3OTPA

Crystal structure of the degp dodecamer with a model substrate
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
440
structure length
381
Chain Sequence
AQQMPSLAPMLEKVMPSVVSINVEQKFMALGSGVIIDADKGYVVTNNHVVDNATVIKVQLSDGRKFDAKMVGKDPRSDIALIQIQNPKNLTAIKMADSDALRVGDYTVAIGNPFGLGETVTSGIVSALGRSGLNAENYENFIQTDAAINRGNAGGALVNLNGELIGINTAILAPDGGNIGIGFAIPSNMVKNLTSQMVEYGQVKRGELGIMGTELNSELAKAMKVDAQRGAFVSQVLPNSSAAKAGIKAGDVITSLNGKPISSFAALRAQVGTMPVGSKLTLGLLRDGKQVNVNLELQQSFNGIEGAEMSNKGKDQGVVVNNVKTGTPAAQIGLKKGDVIIGANQQAVKNIAELRKVLDSKPSVLALNIQRGDSTIYLLMQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protease do
publication title Covalent Linkage of Distinct Substrate Degrons Controls Assembly and Disassembly of DegP Proteolytic Cages.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 81
structure length 381
sequence length 440
chains with identical sequence B, C, D, E, F
ec nomenclature ec 3.4.21.107: Peptidase Do.
pdb deposition date 2010-09-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00595 PDZ PDZ domain
A PF13365 Trypsin_2 Trypsin-like peptidase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 3otpA02
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 3otpA03
2.40.10.120 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 3otpA01
1B8QA 2QKVA 1V5QA 2KOJA 2I1NA 3MH7A 2O8MA 1Q7XA 4R2ZA 3HPMA 2JOAA 1GQ4A 2LOBA 3O8DA 4WH6A 2XNIA 3SU4A 2F9UA 4RI0A 4O06A 4JOPA 3PS4A 1V5LA 1P1EA 4F8KA 2VWRA 4OM9A 2LA8A 3RC5A 3PV5A 3QIKA 1QAVB 4G69A 2W4FA 2I0IA 5EQRA 1VA8A 2PDZA 4B75A 2QKUA 3LNXA 4PQWA 1NF3C 3GJ9A 2M0VA 2IJD1 3DJ1A 2ZPLA 1NS3A 1RY4A 3SHWA 2M10A 2OS6A 4HOPA 1NTEA 1M5ZA 1GM1A 2ZPMA 4B74A 5HETA 1YBOA 2OCSA 1UEWA 3CC0A 5E11A 2KAWA 5IDKA 2M3MA 2M0ZA 1GQ5A 3RL7A 5F3XA 2OMJA 3O8BA 1BT7A 5EYZA 2EGNA 1N6EA 3SUEA 2WZQA 2F0AA 4A92A 1WH1A 2H3MA 2Q3GA 2UZCA 2JIKA 2XCNA 3OU0A 5HEBA 3FY5A 1ZOKA 3B76A 5EPYA 5ETXA 2IWQA 2D92A 4KFWA 1DY9A 2AINA 1VAEA 4REYA 3RC6A 3PDZA 3I18A 2D90A 2KPLA 2GGVB 5HEDA 4WYTA 2O2TA 1X5QA 3JXTA 5B6LA 5GNDA 1ZUBA 2GZVA 3PV2A 1RTLA 3MH6A 4HOPB 2CSJA 5HF1A 1OBXA 5HFFA 1KWAA 2G5MB 1VJ6A 2P59A 2LC6A 2KYLA 3OTPA 4JOEA 3SHUA 4I31A 4WH8A 2H2CA 2RRMA 3KHFA 4Q2QA 4OEOA 5E22A 4Q2OA 2I0LA 1W9QA 3P8NA 3WKLA 2PKUA 4NXQA 1MFLA 1Q3PA 3BPUA 2QKTA 2K20A 4GHNA 5D13A 3NGHA 4NMOA 3K1RA 5JXBA 2A4QA 1WI4A 5ESBA 3TSWA 3GGEA 2OC7A 4B6EA 2EV8A 2LC7A 3WKMA 1RZXA 3ZRTA 4UU5A 3SUGA 2IWPA 2DLUA 1OBZA 3O5NA 3TSZA 1TE0A 4JL7A 2OC8A 1UJUA 4XHVA 5HF4A 3QE1A 4U01A 5DTHA 1UM1A 4B76A 1WF7A 1Z87A 1UJVA 1Y7NA 4A1XA 2OZFA 5EPNA 1UHPA 3I4WA 2CSSA 2WL7A 2K1ZA 3O46A 2JINA 3QDOA 2FM2A 3KZEA 4UU6A 1UITA 2VSVA 4NMVA 5H3JA 3RC4A 1L6OA 3SOEA 2EJYA 2I04A 2OQSA 4OAJA 3EGHC 4YDPA 2AWUA 4JOKA 2YTWA 3SV8A 2EDZA 1N99A 4NWKA 4AMHA 3TMHA 4NMTA 5H4IB 1N1LA 3QJNA 2KJPA 3DJ3A 3AXAA 3AK5A 2A4GA 2DAZA 2DJTA 2PA1A 1KY9A 1U37A 4P2AB 3GCOA 2YOLA 1RGQA 3M5LA 2KJDA 1V62A 1CU1A 1WXRA 3SZEA 2EDPA 3QO6A 2QV1A 5FB8C 3P8OA 5EQQA 1KEFA 4Q2NA 1N6DA 3R0HA 2DKRA 4B73A 2PKTA 1G9OA 2YT8A 1N7EA 2YT7A 1SOTA 2OPGA 5GLJA 2OC1A 4B71A 4GVDA 2R4HA 2V1WA 3SU5A 4IC6A 3LKWA 3TSVA 2EAQA 4JOHA 3QGLA 2CS5A 2KA9A 2KRGA 4L8NA 1UEQA 2OK5A 1WJLA 2HE4A 2G2LA 2XCFA 1X6DA 2L4SA 2KPKA 3U1IB 3CBYA 5HFEA 2EGKA 2DB5A 5F67A 1LCYA 5EZ0A 4NNLA 1N7TA 3SYJA 3VQFA 3L6PA 1RGWA 5HEYA 3GDSA 4TYDA 3SUDA 4K6YA 3R69A 2OC0A 2DM8A 2Z9IA 2FE5A 3GDVA 1TP5A 3KNXA 3CS0A 2KQFA 3CBXA 3QJMA 1DY8A 4A1TA 1N7FA 2OINA 4NWLA 2I6VA 1X5NA 1U39A 2YUBA 2MHOA 2VPHA 2VZ5A 1RGRA 3KN2A 2EDVA 2GVFA 2BYGA 1JXPA 2F9VA 3DORA 4GVCA 2FNEA 2A4RA 4K75A 2X7ZA 1QAUA 2F4LA 3CYYA 4MPAA 3KEEA 5FPSA 5E1YA 3NFLA 2FOMB 4NMQA 1IU0A 5HFBA 3HPKA 5E6PB 2WHXA 2HE2A 3K50A 2EEGA 1VB7A 1K32A 2FCFA 3SU0A 2AWXA 1BE9A 3VQGA 1W9EA 3O8CA 1A1RA 1U3BA 4NMSA 2R3YA 2JREA 3M5OA 2DMZA 2OSGA 4I33A 2OBOA 4JOGA 1UEZA 2DLSA 5A2PA 1Q3OA 3ID3A 3PV4A 2DC2A 2EEHA 4KTCA 1WFGA 2OGPA 3KF2A 4FGMA 1UF1A 3RL8A 4Q6HA 4NNMA 1V6BA 3GSLA 2P3WA 5HFCA 4JOFA 5G1DA 2REYA 4N6XA 2AWWA 3SV7A 2IJOB 3STJA 3ID2A 1Z86A 2KOMA 2YUYA 5GJ4B 2PNTA 2EXGA 3GDUA 5T1VA 1FC6A 3O8RA 4JOJA 2K1QA 5GPIB 2EHRA 3SU1A 1W9OA 2JWEA 2KL1A 3ID1A 1WIFA 2EEIA 4KFVA 4E35A 1FC7A 1T2MA 2QBWA 1UM7A 1DXPA 3LOXA 1WI2A 4I32A 4K72A 3LONA 4JORA 1OBYA 3SV9A 2I4SA 2M0UA 1DXWA 1VCWA 3RLEA 2VSPA 4Q6SA 4LMMA 4K8BA 1FCFA 3OYPA 1TP3A 2PZDA 4WYUA 2EEJA 1QLCA 5EQSA 5FHTA 3PDVA 2KOHA 4EDJA 2QG1A 2Q9VA 1X45A 2FN5A 2H3LA 4Z33A 3K82A 1N6FA 1V1TA 2ENOA 2KBSA 1IHJA 3I1EA 4NMPA 1XZ9A 3ID4A 5I7ZA 3R68A 4OEPA 4E34A 2VRFA 4H11A 3H09A 2JXOA 5HJ1A 2QT5A 5FPTA 3E17A 2KV8A 2EGOA 1WHDA 2HGAA 3EYDA 3NFKA 1X5RA 2L4TA 3SFJA 2L97A 5HFDA 1IU2A 2RCZA 2FP7B 5FPYA 3SU6A 3EGGC 3U1JB 4Z8JA 3DJAA 1FC9A 2KJKA 4NXPA 2IWOA 3CH8A 1PDRA 4NXRA 4JMYA 2W7RA 2IWNA 1OZIA 2VBCA 1I92A 3KZDA 4E3BA 1Y8TA 3GCNA 1UFXA 4K76A 1R6JA 3DIWA 3CBZA 2OBQA 3LNYA 2V90A 2M0TA 3E90B 1SOZA 3L4FD 5HDYA 3SU2A 3SV6A 1MC7A 4R8TB 2D8IA 3SUFA 5G1EA 1WFVA 1MFGA 2F5YA 4Q2PA 1W3CA 1WHAA 1QAVA 3M5NA 4M9FA 3HVQC 1P1DA 1U38A 2JILA 3SU3A 2MX6A 4Q3HA 3SUZA 4WF8A 3MH4A 4B6FA 2E7KA 4NMRA 2Z17A 2WV9A 2KG2A 2H2BA 1WG6A 4P0CA 1BFEA 1WF8A 1X8SA 1TQ3A 2LUIA 1UEPA 1UJDA 1I16A 3M5MA 4YYXA 4K78A 5E21A 4A1VA 1D5GA
chains in the Genus database with same CATH superfamily
4J2YB 4MG3A 2LPRA 4OS4A 3MH7A 3A7WA 1WTGH 1QRXA 4TWWA 1HFDA 4Y0YE 1D3DB 2F91A 4NG9H 1SL3A 2YMSD 4TPYA 2JOAA 1GQ4A 1ZGIA 3O8DA 3SU4A 2C8XB 1QRWA 2HVXA 4O06A 4JOPA 1V5LA 1P1EA 1EQ9A 4F8KA 1SC8U 4JCNA 1WUNH 1QL9A 2FTMA 2VVVA 3HK6B 4K5ZA 2QF5A 1YPJH 2ZGJA 2W4FA 1JIRA 2R2WU 2BMGB 3QWCH 1VA8A 3LGUA 1RS0A 4WMEA 4GSOA 2PGQB 2QKUA 3E3TA 2ZPLA 1IQGA 3VGCC 6CHAC 2W6JD 5AHGH 2M10A 2OS6A 1EP5A 2ZPMA 4YT7H 2ZC9H 1YPHC 1ZPZA 2H5DA 1VKYA 4HFPB 4BNRA 2BD7A 4AZ2B 1YBOA 1FUJA 1HIAB 6LPRA 1ZZZA 5IDKA 2M3MA 2VWMA 2CJIA 2FOGA 5GXPA 4Q80A 1XKBC 1O3PB 3U28C 2ZDVH 1YCPM 1A4WH 4CH2B 5C3NA 4AC9A 1N6EA 5ILBA 1LPKB 1AKSB 1E37B 1DDJA 1YM0A 1BCUH 2YMSB 1WH1A 2EI8A 1KXDA 4D9RA 1OYQA 2G81E 5HEBA 2KCYA 1T8MA 4JZFH 5FAHA 1ZOKA 2HPQH 1W0ZU 4KFWA 1XX9A 3GY4A 1DY9A 1GG6B 1RXPA 4REYA 1VAEA 3H5CB 2VVUA 1QB6A 3ENSB 2KPLA 1L0ZA 3JXTA 1V2MT 3WWBA 1C5XB 1DVAH 1D3QB 4X1QU 1ZUBA 1UCYH 2P3TB 1RTLA 2CSJA 1C1VH 1TLDA 2XBWA 3RXGA 3MQKC 2KYLA 2UUJB 4I31A 3CNRA 4NIWA 1GI6A 4X2VA 3U98H 1BIOA 3S9BA 1NY22 5ESTE 1D3PB 1O3HA 3PWCA 1BRBE 3FFGA 2FS8A 2YNBA 2LNCA 1ACBE 1BITA 1N8OC 1Z6EA 2I0LA 3TK6A 1C4Y2 2ZTXA 5HXFA 2GMTC 1O2UA 3RXJA 1UVPA 2CGAA 1GHZA 1FIZA 2SGDE 5DG6A 1EJNA 2VJ1A 4O9VA 5C20A 1AVWA 3BPUA 2QKTA 5JBBS 2ZHFH 4CBNA 1YPHE 2F43B 4NMOA 2STBE 3K1RA 1W0KD 3BTME 4B6EA 4E05H 5LGOA 2PR3A 2LC7A 1E1QD 1RZXA 2AMDA 1UTMA 1W0JD 2VVCA 5J4QA 4JL7A 1GI7B 1JRTA 1C2DA 1T8NA 4B76A 1KMHB 3SQHE 1MTNB 3TH2H 3RXQA 3BG4C 4GHTA 5EPNA 1UHPA 4BAOB 2CSSA 2WL7A 2NWNA 1TQ7B 1WAYB 3PO1B 1F92A 1BTPA 2RG3A 4A5TS 3QDOA 3LC3A 1NFXA 3NK8A 4X6NA 4I8JA 3SOEA 2EJYA 2AS9A 2OQSA 1BB0B 2AH4X 3T2NA 3SBKA 4JOKA 4SGAE 1C5SA 4ZHAA 2JKHA 3ZV9A 4MDSA 3TMHA 4Q7YA 1G3EA 2ZFFH 3QJNA 3DJ3A 4JJ0A 3AXAA 3AK5A 2A4GA 5F8XA 2DJTA 4NFFA 4XDEA 1KY9A 4P2AB 1PPEE 3GCOA 1P11E 4ISLA 4TY7A 1GI4A 4GUXA 4Y0ZE 2YOLA 5F6MA 2KJDA 2BDAA 2EDPA 3QO6A 3RXHA 5FCKA 4ZAEA 1G9OA 2YT8A 3Q00A 1SOTA 2UWOA 2PUQH 1ZPBA 2OC1A 3K6ZA 2VWLA 1FAKH 2QGRA 2V1WA 1GI1A 3AAVA 1MTVA 4JYUH 2SGPE 2C93B 5HM2A 1P9SA 1JRSA 3PWBA 3QGLA 1NRQH 2C3SA 5T6DA 5F53A 1G2MA 2ZQ1A 2STAE 2ZTYA 2HE4A 2C90B 2G2LA 2L4SA 2K0QA 1X9ZA 1O3FA 3U1IB 3CBYA 1HXEH 5EU8A 4I8GA 5EZ0A 1GJ8B 1QJ1B 1V2OT 2F83A 2WPHS 2HGTH 1N7TA 3VQFA 2L6OA 3A8BA 4H4FA 1FI8A 3NCVA 4D9QA 5JB9S 5HEYA 2F9NA 4DT7B 1WTHD 1GJ9B 2XNDD 5J4SA 2Z9JA 1O3IA 1YP9A 2DM8A 1C2MA 1P2NA 2H6MA 2UUYA 1LHFH 1C5LH 2SGQE 2KQFA 4A1TA 3QJMA 4BXSA 2ZDNA 3ZVAA 1GJCB 2I6VA 1U39A 2MHOA 1XVOA 1O2KA 2GJGA 5TJXA 1ABIH 1RGRA 3HKJB 3KN2A 2EDVA 1PPHE 4WXIA 1IQHA 1TNHA 3MH5A 1IQIA 2SNVA 3RXOA 4CHAB 4ZXYH 1A5HA 3SGAE 5DP6A 3MO9A 2J98A 4O3UA 4NIVA 3GCTG 6GCHF 1QTFA 4K75A 1O2XA 1ELAA 1CBWC 2QC2A 3VXFH 1P2IA 1SHYA 1ZMJA 4ZKOU 1X7AC 2J4IA 3ZZ3A 1V2KT 4MPAA 2BVXH 2WUCA 2VB0A 5DP4A 4YLQH 1O31A 1SGPE 5GCHF 1MCVA 4FUBA 4TY6A 2HE2A 2G52A 4UFGH 4UD9H 1QL7A 1Y5AT 2EA3A 2FI4E 2DE8A 1GVZA 2FEQH 2AWXA 1DE7H 1F5KU 1W9EA 3O8CA 4XD7D 1RFNA 5JPMH 3MO3A 1PPZA 5C1XA 1AWFH 4FLNA 1U3BA 1PYTC 1OWJA 2R3YA 3UQVA 4CRCA 2OSGA 1BMAA 4HZHA 1GDUA 4U30A 3TH3H 2OBOA 2J9NA 1K2I1 2DLSA 4YM9A 2QCYA 1Q3OA 3Q76A 5EOKA 3Q3YA 3PV4A 3DSGA 2EEHA 1H9IE 1WFGA 2OGPA 1QB1A 3FO8D 2RA0A 5HM9A 1WU1A 4FGMA 1ANCA 3RL8A 2HOBA 4X8SH 4Q6HA 3TITA 2H9HA 2A31A 1V6BA 3QK1A 1Z8JB 3GSLA 4RT1A 1K1NA 1NRSH 4X2WA 2HRVA 1E34B 2REYA 1O5FH 2JSNA 4HTCH 2AWWA 2A5IA 4UFEH 3UUZA 3SV7A 1BMMH 1FY4A 1ZSKA 3A7ZA 1AFQC 1DWBH 1P2JA 5T1VA 3AW0A 2PTNA 1W9OA 2ZU2A 1JBUH 1ELVA 1OWHA 3SI3H 1WIFA 3SJIA 4CRGA 1GJ7B 4E35A 1O2MA 2J38A 1P2QA 1ZLRA 3DHKH 4DJZB 1SQTA 1DXPA 1UVSH 4JORA 1OBYA 2ZO3H 5DN6D 3EA9A 3ZVEA 1HAPH 2M0UA 1ZJKA 1VCWA 1NFYA 1GMHG 2VWOA 1F5RA 4MNVA 4LMMA 1XUGA 3OYPA 4CR9A 1AD8H 1GBHA 3FAOA 2FOAA 3RXCA 1QLCA 1BTWA 1SLWB 2ZF0H 1DWCH 5EXLA 1LVBA 2FN5A 1KXAA 4Z33A 3DD2H 1HJAC 5JYIA 2GTBA 4NZQA 2VIDA 1B0FA 4QT8C 1ETTH 3RMLH 2KBSA 3URDA 4NMPA 1XZ9A 1XVMA 5I7ZA 1AN1E 2CF8H 5C1UA 4OEPA 1QQ4A 4E34A 1HXFH 2LELA 1LHGH 5HJ1A 3BG8A 1GHBG 5DKMA 2HNTC 4JK6A 1D4PB 2D1JA 4AG2A 4ZKRU 2BXUH 2XOKD 2SGAA 3FOAA 1MU8B 3M7QA 1IU2A 4IMQA 1YC0A 2V3OH 3MOCA 1BUIA 1O3JA 1O39A 2VIWA 3UPEA 3ZVCA 5KECA 1ELEE 1HRTH 1HAXB 1LQEA 4YTAA 1FC9A 1EPTA 2IWOA 3CH8A 5I46H 4NXRA 3MFJA 2VBCA 3ZZ6A 1QNJA 4AFZA 1SBWA 2QE7D 4B1TA 1TBQH 1CHOG 3RXVA 3ZZDA 1V2JT 1GI3A 2J5UA 8GCHF 1W8BH 1UVOA 2GV7A 2JJ1D 1FIWA 1DANH 1WQSA 2Q6GA 4ZKNU 1O2LA 1F2SE 1S6LA 1AB9B 5JBTA 4R8TB 2B8OH 2FXRA 5B6OA 1O2TA 2THFB 5G1EA 1WFVA 1H8HD 2JJ2D 1WHAA 2A7HA 2ZTZA 1O5DH 3PLBA 1RIWC 2JILA 5JBAS 1QZ8A 3OY6U 1GBIA 4WVPE 2MX6A 2ZFSA 3U8TH 1AZZA 1TX7A 4WF8A 1BBRK 2E7KA 2QN5T 1P03A 1P09A 2JETC 2WV9A 1BRAA 1GCTB 3BIUH 1P2MA 1H9LB 2H2BA 1DSUA 3UR6A 3ZZ5A 1WF8A 1GDQA 4Q4LA 1OWIA 4ABAA 1IQJA 3BTDE 4ABBA 4K78A 1GBKA 1DFPA 1YCPH 2FI5E 2B5TB 3PTBA 4A1VA 2GKVE 3MMGA 2UUFB 5DP5A 2KOJA 4FU9A 1T32A 1AWHB 4X2YA 3AASA 1Q7XA 2EY4C 1TYNA 2ZGXH 3M3VA 1C5PA 8ESTE 3QLPH 2HNTE 4FETA 5G4BA 1F0TA 2BD8A 3HPMA 1XMNB 1ARCA 1IQNA 1BTHH 5DP7A 2F9UA 4Y76A 2FWWA 8LPRA 2ZQ2A 5LPEA 3VB4A 1A61H 2WUBA 1G36A 2VWRA 3BIVH 3N99A 4OM9A 3S0NA 4MPUA 1FY1A 4WMFA 3UWJH 2LA8A 1BBRE 4G69A 3FP6E 3RLYH 1H1BA 2PDZA 3UAIC 1P2KA 3SN8A 1SG8B 3L3TA 5HIZA 4PQWA 1NF3C 3UREA 2M0VA 2XTTB 1ANBA 2IJD1 3P95A 1XXDA 1EB2A 1IQLA 1TNKA 2FDAA 3OY5U 1HAYB 1RY4A 2QA9E 3SHWA 3GCHB 1ARBA 2XC0A 2KAIB 3TK9A 1EFRD 1NTEA 1M5ZA 1W12U 2BX3A 3RXTA 3QN7A 1Z7KA 4ABHA 1AFEH 4KKDA 2OCSA 4Y8YA 2NU4E 1ZJDA 2KAWA 3FP8E 5F3XA 3A85A 4DG4A 5FX6A 1BT7A 4ABFA 1YPMH 4XBDA 1HAVA 4GCHG 1EOJA 2A4OA 2OQ5A 2WZQA 3UOPA 1FY5A 4A92A 3UIRA 7GCHF 1FQ3A 2FLRH 2WYGA 2WPDD 2UZCA 1MUEB 1VR1H 1NRNH 2XCNA 3B76A 5EPYA 4FUIA 1RRKA 3BEIB 4UE7H 1V2WT 3V0XA 5JB8S 3PDZA 2BOHB 2H1UA 4TT3D 2D90A 1A46H 2GGVB 1ELDE 3ZIAD 1X5QA 1MKWK 5GNDA 2BX4A 4LOYH 3K65B 3PV2A 1PPBH 2GP9B 5L2YH 3SHCH 1C5WB 1O2NA 2TRMA 3S9AA 3OTPA 3RXRA 4NFEA 1GI0A 3F9GA 2BD4A 5A09A 2ZHDA 4D7GA 1ZSLA 1V2TT 1PQAA 1DM4B 1ZHMA 4OEOA 1EZSC 1UCYK 3FANA 1G3DA 1Q31A 3UNQA 1W9QA 1MU6B 3P8NA 2PKUA 1O5BB 3A7XA 4HGCA 3BEUA 3F68H 2FYQA 1TAWA 4VGCB 1ANDA 4OS2A 1MQ5A 1PPCE 2K20A 3RXAA 4ABGA 1QR3E 3SI4H 2QF4A 5DK1A 2QYIA 2O9QA 1O3AA 5JXBA 1AIXH 1LMWB 1ZMNA 5ESBA 2ANKH 2OC7A 1K28D 1LTOA 2EV8A 3E8LA 3T27A 1C5VA 3LH3A 3WKMA 3GYMA 3TGKE 1EZXC 5E8EH 4UU5A 2W3IA 3SUGA 2DLUA 1TE0A 3EQ0H 2FTLE 2XXLA 5T3HA 3QE1A 1CA0C 1THPB 5DTHA 1TMBH 1VITG 1DPOA 5T6FA 4ESTE 1WF7A 1UCYE 2W26A 3KQDA 1UJVA 4A7IB 4AN7A 2C8YB 4A1XA 1XUJA 3A8DA 1PQ7A 3Q3KA 1Q2WA 1GBCA 2ZHQH 2K1ZA 2WV5A 2P95A 3TNSA 5A0AE 3O46A 4DIIH 1FY3A 2A5AA 5B42A 3KZEA 1P05A 1UITA 2Q6FA 4BAKB 2A45B 4E7RG 5TCCA 1BOQA 3AAUA 3RDZA 1G32B 2PV9B 4OAJA 2AWUA 1EAXA 1S83A 2VIOA 3EE0B 3SV8A 4YOIA 3WW7A 2EDZA 1N99A 1YF4A 2RA3A 3CENA 4AMHA 1ZTJA 4NWKA 3SJOA 1UJ1A 2FOHA 3UY9A 2WPJS 5H4IB 1N1LA 2W5EA 2KJPA 3S69A 1L4ZA 2GZ7A 1GPZA 2M5TA 1AE8H 1SHHB 3CS7A 3QTVH 5FX5A 1U37A 2AGEX 4E7NA 3M5LA 5FL7D 1XUFA 3ZVFA 1WXRA 1NU7B 4WJG2 2XBVA 4O97A 2BXTH 5FB8C 1O2QA 3P8OA 1KEFA 1N6DA 3R0HA 2YMSC 1LPGB 4B73A 1N7EA 2ZHEH 2OPGA 1A3EH 3VB3A 1C2HA 4GVDA 3NPSA 4CRBA 1ZYOA 5EG4A 1GG6C 2EAQA 1SLUB 1QURH 4JOHA 5E0GA 4GVUA 1MKWH 3T25A 2KA9A 1O5GH 1TOCB 4NA7A 1LHEH 2J94A 1VGCB 3BTTE 1B7XB 2ASUB 2XCFA 6CHAB 1YLCA 2BOKA 2CV3A 2OLGA 2A5KA 5LPRA 1KTTB 5FBEA 2EGKA 2ZFQH 2P94A 1COWD 7ESTE 4D8NA 3C1KA 4X6MA 2F9OA 5C0UA 1AI8H 4YESB 2Z7FE 3ODFA 4NNLA 3SYJA 3W1EA 2BZAA 2BYAX 3L6PA 3KDKA 3JZ1B 2XW9A 1FY8E 3ZZ4A 1V2LT 2RDEA 3TIUA 1J9CH 3R69A 1O35A 3MI4A 1C2JA 2FLBH 2Z9IA 1YGCH 2AYWA 2PSXA 3KNXA 1BTZA 3CS0A 2LP6A 2PGBB 2CHAC 3CBXA 1TRNA 2W7UA 4NIYA 1ZR0A 1CQQA 2ESTE 2BQ7B 1BMNH 1Y3XA 3RXBA 4ISOA 2VZ5A 1FAXA 4HG6A 1YYY1 4U2WA 1UTNA 3A8CA 3E1XB 2JH6D 2WINI 3RXUA 2XC5A 4ACBA 1KXFA 1TFXA 3S7KB 5I25A 2X7ZA 2PWXA 4X1SU 3EAJA 4IMZA 4FOUC 3OSYA 2F4LA 2FODA 1JMOH 2RDLA 1NROH 1ZHPA 2SNWA 1TMUH 4AB8A 1MTNC 2GT8A 3NFLA 3I77A 5HFBA 2ODPA 3MNBA 3MU1A 3HPKA 4AYYB 4H6SB 1TGCA 2Y5HA 3K50A 1BQYA 5AF9H 3V12A 3PO1C 1BE9A 3FN8A 1FJSA 5LPFA 2Z3CA 4NMSA 1DWDH 1TPPA 3A80A 5HMAA 1F5LA 2P3UB 2OXSA 2ZA5A 4OGXA 1Y3UA 1C1WH 2PFEA 5A2PA 2KX4A 1S81A 1QIXB 3AVZA 2DC2A 1DOJA 1DSTA 2GT7A 1YY3A 1V2UT 1UF1A 1FLEE 2G51A 1UHBA 4LZ1H 1SFQB 4NNMA 1G37A 2J98B 1AY6H 1HB0B 5DJ7A 5HFCA 1SR5C 4JOFA 1GHBF 3ZVGA 4ACAA 5G1DA 3E6PH 5FBIA 2GCHG 4N6XA 4XBBA 2JH0D 2ZZUH 1CT0E 3STJA 3N7EA 2ZCHP 1C1NA 1OP0A 2KOMA 2P93A 1GBLA 3GDUA 1FZZA 2IPHA 2SGFE 3RMMH 3MO6A 4JOJA 3SU1A 1QQUA 3NKKA 4MPXA 2JWEA 2KL1A 3ID1A 2KCOA 4ISHH 2R0LA 1GJ5H 1OPHB 1E0FD 3FZDA 3ODDA 1FC7A 1T2MA 2QBWA 1WCZA 4JZDH 2KCPA 1UVUH 1CHOF 2ZPQA 1FN6A 5K0HA 3A82A 3SV9A 3N7DA 3QTOH 4O3TA 1HAIH 3RLEA 4NZLA 2AEIH 1Y59T 1O2IA 1QY6A 2PZDA 4BTUB 1CT2E 3F2GA 4EDJA 5CE1A 1KIGH 2Q9VA 4ZHLU 3BTQE 2Z9LA 1A5GH 3ELAH 1HDTH 1C2GA 5EJZA 3RM0H 4MTBA 1C1MA 1V1TA 4Y79A 1IHJA 3UOUA 3I1EA 1P10A 1BRUP 1GI8B 3ID4A 1V2RT 1IQFA 4UFDH 1GMCG 3MU8A 3SHAH 1J16A 1N6YA 4JZEH 2JXOA 4BANB 1HYLA 1NO9H 2ZU1A 1C1PA 1L1JA 3EYDA 1BTYA 2TGTA 3T28A 1X5RA 2L97A 2Z94A 1MH0A 1TGTA 1TA6A 1MBQA 1RTKA 5TCAA 4CHAC 4HI3A 2PKAA 1ANEA 3NUMA 3SNDA 4Z6AH 1HNEE 5DP9A 4IW4E 3EGGC 2AIPA 4Z8JA 5ABWA 5IK2D 1K1MA 1LVOA 4NXPA 1T7CA 3EA8A 5AFYH 1Z6JH 1PDRA 1TOMH 2W7RA 1GMDF 2I6SA 3PM3A 1OZIA 9ESTA 1Y8TA 2R2MB 1FPCH 2VIVA 3QGNB 1UFXA 1BTUA 3DSPA 3E0PB 3RLWH 3DIWA 1TQ0B 1T4VH 5EXNA 2V90A 3E90B 1MAXA 3L4FD 4RN6A 4XOJA 3SV6A 4BTIB 2KCAA 1K1JA 1DICA 3BTGE 3TGJE 3HGPA 2FMJA 4Y7AA 1QB9A 5FCRA 2BVRH 1QAVA 4KP0A 2FI3E 3F9EA 3M5NA 1DS2E 4M9FA 1C5UA 1NC6A 2P8OB 1NRRH 4D76A 4ZKSU 1D6RA 1TNLA 2G55A 3F0PA 4Q3HA 1MZDA 1FXYA 1SGYE 8KME2 1WYKA 2VGCC 3BF6H 2XC4A 1K22H 2F9PA 4FUJA 3FZZA 1MABB 2KG2A 1NFWA 1NN6A 1S5SA 1SGFG 4P0CA 1H8DH 3ZZCA 1WOFA 1BFEA 2EI7A 1TQ3A 5C94A 5A0CA 1UEPA 4FUGA 3M5MA 1EP6A 1EPTB 1VJAU 2KR7A 1ZSJA 5EXMA 5A0BA 2HWLB 1CBWB 1MKXK 1D5GA 3R0FA 4AORA 3RXKA 4ZCNA 1V5QA 1PFXC 1ZRBA 2G4UA 1QBVH 4BOHA 3PMAB 1S82A 2H9EH 2ILNA 5A8ZA 4CRAA 1FONA 2NU1E 2LOBA 3U8RH 2BZ6H 2CF9H 1BHXF 2XNIA 1Z8GA 4IN1A 1GHXH 4RI0A 4AG1A 3PS4A 4I86A 4Q7XA 1YCPK 2XWAA 1UMAH 3RU4T 3RC5A 2C8ZB 3PV5A 3QIKA 3SJKA 3VXEH 5A8YA 2NU0E 3ZV8A 1GJDB 1C5TA 1EX3A 5GIBA 3A83A 4B75A 5EJ1A 3Q3XA 4INLA 3LNXA 4AX9H 1LQDB 1D3TB 2K8IA 1P06A 1S6FA 2BQWB 1HJ9A 1NS3A 1E79D 1SQRA 3PRBA 1C5RA 1C4V2 1CHGA 3OAAD 1W0YH 4Y10E 3RXLA 4X8UH 4DCDA 4HOPA 3SNCA 5JBCS 1BA8B 1AUJA 4FUEA 2G00A 2ZFPH 3MNSA 4B74A 1E1RD 4U32A 4NA9H 1L4DA 1XUIA 1C1RA 1QA0A 5E11A 1UEWA 1CT4E 4WMDA 4YXWD 2BY6X 1GBTA 2RFKC 1UTPA 4AFQA 1GQ5A 1OKXA 2WPKS 1W7GH 3S9CA 2OMJA 4F55A 2ZWLH 3EE7A 3U69H 5T6GA 1GI5A 4JJ3A 2F0AA 2AGIX 3PRDA 4ABDA 3A81A 2ANYA 1O5CB 2Q3GA 2G5VA 2JIKA 3OU0A 1Z8RA 1LKAA 3MU4A 4IN2A 1QJ7B 5ETXA 4MPVA 3UFAA 2D92A 4FUDA 1ETRH 5EODA 3SOSA 1GGDB 1P01A 4UDWH 1EZQA 2F3CE 3MNXA 3I18A 3FP7E 2QF3A 1AO5A 2FYRA 2XBXA 3WWFA 3DFLA 3BV9B 2PTCE 1UTOA 2GZVA 3MH6A 1OBXA 5HFFA 1F0UA 3I29A 2G5MB 2V3MA 1AB9C 2P59A 3RXPA 3VB7A 2JIZD 3M61U 1BRCE 1MTSA 2LC6A 1GJ4H 4JK5A 1O3DA 3UTUH 2ZP0H 4JOEA 3SHUA 1QA7A 4I7YH 3D49H 1UK4A 3M3SA 3TLOA 2PKSB 2H2CA 4WH8A 3KHFA 1O2RA 5E22A 4Q2OA 1WQVH 1HAVB 4H42U 1GCTC 3NRLA 3PMJA 1QGFA 2HLCA 4TPIZ 3VB6A 4AYVB 5EGMA 4WXVA 2FO9A 2EEKA 4YO9A 1LHCH 1Q3PA 3BTFE 1MKXH 2QXHA 2W6ID 1AE5A 4GHNA 3PMHB 3BSQA 3OTJE 1ZRKA 1QBOA 1SLVB 2C8WB 2FESH 1V2NT 3NZIA 2GCTB 1GBEA 2I6QA 1AVXA 5GWZA 3LGVA 4BAHB 3HGNA 2HPPH 1FX0B 3TSZA 2OC8A 1MTUA 2BHGA 4XHVA 1ZMLA 1GHAG 3LGYA 1SQAA 4U01A 1UM1A 1C9PA 1GWAA 2AERH 1Z87A 1DUEA 1Y7NA 3SZNA 4ZUHA 1W10U 2OZFA 1WSSH 5LH8A 3U9AH 3I4WA 1RIWB 2JINA 1NESE 2PHBA 4TSFD 3BTWE 3A89A 4UU6A 2BD5A 2QIQA 1SGDE 4FVDA 2VSVA 5H3JA 1UTKA 2VWNA 1A5IA 2I04A 3GCHC 1T4UH 3EGHC 2ZHWH 2A0QB 1F7ZA 1ZGVA 4ZXXH 1XM1A 3QZQA 5DPAA 1FNIA 5C5OA 1MTWA 1ESAA 1SMFE 4FVBA 1IOEA 2XWBI 3F0OA 3URCA 1O3LA 4IC5A 1G3CA 2DAZA 2PA1A 2B7DH 1DT2A 6GCHG 1LVYA 4Y8XA 1QBNA 4MVNA 1RGQA 1DX5M 5HKKD 3R3GB 2BDYA 3KYGA 4CRDA 1INCA 4B2BA 5EQQA 4Q2NA 3KQCA 2R3UA 1UTQA 5GCHG 2YT7A 5C1YA 1D9IA 4B71A 2ZKSA 2R4HA 1K1LA 1Y3YA 1MQ6A 1IQMA 1C1TA 3TSVA 2ZU4A 2CK3D 2G4TA 1BMFD 2CS5A 4XE4A 2KRGA 4L8NA 9LPRA 2BLOA 2OK5A 3K6YA 1CA8B 5L6NH 4DT4A 3ITIA 2KPKA 2DUCA 2GZ8A 1O2ZA 1MZAA 4Q7ZA 3T26A 5F67A 4DOQA 1KXEA 4MNYA 3MTYA 1SI5H 2CN0H 4MQAA 6ESTA 3HK3B 2ZFRH 1TNGA 1TX8A 1O0DH 4AFSA 4CRFA 5JDUB 1F0RA 3GDSA 4TYDA 5A2MH 3SUDA 1HBTH 2A7CA 3BEFB 2OC0A 1AZ8A 2FE5A 2ZI2H 3TJOA 7LPRA 3GDVA 1TP5A 3KGPA 4FUCA 1AHTH 1DUAA 3LGIA 3NCLA 4ZMAH 1DY8A 4F4OC 1AVGH 3LDXH 3TPIZ 4VGCC 1Z8IB 1CGHA 3ATMA 3QZRA 4NWLA 4CH8B 3KQ5A 4MPWA 1YLNA 2BD9A 4P00A 2Z9GA 1N6XA 1DLKB 4ASUD 2YUBA 2VPHA 2L74A 2TIOA 4SGBE 3BN9A 2PSYA 1IHSH 2GVFA 2BYGA 1XKAC 1ZPCA 2OCVB 1JXPA 2F9VA 1AUTC 3A87A 2Z6BD 3LU9B 1V2QT 2BLWA 2FNEA 3ATKA 5CHAB 3SGQE 3MU5A 5EW1H 4XRNA 5KEDA 1W13U 2VH6A 4ISIH 1C2FA 1RTFB 1ELGA 3GABA 2QXGA 4Y71A 3CYYA 2GZ9A 3KEEA 1S85A 2DE9A 5E1YA 4DGJA 2FOMB 3VEQB 4K1SA 3PYHA 3IG6B 4CREA 1P8VC 1TIOA 5E6PB 1YWUA 4RT0A 2FCFA 3SU0A 2ANMH 2C4FH 2Z3EA 3VQGA 1EXFA 2TGPZ 1O3OA 1Z71A 2GEFA 1NRPH 2BY9X 2Y81A 4X2XA 5AVDA 3F2FA 4X1PU 1C2EA 4RKOB 1ZHRA 4JOGA 1HCGA 4PROA 4CBOA 1KDQA 3RUOA 1A0JA 1J17T 3I78A 1MD7A 1OP8A 3KQBA 3ID3A 5EW2H 4KTCA 3KF2A 1GMCF 2JDID 4UEHH 3V13A 2P3WA 1C5NH 1SVPA 3F6UH 3GY2A 4KELA 3SV2H 3UNRA 3WY8A 2B9LA 1P3CA 4MNWA 4K2YA 3V7TA 1G30B 3KIDU 5GDSH 1P2OA 2Y7XA 3KYFA 3OFND 1CA0B 1QCPA 2BVSH 4YOJA 2EI6A 3U8OH 1TB6H 4JZ1A 3ID2A 2CXVA 3GY6A 3UNSA 8GCHG 5GJ4B 4GLYA 2PNTA 3O8RA 3GY5A 3BTHE 1YPGH 3PMBB 1OXGA 1S0QA 5GPIB 1SGFA 1P57B 4K3JA 2EHRA 1CSOE 3QX5H 3SJ8A 4DW2U 3LPRA 1C2IA 1A3BH 3VG8A 3E0NB 2AIQA 1U6QA 3SJ9A 3ZZ9A 4P02A 2XBYA 4MNXA 1VGCC 1V2PT 3L33A 4I32A 1WI2A 1EAIA 2BDGA 1SLXB 3LONA 4GPGA 3GCTF 3GS9A 1A7SA 2ZNKH 2SGEE 1O2VA 2AMPA 3G01A 2VSPA 2ZDAH 4Q6SA 2BTCE 3SORA 2ANWA 4F49A 4NCYA 2ZU3A 1AGJA 1XUHA 1BZXE 2HLDD 2EEJA 3VGCB 5FHTA 1ELCA 1S6HA 1SPJA 3PDVA 2KOHA 1AMHA 2QG1A 1TMTH 1UHBB 2H3LA 1O2OA 3K82A 4R0IA 1C2LA 2ZGCA 2ENOA 1W7XH 3B8JA 1V6DA 3D65E 3D23A 3GY3A 1TNJA 1GBFA 1ORFA 3R68A 1VZQH 2VIPA 2BQ6B 1TPAE 4H11A 3H09A 1GL0E 2G8TA 2QT5A 1Z1JA 2GDEH 5FPTA 3E17A 1ELTA 2KV8A 1WHDA 2HGAA 3NFKA 4YOGA 5L2ZH 3A86A 5FXLA 3LH1A 4I8LA 2L4TA 2FOCA 3VFEA 2FOFA 3RXDA 3SGBE 3HKIB 2RCZA 4BXWA 4RKJB 1P3EA 1TRYA 2BY7X 2O8TA 3EGKH 1TGBA 5FPYA 2A2QH 3SU6A 3U1JB 2Y80A 1EAUA 1O2WA 3DJAA 1YLDA 4X6OA 3SNAA 3GYLB 4WWYA 1IQEA 4JMYA 1YPKH 2ODYB 5E0JA 3KQEA 2J92A 3PTNA 1O3GA 4X1RU 5AFZH 2FPZA 4AOQA 3DCLA 1Y3WA 3TGIE 3GCNA 1O3BA 4K76A 1VJ9U 3GY8A 3LGTA 3CBZA 1O38A 4NIXA 2KFWA 2Y6TA 4AFUA 2PLXA 2SFAA 2J34A 5PTPA 3SU2A 4MLFB 1MC7A 2BDBA 1ZTLA 3NWUA 1D6WA 1UTJA 2D8IA 3SUFA 1SGIB 1A2CH 1W3CA 1SGQE 2KZ4A 5SGAE 2CHAB 3K2UA 3HVQC 1P1DA 1U38A 1G2LA 4X8TH 1WV7H 3ZVDA 3SU3A 2UUKB 3SUZA 1N8OB 4NA8A 4B6FA 1GMHF 1O2YA 1Y5UT 4KTSA 2GMTB 1P02A 1H8IH 2EQNA 4B2AA 2PKAB 1WG6A 3RXMA 7GCHG 2Q1JA 3UR9A 2ZGHA 2BDHA 1KTSB 5CDFE 1GCDA 3P8FA 4JYVH 1GDNA 3T29A 1UJDA 5C67A 4YYXA 3P8GA 4X6PA 4OS1A 3MYWA 5KGOA 5E21A 1P9UA 4FU7A 1B8QA 2QKVA 2YNAA 2I1NA 1NPMA 1HIAA 1RD3B 2O8MA 4OS5A 4Y7BA 1O3EA 2ODQA 4R2ZA 2ZPRA 1EASA 4Z1MD 1M9UA 4WH6A 2W7SA 1A0HB 3ATWA 5L30H 1O2HA 1JWTA 4O03A 2TGDA 1AKSA 2Y5GA 1BHXB 1KXBA 4ZROA 1L1GA 1XUKA 2BD2A 3LJOA 1QHRB 1O32A 1QAVB 3BG4B 5EQRA 2I0IA 1SKYE 2AGGX 3QUMP 4KTUA 1C1OA 2FZZA 4Y8ZA 2ZGBH 3GICB 3GJ9A 2ZCLP 5DO4H 4WY3A 3DJ1A 2QF0A 2QXIA 5CHBA 1EZUC 3A7VA 1GVKB 2H2ZA 3N7OA 2BDCA 3KCGH 3ZVBA 2ZIQH 1AQ7A 3RU4D 3CP7A 5BPEA 4BAMB 1SGNE 1TBZH 2BB4A 3C27B 1EOLA 1GM1A 5E0HA 1B0EA 1IQKA 1O37A 1C5YB 3RMOH 5HETA 1KSNA 1TPOA 3CC0A 2QAAA 1ZTKA 4OS6A 4GHQA 2M0ZA 4FUHA 1QJ6B 4DVAU 3RL7A 1C1SA 2NU2E 1TGNA 3O8BA 3ZZBA 3RMNH 5EYZA 4JYTA 2EGNA 4OGYA 4Y11E 3TJNA 3SUEA 3OE7D 1SQOA 1O30A 1TX6A 4AGKA 1PPFE 1ZOMA 2XYAA 4OS7A 4X0WU 2H3MA 2W3KA 3FVFB 1KYNA 1K1OA 1O3NA 1C2KA 3FY5A 1CGIE 1LPZB 1H9HE 2IWQA 1GI9B 1RJXB 2M2AA 2VU8E 2EC9H 2TBSA 2AINA 4K8YA 1T8LA 3RC6A 4XFQA 1GHAF 4BAQB 1UTLM 1CE5A 1ESTA 1BJVA 1K0HA 5HEDA 1HAZB 1L2EA 4NSVA 4WYTA 2O2TA 4IS5A 3ATIA 5B6LA 3M7TA 3ZYEA 1V2ST 5C2ZA 1GBJA 4HOPB 5HF1A 2J97A 3KL6A 5C0TA 1KWAA 1VJ6A 1B5GH 3Q77A 1HGTH 3GISB 2VIQA 3DUXH 1ELFA 1NFUA 1YBWA 1K1PA 2P8OC 5E2OA 1PYTD 2RRMA 3P92A 4Q2QA 1HJ8A 3SW2B 2BLQA 2PW8H 1THSH 1WDIA 4ZH8A 1FPHH 1CGJE 3WKLA 2P3FH 1E35B 3OX7U 4NXQA 1MFLA 5C5NA 2BM2A 1C5QA 2OUAA 1OX1A 1TABE 1CO7E 4FU8A 1J14A 3DA9B 3PLPA 2V0BA 1EKBB 1OWKA 1J8AA 1OWDA 4YZUA 1EPTC 5BRRE 3GOVB 5D13A 2FX4A 3NGHA 1DWEH 3M7UA 3T62A 2Y5FA 2A4QA 3OEED 1WI4A 5F03A 3TSWA 3GGEA 1OP2A 4D7FA 2O8LA 1G3BA 1J15A 3ZRTA 1NTPA 1W2KH 1O3CA 3ESTA 2AFQB 2IWPA 2GV6A 2ZG0H 4M7GA 2GDDA 4AB9A 1OBZA 3O5NA 3QDZB 1DITH 3MU0A 1UJUA 1LDTT 2FIRH 5HF4A 1MBMA 1Z1IA 4GCHF 2R0KA 3IWMA 2ZECA 1IHTH 3P6ZB 3RXFA 5K7RA 1YPEH 1TGSZ 3V3MA 3SNEA 4Z0KA 2ZCKP 1OHHD 2ZPSA 1MMJN 1ESBA 2FM2A 2V3HH 1QL8A 3EDXB 1O36A 2VGCB 4NMVA 3DFJA 2Q6DA 3RU4E 3RC4A 1O2PA 3H7TA 1L6OA 3A8AA 3W94A 1UK3A 4YDPA 1EJMA 2YTWA 5C17A 5EJLA 4INHA 3TNTA 1GVLA 2GD4B 2TPIZ 4NMTA 2KM0A 1O2GH 4A6LA 2WSSD 1LKBA 1HPGA 2B0FA 3RXSA 2ZU5A 2FS9A 2PP6A 3RXIA 1LHDH 1BMLA 3B9FH 3SO3A 1O33A 2AMQA 1V62A 1CU1A 4ASHA 4K60A 3SZEA 1GBMA 2QV1A 2CMYA 4NSYA 1SGRE 4LXBH 1FV9A 5HIYA 5CMXH 4IGDA 2DKRA 3TJUA 3LT3A 2PKTA 3AW1A 3IITA 4INKA 2ULLA 5GLJA 1O3KA 2P16A 1AFQB 1OYTH 1TWXB 4F48B 3SU5A 4IC6A 2BD3A 2J2UA 3LKWA 3PROA 1GGDC 5DP8A 2FOEA 1W11U 1K1IA 2HVYB 1UEQA 3K9XB 2TGAA 3MNCA 2BY5X 1WJLA 3ZZAA 1X6DA 1JOUB 1SSXA 1JIMA 2ALPA 5HFEA 2D8WA 3LIWA 5E2PA 2DB5A 1ETSH 2QXJA 1C9TA 2OD3B 1LCYA 3TH4H 1O34A 1MAYA 1DLEA 3DSOA 1VITF 1BTXA 1THRH 1SFIA 4KGAA 1Y5BT 1RGWA 1GHYH 2Z9KA 2PKSC 3STIA 4K6YA 1HJAB 4YT6H 1OS8A 2VH0A 4CR5A 1W14U 4I8KA 1C4U2 1VITH 1EATA 1HAOH 3S7HB 1C5MD 1VCPA 1GI2A 2ALVA 1N7FA 2IOTA 2WYJA 2IN2A 3ZYDA 1QFKH 3LC5A 4DURA 2Y82A 1C5ZB 2OINA 1BJUA 1X5NA 1KXCA 2NU3E 1PPGE 2A7JA 3ZZ8A 1V3XA 1GJBB 2Y7ZA 2G5NA 1SGTA 1PQ8A 1NBMD 2ZDKA 1OWEA 2GCTC 3DORA 4GVCA 3KHVA 4ABIA 4E06H 4FUFA 3JZ2B 1S0RA 2A4RA 1P04A 4RSPA 1QAUA 3TJVA 4K1TA 1KLIH 2BDIA 2O8UA 5FPSA 3D62A 4NMQA 1IU0A 4UFFH 4X8VH 1C1UH 4K1EA 2A2XH 1O2JA 2WHXA 1SGCA 3F2HA 1ID5H 2EEGA 1VB7A 1K32A 1SB1H 1YPLH 1CVWH 2OTVA 3E16B 3F9HA 5F8ZA 1K21H 4UONA 2V7QD 1A1RA 3LGWA 2JREA 1EJAA 3M5OA 3ATLA 2DMZA 4I33A 5F8TA 3UWIA 1SGEE 4B2CA 1T8OA 2D26C 1UEZA 1F0SA 2WPMS 3PLKA 3F9FA 3MHWU 2J95A 1GBDA 4FXGH 1EAWA 2JETB 3OEHD 1VCQA 2O8WA 5DSFA 1TONA 3NXPA 3ZZ7A 5DP3A 4XSKU 3SQEE 4NGAH 3SNBA 4TWYA 2ZEBA 3W95A 1GMDG 1TBRH 2VNTA 2ZDLA 4I8HA 1FN8A 2VINA 1GBAA 5HYOA 2RCEA 4LZ4B 2IJOB 4BTTB 1Z86A 2YUYA 1P12E 2EXGA 1FC6A 1O3MA 1Q3XA 4AGJA 1KLTA 2K1QA 1H8ED 4K69A 5IYTA 1HUTH 1E36B 3RXEA 2EEIA 1NT1A 4KFVA 1QRZA 3F1SB 1UM7A 4Q2KA 3RM2H 2V35A 1C5OH 3LOXA 1G9IE 4K72A 3E91A 2ZDMA 5DGJA 2WPIS 3KDGA 1EUFA 4GAWA 3UQOA 1EB1H 2I4SA 1KDQB 1ELBA 1DXWA 1PJPA 4K8BA 1FCFA 7KMEH 4ZHMU 1OOKB 1TP3A 4WYUA 2PUXB 3T5FH 1O2SA 1UO6A 5EQSA 3A84A 4THNH 1X45A 2IPQX 1GBBA 4IBLH 1N6FA 1C1QA 1GHVH 1TRMA 1Y3VA 1T31A 3H7OA 4Q63A 1O5AB 3P17H 1HLTH 1TPSA 1A0LA 1KLJH 1ABJH 3A7TA 3TVJB 2VRFA 1BDAA 3VPKA 2OP9A 4LK4A 2R9PA 1UVTH 3F3BA 2EGOA 5EIYA 1H4WA 2FX6A 3SFJA 2ZFTA 2QY0B 3HPTB 1NBME 5HFDA 3FKSD 5IL9A 1GJAB 1NU9A 2AHME 2HNTF 3M37A 4JZIA 1P0SH 4DY7B 3VB5A 2A32A 4J1YA 1FMGA 2FP7B 1K9OE 3RP2A 1IAUA 2BLVA 5CHAC 3TU7H 1LO6A 3MWIU 2XRCA 4DIHH 3QGJA 2KJKA 1HAHH 4YLUA 4ABJA 2OQUA 2IWNA 1E38B 2GCHF 3TK5A 1I92A 3KZDA 3M35A 1YKTA 4E3BA 4X1NU 2H9TH 2UWLA 3M36A 1GHWH 1TNIA 1NM6A 3PB1E 1R6JA 1O5EH 2H5CA 1XXFA 3B23B 1L1NA 3DT0H 3LJJA 2FOBA 1LVMA 2OBQA 3LNYA 3HATH 4ABEA 1BBRH 2M0TA 4H6TA 1SOZA 3A7YA 4Y6DA 5HDYA 3BTEE 1S84A 2F5YA 1MFGA 4Q2PA 1AU8A 1HAGE 2D2DA 4XBCA 2HALA 5A8XA 2V6NA 1FDPA 1TA2A 1UW7A 1NZQH 2WPLS 2Z3DA 1UK2A 3MH4A 1MCTA 2JH5D 2WV4A 4NMRA 1GJ6A 1PQ5A 2Z17A 2GX4A 1TALA 3M3TA 3BTKE 1OSSA 3A88A 1HV7A 2UWPA 1V2VT 1WBGB 1GL1A 3P70B 2KAIA 3UB0A 1X8SA 2LUIA 1I16A 5HGGA 4ISNA 2BY8X 3GY7A 2F9BH 2A1DB 3EA7A 1MD8A
chains in the Genus database with same CATH topology
1B8QA 2QKVA 4ZCNA 1V5QA 2KOJA 2I1NA 3MH7A 2O8MA 1Q7XA 4R2ZA 4FETA 2YMSD 4Z1MD 3HPMA 2JOAA 1GQ4A 2LOBA 3O8DA 4WH6A 2XNIA 3SU4A 2F9UA 4RI0A 4O06A 4JOPA 3PS4A 1V5LA 1P1EA 4F8KA 2VWRA 4OM9A 3N99A 2LA8A 2QF5A 3RC5A 3PV5A 3QIKA 1QAVB 4G69A 2W4FA 2I0IA 5EQRA 1SKYE 1VA8A 2PDZA 4B75A 2QKUA 3LNXA 4PQWA 1NF3C 3GJ9A 2M0VA 2K8IA 2IJD1 3DJ1A 5CHBA 2ZPLA 1NS3A 2W6JD 1RY4A 1E79D 3SHWA 3PRBA 2M10A 3OAAD 2OS6A 1EFRD 4HOPA 1NTEA 1M5ZA 1GM1A 2ZPMA 4B74A 1E1RD 5HETA 1YBOA 2OCSA 1UEWA 3CC0A 5E11A 4YXWD 2KAWA 5IDKA 2M3MA 2M0ZA 1GQ5A 3RL7A 5F3XA 2OMJA 3O8BA 4F55A 1BT7A 5EYZA 2EGNA 1N6EA 5ILBA 3SUEA 4JJ3A 2WZQA 2F0AA 3OE7D 4A92A 3PRDA 2YMSB 1WH1A 2H3MA 2Q3GA 2WPDD 2UZCA 2JIKA 2XCNA 3OU0A 5HEBA 2KCYA 3FY5A 1ZOKA 3B76A 5EPYA 5ETXA 2IWQA 2D92A 4KFWA 2M2AA 1DY9A 2AINA 1VAEA 4REYA 3RC6A 3PDZA 3I18A 4TT3D 2D90A 2KPLA 2GGVB 5HEDA 3ZIAD 4WYTA 2O2TA 1X5QA 3JXTA 3WWFA 5B6LA 5GNDA 3WWBA 1ZUBA 2GZVA 3PV2A 1RTLA 3MH6A 4HOPB 2CSJA 5HF1A 1OBXA 5HFFA 5C0TA 1KWAA 2G5MB 1VJ6A 2P59A 2JIZD 2LC6A 2KYLA 3OTPA 4JOEA 3SHUA 4I31A 4WH8A 2H2CA 2RRMA 3KHFA 4Q2QA 4OEOA 5E22A 4Q2OA 2I0LA 1W9QA 3P8NA 3WKLA 2PKUA 3NRLA 4NXQA 1MFLA 1Q3PA 3BPUA 2QKTA 2W6ID 2K20A 4GHNA 2QF4A 5D13A 3NGHA 2F43B 4NMOA 3K1RA 3OEED 5JXBA 2A4QA 1WI4A 1W0KD 5ESBA 3TSWA 3GGEA 2OC7A 4B6EA 2EV8A 2LC7A 3WKMA 1RZXA 3ZRTA 1E1QD 4UU5A 3SUGA 2IWPA 1FX0B 2DLUA 1OBZA 3O5NA 1W0JD 3TSZA 1TE0A 4JL7A 2OC8A 1UJUA 4XHVA 5HF4A 3QE1A 4U01A 5DTHA 1UM1A 4B76A 1WF7A 1KMHB 1Z87A 1UJVA 1Y7NA 4A1XA 2OZFA 5EPNA 1UHPA 3I4WA 2CSSA 2WL7A 2K1ZA 3O46A 2JINA 4TSFD 1OHHD 3QDOA 5B42A 2FM2A 3KZEA 4UU6A 1UITA 2VSVA 4NMVA 5H3JA 3RC4A 1L6OA 3SOEA 2EJYA 2I04A 2OQSA 4OAJA 3EGHC 4YDPA 2AWUA 4JOKA 2YTWA 5C17A 3SV8A 3WW7A 2EDZA 1N99A 4NWKA 4AMHA 3TMHA 4NMTA 2KM0A 5H4IB 1N1LA 3QJNA 2WSSD 2KJPA 3F0OA 3DJ3A 4JJ0A 3AXAA 3AK5A 2A4GA 2DAZA 2DJTA 2PA1A 1KY9A 1U37A 4P2AB 3GCOA 2YOLA 1RGQA 3M5LA 2KJDA 1V62A 1CU1A 5FL7D 5HKKD 1WXRA 3SZEA 2EDPA 3QO6A 2QV1A 5FB8C 3P8OA 5EQQA 1KEFA 4Q2NA 1N6DA 3R0HA 2YMSC 2DKRA 4B73A 2PKTA 1G9OA 2YT8A 1N7EA 2YT7A 1SOTA 2OPGA 5GLJA 2OC1A 4B71A 4GVDA 2R4HA 2V1WA 3SU5A 4IC6A 3LKWA 3TSVA 2CK3D 2EAQA 4JOHA 3QGLA 1BMFD 2CS5A 2KA9A 2KRGA 4L8NA 1UEQA 5F53A 2OK5A 1WJLA 2HE4A 2G2LA 2XCFA 1X6DA 2L4SA 4DT4A 2K0QA 1X9ZA 2KPKA 3U1IB 3CBYA 5HFEA 2EGKA 2DB5A 5F67A 1COWD 1LCYA 5EZ0A 3DSOA 5C0UA 4NNLA 1N7TA 3SYJA 3VQFA 2L6OA 3W1EA 3L6PA 3KDKA 3NCVA 1RGWA 5HEYA 3GDSA 4TYDA 3SUDA 4K6YA 3R69A 2XNDD 2OC0A 2DM8A 2Z9IA 2FE5A 3GDVA 1TP5A 3KNXA 3CS0A 2KQFA 3CBXA 3QJMA 1DY8A 4A1TA 1N7FA 2OINA 4NWLA 2I6VA 1X5NA 4ASUD 1U39A 2YUBA 2MHOA 2VPHA 2VZ5A 1RGRA 3KN2A 2EDVA 2GVFA 2BYGA 1JXPA 1NBMD 2F9VA 3DORA 4GVCA 2FNEA 2A4RA 4K75A 2X7ZA 1QAUA 2F4LA 3GABA 3CYYA 4MPAA 3KEEA 5FPSA 5E1YA 3NFLA 2FOMB 4NMQA 1IU0A 5HFBA 3HPKA 5E6PB 2WHXA 2HE2A 3F2HA 3K50A 2EEGA 1VB7A 1K32A 2FCFA 3SU0A 2AWXA 1BE9A 3FN8A 3VQGA 1W9EA 3O8CA 4XD7D 2GEFA 2V7QD 3F2FA 1A1RA 4FLNA 1U3BA 4NMSA 2R3YA 2JREA 3M5OA 2DMZA 2OSGA 4I33A 2OBOA 4JOGA 1UEZA 2DLSA 5A2PA 1Q3OA 3ID3A 3PV4A 2DC2A 2EEHA 3OEHD 1WFGA 2OGPA 3KF2A 3FO8D 4KTCA 4FGMA 5DSFA 1UF1A 3RL8A 4Q6HA 4NNMA 1V6BA 2JDID 3GSLA 2P3WA 5HFCA 4JOFA 5G1DA 2REYA 4N6XA 2JSNA 2AWWA 3SV7A 3OFND 2IJOB 3STJA 3N7EA 3ID2A 1Z86A 2KOMA 2YUYA 5GJ4B 2PNTA 2EXGA 3GDUA 5T1VA 1FC6A 3O8RA 4JOJA 2K1QA 5GPIB 1H8ED 2EHRA 3SU1A 1W9OA 2JWEA 2KL1A 3ID1A 2KCOA 3VG8A 1WIFA 2EEIA 4KFVA 4E35A 1FC7A 1T2MA 2QBWA 1UM7A 1DXPA 2KCPA 1WI2A 3LOXA 4K72A 4I32A 3LONA 4JORA 1OBYA 5DN6D 3KDGA 3GS9A 3SV9A 3N7DA 2I4SA 2M0UA 1DXWA 1VCWA 3RLEA 2VSPA 4Q6SA 4LMMA 4K8BA 1FCFA 3OYPA 1TP3A 2PZDA 4WYUA 2HLDD 2EEJA 3F2GA 1QLCA 5EQSA 5FHTA 3PDVA 2KOHA 4EDJA 2QG1A 2Q9VA 1X45A 2FN5A 2H3LA 4Z33A 3K82A 1N6FA 1V1TA 2ENOA 2KBSA 4Q63A 1IHJA 3I1EA 4NMPA 1XZ9A 3ID4A 5I7ZA 3R68A 4OEPA 4E34A 2VRFA 4H11A 2LELA 3H09A 2JXOA 5HJ1A 2QT5A 5FPTA 3E17A 2KV8A 3F3BA 2EGOA 1WHDA 2HGAA 3EYDA 3NFKA 1X5RA 2XOKD 2L4TA 3SFJA 2L97A 3FOAA 1NBME 5HFDA 3FKSD 5IL9A 1IU2A 2AHME 2RCZA 2FP7B 5FPYA 3SU6A 3EGGC 3U1JB 4Z8JA 5IK2D 3DJAA 1FC9A 2KJKA 4NXPA 2IWOA 3CH8A 1PDRA 4NXRA 4JMYA 2W7RA 2IWNA 1OZIA 2VBCA 1I92A 3KZDA 4E3BA 1Y8TA 3DCLA 3GCNA 2QE7D 1UFXA 3DSPA 4K76A 1R6JA 3DIWA 3CBZA 2J5UA 2OBQA 3LNYA 2KFWA 2V90A 2M0TA 2JJ1D 3E90B 1SOZA 3L4FD 5HDYA 1S6LA 3SU2A 3SV6A 2KCAA 1MC7A 4R8TB 2D8IA 3SUFA 5G1EA 1WFVA 1MFGA 2F5YA 4Q2PA 1H8HD 1W3CA 1WHAA 2JJ2D 2KZ4A 1QAVA 3M5NA 4M9FA 3HVQC 1P1DA 1U38A 2JILA 3SU3A 2MX6A 4Q3HA 3F0PA 3SUZA 4WF8A 3MH4A 4B6FA 2E7KA 4NMRA 2Z17A 2WV9A 1MABB 2KG2A 2H2BA 1WG6A 4P0CA 1BFEA 5CDFE 1WF8A 4Q4LA 3UB0A 1X8SA 1TQ3A 2LUIA 1UEPA 1UJDA 1I16A 3M5MA 4YYXA 2KR7A 4K78A 5E21A 4A1VA 1D5GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1B8Q A;  2QKV A;  1V5Q A;  2KOJ A;  2I1N A;  3MH7 A;  2O8M A;  1Q7X A;  4R2Z A;  3HPM A;  2JOA A;  1GQ4 A;  2LOB A;  3O8D A;  4WH6 A;  2XNI A;  3SU4 A;  2F9U A;  4RI0 A;  4O06 A;  4JOP A;  3PS4 A;  1V5L A;  1P1E A;  4F8K A;  2VWR A;  4OM9 A;  2LA8 A;  3RC5 A;  3PV5 A;  3QIK A;  1QAV B;  4G69 A;  2W4F A;  2I0I A;  5EQR A;  1VA8 A;  2PDZ A;  4B75 A;  2QKU A;  3LNX A;  4PQW A;  1NF3 C;  3GJ9 A;  2M0V A;  2IJD 1;  3DJ1 A;  2ZPL A;  1NS3 A;  1RY4 A;  3SHW A;  2M10 A;  2OS6 A;  4HOP A;  1NTE A;  1M5Z A;  1GM1 A;  2ZPM A;  4B74 A;  5HET A;  1YBO A;  2OCS A;  1UEW A;  3CC0 A;  5E11 A;  2KAW A;  5IDK A;  2M3M A;  2M0Z A;  1GQ5 A;  3RL7 A;  5F3X A;  2OMJ A;  3O8B A;  1BT7 A;  5EYZ A;  2EGN A;  1N6E A;  3SUE A;  2WZQ A;  2F0A A;  4A92 A;  1WH1 A;  2H3M A;  2Q3G A;  2UZC A;  2JIK A;  2XCN A;  3OU0 A;  5HEB A;  3FY5 A;  1ZOK A;  3B76 A;  5EPY A;  5ETX A;  2IWQ A;  2D92 A;  4KFW A;  1DY9 A;  2AIN A;  1VAE A;  4REY A;  3RC6 A;  3PDZ A;  3I18 A;  2D90 A;  2KPL A;  2GGV B;  5HED A;  4WYT A;  2O2T A;  1X5Q A;  3JXT A;  5B6L A;  5GND A;  1ZUB A;  2GZV A;  3PV2 A;  1RTL A;  3MH6 A;  4HOP B;  2CSJ A;  5HF1 A;  1OBX A;  5HFF A;  1KWA A;  2G5M B;  1VJ6 A;  2P59 A;  2LC6 A;  2KYL A;  3OTP A;  4JOE A;  3SHU A;  4I31 A;  4WH8 A;  2H2C A;  2RRM A;  3KHF A;  4Q2Q A;  4OEO A;  5E22 A;  4Q2O A;  2I0L A;  1W9Q A;  3P8N A;  3WKL A;  2PKU A;  4NXQ A;  1MFL A;  1Q3P A;  3BPU A;  2QKT A;  2K20 A;  4GHN A;  5D13 A;  3NGH A;  4NMO A;  3K1R A;  5JXB A;  2A4Q A;  1WI4 A;  5ESB A;  3TSW A;  3GGE A;  2OC7 A;  4B6E A;  2EV8 A;  2LC7 A;  3WKM A;  1RZX A;  3ZRT A;  4UU5 A;  3SUG A;  2IWP A;  2DLU A;  1OBZ A;  3O5N A;  3TSZ A;  1TE0 A;  4JL7 A;  2OC8 A;  1UJU A;  4XHV A;  5HF4 A;  3QE1 A;  4U01 A;  5DTH A;  1UM1 A;  4B76 A;  1WF7 A;  1Z87 A;  1UJV A;  1Y7N A;  4A1X A;  2OZF A;  5EPN A;  1UHP A;  3I4W A;  2CSS A;  2WL7 A;  2K1Z A;  3O46 A;  2JIN A;  3QDO A;  2FM2 A;  3KZE A;  4UU6 A;  1UIT A;  2VSV A;  4NMV A;  5H3J A;  3RC4 A;  1L6O A;  3SOE A;  2EJY A;  2I04 A;  2OQS A;  4OAJ A;  3EGH C;  4YDP A;  2AWU A;  4JOK A;  2YTW A;  3SV8 A;  2EDZ A;  1N99 A;  4NWK A;  4AMH A;  3TMH A;  4NMT A;  5H4I B;  1N1L A;  3QJN A;  2KJP A;  3DJ3 A;  3AXA A;  3AK5 A;  2A4G A;  2DAZ A;  2DJT A;  2PA1 A;  1KY9 A;  1U37 A;  4P2A B;  3GCO A;  2YOL A;  1RGQ A;  3M5L A;  2KJD A;  1V62 A;  1CU1 A;  1WXR A;  3SZE A;  2EDP A;  3QO6 A;  2QV1 A;  5FB8 C;  3P8O A;  5EQQ A;  1KEF A;  4Q2N A;  1N6D A;  3R0H A;  2DKR A;  4B73 A;  2PKT A;  1G9O A;  2YT8 A;  1N7E A;  2YT7 A;  1SOT A;  2OPG A;  5GLJ A;  2OC1 A;  4B71 A;  4GVD A;  2R4H A;  2V1W A;  3SU5 A;  4IC6 A;  3LKW A;  3TSV A;  2EAQ A;  4JOH A;  3QGL A;  2CS5 A;  2KA9 A;  2KRG A;  4L8N A;  1UEQ A;  2OK5 A;  1WJL A;  2HE4 A;  2G2L A;  2XCF A;  1X6D A;  2L4S A;  2KPK A;  3U1I B;  3CBY A;  5HFE A;  2EGK A;  2DB5 A;  5F67 A;  1LCY A;  5EZ0 A;  4NNL A;  1N7T A;  3SYJ A;  3VQF A;  3L6P A;  1RGW A;  5HEY A;  3GDS A;  4TYD A;  3SUD A;  4K6Y A;  3R69 A;  2OC0 A;  2DM8 A;  2Z9I A;  2FE5 A;  3GDV A;  1TP5 A;  3KNX A;  3CS0 A;  2KQF A;  3CBX A;  3QJM A;  1DY8 A;  4A1T A;  1N7F A;  2OIN A;  4NWL A;  2I6V A;  1X5N A;  1U39 A;  2YUB A;  2MHO A;  2VPH A;  2VZ5 A;  1RGR A;  3KN2 A;  2EDV A;  2GVF A;  2BYG A;  1JXP A;  2F9V A;  3DOR A;  4GVC A;  2FNE A;  2A4R A;  4K75 A;  2X7Z A;  1QAU A;  2F4L A;  3CYY A;  4MPA A;  3KEE A;  5FPS A;  5E1Y A;  3NFL A;  2FOM B;  4NMQ A;  1IU0 A;  5HFB A;  3HPK A;  5E6P B;  2WHX A;  2HE2 A;  3K50 A;  2EEG A;  1VB7 A;  1K32 A;  2FCF A;  3SU0 A;  2AWX A;  1BE9 A;  3VQG A;  1W9E A;  3O8C A;  1A1R A;  1U3B A;  4NMS A;  2R3Y A;  2JRE A;  3M5O A;  2DMZ A;  2OSG A;  4I33 A;  2OBO A;  4JOG A;  1UEZ A;  2DLS A;  5A2P A;  1Q3O A;  3ID3 A;  3PV4 A;  2DC2 A;  2EEH A;  4KTC A;  1WFG A;  2OGP A;  3KF2 A;  4FGM A;  1UF1 A;  3RL8 A;  4Q6H A;  4NNM A;  1V6B A;  3GSL A;  2P3W A;  5HFC A;  4JOF A;  5G1D A;  2REY A;  4N6X A;  2AWW A;  3SV7 A;  2IJO B;  3STJ A;  3ID2 A;  1Z86 A;  2KOM A;  2YUY A;  5GJ4 B;  2PNT A;  2EXG A;  3GDU A;  5T1V A;  1FC6 A;  3O8R A;  4JOJ A;  2K1Q A;  5GPI B;  2EHR A;  3SU1 A;  1W9O A;  2JWE A;  2KL1 A;  3ID1 A;  1WIF A;  2EEI A;  4KFV A;  4E35 A;  1FC7 A;  1T2M A;  2QBW A;  1UM7 A;  1DXP A;  3LOX A;  1WI2 A;  4I32 A;  4K72 A;  3LON A;  4JOR A;  1OBY A;  3SV9 A;  2I4S A;  2M0U A;  1DXW A;  1VCW A;  3RLE A;  2VSP A;  4Q6S A;  4LMM A;  4K8B A;  1FCF A;  3OYP A;  1TP3 A;  2PZD A;  4WYU A;  2EEJ A;  1QLC A;  5EQS A;  5FHT A;  3PDV A;  2KOH A;  4EDJ A;  2QG1 A;  2Q9V A;  1X45 A;  2FN5 A;  2H3L A;  4Z33 A;  3K82 A;  1N6F A;  1V1T A;  2ENO A;  2KBS A;  1IHJ A;  3I1E A;  4NMP A;  1XZ9 A;  3ID4 A;  5I7Z A;  3R68 A;  4OEP A;  4E34 A;  2VRF A;  4H11 A;  3H09 A;  2JXO A;  5HJ1 A;  2QT5 A;  5FPT A;  3E17 A;  2KV8 A;  2EGO A;  1WHD A;  2HGA A;  3EYD A;  3NFK A;  1X5R A;  2L4T A;  3SFJ A;  2L97 A;  5HFD A;  1IU2 A;  2RCZ A;  2FP7 B;  5FPY A;  3SU6 A;  3EGG C;  3U1J B;  4Z8J A;  3DJA A;  1FC9 A;  2KJK A;  4NXP A;  2IWO A;  3CH8 A;  1PDR A;  4NXR A;  4JMY A;  2W7R A;  2IWN A;  1OZI A;  2VBC A;  1I92 A;  3KZD A;  4E3B A;  1Y8T A;  3GCN A;  1UFX A;  4K76 A;  1R6J A;  3DIW A;  3CBZ A;  2OBQ A;  3LNY A;  2V90 A;  2M0T A;  3E90 B;  1SOZ A;  3L4F D;  5HDY A;  3SU2 A;  3SV6 A;  1MC7 A;  4R8T B;  2D8I A;  3SUF A;  5G1E A;  1WFV A;  1MFG A;  2F5Y A;  4Q2P A;  1W3C A;  1WHA A;  1QAV A;  3M5N A;  4M9F A;  3HVQ C;  1P1D A;  1U38 A;  2JIL A;  3SU3 A;  2MX6 A;  4Q3H A;  3SUZ A;  4WF8 A;  3MH4 A;  4B6F A;  2E7K A;  4NMR A;  2Z17 A;  2WV9 A;  2KG2 A;  2H2B A;  1WG6 A;  4P0C A;  1BFE A;  1WF8 A;  1X8S A;  1TQ3 A;  2LUI A;  1UEP A;  1UJD A;  1I16 A;  3M5M A;  4YYX A;  4K78 A;  5E21 A;  4A1V A;  1D5G A; 
#chains in the Genus database with same CATH topology
 4J2Y B;  4MG3 A;  2LPR A;  4OS4 A;  3MH7 A;  3A7W A;  1WTG H;  1QRX A;  4TWW A;  1HFD A;  4Y0Y E;  1D3D B;  2F91 A;  4NG9 H;  1SL3 A;  2YMS D;  4TPY A;  2JOA A;  1GQ4 A;  1ZGI A;  3O8D A;  3SU4 A;  2C8X B;  1QRW A;  2HVX A;  4O06 A;  4JOP A;  1V5L A;  1P1E A;  1EQ9 A;  4F8K A;  1SC8 U;  4JCN A;  1WUN H;  1QL9 A;  2FTM A;  2VVV A;  3HK6 B;  4K5Z A;  2QF5 A;  1YPJ H;  2ZGJ A;  2W4F A;  1JIR A;  2R2W U;  2BMG B;  3QWC H;  1VA8 A;  3LGU A;  1RS0 A;  4WME A;  4GSO A;  2PGQ B;  2QKU A;  3E3T A;  2ZPL A;  1IQG A;  3VGC C;  6CHA C;  2W6J D;  5AHG H;  2M10 A;  2OS6 A;  1EP5 A;  2ZPM A;  4YT7 H;  2ZC9 H;  1YPH C;  1ZPZ A;  2H5D A;  1VKY A;  4HFP B;  4BNR A;  2BD7 A;  4AZ2 B;  1YBO A;  1FUJ A;  1HIA B;  6LPR A;  1ZZZ A;  5IDK A;  2M3M A;  2VWM A;  2CJI A;  2FOG A;  5GXP A;  4Q80 A;  1XKB C;  1O3P B;  3U28 C;  2ZDV H;  1YCP M;  1A4W H;  4CH2 B;  5C3N A;  4AC9 A;  1N6E A;  5ILB A;  1LPK B;  1AKS B;  1E37 B;  1DDJ A;  1YM0 A;  1BCU H;  2YMS B;  1WH1 A;  2EI8 A;  1KXD A;  4D9R A;  1OYQ A;  2G81 E;  5HEB A;  2KCY A;  1T8M A;  4JZF H;  5FAH A;  1ZOK A;  2HPQ H;  1W0Z U;  4KFW A;  1XX9 A;  3GY4 A;  1DY9 A;  1GG6 B;  1RXP A;  4REY A;  1VAE A;  3H5C B;  2VVU A;  1QB6 A;  3ENS B;  2KPL A;  1L0Z A;  3JXT A;  1V2M T;  3WWB A;  1C5X B;  1DVA H;  1D3Q B;  4X1Q U;  1ZUB A;  1UCY H;  2P3T B;  1RTL A;  2CSJ A;  1C1V H;  1TLD A;  2XBW A;  3RXG A;  3MQK C;  2KYL A;  2UUJ B;  4I31 A;  3CNR A;  4NIW A;  1GI6 A;  4X2V A;  3U98 H;  1BIO A;  3S9B A;  1NY2 2;  5EST E;  1D3P B;  1O3H A;  3PWC A;  1BRB E;  3FFG A;  2FS8 A;  2YNB A;  2LNC A;  1ACB E;  1BIT A;  1N8O C;  1Z6E A;  2I0L A;  3TK6 A;  1C4Y 2;  2ZTX A;  5HXF A;  2GMT C;  1O2U A;  3RXJ A;  1UVP A;  2CGA A;  1GHZ A;  1FIZ A;  2SGD E;  5DG6 A;  1EJN A;  2VJ1 A;  4O9V A;  5C20 A;  1AVW A;  3BPU A;  2QKT A;  5JBB S;  2ZHF H;  4CBN A;  1YPH E;  2F43 B;  4NMO A;  2STB E;  3K1R A;  1W0K D;  3BTM E;  4B6E A;  4E05 H;  5LGO A;  2PR3 A;  2LC7 A;  1E1Q D;  1RZX A;  2AMD A;  1UTM A;  1W0J D;  2VVC A;  5J4Q A;  4JL7 A;  1GI7 B;  1JRT A;  1C2D A;  1T8N A;  4B76 A;  1KMH B;  3SQH E;  1MTN B;  3TH2 H;  3RXQ A;  3BG4 C;  4GHT A;  5EPN A;  1UHP A;  4BAO B;  2CSS A;  2WL7 A;  2NWN A;  1TQ7 B;  1WAY B;  3PO1 B;  1F92 A;  1BTP A;  2RG3 A;  4A5T S;  3QDO A;  3LC3 A;  1NFX A;  3NK8 A;  4X6N A;  4I8J A;  3SOE A;  2EJY A;  2AS9 A;  2OQS A;  1BB0 B;  2AH4 X;  3T2N A;  3SBK A;  4JOK A;  4SGA E;  1C5S A;  4ZHA A;  2JKH A;  3ZV9 A;  4MDS A;  3TMH A;  4Q7Y A;  1G3E A;  2ZFF H;  3QJN A;  3DJ3 A;  4JJ0 A;  3AXA A;  3AK5 A;  2A4G A;  5F8X A;  2DJT A;  4NFF A;  4XDE A;  1KY9 A;  4P2A B;  1PPE E;  3GCO A;  1P11 E;  4ISL A;  4TY7 A;  1GI4 A;  4GUX A;  4Y0Z E;  2YOL A;  5F6M A;  2KJD A;  2BDA A;  2EDP A;  3QO6 A;  3RXH A;  5FCK A;  4ZAE A;  1G9O A;  2YT8 A;  3Q00 A;  1SOT A;  2UWO A;  2PUQ H;  1ZPB A;  2OC1 A;  3K6Z A;  2VWL A;  1FAK H;  2QGR A;  2V1W A;  1GI1 A;  3AAV A;  1MTV A;  4JYU H;  2SGP E;  2C93 B;  5HM2 A;  1P9S A;  1JRS A;  3PWB A;  3QGL A;  1NRQ H;  2C3S A;  5T6D A;  5F53 A;  1G2M A;  2ZQ1 A;  2STA E;  2ZTY A;  2HE4 A;  2C90 B;  2G2L A;  2L4S A;  2K0Q A;  1X9Z A;  1O3F A;  3U1I B;  3CBY A;  1HXE H;  5EU8 A;  4I8G A;  5EZ0 A;  1GJ8 B;  1QJ1 B;  1V2O T;  2F83 A;  2WPH S;  2HGT H;  1N7T A;  3VQF A;  2L6O A;  3A8B A;  4H4F A;  1FI8 A;  3NCV A;  4D9Q A;  5JB9 S;  5HEY A;  2F9N A;  4DT7 B;  1WTH D;  1GJ9 B;  2XND D;  5J4S A;  2Z9J A;  1O3I A;  1YP9 A;  2DM8 A;  1C2M A;  1P2N A;  2H6M A;  2UUY A;  1LHF H;  1C5L H;  2SGQ E;  2KQF A;  4A1T A;  3QJM A;  4BXS A;  2ZDN A;  3ZVA A;  1GJC B;  2I6V A;  1U39 A;  2MHO A;  1XVO A;  1O2K A;  2GJG A;  5TJX A;  1ABI H;  1RGR A;  3HKJ B;  3KN2 A;  2EDV A;  1PPH E;  4WXI A;  1IQH A;  1TNH A;  3MH5 A;  1IQI A;  2SNV A;  3RXO A;  4CHA B;  4ZXY H;  1A5H A;  3SGA E;  5DP6 A;  3MO9 A;  2J98 A;  4O3U A;  4NIV A;  3GCT G;  6GCH F;  1QTF A;  4K75 A;  1O2X A;  1ELA A;  1CBW C;  2QC2 A;  3VXF H;  1P2I A;  1SHY A;  1ZMJ A;  4ZKO U;  1X7A C;  2J4I A;  3ZZ3 A;  1V2K T;  4MPA A;  2BVX H;  2WUC A;  2VB0 A;  5DP4 A;  4YLQ H;  1O31 A;  1SGP E;  5GCH F;  1MCV A;  4FUB A;  4TY6 A;  2HE2 A;  2G52 A;  4UFG H;  4UD9 H;  1QL7 A;  1Y5A T;  2EA3 A;  2FI4 E;  2DE8 A;  1GVZ A;  2FEQ H;  2AWX A;  1DE7 H;  1F5K U;  1W9E A;  3O8C A;  4XD7 D;  1RFN A;  5JPM H;  3MO3 A;  1PPZ A;  5C1X A;  1AWF H;  4FLN A;  1U3B A;  1PYT C;  1OWJ A;  2R3Y A;  3UQV A;  4CRC A;  2OSG A;  1BMA A;  4HZH A;  1GDU A;  4U30 A;  3TH3 H;  2OBO A;  2J9N A;  1K2I 1;  2DLS A;  4YM9 A;  2QCY A;  1Q3O A;  3Q76 A;  5EOK A;  3Q3Y A;  3PV4 A;  3DSG A;  2EEH A;  1H9I E;  1WFG A;  2OGP A;  1QB1 A;  3FO8 D;  2RA0 A;  5HM9 A;  1WU1 A;  4FGM A;  1ANC A;  3RL8 A;  2HOB A;  4X8S H;  4Q6H A;  3TIT A;  2H9H A;  2A31 A;  1V6B A;  3QK1 A;  1Z8J B;  3GSL A;  4RT1 A;  1K1N A;  1NRS H;  4X2W A;  2HRV A;  1E34 B;  2REY A;  1O5F H;  2JSN A;  4HTC H;  2AWW A;  2A5I A;  4UFE H;  3UUZ A;  3SV7 A;  1BMM H;  1FY4 A;  1ZSK A;  3A7Z A;  1AFQ C;  1DWB H;  1P2J A;  5T1V A;  3AW0 A;  2PTN A;  1W9O A;  2ZU2 A;  1JBU H;  1ELV A;  1OWH A;  3SI3 H;  1WIF A;  3SJI A;  4CRG A;  1GJ7 B;  4E35 A;  1O2M A;  2J38 A;  1P2Q A;  1ZLR A;  3DHK H;  4DJZ B;  1SQT A;  1DXP A;  1UVS H;  4JOR A;  1OBY A;  2ZO3 H;  5DN6 D;  3EA9 A;  3ZVE A;  1HAP H;  2M0U A;  1ZJK A;  1VCW A;  1NFY A;  1GMH G;  2VWO A;  1F5R A;  4MNV A;  4LMM A;  1XUG A;  3OYP A;  4CR9 A;  1AD8 H;  1GBH A;  3FAO A;  2FOA A;  3RXC A;  1QLC A;  1BTW A;  1SLW B;  2ZF0 H;  1DWC H;  5EXL A;  1LVB A;  2FN5 A;  1KXA A;  4Z33 A;  3DD2 H;  1HJA C;  5JYI A;  2GTB A;  4NZQ A;  2VID A;  1B0F A;  4QT8 C;  1ETT H;  3RML H;  2KBS A;  3URD A;  4NMP A;  1XZ9 A;  1XVM A;  5I7Z A;  1AN1 E;  2CF8 H;  5C1U A;  4OEP A;  1QQ4 A;  4E34 A;  1HXF H;  2LEL A;  1LHG H;  5HJ1 A;  3BG8 A;  1GHB G;  5DKM A;  2HNT C;  4JK6 A;  1D4P B;  2D1J A;  4AG2 A;  4ZKR U;  2BXU H;  2XOK D;  2SGA A;  3FOA A;  1MU8 B;  3M7Q A;  1IU2 A;  4IMQ A;  1YC0 A;  2V3O H;  3MOC A;  1BUI A;  1O3J A;  1O39 A;  2VIW A;  3UPE A;  3ZVC A;  5KEC A;  1ELE E;  1HRT H;  1HAX B;  1LQE A;  4YTA A;  1FC9 A;  1EPT A;  2IWO A;  3CH8 A;  5I46 H;  4NXR A;  3MFJ A;  2VBC A;  3ZZ6 A;  1QNJ A;  4AFZ A;  1SBW A;  2QE7 D;  4B1T A;  1TBQ H;  1CHO G;  3RXV A;  3ZZD A;  1V2J T;  1GI3 A;  2J5U A;  8GCH F;  1W8B H;  1UVO A;  2GV7 A;  2JJ1 D;  1FIW A;  1DAN H;  1WQS A;  2Q6G A;  4ZKN U;  1O2L A;  1F2S E;  1S6L A;  1AB9 B;  5JBT A;  4R8T B;  2B8O H;  2FXR A;  5B6O A;  1O2T A;  2THF B;  5G1E A;  1WFV A;  1H8H D;  2JJ2 D;  1WHA A;  2A7H A;  2ZTZ A;  1O5D H;  3PLB A;  1RIW C;  2JIL A;  5JBA S;  1QZ8 A;  3OY6 U;  1GBI A;  4WVP E;  2MX6 A;  2ZFS A;  3U8T H;  1AZZ A;  1TX7 A;  4WF8 A;  1BBR K;  2E7K A;  2QN5 T;  1P03 A;  1P09 A;  2JET C;  2WV9 A;  1BRA A;  1GCT B;  3BIU H;  1P2M A;  1H9L B;  2H2B A;  1DSU A;  3UR6 A;  3ZZ5 A;  1WF8 A;  1GDQ A;  4Q4L A;  1OWI A;  4ABA A;  1IQJ A;  3BTD E;  4ABB A;  4K78 A;  1GBK A;  1DFP A;  1YCP H;  2FI5 E;  2B5T B;  3PTB A;  4A1V A;  2GKV E;  3MMG A;  2UUF B;  5DP5 A;  2KOJ A;  4FU9 A;  1T32 A;  1AWH B;  4X2Y A;  3AAS A;  1Q7X A;  2EY4 C;  1TYN A;  2ZGX H;  3M3V A;  1C5P A;  8EST E;  3QLP H;  2HNT E;  4FET A;  5G4B A;  1F0T A;  2BD8 A;  3HPM A;  1XMN B;  1ARC A;  1IQN A;  1BTH H;  5DP7 A;  2F9U A;  4Y76 A;  2FWW A;  8LPR A;  2ZQ2 A;  5LPE A;  3VB4 A;  1A61 H;  2WUB A;  1G36 A;  2VWR A;  3BIV H;  3N99 A;  4OM9 A;  3S0N A;  4MPU A;  1FY1 A;  4WMF A;  3UWJ H;  2LA8 A;  1BBR E;  4G69 A;  3FP6 E;  3RLY H;  1H1B A;  2PDZ A;  3UAI C;  1P2K A;  3SN8 A;  1SG8 B;  3L3T A;  5HIZ A;  4PQW A;  1NF3 C;  3URE A;  2M0V A;  2XTT B;  1ANB A;  2IJD 1;  3P95 A;  1XXD A;  1EB2 A;  1IQL A;  1TNK A;  2FDA A;  3OY5 U;  1HAY B;  1RY4 A;  2QA9 E;  3SHW A;  3GCH B;  1ARB A;  2XC0 A;  2KAI B;  3TK9 A;  1EFR D;  1NTE A;  1M5Z A;  1W12 U;  2BX3 A;  3RXT A;  3QN7 A;  1Z7K A;  4ABH A;  1AFE H;  4KKD A;  2OCS A;  4Y8Y A;  2NU4 E;  1ZJD A;  2KAW A;  3FP8 E;  5F3X A;  3A85 A;  4DG4 A;  5FX6 A;  1BT7 A;  4ABF A;  1YPM H;  4XBD A;  1HAV A;  4GCH G;  1EOJ A;  2A4O A;  2OQ5 A;  2WZQ A;  3UOP A;  1FY5 A;  4A92 A;  3UIR A;  7GCH F;  1FQ3 A;  2FLR H;  2WYG A;  2WPD D;  2UZC A;  1MUE B;  1VR1 H;  1NRN H;  2XCN A;  3B76 A;  5EPY A;  4FUI A;  1RRK A;  3BEI B;  4UE7 H;  1V2W T;  3V0X A;  5JB8 S;  3PDZ A;  2BOH B;  2H1U A;  4TT3 D;  2D90 A;  1A46 H;  2GGV B;  1ELD E;  3ZIA D;  1X5Q A;  1MKW K;  5GND A;  2BX4 A;  4LOY H;  3K65 B;  3PV2 A;  1PPB H;  2GP9 B;  5L2Y H;  3SHC H;  1C5W B;  1O2N A;  2TRM A;  3S9A A;  3OTP A;  3RXR A;  4NFE A;  1GI0 A;  3F9G A;  2BD4 A;  5A09 A;  2ZHD A;  4D7G A;  1ZSL A;  1V2T T;  1PQA A;  1DM4 B;  1ZHM A;  4OEO A;  1EZS C;  1UCY K;  3FAN A;  1G3D A;  1Q31 A;  3UNQ A;  1W9Q A;  1MU6 B;  3P8N A;  2PKU A;  1O5B B;  3A7X A;  4HGC A;  3BEU A;  3F68 H;  2FYQ A;  1TAW A;  4VGC B;  1AND A;  4OS2 A;  1MQ5 A;  1PPC E;  2K20 A;  3RXA A;  4ABG A;  1QR3 E;  3SI4 H;  2QF4 A;  5DK1 A;  2QYI A;  2O9Q A;  1O3A A;  5JXB A;  1AIX H;  1LMW B;  1ZMN A;  5ESB A;  2ANK H;  2OC7 A;  1K28 D;  1LTO A;  2EV8 A;  3E8L A;  3T27 A;  1C5V A;  3LH3 A;  3WKM A;  3GYM A;  3TGK E;  1EZX C;  5E8E H;  4UU5 A;  2W3I A;  3SUG A;  2DLU A;  1TE0 A;  3EQ0 H;  2FTL E;  2XXL A;  5T3H A;  3QE1 A;  1CA0 C;  1THP B;  5DTH A;  1TMB H;  1VIT G;  1DPO A;  5T6F A;  4EST E;  1WF7 A;  1UCY E;  2W26 A;  3KQD A;  1UJV A;  4A7I B;  4AN7 A;  2C8Y B;  4A1X A;  1XUJ A;  3A8D A;  1PQ7 A;  3Q3K A;  1Q2W A;  1GBC A;  2ZHQ H;  2K1Z A;  2WV5 A;  2P95 A;  3TNS A;  5A0A E;  3O46 A;  4DII H;  1FY3 A;  2A5A A;  5B42 A;  3KZE A;  1P05 A;  1UIT A;  2Q6F A;  4BAK B;  2A45 B;  4E7R G;  5TCC A;  1BOQ A;  3AAU A;  3RDZ A;  1G32 B;  2PV9 B;  4OAJ A;  2AWU A;  1EAX A;  1S83 A;  2VIO A;  3EE0 B;  3SV8 A;  4YOI A;  3WW7 A;  2EDZ A;  1N99 A;  1YF4 A;  2RA3 A;  3CEN A;  4AMH A;  1ZTJ A;  4NWK A;  3SJO A;  1UJ1 A;  2FOH A;  3UY9 A;  2WPJ S;  5H4I B;  1N1L A;  2W5E A;  2KJP A;  3S69 A;  1L4Z A;  2GZ7 A;  1GPZ A;  2M5T A;  1AE8 H;  1SHH B;  3CS7 A;  3QTV H;  5FX5 A;  1U37 A;  2AGE X;  4E7N A;  3M5L A;  5FL7 D;  1XUF A;  3ZVF A;  1WXR A;  1NU7 B;  4WJG 2;  2XBV A;  4O97 A;  2BXT H;  5FB8 C;  1O2Q A;  3P8O A;  1KEF A;  1N6D A;  3R0H A;  2YMS C;  1LPG B;  4B73 A;  1N7E A;  2ZHE H;  2OPG A;  1A3E H;  3VB3 A;  1C2H A;  4GVD A;  3NPS A;  4CRB A;  1ZYO A;  5EG4 A;  1GG6 C;  2EAQ A;  1SLU B;  1QUR H;  4JOH A;  5E0G A;  4GVU A;  1MKW H;  3T25 A;  2KA9 A;  1O5G H;  1TOC B;  4NA7 A;  1LHE H;  2J94 A;  1VGC B;  3BTT E;  1B7X B;  2ASU B;  2XCF A;  6CHA B;  1YLC A;  2BOK A;  2CV3 A;  2OLG A;  2A5K A;  5LPR A;  1KTT B;  5FBE A;  2EGK A;  2ZFQ H;  2P94 A;  1COW D;  7EST E;  4D8N A;  3C1K A;  4X6M A;  2F9O A;  5C0U A;  1AI8 H;  4YES B;  2Z7F E;  3ODF A;  4NNL A;  3SYJ A;  3W1E A;  2BZA A;  2BYA X;  3L6P A;  3KDK A;  3JZ1 B;  2XW9 A;  1FY8 E;  3ZZ4 A;  1V2L T;  2RDE A;  3TIU A;  1J9C H;  3R69 A;  1O35 A;  3MI4 A;  1C2J A;  2FLB H;  2Z9I A;  1YGC H;  2AYW A;  2PSX A;  3KNX A;  1BTZ A;  3CS0 A;  2LP6 A;  2PGB B;  2CHA C;  3CBX A;  1TRN A;  2W7U A;  4NIY A;  1ZR0 A;  1CQQ A;  2EST E;  2BQ7 B;  1BMN H;  1Y3X A;  3RXB A;  4ISO A;  2VZ5 A;  1FAX A;  4HG6 A;  1YYY 1;  4U2W A;  1UTN A;  3A8C A;  3E1X B;  2JH6 D;  2WIN I;  3RXU A;  2XC5 A;  4ACB A;  1KXF A;  1TFX A;  3S7K B;  5I25 A;  2X7Z A;  2PWX A;  4X1S U;  3EAJ A;  4IMZ A;  4FOU C;  3OSY A;  2F4L A;  2FOD A;  1JMO H;  2RDL A;  1NRO H;  1ZHP A;  2SNW A;  1TMU H;  4AB8 A;  1MTN C;  2GT8 A;  3NFL A;  3I77 A;  5HFB A;  2ODP A;  3MNB A;  3MU1 A;  3HPK A;  4AYY B;  4H6S B;  1TGC A;  2Y5H A;  3K50 A;  1BQY A;  5AF9 H;  3V12 A;  3PO1 C;  1BE9 A;  3FN8 A;  1FJS A;  5LPF A;  2Z3C A;  4NMS A;  1DWD H;  1TPP A;  3A80 A;  5HMA A;  1F5L A;  2P3U B;  2OXS A;  2ZA5 A;  4OGX A;  1Y3U A;  1C1W H;  2PFE A;  5A2P A;  2KX4 A;  1S81 A;  1QIX B;  3AVZ A;  2DC2 A;  1DOJ A;  1DST A;  2GT7 A;  1YY3 A;  1V2U T;  1UF1 A;  1FLE E;  2G51 A;  1UHB A;  4LZ1 H;  1SFQ B;  4NNM A;  1G37 A;  2J98 B;  1AY6 H;  1HB0 B;  5DJ7 A;  5HFC A;  1SR5 C;  4JOF A;  1GHB F;  3ZVG A;  4ACA A;  5G1D A;  3E6P H;  5FBI A;  2GCH G;  4N6X A;  4XBB A;  2JH0 D;  2ZZU H;  1CT0 E;  3STJ A;  3N7E A;  2ZCH P;  1C1N A;  1OP0 A;  2KOM A;  2P93 A;  1GBL A;  3GDU A;  1FZZ A;  2IPH A;  2SGF E;  3RMM H;  3MO6 A;  4JOJ A;  3SU1 A;  1QQU A;  3NKK A;  4MPX A;  2JWE A;  2KL1 A;  3ID1 A;  2KCO A;  4ISH H;  2R0L A;  1GJ5 H;  1OPH B;  1E0F D;  3FZD A;  3ODD A;  1FC7 A;  1T2M A;  2QBW A;  1WCZ A;  4JZD H;  2KCP A;  1UVU H;  1CHO F;  2ZPQ A;  1FN6 A;  5K0H A;  3A82 A;  3SV9 A;  3N7D A;  3QTO H;  4O3T A;  1HAI H;  3RLE A;  4NZL A;  2AEI H;  1Y59 T;  1O2I A;  1QY6 A;  2PZD A;  4BTU B;  1CT2 E;  3F2G A;  4EDJ A;  5CE1 A;  1KIG H;  2Q9V A;  4ZHL U;  3BTQ E;  2Z9L A;  1A5G H;  3ELA H;  1HDT H;  1C2G A;  5EJZ A;  3RM0 H;  4MTB A;  1C1M A;  1V1T A;  4Y79 A;  1IHJ A;  3UOU A;  3I1E A;  1P10 A;  1BRU P;  1GI8 B;  3ID4 A;  1V2R T;  1IQF A;  4UFD H;  1GMC G;  3MU8 A;  3SHA H;  1J16 A;  1N6Y A;  4JZE H;  2JXO A;  4BAN B;  1HYL A;  1NO9 H;  2ZU1 A;  1C1P A;  1L1J A;  3EYD A;  1BTY A;  2TGT A;  3T28 A;  1X5R A;  2L97 A;  2Z94 A;  1MH0 A;  1TGT A;  1TA6 A;  1MBQ A;  1RTK A;  5TCA A;  4CHA C;  4HI3 A;  2PKA A;  1ANE A;  3NUM A;  3SND A;  4Z6A H;  1HNE E;  5DP9 A;  4IW4 E;  3EGG C;  2AIP A;  4Z8J A;  5ABW A;  5IK2 D;  1K1M A;  1LVO A;  4NXP A;  1T7C A;  3EA8 A;  5AFY H;  1Z6J H;  1PDR A;  1TOM H;  2W7R A;  1GMD F;  2I6S A;  3PM3 A;  1OZI A;  9EST A;  1Y8T A;  2R2M B;  1FPC H;  2VIV A;  3QGN B;  1UFX A;  1BTU A;  3DSP A;  3E0P B;  3RLW H;  3DIW A;  1TQ0 B;  1T4V H;  5EXN A;  2V90 A;  3E90 B;  1MAX A;  3L4F D;  4RN6 A;  4XOJ A;  3SV6 A;  4BTI B;  2KCA A;  1K1J A;  1DIC A;  3BTG E;  3TGJ E;  3HGP A;  2FMJ A;  4Y7A A;  1QB9 A;  5FCR A;  2BVR H;  1QAV A;  4KP0 A;  2FI3 E;  3F9E A;  3M5N A;  1DS2 E;  4M9F A;  1C5U A;  1NC6 A;  2P8O B;  1NRR H;  4D76 A;  4ZKS U;  1D6R A;  1TNL A;  2G55 A;  3F0P A;  4Q3H A;  1MZD A;  1FXY A;  1SGY E;  8KME 2;  1WYK A;  2VGC C;  3BF6 H;  2XC4 A;  1K22 H;  2F9P A;  4FUJ A;  3FZZ A;  1MAB B;  2KG2 A;  1NFW A;  1NN6 A;  1S5S A;  1SGF G;  4P0C A;  1H8D H;  3ZZC A;  1WOF A;  1BFE A;  2EI7 A;  1TQ3 A;  5C94 A;  5A0C A;  1UEP A;  4FUG A;  3M5M A;  1EP6 A;  1EPT B;  1VJA U;  2KR7 A;  1ZSJ A;  5EXM A;  5A0B A;  2HWL B;  1CBW B;  1MKX K;  1D5G A;  3R0F A;  4AOR A;  3RXK A;  4ZCN A;  1V5Q A;  1PFX C;  1ZRB A;  2G4U A;  1QBV H;  4BOH A;  3PMA B;  1S82 A;  2H9E H;  2ILN A;  5A8Z A;  4CRA A;  1FON A;  2NU1 E;  2LOB A;  3U8R H;  2BZ6 H;  2CF9 H;  1BHX F;  2XNI A;  1Z8G A;  4IN1 A;  1GHX H;  4RI0 A;  4AG1 A;  3PS4 A;  4I86 A;  4Q7X A;  1YCP K;  2XWA A;  1UMA H;  3RU4 T;  3RC5 A;  2C8Z B;  3PV5 A;  3QIK A;  3SJK A;  3VXE H;  5A8Y A;  2NU0 E;  3ZV8 A;  1GJD B;  1C5T A;  1EX3 A;  5GIB A;  3A83 A;  4B75 A;  5EJ1 A;  3Q3X A;  4INL A;  3LNX A;  4AX9 H;  1LQD B;  1D3T B;  2K8I A;  1P06 A;  1S6F A;  2BQW B;  1HJ9 A;  1NS3 A;  1E79 D;  1SQR A;  3PRB A;  1C5R A;  1C4V 2;  1CHG A;  3OAA D;  1W0Y H;  4Y10 E;  3RXL A;  4X8U H;  4DCD A;  4HOP A;  3SNC A;  5JBC S;  1BA8 B;  1AUJ A;  4FUE A;  2G00 A;  2ZFP H;  3MNS A;  4B74 A;  1E1R D;  4U32 A;  4NA9 H;  1L4D A;  1XUI A;  1C1R A;  1QA0 A;  5E11 A;  1UEW A;  1CT4 E;  4WMD A;  4YXW D;  2BY6 X;  1GBT A;  2RFK C;  1UTP A;  4AFQ A;  1GQ5 A;  1OKX A;  2WPK S;  1W7G H;  3S9C A;  2OMJ A;  4F55 A;  2ZWL H;  3EE7 A;  3U69 H;  5T6G A;  1GI5 A;  4JJ3 A;  2F0A A;  2AGI X;  3PRD A;  4ABD A;  3A81 A;  2ANY A;  1O5C B;  2Q3G A;  2G5V A;  2JIK A;  3OU0 A;  1Z8R A;  1LKA A;  3MU4 A;  4IN2 A;  1QJ7 B;  5ETX A;  4MPV A;  3UFA A;  2D92 A;  4FUD A;  1ETR H;  5EOD A;  3SOS A;  1GGD B;  1P01 A;  4UDW H;  1EZQ A;  2F3C E;  3MNX A;  3I18 A;  3FP7 E;  2QF3 A;  1AO5 A;  2FYR A;  2XBX A;  3WWF A;  3DFL A;  3BV9 B;  2PTC E;  1UTO A;  2GZV A;  3MH6 A;  1OBX A;  5HFF A;  1F0U A;  3I29 A;  2G5M B;  2V3M A;  1AB9 C;  2P59 A;  3RXP A;  3VB7 A;  2JIZ D;  3M61 U;  1BRC E;  1MTS A;  2LC6 A;  1GJ4 H;  4JK5 A;  1O3D A;  3UTU H;  2ZP0 H;  4JOE A;  3SHU A;  1QA7 A;  4I7Y H;  3D49 H;  1UK4 A;  3M3S A;  3TLO A;  2PKS B;  2H2C A;  4WH8 A;  3KHF A;  1O2R A;  5E22 A;  4Q2O A;  1WQV H;  1HAV B;  4H42 U;  1GCT C;  3NRL A;  3PMJ A;  1QGF A;  2HLC A;  4TPI Z;  3VB6 A;  4AYV B;  5EGM A;  4WXV A;  2FO9 A;  2EEK A;  4YO9 A;  1LHC H;  1Q3P A;  3BTF E;  1MKX H;  2QXH A;  2W6I D;  1AE5 A;  4GHN A;  3PMH B;  3BSQ A;  3OTJ E;  1ZRK A;  1QBO A;  1SLV B;  2C8W B;  2FES H;  1V2N T;  3NZI A;  2GCT B;  1GBE A;  2I6Q A;  1AVX A;  5GWZ A;  3LGV A;  4BAH B;  3HGN A;  2HPP H;  1FX0 B;  3TSZ A;  2OC8 A;  1MTU A;  2BHG A;  4XHV A;  1ZML A;  1GHA G;  3LGY A;  1SQA A;  4U01 A;  1UM1 A;  1C9P A;  1GWA A;  2AER H;  1Z87 A;  1DUE A;  1Y7N A;  3SZN A;  4ZUH A;  1W10 U;  2OZF A;  1WSS H;  5LH8 A;  3U9A H;  3I4W A;  1RIW B;  2JIN A;  1NES E;  2PHB A;  4TSF D;  3BTW E;  3A89 A;  4UU6 A;  2BD5 A;  2QIQ A;  1SGD E;  4FVD A;  2VSV A;  5H3J A;  1UTK A;  2VWN A;  1A5I A;  2I04 A;  3GCH C;  1T4U H;  3EGH C;  2ZHW H;  2A0Q B;  1F7Z A;  1ZGV A;  4ZXX H;  1XM1 A;  3QZQ A;  5DPA A;  1FNI A;  5C5O A;  1MTW A;  1ESA A;  1SMF E;  4FVB A;  1IOE A;  2XWB I;  3F0O A;  3URC A;  1O3L A;  4IC5 A;  1G3C A;  2DAZ A;  2PA1 A;  2B7D H;  1DT2 A;  6GCH G;  1LVY A;  4Y8X A;  1QBN A;  4MVN A;  1RGQ A;  1DX5 M;  5HKK D;  3R3G B;  2BDY A;  3KYG A;  4CRD A;  1INC A;  4B2B A;  5EQQ A;  4Q2N A;  3KQC A;  2R3U A;  1UTQ A;  5GCH G;  2YT7 A;  5C1Y A;  1D9I A;  4B71 A;  2ZKS A;  2R4H A;  1K1L A;  1Y3Y A;  1MQ6 A;  1IQM A;  1C1T A;  3TSV A;  2ZU4 A;  2CK3 D;  2G4T A;  1BMF D;  2CS5 A;  4XE4 A;  2KRG A;  4L8N A;  9LPR A;  2BLO A;  2OK5 A;  3K6Y A;  1CA8 B;  5L6N H;  4DT4 A;  3ITI A;  2KPK A;  2DUC A;  2GZ8 A;  1O2Z A;  1MZA A;  4Q7Z A;  3T26 A;  5F67 A;  4DOQ A;  1KXE A;  4MNY A;  3MTY A;  1SI5 H;  2CN0 H;  4MQA A;  6EST A;  3HK3 B;  2ZFR H;  1TNG A;  1TX8 A;  1O0D H;  4AFS A;  4CRF A;  5JDU B;  1F0R A;  3GDS A;  4TYD A;  5A2M H;  3SUD A;  1HBT H;  2A7C A;  3BEF B;  2OC0 A;  1AZ8 A;  2FE5 A;  2ZI2 H;  3TJO A;  7LPR A;  3GDV A;  1TP5 A;  3KGP A;  4FUC A;  1AHT H;  1DUA A;  3LGI A;  3NCL A;  4ZMA H;  1DY8 A;  4F4O C;  1AVG H;  3LDX H;  3TPI Z;  4VGC C;  1Z8I B;  1CGH A;  3ATM A;  3QZR A;  4NWL A;  4CH8 B;  3KQ5 A;  4MPW A;  1YLN A;  2BD9 A;  4P00 A;  2Z9G A;  1N6X A;  1DLK B;  4ASU D;  2YUB A;  2VPH A;  2L74 A;  2TIO A;  4SGB E;  3BN9 A;  2PSY A;  1IHS H;  2GVF A;  2BYG A;  1XKA C;  1ZPC A;  2OCV B;  1JXP A;  2F9V A;  1AUT C;  3A87 A;  2Z6B D;  3LU9 B;  1V2Q T;  2BLW A;  2FNE A;  3ATK A;  5CHA B;  3SGQ E;  3MU5 A;  5EW1 H;  4XRN A;  5KED A;  1W13 U;  2VH6 A;  4ISI H;  1C2F A;  1RTF B;  1ELG A;  3GAB A;  2QXG A;  4Y71 A;  3CYY A;  2GZ9 A;  3KEE A;  1S85 A;  2DE9 A;  5E1Y A;  4DGJ A;  2FOM B;  3VEQ B;  4K1S A;  3PYH A;  3IG6 B;  4CRE A;  1P8V C;  1TIO A;  5E6P B;  1YWU A;  4RT0 A;  2FCF A;  3SU0 A;  2ANM H;  2C4F H;  2Z3E A;  3VQG A;  1EXF A;  2TGP Z;  1O3O A;  1Z71 A;  2GEF A;  1NRP H;  2BY9 X;  2Y81 A;  4X2X A;  5AVD A;  3F2F A;  4X1P U;  1C2E A;  4RKO B;  1ZHR A;  4JOG A;  1HCG A;  4PRO A;  4CBO A;  1KDQ A;  3RUO A;  1A0J A;  1J17 T;  3I78 A;  1MD7 A;  1OP8 A;  3KQB A;  3ID3 A;  5EW2 H;  4KTC A;  3KF2 A;  1GMC F;  2JDI D;  4UEH H;  3V13 A;  2P3W A;  1C5N H;  1SVP A;  3F6U H;  3GY2 A;  4KEL A;  3SV2 H;  3UNR A;  3WY8 A;  2B9L A;  1P3C A;  4MNW A;  4K2Y A;  3V7T A;  1G30 B;  3KID U;  5GDS H;  1P2O A;  2Y7X A;  3KYF A;  3OFN D;  1CA0 B;  1QCP A;  2BVS H;  4YOJ A;  2EI6 A;  3U8O H;  1TB6 H;  4JZ1 A;  3ID2 A;  2CXV A;  3GY6 A;  3UNS A;  8GCH G;  5GJ4 B;  4GLY A;  2PNT A;  3O8R A;  3GY5 A;  3BTH E;  1YPG H;  3PMB B;  1OXG A;  1S0Q A;  5GPI B;  1SGF A;  1P57 B;  4K3J A;  2EHR A;  1CSO E;  3QX5 H;  3SJ8 A;  4DW2 U;  3LPR A;  1C2I A;  1A3B H;  3VG8 A;  3E0N B;  2AIQ A;  1U6Q A;  3SJ9 A;  3ZZ9 A;  4P02 A;  2XBY A;  4MNX A;  1VGC C;  1V2P T;  3L33 A;  4I32 A;  1WI2 A;  1EAI A;  2BDG A;  1SLX B;  3LON A;  4GPG A;  3GCT F;  3GS9 A;  1A7S A;  2ZNK H;  2SGE E;  1O2V A;  2AMP A;  3G01 A;  2VSP A;  2ZDA H;  4Q6S A;  2BTC E;  3SOR A;  2ANW A;  4F49 A;  4NCY A;  2ZU3 A;  1AGJ A;  1XUH A;  1BZX E;  2HLD D;  2EEJ A;  3VGC B;  5FHT A;  1ELC A;  1S6H A;  1SPJ A;  3PDV A;  2KOH A;  1AMH A;  2QG1 A;  1TMT H;  1UHB B;  2H3L A;  1O2O A;  3K82 A;  4R0I A;  1C2L A;  2ZGC A;  2ENO A;  1W7X H;  3B8J A;  1V6D A;  3D65 E;  3D23 A;  3GY3 A;  1TNJ A;  1GBF A;  1ORF A;  3R68 A;  1VZQ H;  2VIP A;  2BQ6 B;  1TPA E;  4H11 A;  3H09 A;  1GL0 E;  2G8T A;  2QT5 A;  1Z1J A;  2GDE H;  5FPT A;  3E17 A;  1ELT A;  2KV8 A;  1WHD A;  2HGA A;  3NFK A;  4YOG A;  5L2Z H;  3A86 A;  5FXL A;  3LH1 A;  4I8L A;  2L4T A;  2FOC A;  3VFE A;  2FOF A;  3RXD A;  3SGB E;  3HKI B;  2RCZ A;  4BXW A;  4RKJ B;  1P3E A;  1TRY A;  2BY7 X;  2O8T A;  3EGK H;  1TGB A;  5FPY A;  2A2Q H;  3SU6 A;  3U1J B;  2Y80 A;  1EAU A;  1O2W A;  3DJA A;  1YLD A;  4X6O A;  3SNA A;  3GYL B;  4WWY A;  1IQE A;  4JMY A;  1YPK H;  2ODY B;  5E0J A;  3KQE A;  2J92 A;  3PTN A;  1O3G A;  4X1R U;  5AFZ H;  2FPZ A;  4AOQ A;  3DCL A;  1Y3W A;  3TGI E;  3GCN A;  1O3B A;  4K76 A;  1VJ9 U;  3GY8 A;  3LGT A;  3CBZ A;  1O38 A;  4NIX A;  2KFW A;  2Y6T A;  4AFU A;  2PLX A;  2SFA A;  2J34 A;  5PTP A;  3SU2 A;  4MLF B;  1MC7 A;  2BDB A;  1ZTL A;  3NWU A;  1D6W A;  1UTJ A;  2D8I A;  3SUF A;  1SGI B;  1A2C H;  1W3C A;  1SGQ E;  2KZ4 A;  5SGA E;  2CHA B;  3K2U A;  3HVQ C;  1P1D A;  1U38 A;  1G2L A;  4X8T H;  1WV7 H;  3ZVD A;  3SU3 A;  2UUK B;  3SUZ A;  1N8O B;  4NA8 A;  4B6F A;  1GMH F;  1O2Y A;  1Y5U T;  4KTS A;  2GMT B;  1P02 A;  1H8I H;  2EQN A;  4B2A A;  2PKA B;  1WG6 A;  3RXM A;  7GCH G;  2Q1J A;  3UR9 A;  2ZGH A;  2BDH A;  1KTS B;  5CDF E;  1GCD A;  3P8F A;  4JYV H;  1GDN A;  3T29 A;  1UJD A;  5C67 A;  4YYX A;  3P8G A;  4X6P A;  4OS1 A;  3MYW A;  5KGO A;  5E21 A;  1P9U A;  4FU7 A;  1B8Q A;  2QKV A;  2YNA A;  2I1N A;  1NPM A;  1HIA A;  1RD3 B;  2O8M A;  4OS5 A;  4Y7B A;  1O3E A;  2ODQ A;  4R2Z A;  2ZPR A;  1EAS A;  4Z1M D;  1M9U A;  4WH6 A;  2W7S A;  1A0H B;  3ATW A;  5L30 H;  1O2H A;  1JWT A;  4O03 A;  2TGD A;  1AKS A;  2Y5G A;  1BHX B;  1KXB A;  4ZRO A;  1L1G A;  1XUK A;  2BD2 A;  3LJO A;  1QHR B;  1O32 A;  1QAV B;  3BG4 B;  5EQR A;  2I0I A;  1SKY E;  2AGG X;  3QUM P;  4KTU A;  1C1O A;  2FZZ A;  4Y8Z A;  2ZGB H;  3GIC B;  3GJ9 A;  2ZCL P;  5DO4 H;  4WY3 A;  3DJ1 A;  2QF0 A;  2QXI A;  5CHB A;  1EZU C;  3A7V A;  1GVK B;  2H2Z A;  3N7O A;  2BDC A;  3KCG H;  3ZVB A;  2ZIQ H;  1AQ7 A;  3RU4 D;  3CP7 A;  5BPE A;  4BAM B;  1SGN E;  1TBZ H;  2BB4 A;  3C27 B;  1EOL A;  1GM1 A;  5E0H A;  1B0E A;  1IQK A;  1O37 A;  1C5Y B;  3RMO H;  5HET A;  1KSN A;  1TPO A;  3CC0 A;  2QAA A;  1ZTK A;  4OS6 A;  4GHQ A;  2M0Z A;  4FUH A;  1QJ6 B;  4DVA U;  3RL7 A;  1C1S A;  2NU2 E;  1TGN A;  3O8B A;  3ZZB A;  3RMN H;  5EYZ A;  4JYT A;  2EGN A;  4OGY A;  4Y11 E;  3TJN A;  3SUE A;  3OE7 D;  1SQO A;  1O30 A;  1TX6 A;  4AGK A;  1PPF E;  1ZOM A;  2XYA A;  4OS7 A;  4X0W U;  2H3M A;  2W3K A;  3FVF B;  1KYN A;  1K1O A;  1O3N A;  1C2K A;  3FY5 A;  1CGI E;  1LPZ B;  1H9H E;  2IWQ A;  1GI9 B;  1RJX B;  2M2A A;  2VU8 E;  2EC9 H;  2TBS A;  2AIN A;  4K8Y A;  1T8L A;  3RC6 A;  4XFQ A;  1GHA F;  4BAQ B;  1UTL M;  1CE5 A;  1EST A;  1BJV A;  1K0H A;  5HED A;  1HAZ B;  1L2E A;  4NSV A;  4WYT A;  2O2T A;  4IS5 A;  3ATI A;  5B6L A;  3M7T A;  3ZYE A;  1V2S T;  5C2Z A;  1GBJ A;  4HOP B;  5HF1 A;  2J97 A;  3KL6 A;  5C0T A;  1KWA A;  1VJ6 A;  1B5G H;  3Q77 A;  1HGT H;  3GIS B;  2VIQ A;  3DUX H;  1ELF A;  1NFU A;  1YBW A;  1K1P A;  2P8O C;  5E2O A;  1PYT D;  2RRM A;  3P92 A;  4Q2Q A;  1HJ8 A;  3SW2 B;  2BLQ A;  2PW8 H;  1THS H;  1WDI A;  4ZH8 A;  1FPH H;  1CGJ E;  3WKL A;  2P3F H;  1E35 B;  3OX7 U;  4NXQ A;  1MFL A;  5C5N A;  2BM2 A;  1C5Q A;  2OUA A;  1OX1 A;  1TAB E;  1CO7 E;  4FU8 A;  1J14 A;  3DA9 B;  3PLP A;  2V0B A;  1EKB B;  1OWK A;  1J8A A;  1OWD A;  4YZU A;  1EPT C;  5BRR E;  3GOV B;  5D13 A;  2FX4 A;  3NGH A;  1DWE H;  3M7U A;  3T62 A;  2Y5F A;  2A4Q A;  3OEE D;  1WI4 A;  5F03 A;  3TSW A;  3GGE A;  1OP2 A;  4D7F A;  2O8L A;  1G3B A;  1J15 A;  3ZRT A;  1NTP A;  1W2K H;  1O3C A;  3EST A;  2AFQ B;  2IWP A;  2GV6 A;  2ZG0 H;  4M7G A;  2GDD A;  4AB9 A;  1OBZ A;  3O5N A;  3QDZ B;  1DIT H;  3MU0 A;  1UJU A;  1LDT T;  2FIR H;  5HF4 A;  1MBM A;  1Z1I A;  4GCH F;  2R0K A;  3IWM A;  2ZEC A;  1IHT H;  3P6Z B;  3RXF A;  5K7R A;  1YPE H;  1TGS Z;  3V3M A;  3SNE A;  4Z0K A;  2ZCK P;  1OHH D;  2ZPS A;  1MMJ N;  1ESB A;  2FM2 A;  2V3H H;  1QL8 A;  3EDX B;  1O36 A;  2VGC B;  4NMV A;  3DFJ A;  2Q6D A;  3RU4 E;  3RC4 A;  1O2P A;  3H7T A;  1L6O A;  3A8A A;  3W94 A;  1UK3 A;  4YDP A;  1EJM A;  2YTW A;  5C17 A;  5EJL A;  4INH A;  3TNT A;  1GVL A;  2GD4 B;  2TPI Z;  4NMT A;  2KM0 A;  1O2G H;  4A6L A;  2WSS D;  1LKB A;  1HPG A;  2B0F A;  3RXS A;  2ZU5 A;  2FS9 A;  2PP6 A;  3RXI A;  1LHD H;  1BML A;  3B9F H;  3SO3 A;  1O33 A;  2AMQ A;  1V62 A;  1CU1 A;  4ASH A;  4K60 A;  3SZE A;  1GBM A;  2QV1 A;  2CMY A;  4NSY A;  1SGR E;  4LXB H;  1FV9 A;  5HIY A;  5CMX H;  4IGD A;  2DKR A;  3TJU A;  3LT3 A;  2PKT A;  3AW1 A;  3IIT A;  4INK A;  2ULL A;  5GLJ A;  1O3K A;  2P16 A;  1AFQ B;  1OYT H;  1TWX B;  4F48 B;  3SU5 A;  4IC6 A;  2BD3 A;  2J2U A;  3LKW A;  3PRO A;  1GGD C;  5DP8 A;  2FOE A;  1W11 U;  1K1I A;  2HVY B;  1UEQ A;  3K9X B;  2TGA A;  3MNC A;  2BY5 X;  1WJL A;  3ZZA A;  1X6D A;  1JOU B;  1SSX A;  1JIM A;  2ALP A;  5HFE A;  2D8W A;  3LIW A;  5E2P A;  2DB5 A;  1ETS H;  2QXJ A;  1C9T A;  2OD3 B;  1LCY A;  3TH4 H;  1O34 A;  1MAY A;  1DLE A;  3DSO A;  1VIT F;  1BTX A;  1THR H;  1SFI A;  4KGA A;  1Y5B T;  1RGW A;  1GHY H;  2Z9K A;  2PKS C;  3STI A;  4K6Y A;  1HJA B;  4YT6 H;  1OS8 A;  2VH0 A;  4CR5 A;  1W14 U;  4I8K A;  1C4U 2;  1VIT H;  1EAT A;  1HAO H;  3S7H B;  1C5M D;  1VCP A;  1GI2 A;  2ALV A;  1N7F A;  2IOT A;  2WYJ A;  2IN2 A;  3ZYD A;  1QFK H;  3LC5 A;  4DUR A;  2Y82 A;  1C5Z B;  2OIN A;  1BJU A;  1X5N A;  1KXC A;  2NU3 E;  1PPG E;  2A7J A;  3ZZ8 A;  1V3X A;  1GJB B;  2Y7Z A;  2G5N A;  1SGT A;  1PQ8 A;  1NBM D;  2ZDK A;  1OWE A;  2GCT C;  3DOR A;  4GVC A;  3KHV A;  4ABI A;  4E06 H;  4FUF A;  3JZ2 B;  1S0R A;  2A4R A;  1P04 A;  4RSP A;  1QAU A;  3TJV A;  4K1T A;  1KLI H;  2BDI A;  2O8U A;  5FPS A;  3D62 A;  4NMQ A;  1IU0 A;  4UFF H;  4X8V H;  1C1U H;  4K1E A;  2A2X H;  1O2J A;  2WHX A;  1SGC A;  3F2H A;  1ID5 H;  2EEG A;  1VB7 A;  1K32 A;  1SB1 H;  1YPL H;  1CVW H;  2OTV A;  3E16 B;  3F9H A;  5F8Z A;  1K21 H;  4UON A;  2V7Q D;  1A1R A;  3LGW A;  2JRE A;  1EJA A;  3M5O A;  3ATL A;  2DMZ A;  4I33 A;  5F8T A;  3UWI A;  1SGE E;  4B2C A;  1T8O A;  2D26 C;  1UEZ A;  1F0S A;  2WPM S;  3PLK A;  3F9F A;  3MHW U;  2J95 A;  1GBD A;  4FXG H;  1EAW A;  2JET B;  3OEH D;  1VCQ A;  2O8W A;  5DSF A;  1TON A;  3NXP A;  3ZZ7 A;  5DP3 A;  4XSK U;  3SQE E;  4NGA H;  3SNB A;  4TWY A;  2ZEB A;  3W95 A;  1GMD G;  1TBR H;  2VNT A;  2ZDL A;  4I8H A;  1FN8 A;  2VIN A;  1GBA A;  5HYO A;  2RCE A;  4LZ4 B;  2IJO B;  4BTT B;  1Z86 A;  2YUY A;  1P12 E;  2EXG A;  1FC6 A;  1O3M A;  1Q3X A;  4AGJ A;  1KLT A;  2K1Q A;  1H8E D;  4K69 A;  5IYT A;  1HUT H;  1E36 B;  3RXE A;  2EEI A;  1NT1 A;  4KFV A;  1QRZ A;  3F1S B;  1UM7 A;  4Q2K A;  3RM2 H;  2V35 A;  1C5O H;  3LOX A;  1G9I E;  4K72 A;  3E91 A;  2ZDM A;  5DGJ A;  2WPI S;  3KDG A;  1EUF A;  4GAW A;  3UQO A;  1EB1 H;  2I4S A;  1KDQ B;  1ELB A;  1DXW A;  1PJP A;  4K8B A;  1FCF A;  7KME H;  4ZHM U;  1OOK B;  1TP3 A;  4WYU A;  2PUX B;  3T5F H;  1O2S A;  1UO6 A;  5EQS A;  3A84 A;  4THN H;  1X45 A;  2IPQ X;  1GBB A;  4IBL H;  1N6F A;  1C1Q A;  1GHV H;  1TRM A;  1Y3V A;  1T31 A;  3H7O A;  4Q63 A;  1O5A B;  3P17 H;  1HLT H;  1TPS A;  1A0L A;  1KLJ H;  1ABJ H;  3A7T A;  3TVJ B;  2VRF A;  1BDA A;  3VPK A;  2OP9 A;  4LK4 A;  2R9P A;  1UVT H;  3F3B A;  2EGO A;  5EIY A;  1H4W A;  2FX6 A;  3SFJ A;  2ZFT A;  2QY0 B;  3HPT B;  1NBM E;  5HFD A;  3FKS D;  5IL9 A;  1GJA B;  1NU9 A;  2AHM E;  2HNT F;  3M37 A;  4JZI A;  1P0S H;  4DY7 B;  3VB5 A;  2A32 A;  4J1Y A;  1FMG A;  2FP7 B;  1K9O E;  3RP2 A;  1IAU A;  2BLV A;  5CHA C;  3TU7 H;  1LO6 A;  3MWI U;  2XRC A;  4DIH H;  3QGJ A;  2KJK A;  1HAH H;  4YLU A;  4ABJ A;  2OQU A;  2IWN A;  1E38 B;  2GCH F;  3TK5 A;  1I92 A;  3KZD A;  3M35 A;  1YKT A;  4E3B A;  4X1N U;  2H9T H;  2UWL A;  3M36 A;  1GHW H;  1TNI A;  1NM6 A;  3PB1 E;  1R6J A;  1O5E H;  2H5C A;  1XXF A;  3B23 B;  1L1N A;  3DT0 H;  3LJJ A;  2FOB A;  1LVM A;  2OBQ A;  3LNY A;  3HAT H;  4ABE A;  1BBR H;  2M0T A;  4H6T A;  1SOZ A;  3A7Y A;  4Y6D A;  5HDY A;  3BTE E;  1S84 A;  2F5Y A;  1MFG A;  4Q2P A;  1AU8 A;  1HAG E;  2D2D A;  4XBC A;  2HAL A;  5A8X A;  2V6N A;  1FDP A;  1TA2 A;  1UW7 A;  1NZQ H;  2WPL S;  2Z3D A;  1UK2 A;  3MH4 A;  1MCT A;  2JH5 D;  2WV4 A;  4NMR A;  1GJ6 A;  1PQ5 A;  2Z17 A;  2GX4 A;  1TAL A;  3M3T A;  3BTK E;  1OSS A;  3A88 A;  1HV7 A;  2UWP A;  1V2V T;  1WBG B;  1GL1 A;  3P70 B;  2KAI A;  3UB0 A;  1X8S A;  2LUI A;  1I16 A;  5HGG A;  4ISN A;  2BY8 X;  3GY7 A;  2F9B H;  2A1D B;  3EA7 A;  1MD8 A; 
#chains in the Genus database with same CATH homology
 1B8Q A;  2QKV A;  4ZCN A;  1V5Q A;  2KOJ A;  2I1N A;  3MH7 A;  2O8M A;  1Q7X A;  4R2Z A;  4FET A;  2YMS D;  4Z1M D;  3HPM A;  2JOA A;  1GQ4 A;  2LOB A;  3O8D A;  4WH6 A;  2XNI A;  3SU4 A;  2F9U A;  4RI0 A;  4O06 A;  4JOP A;  3PS4 A;  1V5L A;  1P1E A;  4F8K A;  2VWR A;  4OM9 A;  3N99 A;  2LA8 A;  2QF5 A;  3RC5 A;  3PV5 A;  3QIK A;  1QAV B;  4G69 A;  2W4F A;  2I0I A;  5EQR A;  1SKY E;  1VA8 A;  2PDZ A;  4B75 A;  2QKU A;  3LNX A;  4PQW A;  1NF3 C;  3GJ9 A;  2M0V A;  2K8I A;  2IJD 1;  3DJ1 A;  5CHB A;  2ZPL A;  1NS3 A;  2W6J D;  1RY4 A;  1E79 D;  3SHW A;  3PRB A;  2M10 A;  3OAA D;  2OS6 A;  1EFR D;  4HOP A;  1NTE A;  1M5Z A;  1GM1 A;  2ZPM A;  4B74 A;  1E1R D;  5HET A;  1YBO A;  2OCS A;  1UEW A;  3CC0 A;  5E11 A;  4YXW D;  2KAW A;  5IDK A;  2M3M A;  2M0Z A;  1GQ5 A;  3RL7 A;  5F3X A;  2OMJ A;  3O8B A;  4F55 A;  1BT7 A;  5EYZ A;  2EGN A;  1N6E A;  5ILB A;  3SUE A;  4JJ3 A;  2WZQ A;  2F0A A;  3OE7 D;  4A92 A;  3PRD A;  2YMS B;  1WH1 A;  2H3M A;  2Q3G A;  2WPD D;  2UZC A;  2JIK A;  2XCN A;  3OU0 A;  5HEB A;  2KCY A;  3FY5 A;  1ZOK A;  3B76 A;  5EPY A;  5ETX A;  2IWQ A;  2D92 A;  4KFW A;  2M2A A;  1DY9 A;  2AIN A;  1VAE A;  4REY A;  3RC6 A;  3PDZ A;  3I18 A;  4TT3 D;  2D90 A;  2KPL A;  2GGV B;  5HED A;  3ZIA D;  4WYT A;  2O2T A;  1X5Q A;  3JXT A;  3WWF A;  5B6L A;  5GND A;  3WWB A;  1ZUB A;  2GZV A;  3PV2 A;  1RTL A;  3MH6 A;  4HOP B;  2CSJ A;  5HF1 A;  1OBX A;  5HFF A;  5C0T A;  1KWA A;  2G5M B;  1VJ6 A;  2P59 A;  2JIZ D;  2LC6 A;  2KYL A;  3OTP A;  4JOE A;  3SHU A;  4I31 A;  4WH8 A;  2H2C A;  2RRM A;  3KHF A;  4Q2Q A;  4OEO A;  5E22 A;  4Q2O A;  2I0L A;  1W9Q A;  3P8N A;  3WKL A;  2PKU A;  3NRL A;  4NXQ A;  1MFL A;  1Q3P A;  3BPU A;  2QKT A;  2W6I D;  2K20 A;  4GHN A;  2QF4 A;  5D13 A;  3NGH A;  2F43 B;  4NMO A;  3K1R A;  3OEE D;  5JXB A;  2A4Q A;  1WI4 A;  1W0K D;  5ESB A;  3TSW A;  3GGE A;  2OC7 A;  4B6E A;  2EV8 A;  2LC7 A;  3WKM A;  1RZX A;  3ZRT A;  1E1Q D;  4UU5 A;  3SUG A;  2IWP A;  1FX0 B;  2DLU A;  1OBZ A;  3O5N A;  1W0J D;  3TSZ A;  1TE0 A;  4JL7 A;  2OC8 A;  1UJU A;  4XHV A;  5HF4 A;  3QE1 A;  4U01 A;  5DTH A;  1UM1 A;  4B76 A;  1WF7 A;  1KMH B;  1Z87 A;  1UJV A;  1Y7N A;  4A1X A;  2OZF A;  5EPN A;  1UHP A;  3I4W A;  2CSS A;  2WL7 A;  2K1Z A;  3O46 A;  2JIN A;  4TSF D;  1OHH D;  3QDO A;  5B42 A;  2FM2 A;  3KZE A;  4UU6 A;  1UIT A;  2VSV A;  4NMV A;  5H3J A;  3RC4 A;  1L6O A;  3SOE A;  2EJY A;  2I04 A;  2OQS A;  4OAJ A;  3EGH C;  4YDP A;  2AWU A;  4JOK A;  2YTW A;  5C17 A;  3SV8 A;  3WW7 A;  2EDZ A;  1N99 A;  4NWK A;  4AMH A;  3TMH A;  4NMT A;  2KM0 A;  5H4I B;  1N1L A;  3QJN A;  2WSS D;  2KJP A;  3F0O A;  3DJ3 A;  4JJ0 A;  3AXA A;  3AK5 A;  2A4G A;  2DAZ A;  2DJT A;  2PA1 A;  1KY9 A;  1U37 A;  4P2A B;  3GCO A;  2YOL A;  1RGQ A;  3M5L A;  2KJD A;  1V62 A;  1CU1 A;  5FL7 D;  5HKK D;  1WXR A;  3SZE A;  2EDP A;  3QO6 A;  2QV1 A;  5FB8 C;  3P8O A;  5EQQ A;  1KEF A;  4Q2N A;  1N6D A;  3R0H A;  2YMS C;  2DKR A;  4B73 A;  2PKT A;  1G9O A;  2YT8 A;  1N7E A;  2YT7 A;  1SOT A;  2OPG A;  5GLJ A;  2OC1 A;  4B71 A;  4GVD A;  2R4H A;  2V1W A;  3SU5 A;  4IC6 A;  3LKW A;  3TSV A;  2CK3 D;  2EAQ A;  4JOH A;  3QGL A;  1BMF D;  2CS5 A;  2KA9 A;  2KRG A;  4L8N A;  1UEQ A;  5F53 A;  2OK5 A;  1WJL A;  2HE4 A;  2G2L A;  2XCF A;  1X6D A;  2L4S A;  4DT4 A;  2K0Q A;  1X9Z A;  2KPK A;  3U1I B;  3CBY A;  5HFE A;  2EGK A;  2DB5 A;  5F67 A;  1COW D;  1LCY A;  5EZ0 A;  3DSO A;  5C0U A;  4NNL A;  1N7T A;  3SYJ A;  3VQF A;  2L6O A;  3W1E A;  3L6P A;  3KDK A;  3NCV A;  1RGW A;  5HEY A;  3GDS A;  4TYD A;  3SUD A;  4K6Y A;  3R69 A;  2XND D;  2OC0 A;  2DM8 A;  2Z9I A;  2FE5 A;  3GDV A;  1TP5 A;  3KNX A;  3CS0 A;  2KQF A;  3CBX A;  3QJM A;  1DY8 A;  4A1T A;  1N7F A;  2OIN A;  4NWL A;  2I6V A;  1X5N A;  4ASU D;  1U39 A;  2YUB A;  2MHO A;  2VPH A;  2VZ5 A;  1RGR A;  3KN2 A;  2EDV A;  2GVF A;  2BYG A;  1JXP A;  1NBM D;  2F9V A;  3DOR A;  4GVC A;  2FNE A;  2A4R A;  4K75 A;  2X7Z A;  1QAU A;  2F4L A;  3GAB A;  3CYY A;  4MPA A;  3KEE A;  5FPS A;  5E1Y A;  3NFL A;  2FOM B;  4NMQ A;  1IU0 A;  5HFB A;  3HPK A;  5E6P B;  2WHX A;  2HE2 A;  3F2H A;  3K50 A;  2EEG A;  1VB7 A;  1K32 A;  2FCF A;  3SU0 A;  2AWX A;  1BE9 A;  3FN8 A;  3VQG A;  1W9E A;  3O8C A;  4XD7 D;  2GEF A;  2V7Q D;  3F2F A;  1A1R A;  4FLN A;  1U3B A;  4NMS A;  2R3Y A;  2JRE A;  3M5O A;  2DMZ A;  2OSG A;  4I33 A;  2OBO A;  4JOG A;  1UEZ A;  2DLS A;  5A2P A;  1Q3O A;  3ID3 A;  3PV4 A;  2DC2 A;  2EEH A;  3OEH D;  1WFG A;  2OGP A;  3KF2 A;  3FO8 D;  4KTC A;  4FGM A;  5DSF A;  1UF1 A;  3RL8 A;  4Q6H A;  4NNM A;  1V6B A;  2JDI D;  3GSL A;  2P3W A;  5HFC A;  4JOF A;  5G1D A;  2REY A;  4N6X A;  2JSN A;  2AWW A;  3SV7 A;  3OFN D;  2IJO B;  3STJ A;  3N7E A;  3ID2 A;  1Z86 A;  2KOM A;  2YUY A;  5GJ4 B;  2PNT A;  2EXG A;  3GDU A;  5T1V A;  1FC6 A;  3O8R A;  4JOJ A;  2K1Q A;  5GPI B;  1H8E D;  2EHR A;  3SU1 A;  1W9O A;  2JWE A;  2KL1 A;  3ID1 A;  2KCO A;  3VG8 A;  1WIF A;  2EEI A;  4KFV A;  4E35 A;  1FC7 A;  1T2M A;  2QBW A;  1UM7 A;  1DXP A;  2KCP A;  1WI2 A;  3LOX A;  4K72 A;  4I32 A;  3LON A;  4JOR A;  1OBY A;  5DN6 D;  3KDG A;  3GS9 A;  3SV9 A;  3N7D A;  2I4S A;  2M0U A;  1DXW A;  1VCW A;  3RLE A;  2VSP A;  4Q6S A;  4LMM A;  4K8B A;  1FCF A;  3OYP A;  1TP3 A;  2PZD A;  4WYU A;  2HLD D;  2EEJ A;  3F2G A;  1QLC A;  5EQS A;  5FHT A;  3PDV A;  2KOH A;  4EDJ A;  2QG1 A;  2Q9V A;  1X45 A;  2FN5 A;  2H3L A;  4Z33 A;  3K82 A;  1N6F A;  1V1T A;  2ENO A;  2KBS A;  4Q63 A;  1IHJ A;  3I1E A;  4NMP A;  1XZ9 A;  3ID4 A;  5I7Z A;  3R68 A;  4OEP A;  4E34 A;  2VRF A;  4H11 A;  2LEL A;  3H09 A;  2JXO A;  5HJ1 A;  2QT5 A;  5FPT A;  3E17 A;  2KV8 A;  3F3B A;  2EGO A;  1WHD A;  2HGA A;  3EYD A;  3NFK A;  1X5R A;  2XOK D;  2L4T A;  3SFJ A;  2L97 A;  3FOA A;  1NBM E;  5HFD A;  3FKS D;  5IL9 A;  1IU2 A;  2AHM E;  2RCZ A;  2FP7 B;  5FPY A;  3SU6 A;  3EGG C;  3U1J B;  4Z8J A;  5IK2 D;  3DJA A;  1FC9 A;  2KJK A;  4NXP A;  2IWO A;  3CH8 A;  1PDR A;  4NXR A;  4JMY A;  2W7R A;  2IWN A;  1OZI A;  2VBC A;  1I92 A;  3KZD A;  4E3B A;  1Y8T A;  3DCL A;  3GCN A;  2QE7 D;  1UFX A;  3DSP A;  4K76 A;  1R6J A;  3DIW A;  3CBZ A;  2J5U A;  2OBQ A;  3LNY A;  2KFW A;  2V90 A;  2M0T A;  2JJ1 D;  3E90 B;  1SOZ A;  3L4F D;  5HDY A;  1S6L A;  3SU2 A;  3SV6 A;  2KCA A;  1MC7 A;  4R8T B;  2D8I A;  3SUF A;  5G1E A;  1WFV A;  1MFG A;  2F5Y A;  4Q2P A;  1H8H D;  1W3C A;  1WHA A;  2JJ2 D;  2KZ4 A;  1QAV A;  3M5N A;  4M9F A;  3HVQ C;  1P1D A;  1U38 A;  2JIL A;  3SU3 A;  2MX6 A;  4Q3H A;  3F0P A;  3SUZ A;  4WF8 A;  3MH4 A;  4B6F A;  2E7K A;  4NMR A;  2Z17 A;  2WV9 A;  1MAB B;  2KG2 A;  2H2B A;  1WG6 A;  4P0C A;  1BFE A;  5CDF E;  1WF8 A;  4Q4L A;  3UB0 A;  1X8S A;  1TQ3 A;  2LUI A;  1UEP A;  1UJD A;  1I16 A;  3M5M A;  4YYX A;  2KR7 A;  4K78 A;  5E21 A;  4A1V A;  1D5G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...