDD 3DD6A 2CVEA 4NXNE 4DPYA 2MKDA 2WBUA 2EMYA 2DLKA 3HXLA 1FWKA 1GZ6A 3B82A 3WU4A 4DV0I 4BA2B 2NN6E 2JXPA 2EN4A 3TQMA 5A69A 1T39A 1EH6A 5LL6R 1Z59A 4UT4A 5A6BA 4LF5I 2RS6A 3KZYA 1AH5A 4DUYE 4F6NA 2UU9E 4RPFA 1DI2A 4U3BA 4Z7YA 5IXMB 4OOGC 1Z5AA 2LMZA 4RHBB 3LPSA 1H74A 4DKKA 1A1IA 1ZU1A 2DSYA 2EN1A 4DR2E 4GQUA 2HHHI 3F0NA 2PNMA 1IBME 1TF3A 4LOMA 2L2NA 2ODRD 3CDJA 1EH8A 3PYDA 4AM3A 2B7TA 4X66E 3L00A 2LTSA 3T1YE 4JV5E 4DR6I 1BKNA 2CG9A 4WSGA 3K17A 4DPWA 2VQFI 1XNRE 3P3EA 2YZTA 2F1DA 1A1FA 4JI0I 1Y60A 2EPNA 2JE6A 2I9IA 4K0KE 1A1HA 3BIDA 1YSAC 4TUIA 4DR4E 3LNUA 2EE8A 2YTFA 2BV3A 4IFDB 2JWOA 4GZNC 1WHNA 1UDQA 2CTDA 2ELZA 5A6KA 4GKJI 2LJHA 2UXDE 1Z0GA 2GO4A 3ADGA 2FGGA 2EM8A 5T6JA 1B69A 1Z5CA 1U2RA 2F8BA 4FW3A 2NUEA 5KL3A 4JI7I 1E3HA 1YPNA 4NZVA 3Q6NA 2EQ3A 3ZOQB 1S4EA 5AE1A 2YTJA 1FJGE 4BC9A 2V86A 3EPKA 2L3CA 1EKZA 4PU9A 5DNLA 1A1JA 2YTPA 2EMCA 2EOOA 1HNWI 1MX0A 3B78A 5AE3A 5BR8E 2WW4A 5C0XA 4ISAA 4JI8E 2VQEE 1KIJA 4BA1A 3BBGA 2IOPA 2BM1A 4PRXA 2EPXA 1XMQE 1NHJA 4LFAE 3BGHA 2MDRA 4DV4E 1QNTA 1FI4A 1UDOA 4PRVA 3HJCA 2RS7A 4ZYDA 1FJGI 2EOYA 3HQ1A 4NHRA 2NN6F 2YRHA 1ZAAC 3QG5C 1IBLI 2VF3A 3GMEA 1WHQA 4IS9A 1MGTA 3VHTB 4U3DA 2EN3A 3MSWA 2O3ZA 5LLQA 2WP8B 4MDTA 5ADZA 1X47A 2HK3A 2IERA 4DUZI 1STUA 4JI2I 2V83A 2BR2A 3J81C 4EMDA 4X8WA 2C38B 1YFHA 2Q8UA 1IBKI 2VRDA 4DR7E 1I94E 2X36A 1UN6B 4HEIA 2PNLA 2YTOA 4JI1E 2V2VA 4LFAI 1J26A 1KJKA 3FIGA 3OTOE 4N3OA 4I3HA 3T1HE 1JK2A 3B8HA 4DV5I 2JEAB 4DV3I 3BF2A 2EOZA 2J7KA 5ELWA 1X49A 4ZYEA 2WNRA 4FW6A 4LFCE 4F6MA 5EKWA 1A6FA 3EPJA 4FK5C 4WXCA 4KWYA 1H73A 1Z0TA 2GO3A 1JK1A 2K4VA 1IQOA 1UDSA 3K1JA 3LTOA 4LF6E 1Z0EA 2EL5A 5F3WA 3HULA 2LVHA 3QT7A 4ZVIA 2EOMA 2EPMX 4R2AA 2EM5A 3WU6A 2C39B 3C4BA 2M4IA 4IFDE 2GLIA 1ZM2A 2GQ0A 4KHPE 1O0WA 4OO1E 4DUYI 4OKGA 4LPFA 2UU9I 1XXEA 1XNRI 3T1HI 1XHKA 1G2FC 1BBGA 4LF9E 2ZM6E 1GQEA 4R2EA 2GS8A 1UDNA 1HR0I 5CFFE 2V88A 1ZBTA 2JP9A 2FTXB 3EQ1A 1PKPA 2JVAA 2JYAA 3IWBA 2V87A 4J8ZA 5KL5A 4MU3A 1Z0WA 4ZYGA 4R2SA 1YUIA 4LF4I 4BCAA 1Z0BA 3WU5A 1HNXI 5IT9Q 5DRPA 3THOB 1RR9A 1WXRA 3K6QA 2DIXA 2HFSA 1KVKA 1WRJA 4DV6I 3PS3A 4B3TI 3ADJA 3C6KA 4K0KI 1Y4UA 4R2DA 1USVA 4DR4I 4R2CA 3P3GA 4DR1E 4MLVA 4YY3I 2NN6B 1F2IG 4R8OA 2V85A 1L4SA 2UXDI 2EM3A 1PJSA 1SR9A 1USUA 1N0VC 4DR5E 2CSHA 3P3CA 3PRYA 4IJDA 1VI7A 2YTEA 3KZZA 4DR3E
chains in the Genus database with same CATH topology
3M6AA 2IHR1 2UUBI 1ZM9A 3PYFA 4L5NC 1ZBQA 1YYWA 2E1RA 2MC6A 2LBSB 5LMUI 1T4NA 3C4TA 4AQYI 4LFBI 1RREA 1WUUA 4MYTA 4IZKA 3J7AM 3AUZA 1Y6ZA 2XEXA 4DU8A 3JAMC 2V34A 4NXMI 1N36I 3QT6A 2EZ6A 2RTXA 1XNQE 1ZM4A 2O1WA 4HY1A 4DV1I 2WZOA 3V2UC 5AE2A 4IZJD 4JI6E 4DV4I 4DUZE 2HKEA 3V5RA 3VYYA 2M1SA 4M1KA 1B62A 4LF5E 3P1XA 4FWGA 5IT9C 4LF7I 3QT8A 2IOQA 4YHHI 2UXCI 4USKA 3AV0A 3GONA 3F6GA 2L6MA 1YYOA 1KKHA 2N3GA 2V8QB 4DV2E 3VK6A 4JI3E 4JI5E 3J81Q 4X64I 4JI4I 2JR1A 1FNMA 3VYXA 2V89A 2Z5BB 4KZSA 2LJPA 2E5LE 4HACB 1HK7A 4X65I 4FWHA 2Z5EA 1HR0E 2ZBKB 2UUAE 5FLXC 2EFGA 2Z5CA 4HYMA 1UHZA 2N3HA 4F9BB 2HKJA 2E1MA 4Q28A 2DEJA 1PVGA 4B3SI 4M0VA 2JOXA 2BM0A 5IWAE 3ZM7A 2JY9A 4X62E 2X7IA 4MYUA 3IWCA 2E5LI 1FKAE 1ZXNA 2MC5A 3J7Yp 2NUGA 3DJWA 3ZZUA 4JI7E 4DMIA 2FV4B 3J80C 3PYGA 1UILA 1YZ9A 2UXBI 2L2MA 4R1FA 1T4OA 3H09A 4KHPI 1J5EI 4ED4A 2LUQA 4WYQB 2AJ4A 5LMNI 4JI0E 2UUCE 3DF6A 4FN5A 1HNWE 2LUPB 5GMEA 4DV1E 1HNXE 4DR7I 4LF8E 5GMDA 4P52A 2UXBE 1EI1A 4USMA 4OX9E 1VISA 4B3MI 2Q2EB 3ADIA 3OMLA 2A2DA 3CWVA 4DR1I 2KONA 1XMOE 4BS9A 1H7SA 5FWKA 1XNQI 4GKKI 5BR8I 3HPZA 4Z7CA 4F54A 1RC7A 1Z5BA 2Z5BA 1EA6A 5DNYA 4FWDA 3ZZ0A 2F4VE 1N34I 1XMQI 4LF4E 1DARA 3PYEA 1HNZE 4JI3I 4X66I 4JV5I 1QU6A 4FW9A 4B3ME 2ZM6I 4OX9I 1N33I 4IZJA 2R42A 4P7AA 4DPUA 2DB2A 2L3JA 4GKKE 1RQ0A 2NA2A 2HHHE 4HACA 2L33A 4JI2E 3QT5A 1OJ4A 4JI8I 2VQEI 1ELOA 1N34E 2F4VI 1I94I 5A2QQ 2LE2A 2VQFE 4M2ZA 4WFTA 1H7UA 4B3SE 2VF1A 1IBKE 1N33E 4HXZA 1IBLE 2B7VA 3JAMQ 4DV3E 1Y4SA 2O1TA 4L8NA 3RMPA 3ZKDA 2L2KB 2H36X 2OI2A 2L8TA 4DV7I 4F9AB 1IBMI 5LMUE 5IWAI 4X62I 2DEIA 4TUGA 3ZZTA 2CPNA 3HPSA 4WSPA 2G7HA 3J7AG 4NXNI 2L92A 1QZRA 4DV0E 4GEQB 2V2QA 4NXME 4LTYA 4YY3E 2ZITA 4I8OA 4X65E 1D6TA 4F9CB 4LF9I 2RSMA 3P06A 2UUCI 4LF6I 1NHHA 4DV7E 4JI6I 4R03A 4WUDA 1DQ3A 2R3VA 1NHIA 4DPTA 3KWRA 1S16A 2UUBE 2O1VA 4B3RI 2CGEA 3J80Q 4DV2I 1ZM3A 2DMYA 4X64E 4DXLA 1N0UA 4IZKB 4DPXA 1Z0VA 5A2QC 2EWLA 1H72C 3K85A 3Q1QA 4P7DA 4DV5E 2B9DA 3ADLA 1MG7A 1N32E 4M30A 2YT4A 2O1UA 2UUAI 4URLA 1B63A 4JI4E 4DR6E 4GKJE 3T1YI 4DV6E 4JI1I 4B3RE 2NPFA 3LMLA 1J5EE 2ODRC 4AQYE 3WU3A 2M7QA 3Q6MA 4WUCA 1N36E 3ZKBA 4LFCI 1N32I 5AASA 4DU7A 4LU9A 4WPYA 4BMJA 3HTXA 4P78A 1K47A 1HNZI 2NUFA 1Z0CA 3JU0A 2JOBA 3F6HA 1UEKA 4BC7A 2CZ9A 4LF7E 5FLXQ 1FWLA 2A2CA 1PIEA 4B3TE 2KHXA 1X48A 4KQVA 2LRSA 2VE7C 1ZXMA 1KTVA 4JYAE 1YYKA 2Z5CB 1T4LB 4DR5I 4DR3I 4WUBA 1NZ0A 2HK2A 3IWDA 4IZJB 4BBYA 4LF8I 4XTJA 4JI5I 4LFBE 3D4JA 5LMNE 2KOUA 4YHHE 2UXCE 2V8PA 3OTOI 2V2ZA 1MU5A 2LTRA 1XMOI 3H4LA 2HFUA 4DR2I 5L3JA 3JTZA 3LLHA 2B3TB 4UTGA 4DPYA 4NXNE 3B82A 1FWKA 3HXLA 1GZ6A 4DV0I 3WU4A 5LL6R 1Z59A 4UT4A 4LF5I 2RS6A 4DUYE 2UU9E 4RPFA 1DI2A 4Z7YA 4OOGC 1Z5AA 2LMZA 3LPSA 1H74A 4DKKA 2DSYA 2HHHI 4DR2E 3F0NA 2PNMA 1IBME 2L2NA 2ODRD 3PYDA 2B7TA 4X66E 4JV5E 2LTSA 3T1YE 4DR6I 1BKNA 2CG9A 3K17A 2VQFI 4DPWA 1XNRE 2YZTA 4JI0I 4K0KE 4TUIA 4DR4E 3LNUA 2BV3A 2JWOA 1WHNA 4GKJI 2UXDE 2LJHA 1Z0GA 3ADGA 2FGGA 5T6JA 1Z5CA 1U2RA 2F8BA 2NUEA 3Q6NA 3ZOQB 1S4EA 5AE1A 1FJGE 4BC9A 2V86A 2L3CA 1EKZA 4PU9A 1HNWI 1MX0A 3B78A 5AE3A 5BR8E 2WW4A 4JI8E 2VQEE 1KIJA 2IOPA 2BM1A 4PRXA 1XMQE 1NHJA 4LFAE 2MDRA 4DV4E 1FI4A 4PRVA 3HJCA 2RS7A 1FJGI 3HQ1A 1IBLI 2VF3A 1WHQA 3MSWA 5ADZA 1X47A 2HK3A 4DUZI 4JI2I 1STUA 2V83A 3J81C 4EMDA 4X8WA 1IBKI 4DR7E 1I94E 2X36A 2PNLA 2V2VA 4JI1E 4LFAI 1J26A 3FIGA 3OTOE 4N3OA 4I3HA 3T1HE 3B8HA 4DV5I 4DV3I 2J7KA 1X49A 1A6FA 1Z0TA 4JYAI 4JG4A 1H73A 3K1JA 2K4VA 3LTOA 4LF6E 1Z0EA 5F3WA 3HULA 3QT7A 4ZVIA 3WU6A 3C4BA 2M4IA 1ZM2A 2GQ0A 4KHPE 1O0WA 4DUYI 2UU9I 1XNRI 3T1HI 1XHKA 4LF9E 2ZM6E 1GQEA 2GS8A 1HR0I 5CFFE 2V88A 1ZBTA 2FTXB 1PKPA 2JVAA 2V87A 3IWBA 4J8ZA 1Z0WA 4LF4I 4BCAA 1Z0BA 3WU5A 1HNXI 5IT9Q 1RR9A 1WXRA 3K6QA 2DIXA 2HFSA 1KVKA 4DV6I 4B3TI 3ADJA 4K0KI 1Y4UA 1USVA 4DR4I 4DR1E 4YY3I 4R8OA 2V85A 2UXDI 1USUA 1SR9A 1N0VC 4DR5E 3PRYA 4LFCE 4JI7I 4DR3E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3M6A A;  2IHR 1;  2UUB I;  1ZM9 A;  3PYF A;  2E1R A;  1YYW A;  2LBS B;  5LMU I;  1T4N A;  3C4T A;  4AQY I;  4LFB I;  1RRE A;  1WUU A;  4MYT A;  3J7A M;  2XEX A;  4DU8 A;  3JAM C;  2V34 A;  4NXM I;  1N36 I;  3QT6 A;  2EZ6 A;  2RTX A;  1XNQ E;  1ZM4 A;  4HY1 A;  4DV1 I;  3V2U C;  4JI6 E;  4DV4 I;  4DUZ E;  2HKE A;  3V5R A;  3VYY A;  4M1K A;  1B62 A;  4LF5 E;  3P1X A;  4FWG A;  5IT9 C;  4LF7 I;  3QT8 A;  4YHH I;  2UXC I;  4USK A;  3GON A;  1YYO A;  1KKH A;  2N3G A;  4DV2 E;  4JI3 E;  4JI5 E;  3J81 Q;  4X64 I;  4JI4 I;  1FNM A;  3VYX A;  2LJP A;  2E5L E;  4HAC B;  4X65 I;  4FWH A;  1HR0 E;  2ZBK B;  2UUA E;  5FLX C;  2EFG A;  4HYM A;  1UHZ A;  2N3H A;  2HKJ A;  2DEJ A;  1PVG A;  4B3S I;  2BM0 A;  5IWA E;  3ZM7 A;  2JY9 A;  4X62 E;  2X7I A;  4MYU A;  2E5L I;  1FKA E;  1ZXN A;  3J7Y p;  2NUG A;  3ZZU A;  4JI7 E;  3J80 C;  3PYG A;  1UIL A;  1YZ9 A;  2UXB I;  2L2M A;  4R1F A;  1T4O A;  4KHP I;  1J5E I;  4ED4 A;  2LUQ A;  4WYQ B;  2AJ4 A;  5LMN I;  4JI0 E;  2UUC E;  4FN5 A;  1HNW E;  2LUP B;  5GME A;  4DV1 E;  1HNX E;  4DR7 I;  4LF8 E;  5GMD A;  4P52 A;  2UXB E;  1EI1 A;  4USM A;  4OX9 E;  1VIS A;  4B3M I;  2Q2E B;  3ADI A;  2A2D A;  3CWV A;  4DR1 I;  1XMO E;  1H7S A;  4GKK I;  1XNQ I;  5BR8 I;  4Z7C A;  1RC7 A;  1Z5B A;  1EA6 A;  4FWD A;  3ZZ0 A;  2F4V E;  1N34 I;  1XMQ I;  4LF4 E;  1DAR A;  3PYE A;  1HNZ E;  4JI3 I;  4X66 I;  4JV5 I;  1QU6 A;  4FW9 A;  4B3M E;  2ZM6 I;  4OX9 I;  1N33 I;  2R42 A;  4P7A A;  4DPU A;  2DB2 A;  2L3J A;  4GKK E;  1RQ0 A;  2NA2 A;  2HHH E;  4HAC A;  2L33 A;  4JI2 E;  3QT5 A;  1OJ4 A;  4JI8 I;  2VQE I;  1ELO A;  1N34 E;  2F4V I;  1I94 I;  5A2Q Q;  2VQF E;  4M2Z A;  4WFT A;  1H7U A;  4B3S E;  1IBK E;  1N33 E;  4HXZ A;  1IBL E;  2B7V A;  3JAM Q;  4DV3 E;  3ZKD A;  2L2K B;  2OI2 A;  4DV7 I;  1IBM I;  5LMU E;  5IWA I;  4X62 I;  2DEI A;  3ZZT A;  2CPN A;  3J7A G;  4NXN I;  1QZR A;  4DV0 E;  2V2Q A;  4NXM E;  4YY3 E;  2ZIT A;  4X65 E;  1D6T A;  4LF9 I;  2RSM A;  2UUC I;  4LF6 I;  1NHH A;  4DV7 E;  4JI6 I;  4WUD A;  2R3V A;  1NHI A;  4DPT A;  2UUB E;  1S16 A;  4B3R I;  3J80 Q;  4DV2 I;  1ZM3 A;  2DMY A;  4X64 E;  4DXL A;  1N0U A;  4DPX A;  1Z0V A;  5A2Q C;  1H72 C;  3Q1Q A;  4DV5 E;  3ADL A;  1MG7 A;  1N32 E;  4M30 A;  2YT4 A;  2UUA I;  4URL A;  1B63 A;  4JI4 E;  4DR6 E;  4GKJ E;  3T1Y I;  4DV6 E;  4JI1 I;  4B3R E;  2NPF A;  1J5E E;  4AQY E;  3WU3 A;  4WUC A;  1N36 E;  3ZKB A;  4LFC I;  1N32 I;  4DU7 A;  3HTX A;  1K47 A;  1HNZ I;  2NUF A;  1Z0C A;  1UEK A;  2CZ9 A;  4LF7 E;  5FLX Q;  1FWL A;  2A2C A;  1PIE A;  4B3T E;  2KHX A;  1X48 A;  4KQV A;  2LRS A;  1ZXM A;  1KTV A;  4JYA E;  1YYK A;  1T4L B;  4DR5 I;  4DR3 I;  4WUB A;  1NZ0 A;  2HK2 A;  4LF8 I;  4XTJ A;  4JI5 I;  4LFB E;  3D4J A;  5LMN E;  4YHH E;  2UXC E;  2V8P A;  3OTO I;  2V2Z A;  1MU5 A;  2LTR A;  1XMO I;  3H4L A;  2HFU A;  4DR2 I;  5L3J A;  3LLH A;  2B3T B;  4UTG A;  4DPY A;  4NXN E;  3B82 A;  1FWK A;  4DV0 I;  3WU4 A;  1Z59 A;  5LL6 R;  4UT4 A;  4LF5 I;  2RS6 A;  4DUY E;  2UU9 E;  4RPF A;  1DI2 A;  4Z7Y A;  4OOG C;  1Z5A A;  3LPS A;  1H74 A;  4DKK A;  2HHH I;  4DR2 E;  3F0N A;  1IBM E;  2L2N A;  3PYD A;  2B7T A;  4X66 E;  4JV5 E;  2LTS A;  3T1Y E;  4DR6 I;  1BKN A;  3K17 A;  2VQF I;  4DPW A;  1XNR E;  4JI0 I;  4K0K E;  4DR4 E;  3LNU A;  2BV3 A;  1WHN A;  4GKJ I;  2UXD E;  2LJH A;  1Z0G A;  3ADG A;  1Z5C A;  1U2R A;  2NUE A;  1S4E A;  1FJG E;  2L3C A;  1EKZ A;  4PU9 A;  1HNW I;  1MX0 A;  3B78 A;  5BR8 E;  2WW4 A;  4JI8 E;  2VQE E;  1KIJ A;  2BM1 A;  4PRX A;  1XMQ E;  1NHJ A;  4LFA E;  2MDR A;  4DV4 E;  1FI4 A;  4PRV A;  2RS7 A;  1FJG I;  1IBL I;  2VF3 A;  1WHQ A;  1X47 A;  2HK3 A;  4DUZ I;  4JI2 I;  1STU A;  3J81 C;  4EMD A;  4X8W A;  1IBK I;  4DR7 E;  1I94 E;  2X36 A;  2V2V A;  4JI1 E;  4LFA I;  1J26 A;  3OTO E;  4I3H A;  3T1H E;  3B8H A;  4DV5 I;  4DV3 I;  2J7K A;  1X49 A;  1A6F A;  1Z0T A;  4JYA I;  4JG4 A;  1H73 A;  3K1J A;  3LTO A;  4LF6 E;  1Z0E A;  3HUL A;  3QT7 A;  4ZVI A;  3WU6 A;  3C4B A;  1ZM2 A;  4KHP E;  1O0W A;  4DUY I;  2UU9 I;  1XNR I;  3T1H I;  1XHK A;  4LF9 E;  2ZM6 E;  1GQE A;  2GS8 A;  1HR0 I;  5CFF E;  1ZBT A;  1PKP A;  2JVA A;  1Z0W A;  4LF4 I;  1Z0B A;  3WU5 A;  1HNX I;  5IT9 Q;  1RR9 A;  2DIX A;  2HFS A;  1KVK A;  4DV6 I;  4B3T I;  3ADJ A;  4K0K I;  4DR4 I;  4DR1 E;  4YY3 I;  2UXD I;  1N0V C;  4DR5 E;  4LFC E;  4JI7 I;  4DR3 E; 
#chains in the Genus database with same CATH topology
 2YU8 A;  5A6A A;  3M6A A;  2IHR 1;  3PS2 A;  2UUB I;  1ZM9 A;  3PYF A;  4L5N C;  2EPU A;  1ZBQ A;  1YYW A;  2E1R A;  2MC6 A;  2LBS B;  2EML A;  2ENA A;  1T4N A;  2NN6 C;  2YRK A;  3C4T A;  5LMU I;  4AQY I;  3MHH C;  4LFB I;  1RRE A;  5A6J A;  2EN6 A;  2EMX A;  2EMH A;  1WUU A;  2EM7 A;  4MYT A;  4IZK A;  3J7A M;  4MQY A;  3AUZ A;  1Y6Z A;  2XEX A;  2ELY A;  3JAM C;  1TN9 A;  4DU8 A;  2V34 A;  4NXM I;  2YTG A;  1N36 I;  3QT6 A;  2EZ6 A;  2RTX A;  1XNQ E;  1X6H A;  1ZM4 A;  2O1W A;  4HY1 A;  2WZO A;  4O24 A;  5JEA C;  4MU0 A;  5AE2 A;  1Z1B A;  3V2U C;  4DV1 I;  4IZJ D;  2JEA A;  1RMD A;  3NZK A;  5DRQ A;  5K36 E;  5AC4 A;  4JI6 E;  4N4R B;  2JEB A;  4DUZ E;  2HKE A;  4DV4 I;  5DNX A;  3V5R A;  3VYY A;  2M1S A;  4M1K A;  1B62 A;  2HJJ A;  1UBD C;  4LF5 E;  3P1X A;  3KRN A;  5IT9 C;  4FWG A;  2JPA A;  4JYA I;  4R2Q A;  2R1F A;  2EOR A;  4LF7 I;  3QT8 A;  2IOQ A;  4YHH I;  2UXC I;  1A1G A;  2DRP A;  2D9H A;  4USK A;  3AV0 A;  3GON A;  2PO2 B;  5DRO A;  2EMF A;  3EPH A;  1BB8 A;  3F6G A;  2L6M A;  2EOJ A;  1YYO A;  2DMI A;  2N3G A;  1KKH A;  2V8Q B;  4DV2 E;  3VK6 A;  4JI3 E;  4JI5 E;  2JEB B;  3J81 Q;  4X64 I;  4JI4 I;  2JR1 A;  1FNM A;  2EJ4 A;  5C0X D;  1YH8 A;  2ENH A;  4MLQ A;  3VYX A;  4NBQ A;  2V89 A;  2Z5B B;  4KZS A;  2HGH A;  2LJP A;  3P76 A;  2E5L E;  4HAC B;  1PJQ A;  1HK7 A;  4X65 I;  2PRT A;  3GLL A;  2Z5E A;  4FWH A;  1HR0 E;  4BA1 B;  1A1K A;  2ZBK B;  2UUA E;  4MU4 A;  4JG4 A;  2BA1 G;  5FLX C;  5KL4 A;  4LCG A;  2EFG A;  2Z5C A;  4HYM A;  2LCE A;  1UHZ A;  3M7N G;  2N3H A;  4F9B B;  4HTG A;  2HKJ A;  2E1M A;  4Q28 A;  2DEJ A;  1PVG A;  2GPI A;  4B3S I;  4M0V A;  2JOX A;  2BM0 A;  3M85 G;  5IWA E;  3ZM7 A;  2JY9 A;  4X62 E;  3GCM A;  2X7I A;  4MYU A;  1PDA A;  2PO1 B;  1X6F A;  3IWC A;  2E5L I;  4IFD A;  2YSP A;  1FKA E;  2A25 A;  4Q35 B;  2NN6 A;  2EN8 A;  2EPR A;  3M99 B;  1ZXN A;  5TSE A;  2MC5 A;  2K7I A;  3J7Y p;  2EN7 A;  2NUG A;  1OYS A;  2IES A;  3DJW A;  4OO1 C;  2I13 A;  3ZZU A;  4JI7 E;  4DMI A;  4IFD F;  2FV4 B;  4LCH A;  4OO1 F;  2ENC A;  3J80 C;  1RHY A;  4FW7 A;  3PYG A;  1UIL A;  1YZ9 A;  5KL7 A;  2PNZ A;  2L2M A;  2RSI A;  1E3P A;  4R1F A;  2UXB I;  2JT2 A;  1T4O A;  3H09 A;  4KHP I;  1YHC A;  5AC5 A;  1J5E I;  5K36 F;  2HC5 A;  1BBO A;  1T38 A;  4ED4 A;  2LUQ A;  4WYQ B;  2AJ4 A;  5LMN I;  3C6M A;  4JI0 E;  2YPN A;  1ZR9 A;  2UUC E;  3DF6 A;  4FN5 A;  2CT1 A;  2EQ1 A;  1HNW E;  3PS1 A;  2LUP B;  4FW4 A;  5GME A;  4DV1 E;  1HNX E;  4DR7 I;  2EPC A;  2E72 A;  4LF8 E;  4IS1 C;  5GMD A;  4P52 A;  2UXB E;  1EI1 A;  2EPO A;  2PO0 A;  5KL2 A;  4USM A;  4OX9 E;  1VIS A;  4B3M I;  2Q2E B;  3ADI A;  2EOX A;  3OML A;  2A2D A;  3CWV A;  4DR1 I;  2KON A;  3CDI A;  2ADR A;  2BA0 G;  1XMO E;  4BS9 A;  1H7S A;  5FWK A;  1XNQ I;  4GKK I;  5BR8 I;  3HPZ A;  4Z7C A;  4F54 A;  1RC7 A;  2LO3 A;  1Z5B A;  2Z5B A;  1EA6 A;  5DNY A;  1R6M A;  2C37 A;  4X9J A;  4FWD A;  3ZZ0 A;  2F4V E;  1N34 I;  2EPL X;  1IQS A;  1XMQ I;  3UK3 C;  4LF4 E;  2C38 A;  4M9V C;  2YRM A;  5A6B D;  1DAR A;  3PYE A;  1HNZ E;  4JI3 I;  4OO1 B;  4X66 I;  4JV5 I;  1QU6 A;  4AIM A;  3M85 D;  4FW9 A;  4B3M E;  2ZM6 I;  4OX9 I;  1N33 I;  2WCC 3;  2R42 A;  4IZJ A;  4P7A A;  4DPU A;  1MEY C;  2DB2 A;  2EL6 A;  2EM9 A;  2L3J A;  4GKK E;  3THN A;  1RQ0 A;  2NA2 A;  2HHH E;  4HAC A;  5JEA A;  2L33 A;  4JI2 E;  3QT5 A;  4WXD A;  1OJ4 A;  2EPZ A;  2PO1 A;  4JI8 I;  2VQE I;  1ELO A;  1N34 E;  5DRR A;  2F4V I;  1I94 I;  1PJT A;  2PNZ B;  5A2Q Q;  2LE2 A;  2VQF E;  4M2Z A;  4WFT A;  1H7U A;  5C0X E;  4B3S E;  3H1C A;  2VF1 A;  2YTQ A;  1IBK E;  1N33 E;  1DGC A;  1OYR A;  4HXZ A;  1IMU A;  1IBL E;  2B7V A;  3JAM Q;  4DV3 E;  4IFD C;  1Y4S A;  5C0X C;  2N8X A;  2O1T A;  4L8N A;  1P47 A;  3RMP A;  2YSO A;  3ECR A;  3ZKD A;  5JEA B;  2L2K B;  2H36 X;  1EH7 A;  2L8T A;  2OI2 A;  4DV7 I;  2WP8 A;  4F9A B;  1IBM I;  5LMU E;  5IWA I;  5K36 B;  1YUJ A;  3UHM A;  4AID A;  4X62 I;  2YWQ A;  1NEI A;  4TUG A;  2DEI A;  2NN6 D;  2CPN A;  3ZZT A;  2PO2 A;  2BA0 D;  1AAY A;  3HPS A;  4WSP A;  2EN2 A;  2G7H A;  2EPK X;  3J7A G;  1OYP A;  2L92 A;  4O43 A;  4NXN I;  1QZR A;  4LCF A;  2YTD A;  4GEQ B;  4DV0 E;  2V2Q A;  3B4T A;  4NXM E;  4LTY A;  4YY3 E;  2PO0 B;  2ZIT A;  5K36 C;  2R76 A;  4I8O A;  4X65 E;  1D6T A;  4F9C B;  4LF9 I;  2RSM A;  2EM2 A;  3L7Z A;  2EPA A;  3P06 A;  1WJP A;  2UUC I;  2EPP A;  4LF6 I;  1NHH A;  2EM0 A;  4DV7 E;  4JI6 I;  3EPL A;  5C0X F;  4R03 A;  4WUD A;  1DQ3 A;  2R3V A;  1NHI A;  5K36 D;  2EMI A;  4DPT A;  3KWR A;  2DGC A;  2UUB E;  1S16 A;  2O1V A;  4B3R I;  3MHS C;  2CGE A;  4WX9 A;  3J80 Q;  4DV2 I;  4O5G A;  2RQL A;  4R2P A;  2DMY A;  4X64 E;  1ZM3 A;  4DXL A;  2EOF A;  1N0U A;  4IZK B;  4DPX A;  1Z0V A;  5A2Q C;  1R6L A;  2EWL A;  1H72 C;  2NAB A;  4O4K A;  3K85 A;  3Q1Q A;  4P7D A;  2BA1 D;  4DV5 E;  2B9D A;  2VES A;  2RPC A;  3M7N D;  3ADL A;  1MG7 A;  2EQ0 A;  1A1L A;  1N32 E;  2GHF A;  2YT4 A;  4M30 A;  2O1U A;  4OO1 A;  2BB8 A;  2UUA I;  4BA2 A;  4URL A;  2EMB A;  1B63 A;  4JI4 E;  4DR6 E;  4GKJ E;  3T1Y I;  1N3G A;  4DV6 E;  1X3C A;  4JI1 I;  5C0X B;  4B3R E;  2NPF A;  2LJU A;  3LML A;  5JEA E;  2EOQ A;  1G2D C;  1J5E E;  2ODR C;  4AQY E;  2BR2 B;  3WU3 A;  1KYQ A;  2M7Q A;  3Q6M A;  3U1Y A;  4WUC A;  1N36 E;  2J7J A;  2MDG A;  4RH8 A;  2MKN A;  4OZE A;  3ZKB A;  1LLM C;  2EMK A;  4ZYH A;  2EOI A;  4LFC I;  2J65 A;  1TF6 A;  1N32 I;  5AAS A;  4DU7 A;  4LU9 A;  4WPY A;  4BMJ A;  3HTX A;  4P78 A;  1K47 A;  1HNZ I;  2NUF A;  2BBG A;  1Z0C A;  2LV2 A;  3JU0 A;  4FW5 A;  2JOB A;  2EM4 A;  3F6H A;  2JE6 B;  4BHB A;  1UEK A;  4BC7 A;  2WNR B;  2YTN A;  2EL4 A;  5EL9 A;  2CZ9 A;  4F2J C;  2EMW A;  2YTI A;  4LF7 E;  1FWL A;  2A2C A;  1PIE A;  4B3T E;  2KHX A;  5FLX Q;  2DLQ A;  1X48 A;  5K36 A;  4KQV A;  1X5W A;  2LRS A;  2C39 A;  2EMA A;  2YU5 A;  1P42 A;  2EP3 A;  2VE7 C;  1ZXM A;  1KTV A;  4JYA E;  2C37 B;  2EMZ A;  2LT7 A;  1YYK A;  2Z5C B;  1T4L B;  4DR5 I;  4BHC A;  4R2R A;  5JEA F;  4DR3 I;  4WUB A;  1GTK A;  2EOS A;  1NZ0 A;  2WBS A;  2HK2 A;  1SFE A;  3IWD A;  4IZJ B;  4BBY A;  5JEA D;  5IV8 B;  4LF8 I;  5KL6 A;  4XTJ A;  4JI5 I;  4LFB E;  3D4J A;  2EOH A;  5LMN E;  4OO1 D;  2KOU A;  2WBT A;  1X6E A;  4YHH E;  2UXC E;  2V8P A;  3OTO I;  2EOE A;  2V2Z A;  1MU5 A;  4J3D A;  2EM6 A;  2LTR A;  1Y5Y A;  2EMG A;  2AE8 A;  1XMO I;  3H4L A;  2HFU A;  3U1K A;  4DR2 I;  4MU1 A;  3L7Z B;  1NCS A;  3HKM A;  5L3J A;  4QNK A;  3JTZ A;  2M9A A;  3LLH A;  4QNJ A;  2B3T B;  4UTG A;  4IFD D;  3DD6 A;  2CVE A;  4NXN E;  4DPY A;  2MKD A;  2WBU A;  2EMY A;  2DLK A;  3HXL A;  1FWK A;  1GZ6 A;  3B82 A;  3WU4 A;  4DV0 I;  4BA2 B;  2NN6 E;  2JXP A;  2EN4 A;  3TQM A;  5A69 A;  1T39 A;  1EH6 A;  5LL6 R;  1Z59 A;  4UT4 A;  5A6B A;  4LF5 I;  2RS6 A;  3KZY A;  1AH5 A;  4DUY E;  4F6N A;  2UU9 E;  4RPF A;  1DI2 A;  4U3B A;  4Z7Y A;  5IXM B;  4OOG C;  1Z5A A;  2LMZ A;  4RHB B;  3LPS A;  1H74 A;  4DKK A;  1A1I A;  1ZU1 A;  2DSY A;  2EN1 A;  4DR2 E;  4GQU A;  2HHH I;  3F0N A;  2PNM A;  1IBM E;  1TF3 A;  4LOM A;  2L2N A;  2ODR D;  3CDJ A;  1EH8 A;  3PYD A;  4AM3 A;  2B7T A;  4X66 E;  3L00 A;  2LTS A;  3T1Y E;  4JV5 E;  4DR6 I;  1BKN A;  2CG9 A;  4WSG A;  3K17 A;  4DPW A;  2VQF I;  1XNR E;  3P3E A;  2YZT A;  2F1D A;  1A1F A;  4JI0 I;  1Y60 A;  2EPN A;  2JE6 A;  2I9I A;  4K0K E;  1A1H A;  3BID A;  1YSA C;  4TUI A;  4DR4 E;  3LNU A;  2EE8 A;  2YTF A;  2BV3 A;  4IFD B;  2JWO A;  4GZN C;  1WHN A;  1UDQ A;  2CTD A;  2ELZ A;  5A6K A;  4GKJ I;  2LJH A;  2UXD E;  1Z0G A;  2GO4 A;  3ADG A;  2FGG A;  2EM8 A;  5T6J A;  1B69 A;  1Z5C A;  1U2R A;  2F8B A;  4FW3 A;  2NUE A;  5KL3 A;  4JI7 I;  1E3H A;  1YPN A;  4NZV A;  3Q6N A;  2EQ3 A;  3ZOQ B;  1S4E A;  5AE1 A;  2YTJ A;  1FJG E;  4BC9 A;  2V86 A;  3EPK A;  2L3C A;  1EKZ A;  4PU9 A;  5DNL A;  1A1J A;  2YTP A;  2EMC A;  2EOO A;  1HNW I;  1MX0 A;  3B78 A;  5AE3 A;  5BR8 E;  2WW4 A;  5C0X A;  4ISA A;  4JI8 E;  2VQE E;  1KIJ A;  4BA1 A;  3BBG A;  2IOP A;  2BM1 A;  4PRX A;  2EPX A;  1XMQ E;  1NHJ A;  4LFA E;  3BGH A;  2MDR A;  4DV4 E;  1QNT A;  1FI4 A;  1UDO A;  4PRV A;  3HJC A;  2RS7 A;  4ZYD A;  1FJG I;  2EOY A;  3HQ1 A;  4NHR A;  2NN6 F;  2YRH A;  1ZAA C;  3QG5 C;  1IBL I;  2VF3 A;  3GME A;  1WHQ A;  4IS9 A;  1MGT A;  3VHT B;  4U3D A;  2EN3 A;  3MSW A;  2O3Z A;  5LLQ A;  2WP8 B;  4MDT A;  5ADZ A;  1X47 A;  2HK3 A;  2IER A;  4DUZ I;  1STU A;  4JI2 I;  2V83 A;  2BR2 A;  3J81 C;  4EMD A;  4X8W A;  2C38 B;  1YFH A;  2Q8U A;  1IBK I;  2VRD A;  4DR7 E;  1I94 E;  2X36 A;  1UN6 B;  4HEI A;  2PNL A;  2YTO A;  4JI1 E;  2V2V A;  4LFA I;  1J26 A;  1KJK A;  3FIG A;  3OTO E;  4N3O A;  4I3H A;  3T1H E;  1JK2 A;  3B8H A;  4DV5 I;  2JEA B;  4DV3 I;  3BF2 A;  2EOZ A;  2J7K A;  5ELW A;  1X49 A;  4ZYE A;  2WNR A;  4FW6 A;  4LFC E;  4F6M A;  5EKW A;  1A6F A;  3EPJ A;  4FK5 C;  4WXC A;  4KWY A;  1H73 A;  1Z0T A;  2GO3 A;  1JK1 A;  2K4V A;  1IQO A;  1UDS A;  3K1J A;  3LTO A;  4LF6 E;  1Z0E A;  2EL5 A;  5F3W A;  3HUL A;  2LVH A;  3QT7 A;  4ZVI A;  2EOM A;  2EPM X;  4R2A A;  2EM5 A;  3WU6 A;  2C39 B;  3C4B A;  2M4I A;  4IFD E;  2GLI A;  1ZM2 A;  2GQ0 A;  4KHP E;  1O0W A;  4OO1 E;  4DUY I;  4OKG A;  4LPF A;  2UU9 I;  1XXE A;  1XNR I;  3T1H I;  1XHK A;  1G2F C;  1BBG A;  4LF9 E;  2ZM6 E;  1GQE A;  4R2E A;  2GS8 A;  1UDN A;  1HR0 I;  5CFF E;  2V88 A;  1ZBT A;  2JP9 A;  2FTX B;  3EQ1 A;  1PKP A;  2JVA A;  2JYA A;  3IWB A;  2V87 A;  4J8Z A;  5KL5 A;  4MU3 A;  1Z0W A;  4ZYG A;  4R2S A;  1YUI A;  4LF4 I;  4BCA A;  1Z0B A;  3WU5 A;  1HNX I;  5IT9 Q;  5DRP A;  3THO B;  1RR9 A;  1WXR A;  3K6Q A;  2DIX A;  2HFS A;  1KVK A;  1WRJ A;  4DV6 I;  3PS3 A;  4B3T I;  3ADJ A;  3C6K A;  4K0K I;  1Y4U A;  4R2D A;  1USV A;  4DR4 I;  4R2C A;  3P3G A;  4DR1 E;  4MLV A;  4YY3 I;  2NN6 B;  1F2I G;  4R8O A;  2V85 A;  1L4S A;  2UXD I;  2EM3 A;  1PJS A;  1SR9 A;  1USU A;  1N0V C;  4DR5 E;  2CSH A;  3P3C A;  3PRY A;  4IJD A;  1VI7 A;  2YTE A;  3KZZ A;  4DR3 E; 
#chains in the Genus database with same CATH homology
 3M6A A;  2IHR 1;  2UUB I;  1ZM9 A;  3PYF A;  4L5N C;  1ZBQ A;  1YYW A;  2E1R A;  2MC6 A;  2LBS B;  5LMU I;  1T4N A;  3C4T A;  4AQY I;  4LFB I;  1RRE A;  1WUU A;  4MYT A;  4IZK A;  3J7A M;  3AUZ A;  1Y6Z A;  2XEX A;  4DU8 A;  3JAM C;  2V34 A;  4NXM I;  1N36 I;  3QT6 A;  2EZ6 A;  2RTX A;  1XNQ E;  1ZM4 A;  2O1W A;  4HY1 A;  4DV1 I;  2WZO A;  3V2U C;  5AE2 A;  4IZJ D;  4JI6 E;  4DV4 I;  4DUZ E;  2HKE A;  3V5R A;  3VYY A;  2M1S A;  4M1K A;  1B62 A;  4LF5 E;  3P1X A;  4FWG A;  5IT9 C;  4LF7 I;  3QT8 A;  2IOQ A;  4YHH I;  2UXC I;  4USK A;  3AV0 A;  3GON A;  3F6G A;  2L6M A;  1YYO A;  1KKH A;  2N3G A;  2V8Q B;  4DV2 E;  3VK6 A;  4JI3 E;  4JI5 E;  3J81 Q;  4X64 I;  4JI4 I;  2JR1 A;  1FNM A;  3VYX A;  2V89 A;  2Z5B B;  4KZS A;  2LJP A;  2E5L E;  4HAC B;  1HK7 A;  4X65 I;  4FWH A;  2Z5E A;  1HR0 E;  2ZBK B;  2UUA E;  5FLX C;  2EFG A;  2Z5C A;  4HYM A;  1UHZ A;  2N3H A;  4F9B B;  2HKJ A;  2E1M A;  4Q28 A;  2DEJ A;  1PVG A;  4B3S I;  4M0V A;  2JOX A;  2BM0 A;  5IWA E;  3ZM7 A;  2JY9 A;  4X62 E;  2X7I A;  4MYU A;  3IWC A;  2E5L I;  1FKA E;  1ZXN A;  2MC5 A;  3J7Y p;  2NUG A;  3DJW A;  3ZZU A;  4JI7 E;  4DMI A;  2FV4 B;  3J80 C;  3PYG A;  1UIL A;  1YZ9 A;  2UXB I;  2L2M A;  4R1F A;  1T4O A;  3H09 A;  4KHP I;  1J5E I;  4ED4 A;  2LUQ A;  4WYQ B;  2AJ4 A;  5LMN I;  4JI0 E;  2UUC E;  3DF6 A;  4FN5 A;  1HNW E;  2LUP B;  5GME A;  4DV1 E;  1HNX E;  4DR7 I;  4LF8 E;  5GMD A;  4P52 A;  2UXB E;  1EI1 A;  4USM A;  4OX9 E;  1VIS A;  4B3M I;  2Q2E B;  3ADI A;  3OML A;  2A2D A;  3CWV A;  4DR1 I;  2KON A;  1XMO E;  4BS9 A;  1H7S A;  5FWK A;  1XNQ I;  4GKK I;  5BR8 I;  3HPZ A;  4Z7C A;  4F54 A;  1RC7 A;  1Z5B A;  2Z5B A;  1EA6 A;  5DNY A;  4FWD A;  3ZZ0 A;  2F4V E;  1N34 I;  1XMQ I;  4LF4 E;  1DAR A;  3PYE A;  1HNZ E;  4JI3 I;  4X66 I;  4JV5 I;  1QU6 A;  4FW9 A;  4B3M E;  2ZM6 I;  4OX9 I;  1N33 I;  4IZJ A;  2R42 A;  4P7A A;  4DPU A;  2DB2 A;  2L3J A;  4GKK E;  1RQ0 A;  2NA2 A;  2HHH E;  4HAC A;  2L33 A;  4JI2 E;  3QT5 A;  1OJ4 A;  4JI8 I;  2VQE I;  1ELO A;  1N34 E;  2F4V I;  1I94 I;  5A2Q Q;  2LE2 A;  2VQF E;  4M2Z A;  4WFT A;  1H7U A;  4B3S E;  2VF1 A;  1IBK E;  1N33 E;  4HXZ A;  1IBL E;  2B7V A;  3JAM Q;  4DV3 E;  1Y4S A;  2O1T A;  4L8N A;  3RMP A;  3ZKD A;  2L2K B;  2H36 X;  2OI2 A;  2L8T A;  4DV7 I;  4F9A B;  1IBM I;  5LMU E;  5IWA I;  4X62 I;  2DEI A;  4TUG A;  3ZZT A;  2CPN A;  3HPS A;  4WSP A;  2G7H A;  3J7A G;  4NXN I;  2L92 A;  1QZR A;  4DV0 E;  4GEQ B;  2V2Q A;  4NXM E;  4LTY A;  4YY3 E;  2ZIT A;  4I8O A;  4X65 E;  1D6T A;  4F9C B;  4LF9 I;  2RSM A;  3P06 A;  2UUC I;  4LF6 I;  1NHH A;  4DV7 E;  4JI6 I;  4R03 A;  4WUD A;  1DQ3 A;  2R3V A;  1NHI A;  4DPT A;  3KWR A;  1S16 A;  2UUB E;  2O1V A;  4B3R I;  2CGE A;  3J80 Q;  4DV2 I;  1ZM3 A;  2DMY A;  4X64 E;  4DXL A;  1N0U A;  4IZK B;  4DPX A;  1Z0V A;  5A2Q C;  2EWL A;  1H72 C;  3K85 A;  3Q1Q A;  4P7D A;  4DV5 E;  2B9D A;  3ADL A;  1MG7 A;  1N32 E;  4M30 A;  2YT4 A;  2O1U A;  2UUA I;  4URL A;  1B63 A;  4JI4 E;  4DR6 E;  4GKJ E;  3T1Y I;  4DV6 E;  4JI1 I;  4B3R E;  2NPF A;  3LML A;  1J5E E;  2ODR C;  4AQY E;  3WU3 A;  2M7Q A;  3Q6M A;  4WUC A;  1N36 E;  3ZKB A;  4LFC I;  1N32 I;  5AAS A;  4DU7 A;  4LU9 A;  4WPY A;  4BMJ A;  3HTX A;  4P78 A;  1K47 A;  1HNZ I;  2NUF A;  1Z0C A;  3JU0 A;  2JOB A;  3F6H A;  1UEK A;  4BC7 A;  2CZ9 A;  4LF7 E;  5FLX Q;  1FWL A;  2A2C A;  1PIE A;  4B3T E;  2KHX A;  1X48 A;  4KQV A;  2LRS A;  2VE7 C;  1ZXM A;  1KTV A;  4JYA E;  1YYK A;  2Z5C B;  1T4L B;  4DR5 I;  4DR3 I;  4WUB A;  1NZ0 A;  2HK2 A;  3IWD A;  4IZJ B;  4BBY A;  4LF8 I;  4XTJ A;  4JI5 I;  4LFB E;  3D4J A;  5LMN E;  2KOU A;  4YHH E;  2UXC E;  2V8P A;  3OTO I;  2V2Z A;  1MU5 A;  2LTR A;  1XMO I;  3H4L A;  2HFU A;  4DR2 I;  5L3J A;  3JTZ A;  3LLH A;  2B3T B;  4UTG A;  4DPY A;  4NXN E;  3B82 A;  1FWK A;  3HXL A;  1GZ6 A;  4DV0 I;  3WU4 A;  5LL6 R;  1Z59 A;  4UT4 A;  4LF5 I;  2RS6 A;  4DUY E;  2UU9 E;  4RPF A;  1DI2 A;  4Z7Y A;  4OOG C;  1Z5A A;  2LMZ A;  3LPS A;  1H74 A;  4DKK A;  2DSY A;  2HHH I;  4DR2 E;  3F0N A;  2PNM A;  1IBM E;  2L2N A;  2ODR D;  3PYD A;  2B7T A;  4X66 E;  4JV5 E;  2LTS A;  3T1Y E;  4DR6 I;  1BKN A;  2CG9 A;  3K17 A;  2VQF I;  4DPW A;  1XNR E;  2YZT A;  4JI0 I;  4K0K E;  4TUI A;  4DR4 E;  3LNU A;  2BV3 A;  2JWO A;  1WHN A;  4GKJ I;  2UXD E;  2LJH A;  1Z0G A;  3ADG A;  2FGG A;  5T6J A;  1Z5C A;  1U2R A;  2F8B A;  2NUE A;  3Q6N A;  3ZOQ B;  1S4E A;  5AE1 A;  1FJG E;  4BC9 A;  2V86 A;  2L3C A;  1EKZ A;  4PU9 A;  1HNW I;  1MX0 A;  3B78 A;  5AE3 A;  5BR8 E;  2WW4 A;  4JI8 E;  2VQE E;  1KIJ A;  2IOP A;  2BM1 A;  4PRX A;  1XMQ E;  1NHJ A;  4LFA E;  2MDR A;  4DV4 E;  1FI4 A;  4PRV A;  3HJC A;  2RS7 A;  1FJG I;  3HQ1 A;  1IBL I;  2VF3 A;  1WHQ A;  3MSW A;  5ADZ A;  1X47 A;  2HK3 A;  4DUZ I;  4JI2 I;  1STU A;  2V83 A;  3J81 C;  4EMD A;  4X8W A;  1IBK I;  4DR7 E;  1I94 E;  2X36 A;  2PNL A;  2V2V A;  4JI1 E;  4LFA I;  1J26 A;  3FIG A;  3OTO E;  4N3O A;  4I3H A;  3T1H E;  3B8H A;  4DV5 I;  4DV3 I;  2J7K A;  1X49 A;  1A6F A;  1Z0T A;  4JYA I;  4JG4 A;  1H73 A;  3K1J A;  2K4V A;  3LTO A;  4LF6 E;  1Z0E A;  5F3W A;  3HUL A;  3QT7 A;  4ZVI A;  3WU6 A;  3C4B A;  2M4I A;  1ZM2 A;  2GQ0 A;  4KHP E;  1O0W A;  4DUY I;  2UU9 I;  1XNR I;  3T1H I;  1XHK A;  4LF9 E;  2ZM6 E;  1GQE A;  2GS8 A;  1HR0 I;  5CFF E;  2V88 A;  1ZBT A;  2FTX B;  1PKP A;  2JVA A;  2V87 A;  3IWB A;  4J8Z A;  1Z0W A;  4LF4 I;  4BCA A;  1Z0B A;  3WU5 A;  1HNX I;  5IT9 Q;  1RR9 A;  1WXR A;  3K6Q A;  2DIX A;  2HFS A;  1KVK A;  4DV6 I;  4B3T I;  3ADJ A;  4K0K I;  1Y4U A;  1USV A;  4DR4 I;  4DR1 E;  4YY3 I;  4R8O A;  2V85 A;  2UXD I;  1USU A;  1SR9 A;  1N0V C;  4DR5 E;  3PRY A;  4LFC E;  4JI7 I;  4DR3 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...