3OU8A

The crystal structure of adenosine deaminase from pseudomonas aeruginosa
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
313
structure length
313
Chain Sequence
b'YEWLNALPKAELHLHLEGTLEPELLFALAERNRIALPWNDVETLRKAYAFNNLQEFLDLYYAGADVLRTEQDFYDLTWAYLQKCKAQNVVHVEPFFDPQTHTDRGIPFEVVLAGIRAALRDGEKLLGIRHGLILSFLRHLSEEQAQKTLDQALPFRDAFIAVGLDSSEVGHPPSKFQRVFDRARSEGFLTVAHAGEEGPPEYIWEALDLLKVERIDHGVRAFEDERLMRRLIDEQIPLTVCPLSNTKLCVFDDMSQHTILDMLERGVKVTVNSDDPAYFGGYVTENFHALQQSLGMTEEQARRLAQNSLDARL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Adenosine deaminase
publication title The crystal structure of adenosine deaminase from Pseudomonas aeruginosa
rcsb
source organism Pseudomonas aeruginosa
molecule tags Hydrolase
total genus 124
structure length 313
sequence length 313
chains with identical sequence B
ec nomenclature ec 3.5.4.2: Adenine deaminase.
pdb deposition date 2010-09-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00962 A_deaminase Adenosine/AMP deaminase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.140 Alpha Beta Alpha-Beta Barrel TIM Barrel Metal-dependent hydrolases 3ou8A00
4H00A 2AQOA 4GY0A 4LAKA 4C6PA 3TN3A 2O4QA 4XAYA 4B91A 4LAOA 2Y1HA 3A4JA 3PNZA 2PAJA 4GX9A 3LU2A 3OJGA 4DLMA 3OODA 4ERAA 3RCMA 1FKXA 4RDWA 2R1PA 4H9ZA 4I6KA 4C6OA 4C6DA 4PCNA 3QY8A 2EG6A 3F2BA 2VR2A 3SO7A 2VC5A 4DO7A 2VM8A 1A5LC 4C65A 2R1NA 4NI8A 3HPAA 4EP8C 2GWNA 4C6BA 4IF2A 4XD6A 1EF2A 4M51A 4F0LA 4DNMA 1GKRA 2HNHA 3TN6A 1PB0A 2PGFA 5CH9A 2YZ5A 4JOMA 1UMLA 4CNUA 3DUGA 2I9UA 2FVKA 2AQVA 1V7AA 3GU1A 4GYFA 4C6MA 1ITUA 3TN5A 5E5CA 2PUZA 2OGJA 3IPWA 3OQEA 2PGRA 3RN6A 4XD3A 4G7EA 1A5OC 2DVUA 3IRSA 3DC8A 3WMLA 4PCPA 3IARA 2YB1A 4LEFA 4LAMA 3A3XA 3C86A 2XIOA 1XRFA 2PLMA 4UB9A 4HK5A 3UPMA 2BB0A 4C6EA 3T81A 3AU6A 3T8LA 4H9UA 4KETA 2Z00A 3UF9A 3CS2A 1V79A 3IGHX 4C6KA 4IH3A 1EJVC 1FKWA 1POJA 5AKQA 5HMDA 4QS6A 4RDVA 3K2GA 4CNSA 4IG2A 2ICSA 2FVMA 4QRNA 2VHLA 2R1LA 4R88A 3GTFA 4QROA 4V1YA 1RK6A 1M68A 1RJRA 4R7WA 1UIOA 1JGMA 4XAZA 4QTGA 1FWHC 2D2JA 2F6KA 2QT3A 3HM7A 4J2MA 1KRAC 1J6PA 1RAKA 4C6FA 1P6CA 2AMXA 3IJ6A 2UBPC 3MSRA 3LSBA 2VUNA 1ONWA 4LALA 4C5ZA 3ISIX 3LS9A 1KRMA 3SFWA 4H01A 1EJRC 2GZXA 1RK5A 1V77A 4H9VA 4G7EB 1RA5A 1YMYA 4QSFA 1GKPA 4C6CA 3GTXA 4B92A 4J5NA 4LANA 2Z4GA 4GY7A 3FEQA 3B40A 1K1DA 1K6WA 1BF6A 2KAUC 3GUWA 2WJDA 4HK6A 2BGNE 3PNUA 2Z2AA 1ZZMA 3FDKA 1NDVA 2FFIA 3UR5A 2ANUA 3TN4A 2O4MA 2P50A 1M7JA 3NEHA 3LY0A 1A4MA 4AC7C 1J5SA 4KEUA 4RE0A 1WXZA 1M65A 4GX8A 4B3ZA 1A4LA 2Z27A 4F0RA 3TNBA 4L9XA 1EZ2A 3RYSA 4C6LA 2DVTA 1QXLA 5HMFA 2R1MA 3S4TA 4BY3A 1UBPC 3A3WA 3GU9A 4NG3A 3QY6A 5G4HC 4PBFA 2HQAA 3D6NA 4C6QA 4BKNA 2HBVA 4C6IA 2E1WA 1FWIC 3O7UA 3HTWA 3MKVA 1A5KC 1EJXC 3E38A 1POKA 1YRRA 1P6BA 1S3TC 4ZSUA 2GSEA 3MDUA 4HJWA 4EPKA 3K5XA 2FTWA 2Q01A 1NDWA 1EJTC 4IFKA 1W1IE 4CQBA 3DCPA 2Z24A 2GOKA 4GOAA 3GIQA 3OVGA 1ITQA 2QS8A 3K4WA 3N2CA 4DZIA 1I0DA 2Z26A 3LGDA 5FSDC 4KESA 1YBQA 4DI8A 4C6JA 1GKQA 1NDZA 4C5YA 1RJPA 5A6TC 3RHGA 4D8LA 4F0SA 2OOFA 2Z29A 2EG7A 1NFGA 1PO9A 3PAOA 3ICJA 1V4YA 3S2NA 1R9ZA 4MUPA 3WYZA 1YNYA 4ERGA 3PANA 1HZYA 3URBA 4WGXA 3V7PA 2ADAA 4ZSTA 4G2DA 2Z28A 4J35A 3MTWA 3IACA 4GXWA 1KRCC 3PBMA 4XAFA 4ERIA 3FDGA 3WZ0E 3MJMA 3URQA 3OU8A 1P1MA 3GU2A 4H9XA 4OFCA 4C60A 3UBPC 3MPGA 2QVNA 5FSEC 1FWGC 1FWCC 4EPEC 3MDWA 1FWBC 1QW7A 2ZC1A 1O12A 4C6NA 1EJWC 4IFKB 4DIAA 1RA0A 2OQLA 4IGMA 3EWDA 4EPDC 1FWEC 3F2DA 4EPBC 2FTYA 4I6VA 2A3LA 2WJEA 4LCSA 3F2CA 4YIWA 1I0BA 1YBQB 1IE7C 1FWAC 1PTAA 3R0DA 4XD4A 4IG2B 1A5NC 3MVIA 1YIXA 1RJQA 4IFRA 3OOQA 2D2GA 4IFOA 4LCRA 3ID7A 2QPXA 3ORWA 3CJPA 3O0FA 1XWYA 4H9YA 4LCQA 2IMRA 3F4CA 3E74A 3URAA 1A5MC 2CZVA 4ICMA 1XRTA 2D2HA 3GRIA 1E9YB 3LA4A 4XAGA 3T1GA 4LH8A 2WJFA 2VC7A 2Q09A 2Z25A 5HMEA 4H9TA 3KM8A 4QS5A 2I5GA 3BE7A 1K70A 3EWCA 2HBXA 2HPIA 4PBEA 2G3FA 4PE8A 3B0YA 2UZ9A 4INFA 4TQTA 4GY1A 3LSCA 4WVXA 3F4DA 4BJHA 5LXXA 3MVTA 4V1XA 1O5RA 2HPMA 4WHBA 4KF1A 3B0XA 2Z7GA 3QGKC 3AUOA 4KERA 1FWFC 3AU2A 4KEVA 3LGGA 1KRBC 4NP7A 4L6DA 4RDYA 4AQLA 3LNPA 1J79A 4IQJA 4RDZA 4CNTA 4B90A 3URNA 1FWDC 2EG8A 3GTIA 3CAKA 2R1KA 2WM1A 1WXYA 1EYWA 2E25A 2W9MA 4UBPC 3S2MA 4Z42C 4GZ7A 1J6OA 4CEUC 4CQCA 4DYKA 4CEXC 1E9ZB 1V51A 2P53A 3ITCA 4E3TA 4DLFA 1ADDA 3NQBA 4GK8A 4IGNA 4KIRA 3QGAC 4KQNA 4RZBA 4GC3A 1R9XA 4HK7A 4CQDA 3GIPA 1PSCA 4H9MA 4HA0A 2RAGA 3QY7A 3E3HA 3S2LA 3EGJA 2YB4A 1KCXA 1UIPA 1VFLA 3NURA 1R9YA 4XD5A 1NDYA 3GTHA 2DVXA 3E0FA 3E0LA 3E2VA 3S2JA 1FWJC 4GBDA 3IV8A 2OODA 2Z2BA 4DZHA 4DI9A 3JZEA 2GWGA 1ONXA 1XGEA 4P5UA 4R85A 4LFYA 4KEZA 1DPMA 3UR2A 2YXOA 3G77A 3GG7A 2OB3A 1EJUC 1EJSC
chains in the Genus database with same CATH superfamily
4LPCA 3W25A 1VFMA 2I57A 3ITGA 1VCVA 4GQGA 2AQOA 1LLOA 4AY1A 5FF7A 3MP4A 1SO4A 4X0VA 2DV0A 3S42A 4JFTA 3SR7A 3CM4A 1FFRA 4BHYA 2OGYA 4G7FA 4AD2A 1F2JA 2EHHA 1E0VA 2QIIA 3MC5A 5M17A 1X7IA 3ME3A 2Z1KA 2HVOA 2VC5A 3CWHA 3O2LA 3SECA 2F7FA 3WKZA 4EP8C 1B4EA 1OFQA 4IISA 4NAEB 1XLCA 3QQWA 3MZNA 4WIWA 4FLQA 4A21A 4JOMA 4HYWA 3RMJA 1SR9A 4P7OA 1HO4A 1BYCA 1O5QA 3WLNA 4Q4KA 4CUCA 3EKZA 1NM9A 5CKSA 3MUAA 1O5XA 3WQCA 9XIAA 3WJZA 4C6MA 1VC4A 3GR4A 1P1XA 4L1WA 4CNNA 4F0HA 2CYGA 4I7VA 1WDWA 1IZCA 1ZCCA 3OP2A 3B8WA 4HK5A 4IX2A 4LOCA 2SFPA 2WK2A 2J6XA 3I3BA 1AL8A 4JICA 3TP4A 4D72A 1R0MA 1BKSA 2FHBA 2ISFA 2B7QA 1OX4B 1XYLA 1R85A 4OZOA 3KP0A 3M0IA 3FGCA 1F3XA 1GTEA 3MY9A 7REQB 4IG2A 4FOJA 4R88A 3CAVA 2D24A 3VC6A 4DO5A 2R94A 5PTDA 4JTAA 1HJWA 4REQA 4JFWA 3VCCA 1QDSA 3T6CA 1UR0A 4HN8A 4WR3A 1GCYA 1XSJA 5AC7A 1ZLPA 1ZAJA 2XG9A 3PZUA 5LZLA 2JK2A 4POCA 3CAQA 4ZA0A 1TMLA 3GTXA 5GJMA 2AL2A 4LANA 4A3HA 1J10A 1FP8A 3LOTA 1Q6OA 5M3WA 2DT1A 1KM1A 5D38A 3GUWA 3ONCA 2IKIA 3GDLA 3LCGA 1NWRA 3FDKA 3WD4A 3AOFA 2E9BA 4ZTXA 3QPEA 2XJ7A 1XH2A 3RNDA 1RQEA 4O0KA 1JFXA 3WBEA 4KEUA 1SQ7A 1KFBA 2FPTA 3WQOA 3GXIA 3TTOA 3UWWA 4FNTA 3C8NA 3N17A 4BEQA 4FA3A 4F0KA 4JTFA 3GU9A 2X16A 2IUZA 5AZ0A 1OSEA 2OT1A 1AG1O 4GC4A 2PRHA 1GTHA 1OD0A 3K8KA 3HTWA 4BS0A 1CXEA 3LNMA 4ZQNA 2QJNA 1P0BA 4EWND 1S3TC 1R8LA 3Q58A 4MUZA 3TYEA 4KGJA 5C5YA 3RILA 1XUZA 1JCTA 3VUSA 1ZJHA 2VZVA 4UXDA 4NI3A 1NDWA 5FOOA 1JZ5A 3GFZA 1EL3A 3NM1A 5AFDA 1GQKA 5RUBA 2D22A 1U1UA 4KESA 5AYIA 3FJNA 3VKKA 4AISA 2YA1A 4YWSA 4PMDA 3UYCA 5A6TC 3RHGA 2Z29A 2EG7A 1EGMA 5HUOA 2QVHA 5DBTA 2ZUMA 4TXEA 4LSBA 4GISA 3P3BA 2V67A 1ADOA 3MU7A 4ZSTA 4G2DA 1IT8A 2YL9A 4H83A 1B9ZA 4DJED 3PZQA 2Q3RA 2ABAA 2YDQA 5KZMA 4GO8A 4YS1A 2VDIA 2VGBA 3PAJA 1HIZA 1IR2A 4XSMA 1L9WA 1QW7A 2DT0A 4O13A 3WNOA 4OOZA 4IGMA 4I9AA 5HA7A 3CQIA 4W7WA 4A35A 1W9BM 1OG6A 1TVPA 3KRUA 2WNQA 1F6PA 2W0UA 3S9ZA 2HS8A 5CG7A 4DYJA 1SSGA 3CWOX 3VGBA 4R34A 4NNAA 3AJXA 4LCQA 3AXXA 3ZVIA 4ORIA 2PD5A 1LTDA 4AMAA 2IXVA 2D2HA 3IGXA 1XC4A 3LN3A 3RPDA 3CV7A 3NVDA 1NFBA 5IBXC 5FCZA 2HBXA 2QCFA 1QTWA 4PBEA 3AYTA 4NT0A 1QRQA 5A6LA 1ZAIA 2B0MA 5GJNA 5BWAA 1XCFA 3HPXA 6ALDA 1PVNA 2FGBA 3ARSA 3TFCA 1YTEA 2Z7GA 3BVJA 5KSWA 1JQXA 3MT1A 3AU2A 2BY3A 5FJIA 3R0KA 1IEXA 1XDMA 1RBLA 3UQNA 3MQTA 1S5MA 2VXNA 1J79A 6PTDA 1E5NA 4B90A 3GBEA 3ZVHB 2B4GA 4UTFA 1OF8A 1TSIA 2DUZA 3CZLA 2OU4A 3FOKA 3WN6A 2VVNA 3WL1A 4DLFA 3LEPA 1XYMA 3ZS4A 4IGNA 1XBZA 2XH4A 2PDKA 3GH5A 2PDNA 1SM9A 5HNTA 5AHLA 3VOHA 2Z1BA 3W70A 1L2UA 3RO8A 3WF0A 4GFSA 3NURA 1R9YA 4HT3A 1LWIA 1P6WA 3UWZA 4GBDA 4ES4A 1UB3A 3IV8A 5EGRA 3ANUA 5L9FA 2GQ8A 4CGTA 3PUEA 3VE7A 2PTZA 1B3OA 3WH5A 1EWDA 2V3EA 1TWSA 4QJ4B 3W86A 2NLIA 4P2VA 1XV8A 1ECEA 4MM1A 2P8BA 3UR7A 2V5BA 1EUAA 5TF0A 3W1QA 4QE5A 3LU2A 5HMSA 1NP0A 2D2OA 3R13A 2YDRA 4HGXA 3TYCA 3F2BA 3EOSA 3SO7A 1W54A 2QZRA 1A0EA 4I7WA 1A5LC 3V0UA 4F0MA 4ADSA 3BAXA 3CT2A 2O7SA 4B4HA 3TQ0A 4Z08A 5I3FA 4MJMA 3WLTA 1WNOA 3R8GA 1UWRA 4O4WA 4DNMA 1LORA 1JZ8A 3G0XA 4AG0A 5CH9A 1O7AA 1QI0A 1S2VA 2I7GA 1UMLA 4AHQA 4CD7A 2H9AA 2MANA 1VBGA 3T0BA 3OA3A 4N9DA 1TFVA 3L4TA 1SJBA 3AMLA 3EWYA 3VNLA 1YNPA 3KCOA 2XSXA 4RV8A 3BOXA 2HRWA 4NZFA 3M0ZA 4RNIA 1A5OC 4YTUA 3MJYA 4LEFA 1QBAA 2XIOA 3QSTA 3W24A 3RXZA 6XIAA 3CQJA 1Q4NX 1R7OA 2V5KA 4WGHA 1KM4A 4LC8A 3S9IA 1AA1B 2BVDA 4IH3A 4ZQMA 1EJVC 1L2QA 5FJRA 2WO5A 1Z48A 1DJQA 1GYMA 3W74A 2Y8KA 4UTTA 2ZXAA 3MSGA 2OCZA 2ZX9A 6TIMA 1BG4A 1OD8A 2O56A 4S3KA 3U2OA 3RG6A 4Z1DA 1NF7A 4UUIA 3XIMA 4AD3A 3ISIX 4D6EA 2DJXA 1WQ5A 4LUSB 1F76A 5EMMA 4CD8A 3EB2A 2GZXA 1UKPA 5U7SA 1MSSA 3WUBA 3UY7A 2PDQA 2OZ8A 3BAWA 1MZHA 3UR8A 4KMQA 4UZSA 4GCXA 5HQMA 4ZENA 4UTWC 2BVWA 4GUGA 4MNMA 1C8XA 8RUCA 2BLEA 4A2RA 3FVDA 4LY8A 3WEZA 2FZNA 4HU3A 5KZEA 3P5YA 4AC7C 4PULA 4YNGA 3M5VA 4AD5A 1KCKA 2OX4A 2DVTA 4PC8A 4S3BA 3CWNA 2OYMA 3A4XA 4M3PA 2JALA 3CUJA 4NNBA 1JYVA 3B03A 1OYBA 2Z1SA 4ZSUA 7TAAA 3TROA 4UTLA 3VCNA 2WLYA 4HJWA 1JAEA 5EB8A 1E73M 2GQAA 3H2FA 5DXYA 1A50A 1KBJA 4R53A 2YFNA 2PEVA 3RX4A 1CLKA 3IAPA 1YBQA 2DZAA 1TO3A 1R7AA 3WD2A 3MSYA 3NQMA 3M41A 2ZFAA 1RHCA 2PDFA 3PB2A 1PX3A 1V4YA 4NF7A 2GQ3A 3QHMA 2QDDA 4B2DD 1YPIA 3VNKA 1ISVA 4ERGA 3OBEA 3WLKX 2PBGA 1RLCL 4WGXA 1CWYA 4XZIA 2XZ7A 3MTWA 1OQFA 3DHUA 1O60A 3PFRA 2CZ5A 2Z0IA 1WKDA 4H9XA 2YSWA 3ABZA 4HA3A 1BGGA 3E12A 2WC4A 4Q8PA 1FWCC 4HYRA 5DY3A 1W9DM 2JIWA 3M5XA 1QJWA 1S2WA 3MWCA 3OGSA 1PX4A 1QNRA 4I6VA 3C3NA 1V6XA 3QEZA 2ZZ2A 4DAFA 1O6IA 1Q8AA 5HQEA 1YW1A 5TD4A 2F2KA 3P2VA 1FWAC 2I56A 4Z1AA 1Q66A 3SIZA 1P0EA 2D2GA 5D9MA 1JZ3A 1S5TA 4HQVA 3OZPA 4GUFA 2IMRA 3HQNA 3H2NA 1FA2A 3VKAA 4QE4A 4S3JA 1VJSA 4H8HA 3GNNA 3W1AA 4I9JA 4XAGA 8TIMA 3T1GA 3QZAA 4O0QA 1EC7A 4B3KA 3WQGA 2GK1B 1W1B1 1M3UA 3SUVA 1H4PA 3NQ6A 4LJ3A 5CSYA 1I9CB 1KQZA 2FPYA 3JVAA 1F7BA 4L6HA 4PTDA 3LSCA 1W1ZA 4A3QA 1EWEA 3PG8A 5JIPA 1U1HA 1MEWA 4AIOA 4AZHA 1NOWA 5D2YA 4Z2IA 2IXUA 3FEMA 1I4NA 1NY1A 4GO9A 3GUGA 2IW0A 4N2YA 3PK7A 5HJLA 1W3LA 4FXSA 4OJYA 2QJMA 2VGGA 3KUMA 2R1KA 4XWUA 4M7SA 3BCDA 1J6OA 1OWQA 6ENLA 4P7NA 1P7TB 3R11A 1HXJA 2FPVA 3MO7A 1OFRA 5DMLA 3ERPA 3QFEA 3VI2A 5A2BA 1XLKA 4GI8A 2B7OA 2PLKA 3QVQA 4UMAA 1BPLB 3EA3A 3W83A 1CBGA 2XPKA 3MO4A 1TZ9A 1GW1A 1UIPA 1QHPA 3LHVA 5TNVA 3VM7A 2PWGA 1IZJA 4HIBA 2NVDA 2EPMX 1Z44A 3G0UA 4IMAA 1UJQA 3ZJ6A 1E43A 4AZCB 3BW3A 3OVRA 3NDZA 4DI9A 1BYDA 2W6RA 1TRDA 3I3DA 4LFYA 4KEZA 1LP6A 5HAOA 2FZ9A 2YGYA 1MVYA 3WFZA 3FYYA 2GVGA 1TV5A 4LUJA 1AJ2A 3D5HA 3LHUA 1JJKA 3ATZA 2PAJA 2C7FA 1UD3A 1ESWA 2Y89A 4N9EA 4LS0A 3QHNA 3TZNA 2A1YA 3WSUA 1OZQA 1GVSA 5AC4A 1PZ0A 3VFLA 1V02A 3CUGA 1E3ZA 3FSTA 1W1A1 3TW7A 3A5VA 5DCDA 1RPXA 2HJPA 4P7RA 4J28A 1VYSX 4A29A 3VVGA 4XD6A 4A8IA 1OG0A 3N6JA 3HPZA 2V81A 3OYZA 1KM0A 1MUMA 1DORA 3DI1A 3U7VA 3W7MA 3GDBA 4E8CA 1GOOA 1AD1A 2P10A 3U57A 5JBFA 1CGXA 3ES7A 1S46A 3KE0A 4H4IA 4LWWA 2ON3A 1Q7MA 2C1GA 5EL1A 5A1AA 3LLDA 3TIMA 3O9NA 1Q6CA 4AD1A 3GIYA 1XRFA 2A6NA 1C29A 1JDEA 1V03A 1B3WA 2VOTA 2VUYA 1RCXB 3WF4A 2NXHA 3TOYA 2Y7GA 4DWSD 4GVHA 4AX7A 3KHJA 2ZRUA 3GHTA 2V8ZA 1XLIA 1BRLB 1KA9F 3GTFA 1M68A 1GEQA 1HKJA 1M7OA 4WY0A 1PZ3A 3KL3A 3CHDA 4DJFA 1QI5A 4U33A 1P6CA 4M81A 4NU7A 2PI6A 1DKWA 1Z6KA 2VO5A 1US0A 4LALA 2J9XA 1SR0A 1KRMA 3QR1A 4FNRA 1GZ1A 5ABEA 2OEKA 5HNUA 4HN4A 4S3FA 1Z69A 3W71A 1E4MM 2VOMA 4HVXA 2Y7DA 5JBEA 3U2ZA 3UWEA 5JIWA 3QZEA 4CU6A 1QNQA 2DPEA 1RV8A 1JI2A 3RM4A 3WDHA 2J25A 2CU0A 5EMJA 1ZPTA 3UR5A 4E2VA 1ME9A 4WJXA 1QPOA 1A4MA 3V0SA 4HHPA 2BASA 4K38A 2WHLA 1TG7A 4GX8A 1HJXA 3WLJA 1AW5A 1SFJA 4YCOA 1XBVA 3N4FA 5HMFA 1FHVA 3FCPA 1UBPC 5A8OA 2W63A 4RE4A 4ZVJA 3UY8A 1MDRA 4C6IA 2CLHA 5GNXA 5E9XA 1W91A 4W85A 3VE9A 2WV8A 5HK4A 1UW9A 1DE5A 3UZJA 2VX7A 1EXBA 4GIEA 5BRQA 5A8MA 3TYZA 3K5XA 1UP0A 4BQ5A 2I17A 2QCLA 1WDQA 2VZUA 3H7UA 2GGEA 1OEPA 1X7FA 3T2QA 3VGHA 5I5RA 2VVSA 4KCUA 1SJCA 3ZR6A 4YTRA 3LLXA 5CPTA 4L4LA 1VEMA 4XV0A 4Q6XA 3SCOA 4PB5A 2WLZA 3WQWA 2NXIA 1W5MA 1VFTA 2WBGA 3I4KA 5MKGA 3ARXA 3VIGA 3ZQ9A 6XIMA 3W9ZA 1XL9A 4OU1A 1PCWA 1OFPA 3ALFA 1QBBA 1O1HA 2ADAA 1C8QA 3BURA 2ZZ4A 5BCAA 3ITYA 3MUIA 4JAWA 4XAFA 4JKLA 3TSDA 3AHVA 5IHRA 3ZJ7A 4TX8A 2V9DA 4U31A 1OYAA 4XKMA 2A79A 3TTEA 3SJNA 3E2RA 2ZC1A 4I9MA 3GNOA 1O12A 3BSHA 3T05A 1FWEC 3QPYA 4DBEA 1B54A 3A9IA 4NJJA 3F2CA 2WZMA 2CHNA 2F9RA 3LQLA 3ZT7A 1LG1A 4LF1A 4XIMA 4JIIX 5D02A 3P81A 1KBIA 3WMBA 2CBIA 1UKOA 2QCEA 3A47A 1OFAA 1XWYA 4JCLA 1A5MC 1BVNP 1NWUA 3GRIA 1K7XA 2C16A 3BJSA 4P8WA 5CZJA 1K7EA 2NXGA 3F5JA 4HSNA 3KM8A 3ABXA 2GPTA 1Q6EA 3N3TA 4ORMA 3SADA 4JL1A 4UTHA 3M6YA 4RXFA 5C9ZA 2XN2A 4KW2A 2HE8A 2DQWA 1CECA 3ELFA 2HPMA 1E0WA 2TMDA 4LVDA 3AYRA 3QTGA 1P0DA 1FTXA 4JTKA 2QEZA 3S6OA 4A05A 3AO0A 1JCLA 5DCEA 5J5DA 4GZ7A 4DYKA 1MW1A 2V5LA 4OV4A 1E1CA 4DBWA 4ROPA 2XU2A 3E96A 3NL5A 3WLIA 1K8YA 3BXWA 5ECVA 2PDPA 4GWEA 1RY0A 4NHVA 4XUYA 3DXIA 5K7JA 4NZ5A 4MJZA 4RL3A 5BMWA 4OUEA 1OC7A 1MW3A 4JTGA 3V5OA 2EO7A 1TTPA 6A3HA 1RD6A 2I5IA 3GTHA 3IJIA 3CH0A 4QXIA 3HO8A 3M64A 3GVQA 3IJQA 2EJ1A 3EOLA 1O94A 3G8EA 4RE2A 5LIXX 3GYEA 2I1OA 3N2TA 3ZJ8A 3G77A 2J47A 1EJSC 3QMTA 3OEXA 1E6ZA 1GJUA 1KB3A 2GQ9A 2YLLA 5F4XA 2Y8VA 4GNJA 4IXHA 2FIQA 1PKMA 4KRTA 1PZ1A 5FAGA 4RDWA 2X1SA 1X1ZA 2DW6A 2E5BA 3RK8A 3V5CA 1XIMA 3VM5A 4DO7A 3UXAA 2R1NA 4NI8A 3E2QA 3W01A 3AXKA 4YJ5A 3SCQA 5BRPA 1BXCA 3ZT6A 3SN1A 3NFUA 1A80A 2PGFA 4IP7A 2DORA 1EEXA 3EMZA 3WQVA 1A49A 3G24A 3WFAA 1IR1A 2VFIA 2D0FA 4Q8UA 3DKJA 2OGJA 3WJXA 4AZBA 3M0MA 4AFYA 3PTKA 3AUJA 2DVUA 1ZFJA 3AIVA 3EEZA 3KDOA 3N15A 4O1BA 4DJEA 1TUFA 3HZ3A 1OADA 3UGRA 3IEBA 3LZ3A 4OHQA 1BTMA 1EP1A 4B5VA 3T81A 1XYFA 2VTFA 1KFLA 2HE5A 2EAWA 2ZBTA 4DJDC 2CBUA 1TPVA 4O17A 1WBHA 4RZ5A 2ZUWA 4TVUA 3KVLA 3L0NA 4RDVA 5DBUA 3W7QA 4E38A 1GZGA 1H09A 3AIWA 3U4FA 3M0JA 4GUIA 5E0CA 4WSHA 2J79A 3N14A 5ABFB 1TE6A 5K4ZA 3AIBA 2F6XA 4Q7NA 2GVEA 1WKYA 3USBA 2H9AB 4GYKA 4RW5A 2NV2A 3BPWA 7ENLA 4EOUA 2W91A 4NIRA 1B1YA 1EJRC 5CC7A 1GK8A 3UJRA 2ACSA 4LF2A 3SB0A 4NZJA 3GKAA 3TYUA 2VD9A 1YMYA 1YE6A 4UNLA 1WXJA 3QW3A 4GIRA 1HP5A 1KXVA 1Q6GA 2CEQA 2HTMA 3Q2DA 3Q65A 3GWQA 4ROQA 4FALA 3CYVA 1KFWA 3U7BA 3PPGA 3CMGA 3N12A 2P50A 1TKKA 5I3DA 3W22A 4J1OA 3AAMA 1PHQA 2WOQA 3A4AA 3BSGA 4LUTB 4H8UA 2FQIA 4O54A 2XM2A 1P5BA 3WQFA 5LKYA 4OBSA 1F3EA 1KFEA 4QDWA 4JKKA 3EMCA 3QMSA 3NQDA 1NWTA 2OSXA 1HL8A 4BI7A 2J7HA 4AC1X 4PMVA 5DMMA 3EPOA 4LVBA 3HPFA 8XIMA 1CX9A 3R1ZA 2NX3A 4XB3A 3PPHA 2WMIB 1UPPA 5M03A 4L4OA 3IVUA 4PZVA 2E6AA 5JH2A 3SN4A 2V38A 3KBSA 4HCHA 2JEPA 1FP9A 1K3UA 2ZZ6A 1JZ2A 2FTWA 2Q01A 5HNNA 1FCBA 1NP2A 1NOFA 1SZGA 1HP4A 2A3CA 5C55A 3BGJA 3GQYA 4K1GA 4XZLX 1KTBA 3SCVA 5K4XA 3WH9A 1I8JA 3FJ6A 4QCEA 2Z26A 3WDIA 5REQB 3D47A 1OGSA 3U6WA 1EDGA 3LCHA 5AOUA 4IPIA 4LV9A 1XLEA 4IP4A 1JEZA 4JQ1A 5CJMA 4ZGYA 3ITXA 4RZ6A 3PP7A 4MUPA 4GZEA 5DFAA 3TC7A 4Z2GA 3B9EA 3R58A 3URBA 1IWBA 2HROA 1XPYA 3ARWA 1P4CA 2VEFA 1V5XA 1J2WA 3ARUA 4DF2A 1HJVA 1HL2A 1R3TA 3VZXA 1DQWA 1WAUA 3PTQA 3FDGA 2ZX6A 3F5LA 2V3DA 9CGTA 3LYEA 3VNIA 4EPEC 2CCRA 5GVJA 4MZYA 4JL2A 1RA0A 8XIAA 5JQ9A 1OM0A 5I09A 4ATLA 2A3LA 2VEPA 3DHPA 2OMAA 4EIVA 1TMQA 3B8VA 1YBQB 1TWWA 1DHPA 3W87A 3AHZA 1UZ4A 1RH9A 3W88A 2C3ZA 3RMEA 3VDGA 3KOWA 3ZFHA 3ID7A 5AN7A 2YCJA 3TX9A 4JX5A 1IGWA 4B5XA 2C71A 4C7GA 2CZVA 1EBHA 2VFHA 2B31A 1DIKA 4M8UA 3T9PA 2FLIA 4UFJA 4XO6A 2PRLA 4PMZA 1KCZA 1K70A 1IF2A 3K46A 4Q7BA 3WBWA 2GJNA 2G3FA 1YDYA 3VKCA 1BHGA 3TK7A 4NZ3A 3SCSA 4JTLA 3AIUA 2X0YA 2ZZ3A 4OTKA 3VGEA 4J4KA 4IQDA 4ZOEA 1DWIM 2WANA 2VR4A 5KITA 3PBVA 2WPGA 3LGEA 2VZOA 1KWGA 2QPSA 3SBFA 3LNPA 5C0QA 2Y7EA 4HZ7A 1EUNA 1FY6A 2XSBA 3H2OA 3NXFA 2CZFA 2GOUA 3LZ5A 4Y90A 3GXTA 1D8WA 2X0HA 2WKGA 4PODA 5M1TA 3WK0A 1LZOA 1TPWA 2WHKA 1XLJA 4HK7A 4TR9A 1AZ1A 3WEOA 1GG1A 2RAGA 1GQJA 1B2YA 5G1YA 2NW0A 3VK5A 1CXHA 3UJEA 3EX3A 2QCDA 4EACA 1NFPA 4D6HA 5HJXA 4FLRA 3GAYA 1VS1A 2OODA 1JD9A 3KOZA 2CPUA 1KNWA 4FHAA 4ASTA 2O9PA 1RSCA 3N11A 1V0MA 2E9LA 1DPMA 4KCTA 3KL0A 3GG7A 5D30A 1G4EA 3OLIA 4HA4A 1XW8A 1GYLA 1EZWA 2OLSA 2EKGA 3JZUA 5U4NA 4ZEPA 3PNZA 3ITTA 1G01A 1ADSA 3PZOA 5LNSA 5MF5A 3OJGA 4DLMA 4E8DA 3OODA 1BFNA 1TQJA 3BQ5A 4B5TA 1QI4A 4MY8A 3GNPA 5KZDA 4Z0SA 3P82A 2XTKA 4IIBA 3WBXA 4E8GA 2JKEA 2QDGA 4ZXOA 3LHZA 3P6LA 3E6EA 1VP5A 1F8IA 2HNHA 1PB0A 3DEQA 5HINA 5G2WA 1L6FA 3UZZA 2FB3A 1TELA 4BR1A 4CNUA 5I3IA 1RCOB 3N34A 2Y2WA 4B2DA 2OSWA 2AQVA 3AIEA 3QFWA 3VCRA 1HKVA 1EHAA 2XSAA 3EZ4A 1IEQA 4MWAA 3OQEA 4DXVA 1IEWA 1P48A 3B8UA 1MWOA 2J78A 1JPHA 4G7EA 2V0TA 1NELA 2IKHA 2Y0FA 2IKGA 3RIKA 3CZ8A 4GYPC 1KM5A 5DMYA 3DU0A 4JDBA 4PGLA 2X8RA 2ZXQA 2XGIA 4YHGA 2C15A 3TW9A 3EWZA 4DJDD 3WLOA 2G3MA 1A0DA 7CGTA 4MOZA 1XJBA 2Z00A 1S5WA 2OPJA 3TSMA 3QM3A 4QFUA 5FD0A 3TR9A 1O66A 2V5DA 3S5ZA 1XGZA 3RUBL 3BMXA 1UC5A 2PZ0A 4HMNA 2CZDA 4ZE4A 3BZGA 1QK2A 1K7FA 1XF0A 3EX1A 3MCOA 4C6FA 4UQEA 3IJ6A 3NQFA 4PRRA 2UBPC 3IGUA 1AK5A 5GPRA 4IPLA 3LS9A 5BW6A 4O53A 2VEKA 2FKPA 5H6HA 3SGUA 4GFIA 5ABTA 1JR1A 3E5PA 3VOCA 3AYSA 3KL5A 3PR2A 4Z0JA 4PYSA 2X7WA 2G50A 2R82A 1Z8AA 4IZGA 3WUFA 3KTSA 3V1HA 1XSKA 3IJ9A 3IUDA 4Z1CA 3U3HA 1ZZMA 5EPDA 3H2MA 3RLHA 5FL1A 2YDAA 3O6DA 3AS0A 4E2OA 1K02A 3GC4A 1M7JA 4JD4A 3CU2A 1X1NA 3THDA 2HSAA 1GORA 4L5ZA 1WXZA 4MVAA 1U5VA 4LVGA 2ZX5A 4D6JA 4NAFA 2Y5EA 4ZFMA 4IL2A 2DJLA 1EZ2A 1UKSA 4JCMA 1I2QA 3V18A 4C6LA 5DN1A 1PJ9A 3WFLA 5CEWA 1WOBA 3KS6A 1DJHA 5BNKA 2OEMA 3VYLA 1F07A 1TPH1 4BKNA 2G96A 3VAVA 4LNCA 3O7UA 1NOUA 3BARA 2DIKA 3QYSA 3Q94A 3U9IA 4WSJA 2EF9A 4FNUA 1U33A 3WIJA 4HPJA 2GSEA 3M0XA 5C2XA 3BG3A 4F9DA 3VDCA 1TUXA 3LPFA 3PWGA 4IPPA 1KBLA 1K9TA 2GOKA 3KCLA 4AY7A 3S1GA 1FHUA 1TTIA 4FIQA 3T44A 4HP5A 2PTYA 1ZAHA 4L6OA 1TZ7A 1WA3A 5D09A 2DGAA 4DBSA 1R2TA 3S1WA 1ALDA 1CB2A 1QNSA 2D73A 3NGJA 2VKZG 3QPZA 2VURA 1YNYA 4G1NA 3PANA 2H3BA 3NGFA 4B5SA 3W1NA 4WUIA 2VX6A 4JTSA 2A6LA 3V7PA 3N2XA 4NAEA 4HD5A 2Z28A 4J35A 1UH4A 4GXWA 4LUYA 1JGIA 3LMZA 1MRQA 3OU8A 4GA8A 1LYXA 4YHEA 3W7HA 2V30A 4NRRA 4MPQA 1FWBC 1C93A 4C6NA 1PXGA 1LBFA 1UD8A 4DIAA 2TPSA 3GR7A 3UNTA 3LDVA 3RRXA 4LCSA 1MW2A 1GOXA 1E51A 3VDHA 2PPGA 1QATA 1MW0A 2OG9A 1GJPA 1US3A 3R0DA 4XD4A 5A8GA 3W0KA 2PC4A 4LYKA 1R3WA 2BZNA 2G4JA 5HR7A 4CQAA 4LCRA 3WMCA 1V7YA 1BKHA 4CU7A 1EB3A 3M0LA 3CQ0A 1AODA 5MKGB 1NQ6A 4DWSA 1QPQA 1X39A 4PCFA 1B3YA 3AYVA 2NQLA 3DECA 3BZJA 3ITVA 4GQ0A 2CLEA 3UXIA 3NUKA 5HPCA 5BU9A 1JI1A 1D3GA 1W9XA 1LWHA 3EWCA 3VNJA 3DIPA 1W1VA 4YCPA 4CNPA 2AAAA 1A5BA 3QN3A 1XDJA 4TQTA 4JZ5A 4ACYA 2RKXA 3S3GA 2WZTA 3QHOA 3TJLA 3W6YA 1TPDA 3G3DA 3TA6A 4IGHA 3A23A 1L8NA 2D1ZA 4GG9A 1KRBC 3LHTA 4NP7A 1JDCA 5C71A 1XBYA 4Z42C 1L0PA 2I9EA 4CQCA 5IFPA 2YXXA 1I6NA 2CXEA 1DP0A 3PZTA 4JTDA 4Q4PA 3NYZA 3QKEA 4GC3A 3GHUA 5DRIA 3PC0A 4YYFA 2QJIA 5DLCA 4GABA 3HQ1A 2CLPA 3LRMA 1KGWA 3D3AA 2YB4A 3GXDA 4ZTYA 3ATYA 2NZLA 1IWAA 2YCIX 4AMCA 2ZUSA 2DVXA 2OSYA 3SCTA 2FFCA 2Z6IA 5C2CA 2ALDA 3LBCA 2O0TA 2NUWA 1OBAA 1H7XA 1VLIA 1YEYA 4GJ1A 1MDLA 1LM1A 1QAPA 2PDMA 5I2UA 4FR1A 4H00A 4C6PA 1IXNA 3C0JA 1KXQA 1RUSA 1PTDA 3NQAA 3B06A 4ERAA 2DW7A 1UR1A 1YXCA 4WSKA 1E1CB 5EFDA 4PCNA 1MUCA 2ISVA 3CPRA 1NH6A 3I6EA 4C65A 3N4EA 5DT7A 1KV5A 2XUCA 3H4WA 2YL8A 4IXXA 3HFYA 4PL1A 4GIYA 3CMFA 3OVQA 5ABHA 1ML1A 4YTSA 1QHZA 3V1PA 1HVQA 4GNVA 1BF2A 4I5RA 1AQHA 1J01A 4A4AA 4UFKA 1MNSA 4XD3A 1O1ZA 1CYGA 1H63A 2YBVA 4H3DA 3TMQA 2WMFA 1M7PA 1Z3NA 4J3ZA 4XISA 4M6QA 4Y9MA 4ZB2A 1A0CA 3TLQA 2JFEX 3JS3A 3PVFA 5LGXA 1MQPA 2OJPA 3N2BA 3FJ4A 4G9PA 3QOKA 2V3FA 4MNJA 1VJZA 4EE9A 3BJTA 3R7MA 1CGTA 4L4MA 3DZ1A 4MTVA 1T7LA 1KBKA 3VGGA 1DJIA 4JFVA 4UOJA 2R1LA 4HNOA 3VILA 3EB3A 3NQ8A 2YOCA 4KEMA 1JDAA 1EYEA 4J2MA 1XIDA 2ZUUA 3CZJA 3E0WA 3NSNA 4DY1A 1H7PA 4FF5A 1DJWA 5BU6A 3IUHA 3T42A 2VUNA 2V6AA 1K03A 1RZMA 2BTMA 4HCDA 1RK5A 4GI9A 2R6OA 5L6UA 3AICA 4QSFA 2YDSA 2C13A 1GOKA 5CGTA 4XK2A 4C1LA 3AIRA 4JFSA 3M0VA 3WO8A 1Q85A 4IUGA 2Q8XA 4NQ1A 5C2GA 1J0IA 4Y9NA 5CPMA 4W7VA 5JBDA 3R79A 1XDLA 2ZTJA 3VOJA 3H4XA 4N9BA 3DH7A 3ZVHA 2VT0A 4RZ4A 1R5YA 3TV8A 1FFQA 2PP3A 4GNKB 3W1TA 4JBRA 3RPTA 4Y9AA 1UZHA 3KBVA 1GEHA 4WLCA 2KX9A 5EMKA 1YQ2A 3CUZA 3CO8A 5D37A 2V2HA 2ZICA 1W3KA 2ZRYA 1FWIC 4KT2A 1E3XA 3FAXA 4YVVA 3E38A 2FDMA 4JTIA 3LI1A 4PR4A 2G3IA 3UCDA 1GVQA 5E1QA 3VFCA 4H04A 1UR8A 2OYKA 1J0JA 4PMNA 4X9SA 1H62A 1HF6A 2EPLX 4CQBA 1OT1A 1P0NA 5I7GA 5CPNA 3LPOA 3B0UX 2W4XA 4PUDA 1JYNA 3G22A 4PSPA 4QAIA 2OKOA 3UZ5A 3MB9A 4GIAA 5BXTA 2QAPA 3B9DA 4PA8A 3GDMA 5FJPA 1GKQA 3AALA 4MKSA 4IMDA 3BAYA 4G56A 3VIIA 2GGHA 1PS9A 2ZXDA 1WX0A 3WDQA 1B4KA 2XM1A 3RO6A 1DV7A 1LOQA 1R30A 4MHBA 3K4AA 3CHVA 1PIGA 3C8FA 5AYXA 3IGSA 3HIJA 2Q02A 4M5PA 5AHEA 2NQZA 1YPXA 1W37A 2DSWA 4S2CA 1SW7A 3F5KA 3M9YA 2GGJA 3GU2A 4OFCA 3U2EA 3MPGA 1SMAA 1Q7ZA 3R5EA 2D0GA 4FX7A 1N55A 2D23A 1M9HA 2F6UA 3A3HA 2OQLA 1RBAA 4IOTA 2ZYFA 4JEJA 2G41A 3NTYA 3ZLHA 4FZIA 2WMKA 1PTAA 1YIXA 3CIXA 2HCVA 1Q6RA 2W61A 4IFOA 2PWEA 1G67A 1OCBA 2Q3OA 4KCWA 3CJPA 2TYSA 1QW8A 2PS2A 2VQUA 2FZDA 3E74A 1P43A 3APYA 3QR0A 1LDCA 1HL9A 2E1DA 8CGTA 2I14A 2YX0A 3TFXA 3SQSA 2VC7A 3G1YA 4DPPA 1HNYA 4GINA 3OG3A 3E1F1 4NXSA 3LHYA 1ZBCA 2GJXB 3WL0A 3T2PA 1DE6A 4RPQA 3NCOA 4GY1A 3L5LA 1V08A 1XM3A 4WHBA 4KF1A 4LUSA 4ENLA 2OLAA 3DG6A 1VR6A 5D2TA 1J18A 1AQMA 3QV6A 4GGBA 3W7CA 1F6YA 4LRSA 1KLZA 4D6FA 1EYWA 2ZVIA 2DZUA 2HISA 3THAA 1MEIA 3GXFA 1PPIA 3S2CA 1V0NA 1DWAM 3AS2A 4LW7A 2D3LA 1XQKA 4KQNA 3KFTA 3ZO9A 5C9RA 3MV11 3CV1A 3EDJA 3PBGA 1CZ1A 3VINA 1C3FA 1PZ2A 3W72A 4DEFA 5CC5A 2QIWA 1SPQA 4EX4A 4Q4RA 4XD5A 1V3HA 4JTJA 3E0FA 3AMKA 4UOZA 1R86A 4DZHA 4DUVA 4HCLA 4GHRA 4US5D 2DZSA 1XGEA 2PDIA 2E5CA 3MHFA 1XIHA 5B7ZA 3PF3A 4FNQA 1W3NA 4PUUA 4B91A 4XAYA 1ZQ5A 3G6MA 2Y1HA 3H2CA 1KXHA 4PMUA 3TH6A 2NT0A 2PWVA 4JQ3A 4KWOA 3H53A 3LTSA 4V28A 3MP5A 4Z2HA 3GS6A 3WF1A 1F6KA 4KFNA 2PF0A 1DHKA 4UFIA 2O55A 3PHAA 2PDWA 1E4NA 1FWSA 3H2EA 1T96A 3L2IA 3LERA 4G5DA 2Z1XA 3UPBA 2QCDB 3WMSA 4CCZA 4EXQA 4YMZA 1Q6LA 4WXZA 2Z6JA 3GU1A 1OC5A 1ITXA 4ZQRA 3ABQA 5IOBA 4RJEA 4CD5A 4WXYA 4ALDA 4JN8A 1QOXA 2RJHA 4WJ8A 3IARA 4XVEA 1GHSA 4UQDA 2ZWZA 3U5UA 4KWWA 1UR4A 3GK0A 1OFEA 3IIOA 2Q6ZA 3FX4A 4JTEA 3WNLA 2CKSA 3TW6A 2WM0A 1F73A 1H7RA 5I6SA 3SZ8A 1GW9A 5C9UA 3WCZA 3TZFA 2C79A 4K7YA 4PUMA 3TYDA 1RJRA 1JGMA 3ITOA 4XAZA 4EANA 3NDYA 3VIPA 1D8CA 1HGWA 2F6KA 2W3ZA 2PWHA 4H7ZA 1VD6A 1ZHAA 3NWRA 1RAKA 1UA3A 2IPFA 1RR2A 3P14A 4FMVA 6CGTA 2ISSA 1M7XA 2ZUTA 3S83A 1VYRA 2XVLA 5EY5A 2WCGA 1GOWA 1K4GA 3OZYA 4G7EB 2ONEA 1SFLA 3DG7A 1A53A 1GKPA 4Q8QA 3W27A 3ZWTA 2VCCA 4J5NA 1H51A 2Y63A 3Q45A 4MMWA 3RAOA 5DX7A 1VFSA 1K1DA 4H6QA 1FQ0A 4FOKA 5JMUA 1UWSA 4AEFA 3AFBA 5CC3A 2YR1A 2OQYA 2A0NA 4W8LA 2FMOA 4BA0A 3EXSA 3WX7A 1K9EA 3DENA 4DO6A 3BAKA 1PWMA 4IIFA 4PTMA 2Z27A 4QGCA 3BSMA 3WY1A 1QXLA 5J5RA 4MZ8A 1V6UA 3QY6A 2CLKA 5F2GA 1LLWA 1VPQA 1U22A 4W7UA 1F61A 4LYRA 2QMJA 2XFWA 1XLLA 3MUXA 4LY4A 3LHWA 1AMYA 4Z2KA 3T40A 3PFMA 3BAIA 4O19A 4AZCA 2C1IA 4U10A 1EJTC 3NPWA 3DCPA 3WQ6A 1TVNA 5BOEA 1M41A 3N6HA 3E02A 3MMUA 3WJYA 3BMVA 1TCDA 4TV6A 1V6TA 1PCKA 1YPFA 4DI8A 3GC2A 4PMXA 4C5YA 3SSZA 5D9NA 3CUIA 4UNKA 3PZGA 4DBDA 3S8HA 3DGBA 3PTMA 1V8EA 3S2NA 3RPMA 1C92A 2GUBA 1HZYA 4JPGA 5CAKA 3VIJA 5D9PA 1J0KA 3UYIA 3E9AA 1EX1A 3B9AA 5A8PA 4QLJA 3N9RA 1W3HA 1I75A 5IHSA 2C19A 1VZWA 1J0HA 2C1HA 4Q8TA 3DFSA 5AECA 2VWSA 2ZA2A 4F2BA 3PN8A 4P8UA 4AYGA 1MXDA 1OCNA 4KKXA 3T78A 4MYAA 3PY2A 4E5TA 2GUUA 3TWBA 3M5ZA 4RK8A 4BZYA 3UXLA 5KETA 2VI0A 3O6YX 4EPDC 1YXDA 4JYEA 1FHDA 4EPBC 2Y5SA 2ACQA 4X0NA 3T08A 3G1HA 4LTSA 5BROA 4UOQA 3MZ2A 5FF0A 2DUXA 3GZ3A 4W8AA 2CLLA 1C91A 3I7RA 5IDZA 2ZE0A 4NJHA 1SFTA 1WZLA 1ODZA 1HG3A 2DU2A 4QHRA 1WKFA 3LQGA 4DJDA 1OGBA 3AMGA 1BRLA 1S2TA 2NWSA 1OC6A 2DZXA 4WRHA 5A8NA 2WVUA 4H2HA 2QULA 5G5IA 4JY8A 4ILSA 3WNPA 2NT1A 2RDWA 5DANA 4NRSA 4UCGA 4WVXA 4BJHA 5I77A 3P0XA 3P5ZA 1JDDA 1NJJA 1G7VA 2HNEA 3H12A 3L4VA 4PCTA 5EBAA 3OQ8A 4MF4A 3PM6A 2REQB 2HVMA 3HV9A 3LRKA 2EG8A 3O0KA 3UESA 3NQ7A 4W87A 1JYXA 4EVZA 3SRDA 1EO5A 4AVFA 4GVGA 1T40A 3NQEA 4GK8A 4KIRA 1VBRA 3B9NA 4Q8NA 3S5NA 3HMJG 4M6UA 3CYJA 4DWSB 4AXNA 1DQUA 2Y70A 1QW9A 2YA0A 4IHCA 3LPGA 1UCWA 4J40A 5EMLA 4GUHA 5DO8A 1OF6A 1ZGDA 3APGA 3TONA 1C90A 4AZGA 4BWLA 1EOMA 3BGAA 1IIGA 2OO0A 3HPSA 2JQXA 3PBYA 1CDGA 5CGQA 4K68A 1WAWA 3A64A 4QSHA 4AUBA 4NASA 3KCJA 2E6FA 2G4FA 3KAOA 1B5TA 3P67A 2YW3A 4K2SA 2O4QA 2PWFA 3A4JA 4IL0A 4QLLA 3F4NA 4D6IA 2HMCA 9XIMA 4ZODA 1O5KA 4O50A 3AC0A 3BL3A 3FJLA 1G4SA 1GOQA 3GDTA 3F4WA 4JGDA 4G1KA 4C6DA 3T4CA 4F4RA 3A6OA 1E15A 1UD5A 4DWDA 2VM8A 1XBXA 4WX2A 3CB3A 4PUKA 1BWVA 4Z1BA 1VGAA 3VKBA 1DTUA 3QYQA 5D2VA 3G1AA 5I79A 4ZZ9A 5CSRA 4PTXA 3ZSTA 4F40A 1K9DA 2G95A 4LS1A 1R3VA 4HNLA 1K77A 3DERA 1WOAA 5E5CA 1W5QA 3HQOA 3W7PA 1IXOA 3G2GA 3B04A 3OZOA 4PCPA 2FZBA 5H8PA 2ZVRA 3C86A 2V63A 4AAJA 3MV01 3DFOA 3CV2A 1SZRA 4ZMGA 3UPMA 1KTNA 1QK0A 4F2TA 1XLFA 2W66A 2WSKA 4H9UA 3PG9A 3FN9A 2QCCA 1R47A 2OYLA 5F1VA 4IT1A 5HMDA 1V6WA 4AU0A 1PKNA 5I3KA 5KINA 2J75A 1KKRA 1UIOA 5LA2A 4DVOA 4TMBA 4B3LA 1H0IA 1Q4WA 3E2SA 5EMUA 2FHFA 2H6RA 3HG4A 3MKCA 1W9VA 1QNOA 3LRLA 1BVWA 3LSBA 3W2UA 1VAHA 1T8QA 4HZ6A 3KBWA 2PCQA 2ZWYA 3LCIA 5CSSA 3HFTA 4N6EA 3K1GA 4H9VA 1RA5A 1ZP3A 4ICNA 4MAZA 3GY1A 1Y5WA 2I5QA 4PTWA 3WUEA 2Z1VA 2R91A 3USZA 2VD8A 3QJAA 3W2KA 1V3MA 4QJ1A 3GHSA 1S3HA 1KXTA 1UZDA 3KTCA 4MPKA 5LSMA 5FEZA 2BX7A 3TJIA 2Z2AA 3WDPP 2J9ZA 3P8IA 1JYWA 1U83A 2FFIA 4Z1YA 4QDMA 4W8BA 2O4MA 1TV2A 3TOPA 1AQ0A 3BC9A 1TB3A 3FHAA 3WF2A 4RE0A 5EA9A 4C1NA 1BAGA 4URIA 1GZJA 5A6MA 1KKOA 1GHRA 5D8WA 1E1FA 1PE1A 1GONA 2B81A 4PBFA 2E5DA 1Z9AA 4L65A 3HB9A 5I06A 3RCNA 3NA8A 4R7OA 1EJXC 2NUXA 3GXMA 5FF2A 3CL7A 3L5AA 1JUKA 2YPIA 3GTNA 4LYQA 4IFKA 1W1IE 2BP1A 2VFDA 4AD4A 4DELA 3PTDA 1F05A 5I24A 4UTJA 4MDPA 2XIBA 2PP0A 1E40A 1HJUA 4AEOA 3OTRA 4ZOCA 5D2WA 4C6JA 5HWJA 1DIDA 1YE4A 1GOMA 4D8LA 1RCQA 1CW2A 3R12A 5CPSA 5DELA 4HMCA 4Q4MA 4HSHA 3BCFA 1JXJA 3THUA 4K37A 4M19A 2EEXA 1UWAA 4K39A 5AYYA 3ABRA 2NVCA 4FR6A 2EJAA 2JBMA 4M1BA 4XSLA 5FJUA 4AD0A 1CNVA 1HW6A 3BG5A 2BFGA 5A6KA 1LOLA 3AXHA 1UR2A 4QDPA 3IVSA 2J7DA 3NOYA 1B0IA 3WG6A 2XFFA 4TO8A 2GDUA 2A5HA 3FS2A 4YWIA 3XINA 5ECUA 2ZRVA 1VF8A 4NJGA 3AZTA 3POCA 5BZAA 1A3XA 4K8GA 4S2BA 4Z2LA 3U4AA 2PCEA 1LQ0A 1V02E 2BSLA 4AYSA 2GGGA 3KOFA 3NG3A 3EOOA 3WK2A 2ZUVA 1NU5A 1HKKA 1A5NC 3DFHA 5H8UA 2XIIA 2UY2A 2OEJA 3G18A 5DY2A 1F4HA 1LLZA 1IV8A 4L80A 2EPOA 3VOFA 4Q8MA 4AIUA 1JCMP 1OFOA 4IJRA 4J3WA 4LC6A 1MEHA 3UCCA 4U4MA 5ABFA 1JVNA 2MUCA 2YXGA 1T6MA 1UHVA 1XIEA 3JW7A 4JTRA 3O16A 4Z2JA 4NSBA 2BOGX 4IICA 2DIJA 2GDVA 1TTQA 3CPUA 3T0TA 2XVGA 1MFVA 1BTCA 4R33A 4M6VA 3S5YA 3AUOA 2W62A 2W79A 1VEOA 3EBVA 3HN3A 3B0VC 3LD5A 5LNUA 4IQJA 1OFBA 3KVKA 2VEMA 4CEUC 1N7KA 3LXCA 3B8DA 3UWVA 1YTKA 4FAMA 5BYWA 1X38A 4JNYA 1U1JA 3DFNA 2AGTA 4CQDA 2D0HA 4KRZA 1OFDA 3CB8A 3KX6A 4LUTA 5TBOA 4P8VA 2VL4A 2PLJA 5FEXA 2CLOA 3O8AA 2E7FA 2QUUA 1WCGA 3F1QA 2QXWA 1WZKA 2POTA 4HHLA 2YYTA 5HATA 2O9RA 3W7JA 2INZA 4LYPA 4UFHA 1C9WA 2WMIA 3P7YA 1ONXA 4V1YA 3FYOA 5C7HA 1R3SA 1GQNA 2WNNA 3TN3A 4WY0F 5H91A 1QCWA 3I10A 4J2PA 1LRTA 2X1RA 3S1UA 2UV8G 3WQEA 4H19A 5T26A 1Q2SA 2J74A 1GPFA 3D3FA 3G1FA 3BOFA 1S2CA 4DJFC 4I90A 1VCGA 5I78A 5REQA 4LAUA 1VPXA 3ABOA 2RDTA 2WBKA 1LL4A 4J27A 2J7FA 1C7SA 3CLWA 4IF2A 1UMYA 3MI3A 3TN6A 3P84A 5CZKA 2R24A 4L4PA 2YZ5A 4L7ZA 3EDFA 2I9UA 1VHCA 3UWYA 3L4YA 2W67A 4GYFA 2RGMA 4WDWA 4UCFA 3TTQA 2GYIA 1YX1A 4B15A 2EPHA 2WHMA 1WDSA 4HPXA 1CEOA 2ASHA 3UG3A 4IMCA 4I8YA 3IS4A 3UVIA 3AU6A 4JQ4A 3FV9A 3PZMA 2NUYA 4UTIA 3LPPA 1VKFA 2CWNA 1V79A 3GD6A 4ZE5A 3QKZA 3KS5A 5DRCA 4TVCA 1RQHA 2ICSA 1OJXA 3UG8A 2FZ8A 2IKJA 1ONEA 1P0KA 5CLTA 1FH7A 3MMTA 2CHOA 4C91A 2DZWA 5FESA 3DHFA 1KRAC 4MIMA 2WMJA 2AMXA 3M0KA 1TPC1 4PUJA 3VOGA 2UY3A 4C5ZA 3HBLA 3STGA 3TNOA 1FWRA 1TYGA 1HVXA 1XH0A 2INFA 3K8LA 3VZZA 3WNMA 4C90A 1GVYA 2BGSA 3V0TA 4WD0A 3WK3A 3BV7A 2QJGA 1PUDA 4C7FA 2ABBA 1K6WA 1A5AA 1TPEA 3BV4A 1OB0A 2KAUC 3AHYA 2WJDA 1RQBA 2CFFA 2YIHA 3QZ6A 2CWXA 4EKJA 4GE8A 4MJ4A 3VIHA 4L1XA 3GNRA 2RH9A 3GX9A 1HKWA 1XYZA 2DT3A 1V93A 5E0KA 3TR2A 1A4LA 4L9XA 3P62A 2R1MA 3S4TA 3BDKA 5IFTA 4NG3A 5A6SA 1QR7A 3DN5A 4JY9A 2HS6A 1WYIA 3VD5A 5J8LA 4P7LA 5C54A 1YLVA 2VP8A 4LU0A 4N0RA 3ARQA 3N1AA 1W8GA 4KFPA 4O12A 4L64A 2ZOXA 4FNSA 2ISDA 1H41A 3W53A 2VELA 3T0AA 5AHNA 4PFMA 4MB5A 3PWAA 2A2IA 1ICSA 5EU9A 1SFSA 4RW3A 4OV9A 4D6CA 1LUCA 2G0WA 4MB3A 4US5A 1UWQA 2JE8A 5GJPA 1RP9A 7A3HA 1N82A 3WJSA 4K8HA 1W0MA 3GO2A 2HEJA 3KHDA 4N42A 2QUMA 4UTKA 1EXPA 4BF9A 1TR9A 3SUUA 3S5OA 1OK6A 3OG2A 3RJYA 3C2YA 3IK2A 1XKJA 2BDQA 1B90A 4JQAA 1RBOB 4X61A 4PB3A 4XO7A 3N18A 3PBMA 4QAWA 3AXIA 1CXFA 2IS7A 2TRSA 2DY3A 4ZXLA 1TPFA 3E5BA 4D1JA 1SO5A 2ACUA 4NJIA 4UR9A 1Q6DA 1UASA 1I45A 4GZIA 1OCQA 2BOEX 4CU8A 1M6JA 4CVUA 3NZQA 1E9LA 3FAWA 2PRMA 4W5UA 1Q7QA 1UZ1A 3OOQA 3N29A 3VIOA 3FA5A 4FXJA 5AVHA 3O0FA 2P0IA 3CTTA 3L4UA 3SQLA 2TSYA 4NKCA 4ICMA 3WH6A 4CCCA 3CC1A 4OBRA 3UZXA 2CBJA 4LH8A 4BQ3A 4HMEA 3AJ7A 3ZYZA 4HBKA 3V16A 1W9UA 4KFOA 1R87A 4KWVA 5F2IA 2FB2A 3B3DA 1Q3NA 3KVMA 3QV7A 3FK4A 3PBWA 1NEYA 4E4FA 4GH3A 2QJJA 4Y8FA 3W37A 1E6NA 3T7VA 1ZCOA 1VLWA 1C7TA 1XD0A 3FXYA 4FXRA 1TZZA 3H7RA 3TE9A 1QPNA 3GDRA 1ENUA 3NPXA 5CBJA 1LRNA 3T55A 4EWJA 2PDXA 4ZB5A 2VENA 3WD0A 2DIEA 4L9YA 4E3TA 4RLIA 4HZ8A 3CZGA 1Q13A 3NNTA 3B8TA 1AUSL 3FA4A 4YTQA 4HA0A 2NV9A 4O8AA 3G1XA 2BODX 3MUY1 1ZJAA 3HMCA 4DJEC 1ZBKA 3BLPX 4PUWA 1MMFA 3T09A 1MI3A 4N02A 2Y4SA 4GRSA 3MANA 2NVAA 3E2VA 3NO3A 4M82A 4D2JA 3MYPA 2Z2BA 2VFGA 2J6VA 4XKYA 5FAJA 2OWWA 4AHOA 3JZEA 3PUGA 4LEQA 5A8QA 1KGUA 3SDOA 4W84A 1SYTA 4R27A 1L6YA 3TVAA 4TIMA 2GJPA 1XYCA 4A3RA 2VZTA 4AVNA 5D33A 4WZHA 4J3TA 3L5MA 2VRQA 3SCNA 3N73A 3V5FA 3I4EA 2HXTA 4I6KA 3ARZA 3NL2A 1E70M 3HG2A 4FX8A 4J3VA 5FF4A 2VR2A 1BG9A 2PZNA 3KRSA 2OWCA 2XVKA 3OHMB 1XLMA 5AY7A 5FJOA 3TWAA 4H6EA 2P1FA 4F0LA 2B7NA 5CZ0A 5LNVA 4RKAA 4OUIA 1XCXA 3LM3A 1JULA 2HDJA 2Y88A 3DFPA 1BQGA 4JX6A 4BQ2A 4MB1A 4F48A 1BVZA 2JKAA 1UP2A 3DX5A 1LT8A 1N2VA 1YKWA 2OLHA 2ZADA 2WSYA 3I7SA 4UB9A 4AZ5A 1H11A 4WOZA 1DL3A 2EPKX 4FB7A 5HNRA 1S1RA 2VFFA 3ZR5A 4RNHA 1MRAA 4JXCA 3B4UA 1L6WA 2WW5A 1WP6A 3W2LA 2PTXA 1FKWA 1CPUA 2YLAA 3K2GA 3SGGA 4QIUA 3D0CA 1BLIA 1ZJBA 2VDHA 1YDNA 1AW2A 2H3DA 1RK6A 4QP0A 4R7WA 3EB4A 5CPOA 1AJZA 3HG3A 3AS1A 4ZO8A 2QT3A 3W2NA 5F2MA 3H6OA 3VKJA 3O06A 4UQBA 3I68A 3JUGA 1DXEA 4NVTA 3C2VA 3GFXA 4EAYA 2PSNA 1OVDA 3H54A 3VABA 2QLYA 1PIFA 1J5TA 3RR4A 5LNWA 4O10A 5G1TA 3OGVA 4QG9A 1BF6A 3S9YA 1O95A 3FNDA 2DSKA 3WLSA 3AMDA 5CC6A 4AB4A 2G8ZA 3CGTA 2OOGA 2XINA 2NSXA 4JNZA 4JIHA 2OKTA 4QM1A 2H8ZA 4ZBCA 1Y5XA 1W2PA 4Y6GA 1NARA 4JTUA 4Q3MA 1UBSA 1F4AA 3IANA 3AWNA 1GJWA 5GQBA 1OCJA 3KOYA 3EA1A 3LXBA 1ZY9A 1KFCA 2F61A 3L66A 4W4QA 3D6NA 1A3HA 3BLKA 4FOUA 4PRWA 4UMBA 3AZSA 4WCJA 3CQKA 4H8NA 1A5KC 1TWIA 1POKA 2WAGA 2WZHA 5LHFA 2OZ3A 3TCSA 3BLLA 3QF0A 3LXAA 1H50A 4Q4SA 3IAQA 3TYAA 4E2DA 2PWDA 3PJUA 2GSJA 3VNMA 1HKMA 4NZ4A 3TUUA 5CZTA 3U2CA 3N2CA 1I0DA 2PODA 1S2UA 2VWTA 3UG4A 3KLLA 3SN0A 3L2LA 3NSMA 2QMKA 3NQ2A 2Y85A 4F0SA 1MO0A 3QSRA 4AIBA 1UKQA 4C1NB 4I5XA 4MG4A 1R9ZA 4OQVA 1E6RA 1GQIA 2J24A 4UIOA 2B7PA 1E1EA 5B80A 5CG0A 1I1XA 4KWSA 2IQ0A 3VNZA 1GT8A 2P76A 1IWPA 4GI6A 2X7VA 2E67A 3WZ0E 4S1FA 3W1MA 1X1OA 3EX6A 3SCWA 3BLOA 2YA2A 4IFKB 4W93A 3NXLA 2NQHA 3EWDA 1EKOA 3LV5A 3LMYA 1ZBVA 3MW7A 1OABA 3JR2A 4F3HA 1EDTA 5GNZA 2X1UA 3GYCA 2Z1WA 5I3JA 3SY8A 2QHAA 2Q8LA 1DWJM 4CD4A 4H9YA 1EA0A 2A7RA 4U28A 2WWCA 4WF7A 4TTGA 3VUPA 3GW3A 5G2HA 4OGZA 1CGVA 1SVDA 2PU1A 3NPVA 4MWAE 2Z25A 1ZS2A 3L12A 3BG9A 4LV4A 4V27A 3CPGA 4UFMA 1EPVA 2XGZA 5XIMA 3SJ3A 4YN5A 4BCEA 5LXXA 2O92A 2P0OA 1LOSA 3OIHA 5LIKX 1IXQA 4GVIA 3O3RA 2J77A 3I65A 4ECLA 1ISZA 2J66A 4GI4A 1JUEA 4QCFA 1QI2A 4AQLA 4FPSA 4U3AA 3SCPA 4RDZA 1E6XM 3GVGA 1FWDC 3M7WA 2ZIDA 3GTIA 3UXKA 3TAOA 4MFEA 3MSDA 1E9ZB 1V51A 4O1DA 1FH8A 1J93A 2PDCA 1VH7A 2CNCA 2JGQA 2PA6A 4HYVA 5F4WA 2E09A 4MWAC 4HHMA 3GIPA 2DSZA 3UJFA 4YYCA 1FWTA 1BXNA 1JPKA 5KZ6A 3EGJA 1JG9A 3VZYA 5HBFA 4MLJA 2YKKA 9RUBA 1WBJA 5DEZA 4O1CA 2QUTA 1AQFA 1I1WA 1UROA 2WYSA 1YDOA 2BY2A 1XFBA 1OIFA 4CQ9A 1SW0A 2YL6A 1ZNNA 3POHA 2QGHA 1UA7A 2VDGA 3L4XA 5EKYA 2OB3A 1NWSA 3PJTA 1Z32X 3QV9A 3WQPA 4ZB0A 2GDQA 1IYXA 2XH7A 1FVPA 2C91A 3C0QA 2R1PA 4K8EA 1IGSA 3VDBA 4Q22A 3UG5A 3W75A 1FXQA 3JRKA 4CKQA 5LA1A 1TJ1A 3SSJA 1PHWA 1HQTA 1F9CA 5LIWX 3UFYA 4H1ZA 1E0UA 2A4AA 1MQRA 4L1GA 2XISA 3AROA 1QFEA 3OIXA 3OLGA 3IJLA 3F03K 3GR8A 3KRZA 3J7HA 1DJXA 1CCWB 1AVAA 5FJTA 1WUFA 2WC7A 4R9XA 1V7AA 2JF7A 3GDKA 3ZXWA 4GACA 1UP3A 4FX6M 3L67A 3WNNA 5F4SA 3EEGA 3IRSA 1XIFA 3WMLA 1TX2A 5AHMA 1KBBA 4GJJA 5DF0A 1TA3A 2QPUA 4RV3A 1ZJIA 3NQVA 3T8LA 1W8SA 4FK9A 1SMDA 2NQJA 2CLIA 4X3ZA 3O07A 3UF9A 4MNKA 1KQYA 3VMPA 2ZX7A 3SEPA 1POJA 4CNSA 4QISA 4CLMA 4AF0B 2O9OA 1TV3A 3FSUA 2EPNA 4FXFA 2WVVA 3TTSA 3MHGA 3W1LA 3HM7A 1H49A 3B9OA 2J7EA 1ZRQA 4HPHA 1LL7A 2QW5A 4WDXA 3ZT5A 1QO2A 3C56A 4TOQA 4DYEA 1HKIA 3IJ8A 3MSRA 2JEQA 4XZMX 5CQ1A 4M0XA 5A95A 2EXOA 4WDUA 4GH1A 5A5WA 2WQDA 2GJXA 3GG1A 4MLRA 3UETA 1MXSA 3H70A 3H8AA 1S1PA 3B8IA 3C3UA 4B92A 4MY1A 3AZRA 3MA8A 1IHIA 2OZTA 3W82A 4PEEA 4H6RA 4IX0A 2WWDA 5A6BD 5G4WA 4DXKA 2QV4A 4NUWA 2YFOA 3VGFA 2BGQA 3CHFA 5F7UA 1J0YA 1G4PA 1JPMA 3LY0A 2E40A 1XPGA 4B5UA 3HGOA 1NF0A 1N8WA 3QBUA 1NTHA 3RYSA 4NZ1A 5A6AA 3W2MA 3H55A 1FUYA 3DOPA 4MZ1A 3U8GA 5G4HC 4E0CA 4C6QA 2YCEA 2DFAA 2Z7KA 3NO5A 4RXGA 5I23A 1B31A 1IXPA 1I2OA 3PSVA 3CUFA 5I0DA 1AD4A 4PMYA 1X97A 4AWUA 1VEPA 4NZCA 1SZNA 1U5HA 4TV5A 4QITA 4AIEA 4DWSC 3IIZA 1EP3A 1FDZA 3QC3A 5HWNA 3LGDA 3UJ2A 3PWIA 4BI5A 3G8RA 1JRBA 2Y62A 4ATDA 5J04A 1B57A 4QBXA 2YW4A 3CNYA 1B3ZA 3W00A 2QDHA 4PMJA 1B9BA 3E49A 3TLLA 4A8LA 4WKFA 1HJSA 3TCEA 3LI0A 1XHGA 2CESA 4OBTA 1M03A 2YYUA 4JKMA 3MP3A 3VIFA 2DZTA 3DFQA 3O6CA 3WDJA 2WHJA 4KS0A 3WF3A 1FWGC 3V3WA 3UCQA 2LLEA 2NQ9A 4K1WA 2INEA 2ACRA 1LUCB 3F2DA 2GJRA 4YIWA 2AL1A 1H5VA 4CCEA 2BY1A 4ZQOA 1RJQA 2DSUA 3R8HA 1DJGA 3EDKA 1IQ8A 3LX9A 1XISA 3AHTA 3WD1A 2CKRA 2WSPA 3BGGA 1DYSA 1XKYA 3CAWA 1A5SA 4PUNA 4ZCWA 3EA2A 4DUXA 3LA4A 4JYDA 3P61A 2A3HA 4LAZA 5E70A 3L4WA 3B8SA 3F7JA 3GVWA 2YCLB 2YBUA 3BE7A 2HPIA 3R25A 1DXFA 3VDAA 2D3NA 4PE8A 5BOOA 4ZFCA 1R2SA 3B97A 3F4DA 3WEMA 4MY9A 3MVTA 3N13A 2VC6A 2C8NA 4JHZA 2L5HA 7PTDA 1S38A 1E0XA 3VIMA 2P3ZA 1H1NA 3EOUA 1Q63A 5D2XA 4L6DA 3W1RA 2BS9A 4CNTA 5E09A 1WXYA 3S2MA 3WLRA 3QW4B 1JPIA 3LCFA 2HWGA 3ITCA 4RPPA 4YVXA 1ADDA 3THQA 3IUIA 1KO0A 1N8IA 3DFYA 2VRKA 4B9ZA 4F2UA 2WB5A 4MWAD 1S5VA 3EDEA 1JZ4A 1NQKA 4U2YA 3SURA 1D3CA 1V3LA 3A13A 2QQ6A 4JYFA 1WUEA 4LNYA 1VFLA 5D05A 3PZIA 4OT7A 1VBJA 5XINA 3PB0A 3NAVA 1FWJC 4HSOA 1VENA 3TJXA 3REQA 3H2AA 2VR5A 1OINA 1PEZA 1UPMB 3PSWA 3W1PA 2VNCA 4R85A 1BYBA 5TQLA 4YTTA 1ZTVA 1YNQA 4HNUA 1KLYA 3M5YA 4S3CA 1D7KA 5IBXA 3VXGA 4R7JA 1JCNA 1HTIA 4R9OA 3ZSSA 4O8RA 3SAZA 1CXIA 3YPIA 4S39A 2ZX8A 2OFJA 3SI9A 3THCA 2BY0A 1J4EA 4PN2A 1M53A 1XUUA 5C6MA 1TRIA 1SSDA 4ZO9A 4A8NA 1KM3A 3CEUA 5K2ZA 2AGKA 2BVYA 2EGZA 3BCJA 1EBGA 3EXTA 5CAHA 4M51A 3L2MA 1V0KA 3UZYA 4K6AA 1G0CA 2VJXA 5BMXA 4HJFA 3DBNA 3VGDA 3BWWA 4MFDA 2E8YA 2J7GA 4UZUA 4E3VA 4QX4A 4XKYB 1XG4A 4YXGA 5AB3A 4AWSA 1CT5A 1HX0A 6REQB 1PIIA 4BF7A 1H7OA 3DC8A 2O7QA 5HXMA 3LB0A 1A5UA 4X60A 4LAMA 2GGIA 2D69A 2POZA 3EMQA 3HU7A 4FI4A 3ZZ1A 4Z17A 2OX1A 1M5WA 3C2RA 1Q5MA 4IJCA 3TSBA 2X2GA 1ODUA 1JZ6A 3A21A 3GG8A 5H8MA 4KETA 4FEZA 3CS2A 4X2RA 3IGHX 1UH3A 4IQLA 3NZRA 1K6AA 1FHLA 4UC5A 4JQ2A 4LRTA 3L23A 4LUIA 2ZDRA 4M1RA 3W1XA 4FNPA 4OWGA 3TC3A 5TIMA 1Q6FA 4XZBA 3RITA 2J7CA 1WB0A 1XRVA 4QTGA 4MKNA 2CC0A 2D2JA 1HT6A 3QLDA 3AWOA 1R3YA 3M7SA 1OZMA 4MDOA 5HDRA 1VQTA 4WJEA 4QNEA 5H2ZA 4QEEA 1EP2A 5LGZA 1SZEA 4D6GA 4RNFA 2XFRA 3SFWA 4H01A 3QGVA 2JIEA 1JZ7A 2FJKA 3QQ1A 2ZDSA 1UWIA 3CZKA 4C6CA 2E6DA 4MYXA 5ABGA 3DG3A 4Q6JA 4DM1A 2BV9A 3PZVA 2PB1A 4XZNX 3IVTA 3STPA 3EPNA 4UMCA 1VFUA 2J13A 4F8XA 1JXKA 1H7NA 4HK6A 1Y7VA 3E0VA 2F2HA 4Q33A 3MS8A 2BGNE 3PNUA 4BF5A 4HKPA 3GXNA 3TC6A 4ZQPA 2PE4A 1WKEA 1CI1A 4IMEA 2REQA 5E6YA 3P74A 3CIWA 1AH3A 4BEUA 3PPCA 4WOQA 4CN1A 5DXXA 2W92A 1DOSA 2UY5A 4F0RA 5HWMA 3TNBA 2NX9A 3WJWA 1Q6QA 1G4TA 2VX4A 4PEKA 4OVXA 5C9XA 3WLLA 1WDRA 1EIBA 4PSRA 4N9CA 4F79A 4GXMA 4MGGA 4A22A 2OR2A 3MKVA 3O15A 3S0CA 3W4RA 2G97A 3CL8A 4B5NA 1YRRA 3G1DA 5FL0A 2ATSA 2NX1A 1FCUA 3SIMA 1TV4A 3UGVA 1TJPA 4M24A 2FH6A 3GAKA 4K3ZA 4A3UA 3GW0A 4YU1A 3LTPA 4XX6A 1H7WA 3NR0A 4IUOA 4JDYA 4QLKA 1XIIA 4GCAA 5AHFA 1ITQA 4K36A 1A3WA 5A3HA 4RUBA 4NY2A 1LWJA 4D71A 1NVMA 3APTA 3WQ5A 4HU4A 3PUDA 3GE7A 3AS3A 1NDZA 2EBNA 5JH1A 3NVTA 3H24A 4J7RA 1GVFA 3PAOA 4UTWA 3GNDA 1YYAA 2WQPA 2XHYA 3DYPA 3L4ZA 1B3XA 1R38A 2ZRXA 2DZBA 3BK0A 3NQGA 2PD9A 1FBAA 4EAMA 1EDQA 1Z42A 4QJ3B 4Y2WA 2WCSA 3C0LA 4JHOA 2H8XA 4QG8A 1UWTA 4GYJA 4C60A 1TJRA 3UBPC 3SGZA 4XG1A 3QC0A 1M01A 1EJWC 3EAUA 2RUSA 3GM8A 1ZP4A 1TQXA 1CGYA 1JIBA 1QOQA 3C5QA 4MKVA 2F84A 5EFFA 4AXKA 5LXEA 2C6QA 3FGCB 1IE7C 4TVDA 1KFKA 4HOZA 4IG2B 1KGXA 3QV8A 4L61A 3VNDA 3MWAA 2WNWA 1JF6A 2X1TA 3SUTA 2V2CA 2QF8A 2Q71A 1WDDA 4MJ2A 3S6DA 4REQB 3KBMA 3UXDA 2FYMA 4O4VA 1XYAA 3WH7A 4D8AA 2UWFA 3B0PA 4ML4A 4H9TA 3O1NA 2VGFA 1K9FA 3IWPA 5M2FX 1QWKA 2ZA1A 3BQ6A 2WKLA 3UERA 3UVAA 1XH1A 3W1UA 1GYNA 2AL2B 2V69A 5FACA 4J9JA 1EHNA 2G37A 3ARRA 2W5FA 3M0HA 3C6CA 3RFAA 4FF7A 3OLDA 3RCYA 4CN6A 3V4BA 4WQ6A 3OVPA 4RDYA 4XBSA 2PTWA 3ENLA 1E6QM 1VFFA 3URNA 3ARYA 1AH0A 4PB4A 3N19B 2WM1A 4UBPC 1H1ZA 3R6IA 3V75A 3CQHA 3HG5A 1NSJA 2FGZA 3KTXA 4FLOA 4QQUA 4Q8WA 4L9ZA 2YL5A 1C8VA 1N8FA 4H6KA 1LF1A 2WSRA 3FLUA 4NX5A 3S2LA 3P93A 1A47A 2A7NA 3NDOA 1KCXA 3FXGA 1HJQA 4MB4A 3ZM8A 4A8RA 1ME7A 1ME8A 3KBJA 3E0LA 3OGRA 3RR1A 4CVWA 3S6TA 1JNEA 2Z2UA 3T4WA 3W85A 1MYRA 5I3GA 2CERA 2RJGA 1Q45A 3MBFA 4GVFA 1BWKA 4S3AA 1TE1A 3HQPA 1WZMA 1X8CA 3GB6A 1BSIA 1FDJA 2GVYA 3PBUA 3VD9A 2DZPA 3PJWA 3MUZ1 3R43A 3RDKA 1WPCA 1F8MA 3WLPA 1TIWA 3RCMA 4JHMA 1FOBA 3FIGA 5FF3A 3RU8X 2EG6A 3S1XA 3QMRA 2WZEA 2IQTA 4NL1A 3HPAA 1K8ZA 1U30A 2GWNA 1UQZA 5XIAA 4DXXA 1I60A 1FWWA 4V2XA 5D04C 3N2MA 3DUGA 1SZFA 1G5AA 2FVLA 2OELA 2J8GA 4PTVA 3Q37A 5CGMA 4RX0A 4A3YA 3L9CA 2J88A 1V3KA 2CETA 3KZPA 3WBYA 4KPLA 7TIMA 1KFJA 4FLSA 4LXFA 1VB9A 1EIXA 3MUCA 5BRBA 5K3VA 3O63A 4Y7EA 4X2PA 4EXBA 2BB0A 1QU4A 4YPJA 5IM51 2BXYA 2PU0A 2ZRZA 5MHBA 4AZIA 4ZR8A 3GSMA 2QGYA 2ZZ1A 2V5CA 3L68A 1PX8A 3HGSA 3DHDA 1EQPA 4QS6A 2FVMA 1BD0A 3WENA 5IDIA 1KWKA 1RD5A 4QROA 1HO1A 4DX3A 1EJ7L 2EQDA 4O1AA 1LRQA 1LCOA 5HOSA 2X05A 2QUVA 2E0PA 1DQXA 4O11A 3NIYA 2VCBA 2QCGA 5AC6A 2XIJA 3K1DA 1JUBA 1BGAA 2XIMA 3CK5A 1ZBWA 4ZOAA 1A5CA 3C52A 4DF0A 1RXOB 3II1A 3H26A 3TU9A 1CB7B 1EPXA 5IXEA 1T0OA 3BMWA 1AL7A 1B3VA 4O1FA 3NJ3A 3KBNA 5CXPA 3SY1A 4IM4A 3N6QA 4V15A 5EBUA 3OPSA 3NPUA 1DWGM 1HGYA 1TA3B 2E3ZA 4Y9PA 3QOMA 3FY1A 4QE1A 5T9BG 1BXBA 1TJ2A 2Y7FA 4D6DA 3ZMRA 5G2IA 3N04A 1AZ2A 1DIEA 1QNVA 5AVNA 2ANUA 3TN4A 1CXKA 2CHRA 3VD7A 1DTNA 4G6CA 2XN0A 4MSSA 3KDNA 3P60A 2PC8A 3NEHA 4QR6A 4P61A 4KWUA 3BW4A 2A3AA 5FKYA 4CN4A 4ZL1A 2X0SA 5CPQA 1J5SA 4M6PA 1M1BA 1M65A 4TX6A 5LA0A 4JTTA 2WVVB 4P8XA 3N9SA 3UZWA 2IPJA 4W9TA 1E71M 1L6SA 3ZWSA 4JIPA 1FX6A 2HQAA 4C1KA 4J3XA 3UD6A 1KCLA 1W5PA 3MKKA 1P6BA 5A94A 4ZO6A 1Q65A 1ITCA 2E6YA 3T07A 1JFHA 3MDUA 3L0KA 3S47A 3LM7A 1OX5A 2RGLA 2X2YA 4IWWA 3UEQA 1TPB1 1PL9A 3CO4A 2PDGA 4GOAA 2J7BA 3HOJA 4IP5A 2QS8A 1R6WA 3EOEA 4DZIA 2WMGA 1FXPA 3CASA 4KIEA 2TAAA 3ONBA 1XP3A 3GHRA 4XAPA 4NXKA 4YLWA 1UJPA 4CCDA 1Q2RA 1AW1A 4UWMA 1LT7A 2BBFA 1G9HA 2BXVA 4IMGA 1MZRA 1UH2A 1BYAA 4HOWA 2X1IA 3LK6A 3EXRA 5HR6A 4NNCA 3DYOA 1RP8A 1BQCA 1RPKA 1OY0A 1E9IA 1GUVA 4QQ3A 1GPWA 1JD7A 4UTMA 3K30A 1TV8A 4JIRA 4PRTA 3UW6A 4ERIA 3DFTA 1P1MA 1RVGA 5FSEC 2GSHA 1KW1A 1XLGA 1GVOA 2JKPA 3T0DA 1W56A 3U48A 4N7QA 2QYGA 3DYMA 2P3EA 1E4LA 1LQ2A 1FWNA 3E0IA 4PTNA 5DMNA 1EF3A 3EWUA 1I0BA 3RX2A 4HNNA 1TCMA 1Y5VA 4P7QA 3ZLFA 4IFRA 4BWLC 1EO7A 4XZ9A 2QPXA 3ORWA 2CITA 3I6TA 3W6MA 2OT0A 3HV8A 4DUWA 3F4CA 3ZIZA 5I00A 3COTA 4Y8EA 1W5OA 1XRTA 2ODOA 5K9DA 3WLHA 1E9YB 5C9WA 4OKDA 4E2BA 1TX0A 1XCWA 3ANYA 3CZEA 4PUEA 2NWRA 2Q09A 4QEHA 3RF9A 1V6YA 4TMCA 2ZE3A 4QS5A 2HK1A 4GUJA 1PYFA 4UQAA 4U5KA 2UZ9A 4INFA 3BO9A 1PBGA 1XSIA 4GKTA 4V1XA 5D8ZA 2WNZA 3AIQA 4UQ9A 1WV2A 2PGWA 4KERA 1FWFC 3C4UA 4KEVA 1H60A 1PDZA 1L6GA 3WK1A 1XXXA 3N9KA 3EPMA 2E25A 4U2ZA 4GJIA 3N25A 5CJ5A 2P53A 2BHYA 3NQBA 4LVFA 1REQA 5A6BA 3QGAC 3UJSA 1VBUA 3W29A 2CIPA 5BXPA 5D03A 1T41A 4GQRA 4O57A 4TTUA 5DQPA 4UTUA 3QLLA 1ISWA 4AVOA 4YVPA 3G1SA 2IPGA 3WQ8A 1VBHA 1E6SM 3R10A 4US6A 4S3GA 2GWGA 1EX5A 2F8QA 1E72M 4IIDA 5HUPA 3UR2A 2YXOA 1G6CA 1EJUC 1C8YA 3T2OA 2E4TA 4LBSA 3M1ZA 3WUGA 2C0AA 3SY5A 3EDDA 3WLMA 3SW6A 3B05A 3C2FA 3CUHA 1CXLA 3K4DA 1XYBA 1UUQA 3LBOA 3T0CA 1PTGA 3EX4A 4DF1A 1DEDA 3G1VA 3NZ1A 3A5FA 4M7TA 3RU6A 1SU5A 1EF2A 2CLMA 1L8PA 4JN7A 1F3WA 2Y5JA 2R14A 3FKRA 1HFBA 3KW3A 3G1RA 1G1YA 4FIRA 2J62A 1ITUA 4IMFA 1D9EA 3REQB 1NAL1 4HZMA 1E5JA 2PUZA 1R3QA 3TKFA 2V3GA 3RN6A 1Z89A 1U5JA 5LYRA 3ARVA 1ZB5A 3MBDA 4O15A 1XIGA 2VYOA 4JX4A 3W73A 1Z41A 8A3HA 3BUVA 3SRHA 3W28A 3L7RA 1ONRA 2PLMA 3M07A 3UNDA 4TU1A 2WC3A 4HOXA 3BTNA 2FGLA 3W7DA 4EK7A 2AAMA 1ZU8A 4HMDA 1S5NA 2NQ5A 1ISXA 2PF8A 4PMOA 2VQTA 2E28A 4BK9A 4GGHA 1ZUAX 1RY8A 3MMDA 3EX2A 4ZOBA 4M29A 2VHLA 3GH7A 1XLHA 3EYPA 2VZSA 2YBTA 1PDYA 2WCAA 1CTNA 4PCSA 3LUTA 1TIMA 3MI6A 1LJYA 5DT5A 5FI8A 4ADUA 5K9CA 1EC8A 3ZOAA 3AHXA 4NJKA 5HPOA 2ATMA 2DT2A 1JRCA 3OO2A 1VJIA 1XICA 3TMLA 2X09A 1JNDA 1V77A 3MI2A 3TJ4A 1XD1A 3TTYA 1QUMA 2HXUA 5C8BB 5FJJA 2CW6A 3B40A 3STCA 1JL8A 4I7UA 2GLKA 5C7VA 3KRBA 2ZKMX 3KP1A 3N3MA 1J0ZA 1CENA 2R9RA 1QNPA 2NLYA 2VC9A 5AYBA 1QPRA 3HGRA 3HJZA 3VMNA 3CEPA 1PYMA 1GWJA 3UP8A 1H1YA 2ZQ0A 1X6UA 2X41A 4IIGA 3VX0A 1F3TA 3M6DA 1S39A 3FW6A 3W7IA 4MNLA 3CHEA 3ZLGA 1E4IA 2WSQA 5E6ZA 2YZRA 1XX1A 2BG5A 4AWTA 3OYXA 4LS2A 2JGYA 3SFKA 2C14A 2DH3A 4LQ1A 4DZ5A 2Y61A 2AQWA 1QI3A 2A3BA 3KEHA 4ACZA 4D8ZA 3K4WA 3IV3A 2RHGA 3ABSA 3AISA 3AXMA 3ALGA 1M04A 2OOFA 3A24A 4PL2A 3CHCA 4TUFA 4XIAA 1NFGA 1PO9A 4FP1A 3WYZA 3W7NA 4NYUA 2J8FA 2ZC8A 3XISA 4OIFA 4DAIA 2BMBA 3SCRA 3PZ9A 4NX0A 1I2NA 2ALRA 1KR1A 5M5DA 4JFUA 4OE7A 5JU6A 1D3HA 5CCZA 3PUOA 1EEPA 3U0HA 1F5ZA 5G4EA 1THFD 1TVLA 4LT9A 3JU2A 4B9YA 1XS2A 2J27A 2XZ9A 4Y96A 1MXGA 1TR1A 4LX4A 4WEVX 1LROA 2RDXA 3HGJA 2FTYA 2WJEA 3GNXA 5LIUX