3OTOE

Crystal structure of the 30s ribosomal subunit from a ksga mutant of thermus thermophilus (hb8)
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
150
structure length
150
Chain Sequence
DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title Modification of 16S ribosomal RNA by the KsgA methyltransferase restructures the 30S subunit to optimize ribosome function.
pubmed doi rcsb
molecule tags Ribosome
total genus 36
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2010-09-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 3otoE01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 3otoE02
1N32E 5A2QQ 2GS8A 3ZKDA 4DPWA 4OX9I 1DI2A 4YHHI 1XNRE 4Z7YA 3K1JA 4M2ZA 2OI2A 2BM1A 4JI5E 2ZBKB 5LMNE 2EZ6A 1H7UA 2DB2A 5FLXQ 4LF6E 4DUZI 1YZ9A 2UUCE 1EKZA 3P1XA 4MYUA 2RS6A 1VISA 5BR8I 4FWDA 3HULA 4X66I 4LF9I 4JI8E 2LRSA 4GKJE 4DR2I 2NUFA 3QT7A 1ZM3A 1T4LB 2NUGA 1OJ4A 2B3TB 1Z0CA 4UT4A 4DUYI 1XMQI 2UXDI 3OTOE 4KHPE 3B82A 4DV1I 3ZM7A 1UHZA 3GONA 4DV7E 4NXMI 2DIXA 3J81C 1Z0WA 3B78A 2HHHI 4X65I 4GKKI 3ZZTA 2VQEE 1KVKA 2L2KB 4RPFA 3J7AG 4B3TE 3ZZ0A 3ADIA 3LTOA 4WYQB 2LUPB 1FNMA 4M30A 2NUEA 2V2VA 1FWKA 2F4VI 4DKKA 4HY1A 2DEJA 4B3MI 2UU9E 4JYAI 3JAMC 1X48A 1N36E 1D6TA 3LLHA 1XMOE 4JI1E 1QU6A 4DPYA 2L33A 1XNQI 4PRXA 1Z0VA 3D4JA 1RR9A 3J80Q 1FJGE 2HK3A 3ZZUA 4PRVA 1XHKA 2HK2A 1IBKE 4K0KE 2AJ4A 3T1YE 2L3JA 3PYGA 1HR0E 4NXNI 2UUCI 4FWGA 4HACB 4ZVIA 4JI4E 4USMA 2VQFE 4DR7E 2UUAI 2Q2EB 4ED4A 5LL6R 4I3HA 3V2UC 4GKJI 4B3SE 4AQYE 1Z5CA 1B63A 4DU8A 4R1FA 2CPNA 1N33I 3OTOI 2DEIA 4FWHA 2ZM6E 1STUA 4LF5E 3VYXA 5IT9Q 2L3CA 2LJPA 2RTXA 3LPSA 5GMEA 2VQEI 4JI7I 4B3RE 3LNUA 5IWAE 1Z59A 4LFCI 4B3TI 3C4TA 1UILA 4KQVA 4YY3I 4DR1E 1ELOA 2ZITA 4LF7E 3V5RA 1H74A 2UXCE 5LMUE 2V8PA 2B7TA 3H4LA 2UU9I 4HACA 1J5EE 1BKNA 4WUBA 1N36I 3K17A 2WW4A 2A2CA 1XMOI 2EFGA 4DV2E 3PYEA 1NHIA 3ZKBA 1Z0TA 1YYWA 2E5LE 3WU5A 1B62A 4HYMA 1IBME 1RQ0A 1FJGI 1DARA 1IBKI 1ZM4A 4DV6E 1S16A 4K0KI 3T1YI 1NZ0A 1HNWE 1GQEA 1HR0I 4JI2I 1N34E 2NPFA 5GMDA 5A2QC 3T1HE 4DV0E 4DPXA 1HNXE 4JI4I 4X8WA 4DR6E 2VQFI 1HNZE 4DR7I 3C4BA 3WU3A 1WHQA 1T4NA 4LFAE 3J7AM 2HFUA 2N3GA 2N3HA 4DV5I 4DV4E 2CZ9A 4MYTA 4DR3I 4DR5I 2JVAA 2IHR1 1YYKA 1Z5BA 1FI4A 4DUZE 1WHNA 1J26A 4DR4I 5BR8E 1K47A 4UTGA 1NHHA 1N32I 2ZM6I 4LF9E 1Z5AA 1XNRI 2LBSB 4JI5I 1H73A 1IBLE 2HKEA 5LMNI 2RSMA 4JI3E 4LF6I 2V2QA 1Z0EA 1A6FA 4JV5E 4DV1E 2XEXA 5LMUI 4JI8I 1T4OA 2YT4A 4NXME 2DMYA 4OOGC 2HHHE 4GKKE 1J5EI 3CWVA 4LFBE 3M6AA 2MDRA 4FW9A 2E5LI 4DV3E 1QZRA 1IBMI 2UUBE 4KHPI 3QT6A 2R3VA 4DV7I 3F0NA 3WU6A 1N0UA 2A2DA 4X64E 4B3ME 4JYAE 1KTVA 3J80C 2L2NA 1ZM9A 2J7KA 1N34I 2V2ZA 3J81Q 1EA6A 1XNQE 1PVGA 1HNXI 4DR6I 1KKHA 4WUDA 1YYOA 4X62E 2UXBE 1I94E 2V34A 1Z0GA 4JI6E 4LFAI 2LUQA 3WU4A 4USKA 4DV4I 5L3JA 4Z7CA 4LF8E 4NXNE 2BV3A 4JI1I 1RC7A 4XTJA 3JAMQ 2UUAE 3ADLA 1ZM2A 4JI0E 4LF4E 1WUUA 2VF3A 1MU5A 3PYDA 2E1RA 1IBLI 3QT8A 4JI3I 1MG7A 1S4EA 4JV5I 5IT9C 1N33E 1RREA 4OX9E 1N0VC 4YHHE 2KHXA 5FLXC 1PIEA 4B3SI 4AQYI 3B8HA 1NHJA 4JI7E 1FKAE 4LFBI 2LTRA 3QT5A 4LFCE 4DPUA 1Z0BA 4DV3I 2NA2A 1X47A 3ADJA 2UUBI 4WUCA 2HFSA 4YY3E 3Q1QA 4X66E 4LF5I 3HTXA 4P7AA 2L2MA 3J7Yp 4P52A 1ZXNA 1H72C 4DU7A 2B7VA 4DR2E 4X64I 4B3RI 5IWAI 1H7SA 4DUYE 1XMQE 2UXDE 4DR1I 3PYFA 1UEKA 4X62I 4LF7I 3ADGA 1I94I 2UXBI 4JI6I 2UXCI 1FWLA 3VYYA 2R42A 1MX0A 4DXLA 1ZBTA 1O0WA 4X65E 4EMDA 2JY9A 2LTSA 2X7IA 4LF8I 4HXZA 2RS7A 4JI2E 4DV2I 1PKPA 2HKJA 4JI0I 2BM0A 4URLA 4JG4A 1ZXMA 4DV6I 4LF4I 4PU9A 4DV5E 4FN5A 2F4VE 1EI1A 1X49A 2LJHA 4DR3E 4DR5E 1HNWI 4WFTA 1KIJA 1U2RA 4DV0I 3T1HI 4DR4E 2X36A 5CFFE 1HNZI 4M1KA 4DPTA
chains in the Genus database with same CATH superfamily
1N32E 5A2QQ 2GS8A 1Y4SA 4LPFA 3ZKDA 3BF2A 4DPWA 4OX9I 1DI2A 2YRMA 4YHHI 2EPNA 2N8XA 1XNRE 4Z7YA 4R2EA 2E1MA 1USUA 1TN9A 3K1JA 4BA2A 4M2ZA 3M7ND 2OI2A 2BM1A 2RSIA 1PJQA 4JI5E 2KOUA 2JE6B 2LO3A 2ZBKB 5LMNE 2IERA 2EZ6A 1H7UA 2DB2A 5DRQA 5FLXQ 4LF6E 4J3DA 4DUZI 2EOFA 2UUCE 1YZ9A 3K85A 2JEAA 2PO1B 1EKZA 2PNMA 3P1XA 4MYUA 2RS6A 2JPAA 1VISA 5BR8I 4FWDA 3HULA 4X66I 3Q6MA 1AH5A 4IZKA 4LF9I 2NN6F 1AAYA 4JI8E 2M7QA 2LRSA 3PS3A 4TUGA 5A6JA 4GKJE 4DR2I 2NUFA 3QT7A 1ZM3A 4Q35B 4IFDA 1T4LB 2CSHA 2NUGA 4R2QA 2B3TB 4ZYDA 1OJ4A 2EMAA 3C6MA 4LU9A 4NZVA 1Z0CA 4UT4A 2EMHA 4BCAA 4LCGA 4DUYI 2ENAA 2JEBA 5JEAA 1XMQI 4Q28A 2UXDI 4F6MA 2J65A 4IFDE 4U3BA 3OTOE 1A1FA 4KHPE 2VF1A 3B82A 2LVHA 1UHZA 3ZM7A 4DV1I 4HTGA 3GONA 5EL9A 4DV7E 4NXMI 2DIXA 2PNZA 5JEAE 4LCFA 3J81C 1Z0WA 3B78A 2HHHI 5AE1A 4X65I 4GKKI 3ZZTA 2EM8A 4R03A 2VQEE 1KVKA 2L2KB 3J7AG 4RPFA 3UHMA 1BBOA 4BA1B 1EH8A 5KL4A 4B3TE 2GO4A 4J8ZA 3ZZ0A 1YPNA 1ZU1A 2EM6A 2EPUA 2YTGA 3ADIA 2CGEA 4MU3A 5K36C 2EOXA 3LTOA 2KONA 1MEYC 2EL5A 4LCHA 3P76A 5A6AA 4MU4A 4WYQB 1WXRA 2LUPB 1FNMA 2EMKA 4AIDA 3QG5C 2Q8UA 4M30A 2NUEA 2V2VA 1BBGA 4IZJA 5A69A 1FWKA 2F4VI 4DKKA 4HY1A 2PO1A 2EQ3A 2DEJA 1IQSA 2EM0A 2UU9E 4B3MI 4JYAI 2YU5A 3JAMC 1X48A 2GHFA 1NCSA 2NN6C 1N36E 1D6TA 3LLHA 2M9AA 1XMOE 1UN6B 3RMPA 4JI1E 1QU6A 4F6NA 1LLMC 2L33A 4DPYA 2JT2A 4PRXA 1XNQI 1Z0VA 3D4JA 2CT1A 4O24A 2LV2A 3UK3C 3IWBA 1RR9A 4AIMA 1Y60A 3J80Q 1FJGE 2HK3A 4FW6A 1Y5YA 3THNA 3ZZUA 3MSWA 4OO1A 4PRVA 1XHKA 2HK2A 1IBKE 2NN6B 3M85D 2V85A 3GCMA 2YTQA 2LT7A 4K0KE 2CTDA 2BR2B 2AJ4A 2EN6A 1MGTA 3T1YE 2JXPA 2L3JA 4OO1E 4GEQB 3PYGA 2FTXB 1A1KA 1HR0E 2ELZA 2WP8B 2Z5EA 2L92A 4NXNI 2UUCI 2WBUA 4FWGA 2Z5BB 1ZR9A 2EN7A 1UDNA 4JI4E 2V86A 2YSPA 4HACB 4F9CB 4ZVIA 4USMA 3DF6A 2VQFE 1T38A 4DR7E 2UUAI 1BB8A 2Q2EB 2DRPA 4ED4A 3M99B 2YWQA 5LL6R 5IV8B 5KL3A 4IZJD 4I3HA 2YTIA 5AC4A 3AV0A 2E72A 3V2UC 4OO1F 2YTOA 4GKJI 4N4RB 4F2JC 4B3SE 5EKWA 4FW3A 4ZYHA 4AQYE 1Z5CA 4O5GA 1ZAAC 2EMXA 1B63A 2EM7A 2DMIA 3KRNA 1KJKA 5TSEA 4U3DA 3BIDA 2ELYA 5DRRA 3GMEA 3VK6A 4DU8A 4R1FA 2CPNA 3B4TA 2D9HA 4OO1D 2HC5A 5FWKA 1N33I 3OTOI 2DEIA 4FWHA 2GQ0A 2ZM6E 1STUA 4LF5E 3VYXA 1X3CA 2EM9A 2Z5CB 5K36A 4BC9A 3HPSA 2YU8A 1UBDC 5IT9Q 2L3CA 2LJPA 2JP9A 2RTXA 2PRTA 3LPSA 3ZOQB 2ODRD 2WCC3 5GMEA 3IWDA 2EQ1A 2EPAA 2VQEI 4B3RE 4JI7I 3LNUA 5IWAE 1UDQA 5K36E 4MLVA 2GO3A 1Z59A 3K6QA 4LFCI 4B3TI 3EPLA 4IS1C 3EQ1A 5C0XA 3C4TA 2EMGA 3F6GA 1UILA 2M4IA 2EMBA 4IJDA 2O1WA 3P3CA 4KQVA 2R1FA 4YY3I 4DR1E 1ELOA 2ZITA 4MQYA 2C37B 4LF7E 3V5RA 2PO2B 1H74A 2DLKA 2UXCE 2EPCA 5LMUE 2EOEA 3L00A 4P78A 1OYSA 2PO0B 5C0XE 3CDJA 5ADZA 2EPZA 2V8PA 2B7TA 2DSYA 3H4LA 2UU9I 4HACA 2GLIA 1J5EE 1BKNA 4WUBA 4FW7A 3HQ1A 3K17A 1UDSA 2WW4A 1N36I 2MC5A 2A2CA 1XMOI 4GQUA 2EFGA 4DV2E 1NHIA 3PYEA 3ZKBA 2VE7C 1Z0TA 1YYWA 2E5LE 3WU5A 2EOHA 1B62A 2JR1A 4HYMA 3U1YA 1IBME 1RQ0A 1USVA 2YTPA 1RHYA 2YRKA 3HJCA 4DXLA 1FJGI 1DARA 2MKNA 2LJUA 4BS9A 1SR9A 4GZNC 2O1UA 4R2DA 3CDIA 2H36X 3LMLA 1YUIA 4LOMA 1IBKI 1ZM4A 4DV6E 2YRHA 2EE8A 2C39A 1S16A 2G7HA 2ODRC 4K0KI 3DJWA 4WX9A 2BBGA 1EH7A 1NZ0A 2IESA 3T1YI 4AM3A 1HNWE 1GQEA 1HR0I 4JI2I 1N34E 2NPFA 2A25A 5GMDA 5A2QC 3T1HE 4DV0E 4DPXA 3EPHA 4IFDF 4WSGA 2L6MA 3KZYA 5KL7A 1HNXE 4JI4I 4MLQA 4X8WA 4DR6E 2VQFI 1HNZE 2YZTA 5IXMB 5KL5A 4DR7I 3C4BA 3TQMA 3WU3A 1WHQA 1T4NA 4LFAE 5JEAF 4WXCA 3J7AM 2HFUA 2LMZA 2EOMA 2N3GA 2V83A 2JE6A 4IS9A 2EOIA 2N3HA 4DV5I 4IFDD 1YFHA 1A1LA 3L7ZB 4DV4E 1VI7A 2IOQA 4QNJA 2CZ9A 1PJTA 4MYTA 4DR3I 4DR5I 2K4VA 5AE2A 2JVAA 5F3WA 5JEAD 2IHR1 1YYKA 1Z5BA 1FI4A 2C37A 4DUZE 1WHNA 3HPZA 2EN2A 4KZSA 1J26A 4DR4I 2O1VA 2DGCA 4MU1A 1Z1BA 2PO0A 3EPKA 5BR8E 2EOQA 2HJJA 2V87A 1K47A 4UTGA 1OYRA 1NHHA 1N32I 2ZM6I 4LF9E 1Z5AA 2MKDA 1G2DC 1WJPA 1XNRI 2WNRB 1EH6A 3KWRA 2EN4A 5DROA 2BA0G 1P42A 2LBSB 4R2CA 5A6BA 1YH8A 4JI5I 1H73A 2M1SA 1IBLE 4BBYA 2HKEA 4MU0A 3KZZA 4WSPA 5LMNI 3NZKA 2RSMA 4JI3E 4LF6I 2EN8A 2V2QA 3P06A 1Z0EA 3JU0A 4O43A 4HEIA 1A6FA 2LE2A 4LFAI 2V88A 4JV5E 4I8OA 2BB8A 2JEAB 4DV1E 1DQ3A 1YSAC 2XEXA 5LMUI 3HXLA 4JI8I 4IFDC 2YTJA 1T4OA 4FK5C 2YT4A 4RH8A 4NXME 1Y6ZA 4BA1A 2R76A 1GZ6A 2DMYA 4OOGC 2GPIA 2HHHE 3P3EA 4GKKE 5JEAC 1J5EI 3CWVA 4LFBE 3M6AA 2MDRA 4FW9A 5AE3A 2EMYA 3ECRA 1P47A 2E5LI 1SFEA 2PNLA 2EPLX 4DV3E 1QZRA 4IFDB 5A6KA 2I13A 1IBMI 2UUBE 2EM3A 2YTEA 4MDTA 4KHPI 2V34A 3QT6A 1OYPA 2JEBB 2R3VA 1X5WA 3F0NA 4DV7I 3WU6A 2AE8A 1PDAA 1N0UA 4LTYA 5DNLA 2A2DA 4X64E 4B3ME 4JYAE 1TF3A 1KTVA 5DNXA 3J80C 2PNZB 2YTFA 2L2NA 1ZM9A 2J7KA 1N34I 4R2RA 3OMLA 1WRJA 2BA1G 2V2ZA 3J81Q 1EA6A 1XNQE 1PVGA 2JOBA 1A1HA 1HNXI 4X9JA 1XXEA 2NN6A 4DR6I 2EOYA 4F9BB 2MC6A 4N3OA 1KKHA 4WUDA 1YYOA 5LLQA 4X62E 1I94E 2UXBE 2NABA 4JI6E 1Z0GA 4KWYA 5T6JA 2LUQA 1F2IG 2BR2A 1X6EA 4BC7A 2VRDA 3AUZA 1YUJA 1YHCA 3WU4A 4USKA 1Y4UA 2JOXA 2NN6E 2WP8A 4DV4I 5L3JA 4Z7CA 2I9IA 5K36F 5KL6A 2EJ4A 1JK2A 4P7DA 2Z5BA 1N3GA 2L8TA 4LF8E 4IZJB 2EMFA 2BA0D 4NXNE 2BV3A 4JI1I 1RC7A 4OO1C 2EM5A 4F9AB 2EOOA 2JYAA 5AASA 2WBSA 1JK1A 1HK7A 4FW5A 1G2FC 4XTJA 2EMLA 3JAMQ 3M85G 2UUAE 5C0XF 4O4KA 3ADLA 2C38B 5K36D 5DRPA 1ZM2A 4JI0E 2MDGA 4LF4E 1PJSA 4R2SA 1WUUA 1DGCA 1MU5A 1A1JA 2VF3A 3THOB 1NEIA 4OZEA 4OO1B 3Q6NA 3PYDA 5K36B 2K7IA 2E1RA 1IBLI 5C0XD 3QT8A 2EPKX 4M9VC 4JI3I 2EMCA 1MG7A 2NN6D 2YTDA 1L4SA 4L5NC 2J7JA 3HKMA 2FGGA 1S4EA 2Z5CA 2EN3A 3EPJA 3FIGA 4JV5I 4L8NA 5IT9C 1N33E 3PS2A 2EM2A 4RHBB 2F8BA 2VESA 1RREA 1ZBQA 2EMWA 4OX9E 1N0VC 4YHHE 1GTKA 2KHXA 2EOZA 5FLXC 1A1IA 3BBGA 2ENCA 1PIEA 4B3SI 4AQYI 1R6MA 3B8HA 4R8OA 1NHJA 4JI7E 1T39A 1FKAE 4LFBI 2LTRA 3QT5A 2WBTA 5KL2A 4LFCE 4DPUA 2EPPA 1Z0BA 4BMJA 2PO2A 4DV3I 2NA2A 2EPOA 3IWCA 4FW4A 1X47A 3ADJA 2ADRA 4BHBA 2UUBI 4R2AA 4WUCA 2HFSA 4YY3E 2ENHA 4F54A 2EPXA 4X66E 2BA1D 2O3ZA 3Q1QA 2B9DA 4LF5I 3HTXA 3M7NG 4P7AA 3F6HA 2EN1A 2L2MA 2JWOA 3J7Yp 1ZXNA 4P52A 1UDOA 3BGHA 1H72C 4DU7A 4TUIA 2B7VA 2V8QB 4DR2E 4ISAA 5C0XC 4X64I 1X6HA 2EM4A 2EQ0A 4B3RI 2EL4A 2IOPA 5IWAI 2C38A 4BA2B 3U1KA 1H7SA 4WPYA 4R2PA 3P3GA 1R6LA 4DUYE 3JTZA 4BHCA 2F1DA 1XMQE 2UXDE 2CVEA 2EPMX 3H1CA 4DR1I 3PYFA 1X6FA 4QNKA 3MHHC 1A1GA 1UEKA 4X62I 4LF7I 3ADGA 5C0XB 1I94I 4JI6I 2UXBI 2UXCI 4M0VA 1FWLA 3VYYA 5AC5A 3PS1A 4WXDA 3H09A 2RQLA 2R42A 2RPCA 4DMIA 2FV4B 1ZBTA 1MX0A 4ZYEA 2V89A 5DNYA 1O0WA 4IZKB 1RMDA 1KYQA 4X65E 4EMDA 2EORA 2JY9A 2LTSA 2X7IA 3DD6A 4LF8I 4OKGA 2YTNA 3C6KA 4HXZA 2RS7A 4JI2E 2EPRA 3MHSC 4DV2I 2EMIA 4ZYGA 1QNTA 1IMUA 3VHTB 4NHRA 2EMZA 2O1TA 3PRYA 2HGHA 1PKPA 2LCEA 2HKJA 4NBQA 3L7ZA 2EP3A 4JI0I 1IQOA 2BM0A 2YPNA 2YSOA 4JG4A 4URLA 5JEAB 2EOJA 1ZXMA 4DV6I 4LF4I 1TF6A 4PU9A 4DV5E 5A6BD 4FN5A 2F4VE 2EOSA 1EI1A 1X49A 2LJHA 4DR3E 2EL6A 4DR5E 1HNWI 4WFTA 1KIJA 2C39B 1U2RA 4DV0I 3T1HI 5ELWA 4DR4E 1E3PA 2WZOA 2X36A 5CFFE 1B69A 2CG9A 2EWLA 2DLQA 2WNRA 4M1KA 1HNZI 4DPTA 3GLLA 1E3HA
chains in the Genus database with same CATH topology
1N32E 5A2QQ 2GS8A 1Y4SA 3ZKDA 4DPWA 4OX9I 1DI2A 4YHHI 1XNRE 4Z7YA 2E1MA 1USUA 3K1JA 4M2ZA 2OI2A 2BM1A 4JI5E 2KOUA 2ZBKB 5LMNE 2EZ6A 1H7UA 2DB2A 5FLXQ 4LF6E 4DUZI 1YZ9A 2UUCE 3K85A 1EKZA 2PNMA 3P1XA 4MYUA 2RS6A 1VISA 5BR8I 4FWDA 3HULA 4X66I 3Q6MA 4IZKA 4LF9I 4JI8E 2M7QA 2LRSA 4TUGA 4GKJE 4DR2I 2NUFA 3QT7A 1ZM3A 1T4LB 2NUGA 1OJ4A 2B3TB 1Z0CA 4LU9A 4UT4A 4BCAA 4DUYI 1XMQI 4Q28A 2UXDI 3OTOE 4KHPE 2VF1A 3B82A 3ZM7A 1UHZA 4DV1I 3GONA 4DV7E 4NXMI 2DIXA 3J81C 1Z0WA 3B78A 2HHHI 5AE1A 4X65I 4GKKI 3ZZTA 2VQEE 4R03A 1KVKA 2L2KB 3J7AG 4RPFA 4B3TE 4J8ZA 3ZZ0A 3ADIA 2CGEA 3LTOA 2KONA 4WYQB 1WXRA 2LUPB 1FNMA 4M30A 2NUEA 2V2VA 4IZJA 1FWKA 2F4VI 4DKKA 4HY1A 2DEJA 4B3MI 2UU9E 4JYAI 3JAMC 1X48A 1N36E 1D6TA 3LLHA 1XMOE 3RMPA 4JI1E 1QU6A 4DPYA 2L33A 1XNQI 4PRXA 1Z0VA 3D4JA 1RR9A 3IWBA 3J80Q 1FJGE 2HK3A 3ZZUA 3MSWA 4PRVA 1XHKA 2HK2A 1IBKE 2V85A 4K0KE 2AJ4A 3T1YE 2L3JA 4GEQB 3PYGA 2FTXB 1HR0E 2Z5EA 2L92A 4NXNI 2UUCI 4FWGA 2Z5BB 4HACB 4ZVIA 4JI4E 2V86A 4USMA 4F9CB 3DF6A 2VQFE 4DR7E 2UUAI 2Q2EB 4ED4A 5LL6R 4IZJD 4I3HA 3AV0A 3V2UC 4GKJI 4B3SE 4AQYE 1Z5CA 1B63A 4DU8A 3VK6A 4R1FA 2CPNA 5FWKA 1N33I 3OTOI 2DEIA 4FWHA 2GQ0A 2ZM6E 1STUA 4LF5E 3VYXA 2Z5CB 4BC9A 3HPSA 5IT9Q 2L3CA 2LJPA 2RTXA 3LPSA 3ZOQB 2ODRD 5GMEA 3IWDA 2VQEI 4JI7I 4B3RE 3LNUA 5IWAE 1Z59A 3K6QA 4LFCI 4B3TI 3C4TA 3F6GA 1UILA 2M4IA 4KQVA 2O1WA 4YY3I 4DR1E 1ELOA 2ZITA 4LF7E 3V5RA 1H74A 2UXCE 5LMUE 4P78A 5ADZA 2V8PA 2B7TA 2DSYA 3H4LA 2UU9I 4HACA 1J5EE 1BKNA 4WUBA 3HQ1A 3K17A 2WW4A 1N36I 2MC5A 2A2CA 1XMOI 2EFGA 4DV2E 1NHIA 3PYEA 3ZKBA 2VE7C 1Z0TA 1YYWA 2E5LE 3WU5A 1B62A 2JR1A 4HYMA 1IBME 1RQ0A 1USVA 3HJCA 1FJGI 1DARA 4BS9A 1SR9A 2O1UA 2H36X 3LMLA 1IBKI 1ZM4A 4DV6E 1S16A 2G7HA 2ODRC 4K0KI 3DJWA 3T1YI 1NZ0A 1HNWE 1GQEA 1HR0I 4JI2I 1N34E 2NPFA 5GMDA 5A2QC 3T1HE 4DV0E 4DPXA 2L6MA 1HNXE 4JI4I 4X8WA 4DR6E 2VQFI 1HNZE 2YZTA 4DR7I 3C4BA 3WU3A 1WHQA 1T4NA 4LFAE 3J7AM 2HFUA 2LMZA 2N3GA 2V83A 2N3HA 4DV5I 4DV4E 2IOQA 2CZ9A 4MYTA 4DR3I 4DR5I 2K4VA 5AE2A 2JVAA 5F3WA 2IHR1 1YYKA 1Z5BA 1FI4A 4DUZE 1WHNA 3HPZA 4KZSA 1J26A 4DR4I 2O1VA 5BR8E 2V87A 1K47A 4UTGA 1NHHA 1N32I 2ZM6I 4LF9E 1Z5AA 1XNRI 3KWRA 2LBSB 4JI5I 1H73A 2M1SA 1IBLE 4BBYA 2HKEA 5LMNI 4WSPA 2RSMA 4JI3E 4LF6I 2V2QA 3P06A 1Z0EA 3JU0A 1A6FA 2LE2A 2V88A 4JV5E 4I8OA 4DV1E 1DQ3A 2XEXA 5LMUI 3HXLA 4JI8I 1T4OA 2YT4A 1Y6ZA 4NXME 1GZ6A 2DMYA 4OOGC 2HHHE 4GKKE 1J5EI 3CWVA 4LFBE 3M6AA 2MDRA 4FW9A 5AE3A 2E5LI 2PNLA 4DV3E 1QZRA 1IBMI 2UUBE 4KHPI 3QT6A 2R3VA 4DV7I 3F0NA 3WU6A 1N0UA 4LTYA 2A2DA 4X64E 4B3ME 4JYAE 1KTVA 3J80C 2L2NA 1ZM9A 2J7KA 1N34I 3OMLA 2V2ZA 3J81Q 1EA6A 1XNQE 1PVGA 2JOBA 1HNXI 4DR6I 4F9BB 2MC6A 4N3OA 1KKHA 4WUDA 1YYOA 4X62E 2UXBE 1I94E 2V34A 1Z0GA 4JI6E 4LFAI 5T6JA 2LUQA 4BC7A 3AUZA 3WU4A 4USKA 1Y4UA 2JOXA 4DV4I 5L3JA 4Z7CA 4P7DA 2Z5BA 2L8TA 4LF8E 4IZJB 4NXNE 2BV3A 4JI1I 1RC7A 4F9AB 5AASA 4XTJA 1HK7A 3JAMQ 2UUAE 3ADLA 1ZM2A 4JI0E 4LF4E 1WUUA 2VF3A 1MU5A 3Q6NA 3PYDA 2E1RA 1IBLI 3QT8A 4JI3I 1MG7A 4L5NC 2FGGA 1S4EA 2Z5CA 3FIGA 4JV5I 4L8NA 5IT9C 1N33E 2F8BA 1RREA 1ZBQA 4OX9E 1N0VC 4YHHE 2KHXA 5FLXC 1PIEA 4B3SI 4AQYI 3B8HA 4R8OA 1NHJA 4JI7E 1FKAE 4LFBI 2LTRA 3QT5A 4LFCE 4DPUA 1Z0BA 4BMJA 4DV3I 2NA2A 3IWCA 1X47A 3ADJA 2UUBI 4WUCA 2HFSA 4YY3E 3Q1QA 4F54A 4X66E 2B9DA 4LF5I 3HTXA 4P7AA 3F6HA 2L2MA 2JWOA 3J7Yp 1ZXNA 4P52A 1H72C 4DU7A 4TUIA 2B7VA 2V8QB 4DR2E 4X64I 4B3RI 2IOPA 5IWAI 1H7SA 4WPYA 4DUYE 3JTZA 1XMQE 2UXDE 4DR1I 3PYFA 1UEKA 4X62I 4LF7I 3ADGA 1I94I 2UXBI 4JI6I 2UXCI 4M0VA 1FWLA 3VYYA 3H09A 2R42A 4DMIA 1MX0A 2FV4B 1ZBTA 4IZKB 5DNYA 2V89A 4DXLA 1O0WA 4X65E 4EMDA 2JY9A 2LTSA 2X7IA 4LF8I 4HXZA 2RS7A 4JI2E 4DV2I 2O1TA 3PRYA 1PKPA 2HKJA 4JI0I 2BM0A 4URLA 4JG4A 1ZXMA 4DV6I 4LF4I 4PU9A 4DV5E 4FN5A 2F4VE 1EI1A 1X49A 2LJHA 4DR3E 4DR5E 1HNWI 4WFTA 1KIJA 1U2RA 4DV0I 3T1HI 4DR4E 2WZOA 2X36A 5CFFE 2CG9A 2EWLA 1HNZI 4M1KA 4DPTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N32 E;  5A2Q Q;  2GS8 A;  3ZKD A;  4DPW A;  4OX9 I;  1DI2 A;  4YHH I;  1XNR E;  4Z7Y A;  3K1J A;  4M2Z A;  2OI2 A;  2BM1 A;  4JI5 E;  2ZBK B;  5LMN E;  2EZ6 A;  1H7U A;  2DB2 A;  5FLX Q;  4LF6 E;  4DUZ I;  1YZ9 A;  2UUC E;  1EKZ A;  3P1X A;  4MYU A;  2RS6 A;  1VIS A;  5BR8 I;  4FWD A;  3HUL A;  4X66 I;  4LF9 I;  4JI8 E;  2LRS A;  4GKJ E;  4DR2 I;  2NUF A;  3QT7 A;  1ZM3 A;  1T4L B;  2NUG A;  1OJ4 A;  2B3T B;  1Z0C A;  4UT4 A;  4DUY I;  1XMQ I;  2UXD I;  3OTO E;  4KHP E;  3B82 A;  4DV1 I;  3ZM7 A;  1UHZ A;  3GON A;  4DV7 E;  4NXM I;  2DIX A;  3J81 C;  1Z0W A;  3B78 A;  2HHH I;  4X65 I;  4GKK I;  3ZZT A;  2VQE E;  1KVK A;  2L2K B;  4RPF A;  3J7A G;  4B3T E;  3ZZ0 A;  3ADI A;  3LTO A;  4WYQ B;  2LUP B;  1FNM A;  4M30 A;  2NUE A;  2V2V A;  1FWK A;  2F4V I;  4DKK A;  4HY1 A;  2DEJ A;  4B3M I;  2UU9 E;  4JYA I;  3JAM C;  1X48 A;  1N36 E;  1D6T A;  3LLH A;  1XMO E;  4JI1 E;  1QU6 A;  4DPY A;  2L33 A;  1XNQ I;  4PRX A;  1Z0V A;  3D4J A;  1RR9 A;  3J80 Q;  1FJG E;  2HK3 A;  3ZZU A;  4PRV A;  1XHK A;  2HK2 A;  1IBK E;  4K0K E;  2AJ4 A;  3T1Y E;  2L3J A;  3PYG A;  1HR0 E;  4NXN I;  2UUC I;  4FWG A;  4HAC B;  4ZVI A;  4JI4 E;  4USM A;  2VQF E;  4DR7 E;  2UUA I;  2Q2E B;  4ED4 A;  5LL6 R;  4I3H A;  3V2U C;  4GKJ I;  4B3S E;  4AQY E;  1Z5C A;  1B63 A;  4DU8 A;  4R1F A;  2CPN A;  1N33 I;  3OTO I;  2DEI A;  4FWH A;  2ZM6 E;  1STU A;  4LF5 E;  3VYX A;  5IT9 Q;  2L3C A;  2LJP A;  2RTX A;  3LPS A;  5GME A;  2VQE I;  4JI7 I;  4B3R E;  3LNU A;  5IWA E;  1Z59 A;  4LFC I;  4B3T I;  3C4T A;  1UIL A;  4KQV A;  4YY3 I;  4DR1 E;  1ELO A;  2ZIT A;  4LF7 E;  3V5R A;  1H74 A;  2UXC E;  5LMU E;  2V8P A;  2B7T A;  3H4L A;  2UU9 I;  4HAC A;  1J5E E;  1BKN A;  4WUB A;  1N36 I;  3K17 A;  2WW4 A;  2A2C A;  1XMO I;  2EFG A;  4DV2 E;  3PYE A;  1NHI A;  3ZKB A;  1Z0T A;  1YYW A;  2E5L E;  3WU5 A;  1B62 A;  4HYM A;  1IBM E;  1RQ0 A;  1FJG I;  1DAR A;  1IBK I;  1ZM4 A;  4DV6 E;  1S16 A;  4K0K I;  3T1Y I;  1NZ0 A;  1HNW E;  1GQE A;  1HR0 I;  4JI2 I;  1N34 E;  2NPF A;  5GMD A;  5A2Q C;  3T1H E;  4DV0 E;  4DPX A;  1HNX E;  4JI4 I;  4X8W A;  4DR6 E;  2VQF I;  1HNZ E;  4DR7 I;  3C4B A;  3WU3 A;  1WHQ A;  1T4N A;  4LFA E;  3J7A M;  2HFU A;  2N3G A;  2N3H A;  4DV5 I;  4DV4 E;  2CZ9 A;  4MYT A;  4DR3 I;  4DR5 I;  2JVA A;  2IHR 1;  1YYK A;  1Z5B A;  1FI4 A;  4DUZ E;  1WHN A;  1J26 A;  4DR4 I;  5BR8 E;  1K47 A;  4UTG A;  1NHH A;  1N32 I;  2ZM6 I;  4LF9 E;  1Z5A A;  1XNR I;  2LBS B;  4JI5 I;  1H73 A;  1IBL E;  2HKE A;  5LMN I;  2RSM A;  4JI3 E;  4LF6 I;  2V2Q A;  1Z0E A;  1A6F A;  4JV5 E;  4DV1 E;  2XEX A;  5LMU I;  4JI8 I;  1T4O A;  2YT4 A;  4NXM E;  2DMY A;  4OOG C;  2HHH E;  4GKK E;  1J5E I;  3CWV A;  4LFB E;  3M6A A;  2MDR A;  4FW9 A;  2E5L I;  4DV3 E;  1QZR A;  1IBM I;  2UUB E;  4KHP I;  3QT6 A;  2R3V A;  4DV7 I;  3F0N A;  3WU6 A;  1N0U A;  2A2D A;  4X64 E;  4B3M E;  4JYA E;  1KTV A;  3J80 C;  2L2N A;  1ZM9 A;  2J7K A;  1N34 I;  2V2Z A;  3J81 Q;  1EA6 A;  1XNQ E;  1PVG A;  1HNX I;  4DR6 I;  1KKH A;  4WUD A;  1YYO A;  4X62 E;  2UXB E;  1I94 E;  2V34 A;  1Z0G A;  4JI6 E;  4LFA I;  2LUQ A;  3WU4 A;  4USK A;  4DV4 I;  5L3J A;  4Z7C A;  4LF8 E;  4NXN E;  2BV3 A;  4JI1 I;  1RC7 A;  4XTJ A;  3JAM Q;  2UUA E;  3ADL A;  1ZM2 A;  4JI0 E;  4LF4 E;  1WUU A;  2VF3 A;  1MU5 A;  3PYD A;  2E1R A;  1IBL I;  3QT8 A;  4JI3 I;  1MG7 A;  1S4E A;  4JV5 I;  5IT9 C;  1N33 E;  1RRE A;  4OX9 E;  1N0V C;  4YHH E;  2KHX A;  5FLX C;  1PIE A;  4B3S I;  4AQY I;  3B8H A;  1NHJ A;  4JI7 E;  1FKA E;  4LFB I;  2LTR A;  3QT5 A;  4LFC E;  4DPU A;  1Z0B A;  4DV3 I;  2NA2 A;  1X47 A;  3ADJ A;  2UUB I;  4WUC A;  2HFS A;  4YY3 E;  3Q1Q A;  4X66 E;  4LF5 I;  3HTX A;  4P7A A;  2L2M A;  3J7Y p;  4P52 A;  1ZXN A;  1H72 C;  4DU7 A;  2B7V A;  4DR2 E;  4X64 I;  4B3R I;  5IWA I;  1H7S A;  4DUY E;  1XMQ E;  2UXD E;  4DR1 I;  3PYF A;  1UEK A;  4X62 I;  4LF7 I;  3ADG A;  1I94 I;  2UXB I;  4JI6 I;  2UXC I;  1FWL A;  3VYY A;  2R42 A;  1MX0 A;  4DXL A;  1ZBT A;  1O0W A;  4X65 E;  4EMD A;  2JY9 A;  2LTS A;  2X7I A;  4LF8 I;  4HXZ A;  2RS7 A;  4JI2 E;  4DV2 I;  1PKP A;  2HKJ A;  4JI0 I;  2BM0 A;  4URL A;  4JG4 A;  1ZXM A;  4DV6 I;  4LF4 I;  4PU9 A;  4DV5 E;  4FN5 A;  2F4V E;  1EI1 A;  1X49 A;  2LJH A;  4DR3 E;  4DR5 E;  1HNW I;  4WFT A;  1KIJ A;  1U2R A;  4DV0 I;  3T1H I;  4DR4 E;  2X36 A;  5CFF E;  1HNZ I;  4M1K A;  4DPT A; 
#chains in the Genus database with same CATH topology
 1N32 E;  5A2Q Q;  2GS8 A;  1Y4S A;  4LPF A;  3ZKD A;  3BF2 A;  4DPW A;  4OX9 I;  1DI2 A;  2YRM A;  4YHH I;  2EPN A;  2N8X A;  1XNR E;  4Z7Y A;  4R2E A;  2E1M A;  1USU A;  1TN9 A;  3K1J A;  4BA2 A;  4M2Z A;  3M7N D;  2OI2 A;  2BM1 A;  2RSI A;  1PJQ A;  4JI5 E;  2KOU A;  2JE6 B;  2LO3 A;  2ZBK B;  5LMN E;  2IER A;  2EZ6 A;  1H7U A;  2DB2 A;  5DRQ A;  5FLX Q;  4LF6 E;  4J3D A;  4DUZ I;  2EOF A;  2UUC E;  1YZ9 A;  3K85 A;  2JEA A;  2PO1 B;  1EKZ A;  2PNM A;  3P1X A;  4MYU A;  2RS6 A;  2JPA A;  1VIS A;  5BR8 I;  4FWD A;  3HUL A;  4X66 I;  3Q6M A;  1AH5 A;  4IZK A;  4LF9 I;  2NN6 F;  1AAY A;  4JI8 E;  2M7Q A;  2LRS A;  3PS3 A;  4TUG A;  5A6J A;  4GKJ E;  4DR2 I;  2NUF A;  3QT7 A;  1ZM3 A;  4Q35 B;  4IFD A;  1T4L B;  2CSH A;  2NUG A;  4R2Q A;  2B3T B;  4ZYD A;  1OJ4 A;  2EMA A;  3C6M A;  4LU9 A;  4NZV A;  1Z0C A;  4UT4 A;  2EMH A;  4BCA A;  4LCG A;  4DUY I;  2ENA A;  2JEB A;  5JEA A;  1XMQ I;  4Q28 A;  2UXD I;  4F6M A;  2J65 A;  4IFD E;  4U3B A;  3OTO E;  1A1F A;  4KHP E;  2VF1 A;  3B82 A;  2LVH A;  1UHZ A;  3ZM7 A;  4DV1 I;  4HTG A;  3GON A;  5EL9 A;  4DV7 E;  4NXM I;  2DIX A;  2PNZ A;  5JEA E;  4LCF A;  3J81 C;  1Z0W A;  3B78 A;  2HHH I;  5AE1 A;  4X65 I;  4GKK I;  3ZZT A;  2EM8 A;  4R03 A;  2VQE E;  1KVK A;  2L2K B;  3J7A G;  4RPF A;  3UHM A;  1BBO A;  4BA1 B;  1EH8 A;  5KL4 A;  4B3T E;  2GO4 A;  4J8Z A;  3ZZ0 A;  1YPN A;  1ZU1 A;  2EM6 A;  2EPU A;  2YTG A;  3ADI A;  2CGE A;  4MU3 A;  5K36 C;  2EOX A;  3LTO A;  2KON A;  1MEY C;  2EL5 A;  4LCH A;  3P76 A;  5A6A A;  4MU4 A;  4WYQ B;  1WXR A;  2LUP B;  1FNM A;  2EMK A;  4AID A;  3QG5 C;  2Q8U A;  4M30 A;  2NUE A;  2V2V A;  1BBG A;  4IZJ A;  5A69 A;  1FWK A;  2F4V I;  4DKK A;  4HY1 A;  2PO1 A;  2EQ3 A;  2DEJ A;  1IQS A;  2EM0 A;  2UU9 E;  4B3M I;  4JYA I;  2YU5 A;  3JAM C;  1X48 A;  2GHF A;  1NCS A;  2NN6 C;  1N36 E;  1D6T A;  3LLH A;  2M9A A;  1XMO E;  1UN6 B;  3RMP A;  4JI1 E;  1QU6 A;  4F6N A;  1LLM C;  2L33 A;  4DPY A;  2JT2 A;  4PRX A;  1XNQ I;  1Z0V A;  3D4J A;  2CT1 A;  4O24 A;  2LV2 A;  3UK3 C;  3IWB A;  1RR9 A;  4AIM A;  1Y60 A;  3J80 Q;  1FJG E;  2HK3 A;  4FW6 A;  1Y5Y A;  3THN A;  3ZZU A;  3MSW A;  4OO1 A;  4PRV A;  1XHK A;  2HK2 A;  1IBK E;  2NN6 B;  3M85 D;  2V85 A;  3GCM A;  2YTQ A;  2LT7 A;  4K0K E;  2CTD A;  2BR2 B;  2AJ4 A;  2EN6 A;  1MGT A;  3T1Y E;  2JXP A;  2L3J A;  4OO1 E;  4GEQ B;  3PYG A;  2FTX B;  1A1K A;  1HR0 E;  2ELZ A;  2WP8 B;  2Z5E A;  2L92 A;  4NXN I;  2UUC I;  2WBU A;  4FWG A;  2Z5B B;  1ZR9 A;  2EN7 A;  1UDN A;  4JI4 E;  2V86 A;  2YSP A;  4HAC B;  4F9C B;  4ZVI A;  4USM A;  3DF6 A;  2VQF E;  1T38 A;  4DR7 E;  2UUA I;  1BB8 A;  2Q2E B;  2DRP A;  4ED4 A;  3M99 B;  2YWQ A;  5LL6 R;  5IV8 B;  5KL3 A;  4IZJ D;  4I3H A;  2YTI A;  5AC4 A;  3AV0 A;  2E72 A;  3V2U C;  4OO1 F;  2YTO A;  4GKJ I;  4N4R B;  4F2J C;  4B3S E;  5EKW A;  4FW3 A;  4ZYH A;  4AQY E;  1Z5C A;  4O5G A;  1ZAA C;  2EMX A;  1B63 A;  2EM7 A;  2DMI A;  3KRN A;  1KJK A;  5TSE A;  4U3D A;  3BID A;  2ELY A;  5DRR A;  3GME A;  3VK6 A;  4DU8 A;  4R1F A;  2CPN A;  3B4T A;  2D9H A;  4OO1 D;  2HC5 A;  5FWK A;  1N33 I;  3OTO I;  2DEI A;  4FWH A;  2GQ0 A;  2ZM6 E;  1STU A;  4LF5 E;  3VYX A;  1X3C A;  2EM9 A;  2Z5C B;  5K36 A;  4BC9 A;  3HPS A;  2YU8 A;  1UBD C;  5IT9 Q;  2L3C A;  2LJP A;  2JP9 A;  2RTX A;  2PRT A;  3LPS A;  3ZOQ B;  2ODR D;  2WCC 3;  5GME A;  3IWD A;  2EQ1 A;  2EPA A;  2VQE I;  4B3R E;  4JI7 I;  3LNU A;  5IWA E;  1UDQ A;  5K36 E;  4MLV A;  2GO3 A;  1Z59 A;  3K6Q A;  4LFC I;  4B3T I;  3EPL A;  4IS1 C;  3EQ1 A;  5C0X A;  3C4T A;  2EMG A;  3F6G A;  1UIL A;  2M4I A;  2EMB A;  4IJD A;  2O1W A;  3P3C A;  4KQV A;  2R1F A;  4YY3 I;  4DR1 E;  1ELO A;  2ZIT A;  4MQY A;  2C37 B;  4LF7 E;  3V5R A;  2PO2 B;  1H74 A;  2DLK A;  2UXC E;  2EPC A;  5LMU E;  2EOE A;  3L00 A;  4P78 A;  1OYS A;  2PO0 B;  5C0X E;  3CDJ A;  5ADZ A;  2EPZ A;  2V8P A;  2B7T A;  2DSY A;  3H4L A;  2UU9 I;  4HAC A;  2GLI A;  1J5E E;  1BKN A;  4WUB A;  4FW7 A;  3HQ1 A;  3K17 A;  1UDS A;  2WW4 A;  1N36 I;  2MC5 A;  2A2C A;  1XMO I;  4GQU A;  2EFG A;  4DV2 E;  1NHI A;  3PYE A;  3ZKB A;  2VE7 C;  1Z0T A;  1YYW A;  2E5L E;  3WU5 A;  2EOH A;  1B62 A;  2JR1 A;  4HYM A;  3U1Y A;  1IBM E;  1RQ0 A;  1USV A;  2YTP A;  1RHY A;  2YRK A;  3HJC A;  4DXL A;  1FJG I;  1DAR A;  2MKN A;  2LJU A;  4BS9 A;  1SR9 A;  4GZN C;  2O1U A;  4R2D A;  3CDI A;  2H36 X;  3LML A;  1YUI A;  4LOM A;  1IBK I;  1ZM4 A;  4DV6 E;  2YRH A;  2EE8 A;  2C39 A;  1S16 A;  2G7H A;  2ODR C;  4K0K I;  3DJW A;  4WX9 A;  2BBG A;  1EH7 A;  1NZ0 A;  2IES A;  3T1Y I;  4AM3 A;  1HNW E;  1GQE A;  1HR0 I;  4JI2 I;  1N34 E;  2NPF A;  2A25 A;  5GMD A;  5A2Q C;  3T1H E;  4DV0 E;  4DPX A;  3EPH A;  4IFD F;  4WSG A;  2L6M A;  3KZY A;  5KL7 A;  1HNX E;  4JI4 I;  4MLQ A;  4X8W A;  4DR6 E;  2VQF I;  1HNZ E;  2YZT A;  5IXM B;  5KL5 A;  4DR7 I;  3C4B A;  3TQM A;  3WU3 A;  1WHQ A;  1T4N A;  4LFA E;  5JEA F;  4WXC A;  3J7A M;  2HFU A;  2LMZ A;  2EOM A;  2N3G A;  2V83 A;  2JE6 A;  4IS9 A;  2EOI A;  2N3H A;  4DV5 I;  4IFD D;  1YFH A;  1A1L A;  3L7Z B;  4DV4 E;  1VI7 A;  2IOQ A;  4QNJ A;  2CZ9 A;  1PJT A;  4MYT A;  4DR3 I;  4DR5 I;  2K4V A;  5AE2 A;  2JVA A;  5F3W A;  5JEA D;  2IHR 1;  1YYK A;  1Z5B A;  1FI4 A;  2C37 A;  4DUZ E;  1WHN A;  3HPZ A;  2EN2 A;  4KZS A;  1J26 A;  4DR4 I;  2O1V A;  2DGC A;  4MU1 A;  1Z1B A;  2PO0 A;  3EPK A;  5BR8 E;  2EOQ A;  2HJJ A;  2V87 A;  1K47 A;  4UTG A;  1OYR A;  1NHH A;  1N32 I;  2ZM6 I;  4LF9 E;  1Z5A A;  2MKD A;  1G2D C;  1WJP A;  1XNR I;  2WNR B;  1EH6 A;  3KWR A;  2EN4 A;  5DRO A;  2BA0 G;  1P42 A;  2LBS B;  4R2C A;  5A6B A;  1YH8 A;  4JI5 I;  1H73 A;  2M1S A;  1IBL E;  4BBY A;  2HKE A;  4MU0 A;  3KZZ A;  4WSP A;  5LMN I;  3NZK A;  2RSM A;  4JI3 E;  4LF6 I;  2EN8 A;  2V2Q A;  3P06 A;  1Z0E A;  3JU0 A;  4O43 A;  4HEI A;  1A6F A;  2LE2 A;  4LFA I;  2V88 A;  4JV5 E;  4I8O A;  2BB8 A;  2JEA B;  4DV1 E;  1DQ3 A;  1YSA C;  2XEX A;  5LMU I;  3HXL A;  4JI8 I;  4IFD C;  2YTJ A;  1T4O A;  4FK5 C;  2YT4 A;  4RH8 A;  4NXM E;  1Y6Z A;  4BA1 A;  2R76 A;  1GZ6 A;  2DMY A;  4OOG C;  2GPI A;  2HHH E;  3P3E A;  4GKK E;  5JEA C;  1J5E I;  3CWV A;  4LFB E;  3M6A A;  2MDR A;  4FW9 A;  5AE3 A;  2EMY A;  3ECR A;  1P47 A;  2E5L I;  1SFE A;  2PNL A;  2EPL X;  4DV3 E;  1QZR A;  4IFD B;  5A6K A;  2I13 A;  1IBM I;  2UUB E;  2EM3 A;  2YTE A;  4MDT A;  4KHP I;  2V34 A;  3QT6 A;  1OYP A;  2JEB B;  2R3V A;  1X5W A;  3F0N A;  4DV7 I;  3WU6 A;  2AE8 A;  1PDA A;  1N0U A;  4LTY A;  5DNL A;  2A2D A;  4X64 E;  4B3M E;  4JYA E;  1TF3 A;  1KTV A;  5DNX A;  3J80 C;  2PNZ B;  2YTF A;  2L2N A;  1ZM9 A;  2J7K A;  1N34 I;  4R2R A;  3OML A;  1WRJ A;  2BA1 G;  2V2Z A;  3J81 Q;  1EA6 A;  1XNQ E;  1PVG A;  2JOB A;  1A1H A;  1HNX I;  4X9J A;  1XXE A;  2NN6 A;  4DR6 I;  2EOY A;  4F9B B;  2MC6 A;  4N3O A;  1KKH A;  4WUD A;  1YYO A;  5LLQ A;  4X62 E;  1I94 E;  2UXB E;  2NAB A;  4JI6 E;  1Z0G A;  4KWY A;  5T6J A;  2LUQ A;  1F2I G;  2BR2 A;  1X6E A;  4BC7 A;  2VRD A;  3AUZ A;  1YUJ A;  1YHC A;  3WU4 A;  4USK A;  1Y4U A;  2JOX A;  2NN6 E;  2WP8 A;  4DV4 I;  5L3J A;  4Z7C A;  2I9I A;  5K36 F;  5KL6 A;  2EJ4 A;  1JK2 A;  4P7D A;  2Z5B A;  1N3G A;  2L8T A;  4LF8 E;  4IZJ B;  2EMF A;  2BA0 D;  4NXN E;  2BV3 A;  4JI1 I;  1RC7 A;  4OO1 C;  2EM5 A;  4F9A B;  2EOO A;  2JYA A;  5AAS A;  2WBS A;  1JK1 A;  1HK7 A;  4FW5 A;  1G2F C;  4XTJ A;  2EML A;  3JAM Q;  3M85 G;  2UUA E;  5C0X F;  4O4K A;  3ADL A;  2C38 B;  5K36 D;  5DRP A;  1ZM2 A;  4JI0 E;  2MDG A;  4LF4 E;  1PJS A;  4R2S A;  1WUU A;  1DGC A;  1MU5 A;  1A1J A;  2VF3 A;  3THO B;  1NEI A;  4OZE A;  4OO1 B;  3Q6N A;  3PYD A;  5K36 B;  2K7I A;  2E1R A;  1IBL I;  5C0X D;  3QT8 A;  2EPK X;  4M9V C;  4JI3 I;  2EMC A;  1MG7 A;  2NN6 D;  2YTD A;  1L4S A;  4L5N C;  2J7J A;  3HKM A;  2FGG A;  1S4E A;  2Z5C A;  2EN3 A;  3EPJ A;  3FIG A;  4JV5 I;  4L8N A;  5IT9 C;  1N33 E;  3PS2 A;  2EM2 A;  4RHB B;  2F8B A;  2VES A;  1RRE A;  1ZBQ A;  2EMW A;  4OX9 E;  1N0V C;  4YHH E;  1GTK A;  2KHX A;  2EOZ A;  5FLX C;  1A1I A;  3BBG A;  2ENC A;  1PIE A;  4B3S I;  4AQY I;  1R6M A;  3B8H A;  4R8O A;  1NHJ A;  4JI7 E;  1T39 A;  1FKA E;  4LFB I;  2LTR A;  3QT5 A;  2WBT A;  5KL2 A;  4LFC E;  4DPU A;  2EPP A;  1Z0B A;  4BMJ A;  2PO2 A;  4DV3 I;  2NA2 A;  2EPO A;  3IWC A;  4FW4 A;  1X47 A;  3ADJ A;  2ADR A;  4BHB A;  2UUB I;  4R2A A;  4WUC A;  2HFS A;  4YY3 E;  2ENH A;  4F54 A;  2EPX A;  4X66 E;  2BA1 D;  2O3Z A;  3Q1Q A;  2B9D A;  4LF5 I;  3HTX A;  3M7N G;  4P7A A;  3F6H A;  2EN1 A;  2L2M A;  2JWO A;  3J7Y p;  1ZXN A;  4P52 A;  1UDO A;  3BGH A;  1H72 C;  4DU7 A;  4TUI A;  2B7V A;  2V8Q B;  4DR2 E;  4ISA A;  5C0X C;  4X64 I;  1X6H A;  2EM4 A;  2EQ0 A;  4B3R I;  2EL4 A;  2IOP A;  5IWA I;  2C38 A;  4BA2 B;  3U1K A;  1H7S A;  4WPY A;  4R2P A;  3P3G A;  1R6L A;  4DUY E;  3JTZ A;  4BHC A;  2F1D A;  1XMQ E;  2UXD E;  2CVE A;  2EPM X;  3H1C A;  4DR1 I;  3PYF A;  1X6F A;  4QNK A;  3MHH C;  1A1G A;  1UEK A;  4X62 I;  4LF7 I;  3ADG A;  5C0X B;  1I94 I;  4JI6 I;  2UXB I;  2UXC I;  4M0V A;  1FWL A;  3VYY A;  5AC5 A;  3PS1 A;  4WXD A;  3H09 A;  2RQL A;  2R42 A;  2RPC A;  4DMI A;  2FV4 B;  1ZBT A;  1MX0 A;  4ZYE A;  2V89 A;  5DNY A;  1O0W A;  4IZK B;  1RMD A;  1KYQ A;  4X65 E;  4EMD A;  2EOR A;  2JY9 A;  2LTS A;  2X7I A;  3DD6 A;  4LF8 I;  4OKG A;  2YTN A;  3C6K A;  4HXZ A;  2RS7 A;  4JI2 E;  2EPR A;  3MHS C;  4DV2 I;  2EMI A;  4ZYG A;  1QNT A;  1IMU A;  3VHT B;  4NHR A;  2EMZ A;  2O1T A;  3PRY A;  2HGH A;  1PKP A;  2LCE A;  2HKJ A;  4NBQ A;  3L7Z A;  2EP3 A;  4JI0 I;  1IQO A;  2BM0 A;  2YPN A;  2YSO A;  4JG4 A;  4URL A;  5JEA B;  2EOJ A;  1ZXM A;  4DV6 I;  4LF4 I;  1TF6 A;  4PU9 A;  4DV5 E;  5A6B D;  4FN5 A;  2F4V E;  2EOS A;  1EI1 A;  1X49 A;  2LJH A;  4DR3 E;  2EL6 A;  4DR5 E;  1HNW I;  4WFT A;  1KIJ A;  2C39 B;  1U2R A;  4DV0 I;  3T1H I;  5ELW A;  4DR4 E;  1E3P A;  2WZO A;  2X36 A;  5CFF E;  1B69 A;  2CG9 A;  2EWL A;  2DLQ A;  2WNR A;  4M1K A;  1HNZ I;  4DPT A;  3GLL A;  1E3H A; 
#chains in the Genus database with same CATH homology
 1N32 E;  5A2Q Q;  2GS8 A;  1Y4S A;  3ZKD A;  4DPW A;  4OX9 I;  1DI2 A;  4YHH I;  1XNR E;  4Z7Y A;  2E1M A;  1USU A;  3K1J A;  4M2Z A;  2OI2 A;  2BM1 A;  4JI5 E;  2KOU A;  2ZBK B;  5LMN E;  2EZ6 A;  1H7U A;  2DB2 A;  5FLX Q;  4LF6 E;  4DUZ I;  1YZ9 A;  2UUC E;  3K85 A;  1EKZ A;  2PNM A;  3P1X A;  4MYU A;  2RS6 A;  1VIS A;  5BR8 I;  4FWD A;  3HUL A;  4X66 I;  3Q6M A;  4IZK A;  4LF9 I;  4JI8 E;  2M7Q A;  2LRS A;  4TUG A;  4GKJ E;  4DR2 I;  2NUF A;  3QT7 A;  1ZM3 A;  1T4L B;  2NUG A;  1OJ4 A;  2B3T B;  1Z0C A;  4LU9 A;  4UT4 A;  4BCA A;  4DUY I;  1XMQ I;  4Q28 A;  2UXD I;  3OTO E;  4KHP E;  2VF1 A;  3B82 A;  3ZM7 A;  1UHZ A;  4DV1 I;  3GON A;  4DV7 E;  4NXM I;  2DIX A;  3J81 C;  1Z0W A;  3B78 A;  2HHH I;  5AE1 A;  4X65 I;  4GKK I;  3ZZT A;  2VQE E;  4R03 A;  1KVK A;  2L2K B;  3J7A G;  4RPF A;  4B3T E;  4J8Z A;  3ZZ0 A;  3ADI A;  2CGE A;  3LTO A;  2KON A;  4WYQ B;  1WXR A;  2LUP B;  1FNM A;  4M30 A;  2NUE A;  2V2V A;  4IZJ A;  1FWK A;  2F4V I;  4DKK A;  4HY1 A;  2DEJ A;  4B3M I;  2UU9 E;  4JYA I;  3JAM C;  1X48 A;  1N36 E;  1D6T A;  3LLH A;  1XMO E;  3RMP A;  4JI1 E;  1QU6 A;  4DPY A;  2L33 A;  1XNQ I;  4PRX A;  1Z0V A;  3D4J A;  1RR9 A;  3IWB A;  3J80 Q;  1FJG E;  2HK3 A;  3ZZU A;  3MSW A;  4PRV A;  1XHK A;  2HK2 A;  1IBK E;  2V85 A;  4K0K E;  2AJ4 A;  3T1Y E;  2L3J A;  4GEQ B;  3PYG A;  2FTX B;  1HR0 E;  2Z5E A;  2L92 A;  4NXN I;  2UUC I;  4FWG A;  2Z5B B;  4HAC B;  4ZVI A;  4JI4 E;  2V86 A;  4USM A;  4F9C B;  3DF6 A;  2VQF E;  4DR7 E;  2UUA I;  2Q2E B;  4ED4 A;  5LL6 R;  4IZJ D;  4I3H A;  3AV0 A;  3V2U C;  4GKJ I;  4B3S E;  4AQY E;  1Z5C A;  1B63 A;  4DU8 A;  3VK6 A;  4R1F A;  2CPN A;  5FWK A;  1N33 I;  3OTO I;  2DEI A;  4FWH A;  2GQ0 A;  2ZM6 E;  1STU A;  4LF5 E;  3VYX A;  2Z5C B;  4BC9 A;  3HPS A;  5IT9 Q;  2L3C A;  2LJP A;  2RTX A;  3LPS A;  3ZOQ B;  2ODR D;  5GME A;  3IWD A;  2VQE I;  4JI7 I;  4B3R E;  3LNU A;  5IWA E;  1Z59 A;  3K6Q A;  4LFC I;  4B3T I;  3C4T A;  3F6G A;  1UIL A;  2M4I A;  4KQV A;  2O1W A;  4YY3 I;  4DR1 E;  1ELO A;  2ZIT A;  4LF7 E;  3V5R A;  1H74 A;  2UXC E;  5LMU E;  4P78 A;  5ADZ A;  2V8P A;  2B7T A;  2DSY A;  3H4L A;  2UU9 I;  4HAC A;  1J5E E;  1BKN A;  4WUB A;  3HQ1 A;  3K17 A;  2WW4 A;  1N36 I;  2MC5 A;  2A2C A;  1XMO I;  2EFG A;  4DV2 E;  1NHI A;  3PYE A;  3ZKB A;  2VE7 C;  1Z0T A;  1YYW A;  2E5L E;  3WU5 A;  1B62 A;  2JR1 A;  4HYM A;  1IBM E;  1RQ0 A;  1USV A;  3HJC A;  1FJG I;  1DAR A;  4BS9 A;  1SR9 A;  2O1U A;  2H36 X;  3LML A;  1IBK I;  1ZM4 A;  4DV6 E;  1S16 A;  2G7H A;  2ODR C;  4K0K I;  3DJW A;  3T1Y I;  1NZ0 A;  1HNW E;  1GQE A;  1HR0 I;  4JI2 I;  1N34 E;  2NPF A;  5GMD A;  5A2Q C;  3T1H E;  4DV0 E;  4DPX A;  2L6M A;  1HNX E;  4JI4 I;  4X8W A;  4DR6 E;  2VQF I;  1HNZ E;  2YZT A;  4DR7 I;  3C4B A;  3WU3 A;  1WHQ A;  1T4N A;  4LFA E;  3J7A M;  2HFU A;  2LMZ A;  2N3G A;  2V83 A;  2N3H A;  4DV5 I;  4DV4 E;  2IOQ A;  2CZ9 A;  4MYT A;  4DR3 I;  4DR5 I;  2K4V A;  5AE2 A;  2JVA A;  5F3W A;  2IHR 1;  1YYK A;  1Z5B A;  1FI4 A;  4DUZ E;  1WHN A;  3HPZ A;  4KZS A;  1J26 A;  4DR4 I;  2O1V A;  5BR8 E;  2V87 A;  1K47 A;  4UTG A;  1NHH A;  1N32 I;  2ZM6 I;  4LF9 E;  1Z5A A;  1XNR I;  3KWR A;  2LBS B;  4JI5 I;  1H73 A;  2M1S A;  1IBL E;  4BBY A;  2HKE A;  5LMN I;  4WSP A;  2RSM A;  4JI3 E;  4LF6 I;  2V2Q A;  3P06 A;  1Z0E A;  3JU0 A;  1A6F A;  2LE2 A;  2V88 A;  4JV5 E;  4I8O A;  4DV1 E;  1DQ3 A;  2XEX A;  5LMU I;  3HXL A;  4JI8 I;  1T4O A;  2YT4 A;  1Y6Z A;  4NXM E;  1GZ6 A;  2DMY A;  4OOG C;  2HHH E;  4GKK E;  1J5E I;  3CWV A;  4LFB E;  3M6A A;  2MDR A;  4FW9 A;  5AE3 A;  2E5L I;  2PNL A;  4DV3 E;  1QZR A;  1IBM I;  2UUB E;  4KHP I;  3QT6 A;  2R3V A;  4DV7 I;  3F0N A;  3WU6 A;  1N0U A;  4LTY A;  2A2D A;  4X64 E;  4B3M E;  4JYA E;  1KTV A;  3J80 C;  2L2N A;  1ZM9 A;  2J7K A;  1N34 I;  3OML A;  2V2Z A;  3J81 Q;  1EA6 A;  1XNQ E;  1PVG A;  2JOB A;  1HNX I;  4DR6 I;  4F9B B;  2MC6 A;  4N3O A;  1KKH A;  4WUD A;  1YYO A;  4X62 E;  2UXB E;  1I94 E;  2V34 A;  1Z0G A;  4JI6 E;  4LFA I;  5T6J A;  2LUQ A;  4BC7 A;  3AUZ A;  3WU4 A;  4USK A;  1Y4U A;  2JOX A;  4DV4 I;  5L3J A;  4Z7C A;  4P7D A;  2Z5B A;  2L8T A;  4LF8 E;  4IZJ B;  4NXN E;  2BV3 A;  4JI1 I;  1RC7 A;  4F9A B;  5AAS A;  4XTJ A;  1HK7 A;  3JAM Q;  2UUA E;  3ADL A;  1ZM2 A;  4JI0 E;  4LF4 E;  1WUU A;  2VF3 A;  1MU5 A;  3Q6N A;  3PYD A;  2E1R A;  1IBL I;  3QT8 A;  4JI3 I;  1MG7 A;  4L5N C;  2FGG A;  1S4E A;  2Z5C A;  3FIG A;  4JV5 I;  4L8N A;  5IT9 C;  1N33 E;  2F8B A;  1RRE A;  1ZBQ A;  4OX9 E;  1N0V C;  4YHH E;  2KHX A;  5FLX C;  1PIE A;  4B3S I;  4AQY I;  3B8H A;  4R8O A;  1NHJ A;  4JI7 E;  1FKA E;  4LFB I;  2LTR A;  3QT5 A;  4LFC E;  4DPU A;  1Z0B A;  4BMJ A;  4DV3 I;  2NA2 A;  3IWC A;  1X47 A;  3ADJ A;  2UUB I;  4WUC A;  2HFS A;  4YY3 E;  3Q1Q A;  4F54 A;  4X66 E;  2B9D A;  4LF5 I;  3HTX A;  4P7A A;  3F6H A;  2L2M A;  2JWO A;  3J7Y p;  1ZXN A;  4P52 A;  1H72 C;  4DU7 A;  4TUI A;  2B7V A;  2V8Q B;  4DR2 E;  4X64 I;  4B3R I;  2IOP A;  5IWA I;  1H7S A;  4WPY A;  4DUY E;  3JTZ A;  1XMQ E;  2UXD E;  4DR1 I;  3PYF A;  1UEK A;  4X62 I;  4LF7 I;  3ADG A;  1I94 I;  2UXB I;  4JI6 I;  2UXC I;  4M0V A;  1FWL A;  3VYY A;  3H09 A;  2R42 A;  4DMI A;  1MX0 A;  2FV4 B;  1ZBT A;  4IZK B;  5DNY A;  2V89 A;  4DXL A;  1O0W A;  4X65 E;  4EMD A;  2JY9 A;  2LTS A;  2X7I A;  4LF8 I;  4HXZ A;  2RS7 A;  4JI2 E;  4DV2 I;  2O1T A;  3PRY A;  1PKP A;  2HKJ A;  4JI0 I;  2BM0 A;  4URL A;  4JG4 A;  1ZXM A;  4DV6 I;  4LF4 I;  4PU9 A;  4DV5 E;  4FN5 A;  2F4V E;  1EI1 A;  1X49 A;  2LJH A;  4DR3 E;  4DR5 E;  1HNW I;  4WFT A;  1KIJ A;  1U2R A;  4DV0 I;  3T1H I;  4DR4 E;  2WZO A;  2X36 A;  5CFF E;  2CG9 A;  2EWL A;  1HNZ I;  4M1K A;  4DPT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...