3OTPA

Crystal structure of the degp dodecamer with a model substrate
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
440
structure length
381
Chain Sequence
AQQMPSLAPMLEKVMPSVVSINVEQKFMALGSGVIIDADKGYVVTNNHVVDNATVIKVQLSDGRKFDAKMVGKDPRSDIALIQIQNPKNLTAIKMADSDALRVGDYTVAIGNPFGLGETVTSGIVSALGRSGLNAENYENFIQTDAAINRGNAGGALVNLNGELIGINTAILAPDGGNIGIGFAIPSNMVKNLTSQMVEYGQVKRGELGIMGTELNSELAKAMKVDAQRGAFVSQVLPNSSAAKAGIKAGDVITSLNGKPISSFAALRAQVGTMPVGSKLTLGLLRDGKQVNVNLELQQSFNGIEGAEMSNKGKDQGVVVNNVKTGTPAAQIGLKKGDVIIGANQQAVKNIAELRKVLDSKPSVLALNIQRGDSTIYLLMQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protease do
publication title Covalent Linkage of Distinct Substrate Degrons Controls Assembly and Disassembly of DegP Proteolytic Cages.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 81
structure length 381
sequence length 440
chains with identical sequence B, C, D, E, F
ec nomenclature ec 3.4.21.107: Peptidase Do.
pdb deposition date 2010-09-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00595 PDZ PDZ domain
A PF13365 Trypsin_2 Trypsin-like peptidase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 3otpA02
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 3otpA03
2.40.10.120 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 3otpA01
3R0HA 4GVDA 3SU2A 5ESBA 3SOEA 2CSSA 4JOPA 1Q3OA 5HFCA 5ETXA 2QKVA 4NMOA 3R69A 4GVCA 1QAUA 5FB8C 3O8DA 1N6EA 4P0CA 5HEBA 4K76A 1GQ5A 4REYA 1WJLA 5EQRA 4K72A 1Z87A 1U37A 2DLUA 2P3WA 2FNEA 5HETA 1KEFA 1U3BA 3WKLA 4A1XA 3SV9A 1Z86A 2VSPA 2F9VA 1WI2A 4YYXA 4B6EA 5E11A 2F0AA 1FC9A 2Z9IA 4B74A 4KTCA 3TSZA 2F4LA 1OBXA 2M0UA 5H4IB 1UITA 2GZVA 2WZQA 2D8IA 4NNLA 2M10A 3ID3A 2E7KA 4JMYA 3SV8A 5E21A 1UEQA 2M0VA 1G9OA 3EGHC 3R68A 3U1IB 2F9UA 3QJNA 1VB7A 2EGNA 3EGGC 3CC0A 2JIKA 3OYPA 4Q2PA 2OBOA 2KBSA 1IU0A 4E34A 1IU2A 2A4GA 2L4SA 3I4WA 2JOAA 3DJAA 4Z8JA 3M5MA 2AWWA 3FY5A 3SZEA 5DTHA 5GNDA 4A1VA 3QGLA 2OBQA 3CH8A 2OGPA 1U39A 3AXAA 4WF8A 1I16A 4Q2NA 5EZ0A 3E17A 3HPMA 2OINA 3O8RA 2D90A 2JREA 2FP7B 2P59A 3GDSA 1RZXA 5GLJA 1PDRA 3TSWA 4Z33A 1I92A 3E90B 2L97A 1WFVA 3K82A 1WF8A 3SUGA 1P1EA 2H2CA 4JOEA 1W3CA 3QJMA 5EPNA 3GDUA 1WHDA 1DXWA 2M0ZA 2JINA 1VAEA 2F5YA 4JOGA 2KOJA 1N1LA 2AWUA 1TQ3A 4OEPA 2QG1A 2FE5A 2PZDA 2CSJA 1V1TA 2OSGA 4YDPA 2O2TA 3SU3A 4OM9A 5FHTA 2YTWA 1BFEA 3OTPA 2EEHA 2EDVA 3LOXA 4JOHA 1QAVA 4K8BA 1VA8A 2JXOA 2VSVA 2JWEA 4HOPB 4KFVA 1WHAA 4K75A 2BYGA 2OQSA 4NMTA 3PV2A 1N7FA 1K32A 4I31A 2MHOA 3O8CA 2QT5A 3SUEA 5E1YA 2REYA 2A4QA 5FPSA 3GGEA 5E6PB 5G1EA 3L6PA 2OC8A 2OS6A 1V6BA 1WG6A 3I1EA 3K50A 2FM2A 4Q6SA 1FC7A 2R4HA 1FC6A 5I7ZA 3PS4A 3PDZA 1RGRA 3KZDA 1UM7A 1TP3A 3LKWA 5HFBA 4OEOA 3KN2A 2RRMA 1GM1A 3RC6A 2YUBA 2XCNA 3CBYA 2DJTA 2DC2A 2OMJA 3CYYA 4JOJA 2EAQA 4K6YA 5EYZA 4O06A 3P8OA 3GSLA 3TSVA 4WH6A 4R2ZA 1JXPA 1X8SA 5JXBA 4F8KA 1A1RA 3M5NA 2IWQA 2DKRA 2KJPA 2Q9VA 4I32A 2OK5A 1RY4A 2M0TA 3HVQC 1DY9A 4I33A 2LUIA 3WKMA 3ID4A 2MX6A 3VQGA 1TP5A 1M5ZA 3SU1A 3ID2A 2H3MA 4NWKA 4UU6A 2YUYA 3NGHA 5EQQA 2WHXA 3LNXA 2A4RA 3U1JB 3KEEA 3KZEA 5E22A 1WFGA 3DIWA 4P2AB 2LC7A 2W4FA 2FCFA 2PKUA 4OAJA 2HE4A 1XZ9A 3CS0A 3PV5A 5B6LA 3GCOA 2EDZA 2PA1A 2QKUA 1NF3C 4A1TA 1Q3PA 3SFJA 1MFGA 4JOKA 2LA8A 3GJ9A 3STJA 2KG2A 5HEYA 4Q6HA 4NMPA 2VBCA 2W7RA 2I0LA 3MH7A 3NFKA 3M5OA 5T1VA 3RC4A 1VCWA 4XHVA 2D92A 4NMVA 4TYDA 2KL1A 3K1RA 1LCYA 5IDKA 2YOLA 5HJ1A 4JL7A 1TE0A 3RL7A 4RI0A 1N7EA 1N99A 3QDOA 2YT8A 2DLSA 5HF1A 2ENOA 4E35A 1W9OA 2EEJA 3KHFA 2OZFA 3M5LA 1NTEA 3O5NA 2KJDA 2KPLA 1NS3A 1V5LA 3KNXA 2IWNA 5GPIB 3O46A 2KJKA 3DJ1A 2AWXA 4Q2QA 1UFXA 2K1QA 2GVFA 2HGAA 3SV7A 1RGWA 1W9QA 2PDZA 2DAZA 2QBWA 2EHRA 2VZ5A 2CS5A 4Q2OA 1X45A 1X5QA 1N6DA 3BPUA 3CBXA 4H11A 2EEGA 4MPAA 1N6FA 2LOBA 2Z17A 1OBZA 1D5GA 1Q7XA 1UJUA 1V62A 2DMZA 2FN5A 2XNIA 1CU1A 2VPHA 4NMQA 2I6VA 5H3JA 1T2MA 4AMHA 3H09A 4B71A 5HEDA 3PDVA 5F67A 1SOTA 2EDPA 1FCFA 2OC7A 1IHJA 3AK5A 3QIKA 1P1DA 2OCSA 4NNMA 4NMSA 3B76A 4FGMA 1UEZA 1W9EA 3JXTA 3DORA 5EPYA 2AINA 3SUDA 2LC6A 1DXPA 3PV4A 3EYDA 2H2BA 3GCNA 4G69A 3SV6A 2RCZA 3SU4A 2Q3GA 5EQSA 2EGKA 2KV8A 4K78A 4EDJA 3RL8A 2K20A 1RGQA 3RC5A 1BT7A 1UEPA 3ID1A 5F3XA 4U01A 4LMMA 4WYUA 3P8NA 1MC7A 4NWLA 2KQFA 2UZCA 5HF4A 4NXPA 2O8MA 4M9FA 3LNYA 1UHPA 1YBOA 2V1WA 4HOPA 3NFLA 5FPYA 2KAWA 4IC6A 2I04A 3OU0A 2WV9A 1X5NA 2EV8A 1WH1A 2DB5A 2KPKA 4PQWA 1QAVB 2KOMA 5HFFA 2PKTA 1KWAA 2OC1A 1U38A 2DM8A 4B73A 4B76A 3O8BA 2VRFA 2KRGA 2L4TA 4Q3HA 3SU6A 1OBYA 1UJVA 2IWOA 2OPGA 5FPTA 1WXRA 3SHUA 1DY8A 1UJDA 4L8NA 2FOMB 2EJYA 2ZPLA 4B75A 1WIFA 4WYTA 2I0IA 1N7TA 4JORA 2H3LA 2JILA 2EEIA 4A92A 1X6DA 4B6FA 1MFLA 1RTLA 1QLCA 3SUZA 3QO6A 2HE2A 4NMRA 4N6XA 1L6OA 4NXRA 3GDVA 2IWPA 3CBZA 3QE1A 2QV1A 2OC0A 3SUFA 2K1ZA 3SU5A 2WL7A 2VWRA 4R8TB 3MH4A 1UM1A 2R3YA 3SU0A 4NXQA 5A2PA 5HFDA 1X5RA 3LONA 2KOHA 2XCFA 2YT7A 2GGVB 1KY9A 2PNTA 4KFWA 5HDYA 1SOZA 4E3BA 5GJ4B 1R6JA 1V5QA 2IJOB 3L4FD 4UU5A 2V90A 3SHWA 1UF1A 3I18A 1B8QA 2EXGA 3HPKA 2KYLA 2I4SA 2X7ZA 1ZOKA 1OZIA 5D13A 2G5MB 2M3MA 1GQ4A 3MH6A 4WH8A 2ZPMA 1UEWA 1ZUBA 3KF2A 2G2LA 3VQFA 3DJ3A 2KA9A 1WF7A 5G1DA 2QKTA 5HFEA 3RLEA 1Y8TA 2IJD1 3ZRTA 1Y7NA 3SYJA 1WI4A 1BE9A 1VJ6A 2I1NA 4GHNA 2EGOA 4JOFA 3TMHA
chains in the Genus database with same CATH superfamily
2P8OB 2JETC 3F3BA 3LGYA 1EJMA 3MNCA 1MU6B 4DIIH 1PPEE 4JOPA 1Q3OA 5HFCA 1GHBF 1QJ1B 1FJSA 4WMFA 1VR1H 5F8ZA 1MBMA 1O3GA 5LH8A 3DHKH 3GYMA 2SGEE 4JZ1A 2AEIH 2CXVA 3TNSA 1QAUA 3T2NA 2XWAA 2NU2E 1QCPA 2NU1E 1HB0B 1C2KA 4P0CA 3HGPA 1EOJA 3QTVH 1XUKA 4IMQA 2FOGA 2BB4A 1VGCB 2FNEA 5HETA 1BRUP 4ZAEA 4VGCB 3MI4A 1Z1JA 3QX5H 1OS8A 3A89A 4Z1MD 4CH2B 1F5KU 1U3BA 1CBWB 1GMHF 1RS0A 1SGDE 1TNJA 2ZKSA 5A2MH 3TH2H 1V2LT 1OX1A 4KTCA 3T27A 3TSZA 3GY2A 2Z3DA 1C5LH 3MFJA 1OYQA 1CQQA 4Y11E 5C67A 1HJ9A 1NFXA 1UTJA 2AIPA 4X6NA 3RLYH 2NU3E 3SV8A 5EXNA 3TK9A 2VH0A 4YT6H 1G9OA 1FY5A 3R68A 1UTLM 2PLXA 2WYJA 1UVTH 2ZO3H 2F9UA 1BTXA 1N6XA 1ZSJA 2JIKA 3FZDA 2OBOA 3TJNA 2KBSA 4E34A 2GCHG 2L4SA 1TABE 2UUKB 1LHEH 3F2HA 2JOAA 2HNTF 4Z8JA 4X6PA 3FY5A 4A1VA 3QGLA 2OBQA 1H8ED 1TNHA 2QXIA 1SFIA 1WOFA 2OGPA 4FU9A 9LPRA 1XUFA 2BXTH 3AXAA 3A7ZA 3K9XB 3SI4H 1G2MA 3UNSA 5HIYA 5EZ0A 3E17A 1V2JT 3ZVDA 3O8RA 2JREA 1AIXH 3SI3H 2ZIQH 4WJG2 1IQMA 7GCHG 3RMLH 3MNSA 1GJCB 3TSWA 1FLEE 4Z33A 1K28D 1I92A 2HNTC 1ANDA 2L97A 5F6MA 1C5QA 2ZU1A 1WF8A 1NRPH 3SHAH 1Q2WA 3QJMA 2BD3A 2BLVA 1WHDA 3BG4C 2M0ZA 1OXGA 4WVPE 2F5YA 1Y3XA 2FDAA 1TQ3A 6ESTA 1O3NA 2VVCA 3TGJE 1WV7H 1EAUA 2FESH 3ESTA 4INHA 2O2TA 3RXMA 1ESBA 2YTWA 2ZWLH 1BFEA 3UPEA 1KXBA 1SLWB 1DVAH 3LIWA 4YXWD 1QAVA 1EP5A 2P3FH 1ZSLA 2JWEA 4HOPB 3KL6A 3RU4T 4KFVA 1WHAA 2Z9JA 3EA9A 5A09A 1G32B 1SGNE 2H5DA 2LPRA 4BNRA 3PV2A 1QA7A 2VWOA 3MU4A 4K60A 4GPGA 1UTMA 2BVSH 3K2UA 1C5RA 2H9TH 4ACBA 5E1YA 3GGEA 5E6PB 1UJ1A 1V2RT 1O3FA 1SQRA 2ZPRA 2FOFA 3C27B 1TGSZ 2BD2A 3RXEA 2ZECA 1Y3WA 2Y7ZA 1FC7A 1FC6A 3F6UH 2ZQ2A 5I7ZA 3RXDA 1FXYA 4UFDH 4LZ4B 1CA8B 2HNTE 4Y71A 2ZFPH 4AFSA 4PROA 4MVNA 2AMDA 1MAYA 1N6YA 1HIAA 3MU5A 4OEOA 1NRNH 1HPGA 2V6NA 3KN2A 2ZF0H 2ZG0H 3M7UA 4WXIA 1GM1A 1B0EA 3FFGA 4IW4E 5AFZH 1CSOE 1LVYA 1D9IA 3CBYA 2ZGHA 2DJTA 2V3MA 2EC9H 4K6YA 4IBLH 2KFWA 1C5XB 1O5AB 2CHAC 4NCYA 3SJ9A 1YKTA 1DWEH 3GYLB 1NESE 1Z8GA 3ZZ8A 5EJ1A 1IHSH 2WSSD 4GCHF 5JXBA 4WY3A 3E91A 3P17H 3P70B 2OK5A 3ATLA 3VPKA 1XXDA 1QJ6B 3A7XA 4I33A 5J4QA 2GCTC 3OSYA 3ID4A 2MX6A 6GCHG 1GGDB 4MNWA 4MTBA 3ATIA 2GMTB 2RG3A 1NTPA 1UVPA 3BSQA 2RDLA 4GAWA 1YCPK 2FYQA 3BV9B 1GJ7B 1TRYA 1TLDA 4K8YA 2VIDA 2XWBI 1C2LA 5E2OA 1C4U2 2G52A 3KZEA 2DUCA 3FP7E 5KGOA 2W4FA 2HE4A 5B6LA 2ZU4A 3F68H 2STAE 2WPHS 3NCLA 4BTTB 1PQ8A 2I6SA 3PWCA 4A5TS 2BM2A 2ZGBH 3HK6B 3GJ9A 2KG2A 3SJKA 5HEYA 1HGTH 1LO6A 2W7RA 4GHTA 3TIUA 5DP5A 2I0LA 3MH7A 3NFKA 3M5OA 1TMUH 5AVDA 3ZZBA 4XHVA 4GSOA 1FY1A 1BJUA 3BTTE 3UB0A 4TYDA 2KL1A 1H1BA 5IDKA 1UHBA 2YOLA 2PSYA 1ARCA 2F9PA 2BDGA 2GV6A 2VWLA 2ZHFH 3I78A 1TONA 1YPMH 3RXIA 3ZVEA 1O2HA 2FOCA 1AKSB 1ZLRA 2CK3D 2BZ6H 3CS7A 2V0BA 3S7HB 3TJUA 3UNRA 1O3MA 2XC0A 2XBVA 3F9HA 1EZQA 4TSFD 4X0WU 2YNBA 1O2ZA 1P2KA 4ISIH 4Y7AA 5GPIB 3DJ1A 3P8GA 4Q2QA 3LC3A 5DKMA 3V13A 2K1QA 1O3KA 4UDWH 1O3PB 4MNYA 1BTYA 1BMLA 4MPXA 3PB1E 4HZHA 1GJ8B 2VZ5A 1A61H 4JZIA 3AVZA 1X45A 1X5QA 3BPUA 5CHBA 2AYWA 2ZFQH 1OBZA 1O2LA 3N7EA 1Q7XA 2DMZA 3TGKE 3EA8A 1B5GH 1ZYOA 2RDEA 4MLFB 1V2VT 1SMFE 3L3TA 2BY5X 4JZDH 2VPHA 4NMQA 3M7QA 1O2SA 4I8GA 4AMHA 5C0TA 4P02A 4R0IA 1HNEE 5F67A 2ZCLP 1SOTA 3DSPA 3UNQA 2BD9A 3AK5A 3QIKA 5IL9A 3A8BA 5TCCA 2OCSA 1K1JA 4YTAA 3P92A 1W9EA 3A87A 4OS6A 3DORA 3I29A 4CRDA 2BYAX 1OWKA 3SUDA 1GVKB 1THPB 5DK1A 3PV4A 1SC8U 2PR3A 2BY7X 1ZJDA 1GBJA 3A8AA 5EQSA 2EGKA 2KV8A 1YGCH 8ESTE 4WWYA 1RD3B 5AF9H 3Q77A 4WMEA 1ANCA 1TQ0B 3WY8A 3ID1A 3RXPA 1FIZA 4ZKRU 2BDCA 4U01A 1GBTA 1FDPA 2FI3E 1SGIB 1BIOA 4WYUA 3D23A 1MC7A 5BPEA 3OEED 2UZCA 3TH4H 1RRKA 3GABA 1G9IE 1BHXF 1EJAA 1V2ST 3PMHB 4ZXXH 1BBRH 2WUBA 3N7DA 1UHPA 2FIRH 1MTWA 4FVDA 3NFLA 1GBDA 1AFQB 1EB2A 1GI4A 2F3CE 3E8LA 1GHVH 4DT4A 1TMBH 2KAWA 1C5NH 2TBSA 1HJAC 1WYKA 3MO6A 1X9ZA 5JYIA 1O3DA 3NRLA 2GEFA 1UK2A 4FUEA 1C5SA 1BMAA 4AG1A 3CNRA 1KXAA 5HFFA 5EU8A 5C1YA 2ESTE 4B76A 2R0KA 3PWBA 3F0OA 2GCHF 3FP8E 3EE0B 4Q4LA 3SHCH 5GCHG 5JBAS 1A3EH 1C5OH 3ZZCA 4A6LA 1ELDE 1DY8A 2FI5E 1C1UH 3S0NA 3MNXA 8LPRA 4NGAH 2EJYA 2I0IA 1N8OC 4JORA 3UTUH 3KQ5A 1QB9A 5FX5A 5E0HA 1KSNA 3HKIB 1AB9C 1X6DA 4FUBA 4O03A 7GCHF 1WQSA 1RTLA 4N6XA 3GOVB 1L6OA 3GISB 2C8ZB 3GDVA 2JKHA 5ESTE 4K1EA 3CBZA 3QE1A 3SORA 3QDZB 5F8XA 3H7TA 4Q7YA 2WL7A 5JPMH 5HXFA 2ZDVH 2TGDA 1LQEA 1O2UA 1X5RA 3EQ0H 1THRH 3NPSA 3ZYDA 2QA9E 1DSTA 1UK3A 2W5EA 2BQWB 2XCFA 1Q31A 1GI7B 1AB9B 3BTME 3JZ1B 5HDYA 4X8SH 2ZGCA 1SGRE 1TPSA 1O31A 1PPGE 1LPKB 1UVUH 4JYVH 4AB8A 2PKSC 2F91A 2KZ4A 2G5NA 2F83A 2F9OA 3DA9B 1UF1A 1XXFA 1SQOA 1O30A 3HPKA 2KYLA 2Q1JA 2I4SA 2G5MB 3MH6A 3M3VA 4WH8A 1AMHA 1ZUBA 1VKYA 4E05H 1AWFH 1O2TA 2KA9A 1WF7A 2QKTA 5TCAA 1L0ZA 1GVZA 1PPFE 1G3DA 1S6LA 2IJD1 2V3HH 2PKSB 1SVPA 2HGTH 2ZFRH 2W26A 1Y7NA 1XUGA 1BE9A 4UE7H 4JOFA 1WU1A 3BEUA 5DG6A 2Y6TA 2PUXB 2QXHA 4K5ZA 2R0LA 1L1GA 1ZRKA 4H6SB 3R69A 2ZDMA 2TRMA 3KIDU 2HPQH 2SNVA 3RU4E 1N6EA 2C93B 2F9BH 2J98A 3DT0H 4REYA 5A0CA 2UUFB 5EQRA 3OX7U 2FODA 1P10A 1EUFA 2DLUA 2P3WA 1K1PA 2A45B 5F03A 1EAXA 1WQVH 7ESTE 1S6FA 2OLGA 1BTWA 1T8OA 1DT2A 3PRBA 1DPOA 2VSPA 2PUQH 4WXVA 3PTNA 1DWBH 5I46H 4X6OA 3UWJH 2F0AA 5HGGA 3RXSA 2Z9IA 4B74A 4HG6A 3SQEE 1SGFA 4CHAC 3SW2B 2OXSA 3A80A 6GCHF 5H4IB 1UITA 2GZVA 1KTTB 1LHFH 2WZQA 3F2GA 4YM9A 2M10A 2E7KA 1Q3XA 2GJGA 2IN2A 1GI0A 4JMYA 4YO9A 3LC5A 4FU8A 4GLYA 2TGTA 1UEQA 2M0VA 1GVLA 3MH5A 2SGAA 4Z0KA 1J17T 1GDQA 1TRMA 1FN6A 4RN6A 4KTUA 1GJ5H 2QXGA 2CV3A 2WINI 1O3HA 1V2QT 3OYPA 4D8NA 1O3AA 5HM9A 3F1SB 2SGQE 3DJAA 4CHAB 1F5RA 1EPTB 1O2RA 1TX7A 3GY3A 1V2OT 1A5GH 2UWPA 1WUNH 1S5SA 2FLBH 2W7UA 1A3BH 1S84A 2HOBA 1BMNH 1OP8A 3RXFA 3UUZA 1I16A 4OS1A 4YESB 1SB1H 1LTOA 1SHYA 3HPMA 2OINA 3HGNA 2D90A 3MU8A 3GDSA 3RXOA 1RZXA 1YLNA 5GLJA 1MH0A 1GDUA 1ZGIA 1MBQA 4FOUC 2JH6D 1HJ8A 2QCYA 1K21H 4U30A 2ZU2A 5EODA 1GPZA 1W3CA 1CGIE 1S6HA 1V2NT 1W0JD 5JB8S 4F49A 1DXWA 1HXEH 2JINA 3QK1A 4GUXA 2QF4A 2AWUA 4TY7A 4RSPA 2VIVA 2FE5A 1FY4A 2FOHA 2CSJA 2OSGA 1ARBA 2OTVA 3SU3A 5FHTA 1SG8B 2VU8E 1AFEH 3OTPA 2BQ6B 3ZYEA 1FY8E 4Q80A 1XUJA 1OWIA 4JOHA 3F9FA 1MZDA 1HV7A 3LJJA 5FBEA 5J4SA 2OQSA 1P9SA 2KM0A 2ZA5A 1GBKA 1IQHA 1BTZA 3RXCA 4I31A 3S9AA 5DP4A 1KLTA 2QT5A 1MKWH 4YLQH 2A4QA 2JIZD 4MG3A 1P11E 2Y5FA 1ZPBA 3LT3A 4JJ3A 1VGCC 1TYNA 4UFEH 2OS6A 5C2ZA 5K7RA 3UAIC 1D6RA 4VGCC 5E2PA 2SNWA 4Q6SA 3U8RH 1ELCA 1VITH 2G8TA 1CBWC 1KLIH 1EFRD 2F9NA 3RMMH 2ZDLA 1UVOA 2A0QB 1W12U 5HMAA 3S9BA 4ACAA 4ISLA 5JBCS 1RGRA 2A31A 1YWUA 3LKWA 5HKKD 5DP7A 5K0HA 1CT0E 2KX4A 2IPHA 5FCRA 1C2JA 1O3IA 2GZ9A 1HAVB 3R3GB 2H9EH 5CDFE 1V2PT 3VGCC 2DC2A 4JOJA 1K1MA 3U8OH 5JB9S 1C1VH 1CO7E 2GD4B 3NCVA 3TSVA 4SGAE 4Y10E 3F0PA 1HCGA 4WH6A 3RXQA 5FAHA 1E0FD 1GMDG 1BB0B 3M5NA 2DKRA 1TA2A 2KJPA 4I32A 1RY4A 3HVQC 4B2BA 3PLPA 2BDHA 1P0SH 2XNDD 1C2EA 4ZH8A 3LU9B 3VQGA 1GMCG 3VGCB 1TP5A 1M5ZA 1EAWA 2P94A 2Z94A 3OAAD 4MQAA 1O5EH 2H3MA 1OSSA 1ZTLA 3ZVAA 4FUGA 1P8VC 1LHDH 1AD8H 3E3TA 3SBKA 1YPHC 3NGHA 3A82A 2NU0E 3PTBA 3STIA 3QZRA 2WV4A 2A4RA 1LMWB 5DGJA 3T62A 4THNH 4U32A 3M36A 2CN0H 8GCHG 1O32A 2FCFA 3BIVH 3SQHE 1XZ9A 5F53A 3ZZ5A 2PA1A 2D26C 3Q76A 3KCGH 1BRCE 1MABB 3LPRA 3SFJA 3EA7A 1UTNA 2F43B 4JOKA 1AI8H 2ZFTA 3GICB 2LA8A 1TALA 2J4IA 2A5KA 1XVOA 3F2FA 3ZV9A 1O2XA 3UR9A 1VCWA 1Y3UA 2D92A 1YBWA 4UFFH 4F48B 2AFQB 1EB1H 2OQ5A 3KDKA 5HJ1A 1TWXB 3MO3A 3MWIU 4JL7A 1TE0A 4RI0A 3VXEH 1O3JA 1G2LA 2YT8A 1GHZA 2ENOA 4E35A 4BANB 2OZFA 4FLNA 4BTIB 3TU7H 4XE4A 3O5NA 1JRSA 2R2MB 3P8FA 5AFYH 2KPLA 3NZIA 1EJNA 2EQNA 5DSFA 2BVRH 2IWNA 2QGRA 2KJKA 1QBNA 2AWXA 4JZFH 4ABEA 3SV7A 1NY22 4YOGA 4IN2A 2QBWA 1O2IA 3GY4A 3MOCA 1OKXA 1B0FA 2CS5A 1C1WH 3SNDA 1EX3A 1W0ZU 1UTQA 2P3TB 2Z17A 5C5NA 1YYY1 2ZI2H 3SGAE 2GZ8A 1D5GA 2H9HA 2BY8X 1V62A 1IQKA 1TPOA 3U69H 2VWNA 2H2ZA 1A46H 3Q00A 2XBXA 2A7CA 2KCOA 2DE8A 4FXGH 5HEDA 3ATKA 3AAUA 4ABJA 3A85A 1D4PB 2HPPH 2OC7A 3QGJA 4GHQA 3TPIZ 1Y3YA 4D9QA 2BDYA 3URCA 2H5CA 3RXAA 3Q3XA 2B9LA 1FIWA 5C17A 2O8WA 5EPYA 1FV9A 1GBIA 5KECA 5PTPA 1DXPA 3EGKH 4KP0A 4H6TA 4AB9A 5GWZA 2FOBA 4X1QU 1GGDC 4E06H 2H2BA 1WAYB 2RCZA 1ACBE 2GMTC 2J95A 3K6ZA 1F0SA 2XOKD 1BT7A 3RL8A 2G55A 3EDXB 3RC5A 1UEPA 1O34A 1D3TB 2FEQH 4Q63A 1GHAG 4UONA 3NWUA 5HIZA 3RXGA 1NBME 2WV5A 2ZGJA 2AS9A 1K1OA 2KQFA 2XW9A 1P02A 2Y7XA 4NXPA 1TQ7B 5FBIA 4AC9A 3RXBA 3DSGA 2PKAA 1YBOA 2V1WA 3OY6U 2D8WA 3M37A 4O3UA 1GI2A 4CRAA 1O35A 1NFWA 4FUCA 3RM0H 1O36A 3A83A 3FZZA 3SO3A 2ZHWH 3V12A 2WV9A 5GIBA 2BY9X 5EJLA 1WH1A 2DB5A 2KPKA 1QAVB 4K3JA 2KOMA 4YOIA 3SJIA 4NZQA 1YLDA 2GV7A 2OC1A 9ESTA 3D65E 4NA9H 3RM2H 1LVMA 1ID5H 2Y82A 5C5OA 4ZUHA 3RXRA 3TH3H 1OBYA 4JCNA 2J92A 3EAJA 1RTFB 2I6QA 1S82A 2BZAA 3SHUA 4CR9A 2FOMB 1T31A 1AZ8A 3QTOH 1T4VH 1T7CA 2JILA 1C5YB 2KAIA 4NSVA 4A92A 1KDQA 1O2GH 4NG9H 1EAIA 1MFLA 2FMJA 1FNIA 2HE2A 5JDUB 1YY3A 4NXRA 1HIAB 1ZTJA 1WTHD 2OC0A 3TK6A 3SU5A 2L74A 2VWRA 4R8TB 2VGCB 3MH4A 6CHAB 3C1KA 4NXQA 5A2PA 5HFDA 1QA0A 1VJ9U 1HRTH 3ZZ4A 2YT7A 1XX9A 1QY6A 2OUAA 1T32A 1DWCH 1SOZA 2V35A 3N7OA 1BTHH 2J97A 2Z9KA 3IITA 3KQCA 3RDZA 3L4FD 1QNJA 1GBAA 2BVXH 3R0FA 2EA3A 1UCYK 1WBGB 2GP9B 2EXGA 1K1NA 1AVXA 1ZOKA 1S85A 1VJAU 3FO8D 1OZIA 3M35A 1NU9A 1PYTD 2M3MA 2O8TA 5CE1A 1QBOA 3M3SA 4RKJB 3KF2A 2XTTB 2G2LA 3VQFA 5B42A 3DJ3A 4NIVA 3VG8A 5EG4A 4BXSA 2NWNA 5HFEA 3VB7A 1OWHA 2D1JA 1MTSA 2HLDD 1H8IH 3ZRTA 3GY7A 3ODDA 4CRCA 1WI4A 1XUIA 1GJBB 1ZPCA 2W7SA 1VJ6A 1FPHH 2ZCHP 1HAGE 5L30H 2ODQA 3R0HA 3GCTG 4GVDA 1CHGA 2C3SA 5ESBA 2M2AA 3SOEA 4CH8B 2QKVA 2NU4E 3RXTA 2FLRH 4NMOA 1CT4E 4TWYA 2XBWA 3ZZAA 1ZZZA 1AFQC 4GVCA 4ZHAA 3S7KB 1QHRB 1BTUA 3M7TA 5FB8C 3DD2H 7LPRA 3SV2H 1TFXA 2PHBA 1MUEB 2YNAA 1SGEE 4K76A 2BD5A 1RIWC 1UHBB 2BY6X 4FUHA 1P05A 1WJLA 2FWWA 3ZVBA 1V2UT 1MD8A 1YPEH 3MU0A 3G01A 1U37A 2HALA 1GJ6A 4Q2KA 4XOJA 4ZKOU 4OS4A 4X8VH 1W14U 1B7XB 1KEFA 3VB4A 1HDTH 2C90B 1GMDF 1Z86A 2C8YB 2RCEA 1ZRBA 2KCYA 1WI2A 3ZZ3A 4CRGA 1P09A 4B6EA 5HYOA 1MQ5A 3BEIB 1FC9A 2ODYB 4JYUH 1OWDA 1BJVA 3RU4D 1C2GA 1O5DH 1OBXA 3ZIAD 3SNEA 1YLCA 1RIWB 1GMCF 1TNLA 3D49H 2AERH 3PROA 2D8IA 4NNLA 3ID3A 1FAKH 1Z6EA 3CP7A 2VINA 1Z8RA 2WPJS 4HI3A 5L2YH 1MCTA 3UFAA 2RFKC 3U1IB 1TOMH 1J14A 4YLUA 2EI7A 1VB7A 1K1LA 3LGUA 1NM6A 4FUFA 4KGAA 3SGBE 2W6JD 2J94A 2WUCA 3U8TH 3DFJA 1CHOG 8GCHF 1RXPA 1DUEA 1IU2A 1IU0A 1A0LA 1P12E 2TGPZ 3PLBA 2JDID 2ZTXA 3Q3KA 3M5MA 1SGTA 3SZEA 1C2FA 5GNDA 1AHTH 3BG8A 4BAQB 4HTCH 5EW1H 1MTNC 2O8LA 1F5LA 4NA8A 1TGTA 1Z6JH 1HLTH 2YMSD 4RT1A 2EI6A 3KQEA 4D76A 1AGJA 2FZZA 4K2YA 1GI8B 2FP7B 1DWDH 4H4FA 1O0DH 5G4BA 1TA6A 4FUDA 4BAOB 1C5ZB 5DP6A 1BBRK 1EASA 1WFVA 4NIXA 1GBBA 3LGIA 4X2WA 3AASA 1FUJA 2ZZUH 5LPRA 1HAXB 1P1EA 2H2CA 4JOEA 2AH4X 2BDBA 5EPNA 3SUGA 1MTNB 3VFEA 1HAZB 1P04A 4JOGA 2KOJA 1MTUA 1N1LA 1OWEA 1W0KD 4UD9H 5CHAC 3RP2A 2QG1A 1AY6H 2ZDKA 1IQEA 1V1TA 4BOHA 4YDPA 3PO1B 6LPRA 3RXJA 1EXFA 4ZHMU 1TB6H 2V3OH 2EEHA 1O5BB 4IGDA 1MZAA 4JZEH 1DLKB 3LOXA 4K8BA 1PQ7A 3LJOA 1TX6A 5EOKA 4K75A 1YPJH 2HVYB 2W3IA 2BYGA 5A8XA 3UREA 3SJOA 4MNXA 1N7FA 2G4UA 1Z71A 3UY9A 3OFND 5CHAB 1IQJA 2PFEA 4F4OC 1A2CH 3T29A 2REYA 2A2QH 4AGJA 3L6PA 1ZOMA 1PPCE 1YP9A 2OC8A 1WG6A 3UOUA 3I1EA 2BLOA 3K50A 2XC5A 1FN8A 4ISHH 3H7OA 1OP2A 4NA7A 4D7GA 1JBUH 1QL7A 3RXHA 1H9HE 1QZ8A 1O2OA 5EIYA 5JBBS 1QGFA 2BD7A 4OGXA 3PDZA 1NRSH 3KZDA 1UM7A 3MTYA 5HFBA 2THFB 3GY8A 4JYTA 3RXVA 3ZZ6A 1WCZA 2RRMA 3NXPA 2ZP0H 4Y0YE 3BTDE 2Y5HA 5DN6D 1AVWA 2YUBA 1DICA 2BOHB 1CA0B 2HWLB 1A5IA 2C4FH 2XCNA 1EP6A 2FI4E 4OS7A 2P95A 1WSSH 2A7HA 1GHAF 2EAQA 2SGDE 4ISOA 4DGJA 1A0HB 1DDJA 2Y5GA 1AVGH 1W13U 1MKXK 4BAHB 3GSLA 2G51A 4R2ZA 1SQTA 1JIRA 4D9RA 1EPTC 1JXPA 1X8SA 5EGMA 1K0HA 1H9IE 1QRXA 3I77A 4F8KA 2IWQA 1P2QA 1SGQE 3HK3B 2Q9VA 2JSNA 1UK4A 1C5UA 3URDA 3ITIA 1DY9A 3WKMA 3KYGA 3UIRA 3ENSB 1CVWH 1O2MA 2FYRA 2J5UA 3LGWA 1Y5BT 2YUYA 4AOQA 2P3UB 4Y8ZA 3UWIA 1LPZB 1EZXC 1E1QD 3QN7A 1AO5A 3LNXA 1JWTA 1UO6A 5I25A 1PQAA 3KEEA 2Y81A 4XFQA 5E22A 1WFGA 4P2AB 2ZFFH 3SJ8A 1GDNA 4BAMB 3QLPH 5A8ZA 3A7WA 3CS0A 3PV5A 1P01A 1QTFA 4E7NA 2EDZA 4ZXYH 2QKUA 2FS9A 1NF3C 1BOQA 1Q3PA 1TNIA 1P2IA 1MFGA 5FL7D 1VCQA 3STJA 1J9CH 4I8JA 2CJIA 4O3TA 4Q6HA 1GL0E 1W7GH 2VBCA 3TNTA 2Z7FE 4A7IB 4KKDA 1HAHH 2Q6DA 3QWCH 2R2WU 1ABJH 2A2XH 3AW1A 3FOAA 2Z3CA 1L2EA 2HRVA 4ABDA 1BA8B 2G4TA 3E0PB 2ZGXH 1QURH 2R3UA 1W2KH 1QL8A 3FP6E 1TGCA 1N99A 3QDOA 5HF1A 1IQNA 1Z1IA 2BMGB 2RA0A 4INKA 4KTSA 1W9OA 4Y76A 4ZKSU 2EEJA 4HFPB 3KHFA 5C3NA 3M5LA 3KHVA 1GBEA 1NTEA 2J98B 2FS8A 1QFKH 3B23B 1COWD 1NS3A 1DS2E 4YOJA 2VIQA 5E8EH 2VIPA 5GDSH 1MQ6A 2HVXA 1GBHA 2ZPQA 3O46A 2G00A 4TWWA 1YPGH 2Z9LA 1NPMA 2GVFA 2HGAA 1ELAA 4TT3D 1GBCA 1GI6A 2FX4A 4ABFA 2CGAA 1FONA 3IG6B 3HPTB 2DAZA 4ABBA 1IQFA 2EHRA 4AFUA 1EZSC 2GT8A 3SOSA 1L4ZA 1N6DA 4I86A 3CBXA 4XBCA 3ZV8A 4E7RG 2EEGA 4MPAA 1NROH 2GDDA 2WYGA 2LOBA 2BD8A 2BXUH 1INCA 1J16A 1O3BA 1C1QA 1DM4B 2FXRA 1WTGH 1AWHB 1IQLA 2ANWA 2QF3A 1F92A 1MTVA 1C2HA 1CU1A 2J38A 1CGHA 2OD3B 3DUXH 5SGAE 1C4Y2 2I6VA 5H3JA 1T2MA 3A86A 3PDVA 1ZHRA 3VB6A 1FPCH 1FCFA 3LH3A 1ESAA 1IHJA 1V2KT 2AHME 4Y8YA 7KMEH 3GCTF 2PP6A 2P16A 4O9VA 2M5TA 3ZZ7A 1H8DH 1T8NA 1P57B 4NNMA 1SI5H 3QUMP 4P00A 1GL1A 4FGMA 1F7ZA 5AHGH 5CMXH 2FTLE 1FAXA 3UR6A 1FQ3A 2LC6A 4X2XA 1O5GH 4F55A 5DPAA 1P3CA 3EYDA 4D7FA 2GZ7A 4G69A 2Q3GA 2EI8A 1QBVH 4K78A 4B2CA 4EDJA 5E0GA 2K20A 1HUTH 1SPJA 3CENA 4ZKNU 1O2NA 2LELA 3BTQE 4XDEA 2Z3EA 1C9PA 3ATWA 1HAIH 4LMMA 1ELGA 3WW7A 1P2MA 1V2TT 1BRBE 1UMAH 1JIMA 1ZMLA 1GBMA 2VIWA 3BTWE 3P8NA 4RKOB 1QB1A 1GHXH 4INLA 1NN6A 2ZHDA 3MMGA 2JETB 4DOQA 2O8MA 1NFUA 1OP0A 1C5MD 1EQ9A 1ETSH 1FX0B 2PGQB 3ODFA 3TJVA 1O2QA 1AE5A 2O9QA 3TLOA 1MKWK 1PPHE 5B6OA 5DP8A 4HOPA 2AGIX 3ZZ9A 1RTKA 2J34A 5FPYA 1HFDA 1K1IA 2H1UA 4IC6A 2XYAA 3A7YA 2I04A 1EZUC 3ZVCA 1DUAA 3OU0A 1X5NA 2W3KA 5DO4H 1TMTH 4PQWA 1NBMD 1UTPA 4TPYA 4X2YA 5GCHF 2KR7A 3V7TA 1JOUB 2DM8A 3BEFB 2VVUA 4MNVA 4B73A 2UWOA 3O8BA 2VRFA 1CHOF 2KRGA 5LGOA 1GHWH 4X8TH 2BDAA 1UJVA 1NC6A 3M61U 2OPGA 5FPTA 2UWLA 2BLQA 4L8NA 2PV9B 3RXKA 1A0JA 2ZPLA 2ZCKP 1WIFA 4XBDA 4B75A 1IQIA 1PJPA 1SFQB 2WPDD 3PLKA 1N7TA 3U28C 5C20A 1C5VA 1RJXB 4B2AA 1F0RA 1TGNA 2QF0A 1D3QB 2EGOA 2ZEBA 1K22H 4O97A 3NUMA 3PM3A 3N99A 5ILBA 3SUZA 2BLWA 2D2DA 1Z7KA 2STBE 3DFLA 2EEKA 2IWPA 2ILNA 1C9TA 2QV1A 3BF6H 4UEHH 1G3BA 2K8IA 2R3YA 1DITH 1TBRH 3PMJA 4AYYB 3LONA 4OGYA 1O38A 2GGVB 1KY9A 1Y5UT 3BN9A 2PNTA 3RUOA 2WPMS 4KFWA 1E1RD 2PTNA 4E3BA 1YPHE 3RXUA 3P95A 1XUHA 4AORA 3A8CA 4Y6DA 1IAUA 1NU7B 2AMQA 1O2KA 1G3EA 3V3MA 3I18A 3H5CB 4Y7BA 1C5TA 5FCKA 2X7ZA 3M3TA 2PWXA 1IOEA 5D13A 1QR3E 1D3PB 1GQ4A 3WWFA 5BRRE 2K0QA 3PMAB 4AN7A 5C0UA 1UEWA 3KDGA 1S83A 1DLEA 1GJDB 2ZFSA 5G1DA 1XKAC 1ZR0A 2B8OH 3HKJB 5EW2H 1ZSKA 1OWJA 3VB3A 4TPIZ 2Q6FA 3BG4B 2IPQX 4X2VA 1Y8TA 1UW7A 1K2I1 1W7XH 3SYJA 2QAAA 1QRWA 2I1NA 4GHNA 1TBQH 2BX4A 4ABHA 3ZVFA 1YCPH 2A5IA 2AGEX 3SU2A 2ZTYA 1BZXE 2CMYA 3S9CA 1O5FH 2CSSA 4ASUD 1GI5A 1LVOA 5ETXA 4DT7B 3QGNB 1JRTA 5T6DA 4KELA 1F0TA 2Z6BD 4BXWA 1DX5M 3O8DA 1AKSA 2A4OA 4LZ1H 3U98H 5HEBA 1FY3A 1GQ5A 2ALPA 4K1SA 3AAVA 4K72A 1Z87A 1HAYB 5HM2A 1AUTC 1TGBA 4DJZB 2WPKS 1KXFA 2O8UA 1IQGA 3E1XB 2XRCA 4IMZA 5DJ7A 3SNBA 2G81E 3WKLA 4A1XA 3SV9A 4OS2A 2F9VA 3KQBA 5C94A 4YYXA 1SLUB 5E11A 2ZPSA 2XC4A 1VCPA 2F4LA 2BD4A 2ZU5A 2M0UA 1TNGA 4MPVA 3A8DA 4WMDA 5E21A 3EGHC 1L4DA 2XXLA 1XM1A 4MDSA 5IYTA 3QJNA 3PRDA 2CHAB 2EGNA 1GBFA 3EGGC 5T6GA 3SNCA 1LHGH 3CC0A 1P03A 4X1PU 3LGTA 4Q2PA 4FUIA 2SGPE 4AX9H 2A4GA 4ESTE 2VGCC 3I4WA 1GJ9B 1A4WH 5FX6A 2J2UA 1SGFG 3W94A 6CHAC 3UQVA 2AWWA 5DTHA 1C2MA 1UCYH 2VVVA 3DSOA 1KXDA 4AZ2B 4XSKU 4B1TA 3KQDA 1KYNA 2ANKH 3CH8A 1E35B 1YCPM 1P2JA 2GCTB 3NKKA 2VJ1A 1U39A 4WF8A 1ETRH 4Q2NA 1TPAE 1DANH 4DCDA 1TBZH 1Y3VA 2P59A 3LGVA 2KCAA 3SGQE 3T28A 2GT7A 1PDRA 1TRNA 2Q6GA 3A88A 1C1PA 5C1UA 3E90B 3ZZDA 3K82A 1Y5AT 2DE9A 2CF8H 1NRRH 1YPKH 4MPWA 1Z8IB 3GDUA 4UFGH 4ABGA 1T4UH 1VAEA 3Q3YA 2FX6A 3MHWU 3BTGE 1BQYA 1SGCA 2BHGA 1XVMA 3MO9A 1V2WT 2ZC9H 4OEPA 1ZMNA 4Y79A 1S81A 2PZDA 4HGCA 5TJXA 4AG2A 1QQUA 1ZHMA 2A32A 4FU7A 3BIUH 2ZU3A 4ZROA 4OM9A 1OHHD 3E16B 1E38B 1IHTH 1SLVB 2H6MA 2OQUA 3K65B 2GDEH 2AIQA 2EDVA 2VNTA 2PKAB 1VA8A 2JXOA 2VSVA 1C1MA 4AYVB 3FKSD 4I8LA 3KYFA 1H9LB 2VB0A 2ZHEH 4GVUA 1QB6A 4NMTA 3V0XA 4FUJA 1ESTA 1F0UA 1K32A 2MHOA 2ANYA 1AQ7A 1UCYE 3SUEA 5E0JA 3ZVGA 3O8CA 5FPSA 1KXCA 1W10U 1VITG 1W8BH 2JJ1D 5KEDA 5G1EA 1O3LA 1ELTA 1XKBC 2B7DH 1GJAB 1V6BA 4I7YH 2QY0B 8KME2 2TIOA 1MU8B 1YF4A 4NIYA 4CBNA 1T8LA 2FM2A 2R4HA 1O3OA 1C2DA 1QIXB 1H8HD 4NFEA 1M9UA 4X1NU 5IK2D 3PS4A 2PW8H 1GHBG 4M7GA 4X1SU 1PQ5A 1E36B 1TP3A 1E37B 1KXEA 1UTOA 3NK8A 3TGIE 2KAIB 1KDQB 3RC6A 5A0AE 4LOYH 3WWBA 1V3XA 1SQAA 1FMGA 1SR5C 1G3CA 1NRQH 3CYYA 2OMJA 1P06A 1VZQH 5EYZA 1C1TA 4O06A 3A7VA 3P8OA 3VEQB 1O3EA 1ZGVA 3A81A 2FOEA 4IS5A 1GCDA 3UOPA 1ELVA 2TGAA 1ZHPA 1JMOH 1GMHG 2ZDAH 1S0QA 1A1RA 3TVJB 3W1EA 1NZQH 1C1SA 2M0TA 1GHYH 2QN5T 2LUIA 1PYTC 3RMNH 1DOJA 2ZDNA 3F9EA 3SU1A 3ID2A 1NO9H 4NWKA 1KIGH 2FOAA 4UU6A 1KLJH 2HLCA 4DIHH 2ODPA 1K9OE 1OOKB 5EQQA 2WHXA 3U1JB 5JBTA 4ABIA 1PFXC 1SHHB 1ELFA 4CBOA 3DIWA 1SGPE 1G30B 1KTSB 1S0RA 4J2YB 2LC7A 3P6ZB 2PKUA 4OAJA 1BRAA 2UUJB 2ZHQH 3BTHE 3GCOA 1V2MT 4K1TA 1FZZA 3OTJE 3BTKE 1AUJA 1CT2E 2VH6A 3DCLA 4A1TA 2W6ID 1BMFD 3FANA 4Y0ZE 4X6MA 5GXPA 4XBBA 4I8KA 4NMPA 3PO1C 1A7SA 1HYLA 4X1RU 4XD7D 1HJAB 5T1VA 4ABAA 1C4V2 3RC4A 2BOKA 5FXLA 4NMVA 4BTUB 4Y8XA 1ABIH 1SBWA 2P93A 3K1RA 1LCYA 1TOCB 2C8XB 1LPGB 1TX8A 2QIQA 2QYIA 2WPLS 1J15A 3E0NB 1ZJKA 1GJ4H 3A84A 1BHXB 2Y80A 3RL7A 4DVAU 1O3CA 1N7EA 2DLSA 2A5AA 2PTCE 1O33A 3PMBB 4NZLA 1O2JA 4AFZA 3K6YA 5DP9A 1T8MA 2KJDA 1Z8JB 4Q7XA 2C8WB 1C1RA 3MQKC 1FI8A 1EOLA 3PYHA 2ULLA 4ZMAH 1XMNB 1C5WB 1V5LA 3KNXA 3MYWA 1BMMH 1GI3A 1NT1A 1N8OB 1BBRE 4ZHLU 1UFXA 3A7TA 1ELEE 1MAXA 3T5FH 5ABWA 1RGWA 1W9QA 2PDZA 2A7JA 4DURA 4DG4A 1O2WA 4LK4A 1GI9B 3BTFE 3L33A 2JJ2D 3LH1A 4H11A 5L6NH 1O37A 1GBLA 4SGBE 3SZNA 5LPEA 1G37A 2BQ7B 1YPLH 1N6FA 4DW2U 1SSXA 4NFFA 1MKXH 1X7AC 4YZUA 1UJUA 5EJZA 2FN5A 1CA0C 1ORFA 3TK5A 1YC0A 2LNCA 3B8JA 4IC5A 2BTCE 1LDTT 1TNKA 1EPTA 2XBYA 2XNIA 3OY5U 3H09A 3GCHC 5EXLA 4J1YA 4B71A 3RXLA 1E34B 1A5HA 3ELAH 1BCUH 2BX3A 2SFAA 2AGGX 2EDPA 1SLXB 1THSH 2ZNKH 3KGPA 1ETTH 1GI1A 2CF9H 1P1DA 2V7QD 1LKBA 1P2NA 1QRZA 4OS5A 4RT0A 2GKVE 1ANEA 4NMSA 3OEHD 2YMSC 3B76A 4U2WA 1UEZA 3JXTA 1F2SE 1GWAA 5T6FA 2QF5A 3GY5A 1SKYE 3QZQA 3UQOA 2AINA 1E79D 3GY6A 4CRBA 3SNAA 1KMHB 1O39A 1D6WA 1C1NA 1AN1E 1LQDB 1NFYA 2VIOA 2WPIS 3GCHB 3GCNA 3RMOH 3SV6A 4H42U 1ZMJA 3SU4A 4AFQA 2QC2A 1RGQA 2J9NA 1U6QA 1DSUA 2GTBA 1SL3A 3SN8A 1DFPA 5F3XA 3JZ2B 1OPHB 3TJOA 4Q7ZA 3HATH 1P9UA 2YMSB 3W95A 1AE8H 1V6DA 3RLWH 4ZCNA 5L2ZH 4NWLA 2B5TB 5HF4A 3ATMA 1YM0A 2JH5D 3VXFH 5C1XA 1PPBH 1SGYE 4ASHA 4M9FA 4GCHG 5T3HA 1O5CB 3LNYA 4CR5A 4Z6AH 1PPZA 2AMPA 2EY4C 3MU1A 3T25A 4IN1A 1HAOH 4JJ0A 2KCPA 1AU8A 2G5VA 1Y59T 2QE7D 3LDXH 4FETA 1DE7H 2EV8A 4X8UH 5EXMA 2ZTZA 1HAPH 1W11U 2PKTA 1QL9A 1KWAA 1MMJN 1U38A 4DY7B 4YT7H 4XRNA 1HXFH 2Z9GA 1P2OA 3IWMA 5DP3A 2UUYA 4TY6A 2L4TA 3B9FH 4Q3HA 4NIWA 3SU6A 2IWOA 1WXRA 1BITA 4CRFA 5A8YA 1BDAA 1D3DB 1G36A 2RA3A 4JK6A 1LKAA 1UVSH 2FO9A 1UJDA 3FVFB 4CREA 2A1DB 2BDIA 2LP6A 4ISNA 3TITA 1CE5A 2SGFE 4WYTA 1C2IA 1LHCH 4BAKB 1HBTH 3U9AH 2H3LA 2ASUB 1L1JA 2L6OA 2EEIA 1CGJE 1O2YA 3OE7D 5LPFA 4B6FA 4I8HA 4LXBH 2VWMA 1GG6C 1UTKA 1ANBA 1QLCA 2FPZA 1HAVA 3E6PH 3QO6A 4NMRA 1W0YH 2OCVB 1ELBA 3AW0A 1MD7A 2PGBB 1TIOA 3T26A 2JH0D 1C5PA 3S69A 3SUFA 2K1ZA 1C1OA 1UM1A 3SU0A 1EKBB 1O2VA 1TPPA 1OYTH 2KOHA 1GCTC 2TPIZ 1RFNA 2GX4A 1BTPA 4MPUA 5F8TA 5A0BA 1O2PA 1QJ7B 5GJ4B 1R6JA 1V5QA 2IJOB 2ALVA 3F9GA 1GG6B 3BTEE 1ZTKA 1WDIA 2IOTA 4K69A 4UU5A 3FAOA 2B0FA 2ZQ1A 2V90A 3SHWA 1J8AA 3GS9A 4FVBA 1B8QA 4JK5A 4QT8C 2R9PA 2P8OC 3VB5A 1AZZA 2ZPMA 1QQ4A 1GCTB 2QXJA 2FTMA 1L1NA 3MNBA 1BUIA 1VITF 2OP9A 3FN8A 1P3EA 3RLEA 2PSXA 1MCVA 4NSYA 1H4WA 2ANMH 1LVBA 1EATA 3EE7A 1ZPZA 1TAWA 4AGKA 3D62A 4Q2OA 3TMHA
chains in the Genus database with same CATH topology
3R0HA 4GVDA 3F3BA 3SU2A 5ESBA 2M2AA 3SOEA 2CSSA 4JOPA 1Q3OA 5HFCA 5ETXA 4ASUD 2QKVA 4NMOA 3R69A 4GVCA 1QAUA 5FB8C 3O8DA 1N6EA 4P0CA 5HEBA 4K76A 1GQ5A 4REYA 1WJLA 5EQRA 4K72A 1Z87A 1U37A 2DLUA 2P3WA 2FNEA 5HETA 1KEFA 4Z1MD 3PRBA 1U3BA 3WKLA 4A1XA 3SV9A 1Z86A 2VSPA 2F9VA 2KCYA 1WI2A 4YYXA 4B6EA 5E11A 2F0AA 1FC9A 2Z9IA 4B74A 4KTCA 3TSZA 2F4LA 1OBXA 3ZIAD 2M0UA 5H4IB 1UITA 2GZVA 2WZQA 2D8IA 4NNLA 3F2GA 2M10A 3ID3A 2E7KA 4JMYA 3SV8A 5E21A 1UEQA 2M0VA 1G9OA 3EGHC 3R68A 3U1IB 2F9UA 3QJNA 3PRDA 1VB7A 2EGNA 3EGGC 5C0TA 3CC0A 2W6JD 2JIKA 3OYPA 4Q2PA 2OBOA 2KBSA 1IU0A 4E34A 1IU2A 2A4GA 2L4SA 3I4WA 2JDID 3F2HA 2JOAA 3DJAA 4Z8JA 3M5MA 2AWWA 3FY5A 3SZEA 5DTHA 3DSOA 5GNDA 4A1VA 3QGLA 2OBQA 1H8ED 3CH8A 2OGPA 1U39A 3AXAA 4WF8A 1I16A 4Q2NA 2YMSD 5EZ0A 3E17A 3HPMA 2OINA 3O8RA 2D90A 2JREA 2FP7B 2P59A 3GDSA 2KCAA 1RZXA 5GLJA 1PDRA 3TSWA 4Z33A 1I92A 3E90B 2L97A 1WFVA 3K82A 1WF8A 3SUGA 1P1EA 2H2CA 4JOEA 1W3CA 3QJMA 1W0JD 5EPNA 3GDUA 1WHDA 1DXWA 2M0ZA 2JINA 1VAEA 2QF4A 2F5YA 4JOGA 2KOJA 1N1LA 1W0KD 2AWUA 1TQ3A 4OEPA 2QG1A 2FE5A 2PZDA 2CSJA 1V1TA 2OSGA 4YDPA 2O2TA 3SU3A 4OM9A 5FHTA 1OHHD 2YTWA 1BFEA 3OTPA 2EEHA 2EDVA 3LOXA 4YXWD 4JOHA 1QAVA 4K8BA 1VA8A 2JXOA 2VSVA 3FKSD 2JWEA 4HOPB 4KFVA 1WHAA 4K75A 2BYGA 2OQSA 4NMTA 2KM0A 3PV2A 1N7FA 1K32A 3OFND 2MHOA 4I31A 3O8CA 2QT5A 3SUEA 5E1YA 2REYA 2A4QA 2JIZD 5FPSA 3GGEA 2JJ1D 5E6PB 5G1EA 3L6PA 4JJ3A 2OC8A 2OS6A 1V6BA 1WG6A 3I1EA 3K50A 2FM2A 4Q6SA 1FC7A 2R4HA 1FC6A 1EFRD 1H8HD 5I7ZA 5IK2D 3PS4A 3PDZA 1RGRA 3KZDA 1UM7A 1TP3A 3LKWA 5HFBA 5HKKD 4OEOA 3KN2A 2RRMA 1GM1A 3RC6A 5DN6D 2YUBA 3WWBA 2XCNA 3CBYA 2DJTA 5CDFE 2DC2A 2OMJA 3CYYA 4JOJA 2EAQA 4K6YA 2KFWA 5EYZA 4O06A 3P8OA 3GSLA 3NCVA 3TSVA 3F0PA 4WH6A 4R2ZA 1JXPA 1X8SA 2WSSD 5JXBA 4F8KA 1A1RA 3M5NA 2IWQA 2DKRA 3W1EA 2KJPA 2Q9VA 4I32A 2OK5A 1RY4A 2JSNA 2M0TA 3HVQC 1DY9A 4I33A 2XNDD 2LUIA 3WKMA 3ID4A 2MX6A 3VQGA 1TP5A 1M5ZA 3OAAD 3SU1A 3ID2A 2H3MA 4NWKA 4UU6A 2J5UA 2YUYA 3NGHA 1E1QD 5EQQA 2WHXA 3LNXA 2A4RA 3U1JB 3KEEA 3KZEA 5E22A 1WFGA 3DIWA 4P2AB 2LC7A 2W4FA 2FCFA 2PKUA 4OAJA 2HE4A 1XZ9A 3CS0A 3PV5A 5B6LA 3GCOA 2EDZA 5F53A 2PA1A 2QKUA 1NF3C 4A1TA 3DCLA 1Q3PA 1MABB 2W6ID 3SFJA 1BMFD 1MFGA 2F43B 5FL7D 4JOKA 2LA8A 3GJ9A 3STJA 2KG2A 5HEYA 4Q6HA 4NMPA 2VBCA 2W7RA 3F2FA 4XD7D 2I0LA 3MH7A 3NFKA 3M5OA 5T1VA 3RC4A 1VCWA 4XHVA 3UB0A 2D92A 4NMVA 4TYDA 3FOAA 2KL1A 3K1RA 1LCYA 5IDKA 2YOLA 3KDKA 5HJ1A 4JL7A 1TE0A 3RL7A 4RI0A 1N7EA 1N99A 3QDOA 2YT8A 2DLSA 5HF1A 2ENOA 4E35A 1W9OA 2EEJA 3KHFA 2OZFA 4FLNA 3M5LA 2CK3D 1NTEA 3O5NA 2KJDA 1COWD 2KPLA 1NS3A 5DSFA 4TSFD 1V5LA 3KNXA 2IWNA 5GPIB 3O46A 2KJKA 3DJ1A 2AWXA 4Q2QA 1UFXA 2K1QA 2GVFA 2HGAA 4TT3D 3SV7A 1RGWA 1W9QA 2PDZA 2DAZA 2QBWA 2EHRA 2VZ5A 2CS5A 4Q2OA 1X45A 1X5QA 2JJ2D 1N6DA 3BPUA 3CBXA 4H11A 2EEGA 4MPAA 1N6FA 2LOBA 2Z17A 5CHBA 1OBZA 1D5GA 3N7EA 1Q7XA 1UJUA 1V62A 2DMZA 2FN5A 2XNIA 1CU1A 2VPHA 4NMQA 2I6VA 5H3JA 1T2MA 4AMHA 2KCOA 3H09A 5HEDA 4B71A 3PDVA 5F67A 1SOTA 3DSPA 2EDPA 1FCFA 2OC7A 1IHJA 3AK5A 2AHME 3QIKA 5IL9A 1P1DA 2V7QD 2OCSA 4NNMA 4NMSA 3OEHD 2YMSC 3B76A 4FGMA 1UEZA 1W9EA 3JXTA 3DORA 5C17A 5EPYA 2QF5A 1SKYE 2AINA 1E79D 3SUDA 2LC6A 1DXPA 1KMHB 4F55A 3PV4A 3EYDA 2H2BA 3GCNA 4G69A 3SV6A 2RCZA 3SU4A 2Q3GA 5EQSA 2EGKA 2KV8A 4K78A 2XOKD 4EDJA 3RL8A 2K20A 1RGQA 3RC5A 1BT7A 1UEPA 2LELA 3ID1A 4Q63A 5F3XA 4U01A 4LMMA 3WW7A 2YMSB 4WYUA 3P8NA 1NBME 4ZCNA 1MC7A 4NWLA 2KQFA 3OEED 2UZCA 3GABA 5HF4A 4NXPA 2O8MA 1FX0B 4M9FA 3LNYA 3N7DA 1UHPA 1YBOA 2V1WA 4HOPA 3NFLA 5FPYA 4DT4A 4JJ0A 2KCPA 2KAWA 4IC6A 2QE7D 2I04A 1X9ZA 3OU0A 3NRLA 2GEFA 2WV9A 1X5NA 4FETA 2EV8A 1WH1A 2DB5A 2KPKA 4PQWA 1QAVB 1NBMD 2KOMA 5HFFA 2PKTA 2KR7A 1KWAA 2OC1A 1U38A 2DM8A 4B73A 4B76A 3O8BA 2VRFA 2KRGA 3F0OA 2L4TA 4Q4LA 4Q3HA 3SU6A 1OBYA 1UJVA 2IWOA 2OPGA 5FPTA 1WXRA 3SHUA 1DY8A 1UJDA 4L8NA 2FOMB 2EJYA 2ZPLA 4B75A 1WIFA 2WPDD 4WYTA 2I0IA 1N7TA 4JORA 2H3LA 2JILA 2EEIA 2L6OA 4A92A 1X6DA 3OE7D 4B6FA 1MFLA 1RTLA 1QLCA 3N99A 5ILBA 3SUZA 3QO6A 2HE2A 4NMRA 4N6XA 1L6OA 4NXRA 3GDVA 2IWPA 3CBZA 3QE1A 2QV1A 2OC0A 3SUFA 2K1ZA 3SU5A 2WL7A 2VWRA 4R8TB 3MH4A 2K8IA 1UM1A 2R3YA 3SU0A 4NXQA 5A2PA 5HFDA 1X5RA 3LONA 2KOHA 2XCFA 2YT7A 2GGVB 1KY9A 2PNTA 4KFWA 1E1RD 5HDYA 1SOZA 4E3BA 5GJ4B 1R6JA 1V5QA 2IJOB 3L4FD 4UU5A 2KZ4A 2V90A 3SHWA 3GS9A 1UF1A 3I18A 1B8QA 2EXGA 3HPKA 2KYLA 2I4SA 2X7ZA 1ZOKA 3FO8D 1OZIA 5D13A 2G5MB 2M3MA 3WWFA 1GQ4A 3MH6A 2K0QA 4WH8A 5C0UA 2ZPMA 1UEWA 1ZUBA 3KDGA 3KF2A 2G2LA 3VQFA 5B42A 3DJ3A 2KA9A 3VG8A 1WF7A 5G1DA 2QKTA 5HFEA 3FN8A 3RLEA 2HLDD 1Y8TA 1S6LA 2IJD1 3ZRTA 1Y7NA 3SYJA 1WI4A 1BE9A 1VJ6A 2I1NA 4GHNA 2EGOA 4JOFA 3TMHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3R0H A;  4GVD A;  3SU2 A;  5ESB A;  3SOE A;  2CSS A;  4JOP A;  1Q3O A;  5HFC A;  5ETX A;  2QKV A;  4NMO A;  3R69 A;  4GVC A;  1QAU A;  5FB8 C;  3O8D A;  1N6E A;  4P0C A;  5HEB A;  4K76 A;  1GQ5 A;  4REY A;  1WJL A;  5EQR A;  4K72 A;  1Z87 A;  1U37 A;  2DLU A;  2P3W A;  2FNE A;  5HET A;  1KEF A;  1U3B A;  3WKL A;  4A1X A;  3SV9 A;  1Z86 A;  2VSP A;  2F9V A;  1WI2 A;  4YYX A;  4B6E A;  5E11 A;  2F0A A;  1FC9 A;  2Z9I A;  4B74 A;  4KTC A;  3TSZ A;  2F4L A;  1OBX A;  2M0U A;  5H4I B;  1UIT A;  2GZV A;  2WZQ A;  2D8I A;  4NNL A;  2M10 A;  3ID3 A;  2E7K A;  4JMY A;  3SV8 A;  5E21 A;  1UEQ A;  2M0V A;  1G9O A;  3EGH C;  3R68 A;  3U1I B;  2F9U A;  3QJN A;  1VB7 A;  2EGN A;  3EGG C;  3CC0 A;  2JIK A;  3OYP A;  4Q2P A;  2OBO A;  2KBS A;  1IU0 A;  4E34 A;  1IU2 A;  2A4G A;  2L4S A;  3I4W A;  2JOA A;  3DJA A;  4Z8J A;  3M5M A;  2AWW A;  3FY5 A;  3SZE A;  5DTH A;  5GND A;  4A1V A;  3QGL A;  2OBQ A;  3CH8 A;  2OGP A;  1U39 A;  3AXA A;  4WF8 A;  1I16 A;  4Q2N A;  5EZ0 A;  3E17 A;  3HPM A;  2OIN A;  3O8R A;  2D90 A;  2JRE A;  2FP7 B;  2P59 A;  3GDS A;  1RZX A;  5GLJ A;  1PDR A;  3TSW A;  4Z33 A;  1I92 A;  3E90 B;  2L97 A;  1WFV A;  3K82 A;  1WF8 A;  3SUG A;  1P1E A;  2H2C A;  4JOE A;  1W3C A;  3QJM A;  5EPN A;  3GDU A;  1WHD A;  1DXW A;  2M0Z A;  2JIN A;  1VAE A;  2F5Y A;  4JOG A;  2KOJ A;  1N1L A;  2AWU A;  1TQ3 A;  4OEP A;  2QG1 A;  2FE5 A;  2PZD A;  2CSJ A;  1V1T A;  2OSG A;  4YDP A;  2O2T A;  3SU3 A;  4OM9 A;  5FHT A;  2YTW A;  1BFE A;  3OTP A;  2EEH A;  2EDV A;  3LOX A;  4JOH A;  1QAV A;  4K8B A;  1VA8 A;  2JXO A;  2VSV A;  2JWE A;  4HOP B;  4KFV A;  1WHA A;  4K75 A;  2BYG A;  2OQS A;  4NMT A;  3PV2 A;  1N7F A;  1K32 A;  4I31 A;  2MHO A;  3O8C A;  2QT5 A;  3SUE A;  5E1Y A;  2REY A;  2A4Q A;  5FPS A;  3GGE A;  5E6P B;  5G1E A;  3L6P A;  2OC8 A;  2OS6 A;  1V6B A;  1WG6 A;  3I1E A;  3K50 A;  2FM2 A;  4Q6S A;  1FC7 A;  2R4H A;  1FC6 A;  5I7Z A;  3PS4 A;  3PDZ A;  1RGR A;  3KZD A;  1UM7 A;  1TP3 A;  3LKW A;  5HFB A;  4OEO A;  3KN2 A;  2RRM A;  1GM1 A;  3RC6 A;  2YUB A;  2XCN A;  3CBY A;  2DJT A;  2DC2 A;  2OMJ A;  3CYY A;  4JOJ A;  2EAQ A;  4K6Y A;  5EYZ A;  4O06 A;  3P8O A;  3GSL A;  3TSV A;  4WH6 A;  4R2Z A;  1JXP A;  1X8S A;  5JXB A;  4F8K A;  1A1R A;  3M5N A;  2IWQ A;  2DKR A;  2KJP A;  2Q9V A;  4I32 A;  2OK5 A;  1RY4 A;  2M0T A;  3HVQ C;  1DY9 A;  4I33 A;  2LUI A;  3WKM A;  3ID4 A;  2MX6 A;  3VQG A;  1TP5 A;  1M5Z A;  3SU1 A;  3ID2 A;  2H3M A;  4NWK A;  4UU6 A;  2YUY A;  3NGH A;  5EQQ A;  2WHX A;  3LNX A;  2A4R A;  3U1J B;  3KEE A;  3KZE A;  5E22 A;  1WFG A;  3DIW A;  4P2A B;  2LC7 A;  2W4F A;  2FCF A;  2PKU A;  4OAJ A;  2HE4 A;  1XZ9 A;  3CS0 A;  3PV5 A;  5B6L A;  3GCO A;  2EDZ A;  2PA1 A;  2QKU A;  1NF3 C;  4A1T A;  1Q3P A;  3SFJ A;  1MFG A;  4JOK A;  2LA8 A;  3GJ9 A;  3STJ A;  2KG2 A;  5HEY A;  4Q6H A;  4NMP A;  2VBC A;  2W7R A;  2I0L A;  3MH7 A;  3NFK A;  3M5O A;  5T1V A;  3RC4 A;  1VCW A;  4XHV A;  2D92 A;  4NMV A;  4TYD A;  2KL1 A;  3K1R A;  1LCY A;  5IDK A;  2YOL A;  5HJ1 A;  4JL7 A;  1TE0 A;  3RL7 A;  4RI0 A;  1N7E A;  1N99 A;  3QDO A;  2YT8 A;  2DLS A;  5HF1 A;  2ENO A;  4E35 A;  1W9O A;  2EEJ A;  3KHF A;  2OZF A;  3M5L A;  1NTE A;  3O5N A;  2KJD A;  2KPL A;  1NS3 A;  1V5L A;  3KNX A;  2IWN A;  5GPI B;  3O46 A;  2KJK A;  3DJ1 A;  2AWX A;  4Q2Q A;  1UFX A;  2K1Q A;  2GVF A;  2HGA A;  3SV7 A;  1RGW A;  1W9Q A;  2PDZ A;  2DAZ A;  2QBW A;  2EHR A;  2VZ5 A;  2CS5 A;  4Q2O A;  1X45 A;  1X5Q A;  1N6D A;  3BPU A;  3CBX A;  4H11 A;  2EEG A;  4MPA A;  1N6F A;  2LOB A;  2Z17 A;  1OBZ A;  1D5G A;  1Q7X A;  1UJU A;  1V62 A;  2DMZ A;  2FN5 A;  2XNI A;  1CU1 A;  2VPH A;  4NMQ A;  2I6V A;  5H3J A;  1T2M A;  4AMH A;  3H09 A;  4B71 A;  5HED A;  3PDV A;  5F67 A;  1SOT A;  2EDP A;  1FCF A;  2OC7 A;  1IHJ A;  3AK5 A;  3QIK A;  1P1D A;  2OCS A;  4NNM A;  4NMS A;  3B76 A;  4FGM A;  1UEZ A;  1W9E A;  3JXT A;  3DOR A;  5EPY A;  2AIN A;  3SUD A;  2LC6 A;  1DXP A;  3PV4 A;  3EYD A;  2H2B A;  3GCN A;  4G69 A;  3SV6 A;  2RCZ A;  3SU4 A;  2Q3G A;  5EQS A;  2EGK A;  2KV8 A;  4K78 A;  4EDJ A;  3RL8 A;  2K20 A;  1RGQ A;  3RC5 A;  1BT7 A;  1UEP A;  3ID1 A;  5F3X A;  4U01 A;  4LMM A;  4WYU A;  3P8N A;  1MC7 A;  4NWL A;  2KQF A;  2UZC A;  5HF4 A;  4NXP A;  2O8M A;  4M9F A;  3LNY A;  1UHP A;  1YBO A;  2V1W A;  4HOP A;  3NFL A;  5FPY A;  2KAW A;  4IC6 A;  2I04 A;  3OU0 A;  2WV9 A;  1X5N A;  2EV8 A;  1WH1 A;  2DB5 A;  2KPK A;  4PQW A;  1QAV B;  2KOM A;  5HFF A;  2PKT A;  1KWA A;  2OC1 A;  1U38 A;  2DM8 A;  4B73 A;  4B76 A;  3O8B A;  2VRF A;  2KRG A;  2L4T A;  4Q3H A;  3SU6 A;  1OBY A;  1UJV A;  2IWO A;  2OPG A;  5FPT A;  1WXR A;  3SHU A;  1DY8 A;  1UJD A;  4L8N A;  2FOM B;  2EJY A;  2ZPL A;  4B75 A;  1WIF A;  4WYT A;  2I0I A;  1N7T A;  4JOR A;  2H3L A;  2JIL A;  2EEI A;  4A92 A;  1X6D A;  4B6F A;  1MFL A;  1RTL A;  1QLC A;  3SUZ A;  3QO6 A;  2HE2 A;  4NMR A;  4N6X A;  1L6O A;  4NXR A;  3GDV A;  2IWP A;  3CBZ A;  3QE1 A;  2QV1 A;  2OC0 A;  3SUF A;  2K1Z A;  3SU5 A;  2WL7 A;  2VWR A;  4R8T B;  3MH4 A;  1UM1 A;  2R3Y A;  3SU0 A;  4NXQ A;  5A2P A;  5HFD A;  1X5R A;  3LON A;  2KOH A;  2XCF A;  2YT7 A;  2GGV B;  1KY9 A;  2PNT A;  4KFW A;  5HDY A;  1SOZ A;  4E3B A;  5GJ4 B;  1R6J A;  1V5Q A;  2IJO B;  3L4F D;  4UU5 A;  2V90 A;  3SHW A;  1UF1 A;  3I18 A;  1B8Q A;  2EXG A;  3HPK A;  2KYL A;  2I4S A;  2X7Z A;  1ZOK A;  1OZI A;  5D13 A;  2G5M B;  2M3M A;  1GQ4 A;  3MH6 A;  4WH8 A;  2ZPM A;  1UEW A;  1ZUB A;  3KF2 A;  2G2L A;  3VQF A;  3DJ3 A;  2KA9 A;  1WF7 A;  5G1D A;  2QKT A;  5HFE A;  3RLE A;  1Y8T A;  2IJD 1;  3ZRT A;  1Y7N A;  3SYJ A;  1WI4 A;  1BE9 A;  1VJ6 A;  2I1N A;  4GHN A;  2EGO A;  4JOF A;  3TMH A; 
#chains in the Genus database with same CATH topology
 2P8O B;  2JET C;  3F3B A;  3LGY A;  1EJM A;  3MNC A;  1MU6 B;  4DII H;  1PPE E;  4JOP A;  1Q3O A;  5HFC A;  1GHB F;  1QJ1 B;  1FJS A;  4WMF A;  1VR1 H;  5F8Z A;  1MBM A;  1O3G A;  5LH8 A;  3DHK H;  3GYM A;  2SGE E;  4JZ1 A;  2AEI H;  2CXV A;  3TNS A;  1QAU A;  3T2N A;  2XWA A;  2NU2 E;  1QCP A;  2NU1 E;  1HB0 B;  1C2K A;  4P0C A;  3HGP A;  1EOJ A;  3QTV H;  1XUK A;  4IMQ A;  2FOG A;  2BB4 A;  1VGC B;  2FNE A;  5HET A;  1BRU P;  4ZAE A;  4VGC B;  3MI4 A;  1Z1J A;  3QX5 H;  1OS8 A;  3A89 A;  4Z1M D;  4CH2 B;  1F5K U;  1U3B A;  1CBW B;  1GMH F;  1RS0 A;  1SGD E;  1TNJ A;  2ZKS A;  5A2M H;  3TH2 H;  1V2L T;  1OX1 A;  4KTC A;  3T27 A;  3TSZ A;  3GY2 A;  2Z3D A;  1C5L H;  3MFJ A;  1OYQ A;  1CQQ A;  4Y11 E;  5C67 A;  1HJ9 A;  1NFX A;  1UTJ A;  2AIP A;  4X6N A;  3RLY H;  2NU3 E;  3SV8 A;  5EXN A;  3TK9 A;  2VH0 A;  4YT6 H;  1G9O A;  1FY5 A;  3R68 A;  1UTL M;  2PLX A;  2WYJ A;  1UVT H;  2ZO3 H;  2F9U A;  1BTX A;  1N6X A;  1ZSJ A;  2JIK A;  3FZD A;  2OBO A;  3TJN A;  2KBS A;  4E34 A;  2GCH G;  2L4S A;  1TAB E;  2UUK B;  1LHE H;  3F2H A;  2JOA A;  2HNT F;  4Z8J A;  4X6P A;  3FY5 A;  4A1V A;  3QGL A;  2OBQ A;  1H8E D;  1TNH A;  2QXI A;  1SFI A;  1WOF A;  2OGP A;  4FU9 A;  9LPR A;  1XUF A;  2BXT H;  3AXA A;  3A7Z A;  3K9X B;  3SI4 H;  1G2M A;  3UNS A;  5HIY A;  5EZ0 A;  3E17 A;  1V2J T;  3ZVD A;  3O8R A;  2JRE A;  1AIX H;  3SI3 H;  2ZIQ H;  4WJG 2;  1IQM A;  7GCH G;  3RML H;  3MNS A;  1GJC B;  3TSW A;  1FLE E;  4Z33 A;  1K28 D;  1I92 A;  2HNT C;  1AND A;  2L97 A;  5F6M A;  1C5Q A;  2ZU1 A;  1WF8 A;  1NRP H;  3SHA H;  1Q2W A;  3QJM A;  2BD3 A;  2BLV A;  1WHD A;  3BG4 C;  2M0Z A;  1OXG A;  4WVP E;  2F5Y A;  1Y3X A;  2FDA A;  1TQ3 A;  6EST A;  1O3N A;  2VVC A;  3TGJ E;  1WV7 H;  1EAU A;  2FES H;  3EST A;  4INH A;  2O2T A;  3RXM A;  1ESB A;  2YTW A;  2ZWL H;  1BFE A;  3UPE A;  1KXB A;  1SLW B;  1DVA H;  3LIW A;  4YXW D;  1QAV A;  1EP5 A;  2P3F H;  1ZSL A;  2JWE A;  4HOP B;  3KL6 A;  3RU4 T;  4KFV A;  1WHA A;  2Z9J A;  3EA9 A;  5A09 A;  1G32 B;  1SGN E;  2H5D A;  2LPR A;  4BNR A;  3PV2 A;  1QA7 A;  2VWO A;  3MU4 A;  4K60 A;  4GPG A;  1UTM A;  2BVS H;  3K2U A;  1C5R A;  2H9T H;  4ACB A;  5E1Y A;  3GGE A;  5E6P B;  1UJ1 A;  1V2R T;  1O3F A;  1SQR A;  2ZPR A;  2FOF A;  3C27 B;  1TGS Z;  2BD2 A;  3RXE A;  2ZEC A;  1Y3W A;  2Y7Z A;  1FC7 A;  1FC6 A;  3F6U H;  2ZQ2 A;  5I7Z A;  3RXD A;  1FXY A;  4UFD H;  4LZ4 B;  1CA8 B;  2HNT E;  4Y71 A;  2ZFP H;  4AFS A;  4PRO A;  4MVN A;  2AMD A;  1MAY A;  1N6Y A;  1HIA A;  3MU5 A;  4OEO A;  1NRN H;  1HPG A;  2V6N A;  3KN2 A;  2ZF0 H;  2ZG0 H;  3M7U A;  4WXI A;  1GM1 A;  1B0E A;  3FFG A;  4IW4 E;  5AFZ H;  1CSO E;  1LVY A;  1D9I A;  3CBY A;  2ZGH A;  2DJT A;  2V3M A;  2EC9 H;  4K6Y A;  4IBL H;  2KFW A;  1C5X B;  1O5A B;  2CHA C;  4NCY A;  3SJ9 A;  1YKT A;  1DWE H;  3GYL B;  1NES E;  1Z8G A;  3ZZ8 A;  5EJ1 A;  1IHS H;  2WSS D;  4GCH F;  5JXB A;  4WY3 A;  3E91 A;  3P17 H;  3P70 B;  2OK5 A;  3ATL A;  3VPK A;  1XXD A;  1QJ6 B;  3A7X A;  4I33 A;  5J4Q A;  2GCT C;  3OSY A;  3ID4 A;  2MX6 A;  6GCH G;  1GGD B;  4MNW A;  4MTB A;  3ATI A;  2GMT B;  2RG3 A;  1NTP A;  1UVP A;  3BSQ A;  2RDL A;  4GAW A;  1YCP K;  2FYQ A;  3BV9 B;  1GJ7 B;  1TRY A;  1TLD A;  4K8Y A;  2VID A;  2XWB I;  1C2L A;  5E2O A;  1C4U 2;  2G52 A;  3KZE A;  2DUC A;  3FP7 E;  5KGO A;  2W4F A;  2HE4 A;  5B6L A;  2ZU4 A;  3F68 H;  2STA E;  2WPH S;  3NCL A;  4BTT B;  1PQ8 A;  2I6S A;  3PWC A;  4A5T S;  2BM2 A;  2ZGB H;  3HK6 B;  3GJ9 A;  2KG2 A;  3SJK A;  5HEY A;  1HGT H;  1LO6 A;  2W7R A;  4GHT A;  3TIU A;  5DP5 A;  2I0L A;  3MH7 A;  3NFK A;  3M5O A;  1TMU H;  5AVD A;  3ZZB A;  4XHV A;  4GSO A;  1FY1 A;  1BJU A;  3BTT E;  3UB0 A;  4TYD A;  2KL1 A;  1H1B A;  5IDK A;  1UHB A;  2YOL A;  2PSY A;  1ARC A;  2F9P A;  2BDG A;  2GV6 A;  2VWL A;  2ZHF H;  3I78 A;  1TON A;  1YPM H;  3RXI A;  3ZVE A;  1O2H A;  2FOC A;  1AKS B;  1ZLR A;  2CK3 D;  2BZ6 H;  3CS7 A;  2V0B A;  3S7H B;  3TJU A;  3UNR A;  1O3M A;  2XC0 A;  2XBV A;  3F9H A;  1EZQ A;  4TSF D;  4X0W U;  2YNB A;  1O2Z A;  1P2K A;  4ISI H;  4Y7A A;  5GPI B;  3DJ1 A;  3P8G A;  4Q2Q A;  3LC3 A;  5DKM A;  3V13 A;  2K1Q A;  1O3K A;  4UDW H;  1O3P B;  4MNY A;  1BTY A;  1BML A;  4MPX A;  3PB1 E;  4HZH A;  1GJ8 B;  2VZ5 A;  1A61 H;  4JZI A;  3AVZ A;  1X45 A;  1X5Q A;  3BPU A;  5CHB A;  2AYW A;  2ZFQ H;  1OBZ A;  1O2L A;  3N7E A;  1Q7X A;  2DMZ A;  3TGK E;  3EA8 A;  1B5G H;  1ZYO A;  2RDE A;  4MLF B;  1V2V T;  1SMF E;  3L3T A;  2BY5 X;  4JZD H;  2VPH A;  4NMQ A;  3M7Q A;  1O2S A;  4I8G A;  4AMH A;  5C0T A;  4P02 A;  4R0I A;  1HNE E;  5F67 A;  2ZCL P;  1SOT A;  3DSP A;  3UNQ A;  2BD9 A;  3AK5 A;  3QIK A;  5IL9 A;  3A8B A;  5TCC A;  2OCS A;  1K1J A;  4YTA A;  3P92 A;  1W9E A;  3A87 A;  4OS6 A;  3DOR A;  3I29 A;  4CRD A;  2BYA X;  1OWK A;  3SUD A;  1GVK B;  1THP B;  5DK1 A;  3PV4 A;  1SC8 U;  2PR3 A;  2BY7 X;  1ZJD A;  1GBJ A;  3A8A A;  5EQS A;  2EGK A;  2KV8 A;  1YGC H;  8EST E;  4WWY A;  1RD3 B;  5AF9 H;  3Q77 A;  4WME A;  1ANC A;  1TQ0 B;  3WY8 A;  3ID1 A;  3RXP A;  1FIZ A;  4ZKR U;  2BDC A;  4U01 A;  1GBT A;  1FDP A;  2FI3 E;  1SGI B;  1BIO A;  4WYU A;  3D23 A;  1MC7 A;  5BPE A;  3OEE D;  2UZC A;  3TH4 H;  1RRK A;  3GAB A;  1G9I E;  1BHX F;  1EJA A;  1V2S T;  3PMH B;  4ZXX H;  1BBR H;  2WUB A;  3N7D A;  1UHP A;  2FIR H;  1MTW A;  4FVD A;  3NFL A;  1GBD A;  1AFQ B;  1EB2 A;  1GI4 A;  2F3C E;  3E8L A;  1GHV H;  4DT4 A;  1TMB H;  2KAW A;  1C5N H;  2TBS A;  1HJA C;  1WYK A;  3MO6 A;  1X9Z A;  5JYI A;  1O3D A;  3NRL A;  2GEF A;  1UK2 A;  4FUE A;  1C5S A;  1BMA A;  4AG1 A;  3CNR A;  1KXA A;  5HFF A;  5EU8 A;  5C1Y A;  2EST E;  4B76 A;  2R0K A;  3PWB A;  3F0O A;  2GCH F;  3FP8 E;  3EE0 B;  4Q4L A;  3SHC H;  5GCH G;  5JBA S;  1A3E H;  1C5O H;  3ZZC A;  4A6L A;  1ELD E;  1DY8 A;  2FI5 E;  1C1U H;  3S0N A;  3MNX A;  8LPR A;  4NGA H;  2EJY A;  2I0I A;  1N8O C;  4JOR A;  3UTU H;  3KQ5 A;  1QB9 A;  5FX5 A;  5E0H A;  1KSN A;  3HKI B;  1AB9 C;  1X6D A;  4FUB A;  4O03 A;  7GCH F;  1WQS A;  1RTL A;  4N6X A;  3GOV B;  1L6O A;  3GIS B;  2C8Z B;  3GDV A;  2JKH A;  5EST E;  4K1E A;  3CBZ A;  3QE1 A;  3SOR A;  3QDZ B;  5F8X A;  3H7T A;  4Q7Y A;  2WL7 A;  5JPM H;  5HXF A;  2ZDV H;  2TGD A;  1LQE A;  1O2U A;  1X5R A;  3EQ0 H;  1THR H;  3NPS A;  3ZYD A;  2QA9 E;  1DST A;  1UK3 A;  2W5E A;  2BQW B;  2XCF A;  1Q31 A;  1GI7 B;  1AB9 B;  3BTM E;  3JZ1 B;  5HDY A;  4X8S H;  2ZGC A;  1SGR E;  1TPS A;  1O31 A;  1PPG E;  1LPK B;  1UVU H;  4JYV H;  4AB8 A;  2PKS C;  2F91 A;  2KZ4 A;  2G5N A;  2F83 A;  2F9O A;  3DA9 B;  1UF1 A;  1XXF A;  1SQO A;  1O30 A;  3HPK A;  2KYL A;  2Q1J A;  2I4S A;  2G5M B;  3MH6 A;  3M3V A;  4WH8 A;  1AMH A;  1ZUB A;  1VKY A;  4E05 H;  1AWF H;  1O2T A;  2KA9 A;  1WF7 A;  2QKT A;  5TCA A;  1L0Z A;  1GVZ A;  1PPF E;  1G3D A;  1S6L A;  2IJD 1;  2V3H H;  2PKS B;  1SVP A;  2HGT H;  2ZFR H;  2W26 A;  1Y7N A;  1XUG A;  1BE9 A;  4UE7 H;  4JOF A;  1WU1 A;  3BEU A;  5DG6 A;  2Y6T A;  2PUX B;  2QXH A;  4K5Z A;  2R0L A;  1L1G A;  1ZRK A;  4H6S B;  3R69 A;  2ZDM A;  2TRM A;  3KID U;  2HPQ H;  2SNV A;  3RU4 E;  1N6E A;  2C93 B;  2F9B H;  2J98 A;  3DT0 H;  4REY A;  5A0C A;  2UUF B;  5EQR A;  3OX7 U;  2FOD A;  1P10 A;  1EUF A;  2DLU A;  2P3W A;  1K1P A;  2A45 B;  5F03 A;  1EAX A;  1WQV H;  7EST E;  1S6F A;  2OLG A;  1BTW A;  1T8O A;  1DT2 A;  3PRB A;  1DPO A;  2VSP A;  2PUQ H;  4WXV A;  3PTN A;  1DWB H;  5I46 H;  4X6O A;  3UWJ H;  2F0A A;  5HGG A;  3RXS A;  2Z9I A;  4B74 A;  4HG6 A;  3SQE E;  1SGF A;  4CHA C;  3SW2 B;  2OXS A;  3A80 A;  6GCH F;  5H4I B;  1UIT A;  2GZV A;  1KTT B;  1LHF H;  2WZQ A;  3F2G A;  4YM9 A;  2M10 A;  2E7K A;  1Q3X A;  2GJG A;  2IN2 A;  1GI0 A;  4JMY A;  4YO9 A;  3LC5 A;  4FU8 A;  4GLY A;  2TGT A;  1UEQ A;  2M0V A;  1GVL A;  3MH5 A;  2SGA A;  4Z0K A;  1J17 T;  1GDQ A;  1TRM A;  1FN6 A;  4RN6 A;  4KTU A;  1GJ5 H;  2QXG A;  2CV3 A;  2WIN I;  1O3H A;  1V2Q T;  3OYP A;  4D8N A;  1O3A A;  5HM9 A;  3F1S B;  2SGQ E;  3DJA A;  4CHA B;  1F5R A;  1EPT B;  1O2R A;  1TX7 A;  3GY3 A;  1V2O T;  1A5G H;  2UWP A;  1WUN H;  1S5S A;  2FLB H;  2W7U A;  1A3B H;  1S84 A;  2HOB A;  1BMN H;  1OP8 A;  3RXF A;  3UUZ A;  1I16 A;  4OS1 A;  4YES B;  1SB1 H;  1LTO A;  1SHY A;  3HPM A;  2OIN A;  3HGN A;  2D90 A;  3MU8 A;  3GDS A;  3RXO A;  1RZX A;  1YLN A;  5GLJ A;  1MH0 A;  1GDU A;  1ZGI A;  1MBQ A;  4FOU C;  2JH6 D;  1HJ8 A;  2QCY A;  1K21 H;  4U30 A;  2ZU2 A;  5EOD A;  1GPZ A;  1W3C A;  1CGI E;  1S6H A;  1V2N T;  1W0J D;  5JB8 S;  4F49 A;  1DXW A;  1HXE H;  2JIN A;  3QK1 A;  4GUX A;  2QF4 A;  2AWU A;  4TY7 A;  4RSP A;  2VIV A;  2FE5 A;  1FY4 A;  2FOH A;  2CSJ A;  2OSG A;  1ARB A;  2OTV A;  3SU3 A;  5FHT A;  1SG8 B;  2VU8 E;  1AFE H;  3OTP A;  2BQ6 B;  3ZYE A;  1FY8 E;  4Q80 A;  1XUJ A;  1OWI A;  4JOH A;  3F9F A;  1MZD A;  1HV7 A;  3LJJ A;  5FBE A;  5J4S A;  2OQS A;  1P9S A;  2KM0 A;  2ZA5 A;  1GBK A;  1IQH A;  1BTZ A;  3RXC A;  4I31 A;  3S9A A;  5DP4 A;  1KLT A;  2QT5 A;  1MKW H;  4YLQ H;  2A4Q A;  2JIZ D;  4MG3 A;  1P11 E;  2Y5F A;  1ZPB A;  3LT3 A;  4JJ3 A;  1VGC C;  1TYN A;  4UFE H;  2OS6 A;  5C2Z A;  5K7R A;  3UAI C;  1D6R A;  4VGC C;  5E2P A;  2SNW A;  4Q6S A;  3U8R H;  1ELC A;  1VIT H;  2G8T A;  1CBW C;  1KLI H;  1EFR D;  2F9N A;  3RMM H;  2ZDL A;  1UVO A;  2A0Q B;  1W12 U;  5HMA A;  3S9B A;  4ACA A;  4ISL A;  5JBC S;  1RGR A;  2A31 A;  1YWU A;  3LKW A;  5HKK D;  5DP7 A;  5K0H A;  1CT0 E;  2KX4 A;  2IPH A;  5FCR A;  1C2J A;  1O3I A;  2GZ9 A;  1HAV B;  3R3G B;  2H9E H;  5CDF E;  1V2P T;  3VGC C;  2DC2 A;  4JOJ A;  1K1M A;  3U8O H;  5JB9 S;  1C1V H;  1CO7 E;  2GD4 B;  3NCV A;  3TSV A;  4SGA E;  4Y10 E;  3F0P A;  1HCG A;  4WH6 A;  3RXQ A;  5FAH A;  1E0F D;  1GMD G;  1BB0 B;  3M5N A;  2DKR A;  1TA2 A;  2KJP A;  4I32 A;  1RY4 A;  3HVQ C;  4B2B A;  3PLP A;  2BDH A;  1P0S H;  2XND D;  1C2E A;  4ZH8 A;  3LU9 B;  3VQG A;  1GMC G;  3VGC B;  1TP5 A;  1M5Z A;  1EAW A;  2P94 A;  2Z94 A;  3OAA D;  4MQA A;  1O5E H;  2H3M A;  1OSS A;  1ZTL A;  3ZVA A;  4FUG A;  1P8V C;  1LHD H;  1AD8 H;  3E3T A;  3SBK A;  1YPH C;  3NGH A;  3A82 A;  2NU0 E;  3PTB A;  3STI A;  3QZR A;  2WV4 A;  2A4R A;  1LMW B;  5DGJ A;  3T62 A;  4THN H;  4U32 A;  3M36 A;  2CN0 H;  8GCH G;  1O32 A;  2FCF A;  3BIV H;  3SQH E;  1XZ9 A;  5F53 A;  3ZZ5 A;  2PA1 A;  2D26 C;  3Q76 A;  3KCG H;  1BRC E;  1MAB B;  3LPR A;  3SFJ A;  3EA7 A;  1UTN A;  2F43 B;  4JOK A;  1AI8 H;  2ZFT A;  3GIC B;  2LA8 A;  1TAL A;  2J4I A;  2A5K A;  1XVO A;  3F2F A;  3ZV9 A;  1O2X A;  3UR9 A;  1VCW A;  1Y3U A;  2D92 A;  1YBW A;  4UFF H;  4F48 B;  2AFQ B;  1EB1 H;  2OQ5 A;  3KDK A;  5HJ1 A;  1TWX B;  3MO3 A;  3MWI U;  4JL7 A;  1TE0 A;  4RI0 A;  3VXE H;  1O3J A;  1G2L A;  2YT8 A;  1GHZ A;  2ENO A;  4E35 A;  4BAN B;  2OZF A;  4FLN A;  4BTI B;  3TU7 H;  4XE4 A;  3O5N A;  1JRS A;  2R2M B;  3P8F A;  5AFY H;  2KPL A;  3NZI A;  1EJN A;  2EQN A;  5DSF A;  2BVR H;  2IWN A;  2QGR A;  2KJK A;  1QBN A;  2AWX A;  4JZF H;  4ABE A;  3SV7 A;  1NY2 2;  4YOG A;  4IN2 A;  2QBW A;  1O2I A;  3GY4 A;  3MOC A;  1OKX A;  1B0F A;  2CS5 A;  1C1W H;  3SND A;  1EX3 A;  1W0Z U;  1UTQ A;  2P3T B;  2Z17 A;  5C5N A;  1YYY 1;  2ZI2 H;  3SGA E;  2GZ8 A;  1D5G A;  2H9H A;  2BY8 X;  1V62 A;  1IQK A;  1TPO A;  3U69 H;  2VWN A;  2H2Z A;  1A46 H;  3Q00 A;  2XBX A;  2A7C A;  2KCO A;  2DE8 A;  4FXG H;  5HED A;  3ATK A;  3AAU A;  4ABJ A;  3A85 A;  1D4P B;  2HPP H;  2OC7 A;  3QGJ A;  4GHQ A;  3TPI Z;  1Y3Y A;  4D9Q A;  2BDY A;  3URC A;  2H5C A;  3RXA A;  3Q3X A;  2B9L A;  1FIW A;  5C17 A;  2O8W A;  5EPY A;  1FV9 A;  1GBI A;  5KEC A;  5PTP A;  1DXP A;  3EGK H;  4KP0 A;  4H6T A;  4AB9 A;  5GWZ A;  2FOB A;  4X1Q U;  1GGD C;  4E06 H;  2H2B A;  1WAY B;  2RCZ A;  1ACB E;  2GMT C;  2J95 A;  3K6Z A;  1F0S A;  2XOK D;  1BT7 A;  3RL8 A;  2G55 A;  3EDX B;  3RC5 A;  1UEP A;  1O34 A;  1D3T B;  2FEQ H;  4Q63 A;  1GHA G;  4UON A;  3NWU A;  5HIZ A;  3RXG A;  1NBM E;  2WV5 A;  2ZGJ A;  2AS9 A;  1K1O A;  2KQF A;  2XW9 A;  1P02 A;  2Y7X A;  4NXP A;  1TQ7 B;  5FBI A;  4AC9 A;  3RXB A;  3DSG A;  2PKA A;  1YBO A;  2V1W A;  3OY6 U;  2D8W A;  3M37 A;  4O3U A;  1GI2 A;  4CRA A;  1O35 A;  1NFW A;  4FUC A;  3RM0 H;  1O36 A;  3A83 A;  3FZZ A;  3SO3 A;  2ZHW H;  3V12 A;  2WV9 A;  5GIB A;  2BY9 X;  5EJL A;  1WH1 A;  2DB5 A;  2KPK A;  1QAV B;  4K3J A;  2KOM A;  4YOI A;  3SJI A;  4NZQ A;  1YLD A;  2GV7 A;  2OC1 A;  9EST A;  3D65 E;  4NA9 H;  3RM2 H;  1LVM A;  1ID5 H;  2Y82 A;  5C5O A;  4ZUH A;  3RXR A;  3TH3 H;  1OBY A;  4JCN A;  2J92 A;  3EAJ A;  1RTF B;  2I6Q A;  1S82 A;  2BZA A;  3SHU A;  4CR9 A;  2FOM B;  1T31 A;  1AZ8 A;  3QTO H;  1T4V H;  1T7C A;  2JIL A;  1C5Y B;  2KAI A;  4NSV A;  4A92 A;  1KDQ A;  1O2G H;  4NG9 H;  1EAI A;  1MFL A;  2FMJ A;  1FNI A;  2HE2 A;  5JDU B;  1YY3 A;  4NXR A;  1HIA B;  1ZTJ A;  1WTH D;  2OC0 A;  3TK6 A;  3SU5 A;  2L74 A;  2VWR A;  4R8T B;  2VGC B;  3MH4 A;  6CHA B;  3C1K A;  4NXQ A;  5A2P A;  5HFD A;  1QA0 A;  1VJ9 U;  1HRT H;  3ZZ4 A;  2YT7 A;  1XX9 A;  1QY6 A;  2OUA A;  1T32 A;  1DWC H;  1SOZ A;  2V35 A;  3N7O A;  1BTH H;  2J97 A;  2Z9K A;  3IIT A;  3KQC A;  3RDZ A;  3L4F D;  1QNJ A;  1GBA A;  2BVX H;  3R0F A;  2EA3 A;  1UCY K;  1WBG B;  2GP9 B;  2EXG A;  1K1N A;  1AVX A;  1ZOK A;  1S85 A;  1VJA U;  3FO8 D;  1OZI A;  3M35 A;  1NU9 A;  1PYT D;  2M3M A;  2O8T A;  5CE1 A;  1QBO A;  3M3S A;  4RKJ B;  3KF2 A;  2XTT B;  2G2L A;  3VQF A;  5B42 A;  3DJ3 A;  4NIV A;  3VG8 A;  5EG4 A;  4BXS A;  2NWN A;  5HFE A;  3VB7 A;  1OWH A;  2D1J A;  1MTS A;  2HLD D;  1H8I H;  3ZRT A;  3GY7 A;  3ODD A;  4CRC A;  1WI4 A;  1XUI A;  1GJB B;  1ZPC A;  2W7S A;  1VJ6 A;  1FPH H;  2ZCH P;  1HAG E;  5L30 H;  2ODQ A;  3R0H A;  3GCT G;  4GVD A;  1CHG A;  2C3S A;  5ESB A;  2M2A A;  3SOE A;  4CH8 B;  2QKV A;  2NU4 E;  3RXT A;  2FLR H;  4NMO A;  1CT4 E;  4TWY A;  2XBW A;  3ZZA A;  1ZZZ A;  1AFQ C;  4GVC A;  4ZHA A;  3S7K B;  1QHR B;  1BTU A;  3M7T A;  5FB8 C;  3DD2 H;  7LPR A;  3SV2 H;  1TFX A;  2PHB A;  1MUE B;  2YNA A;  1SGE E;  4K76 A;  2BD5 A;  1RIW C;  1UHB B;  2BY6 X;  4FUH A;  1P05 A;  1WJL A;  2FWW A;  3ZVB A;  1V2U T;  1MD8 A;  1YPE H;  3MU0 A;  3G01 A;  1U37 A;  2HAL A;  1GJ6 A;  4Q2K A;  4XOJ A;  4ZKO U;  4OS4 A;  4X8V H;  1W14 U;  1B7X B;  1KEF A;  3VB4 A;  1HDT H;  2C90 B;  1GMD F;  1Z86 A;  2C8Y B;  2RCE A;  1ZRB A;  2KCY A;  1WI2 A;  3ZZ3 A;  4CRG A;  1P09 A;  4B6E A;  5HYO A;  1MQ5 A;  3BEI B;  1FC9 A;  2ODY B;  4JYU H;  1OWD A;  1BJV A;  3RU4 D;  1C2G A;  1O5D H;  1OBX A;  3ZIA D;  3SNE A;  1YLC A;  1RIW B;  1GMC F;  1TNL A;  3D49 H;  2AER H;  3PRO A;  2D8I A;  4NNL A;  3ID3 A;  1FAK H;  1Z6E A;  3CP7 A;  2VIN A;  1Z8R A;  2WPJ S;  4HI3 A;  5L2Y H;  1MCT A;  3UFA A;  2RFK C;  3U1I B;  1TOM H;  1J14 A;  4YLU A;  2EI7 A;  1VB7 A;  1K1L A;  3LGU A;  1NM6 A;  4FUF A;  4KGA A;  3SGB E;  2W6J D;  2J94 A;  2WUC A;  3U8T H;  3DFJ A;  1CHO G;  8GCH F;  1RXP A;  1DUE A;  1IU2 A;  1IU0 A;  1A0L A;  1P12 E;  2TGP Z;  3PLB A;  2JDI D;  2ZTX A;  3Q3K A;  3M5M A;  1SGT A;  3SZE A;  1C2F A;  5GND A;  1AHT H;  3BG8 A;  4BAQ B;  4HTC H;  5EW1 H;  1MTN C;  2O8L A;  1F5L A;  4NA8 A;  1TGT A;  1Z6J H;  1HLT H;  2YMS D;  4RT1 A;  2EI6 A;  3KQE A;  4D76 A;  1AGJ A;  2FZZ A;  4K2Y A;  1GI8 B;  2FP7 B;  1DWD H;  4H4F A;  1O0D H;  5G4B A;  1TA6 A;  4FUD A;  4BAO B;  1C5Z B;  5DP6 A;  1BBR K;  1EAS A;  1WFV A;  4NIX A;  1GBB A;  3LGI A;  4X2W A;  3AAS A;  1FUJ A;  2ZZU H;  5LPR A;  1HAX B;  1P1E A;  2H2C A;  4JOE A;  2AH4 X;  2BDB A;  5EPN A;  3SUG A;  1MTN B;  3VFE A;  1HAZ B;  1P04 A;  4JOG A;  2KOJ A;  1MTU A;  1N1L A;  1OWE A;  1W0K D;  4UD9 H;  5CHA C;  3RP2 A;  2QG1 A;  1AY6 H;  2ZDK A;  1IQE A;  1V1T A;  4BOH A;  4YDP A;  3PO1 B;  6LPR A;  3RXJ A;  1EXF A;  4ZHM U;  1TB6 H;  2V3O H;  2EEH A;  1O5B B;  4IGD A;  1MZA A;  4JZE H;  1DLK B;  3LOX A;  4K8B A;  1PQ7 A;  3LJO A;  1TX6 A;  5EOK A;  4K75 A;  1YPJ H;  2HVY B;  2W3I A;  2BYG A;  5A8X A;  3URE A;  3SJO A;  4MNX A;  1N7F A;  2G4U A;  1Z71 A;  3UY9 A;  3OFN D;  5CHA B;  1IQJ A;  2PFE A;  4F4O C;  1A2C H;  3T29 A;  2REY A;  2A2Q H;  4AGJ A;  3L6P A;  1ZOM A;  1PPC E;  1YP9 A;  2OC8 A;  1WG6 A;  3UOU A;  3I1E A;  2BLO A;  3K50 A;  2XC5 A;  1FN8 A;  4ISH H;  3H7O A;  1OP2 A;  4NA7 A;  4D7G A;  1JBU H;  1QL7 A;  3RXH A;  1H9H E;  1QZ8 A;  1O2O A;  5EIY A;  5JBB S;  1QGF A;  2BD7 A;  4OGX A;  3PDZ A;  1NRS H;  3KZD A;  1UM7 A;  3MTY A;  5HFB A;  2THF B;  3GY8 A;  4JYT A;  3RXV A;  3ZZ6 A;  1WCZ A;  2RRM A;  3NXP A;  2ZP0 H;  4Y0Y E;  3BTD E;  2Y5H A;  5DN6 D;  1AVW A;  2YUB A;  1DIC A;  2BOH B;  1CA0 B;  2HWL B;  1A5I A;  2C4F H;  2XCN A;  1EP6 A;  2FI4 E;  4OS7 A;  2P95 A;  1WSS H;  2A7H A;  1GHA F;  2EAQ A;  2SGD E;  4ISO A;  4DGJ A;  1A0H B;  1DDJ A;  2Y5G A;  1AVG H;  1W13 U;  1MKX K;  4BAH B;  3GSL A;  2G51 A;  4R2Z A;  1SQT A;  1JIR A;  4D9R A;  1EPT C;  1JXP A;  1X8S A;  5EGM A;  1K0H A;  1H9I E;  1QRX A;  3I77 A;  4F8K A;  2IWQ A;  1P2Q A;  1SGQ E;  3HK3 B;  2Q9V A;  2JSN A;  1UK4 A;  1C5U A;  3URD A;  3ITI A;  1DY9 A;  3WKM A;  3KYG A;  3UIR A;  3ENS B;  1CVW H;  1O2M A;  2FYR A;  2J5U A;  3LGW A;  1Y5B T;  2YUY A;  4AOQ A;  2P3U B;  4Y8Z A;  3UWI A;  1LPZ B;  1EZX C;  1E1Q D;  3QN7 A;  1AO5 A;  3LNX A;  1JWT A;  1UO6 A;  5I25 A;  1PQA A;  3KEE A;  2Y81 A;  4XFQ A;  5E22 A;  1WFG A;  4P2A B;  2ZFF H;  3SJ8 A;  1GDN A;  4BAM B;  3QLP H;  5A8Z A;  3A7W A;  3CS0 A;  3PV5 A;  1P01 A;  1QTF A;  4E7N A;  2EDZ A;  4ZXY H;  2QKU A;  2FS9 A;  1NF3 C;  1BOQ A;  1Q3P A;  1TNI A;  1P2I A;  1MFG A;  5FL7 D;  1VCQ A;  3STJ A;  1J9C H;  4I8J A;  2CJI A;  4O3T A;  4Q6H A;  1GL0 E;  1W7G H;  2VBC A;  3TNT A;  2Z7F E;  4A7I B;  4KKD A;  1HAH H;  2Q6D A;  3QWC H;  2R2W U;  1ABJ H;  2A2X H;  3AW1 A;  3FOA A;  2Z3C A;  1L2E A;  2HRV A;  4ABD A;  1BA8 B;  2G4T A;  3E0P B;  2ZGX H;  1QUR H;  2R3U A;  1W2K H;  1QL8 A;  3FP6 E;  1TGC A;  1N99 A;  3QDO A;  5HF1 A;  1IQN A;  1Z1I A;  2BMG B;  2RA0 A;  4INK A;  4KTS A;  1W9O A;  4Y76 A;  4ZKS U;  2EEJ A;  4HFP B;  3KHF A;  5C3N A;  3M5L A;  3KHV A;  1GBE A;  1NTE A;  2J98 B;  2FS8 A;  1QFK H;  3B23 B;  1COW D;  1NS3 A;  1DS2 E;  4YOJ A;  2VIQ A;  5E8E H;  2VIP A;  5GDS H;  1MQ6 A;  2HVX A;  1GBH A;  2ZPQ A;  3O46 A;  2G00 A;  4TWW A;  1YPG H;  2Z9L A;  1NPM A;  2GVF A;  2HGA A;  1ELA A;  4TT3 D;  1GBC A;  1GI6 A;  2FX4 A;  4ABF A;  2CGA A;  1FON A;  3IG6 B;  3HPT B;  2DAZ A;  4ABB A;  1IQF A;  2EHR A;  4AFU A;  1EZS C;  2GT8 A;  3SOS A;  1L4Z A;  1N6D A;  4I86 A;  3CBX A;  4XBC A;  3ZV8 A;  4E7R G;  2EEG A;  4MPA A;  1NRO H;  2GDD A;  2WYG A;  2LOB A;  2BD8 A;  2BXU H;  1INC A;  1J16 A;  1O3B A;  1C1Q A;  1DM4 B;  2FXR A;  1WTG H;  1AWH B;  1IQL A;  2ANW A;  2QF3 A;  1F92 A;  1MTV A;  1C2H A;  1CU1 A;  2J38 A;  1CGH A;  2OD3 B;  3DUX H;  5SGA E;  1C4Y 2;  2I6V A;  5H3J A;  1T2M A;  3A86 A;  3PDV A;  1ZHR A;  3VB6 A;  1FPC H;  1FCF A;  3LH3 A;  1ESA A;  1IHJ A;  1V2K T;  2AHM E;  4Y8Y A;  7KME H;  3GCT F;  2PP6 A;  2P16 A;  4O9V A;  2M5T A;  3ZZ7 A;  1H8D H;  1T8N A;  1P57 B;  4NNM A;  1SI5 H;  3QUM P;  4P00 A;  1GL1 A;  4FGM A;  1F7Z A;  5AHG H;  5CMX H;  2FTL E;  1FAX A;  3UR6 A;  1FQ3 A;  2LC6 A;  4X2X A;  1O5G H;  4F55 A;  5DPA A;  1P3C A;  3EYD A;  4D7F A;  2GZ7 A;  4G69 A;  2Q3G A;  2EI8 A;  1QBV H;  4K78 A;  4B2C A;  4EDJ A;  5E0G A;  2K20 A;  1HUT H;  1SPJ A;  3CEN A;  4ZKN U;  1O2N A;  2LEL A;  3BTQ E;  4XDE A;  2Z3E A;  1C9P A;  3ATW A;  1HAI H;  4LMM A;  1ELG A;  3WW7 A;  1P2M A;  1V2T T;  1BRB E;  1UMA H;  1JIM A;  1ZML A;  1GBM A;  2VIW A;  3BTW E;  3P8N A;  4RKO B;  1QB1 A;  1GHX H;  4INL A;  1NN6 A;  2ZHD A;  3MMG A;  2JET B;  4DOQ A;  2O8M A;  1NFU A;  1OP0 A;  1C5M D;  1EQ9 A;  1ETS H;  1FX0 B;  2PGQ B;  3ODF A;  3TJV A;  1O2Q A;  1AE5 A;  2O9Q A;  3TLO A;  1MKW K;  1PPH E;  5B6O A;  5DP8 A;  4HOP A;  2AGI X;  3ZZ9 A;  1RTK A;  2J34 A;  5FPY A;  1HFD A;  1K1I A;  2H1U A;  4IC6 A;  2XYA A;  3A7Y A;  2I04 A;  1EZU C;  3ZVC A;  1DUA A;  3OU0 A;  1X5N A;  2W3K A;  5DO4 H;  1TMT H;  4PQW A;  1NBM D;  1UTP A;  4TPY A;  4X2Y A;  5GCH F;  2KR7 A;  3V7T A;  1JOU B;  2DM8 A;  3BEF B;  2VVU A;  4MNV A;  4B73 A;  2UWO A;  3O8B A;  2VRF A;  1CHO F;  2KRG A;  5LGO A;  1GHW H;  4X8T H;  2BDA A;  1UJV A;  1NC6 A;  3M61 U;  2OPG A;  5FPT A;  2UWL A;  2BLQ A;  4L8N A;  2PV9 B;  3RXK A;  1A0J A;  2ZPL A;  2ZCK P;  1WIF A;  4XBD A;  4B75 A;  1IQI A;  1PJP A;  1SFQ B;  2WPD D;  3PLK A;  1N7T A;  3U28 C;  5C20 A;  1C5V A;  1RJX B;  4B2A A;  1F0R A;  1TGN A;  2QF0 A;  1D3Q B;  2EGO A;  2ZEB A;  1K22 H;  4O97 A;  3NUM A;  3PM3 A;  3N99 A;  5ILB A;  3SUZ A;  2BLW A;  2D2D A;  1Z7K A;  2STB E;  3DFL A;  2EEK A;  2IWP A;  2ILN A;  1C9T A;  2QV1 A;  3BF6 H;  4UEH H;  1G3B A;  2K8I A;  2R3Y A;  1DIT H;  1TBR H;  3PMJ A;  4AYY B;  3LON A;  4OGY A;  1O38 A;  2GGV B;  1KY9 A;  1Y5U T;  3BN9 A;  2PNT A;  3RUO A;  2WPM S;  4KFW A;  1E1R D;  2PTN A;  4E3B A;  1YPH E;  3RXU A;  3P95 A;  1XUH A;  4AOR A;  3A8C A;  4Y6D A;  1IAU A;  1NU7 B;  2AMQ A;  1O2K A;  1G3E A;  3V3M A;  3I18 A;  3H5C B;  4Y7B A;  1C5T A;  5FCK A;  2X7Z A;  3M3T A;  2PWX A;  1IOE A;  5D13 A;  1QR3 E;  1D3P B;  1GQ4 A;  3WWF A;  5BRR E;  2K0Q A;  3PMA B;  4AN7 A;  5C0U A;  1UEW A;  3KDG A;  1S83 A;  1DLE A;  1GJD B;  2ZFS A;  5G1D A;  1XKA C;  1ZR0 A;  2B8O H;  3HKJ B;  5EW2 H;  1ZSK A;  1OWJ A;  3VB3 A;  4TPI Z;  2Q6F A;  3BG4 B;  2IPQ X;  4X2V A;  1Y8T A;  1UW7 A;  1K2I 1;  1W7X H;  3SYJ A;  2QAA A;  1QRW A;  2I1N A;  4GHN A;  1TBQ H;  2BX4 A;  4ABH A;  3ZVF A;  1YCP H;  2A5I A;  2AGE X;  3SU2 A;  2ZTY A;  1BZX E;  2CMY A;  3S9C A;  1O5F H;  2CSS A;  4ASU D;  1GI5 A;  1LVO A;  5ETX A;  4DT7 B;  3QGN B;  1JRT A;  5T6D A;  4KEL A;  1F0T A;  2Z6B D;  4BXW A;  1DX5 M;  3O8D A;  1AKS A;  2A4O A;  4LZ1 H;  3U98 H;  5HEB A;  1FY3 A;  1GQ5 A;  2ALP A;  4K1S A;  3AAV A;  4K72 A;  1Z87 A;  1HAY B;  5HM2 A;  1AUT C;  1TGB A;  4DJZ B;  2WPK S;  1KXF A;  2O8U A;  1IQG A;  3E1X B;  2XRC A;  4IMZ A;  5DJ7 A;  3SNB A;  2G81 E;  3WKL A;  4A1X A;  3SV9 A;  4OS2 A;  2F9V A;  3KQB A;  5C94 A;  4YYX A;  1SLU B;  5E11 A;  2ZPS A;  2XC4 A;  1VCP A;  2F4L A;  2BD4 A;  2ZU5 A;  2M0U A;  1TNG A;  4MPV A;  3A8D A;  4WMD A;  5E21 A;  3EGH C;  1L4D A;  2XXL A;  1XM1 A;  4MDS A;  5IYT A;  3QJN A;  3PRD A;  2CHA B;  2EGN A;  1GBF A;  3EGG C;  5T6G A;  3SNC A;  1LHG H;  3CC0 A;  1P03 A;  4X1P U;  3LGT A;  4Q2P A;  4FUI A;  2SGP E;  4AX9 H;  2A4G A;  4EST E;  2VGC C;  3I4W A;  1GJ9 B;  1A4W H;  5FX6 A;  2J2U A;  1SGF G;  3W94 A;  6CHA C;  3UQV A;  2AWW A;  5DTH A;  1C2M A;  1UCY H;  2VVV A;  3DSO A;  1KXD A;  4AZ2 B;  4XSK U;  4B1T A;  3KQD A;  1KYN A;  2ANK H;  3CH8 A;  1E35 B;  1YCP M;  1P2J A;  2GCT B;  3NKK A;  2VJ1 A;  1U39 A;  4WF8 A;  1ETR H;  4Q2N A;  1TPA E;  1DAN H;  4DCD A;  1TBZ H;  1Y3V A;  2P59 A;  3LGV A;  2KCA A;  3SGQ E;  3T28 A;  2GT7 A;  1PDR A;  1TRN A;  2Q6G A;  3A88 A;  1C1P A;  5C1U A;  3E90 B;  3ZZD A;  3K82 A;  1Y5A T;  2DE9 A;  2CF8 H;  1NRR H;  1YPK H;  4MPW A;  1Z8I B;  3GDU A;  4UFG H;  4ABG A;  1T4U H;  1VAE A;  3Q3Y A;  2FX6 A;  3MHW U;  3BTG E;  1BQY A;  1SGC A;  2BHG A;  1XVM A;  3MO9 A;  1V2W T;  2ZC9 H;  4OEP A;  1ZMN A;  4Y79 A;  1S81 A;  2PZD A;  4HGC A;  5TJX A;  4AG2 A;  1QQU A;  1ZHM A;  2A32 A;  4FU7 A;  3BIU H;  2ZU3 A;  4ZRO A;  4OM9 A;  1OHH D;  3E16 B;  1E38 B;  1IHT H;  1SLV B;  2H6M A;  2OQU A;  3K65 B;  2GDE H;  2AIQ A;  2EDV A;  2VNT A;  2PKA B;  1VA8 A;  2JXO A;  2VSV A;  1C1M A;  4AYV B;  3FKS D;  4I8L A;  3KYF A;  1H9L B;  2VB0 A;  2ZHE H;  4GVU A;  1QB6 A;  4NMT A;  3V0X A;  4FUJ A;  1EST A;  1F0U A;  1K32 A;  2MHO A;  2ANY A;  1AQ7 A;  1UCY E;  3SUE A;  5E0J A;  3ZVG A;  3O8C A;  5FPS A;  1KXC A;  1W10 U;  1VIT G;  1W8B H;  2JJ1 D;  5KED A;  5G1E A;  1O3L A;  1ELT A;  1XKB C;  2B7D H;  1GJA B;  1V6B A;  4I7Y H;  2QY0 B;  8KME 2;  2TIO A;  1MU8 B;  1YF4 A;  4NIY A;  4CBN A;  1T8L A;  2FM2 A;  2R4H A;  1O3O A;  1C2D A;  1QIX B;  1H8H D;  4NFE A;  1M9U A;  4X1N U;  5IK2 D;  3PS4 A;  2PW8 H;  1GHB G;  4M7G A;  4X1S U;  1PQ5 A;  1E36 B;  1TP3 A;  1E37 B;  1KXE A;  1UTO A;  3NK8 A;  3TGI E;  2KAI B;  1KDQ B;  3RC6 A;  5A0A E;  4LOY H;  3WWB A;  1V3X A;  1SQA A;  1FMG A;  1SR5 C;  1G3C A;  1NRQ H;  3CYY A;  2OMJ A;  1P06 A;  1VZQ H;  5EYZ A;  1C1T A;  4O06 A;  3A7V A;  3P8O A;  3VEQ B;  1O3E A;  1ZGV A;  3A81 A;  2FOE A;  4IS5 A;  1GCD A;  3UOP A;  1ELV A;  2TGA A;  1ZHP A;  1JMO H;  1GMH G;  2ZDA H;  1S0Q A;  1A1R A;  3TVJ B;  3W1E A;  1NZQ H;  1C1S A;  2M0T A;  1GHY H;  2QN5 T;  2LUI A;  1PYT C;  3RMN H;  1DOJ A;  2ZDN A;  3F9E A;  3SU1 A;  3ID2 A;  1NO9 H;  4NWK A;  1KIG H;  2FOA A;  4UU6 A;  1KLJ H;  2HLC A;  4DIH H;  2ODP A;  1K9O E;  1OOK B;  5EQQ A;  2WHX A;  3U1J B;  5JBT A;  4ABI A;  1PFX C;  1SHH B;  1ELF A;  4CBO A;  3DIW A;  1SGP E;  1G30 B;  1KTS B;  1S0R A;  4J2Y B;  2LC7 A;  3P6Z B;  2PKU A;  4OAJ A;  1BRA A;  2UUJ B;  2ZHQ H;  3BTH E;  3GCO A;  1V2M T;  4K1T A;  1FZZ A;  3OTJ E;  3BTK E;  1AUJ A;  1CT2 E;  2VH6 A;  3DCL A;  4A1T A;  2W6I D;  1BMF D;  3FAN A;  4Y0Z E;  4X6M A;  5GXP A;  4XBB A;  4I8K A;  4NMP A;  3PO1 C;  1A7S A;  1HYL A;  4X1R U;  4XD7 D;  1HJA B;  5T1V A;  4ABA A;  1C4V 2;  3RC4 A;  2BOK A;  5FXL A;  4NMV A;  4BTU B;  4Y8X A;  1ABI H;  1SBW A;  2P93 A;  3K1R A;  1LCY A;  1TOC B;  2C8X B;  1LPG B;  1TX8 A;  2QIQ A;  2QYI A;  2WPL S;  1J15 A;  3E0N B;  1ZJK A;  1GJ4 H;  3A84 A;  1BHX B;  2Y80 A;  3RL7 A;  4DVA U;  1O3C A;  1N7E A;  2DLS A;  2A5A A;  2PTC E;  1O33 A;  3PMB B;  4NZL A;  1O2J A;  4AFZ A;  3K6Y A;  5DP9 A;  1T8M A;  2KJD A;  1Z8J B;  4Q7X A;  2C8W B;  1C1R A;  3MQK C;  1FI8 A;  1EOL A;  3PYH A;  2ULL A;  4ZMA H;  1XMN B;  1C5W B;  1V5L A;  3KNX A;  3MYW A;  1BMM H;  1GI3 A;  1NT1 A;  1N8O B;  1BBR E;  4ZHL U;  1UFX A;  3A7T A;  1ELE E;  1MAX A;  3T5F H;  5ABW A;  1RGW A;  1W9Q A;  2PDZ A;  2A7J A;  4DUR A;  4DG4 A;  1O2W A;  4LK4 A;  1GI9 B;  3BTF E;  3L33 A;  2JJ2 D;  3LH1 A;  4H11 A;  5L6N H;  1O37 A;  1GBL A;  4SGB E;  3SZN A;  5LPE A;  1G37 A;  2BQ7 B;  1YPL H;  1N6F A;  4DW2 U;  1SSX A;  4NFF A;  1MKX H;  1X7A C;  4YZU A;  1UJU A;  5EJZ A;  2FN5 A;  1CA0 C;  1ORF A;  3TK5 A;  1YC0 A;  2LNC A;  3B8J A;  4IC5 A;  2BTC E;  1LDT T;  1TNK A;  1EPT A;  2XBY A;  2XNI A;  3OY5 U;  3H09 A;  3GCH C;  5EXL A;  4J1Y A;  4B71 A;  3RXL A;  1E34 B;  1A5H A;  3ELA H;  1BCU H;  2BX3 A;  2SFA A;  2AGG X;  2EDP A;  1SLX B;  1THS H;  2ZNK H;  3KGP A;  1ETT H;  1GI1 A;  2CF9 H;  1P1D A;  2V7Q D;  1LKB A;  1P2N A;  1QRZ A;  4OS5 A;  4RT0 A;  2GKV E;  1ANE A;  4NMS A;  3OEH D;  2YMS C;  3B76 A;  4U2W A;  1UEZ A;  3JXT A;  1F2S E;  1GWA A;  5T6F A;  2QF5 A;  3GY5 A;  1SKY E;  3QZQ A;  3UQO A;  2AIN A;  1E79 D;  3GY6 A;  4CRB A;  3SNA A;  1KMH B;  1O39 A;  1D6W A;  1C1N A;  1AN1 E;  1LQD B;  1NFY A;  2VIO A;  2WPI S;  3GCH B;  3GCN A;  3RMO H;  3SV6 A;  4H42 U;  1ZMJ A;  3SU4 A;  4AFQ A;  2QC2 A;  1RGQ A;  2J9N A;  1U6Q A;  1DSU A;  2GTB A;  1SL3 A;  3SN8 A;  1DFP A;  5F3X A;  3JZ2 B;  1OPH B;  3TJO A;  4Q7Z A;  3HAT H;  1P9U A;  2YMS B;  3W95 A;  1AE8 H;  1V6D A;  3RLW H;  4ZCN A;  5L2Z H;  4NWL A;  2B5T B;  5HF4 A;  3ATM A;  1YM0 A;  2JH5 D;  3VXF H;  5C1X A;  1PPB H;  1SGY E;  4ASH A;  4M9F A;  4GCH G;  5T3H A;  1O5C B;  3LNY A;  4CR5 A;  4Z6A H;  1PPZ A;  2AMP A;  2EY4 C;  3MU1 A;  3T25 A;  4IN1 A;  1HAO H;  4JJ0 A;  2KCP A;  1AU8 A;  2G5V A;  1Y59 T;  2QE7 D;  3LDX H;  4FET A;  1DE7 H;  2EV8 A;  4X8U H;  5EXM A;  2ZTZ A;  1HAP H;  1W11 U;  2PKT A;  1QL9 A;  1KWA A;  1MMJ N;  1U38 A;  4DY7 B;  4YT7 H;  4XRN A;  1HXF H;  2Z9G A;  1P2O A;  3IWM A;  5DP3 A;  2UUY A;  4TY6 A;  2L4T A;  3B9F H;  4Q3H A;  4NIW A;  3SU6 A;  2IWO A;  1WXR A;  1BIT A;  4CRF A;  5A8Y A;  1BDA A;  1D3D B;  1G36 A;  2RA3 A;  4JK6 A;  1LKA A;  1UVS H;  2FO9 A;  1UJD A;  3FVF B;  4CRE A;  2A1D B;  2BDI A;  2LP6 A;  4ISN A;  3TIT A;  1CE5 A;  2SGF E;  4WYT A;  1C2I A;  1LHC H;  4BAK B;  1HBT H;  3U9A H;  2H3L A;  2ASU B;  1L1J A;  2L6O A;  2EEI A;  1CGJ E;  1O2Y A;  3OE7 D;  5LPF A;  4B6F A;  4I8H A;  4LXB H;  2VWM A;  1GG6 C;  1UTK A;  1ANB A;  1QLC A;  2FPZ A;  1HAV A;  3E6P H;  3QO6 A;  4NMR A;  1W0Y H;  2OCV B;  1ELB A;  3AW0 A;  1MD7 A;  2PGB B;  1TIO A;  3T26 A;  2JH0 D;  1C5P A;  3S69 A;  3SUF A;  2K1Z A;  1C1O A;  1UM1 A;  3SU0 A;  1EKB B;  1O2V A;  1TPP A;  1OYT H;  2KOH A;  1GCT C;  2TPI Z;  1RFN A;  2GX4 A;  1BTP A;  4MPU A;  5F8T A;  5A0B A;  1O2P A;  1QJ7 B;  5GJ4 B;  1R6J A;  1V5Q A;  2IJO B;  2ALV A;  3F9G A;  1GG6 B;  3BTE E;  1ZTK A;  1WDI A;  2IOT A;  4K69 A;  4UU5 A;  3FAO A;  2B0F A;  2ZQ1 A;  2V90 A;  3SHW A;  1J8A A;  3GS9 A;  4FVB A;  1B8Q A;  4JK5 A;  4QT8 C;  2R9P A;  2P8O C;  3VB5 A;  1AZZ A;  2ZPM A;  1QQ4 A;  1GCT B;  2QXJ A;  2FTM A;  1L1N A;  3MNB A;  1BUI A;  1VIT F;  2OP9 A;  3FN8 A;  1P3E A;  3RLE A;  2PSX A;  1MCV A;  4NSY A;  1H4W A;  2ANM H;  1LVB A;  1EAT A;  3EE7 A;  1ZPZ A;  1TAW A;  4AGK A;  3D62 A;  4Q2O A;  3TMH A; 
#chains in the Genus database with same CATH homology
 3R0H A;  4GVD A;  3F3B A;  3SU2 A;  5ESB A;  2M2A A;  3SOE A;  2CSS A;  4JOP A;  1Q3O A;  5HFC A;  5ETX A;  4ASU D;  2QKV A;  4NMO A;  3R69 A;  4GVC A;  1QAU A;  5FB8 C;  3O8D A;  1N6E A;  4P0C A;  5HEB A;  4K76 A;  1GQ5 A;  4REY A;  1WJL A;  5EQR A;  4K72 A;  1Z87 A;  1U37 A;  2DLU A;  2P3W A;  2FNE A;  5HET A;  1KEF A;  4Z1M D;  3PRB A;  1U3B A;  3WKL A;  4A1X A;  3SV9 A;  1Z86 A;  2VSP A;  2F9V A;  2KCY A;  1WI2 A;  4YYX A;  4B6E A;  5E11 A;  2F0A A;  1FC9 A;  2Z9I A;  4B74 A;  4KTC A;  3TSZ A;  2F4L A;  1OBX A;  3ZIA D;  2M0U A;  5H4I B;  1UIT A;  2GZV A;  2WZQ A;  2D8I A;  4NNL A;  3F2G A;  2M10 A;  3ID3 A;  2E7K A;  4JMY A;  3SV8 A;  5E21 A;  1UEQ A;  2M0V A;  1G9O A;  3EGH C;  3R68 A;  3U1I B;  2F9U A;  3QJN A;  3PRD A;  1VB7 A;  2EGN A;  3EGG C;  5C0T A;  3CC0 A;  2W6J D;  2JIK A;  3OYP A;  4Q2P A;  2OBO A;  2KBS A;  1IU0 A;  4E34 A;  1IU2 A;  2A4G A;  2L4S A;  3I4W A;  2JDI D;  3F2H A;  2JOA A;  3DJA A;  4Z8J A;  3M5M A;  2AWW A;  3FY5 A;  3SZE A;  5DTH A;  3DSO A;  5GND A;  4A1V A;  3QGL A;  2OBQ A;  1H8E D;  3CH8 A;  2OGP A;  1U39 A;  3AXA A;  4WF8 A;  1I16 A;  4Q2N A;  2YMS D;  5EZ0 A;  3E17 A;  3HPM A;  2OIN A;  3O8R A;  2D90 A;  2JRE A;  2FP7 B;  2P59 A;  3GDS A;  2KCA A;  1RZX A;  5GLJ A;  1PDR A;  3TSW A;  4Z33 A;  1I92 A;  3E90 B;  2L97 A;  1WFV A;  3K82 A;  1WF8 A;  3SUG A;  1P1E A;  2H2C A;  4JOE A;  1W3C A;  3QJM A;  1W0J D;  5EPN A;  3GDU A;  1WHD A;  1DXW A;  2M0Z A;  2JIN A;  1VAE A;  2QF4 A;  2F5Y A;  4JOG A;  2KOJ A;  1N1L A;  1W0K D;  2AWU A;  1TQ3 A;  4OEP A;  2QG1 A;  2FE5 A;  2PZD A;  2CSJ A;  1V1T A;  2OSG A;  4YDP A;  2O2T A;  3SU3 A;  4OM9 A;  5FHT A;  1OHH D;  2YTW A;  1BFE A;  3OTP A;  2EEH A;  2EDV A;  3LOX A;  4YXW D;  4JOH A;  1QAV A;  4K8B A;  1VA8 A;  2JXO A;  2VSV A;  3FKS D;  2JWE A;  4HOP B;  4KFV A;  1WHA A;  4K75 A;  2BYG A;  2OQS A;  4NMT A;  2KM0 A;  3PV2 A;  1N7F A;  1K32 A;  3OFN D;  2MHO A;  4I31 A;  3O8C A;  2QT5 A;  3SUE A;  5E1Y A;  2REY A;  2A4Q A;  2JIZ D;  5FPS A;  3GGE A;  2JJ1 D;  5E6P B;  5G1E A;  3L6P A;  4JJ3 A;  2OC8 A;  2OS6 A;  1V6B A;  1WG6 A;  3I1E A;  3K50 A;  2FM2 A;  4Q6S A;  1FC7 A;  2R4H A;  1FC6 A;  1EFR D;  1H8H D;  5I7Z A;  5IK2 D;  3PS4 A;  3PDZ A;  1RGR A;  3KZD A;  1UM7 A;  1TP3 A;  3LKW A;  5HFB A;  5HKK D;  4OEO A;  3KN2 A;  2RRM A;  1GM1 A;  3RC6 A;  5DN6 D;  2YUB A;  3WWB A;  2XCN A;  3CBY A;  2DJT A;  5CDF E;  2DC2 A;  2OMJ A;  3CYY A;  4JOJ A;  2EAQ A;  4K6Y A;  2KFW A;  5EYZ A;  4O06 A;  3P8O A;  3GSL A;  3NCV A;  3TSV A;  3F0P A;  4WH6 A;  4R2Z A;  1JXP A;  1X8S A;  2WSS D;  5JXB A;  4F8K A;  1A1R A;  3M5N A;  2IWQ A;  2DKR A;  3W1E A;  2KJP A;  2Q9V A;  4I32 A;  2OK5 A;  1RY4 A;  2JSN A;  2M0T A;  3HVQ C;  1DY9 A;  4I33 A;  2XND D;  2LUI A;  3WKM A;  3ID4 A;  2MX6 A;  3VQG A;  1TP5 A;  1M5Z A;  3OAA D;  3SU1 A;  3ID2 A;  2H3M A;  4NWK A;  4UU6 A;  2J5U A;  2YUY A;  3NGH A;  1E1Q D;  5EQQ A;  2WHX A;  3LNX A;  2A4R A;  3U1J B;  3KEE A;  3KZE A;  5E22 A;  1WFG A;  3DIW A;  4P2A B;  2LC7 A;  2W4F A;  2FCF A;  2PKU A;  4OAJ A;  2HE4 A;  1XZ9 A;  3CS0 A;  3PV5 A;  5B6L A;  3GCO A;  2EDZ A;  5F53 A;  2PA1 A;  2QKU A;  1NF3 C;  4A1T A;  3DCL A;  1Q3P A;  1MAB B;  2W6I D;  3SFJ A;  1BMF D;  1MFG A;  2F43 B;  5FL7 D;  4JOK A;  2LA8 A;  3GJ9 A;  3STJ A;  2KG2 A;  5HEY A;  4Q6H A;  4NMP A;  2VBC A;  2W7R A;  3F2F A;  4XD7 D;  2I0L A;  3MH7 A;  3NFK A;  3M5O A;  5T1V A;  3RC4 A;  1VCW A;  4XHV A;  3UB0 A;  2D92 A;  4NMV A;  4TYD A;  3FOA A;  2KL1 A;  3K1R A;  1LCY A;  5IDK A;  2YOL A;  3KDK A;  5HJ1 A;  4JL7 A;  1TE0 A;  3RL7 A;  4RI0 A;  1N7E A;  1N99 A;  3QDO A;  2YT8 A;  2DLS A;  5HF1 A;  2ENO A;  4E35 A;  1W9O A;  2EEJ A;  3KHF A;  2OZF A;  4FLN A;  3M5L A;  2CK3 D;  1NTE A;  3O5N A;  2KJD A;  1COW D;  2KPL A;  1NS3 A;  5DSF A;  4TSF D;  1V5L A;  3KNX A;  2IWN A;  5GPI B;  3O46 A;  2KJK A;  3DJ1 A;  2AWX A;  4Q2Q A;  1UFX A;  2K1Q A;  2GVF A;  2HGA A;  4TT3 D;  3SV7 A;  1RGW A;  1W9Q A;  2PDZ A;  2DAZ A;  2QBW A;  2EHR A;  2VZ5 A;  2CS5 A;  4Q2O A;  1X45 A;  1X5Q A;  2JJ2 D;  1N6D A;  3BPU A;  3CBX A;  4H11 A;  2EEG A;  4MPA A;  1N6F A;  2LOB A;  2Z17 A;  5CHB A;  1OBZ A;  1D5G A;  3N7E A;  1Q7X A;  1UJU A;  1V62 A;  2DMZ A;  2FN5 A;  2XNI A;  1CU1 A;  2VPH A;  4NMQ A;  2I6V A;  5H3J A;  1T2M A;  4AMH A;  2KCO A;  3H09 A;  5HED A;  4B71 A;  3PDV A;  5F67 A;  1SOT A;  3DSP A;  2EDP A;  1FCF A;  2OC7 A;  1IHJ A;  3AK5 A;  2AHM E;  3QIK A;  5IL9 A;  1P1D A;  2V7Q D;  2OCS A;  4NNM A;  4NMS A;  3OEH D;  2YMS C;  3B76 A;  4FGM A;  1UEZ A;  1W9E A;  3JXT A;  3DOR A;  5C17 A;  5EPY A;  2QF5 A;  1SKY E;  2AIN A;  1E79 D;  3SUD A;  2LC6 A;  1DXP A;  1KMH B;  4F55 A;  3PV4 A;  3EYD A;  2H2B A;  3GCN A;  4G69 A;  3SV6 A;  2RCZ A;  3SU4 A;  2Q3G A;  5EQS A;  2EGK A;  2KV8 A;  4K78 A;  2XOK D;  4EDJ A;  3RL8 A;  2K20 A;  1RGQ A;  3RC5 A;  1BT7 A;  1UEP A;  2LEL A;  3ID1 A;  4Q63 A;  5F3X A;  4U01 A;  4LMM A;  3WW7 A;  2YMS B;  4WYU A;  3P8N A;  1NBM E;  4ZCN A;  1MC7 A;  4NWL A;  2KQF A;  3OEE D;  2UZC A;  3GAB A;  5HF4 A;  4NXP A;  2O8M A;  1FX0 B;  4M9F A;  3LNY A;  3N7D A;  1UHP A;  1YBO A;  2V1W A;  4HOP A;  3NFL A;  5FPY A;  4DT4 A;  4JJ0 A;  2KCP A;  2KAW A;  4IC6 A;  2QE7 D;  2I04 A;  1X9Z A;  3OU0 A;  3NRL A;  2GEF A;  2WV9 A;  1X5N A;  4FET A;  2EV8 A;  1WH1 A;  2DB5 A;  2KPK A;  4PQW A;  1QAV B;  1NBM D;  2KOM A;  5HFF A;  2PKT A;  2KR7 A;  1KWA A;  2OC1 A;  1U38 A;  2DM8 A;  4B73 A;  4B76 A;  3O8B A;  2VRF A;  2KRG A;  3F0O A;  2L4T A;  4Q4L A;  4Q3H A;  3SU6 A;  1OBY A;  1UJV A;  2IWO A;  2OPG A;  5FPT A;  1WXR A;  3SHU A;  1DY8 A;  1UJD A;  4L8N A;  2FOM B;  2EJY A;  2ZPL A;  4B75 A;  1WIF A;  2WPD D;  4WYT A;  2I0I A;  1N7T A;  4JOR A;  2H3L A;  2JIL A;  2EEI A;  2L6O A;  4A92 A;  1X6D A;  3OE7 D;  4B6F A;  1MFL A;  1RTL A;  1QLC A;  3N99 A;  5ILB A;  3SUZ A;  3QO6 A;  2HE2 A;  4NMR A;  4N6X A;  1L6O A;  4NXR A;  3GDV A;  2IWP A;  3CBZ A;  3QE1 A;  2QV1 A;  2OC0 A;  3SUF A;  2K1Z A;  3SU5 A;  2WL7 A;  2VWR A;  4R8T B;  3MH4 A;  2K8I A;  1UM1 A;  2R3Y A;  3SU0 A;  4NXQ A;  5A2P A;  5HFD A;  1X5R A;  3LON A;  2KOH A;  2XCF A;  2YT7 A;  2GGV B;  1KY9 A;  2PNT A;  4KFW A;  1E1R D;  5HDY A;  1SOZ A;  4E3B A;  5GJ4 B;  1R6J A;  1V5Q A;  2IJO B;  3L4F D;  4UU5 A;  2KZ4 A;  2V90 A;  3SHW A;  3GS9 A;  1UF1 A;  3I18 A;  1B8Q A;  2EXG A;  3HPK A;  2KYL A;  2I4S A;  2X7Z A;  1ZOK A;  3FO8 D;  1OZI A;  5D13 A;  2G5M B;  2M3M A;  3WWF A;  1GQ4 A;  3MH6 A;  2K0Q A;  4WH8 A;  5C0U A;  2ZPM A;  1UEW A;  1ZUB A;  3KDG A;  3KF2 A;  2G2L A;  3VQF A;  5B42 A;  3DJ3 A;  2KA9 A;  3VG8 A;  1WF7 A;  5G1D A;  2QKT A;  5HFE A;  3FN8 A;  3RLE A;  2HLD D;  1Y8T A;  1S6L A;  2IJD 1;  3ZRT A;  1Y7N A;  3SYJ A;  1WI4 A;  1BE9 A;  1VJ6 A;  2I1N A;  4GHN A;  2EGO A;  4JOF A;  3TMH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...