3OU8A

The crystal structure of adenosine deaminase from pseudomonas aeruginosa
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
313
structure length
313
Chain Sequence
YEWLNALPKAELHLHLEGTLEPELLFALAERNRIALPWNDVETLRKAYAFNNLQEFLDLYYAGADVLRTEQDFYDLTWAYLQKCKAQNVVHVEPFFDPQTHTDRGIPFEVVLAGIRAALRDGEKLLGIRHGLILSFLRHLSEEQAQKTLDQALPFRDAFIAVGLDSSEVGHPPSKFQRVFDRARSEGFLTVAHAGEEGPPEYIWEALDLLKVERIDHGVRAFEDERLMRRLIDEQIPLTVCPLSNTKLCVFDDMSQHTILDMLERGVKVTVNSDDPAYFGGYVTENFHALQQSLGMTEEQARRLAQNSLDARL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Adenosine deaminase
publication title The crystal structure of adenosine deaminase from Pseudomonas aeruginosa
rcsb
source organism Pseudomonas aeruginosa
molecule tags Hydrolase
total genus 124
structure length 313
sequence length 313
chains with identical sequence B
ec nomenclature ec 3.5.4.2: Adenine deaminase.
pdb deposition date 2010-09-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00962 A_deaminase Adenosine/AMP deaminase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.140 Alpha Beta Alpha-Beta Barrel TIM Barrel Metal-dependent hydrolases 3ou8A00
2ANUA 4C6FA 1RK6A 2GOKA 4L6DA 2Z27A 3IACA 4KETA 1RAKA 3E0FA 4C6QA 2HQAA 1K70A 3D6NA 4IFRA 4C6LA 4C6IA 3BE7A 3URNA 3WMLA 3GG7A 4KEVA 4C6EA 1GKPA 1YNYA 4OFCA 3FEQA 1EJWC 1NFGA 4LCQA 4DLMA 1A5MC 5FSEC 2OQLA 2WJFA 1J79A 3DC8A 3S2JA 2YZ5A 1ONWA 5G4HC 4LH8A 2WM1A 4C6CA 4AQLA 3T8LA 4LEFA 3LU2A 4TQTA 1YRRA 1V4YA 3LNPA 2AQOA 3PANA 2Q09A 1XGEA 4KQNA 4C6KA 1PB0A 3A4JA 4M51A 4C5ZA 4HK6A 3MSRA 3MTWA 4WHBA 4NG3A 3GIQA 4DO7A 3IGHX 3IPWA 3N2CA 3GTFA 3F2CA 1ITUA 4QS6A 3TN3A 3NQBA 1PO9A 4QS5A 5E5CA 4KIRA 3JZEA 4QROA 3RHGA 3NURA 4LALA 1FWEC 1EJVC 4I6VA 4IGMA 1M65A 1IE7C 1RK5A 2P50A 5CH9A 3PAOA 4ERIA 2VC5A 3K2GA 1W1IE 2QT3A 1A4LA 4EPBC 2W9MA 2R1NA 3AU2A 2QVNA 3E3HA 2DVXA 4EPEC 1YMYA 4NP7A 3ITCA 1RA5A 1UBPC 4C6MA 1KCXA 3S4TA 2VC7A 1V7AA 2EG8A 2Z28A 3G77A 4XD5A 3LS9A 3QY6A 4Z42C 1I0DA 1KRBC 2D2GA 2R1PA 1R9YA 2WJDA 2Z24A 3AUOA 4IGNA 4EPDC 2PAJA 2VM8A 4PCNA 3LSCA 2AMXA 2HBXA 1E9YB 4H01A 4IQJA 3QGAC 2E1WA 4LAOA 4L9XA 3GIPA 3GTXA 4DYKA 4GX8A 3CJPA 3OJGA 3SO7A 4EP8C 2R1LA 4G7EA 2VUNA 3LSBA 4J2MA 4C65A 4V1YA 3E38A 2PLMA 3GTIA 4RZBA 4GX9A 3ISIX 2YB1A 1POKA 1RJPA 3O0FA 3IRSA 3WZ0E 3FDGA 2HPIA 3S2MA 2OB3A 4P5UA 5FSDC 1UIPA 3OQEA 2P53A 2FTWA 2YB4A 1P6BA 4J35A 1J6OA 1FKXA 2VHLA 4GZ7A 3B0XA 1YBQA 1RA0A 1WXZA 2GZXA 2Z29A 2I5GA 4IFOA 4DI8A 1E9ZB 2HBVA 4LCRA 5HMEA 4CEXC 1EZ2A 3F2BA 4ZSUA 2ICSA 3OU8A 4KEUA 1EJTC 1XRFA 3GUWA 2BGNE 2D2HA 1FWHC 4NI8A 3LA4A 3HTWA 3ICJA 2EG7A 3UR5A 3PNUA 3V7PA 2FTYA 4IFKA 3PNZA 3IARA 3E2VA 4CNUA 1FWBC 2Z26A 1KRMA 3NEHA 2YXOA 3F4CA 3RYSA 3A3XA 4IG2B 4C60A 2GSEA 4ZSTA 2UZ9A 4AC7C 2FVKA 1XWYA 4J5NA 1FKWA 2PGFA 4RDZA 4PE8A 2QS8A 3CAKA 3EWDA 4DZHA 3MVIA 4DNMA 3EGJA 4B92A 1RJRA 4GY7A 4XAFA 3QGKC 4KF1A 3UF9A 5A6TC 1FWAC 1A5LC 3RN6A 3AU6A 2D2JA 3MKVA 4RE0A 2Z4GA 2KAUC 4DZIA 3QY8A 1KRAC 4GBDA 5HMDA 2R1MA 4YIWA 1QW7A 2IMRA 1A5KC 4B3ZA 2XIOA 4WGXA 1J5SA 2G3FA 4EPKA 2I9UA 1K1DA 1FWDC 1A4MA 3FDKA 2O4QA 4H00A 4F0RA 4IH3A 2E25A 3R0DA 4XAZA 3IJ6A 2HPMA 4R88A 4XD6A 2GWNA 1VFLA 1A5NC 3T1GA 2Z7GA 4H9XA 3UBPC 1M68A 3IV8A 4KESA 1V79A 3E74A 4BY3A 4XD3A 3S2LA 3GU9A 3GRIA 4B91A 1KRCC 3LGGA 3URQA 4CEUC 3HPAA 4DI9A 4WVXA 4LAMA 2F6KA 1YBQB 1V77A 5HMFA 1NDZA 1K6WA 1J6PA 2FVMA 3URBA 1DPMA 1FWJC 1XRTA 1NDYA 4GY1A 1RJQA 2PUZA 4RDYA 2HNHA 3EWCA 4H9ZA 3OOQA 3GU1A 3O7UA 1S3TC 4G2DA 1FWGC 2Z00A 3ORWA 4H9UA 4XD4A 3S2NA 4C6BA 1JGMA 1P6CA 4XAYA 3F4DA 4GK8A 4ERAA 4HA0A 1O12A 2CZVA 1V51A 1R9ZA 4PCPA 4C6OA 4H9TA 2RAGA 2Z2AA 3MJMA 4GC3A 4PBFA 1UMLA 4BJHA 4C6NA 4R85A 4GOAA 3K5XA 4LFYA 2ADAA 2OOFA 4GXWA 4RDVA 3URAA 4F0LA 2OODA 3GU2A 1EJXC 4F0SA 4H9MA 3OODA 1HZYA 2QPXA 2DVTA 4PBEA 3RCMA 3E0LA 4CQBA 4C6JA 1ONXA 3TNBA 1WXYA 4H9VA 2Y1HA 4HJWA 3ID7A 1EF2A 1GKRA 4UBPC 4GY0A 4HK7A 1EJUC 1M7JA 4E3TA 4R7WA 4KEZA 3DCPA 1UIOA 3F2DA 4IF2A 4CQCA 2UBPC 4D8LA 4CNTA 3UR2A 4CQDA 1PTAA 4V1XA 3MDWA 1EYWA 5LXXA 2GWGA 2DVUA 1PSCA 4IG2A 4QRNA 2AQVA 3UPMA 3K4WA 3LGDA 3QY7A 3B0YA 4ERGA 4H9YA 3TN6A 1FWIC 2A3LA 3HM7A 4G7EB 3SFWA 1EJSC 4QTGA 1R9XA 2WJEA 2OGJA 2R1KA 3DUGA 1ITQA 1ZZMA 1QXLA 2Z2BA 4C5YA 3GTHA 4HK5A 2ZC1A 1ADDA 1YIXA 4XAGA 4LANA 1NDWA 2Q01A 3PBMA 1I0BA 1O5RA 5AKQA 4C6PA 3MDUA 2EG6A 1FWFC 3MPGA 4C6DA 4MUPA 4INFA 3A3WA 3CS2A 4DIAA 1P1MA 1BF6A 4UB9A 1EJRC 4GYFA 1NDVA 1POJA 3TN4A 3LY0A 1GKQA 4QSFA 4RDWA 3C86A 3B40A 4B90A 2PGRA 1A5OC 3T81A 4LAKA 2BB0A 4KERA 4CNSA 3TN5A 4DLFA 3KM8A 2Z25A 4JOMA 3WYZA 4I6KA 4BKNA 2VR2A 4LCSA 4ICMA 4IFKB 2FFIA 1FWCC 2O4MA 3MVTA 3OVGA
chains in the Genus database with same CATH superfamily
1NJJA 2E3ZA 1OK6A 1JDDA 1VRDA 4U4MA 1E72M 2NUWA 1KFBA 1UR0A 4JIRA 3WLJA 4MGGA 3QFEA 1UC5A 4ZE5A 2EPMX 5CPNA 1GKPA 4H83A 3BCJA 3CWOX 1GVFA 3FEQA 4LYPA 3KTXA 1UOKA 9RUBA 1C29A 4MMWA 1GOIA 1F07A 2VQUA 2PZNA 5C2CA 4P7RA 2YZ5A 4DBEA 4S38A 4QG9A 5LA0A 2D73A 4C6CA 5HMSA 3FLUA 5DLCA 2BMBA 4K68A 4RE2A 4FR1A 5AYIA 4DBWA 1IQ8A 5HPOA 4E3VA 3S5NA 2ZX9A 2X1SA 3TK7A 5F1VA 3NQAA 5AHIA 2NX9A 5JIPA 3OLGA 4M51A 3COTA 1KGUA 3KVLA 5DCEA 1L2QA 1E4NA 3IIXA 4Z1CA 5HNNA 1SZFA 3EZ4A 1SW7A 1PO9A 4TVDA 3ABZA 3WD0A 1G4PA 4MY8A 3LRLA 5E09A 3BCFA 1LRTA 4RNJA 1HIZA 2QUVA 4A29A 4GGHA 3CHFA 2RGLA 3CAVA 3LXBA 3M0JA 2NX1A 4LC8A 5ABGA 2VRKA 3DFPA 3G8RA 4XD5A 3GY1A 4OGZA 3ARUA 3PG8A 3L65A 1YTDA 5ABEA 2VTFA 1AH4A 2YCKX 2V5KA 1QW9A 5CC6A 4IIGA 2D1ZA 2AAAA 2QHAA 3VD9A 1EBGA 1Y65A 2VX6A 2WAGA 1NU5A 1TG7A 4GQQA 5HPCA 5BOOA 2YB1A 4Y7EA 1A0DA 4M81A 2DJXA 1XKYA 1DIDA 3IRSA 1VIZA 1TWWA 1EP3A 4F2UA 1JI1A 4P7OA 4A8IA 5IBXC 7TAAA 2OKOA 1EJ7L 4NRRA 3T7VA 3M1ZA 3THUA 2GGJA 4Q4MA 1S5NA 4D6HA 4DBSA 1S2WA 2Z29A 5I2UA 2IPGA 1PZ2A 5FKYA 1JDEA 4HQVA 1EZ2A 4S3GA 2FZBA 1NY1A 3H4WA 4FXSA 3GUWA 3U7VA 4IWWA 3N3MA 3HQPA 3PNUA 4DM1A 3IUDA 1FH8A 2CFFA 4IFKA 4UTFA 4I7UA 3QHNA 1XLCA 2P0IA 1OCQA 3PPHA 1AVAA 2DEPA 5BOFA 3MZNA 3B0VC 5HQMA 1IGSA 4JN6A 4JQ3A 3UZWA 2PGFA 1KCKA 2ZA2A 5CPLA 4B3LA 5AC6A 3P93A 5EMMA 4V15A 1YTKA 2IKHA 2PC4A 2OGYA 5EGRA 1MUCA 3W81A 1NOUA 3NWRA 1G4SA 2VZUA 2J6XA 4JTUA 1UWRA 4Q4QA 4DXKA 4BCEA 1AW1A 2JK2A 4PZVA 3SM0A 3DFYA 1UQZA 2VCCA 1UBSA 3DFOA 3HJEA 1RZMA 1UPPA 1EL3A 1QHPA 4JHOA 4C7GA 1XISA 4TVCA 3PPCA 3WLPA 2ODOA 3FHQA 4HTYA 1GTHA 1KFEA 2LLEA 3GBDA 5MF5A 3MWAA 3AZRA 1UASA 1KTNA 3IK2A 3WDQA 5FESA 1RR2A 2OSXA 2Y7FA 1JCMP 8CGTA 3KP1A 1VPQA 1KBJA 3C8FA 2VDIA 1V6YA 2YL5A 4K2SA 3NO5A 5C2GA 1LCOA 4LUIA 2EKCA 1XGDA 4QISA 4W8BA 4BI5A 1VPYA 1K8ZA 1Z48A 4GQ0A 4OOZA 1SFJA 1PZ1A 5C8BB 4AISA 3ZOAA 4WD0A 1LORA 3JUGA 1HP5A 1V03A 1XIEA 2G5WA 1S39A 4Q8QA 1HKKA 2NW0A 1F5ZA 3WEMA 3WNMA 1K9EA 3REQB 4AZBA 4FOKA 3M6DA 1OABA 1CGUA 1F3EA 4H9UA 1E71M 1EIXA 1KWKA 3H7UA 5D2YA 4ZTXA 1PKYA 3ABSA 1M3UA 5LHFA 1JVNA 4PMQA 4EX4A 2NQJA 4P61A 4Y2WA 1V0NA 3W27A 3WD4A 3QM3A 1CXKA 2DZWA 3ARPA 5HWMA 1HUVA 3NQGA 5A3HA 2QV5A 4NX0A 3ID7A 5ABHA 4WLCA 1TB3A 1EJUC 3NPVA 1DTUA 3WIJA 2QZRA 1UIOA 1V3LA 2Z2UA 1XYLA 1TX0A 4LY4A 4AIOA 5HDRA 1M7OA 2CLMA 1VBJA 2J7GA 2AQVA 3LGDA 1SZRA 4YXGA 3BAJA 3HGRA 5A8QA 3S6OA 1DP0A 3ZR4A 3K8KA 3ZR6A 1ME7A 1DOSA 4YCOA 1CDGA 1OFAA 4P7NA 5LGXA 4OT7A 1BEUA 3EXRA 4ZQOA 3PULA 4YHEA 3M0KA 3WF1A 4BQ4A 1A3XA 1E6ZA 3STEA 2NT1A 1A0EA 2IQ0A 4IX0A 1T96A 3AXKA 1KA9F 3WQFA 4OTKA 2YCEA 4GZEA 1HG3A 1WAUA 4WR3A 3IRDA 2J77A 2Y5SA 4LWWA 4YCPA 2VRJA 3PFMA 5HK4A 1ICQA 3U5YA 2Z25A 2VCAA 3CHCA 3G2GA 2FFIA 3RJXA 3TV8A 4HU8A 4HT3A 2VZVA 3CZKA 3GZ3A 3TTSA 3ZWSA 2BXVA 3KOZA 1I2RA 2WVUA 3VGDA 2J24A 4KH2A 4C6IA 4RKAA 3GW3A 4JFTA 3CH9A 1FUYA 4XZHA 4I8DA 2Z6IA 4DJEA 1BLIA 4LCQA 4NF7A 3D47A 4NXSA 5E70A 3FJ4A 4PEKA 3WQ6A 5K9CA 4QM1A 1TQJA 2CHNA 4CLMA 3BUVA 1D8CA 1GOOA 1L6YA 3VAVA 4HSHA 3KZSA 5EA9A 4KFNA 2F7FA 2JQXA 1SSGA 2VRQA 4DJFD 1J12A 2DH3A 2HJPA 1ZALA 4YWIA 7XIMA 1F4HA 4UUIA 1K7FA 1WZKA 1HJWA 4MHBA 2BY3A 2EPOA 1V4YA 2AQOA 1XGEA 2TYSA 2FPYA 3POCA 5I5RA 4NG3A 3SGGA 4ZVJA 4QS6A 2GL5A 4HPNA 4YTRA 2QUNA 4PUJA 1WUFA 4MIMA 5D04C 5DCDA 1RK5A 1KFWA 4J9JA 4H6RA 2WNWA 1W1IE 4EPBC 5KMYA 3THAA 4C90A 2DIKA 5A8PA 2H3BA 2PTXA 3UJSA 4EPEC 3ZXWA 4Q6XA 1V3IA 2PWUA 3R7MA 3BLOA 4EANA 3M5YA 2QUMA 4MJ2A 3WQEA 3TCSA 3QW4B 4QBXA 4GVHA 3CQHA 4O52A 3N4EA 3QHOA 3ONCA 4WX2A 4L65A 3PZOA 1CLVA 3G6MA 1ECEA 1KXVA 4B5UA 5U7SA 1GQKA 3GIYA 1GT8A 4RZBA 2BGSA 4DF1A 3MQTA 2YBVA 1RJPA 3VD5A 4EWJA 5D2TA 4FLSA 1D9EA 2HPIA 2DH2A 4GCXA 2OB3A 4QEEA 1UWQA 4O28A 2OPJA 2PWVA 4BF9A 4QFUA 1LL7A 4NZ4A 1IWBA 1OX6A 2WKLA 1AD4A 3TMLA 3WQDA 1KXHA 2CWXA 2VGGA 1DQUA 2V38A 4LCRA 3VGHA 3N04A 1Q7QA 1KR1A 4KEUA 4EACA 1XRFA 3KOXA 3G0SA 1T40A 2ZUNA 4F9JA 3S9YA 1EH9A 5DELA 2GGHA 3P3BA 1XLIA 3PR2A 4FNUA 4CNUA 4KT2A 2QCLA 2GUUA 4GZJA 3W84A 2UZ9A 4FXJA 2ZTJA 4LAZA 4DEFA 2FIQA 3T40A 4N6FA 1TRDA 3EWDA 3B8IA 5CJNA 4BEUA 2XINA 4JEJA 2QJJA 4XAFA 4Z2IA 3MCOA 4KF1A 2QDGA 1OD8A 2OT0A 2ZUUA 3UWYA 4S2BA 3HJZA 3LCXA 2WM0A 1W2VA 3IJDA 3P81A 4GBUA 3IEBA 2WHMA 3H22A 5EMYA 3R8GA 1SMDA 5GJMA 5BMWA 2FMOA 3RM4A 3QV8A 3FN9A 1VGAA 3C2VA 2O4QA 2WB5A 2EXOA 4F0RA 4JQ4A 3DC0A 4S3BA 5LYRA 2OYMA 3SCVA 1MWOA 1LUCB 2Q3RA 2Y4SA 4J7RA 2XIMA 2Z1WA 3C0QA 3EWWA 5DY2A 4XD6A 2RGMA 2XVPA 1K7EA 3HV9A 5A2AA 1IF2A 4PCSA 2XU2A 4H6QA 2VELA 1RD5A 4XO7A 4IL0A 4MPQA 1LWJA 3E74A 4E2DA 1KNWA 2VX7A 4IIEA 1HL8A 4ROPA 1F6PA 5I79A 5AHMA 3T0AA 2DZAA 1NDZA 5AY7A 2E09A 4R27A 3MUZ1 2ZCGA 4RXGA 2VFEA 4OWGA 1CXLA 3W2LA 1EQCA 4ZBCA 1TE6A 5HBFA 3TYAA 3R1ZA 1A80A 1UZHA 1O7AA 3LHTA 1EGMA 4M5PA 3F4NA 3LQLA 3TYDA 1LLWA 3WEZA 1HO4A 1AQHA 4XAYA 4OZOA 1Z32X 2XVNA 8XIMA 4AZ7A 4QG8A 4A2SA 3U2ZA 3TVAA 3G3MA 4HTBA 3PTKA 4WXYA 5BNKA 3GXNA 4NAEA 3TYEA 3KBMA 4FF7A 1GVIA 3V1PA 5BXRA 2XH4A 4GFIA 3SGUA 3T2OA 3TYCA 2XM1A 4KWWA 3W7KA 5DX7A 2XIQA 4GUIA 3RILA 4ATWA 4GUGA 4FX8A 1LL4A 4R7WA 3EOEA 3BCDA 7A3HA 4S3EA 4D8LA 2VD9A 2X40A 1QVBA 3AO0A 3VIPA 2OCZA 1PTAA 3BC9A 1EYWA 1YHTA 3FK4A 5CZJA 4ECLA 4GI9A 3AIWA 3QY7A 3VU2A 1LROA 3TN6A 4K36A 2J7FA 3EB2A 3T07A 4MOZA 2A3LA 4JYDA 3HM7A 4JAWA 3GC4A 3IVTA 4LUSA 3TW6A 4L1GA 3G1AA 2CCRA 2FJKA 2ZUMA 1W56A 2V6AA 1EP1A 1TA3A 4Q8TA 4QLLA 3SN0A 2VX5A 1OF8A 4RR4A 4PB3A 1EJRC 1TPUA 4O4VA 2QUTA 1JRBA 2ZKMX 3DHPA 4Y9AA 1TQXA 1A5OC 4DXVA 5C9UA 2ACQA 2VFDA 2C1IA 4JTSA 3ARRA 3WYZA 3LHVA 4HPHA 4IFKB 4BWLA 3UR7A 3MVTA 3WJZA 1X6NA 3OVGA 1ISXA 5H6HA 1K7XA 2B7NA 3GXDA 1W3LA 3USBA 1VFOA 3BE7A 3URNA 3PG9A 2HVNA 1J01A 1QI4A 3VO0A 1AMKA 1YXYA 2XH0A 5LGZA 5FJUA 2OO6A 1R38A 4KCVA 4HHPA 4HZ8A 1E55A 5G4HC 2WCSA 3BV4A 4D1IA 4DYEA 3N17A 2C0AA 4HCHA 4GH3A 3QMRA 3E9AA 3HPSA 4JICA 3POHA 1XX1A 5LSMA 1YRRA 3TR2A 4C6KA 3HG4A 2OZ0A 3A4JA 3INPA 2WSYA 2Y70A 3ZFHA 1SW3A 3GAYA 1NWSA 1TMQA 4GH1A 3ANUA 2VD8A 1D7FA 3DFHA 1PIGA 2RDUA 2H3DA 3WDRA 3LGEA 4K1GA 5F4WA 1E1EA 4LTSA 3EX2A 1EPVA 2C14A 5M3WA 2VWTA 4DZAA 1E9IA 4ZQNA 1OCNA 2ZXQA 3H23A 2QULA 2EJ1A 2FZ8A 2XVGA 1QFEA 4JTFA 1B9BA 4G9PA 3AIQA 3NZPA 4REQA 1DIKA 3LLDA 3UXAA 2J7CA 3MT1A 4AD4A 5AVHA 5E9AA 3HZ3A 1XPGA 3BVJA 3KL0A 3C6CA 4HZMA 3T4WA 3FYOA 4O14A 4PCNA 5M5DA 2GFTA 4MNJA 3DYPA 2E1WA 4L9XA 4DYKA 1IWPA 3DGBA 1OFQA 3F4VA 2XWDA 4EP8C 4PMYA 3LSBA 1SM9A 2PFHA 3AMLA 4BA0A 2ALDA 1HP4A 3PZUA 4QITA 1E51A 3S2MA 1TV7A 2KX9A 3PBUA 4KRUA 3AHYA 5IHSA 4IIFA 3ARXA 1BWKA 1LF1A 3HB9A 3GVVA 1YBQA 1JFHA 3GDTA 5XIMA 4DAFA 1RPKA 3APYA 3DG3A 4CEXC 2BBFA 3QGVA 4XVDA 1L8PA 1FWHC 4HYWA 4NI8A 1XLMA 4EAYA 4DWSB 4FX6M 4LQ1A 4F8XA 2GVYA 3ZT5A 2X1IA 2FTYA 2Y24A 1KWGA 5IFTA 1EXBA 2VEFA 2WQDA 4LB3A 2ZADA 1Q4NX 3F4CA 4QGCA 1WBHA 3BLFA 3I68A 2FZDA 4Q4SA 1FKWA 3B06A 5KZ6A 3HV8A 2RDTA 4WSKA 2XN0A 3EBVA 4DZHA 1B3VA 2PTWA 2QAPA 5DF0A 3A4XA 4JX6A 1RQHA 2CLHA 5E1QA 1EC7A 4QAWA 4A3HA 2XISA 1EDGA 3CV2A 4HCDA 3ZWTA 3U7BA 1MDLA 3O07A 4GXMA 1JD9A 2PBGA 1QW7A 1S46A 1TV5A 1FRBA 1K1DA 1VF8A 1OYCA 1FWDC 3U9IA 1RXOB 1E70M 3R0DA 2FPVA 3WQCA 5BRBA 2RKXA 2XGZA 2O7SA 3HN3A 4UNKA 5LZLA 1C3FA 4Z1AA 3AS3A 2UY5A 2A7PA 3OO2A 1PX3A 5C9WA 4KRZA 2X16A 2P8CA 3GRIA 4A3QA 3LGGA 4ZXOA 5I09A 2OU4A 2PDIA 3KVMA 2DSVA 1C9DA 1FDYA 3LENA 4DQWA 1R7AA 1N2VA 1QCWA 3W85A 3ZLGA 1V77A 2JGQA 1W54A 2ZX6A 1J6PA 3N6QA 1N55A 4AB4A 1E6SM 4NILA 4PUDA 3QR0A 1S2CA 3ITLA 3EEGA 2WW5A 2CLPA 3N34A 5LA1A 2YDAA 5TD4A 3V0SA 3BICA 1EHAA 1U2YA 1XFCA 1AH3A 3EYPA 3WMSA 1JGMA 4RE3A 2YR1A 3BOXA 1OCJA 5FJOA 1PS9A 3CAWA 3T2PA 1EWEA 2CXEA 2CZ5A 3BAXA 4HU0A 1XQKA 5B7ZA 4NYUA 4PCPA 4D72A 1VRXA 4FOJA 3NGJA 2RAGA 3BMWA 2GJPA 2E7FA 4BJHA 3VX0A 3WL1A 5PTDA 4DJFA 5CEWA 3G1YA 4JTKA 4HYRA 1FFRA 4AVFA 1HL9A 3W25A 3GFYA 3QV6A 4LYQA 3NL5A 2XSBA 3PK7A 5D33A 1TSIA 4UBPC 5E93A 1XG3A 4J4KA 3H53A 5C9RA 1E56A 4D6FA 3B8DA 4Q7BA 3VDAA 5I78A 2UBPC 3L2LA 1PKNA 4BR1A 4X2RA 3ES7A 4Q4OA 4ACZA 3XISA 1R3QA 4QQ3A 3CZLA 4ZOCA 4NKCA 3CC1A 4IG2A 4KFOA 4GYPC 3RO6A 3E2QA 4GUFA 1UD6A 1GZJA 4O16A 3DKJA 3L5MA 2DZXA 1XV8A 3V18A 5EPDA 2Y62A 2R1KA 1CBGA 1FFQA 3B8UA 4MWAA 3IJLA 3KUMA 3NXLA 3IVSA 1XSKA 1YX1A 2Z1VA 2XSXA 3S8HA 1M01A 3EKZA 2Q01A 4JX4A 1SO3A 1WPCA 2CU0A 3MPGA 1WDQA 3H2FA 2FB2A 3R94A 3TUUA 4QLKA 3Q65A 4Y90A 1TTIA 3ZS4A 3VMPA 3TJXA 3DGRA 1X6LA 3WK2A 1S5VA 3T0DA 1JZ3A 2DQXA 4UOQA 4Q4RA 3ZLHA 3WY1A 1OVDA 5C6MA 4XSMA 5G1TA 2Z27A 2GOUA 1JDAA 3VOIA 3OHMB 4XISA 1K70A 3D6NA 1CPUA 1QPKA 1YLVA 3GG7A 3W6YA 4N9EA 3LTYA 3FGCA 3RRAA 4N9CA 3GVGA 2BOEX 3MHUA 2OQLA 2I57A 4UTWA 2PDKA 2B7PA 3MHGA 1LOQA 2JKPA 4RV8A 3MUCA 1VKFA 5BXTA 1DORA 4PMJA 3CWHA 4PMVA 5LNSA 1MRAA 1QT1A 3BW3A 4AZHA 1OG6A 3M6YA 4XV0A 4TR9A 3TCEA 3VDGA 3TN3A 2WMIB 1DJQA 2AKZA 3A9IA 1E0UA 2OYKA 3WBWA 2E8YA 3FCPA 4YVPA 4I6VA 1VYPX 5DQPA 3LUTA 4S2CA 1US2A 3VOGA 4YYFA 7REQB 3P0XA 3CUIA 1NQKA 2E4TA 1EO5A 3OLEA 5LHEA 2DZTA 1I6NA 5J5RA 2JEQA 3TQ0A 3TJLA 2WVVA 3TYZA 5CJMA 4A4AA 3BGAA 3A24A 3NQFA 1J8VA 5FOOA 1E0TA 4AHQA 3DHDA 2A21A 3TWBA 3L9CA 4JXCA 4WF7A 4J3VA 2Y63A 4Z1BA 3EEZA 2PWEA 1E3XA 4TTGA 2FDMA 3GTIA 3O8AA 2WMHA 3S47A 1POKA 1VFFA 3UQNA 2V2DA 1B54A 3O0FA 1OFDA 3W73A 1TPVA 2GUBA 4ZO9A 1AJZA 1QMLA 5HULA 4CGTA 5TQLA 1KKOA 4MKSA 2V68A 1WXZA 3AC0A 2I1OA 4HP5A 1R3YA 4PMDA 2I5GA 1EXPA 3AMCA 5HMEA 1AH0A 3EDKA 2FLIA 4DUOA 2VZSA 3F1QA 1BD0A 5IRPA 3QJAA 3RUBL 3W7MA 1BYDA 4MNLA 1OINA 1QO5A 3KBNA 3CPUA 3C2YA 1R30A 1CI1A 3UWVA 1J11A 4ZSTA 3UY8A 1K9DA 1UH2A 3HPZA 4ZOEA 4YU1A 3BLPX 3LG3A 5I77A 2TSYA 4DNMA 3DG7A 1BXBA 3B9NA 2A3HA 5G2IA 2TRSA 4LUSB 4AVOA 4LYRA 4NYYA 2C3ZA 2KAUC 3MCNA 3QY8A 3ITOA 5HMDA 3BSHA 1TA3B 1RVKA 1Q7MA 1U30A 1CWYA 4CUCA 5A6LA 3WQGA 2BASA 1A4MA 2GUYA 3UCDA 3VYLA 4M3PA 1IIHA 2V5LA 2VEGA 3WKZA 3W1AA 3OGRA 3WBAA 3C0LA 5BZAA 3L68A 5LIXX 2HE5A 4TTUA 1M68A 4GRSA 1LWHA 5EMKA 7ENLA 1P48A 3NO3A 3THDA 3GFZA 4CU7A 4JTAA 4LF1A 3NTYA 3EOUA 4B91A 4MB5A 3QLLA 4U31A 4DI9A 1OFPA 3TXVA 2ZFAA 3E6EA 4X2PA 4AIUA 3M5ZA 5HMFA 3NPXA 3UT0A 4O0QA 4YPJA 1DHPA 1LQ0A 3IUHA 1NDYA 1F6KA 2QF7A 1FCQA 2A5HA 1RJQA 3Q37A 4JN8A 2PDMA 4WJXA 4XZ9A 4Z08A 2C7FA 2PE4A 4E2OA 3OTRA 4RDYA 3V5OA 2D3NA 1QI0A 4ATDA 2XIJA 4IX2A 4M80A 1Q6LA 2Z00A 4DNHA 4XD4A 2ZRWA 4N7QA 4ZB5A 2PDYA 3VA8A 3AXHA 4GA8A 1ISVA 1LP6A 4LF2A 3SGZA 3NPUA 3UWZA 1UMLA 3NQVA 4TXEA 1V08A 2BNJA 1NWTA 2JALA 4N4PA 4H9MA 4Z0SA 4UTJA 4YTTA 2PTYA 3SI9A 3LXAA 1WXYA 3SN4A 1XP3A 1JCJA 3BPWA 1TFVA 4LBRA 1THFD 2V3DA 4HPJA 3KHDA 5FL1A 4GACA 4FIQA 4REQB 5HNTA 3AFBA 4OBTA 3KAOA 1OYAA 2YXXA 4UNLA 4MKNA 1QK2A 2ZC8A 4JPGA 1FH7A 4MVAA 3ELFA 3QR3A 4L64A 1J0JA 2X0HA 1EJSC 5CPMA 3QC3A 1PYFA 4J3ZA 4HMNA 4BFAA 2WJEA 2OGJA 4XO6A 1XL9A 3WDJA 3F5KA 4E8CA 3QEZA 4AEFA 4A3RA 2J47A 4WK9A 3MB9A 2GLKA 3PSVA 1OK4A 1ICPA 1VLWA 2ZX8A 3IWPA 1JUKA 3F03K 3SR7A 2R6OA 1SZNA 1JPIA 4AG0A 4DIAA 3KLKA 1HN1A 2J25A 3LPFA 3AMDA 1UD5A 1T0OA 1E4MM 1V93A 3VE9A 1DWJM 3LY0A 1F9CA 5KZEA 2JIWA 1GJPA 3ZVIA 4RJEA 3WQOA 3D3FA 1B3WA 4G1KA 4PH6A 6REQA 2BSLA 3WH7A 4PFMA 3W7CA 1F3TA 1HW6A 4H2CA 4L4PA 1JZ5A 3FOKA 1H11A 3NYDA 2MUCA 1FWCC 4AH7A 1P1XA 4GNJA 4RNFA 4W7WA 4PMOA 5DMNA 4LRTA 3KFTA 4R5EA 1CEOA 4CD6A 3A23A 3MC5A 3H2OA 4GQRA 4C6LA 4ORIA 4Y8FA 1DJYA 4HSOA 3WQ5A 5HA7A 5ECVA 2FPTA 4WKAA 3DDMA 3O9NA 3VXGA 5CBJA 3TTYA 4LC6A 3VZZA 3EB4A 1X96A 1OFBA 3T4CA 3MMUA 1ZB5A 2QAFA 3S1WA 2W27A 4MADA 2A7RA 3EAUA 1Z41A 5BW6A 4LEFA 1IT0A 1UR3M 1XLDA 1XRSA 2UY4A 4LB4A 1US0A 1CECA 3RJYA 4AIEA 1R85A 4DUVA 3JR2A 4YLWA 4PTDA 3O16A 1O60A 4LNCA 3C2RA 4U5KA 1TTPA 2OKTA 1GQLA 2PD9A 1B90A 2TPSA 1FY6A 1I1WA 1P4CA 1XCWA 4ZEPA 3AI0A 1QI2A 4LALA 3FX4A 4OE7A 3EMCA 1GONA 4H6EA 1R3WA 4GKTA 3C3UA 3LERA 3T08A 1U5JA 1WYIA 3PB2A 3WUBA 3WUGA 3UZYA 4MB3A 4Z2HA 1ZUAX 4CKQA 2WNZA 3E3HA 3QQ1A 2GJRA 4PTWA 4IICA 1AMYA 1UBPC 2VQTA 2VZTA 3WDIA 2IXUA 4KBXA 2H8XA 2RDXA 3AHXA 3W76A 5B7YA 2PDGA 1AODA 5A94A 3OLDA 4G6CA 3D5HA 2C16A 4WY0A 2WC7A 1V3HA 3CJPA 4U28A 3GK0A 1Q63A 1UA3A 4V1YA 1ZAJA 2A79A 3QPEA 3VCRA 1LJYA 3PWIA 1TIWA 2CLIA 1TPH1 4LV9A 1P6WA 4ZOAA 1ZBCA 1H7PA 1ENUA 3C3NA 4IMGA 1FCUA 2ZUTA 2REQB 5D2WA 3MI3A 1BXCA 2J7BA 2X2GA 1E1FA 2FDSA 2NXHA 5I3HA 1NFBA 5K4ZA 1IZJA 1IV8A 1XXXA 3OU8A 3G5EA 3W7NA 4JL1A 5DT5A 2EG7A 4TMCA 3AIUA 1DIEA 1XBYA 1ME8A 1BSLA 1Q5MA 3JW7A 3R0UA 3HA1A 2NV2A 3TFCA 1MXDA 6ENLA 3IAPA 4IG2B 3LN3A 4ZR8A 2QJMA 1ZP4A 1W9XA 1XWYA 2X1TA 5HQEA 3L4XA 1OQFA 2IQDA 1UHVA 3CEUA 1RSCA 3QKZA 4RNHA 4MLJA 5I3FA 4E6MA 3QC0A 3TC7A 3AU6A 4TX6A 4OV9A 3GYEA 4MWAB 5D38A 1ITXA 3U57A 1OZQA 5FEWA 2QYGA 3RGTA 1QJWA 1J5SA 4B3KA 2I9UA 3ARSA 4X0NA 2YL9A 3VMOA 3AZSA 3CV7A 1SO6A 1ADOA 2OFJA 4K8HA 3FAXA 3WJWA 4DO5A 2XFRA 1DIOA 1UR9A 1HKIA 5D9NA 4ASTA 2V82A 3RM9A 1HJXA 4JTHA 1FTXA 3GKFA 3LRKA 2GWNA 4K3ZA 1G67A 1NOWA 1YXDA 1HGYA 4LNYA 2XH2A 3BAKA 3H2EA 1V79A 1ZCOA 4XD3A 1B31A 3ZR5A 1VJZA 1Q3NA 4H8NA 3VIJA 4JTLA 1MFUA 3GB6A 1XUZA 1XD0A 3V5CA 3EX6A 1KCLA 2F6KA 3LLXA 2HK1A 3VCCA 3CL8A 1K6WA 3FGCB 3LX9A 4QDPA 5DO8A 1XRTA 1JGIA 4Q8OA 4HNVA 1A53A 2A7NA 3BTNA 1MZHA 1YADA 4LT9A 4LXFA 4DJDC 4A8NA 3LMYA 1GW1A 1H1YA 3QYSA 1F6YA 2OX4A 5IBXA 2E5DA 3PB0A 3CAQA 4H41A 4IPJA 1UP0A 3L7RA 3TIMA 3AIRA 5D9PA 3U5UA 3F4DA 1J0ZA 1Q2SA 4D1JA 2HV5A 3L66A 3GR8A 2GJLA 3GXFA 1GVOA 1JQXA 1PJ9A 4EE9A 4JR5A 1Y5VA 2EF9A 4I5RA 3PTDA 4RDVA 4XG1A 3KE0A 1UKOA 3TNBA 4QG6A 3UVIA 3OEXA 1EA9C 3QR1A 4S3JA 3H70A 2W4XA 2YCLA 3I65A 4S3CA 1B57A 3SCPA 2WVVB 1JQVA 3W7RA 1R2TA 3W7IA 4XK2A 1J96A 3I10A 3M7SA 3FA5A 5LXXA 2D0FA 3ZLFA 1EUAA 4QSHA 3DG6A 1Z44A 3CHDA 1TWSA 1XYCA 4PODA 4M19A 4I9MA 2ISSA 3RRXA 1R9XA 1OGSA 1JZ7A 1KFCA 1QOQA 3RK8A 1EGZA 1TPC1 1UD2A 2ZC1A 5DMYA 4XAGA 4POCA 5LIYX 1I0BA 3QYQA 3Q67A 1DJNA 4C6DA 3AISA 2AOSA 1P1MA 3MYPA 1SR9A 2BVWA 4AD2A 4J40A 1X98A 3UERA 1H4PA 4E8DA 4B90A 4ILSA 3KBVA 1O6IA 2WANA 4AZIA 1ZU8A 3SN1A 4X63A 3G1DA 4PUWA 2B7OA 2PDQA 4UQDA 2QUUA 2YBUA 1Y5WA 2DT3A 4L6DA 4FB7A 4RZ5A 2ZZ6A 2V0TA 4HJFA 4C6EA 4RZ6A 1CXFA 1FXQA 4OFCA 1F2JA 2HRWA 4NZFA 3LK6A 2NSOA 3NYZA 1SVDA 2J74A 3QTPA 1DQWA 4O1AA 3APTA 1R0MA 6TIMA 1TWZA 5EBUA 3UD6A 3FA4A 5F4XA 1MQRA 4LVBA 1P0DA 1HNYA 3NGFA 3SQMA 5EBAA 3FS2A 3QMSA 3VNZA 4C5ZA 4Z1DA 1HKVA 3GIQA 3AUJA 4AYSA 1V02A 1VAHA 5EMUA 5E5CA 2Z6JA 2J13A 1GJWA 1ODUA 1VIWA 4JFSA 3FFSA 3PP7A 4V27A 3HQ1A 5AZ1A 1RPXA 2VVSA 3KEHA 3WLIA 3B0PA 3M64A 2GQ8A 3QF0A 3TEVA 4E4UA 2Y0FA 1RA5A 2Y5EA 2CIPA 3F7JA 2XJ7A 2NWSA 3S4TA 4B16A 1YE4A 2UWFA 4XB3A 1F4AA 2F2HA 3NZRA 1KQZA 4H8VA 4CN4A 1A50A 1R9YA 1H41A 1PPIA 2YGYA 4S3AA 2DQWA 4OUEA 1KBIA 2DUXA 2PRLA 4PRWA 3MBDA 3GVRA 3PBVA 4LS0A 3UWUA 2E1DA 4I9JA 4AY1A 3M07A 4Y9MA 2QV4A 3EWXA 3GWQA 4HMCA 3KL3A 1HKJA 5FSDC 5GJPA 1E6PA 3WJYA 2XZ9A 1V7YA 3NQEA 2VOMA 2WSRA 2NWRA 2FZNA 4E2BA 4QE5A 1WDSA 1IR2A 4IPNB 1RA0A 1DWHM 1E43A 3QTGA 3UESA 4IFOA 1ADSA 1E9ZB 1BYAA 1WOBA 4L5ZA 4ZSUA 1W5OA 4IQDA 3ARZA 1WZMA 2YFNA 1ODZA 1WKEA 2PA6A 3LA4A 3HTWA 3S6DA 3RX4A 4CU8A 2D3LA 1S1RA 4LJ3A 4U33A 2Z26A 3NEHA 4OUIA 4XX6A 3W07A 1LQ2A 4O57A 4V2XA 1YYAA 4TOQA 1E6NA 3GNDA 1XHGA 1K9TA 4BQ2A 4HD5A 4NU7A 2UY3A 4S3DA 5F4SA 3MHFA 4B92A 3UF9A 1A5LC 2D2JA 1JPMA 3MKVA 1GORA 3NQ8A 2R1MA 3LNMA 1F74A 4B3ZA 2XIOA 2YA2A 3VNIA 2J9ZA 2G3FA 3QZ6A 5HNRA 1QNSA 3VMNA 3I4EA 4CD8A 1TVLA 4GO8A 4HNLA 2QCFA 3MI6A 1UR8A 4PYSA 3FSUA 1BXNA 2AMGA 3DX5A 2QVHA 2YJQA 5D8ZA 3NG3A 5FA5A 2GGIA 2XPKA 3KW3A 1EYEA 3CEPA 3GH7A 6REQB 3CIVA 3KDNA 2CZEA 1ECQA 4OQVA 1A5NC 5M1TA 2O0TA 2WHJA 3UBPC 3UCCA 4GGBA 1E5NA 3P74A 1YEYA 4BY3A 3H4GA 3CB3A 3GX9A 3LB0A 1TV8A 5CSUA 1KV8A 2VDHA 4LAMA 1VEPA 1FWRA 1SZGA 2IKGA 1YPIA 1QDSA 1UKQA 3VVGA 4M1BA 3OZPA 2ZICA 2O7QA 1X7IA 3TTEA 2OELA 2F9RA 3A3HA 4IHCA 3ZZ1A 1XFBA 1N8IA 4H04A 3EWCA 3GC2A 4GINA 3OOQA 1G4TA 3B3DA 3B9AA 3DHFA 3OYXA 5HJYA 3VGEA 1SUXA 1UZ4A 3KS6A 3M0VA 4HA0A 5AYXA 5IM51 2X1UA 2QCEA 5EMLA 3KCJA 4AX6A 1CB2A 1CIUA 1PX8A 2E6FA 4JKLA 4S3KA 1MEHA 2QCNA 1SU5A 4GABA 3VD7A 3EPNA 3UFYA 4DWSC 2A1YA 1Q6FA 1YKWA 5D4YA 4C6JA 5HR7A 1XICA 1QPOA 2GJNA 1OEPA 4HJWA 1MI3A 4GNVA 4JTEA 1MW0A 1RBLA 4IUGA 3W2KA 1OIFA 2QQ6A 1H7NA 3IJ8A 4KEZA 5AZ0A 2E8ZA 3D0CA 1UP3A 4QJ4B 4OECA 3I7QA 1OX4B 2WC4A 2PSNA 4M6UA 1VFUA 1PEZA 3WQ4A 1GHRA 1PSCA 3MS8A 3BG9A 1W9VA 3NSMA 1GWJA 3NL2A 4F0KA 5A8MA 4Z2GA 4UQCA 4UMCA 1XLEA 2POZA 2RFGA 2YDQA 3HGOA 1EEXA 3W24A 4QDWA 1XH2A 4MY9A 3STPA 1VD6A 4YNGA 5C0QA 2DW7A 5FAGA 4UFMA 2X7VA 4QE1A 1ZZMA 1W9BM 3STCA 2WMJA 5I03A 1Z6KA 3S1XA 4FR6A 3WDHA 3WH8A 4HK5A 2VFHA 4LANA 1Q65A 1B9ZA 2Y6ZA 3ARWA 2BV9A 4U5IA 2QGHA 3ONBA 5CZ0A 4AFYA 3BLDA 4UCFA 4GHRA 4WIWA 5CCZA 4MJZA 1EP2A 1W0MA 3PZNA 1XIMA 3OBEA 2WC3A 5EMJA 1XD1A 2PDUA 3TN5A 1D7KA 3ZSSA 4KRTA 4CD7A 4HPGA 3TA6A 4JTCA 4GIRA 3G18A 1ZJHA 1XI3A 1K8YA 3P2VA 4UMBA 3RU8X 1W3IA 3UXLA 4C1LA 4F66A 1KFJA 1XH0A 2BZNA 3BLLA 1REQA 4H7CA 3CHEA 4IFRA 1PV8A 3P60A 4KWSA 1VBUA 1SFTA 2G37A 1UUMA 1YNQA 4N2YA 4YMZA 4MYXA 3TFXA 2BODX 4GMEA 1HVQA 3VIFA 1A5MC 1UQYA 4HHMA 3V5FA 4GD0A 3O3RA 1OJXA 4OBRA 3MY9A 2X42A 1R3RA 1J0KA 4P8VA 2Q3OA 4K37A 1GYLA 1IZCA 1U1UA 4AAJA 1H0IA 1XIGA 2VR5A 2WWCA 5LXEA 4UQ9A 4MZ8A 3OPSA 1UUOA 1T8QA 2OSYA 3U2CA 4KQNA 2OYLA 4ZTYA 3W1UA 5D37A 3SY1A 1WUEA 3SECA 1PE1A 1E40A 3GR4A 3PZMA 4C7FA 4FX7A 1H61A 2Z7KA 3NQBA 3TQVA 3H55A 2QCDA 3RLHA 4KIRA 4DPQA 3TSBA 3P82A 4LUTA 3OA5A 2E9MA 1O95A 3PAOA 3HQNA 3CH0A 4QIUA 1TZZA 3A13A 5IHRA 3KRZA 1H1ZA 4A22A 1LT7A 3S9ZA 3WK1A 5C9ZA 1X38A 4C1NB 3BARA 3L23A 2XUCA 1OC5A 2Z1BA 4JZ5A 3VX1A 1VCFA 2R1PA 3KOWA 4Q7IA 2QJNA 3TTOA 1FWNA 3NQDA 3R8HA 3OGVA 3RM8A 1CGTA 1VR6A 3LSCA 1A3WA 2AMXA 4D6DA 4H01A 3UGRA 3QH2A 3I3BA 2RHGA 1TIMA 3IIVA 2VUNA 2ZXBA 3AS0A 3A5FA 2NSXA 1OG0A 4CCZA 2VWSA 3XIMA 3LCWA 2OT1A 3LXCA 7TIMA 1KO0A 3RIKA 1ZBVA 3SQLA 2FTWA 3VZYA 1QU4A 2J62A 2Q8ZA 1P6BA 1ZHAA 4ZOBA 3WBXA 4JQAA 1U5HA 3PUEA 4F48A 4GZ7A 3E0VA 4IUOA 2CBIA 4WOZA 3GG0A 1EFZA 4D6GA 4K7YA 4QDMA 1LYXA 1U1HA 1TREA 4WQ6A 1QNRA 2PS2A 1J4EA 2YCLB 4FOUA 3VOFA 3V7PA 4JCLA 2CBUA 3B8SA 5GNZA 2OG9A 1HXJA 4FIRA 1EO7A 1ZBKA 1HJUA 1XIJA 1TPFA 3CT2A 2OQHA 1JIBA 4ZB2A 3DI0A 1MUWA 3WLMA 3AXMA 3TQPA 4A2RA 5CPTA 1S2AA 4O18A 4GPNA 2DSKA 2V8ZA 3TDFA 1R2SA 1WDWA 1W3HA 1H5VA 3QGKC 1XBVA 5M03A 3GH5A 5DBUA 1ISYA 1DWAM 4D8ZA 3M0IA 4B5WA 4GVGA 4HU3A 3SUUA 4UTUA 1A5KC 3M0LA 5FIPA 4PMUA 3BH4A 1TR9A 3S1VA 3LYEA 1L6SA 3T9PA 1AW5A 4GIEA 2FYMA 3L4VA 3W71A 3N9RA 5GVJA 1J93A 3S3GA 1LG2A 1K6AA 3VKJA 1UWUA 5FEXA 2JKEA 5MKGB 3LM7A 4O1EA 2OZ8A 4XSLA 2VI0A 1VFLA 3MSYA 3W87A 3PZIA 3VNKA 1CXIA 1BTMA 3EKLA 2QDEA 1KM5A 2C18A 4W84A 3I6TA 4A8LA 1WKYA 2OO0A 3VPLA 3GM8A 3SRFA 1QOPA 1TX2A 4GQBA 3W26A 4Z0JA 2A6NA 1Z8AA 3WBYA 4WGHA 4EAMA 3S9IA 1B3ZA 4G8TA 2G97A 1UZ1A 1JCYA 2GDVA 3L4ZA 4GIAA 2WJZA 4JTRA 4MTVA 4ZO8A 4L80A 2X30A 4UQBA 1CGVA 4TV6A 4NNBA 2DSZA 3PWGA 4GLEA 4AXNA 3N25A 1QOXA 6PTDA 3RF9A 5IXEA 3S2NA 3VKAA 3WF4A 4JTIA 1IYXA 4BI6A 4LVDA 4Y9NA 5JBFA 3FYYA 5JU6A 2PP0A 4QJ5B 3WLQA 4PBFA 4GC3A 1CGWA 4R85A 3MUY1 2GJXB 4GOAA 3KVJA 3SSZA 3WLLA 3GG8A 1QTWA 3WJSA 1EJXC 5E6ZA 1B3XA 4DM2A 1MO0A 3MWCA 1LDCA 2ZZ1A 2OLSA 3AZTA 1NWRA 3MMWA 2EPKX 2V81A 1U1JA 2QXWA 1XLFA 5DN1A 2WMFA 3KLLA 1XIDA 2NT0A 4DPPA 2HDJA 3AHZA 3QQ0A 4D71A 4NNAA 3OYZA 3WD3A 2PRMA 1SJDA 3ITVA 3LOTA 3EWZA 4KCTA 5CJ5A 2VGFA 4ZMGA 3FNDA 4CVUA 4H9YA 5AN7A 1UD3A 3MANA 4LPCA 2F2KA 3MMDA 4N4QA 3M9YA 3FKKA 3MUXA 1LT8A 1CZ1A 1DEDA 1UB3A 4M7SA 2GDQA 2WOQA 3N13A 3DUGA 3BOFA 2WV8A 2NXGA 1V6XA 1HL2A 4FA3A 6TAAA 1W2PA 4IIBA 3UJ2A 2BOFX 4HU4A 1MXGA 3OBKA 2VOTA 3SRDA 1W37A 3EKGA 2DZSA 2EG6A 1JPDX 2O92A 2ASHA 1KM2A 4CQAA 4UB9A 4F2BA 2XVLA 3FYPA 3V3WA 4W93A 2CKRA 4RDWA 1KD0A 2WCAA 1UCWA 3LI0A 2NQ5A 4HA4A 2DFAA 2ACRA 3EB3A 1NEYA 3NJ3A 2XYLA 3JRKA 3OHIA 4ZL1A 4CCCA 1RV8A 5EU9A 5DXYA 4LVFA 3LCHA 2XN1A 3EOLA 3NO1A 4US5A 2BVTA 2GOKA 4NQ1A 5JVLA 3BK0A 1ZBWA 3APGA 7PTDA 3HG3A 2EPLX 2HQAA 3B8VA 3J7HA 3IS4A 4UFIA 3L5AA 3N2XA 2QJHA 2GVGA 4JIEA 5EY5A 1PIIA 1L9WA 4FI4A 4DZ5A 3FVDA 4ZB0A 3EA1A 1TELA 3GSMA 1BPLB 1FH9A 5BXSA 1KGWA 3S46A 1ZCCA 3O6CA 1WQ5A 5CAKA 3PBGA 3Q4DA 3TYBA 5HUOA 3PBYA 2CWNA 4QE4A 3LD5A 4GXPA 2VYOA 3DENA 4MZ1A 3SUSA 3LNPA 5FI8A 1AFSA 3R10A 4O8RA 1H60A 2C79A 1H63A 3QZEA 1Q6GA 1ITUA 1G9HA 4IMEA 4Z2KA 1V6VA 1D3GA 1CLKA 1WNOA 4A6GA 3VC5A 4WUIA 4ACYA 1DHKA 4ERIA 1Q8AA 5CLWA 1UPMB 2VC5A 3L2IA 4W86A 4GYPA 1XDMA 2BDQA 4LV4A 2YYUA 2DVXA 1JYWA 2ACSA 1W5QA 3UP8A 2D69A 2OOGA 3E5BA 1Q8JA 3NQMA 3QY6A 7ODCA 3U2EA 1Z42A 5AC7A 2Y8UA 3GNPA 5DRCA 1UYQA 2HMCA 4IQJA 3QGAC 1UG6A 5H2ZA 1N7KA 3BJTA 2V30A 3OBAA 1G0CA 1WDDA 2B81A 1J5TA 3KBSA 2ZA1A 1PHQA 4JKKA 4DY1A 3BLIA 1UIPA 3BG3A 4AD5A 3IV3A 3GE7A 3VUPA 3AROA 4UMAA 1UP2A 3N15A 3NQ6A 3BGJA 3OIHA 4OBSA 1ZS2A 4I3GA 5LNRA 3KRSA 2YL6A 4KEMA 3TW7A 3L21A 3R0KA 4DJDD 3F2BA 1RP8A 3IANA 2W3ZA 3DOPA 1EJTC 1UWSA 2DV0A 3DERA 2PTDA 4I5UA 4P7QA 5JIWA 4TO8A 3C8NA 1M9HA 1H1NA 1LOSA 5A8GA 5AYBA 1NQ6A 3MCMA 3A12A 3SW6A 3EOSA 1XLHA 3BWWA 4HA3A 4XTIA 4C60A 1GZGA 2VO5A 1QBBA 5C54A 2FJUB 2YLLA 2QS8A 2H9AA 3MKCA 4IMCA 4CNOA 1AW2A 1ZP3A 2R82A 4MDPA 1JCNA 3WF0A 4GY7A 5F1UA 5FF7A 3A64A 2E6DA 2JFEX 1C91A 4MY1A 3A5VA 4RE0A 2Z4GA 2EQDA 3GYCA 3S1UA 2ZZ7A 5K3VA 3ABXA 4QEHA 4W88A 3UPWA 5ABFA 4WGXA 3CMFA 2QJGA 2ZZ4A 5XINA 1IEQA 1EX5A 8XIAA 3B9EA 5CZTA 1ISWA 3VILA 3P5YA 4JNZA 1AQ0A 1E0WA 2CYGA 3GLCA 3NXFA 3PJUA 4CQ9A 4R88A 1GOQA 4EF9A 1LQAA 1W3JA 4A35A 1F3XA 2ZX7A 3HPXA 3R5EA 2CLKA 1W32A 3CZ8A 3EA3A 4AVNA 3I7RA 4KESA 4UC5A 4B2DD 1XIBA 3C2OA 1RALA 4TX8A 4IP4A 2DJLA 3E0WA 4BF7A 2GVLA 2VEKA 1REQB 4B5TA 4X61A 4OIFA 1EDQA 3HPFA 1B0IA 3SFKA 1VEOA 1FOBA 1VC4A 1NVMA 5LA2A 1VP5A 4I9AA 3BAWA 1B4EA 3P84A 1XYBA 4RXFA 3Q58A 2JGYA 1NM9A 4GC4A 3ORWA 5KZMA 2YPIA 4MJMA 1PYMA 3RDKA 1W91A 2G3JA 1Q45A 3MP4A 1OC6A 3RLVA 3EWYA 4GJ1A 2YZRA 4M29A 1TJPA 3L2MA 3CU2A 3DYMA 4MB4A 1OCBA 1E5JA 1G6CA 4F0LA 2QCDB 3GU2A 3EMZA 1KTBA 2OWXA 2ZQ0A 5CC5A 3OODA 2X2YA 1LLOA 4B4FA 4D6IA 4XZLX 5I0DA 5ECUA 1XKJA 3WD2A 5CSYA 2CPUA 2GPTA 3CLMA 3FY1A 4IMAA 1EF3A 4IF2A 4O4WA 2WSKA 4GQGA 1C9WA 1B4KA 4FXRA 3W9ZA 4ZE4A 2E77A 4A8RA 1CXEA 1WKDA 4LX4A 4O13A 3CTTA 2E28A 2FH8A 3EXSA 4MZYA 4F2TA 2ISWA 1A5UA 3BV7A 4O10A 5L9FA 2QMJA 1FWIC 3VE7A 2NUXA 4BI7A 2WKGA 1ITQA 2GSJA 3TR9A 3VKDA 3VNJA 1JF6A 1V3MA 1ADDA 2QPSA 4JDYA 3S0CA 5A6BD 2E9BA 3CS2A 1SJAA 4H3DA 4GYFA 1E6QM 4HHLA 1F76A 1NDVA 5JMUA 3TQKA 1ONRA 3KL5A 3NQ7A 1K03A 5D30A 1Y7VA 2PGRA 1ESWA 1JPKA 1MSSA 3P6LA 5G2WA 2FGZA 1DXIA 1JXKA 1FHDA 2VR2A 3MI2A 4BS0A 1HF6A 1IXQA 4L6HA 5CBBA 1I4NA 1RLDA 3VCNA 2VFGA 2IPJA 4RL3A 4ONVA 2BHZA 3WMLA 3RPDA 2P0OA 3IGSA 3KZPA 3FIGA 4W7UA 5B80A 1GOMA 1K4HA 3AICA 2WMGA 1K3UA 4JNMA 4AZCA 2V63A 2PTZA 2WJFA 5K2ZA 3V0UA 4LH8A 1EB3A 1YPXA 4B9ZA 3T8LA 2X1RA 2DZVA 1SJCA 4XZNX 1DJIA 1GPWA 3CHVA 2QCCA 2OWWA 3SIZA 3DFNA 4WHBA 3ARYA 4DO7A 3N2CA 3WLSA 2P10A 4V33A 3L12A 3DIPA 4G56A 3ATYA 4QS5A 3IUIA 1TE1A 4QROA 5I3GA 2F8QA 1CYGA 2I5IA 1BKHA 1GVQA 3UU0A 1BWVA 1IE7C 2P50A 4X60A 1QBAA 4JNYA 3TMQA 3HG2A 1E3ZA 3P67A 4Q6JA 2W9MA 1V0MA 3AU2A 2KZHA 3E2SA 3PZVA 4P2VA 4GKLA 3LCFA 3G77A 5FF3A 2WCGA 4HA1A 3STFA 2GYIA 1K8XA 3H7RA 3K4DA 1YTEA 2RH9A 1QNVA 3AS2A 1RLCL 3CMGA 4ADTA 1BHGA 3HU7A 1GPFA 3RLGA 2CZDA 4J2MA 1JUEA 2OEJA 2PLMA 4IXXA 4E8GA 1Q6OA 3FSTA 3UWWA 5LNVA 2CBVA 8TIMA 3I6RA 1I2NA 3Q45A 3T78A 4UIOA 1BQGA 4WDUA 1X1OA 1MRQA 4P8UA 5AC4A 2G96A 4DAIA 2WMKA 3HBLA 4UZSA 3NQCA 5CPQA 1YPFA 3M7WA 1FKXA 5I3KA 1MEIA 4AIBA 4OHQA 3TKFA 2GZXA 1UZDA 3NQ2A 2DSWA 3SCRA 4NY2A 3WELA 5FF0A 3B05A 3ICJA 2ZE3A 3ITTA 3REQA 2QKFA 1TUFA 4AX7A 3CZGA 2DT1A 3W53A 4PTVA 4DO4A 2ZVIA 1WOAA 3LHWA 4ML9A 3PVFA 4IPIA 4H6KA 2G95A 3N11A 4WJ8A 3FXYA 3N2BA 3E12A 4R3UA 1KQYA 3CYVA 2BTMA 3AQUA 3W7PA 2NLYA 1OFRA 1V3JA 1DWFM 4DWSD 3CUJA 2Z0IA 1W17A 4FK9A 3TNOA 1JR1A 1W1B1 5HNUA 4DZIA 3PZGA 5KTLA 4NZ5A 5FAJA 3LI1A 2PODA 2NQHA 2V5CA 1LZOA 2BFGA 3MZ2A 1JNDA 4G7FA 3WQWA 3LTSA 1C7TA 1SFSA 1W8SA 3UXIA 3WDPP 4Q7NA 1OYBA 2XIIA 3KWXA 4H2HA 3PC0A 4TVUA 4WSHA 2DDXA 4H8HA 5LIWX 1VENA 3HIJA 4DF0A 4H9XA 1Y8BA 3TLLA 2GGEA 1C7SA 4F9DA 3CNYA 5A6JA 3ANYA 1JD7A 1MYRA 1R47A 2OLHA 1SJBA 1IEIA 2YDSA 3VZXA 4MB1A 4DUXA 3NSNA 2Y89A 1SSDA 1Q85A 2FVMA 4OV4A 1M6JA 4GY1A 2G4FA 1CGYA 3QLDA 1O68A 1F7BA 2QR6A 2HNHA 1JL8A 3IGXA 1S3TC 3VIGA 1FWGC 3JS3A 2DZBA 4M7TA 4C91A 1TZ7A 3OIXA 2PCEA 1OWQA 4MLRA 1LWIA 2WVTA 3M5XA 5A2CA 2ZWYA 1ONEA 4DJED 1ZAHA 1WB0A 3CYJA 4L4LA 3W22A 3B8WA 1SO4A 4JFWA 1G01A 4EXQA 4ML4A 1G94A 1Y5XA 1FBAA 4PTMA 3P80A 3AOFA 2FMNA 3OZMA 3E0LA 2XDFA 3L5LA 4H9VA 3TP4A 3UYIA 1MQPA 1OX5A 1F8MA 2C71A 5D9OA 2OJPA 2WNNA 3WH6A 2EKGA 3DCPA 3LHUA 2ZOXA 2I7GA 3F2DA 3OGSA 4I7WA 3VNLA 4TX9A 3G1FA 4V1XA 2V5JA 4QXIA 2DVUA 4X3ZA 1ZJBA 4EXBA 3OG2A 1BYCA 3LHYA 2D0GA 1GYMA 1PDZA 4IGHA 4H19A 2HVOA 4JEQA 5IDZA 2OXNA 3BAIA 2A2IA 1KFKA 2TODA 4X22A 4Q3MA 4MAZA 1IT8A 1NDWA 1LRNA 6ALDA 2Y7EA 2GGGA 2W62A 3MDUA 4FNPA 1BF6A 1K8CA 4Q32A 2PF8A 1V3KA 3BSGA 2P1FA 1L2UA 4O19A 3TN4A 3VD3A 9XIAA 2F6UA 2PDNA 3C86A 1H50A 3B40A 4IQEA 3KX6A 3B9OA 2YCIX 4JHMA 3UXDA 3PZQA 2OTDA 3QXBA 3W2NA 4BKNA 1P7TA 1XYFA 1IR1A 4FSAA 2VXNA 3BQ5A 1BGGA 5BXPA 5IOBA 3U2OA 4DJDA 1N82A 3E0FA 2J8FA 4KGJA 1RY0A 2ZIDA 2H9AB 2I16A 4Y96A 3SY8A 4URIA 3AHVA 2RJGA 3XINA 1X7FA 3R43A 2J7DA 3SSJA 3SCWA 1J79A 3O2LA 2DT0A 1V6UA 3TWAA 3WN6A 1IEXA 3TONA 2W79A 3VNDA 3CTLA 5RUBA 4R33A 4Q22A 1TZ9A 1S2VA 1RQBA 2Q09A 1UJPA 1DKWA 2VEIA 3MSRA 3T42A 2H90A 4PB5A 4AXKA 1A47A 1QRQA 2W0UA 3TOYA 3GTFA 1GCYA 2XGIA 1AL8A 1TTQA 3SCTA 2VC6A 4Z1YA 4UFKA 2QNEA 2CW6A 4YJ5A 2QT3A 1LBFA 4U10A 3P5ZA 1F05A 3RPTA 1W6TA 5GNYA 2ZZ5A 3E96A 5CG7A 3ITCA 3K4AA 3CUXA 1C92A 2DP3A 4FF5A 2JE8A 3GHRA 4C6MA 3AYVA 3W83A 2VUYA 1MW3A 3V35A 3EMQA 3GHUA 4IP5A 3H7VA 3RCNA 2EPNA 4ZXLA 5J04A 2F84A 3GXTA 3L4UA 3AMGA 4UQAA 2A6LA 1LUCA 3OG3A 1W3NA 5DMLA 1ZSXA 2AAMA 2R1LA 5G4WA 4C65A 3O05A 4GX9A 3VDBA 2HWGA 3EXTA 5A8OA 3H8AA 3UY7A 3ABQA 2ISFA 3RLUA 2VJXA 4N02A 4HMDA 4GJJA 4MDOA 1ICSA 5HANA 2BGQA 3B8TA 4YVVA 1XM3A 1WE5A 4OOUA 3MV11 3R58A 1DE5A 3AJXA 4AWUA 4IJCA 2D24A 1GVRA 3LLFA 4NI3A 1EX1A 1WKFA 2BGNE 2INEA 1W31A 3RG6A 4UOJA 3MP5A 5E6YA 3NAVA 3VOHA 1KM0A 5C55A 1GTEA 4PN2A 3S5OA 2WO5A 3NNTA 1JYNA 1UMYA 2J75A 4MAVA 1RP9A 4ZQMA 4XUYA 2H6RA 4A21A 1A5AA 4BK9A 4HNNA 2VX4A 1BRLA 4DVOA 2CXGA 4MF4A 4GYKA 2CKSA 3UR8A 3W2JA 3DU0A 2IKIA 2DT2A 4KCUA 4YL2A 4PULA 1OC7A 3MUIA 1ZQ5A 1DVJA 2BLEA 3BAYA 4O1DA 1KRAC 2HXTA 3DEQA 4IT1A 3GHTA 3A47A 1Q66A 1XS2A 1QNPA 1B2YA 4IH3A 1H7OA 1OGBA 2E25A 4HNTA 5A95A 3KOYA 4NHVA 1EKOA 2DORA 4CN6A 3P61A 4AUBA 3W0KA 4YTUA 1JRCA 4KMQA 3PY2A 2D2OA 1XLLA 4GI4A 3TZFA 3MP3A 4H4IA 3WD1A 3W01A 2YDRA 5A6BA 5ENLA 4HNCA 2WZIA 3OZYA 5FJTA 2FVLA 2X05A 4FNTA 1KRCC 2WLZA 3W1TA 4CEUC 3M46A 3CV1A 3RX2A 1JCLA 2FHFA 3R8RA 1O1ZA 4S39A 3CV6A 2NVCA 4UXDA 4PBGA 4ZQRA 2BG5A 1FP9A 1H09A 1M41A 3UNTA 3RFAA 1XIFA 4AZCB 1HGWA 2QEZA 4DRSA 1UR4A 2Y5JA 1A3HA 2BOGX 3W7HA 1BG9A 1CXHA 4XKYA 3RAOA 4GI8A 4ICNA 3I4KA 3GDBA 2WBKA 4QCEA 1H3GA 3C52A 2QCHA 4JGDA 5HATA 3A21A 3QOKA 4MPKA 3CWNA 1SR0A 2ZRXA 3NL6A 2G50A 3NR0A 2PDLA 2ADAA 2JBMA 3WK3A 1F8IA 3URAA 3VIIA 1JF5A 3L4TA 5BRQA 1XRVA 3G0XA 4XZMX 3WH9A 4M1RA 3Q2DA 3L0KA 1T7LA 3CIWA 1YDVA 3VUSA 4JTTA 1LM1A 5D32A 1M7PA 3K13A 3EA2A 4HZ7A 4S1FA 4CNTA 2JKAA 2WPBA 4TUFA 3MDWA 4XTDA 2NV9A 3EX1A 4IM4A 4JFUA 4WJEA 3BQ6A 1MZRA 3FJLA 3GDKA 2D0HA 3WNOA 4R9XA 1JULA 4XQ6A 4DX3A 1EIBA 4J3WA 3N4FA 1CT5A 1TYGA 1W5PA 1WZLA 3T09A 1QNOA 4R7JA 1QXLA 5AVNA 3UGVA 2OZ3A 2E6AA 1KM6A 1LLZA 3LCIA 2F38A 1QATA 3P62A 3SADA 4ZA0A 3W28A 5AKQA 8RUCA 3U3HA 4C6PA 4H7ZA 3SUTA 3A3WA 3U4AA 5H8PA 4L1XA 1N8FA 2YYTA 4UFLA 1WAWA 4R7OA 1NF0A 3UG5A 2INZA 5FD0A 1KC7A 1PCWA 1VYSX 4JOMA 1W5NA 2IW0A 3N6JA 4FHAA 3AXIA 4ICMA 4ADSA 3UWQA 4IP7A 3V1HA 1VFMA 2ANUA 2VZOA 5A6SA 1ZTVA 2PP3A 2CEQA 3UXKA 2DZUA 4KETA 4C6QA 4NAEB 2Q8LA 4EF8A 3H54A 3A9BA 3NFUA 4LYKA 4KEVA 4IZGA 1TVNA 5F2GA 3FEMA 3GAKA 1G5AA 2W91A 2X0YA 1I2OA 3DYOA 1UROA 3EX4A 1AZ1A 3E49A 2NX3A 4AU0A 4ES4A 3S2JA 2V2HA 4GVIA 3RITA 1ONWA 4W89A 5I23A 5FEZA 3IJIA 5FJJA 1KBKA 1RY8A 6CGTA 3UWEA 2XWEA 1PWLA 5I6SA 3CPGA 4TQTA 3GG1A 4DWSA 1KBBA 5JXQA 4H7VA 1PB0A 4XUGA 4W85A 5BYWA 3C0JA 3IPWA 3HMJG 3LMZA 1NARA 1Y0EA 4K38A 4AW7A 1FWEC 4FLQA 4PTNA 4CQ8A 3FW6A 4JD4A 5CH9A 4WOQA 3WMBA 3TW9A 4W8LA 1H7XA 2R1NA 3W75A 6XIMA 2QVNA 3UYCA 4GYJA 1P0BA 3LZ3A 3EPMA 2Y8VA 2PDXA 1V7AA 3T44A 3MJYA 4JYFA 1VBHA 1QW8A 3O6DA 2V5DA 2WBGA 3BMXA 3ITYA 4DYJA 2VM8A 3CUGA 2WHKA 4CNNA 2Z1XA 3R2GA 2HBXA 4XIAA 4PUKA 3ZVHA 1FWTA 2EGZA 3GIPA 3GTXA 1RBOB 3DFQA 1OZMA 1Q2RA 3CM4A 4XAPA 3GFXA 3R4IA 4LW7A 1KKRA 4O8AA 1A49A 5LNUA 5H8MA 2YB4A 5HINA 2I56A 5CGMA 4Z2LA 4J35A 4PA8A 4MWAE 3OB8A 2VHLA 1E1CA 1UWIA 4JX5A 5G5IA 4HNUA 3KHJA 5F7UA 3HOJA 1MVYA 3SUWA 1EZWA 3O0KA 3LPPA 1C8XA 2V67A 2BVDA 3CZJA 3BDKA 4OJYA 2FZ9A 4NZ1A 2QIWA 3OLIA 4RLIA 2VDGA 1WO2A 4Q8VA 1IXNA 1D2KA 2ZRYA 2AGKA 4UTTC 3AYTA 3A3XA 2NQ9A 3AIEA 2ZUVA 3VDCA 2FVKA 3B4UA 3BZGA 1XQLA 2RUSA 1C93A 3VFCA 3IJQA 5FJPA 3ZJ6A 2PD5A 2HEJA 2PWFA 1FDJA 2QDHA 3PJXA 3LV5A 4L56A 4YTQA 3K1GA 4IIHA 3G3DA 4YIWA 2IMRA 4IXHA 3ZJ7A 4C1KA 3BLEA 1XLAA 3FJ6A 3UG4A 3UJFA 3SAZA 1XLGA 1HQTA 3IJ6A 4XBKA 2OSWA 1OY0A 2PDHA 4MWAD 1NAL1 3C2EA 3NDZA 3W1RA 4AD1A 2Z7GA 2YIHA 5GPRA 1P7TB 3IV8A 3QKEA 3PSWA 5H8UA 2VFIA 2J9XA 1X8FA 2XHYA 3GU9A 1JZ2A 3VDHA 3URQA 3CQ0A 3W7EA 1MXSA 2WSPA 4WVXA 5HR6A 1YBQB 4O53A 3W6MA 2Z1SA 3EWBX 2W61A 4MNKA 4Q8WA 4UNIA 1BG4A 4PTXA 1KFLA 1FHVA 4OU1A 4AF0A 3GDMA 3DZ1A 4L9ZA 3WLKX 3ZIZA 2CESA 3A4WA 2C6QA 2NZLA 2HVMA 1PTGA 4KPLA 3GR7A 1UA7A 5HWNA 4R34A 2CZFA 1V51A 4W87A 3FXGA 1M03A 3BGGA 3DBNA 4W9TA 2A0NA 2DIJA 2JF7A 4HBKA 3S42A 1VCGA 2OOFA 1XF0A 1W5MA 1V0KA 1DQXA 4F0SA 4FLOA 1HZYA 3FV9A 3SEPA 4PBEA 4CQBA 4LU0A 1ONXA 1UR1A 4LBUA 1PZ0A 2Y1HA 3GC5A 1ALDA 2FH6A 3O06A 3AIVA 2ZTKA 5DRIA 1HJQA 2ZWZA 1ZL1A 2WZTA 2B0MA 1HKWA 2J79A 4CQCA 3U8GA 3UR2A 4PUMA 4CQDA 4B5NA 3MYOA 1VS1A 5HXMA 1FWSA 2XG9A 4AEOA 1L8NA 3NDOA 2V3EA 4FS9A 4M8UA 2PDPA 1K9FA 3GNRA 2V9DA 3SFWA 3RU6A 5CGQA 4AHPA 4QCFA 1ELSA 1MQQA 3AHTA 2WMIA 3U6WA 1MNZA 4C5YA 4WCJA 4WDWA 3II1A 2ABAA 2ZXAA 5I02A 3MO4A 4UFJA 1G1YA 3GVQA 4IGSA 3PBMA 7REQA 2C19A 3NPWA 3D46A 1FWFC 5IFPA 3IAQA 4INFA 3UA4A 1H2JA 5C71A 3K30A 3PN8A 1VQTA 5T9CE 2AGTA 3OP2A 1ZNNA 2GK1A 1A5CA 1QHZA 1KV5A 2BB0A 4KERA 5CZSA 3QQWA 3KM8A 3GNNA 4PSRA 3ATZA 4ORMA 1R6WA 4QR6A 9XIMA 3NVTA 1ML1A 1AL7A 3VABA 2J4GA 4J28A 3G1XA 2YXGA 3CLWA 1IGWA 1RK6A 1TRIA 4NZJA 3BG5A 3IACA 1TTJA 1BRLB 1I1XA 3KDOA 4KIEA 4F3HA 2J6VA 3S2CA 2H8ZA 1HX0A 1XDLA 2XN2A 3TLQA 4N9BA 2G41A 4CN1A 1NFGA 1T99A 2ALRA 2UV8G 1PZ3A 3ITGA 4I8YA 5C7HA 1XSJA 5M2FX 2HZGA 1OFOA 2PLKA 3UZZA 2ZDSA 2PPGA 4AC1X 2ABBA 4OVXA 3DFSA 2C1HA 1XCXA 4AWEA 4AQLA 4ACZB 5CLTA 1O5QA 2I14A 4WXZA 2VGIA 5H91A 1W1ZA 1VH7A 2Y61A 1A5BA 3PANA 4AHOA 4L9YA 4XIMA 2P3EA 2NV1A 4HK6A 1NOFA 1PAMA 1Q6QA 2R14A 3IGHX 2GVJA 4XBSA 1GGOA 2YX0A 1S3HA 1TWDA 1TV3A 2JIEA 1FQ0A 2VT0A 5AB3A 4I90A 4AY8A 3W2UA 3SZ8A 1OSEA 2YW4A 4RPPA 4IPLA 4KFPA 1V8EA 2PF0A 1RH9A 3HG5A 2G3IA 2INFA 3WNPA 5EFFA 1GEHA 3V16A 2A3CA 3THCA 1XUUA 3T0BA 4A3YA 1KLYA 2QCGA 4FEZA 1EHNA 1L0PA 5T91A 4XZWA 3AUOA 3AALA 2C0HA 5E0FA 1S5WA 4Q33A 1E9YB 3OVPA 1XCFA 5A8NA 4PR4A 2NVAA 3OJGA 4IMFA 3W29A 3AWOA 4XKYB 4WKHA 1MW2A 1JUBA 1VHCA 3G1SA 1XDJA 2EBNA 5KEZA 2I17A 5M17A 3CXOA 3Q94A 3S5SA 4P5UA 4PUEA 2PB1A 2ZRUA 4PEEA 2P53A 1S2UA 1UKTA 5FF4A 3LRMA 1YW1A 4DBUA 2PZ0A 5HUPA 4IISA 1J6OA 4GE8A 1I75A 3B0XA 1W1PA 4ZGYA 2A4AA 4JY9A 4UTKA 5EB8A 1FDZA 2O9PA 1R2RA 5C70A 3W1XA 3GXIA 2D2HA 1TMLA 5CQ1A 1QO2A 4Q4PA 9CGTA 1AQFA 1TV2A 3FHAA 3M0MA 1A0CA 1W9PA 2EPHA 2PDCA 3IIZA 1KRMA 2PDJA 1IXOA 2YXOA 2IPWA 2ZRVA 3RR1A 5CKSA 4NIRA 2R9RA 3VM5A 3MVIA 4P8XA 1FVPA 5D03A 2V69A 1UUQA 1RJRA 4M82A 2ISVA 4UWMA 2AQWA 1YDNA 4FMVA 3TAKA 2CC0A 1EUNA 1AJ0A 1PXGA 1NP2A 4XBJA 3GVWA 1P0EA 1UWAA 1E6XM 1LRQA 1GUVA 2C15A 2XFFA 2CLOA 4H00A 3T0TA 2VNCA 1RUSA 4ENLA 1HKMA 3H4XA 4MSSA 4GUJA 1Z89A 3CL6A 4RV3A 4O1FA 3WH5A 3CT7A 4H1ZA 4EIVA 4UTIA 1DYSA 1Q6DA 5D8WA 3VINA 2WSQA 4PUNA 1CENA 1R7OA 4YVXA 1RBAA 2E67A 3LQGA 2YBTA 3MA8A 3S5ZA 1IZKA 4PCFA 2HK0A 3HGJA 3QZAA 1DPMA 5I7GA 2ZX5A 4GFSA 3QV7A 5I3JA 1O4UA 3IK4A 2A3BA 5K9XA 4B5XA 3VGFA 2VP8A 1UJQA 3ZM8A 1DV7A 1Z7AA 3GDLA 4PC8A 1DJWA 1X1NA 1QI5A 4FP1A 3H2CA 1OHLA 1ISZA 4YTSA 4PL1A 4C6BA 4MNMA 4MFDA 3TX9A 4D9PA 1O12A 3T0CA 3I7SA 3O63A 4Y8EA 3UNDA 2YFOA 4H9TA 3ZYZA 3AWNA 4HOWA 2PGEA 4LFYA 3TE9A 2C13A 4WKFA 3WENA 2OODA 2WKJA 3PJTA 1TCMA 1JAKA 1UH4A 1ZRQA 2WWDA 3WLOA 3MU7A 2RDWA 4HNOA 5DFAA 1EF2A 2PWGA 2J78A 5HJXA 3AYSA 4GVFA 4E3TA 1LG1A 3WNNA 1JYXA 1FCVA 4CVWA 4LVGA 1WBJA 1KR0A 3PUOA 3W02A 1TPEA 1U22A 1QI3A 4FXFA 1BVWA 3WLHA 4JY8A 2HE8A 4WDTA 3K8MA 3K4WA 3B0YA 4DO6A 3P7YA 3ZVHB 3BSMA 1FA2A 5D05A 1PTDA 5SWUA 3G1VA 1AA1B 1FP8A 1GVYA 1H0GA 1WZAA 1GZ1A 5CBIA 1Z9AA 2Y7GA 1B3YA 1G4EA 3W1NA 1F61A 1OF6A 4AZGA 4JBRA 4ZCWA 3SB0A 5AHLA 4MUPA 4CNPA 4NZCA 2O9TA 5REQA 1E1CB 3NDYA 2E68A 4E4FA 3VNYA 3SBFA 3T81A 1TJ0A 4GISA 5DY3A 2ON3A 4BQ5A 1G69A 2GDUA 3HFYA 4QLJA 1J10A 2EEXA 3S83A 5JBDA 3WO8A 2W92A 2E0PA 3W1LA 4PGLA 2NVDA 3TH6A 4J3XA 4J3TA 2WNQA 3OW1A 3M43A 3ZT6A 3EX3A 4JHZA 3TXZA 1W1TA 3M0HA 2VR4A 2DW6A 3QV9A 1H5YA 4RK8A 4LAUA 1PIFA 3UVAA 4ZO6A 3O6YX 3PF3A 2REQA 1NP0A 3VC6A 2PEVA 5LKYA 3NZGA 3DC8A 3W1QA 5CG0A 2XZ7A 3ZJ8A 1HFBA 2G4JA 4RUBA 2W63A 2VL4A 2WM1A 4K1WA 1AG1O 4ZFCA 1GOKA 5KITA 1OD0A 4IOTA 4QX4A 1PHWA 1UH3A 1LOLA 2BWGA 3NM3A 2ZZ3A 4ADUA 3A4AA 4FPSA 2Y88A 1YNPA 3E02A 3QHMA 3TAOA 4O11A 4FAMA 4WRHA 4N6EA 3W70A 4RCXA 4A05A 2J7HA 2ACUA 3W23A 4NASA 1EJVC 4IGMA 2ATMA 1M65A 2J9YA 2FKPA 4JCMA 5DMMA 5G1YA 2A3EA 2BVYA 4JYEA 4MYAA 2L5HA 3L0NA 1KW1A 1YE6A 1UD8A 3NSXA 3NUKA 3CO8A 3GXMA 3L4YA 2Z28A 3ARVA 5AHEA 3LV6A 3LS9A 4GZIA 1WCGA 2ZYFA 2X8RA 5LIKX 4JFVA 2WJDA 3B03A 4AF0B 4EPDC 2G0WA 1HT6A 2NLIA 5FJIA 3GTNA 1VLIA 4G7EA 3KXQA 3L67A 4PUUA 2IKJA 1JEZA 1I60A 3ALFA 4U3CA 3W38A 1GHSA 3BW4A 1NTHA 5D09A 5JUVA 4O15A 4QNWA 4AD3A 3FAWA 3ALGA 2X0SA 2OEMA 1S5MA 3KTCA 1ZY9A 4C7DA 3HQOA 3ECQA 3PHAA 4YWSA 3EOOA 4UQEA 1GG0A 2BY1A 4DI8A 5J8LA 4NVTA 1O66A 1J0HA 1EC8A 1BYBA 1CLXA 2NQZA 1X39A 3MUAA 3GD6A 3S6TA 2PLJA 5D02A 3PUDA 1C8QA 3ZO9A 3CIXA 3FKRA 3IARA 5C7VA 4NRSA 4HGXA 4UTLA 4NZ3A 1D8WA 3PBWA 1B3OA 2E40A 3H24A 2DZPA 1M5WA 3B97A 4AC7C 3K1DA 1V0LA 2FQIA 1Q6RA 3EGJA 1XC6A 2OWCA 4KGLA 2ZUSA 5CPSA 1DJZA 3I6EA 1FWAC 5I06A 5KSWA 3M5VA 5CC3A 4NAFA 3WL0A 1KLZA 3E5PA 3MO7A 1Q7ZA 3PZTA 2J27A 3DBPA 5BCAA 1AK5A 2Y7DA 1DTNA 3FDKA 1EC9A 3W4RA 3PTQA 3M41A 1QNQA 2PCQA 3W1MA 4DN1A 4XAZA 1BSIA 4WY0B 2XGBA 4IL2A 4EKJA 2GK1B 1U5VA 4ZENA 3H6OA 3NEVA 1W9UA 3NVDA 3WFAA 3T1GA 2CLEA 3WSUA 1DXEA 1PWMA 1H7WA 4UZUA 3W2MA 3WUEA 1VZWA 4GG9A 1PKMA 3DKLA 1V02E 1SFLA 4XVEA 3V75A 3CO4A 2G8ZA 1W9DM 4U3AA 1PCKA 1IWAA 2ZDRA 4Y9PA 2HTMA 2W66A 3U4FA 1F3WA 3OA3A 4DUWA 5K7JA 3M16A 3PUGA 2PUZA 5CC7A 2BHUA 4HMEA 4K39A 4K6AA 3CUHA 3JVAA 3TROA 3PAJA 3RXZA 3GU1A 1JXJA 3EWUA 1V6WA 1VYRA 2R91A 1Q6CA 3TU9A 3EDFA 4DJEC 4D6EA 1H7RA 1KGXA 1J0IA 1EEPA 3G1HA 4GK8A 1UKPA 1KBLA 5C2XA 3WCZA 1EBHA 1J18A 1FXPA 3CQKA 2VKZG 4HN8A 2CZVA 5A1AA 1R9ZA 4C6OA 3I3EA 2JF6A 3TJIA 3HMCA 3K5XA 1L6FA 2YKKA 4Q8UA 3T55A 5XIAA 1Q4WA 4GXWA 1TPB1 3BURA 5FCZA 2QPXA 1JYVA 1NSJA 3ERPA 1X8CA 4RW3A 3F5JA 3CZEA 3WNKA 1OT2A 1ZPTA 1XYAA 5TIMA 3SQSA 1H49A 1PL9A 3VD4A 2ZRZA 2J7EA 4GY0A 3GQYA 3C61A 4PRTA 1XLBA 1HTIA 1SW0A 1F73A 4BZYA 1QWKA 3UCQA 4QHRA 4F0MA 1XBZA 4UR8A 1US3A 2B7QA 1JJKA 3W88A 3DESA 1CB7B 4LS1A 4MFEA 3SIMA 4EK7A 3NCOA 2FGLA 2NQLA 2FFCA 4P8WA 1MMFA 2AL2A 4NL1A 1XGZA 3W72A 3T05A 4BHYA 2YL8A 2HCVA 4TU1A 1ITCA 1SZEA 1GQIA 4BEQA 5AC8A 1O5RA 3GBEA 4KWOA 1H62A 2P8BA 3DI1A 3R6IA 2Q02A 3RO8A 4JTJA 3P8IA 1PUDA 5IDIA 4HZ6A 1U83A 1POJA 1UW9A 1GKQA 4YN5A 4K8EA 1NIUA 4MKVA 1G7UA 2GQ9A 1I9CB 4N9DA 1WA3A 1E73M 4I6KA 4JIPA 3RPMA 4N42A 4LCSA 1X97A 4DWDA 4HHHA 4FNRA 1BVNP 2O4MA 4DHGA 2V3FA 1B1YA 2GVEA 2E6YA 4AYGA 3SCNA 4AWTA 5G1MA 1UWTA 1V6TA 4WEVX 1T8XA 5AYZA 3ARTA 3UZ5A 3ARQA 3NA8A 3T6CA 1E0XA 7CGTA 2B31A 4GJIA 2AL1A 3IVUA 3KP0A 3LBOA 1W3KA 4RNIA 3THQA 3N19B 1X6UA 4JQ2A 1D3CA 3G22A 3CUZA 3LU2A 4M24A 4B9YA 1XIIA 3JU2A 1CCWB 5KZDA 3VIHA 5TF0A 1E0VA 3M0YA 2NUYA 4AEEA 3WUFA 4HYVA 1CW2A 3UA3A 2CERA 4XZIA 1YQ2A 1EWDA 1UKSA 2SFPA 4RE4A 3L4WA 4O54A 4J27A 1YDYA 1ZAIA 4HVXA 3UZXA 3RMEA 1OBAA 1IEVA 4LOCA 1EDTA 2YLAA 2OR2A 3KVKA 1G7VA 1P0KA 5ABTA 3KBJA 4Z2JA 3P14A 1H51A 4DF2A 1TV4A 2YSWA 1KRBC 3AYRA 1DWIM 3PTMA 4MUZA 3BJSA 3N73A 4IGNA 1K77A 5G4EA 4HKPA 1M7XA 3RR4A 4L1WA 4PCTA 1XBXA 4GX8A 1D3HA 2Q8XA 3M44A 1GNXA 1XG4A 2G3NA 3E38A 4G1NA 1GQJA 4CU6A 3AIBA 3DN5A 3FDGA 4KCWA 4LRSA 1SPQA 1BQCA 3OQEA 1BFNA 1MFVA 4JQ1A 5BWFA 4PMNA 2WZEA 4XWUA 4ZQPA 3S5YA 1YXCA 1T5AA 3GNXA 4J2PA 1W1YA 1L6GA 2C1GA 4FNQA 2FGBA 4PRRA 2P3ZA 3N3TA 1UOZA 2ICSA 1S5TA 2IXVA 2VEMA 3B0UX 4O0ZA 3MMTA 2TMDA 3A6OA 1FHUA 3E2VA 4S3FA 4ZO7A 2GSEA 1VJIA 1GW9A 2XM2A 3VGBA 4CD5A 2D22A 4LVAA 4PE8A 3BLKA 1EQPA 5E0CA 1TJRA 1QUMA 2PLCA 3MW7A 4KWUA 5FACA 3DHUA 1J2WA 4AMAA 1PBGA 1VFHA 2I5QA 4IQLA 1QAPA 2WZMA 4GBDA 1OFEA 2OVLA 3NZQA 1IIGA 6XIAA 3W7GA 5REQB 4BQ3A 3GH4A 1OX4A 2E9LA 3C4UA 3SUVA 2PC8A 2YW3A 3KCLA 1P43A 4Q8MA 5CSSA 5AHNA 2J66A 3NOYA 1RCOB 1FX6A 2IPFA 1M53A 3VK5A 1XYMA 3CPRA 2YOCA 3NOEA 4FNSA 3FJNA 3P8JA 5A6MA 2NXIA 1DJHA 3T2QA 5EL1A 5BRPA 1T6MA 1BGAA 3GS6A 2XVKA 4BWLC 1W1VA