3OU8A

The crystal structure of adenosine deaminase from pseudomonas aeruginosa
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
313
structure length
313
Chain Sequence
YEWLNALPKAELHLHLEGTLEPELLFALAERNRIALPWNDVETLRKAYAFNNLQEFLDLYYAGADVLRTEQDFYDLTWAYLQKCKAQNVVHVEPFFDPQTHTDRGIPFEVVLAGIRAALRDGEKLLGIRHGLILSFLRHLSEEQAQKTLDQALPFRDAFIAVGLDSSEVGHPPSKFQRVFDRARSEGFLTVAHAGEEGPPEYIWEALDLLKVERIDHGVRAFEDERLMRRLIDEQIPLTVCPLSNTKLCVFDDMSQHTILDMLERGVKVTVNSDDPAYFGGYVTENFHALQQSLGMTEEQARRLAQNSLDARL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of adenosine deaminase from Pseudomonas aeruginosa
rcsb
source organism Pseudomonas aeruginosa
molecule tags Hydrolase
molecule keywords Adenosine deaminase
total genus 124
structure length 313
sequence length 313
chains with identical sequence B
ec nomenclature ec 3.5.4.2: Adenine deaminase.
pdb deposition date 2010-09-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00962 A_deaminase Adenosine/AMP deaminase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.140 Alpha Beta Alpha-Beta Barrel TIM Barrel Metal-dependent hydrolases 3ou8A00
4H9ZA 2Y1HA 1PO9A 3IGHX 1RK6A 4XD3A 4LALA 2WJEA 2DVUA 4H9VA 4F0RA 1ONWA 1I0DA 3URNA 2D2JA 4GX9A 2P53A 4AQLA 2GZXA 3QY6A 3A3WA 1M65A 1EZ2A 1M7JA 1RA5A 4H9UA 1EF2A 3K5XA 4XD4A 4C6FA 3HTWA 3FEQA 3GTHA 1QXLA 1XWYA 2PLMA 4C6BA 1V4YA 4QRNA 1ITQA 4IG2B 1R9YA 4C6OA 3DC8A 4R85A 3UR5A 2FVMA 2R1LA 4DI9A 1K70A 2PGFA 4XAZA 4CNUA 1NDZA 3HPAA 5FSEC 3E0FA 3MKVA 2CZVA 3O0FA 4CNTA 3AUOA 4ICMA 1I0BA 3ISIX 4IFKA 3UF9A 1A5NC 3S2NA 5HMFA 3NEHA 3EWDA 2P50A 1O12A 4C60A 3N2CA 2PAJA 3URBA 3QY8A 1WXYA 3F4DA 3F2BA 1YNYA 1RJRA 2QVNA 2E1WA 4I6KA 1R9ZA 1UIPA 3GU2A 3K2GA 4IFKB 1PB0A 3MTWA 4J5NA 4DLMA 4Z42C 3FDGA 2XIOA 1KCXA 3EGJA 3NURA 3RYSA 1YMYA 3F2CA 1RAKA 4KF1A 3GIQA 4PCNA 4IF2A 4XD6A 4C6JA 3G77A 4GY7A 1BF6A 1POKA 2F6KA 4OFCA 3RCMA 3TN4A 1PTAA 4H00A 1GKQA 3MDUA 4RDVA 1UMLA 1PSCA 3SFWA 2O4MA 4INFA 3OJGA 3TN3A 2VUNA 1RJPA 4V1YA 3B0YA 4ZSTA 4CEUC 2FFIA 4RZBA 4GZ7A 4C5ZA 4DLFA 2G3FA 2ICSA 4KERA 1JGMA 1EYWA 4LAMA 1A5LC 2FVKA 3WMLA 1KRMA 2EG7A 3A3XA 3GUWA 4DIAA 1ZZMA 4G7EB 2A3LA 4H9TA 4BY3A 3LGGA 2EG8A 1A4MA 1E9ZB 4TQTA 1P6CA 2ADAA 1P1MA 3PAOA 1V79A 4GY0A 3A4JA 2Z27A 3MPGA 4H9XA 3FDKA 4C6KA 4C6LA 2QPXA 4LAOA 2YZ5A 3E74A 3AU6A 4IGNA 4RDZA 2RAGA 4KEUA 4L9XA 2I5GA 1YBQA 3D6NA 1IE7C 2BGNE 2OGJA 3S2LA 4DNMA 1NFGA 3E0LA 2ANUA 2Z25A 5AKQA 1XRTA 4GC3A 4QS5A 2VC7A 3CAKA 4HA0A 4WGXA 3B40A 2Q09A 4IGMA 4ERGA 3PBMA 4CQBA 3GTXA 1J6PA 4EP8C 4HJWA 3QY7A 1FWCC 1J79A 1XGEA 2FTYA 1FWGC 4EPBC 4B92A 3UPMA 4R88A 1GKRA 2I9UA 3OVGA 4LEFA 4IFOA 3LGDA 4HK7A 1R9XA 2D2HA 2OB3A 1P6BA 2VR2A 4E3TA 3MVTA 1NDVA 1W1IE 3LNPA 1DPMA 4GBDA 2WJDA 1EJSC 3E2VA 1V77A 4KEVA 5HMDA 1HZYA 4KETA 4LANA 4IH3A 1KRCC 2Z26A 2Z00A 4CQCA 1ADDA 4H9MA 4UBPC 2Z29A 2Z24A 4H01A 4UB9A 3OODA 4GOAA 2R1KA 5A6TC 4IQJA 3IJ6A 1FWBC 2OODA 4EPKA 4L6DA 4GX8A 3GTFA 3F2DA 2OOFA 4CEXC 1V51A 3TNBA 4NI8A 4BKNA 1A4LA 3IARA 4CQDA 2ZC1A 3GRIA 2R1MA 3B0XA 1YRRA 2YB4A 3S2JA 4C5YA 1FWHC 2VC5A 4XAYA 3T8LA 4F0LA 3E38A 5HMEA 4DZHA 2Z4GA 4ERAA 3GIPA 4C6QA 4JOMA 1ITUA 4GXWA 1FKXA 1A5MC 2D2GA 1FWEC 1EJXC 2W9MA 3R0DA 3SO7A 2WM1A 4LCSA 3CJPA 1NDWA 3ORWA 3V7PA 3IV8A 4C6CA 4P5UA 3PNZA 4C6EA 3LU2A 1QW7A 3AU2A 3KM8A 1EJRC 4XAGA 4IG2A 4BJHA 3JZEA 2R1PA 3GU9A 3PNUA 2O4QA 1FWFC 3LY0A 2HBXA 2VM8A 3GU1A 4DO7A 3ICJA 4PBFA 3UBPC 1E9YB 1YBQB 4RDYA 2Q01A 3HM7A 2PGRA 2AQVA 3TN6A 4DI8A 1J6OA 4R7WA 4AC7C 1POJA 4GYFA 4V1XA 5G4HC 2YXOA 1NDYA 4LCRA 1EJTC 1KRBC 3TN5A 4H9YA 4J2MA 2Z7GA 1XRFA 2HPMA 4KEZA 2AQOA 3T1GA 1FWIC 3NQBA 2PUZA 3UR2A 4C65A 3MSRA 3BE7A 4G2DA 1S3TC 3ID7A 4GK8A 2OQLA 1UIOA 2FTWA 3F4CA 4F0SA 4XD5A 3WYZA 4B91A 1WXZA 3LA4A 1VFLA 4G7EA 4KIRA 1A5OC 4D8LA 1J5SA 2GWNA 2GWGA 5FSDC 4DZIA 3URQA 1EJUC 1O5RA 4LFYA 3URAA 2GOKA 4EPEC 4KQNA 2VHLA 1EJWC 3WZ0E 4PBEA 2GSEA 1EJVC 3RHGA 3LSBA 2Z28A 4IFRA 4QS6A 4DYKA 4XAFA 4CNSA 2WJFA 4NP7A 3ITCA 5LXXA 3GTIA 2HPIA 4QROA 1KRAC 3O7UA 2UBPC 4C6MA 1FWJC 4ZSUA 3GG7A 2DVXA 2R1NA 4YIWA 1ONXA 3IACA 1A5KC 1RJQA 3IRSA 4J35A 4QSFA 2HBVA 3OOQA 3DCPA 5CH9A 2EG6A 4LAKA 3EWCA 3K4WA 1FKWA 2E25A 2QT3A 3S4TA 2Z2BA 2KAUC 3RN6A 4NG3A 4WHBA 3QGKC 4PE8A 4WVXA 4C6PA 3MJMA 1FWAC 1K1DA 2HNHA 3DUGA 3QGAC 4LCQA 3C86A 3IPWA 4ERIA 2Z2AA 3E3HA 3CS2A 2DVTA 4EPDC 4GY1A 4C6NA 3OU8A 4B90A 3MVIA 4RE0A 3MDWA 1YIXA 5E5CA 2AMXA 1V7AA 4B3ZA 4PCPA 2IMRA 4MUPA 2BB0A 2HQAA 4KESA 1UBPC 1RA0A 3T81A 4HK5A 4RDWA 4HK6A 3OQEA 4I6VA 1RK5A 3S2MA 3LSCA 1K6WA 1M68A 4M51A 2UZ9A 4QTGA 1GKPA 2YB1A 1FWDC 4LH8A 2QS8A 3LS9A 4C6IA 3PANA 4C6DA
chains in the Genus database with same CATH superfamily
3MUZ1 2Y1HA 3RILA 4HCHA 4H7ZA 1GVIA 4X22A 3OYXA 3L2IA 3NZPA 5A8NA 3TA6A 2W66A 2WKJA 3P60A 2OZ8A 1AL7A 3FKKA 2PWFA 3WNKA 1V4YA 4QRNA 4AZ6A 1NIUA 2YYUA 1XKYA 3WQEA 1KW1A 4XAZA 4HHHA 1JYWA 2XU2A 5FSEC 2NXGA 2G8ZA 4A21A 2J7GA 2GJLA 4V33A 2YL5A 1XBVA 3GG0A 1XYCA 1EP3A 1Y7VA 2O0TA 5DXYA 3TC7A 3PUGA 4LYRA 2CLOA 4GCAA 5AOUA 1MQRA 1ZJAA 2DT3A 3F03K 4PFHA 4CD8A 3CV2A 3ES8A 4J7RA 4C91A 1P0DA 1BG4A 1SO4A 2OWCA 2X2YA 3T0CA 1VJSA 2B0MA 3RU8X 4G56A 4PCNA 3TJIA 3TSBA 2FYMA 1RBOB 3A9BA 1IR1A 3TMQA 4MZ8A 3WSUA 1X1ZA 1UH3A 3MDUA 2PC4A 1TSIA 3SSJA 1T5AA 1XHGA 1DJWA 4IMAA 4V1YA 1Q6RA 1KFBA 2J7HA 4K37A 3W7OA 4ZENA 4I9JA 1F76A 4Z2HA 4C5ZA 3STCA 2BV9A 3OVRA 2EG8A 3BCFA 4CU8A 5LA2A 3W1AA 3TK7A 1ZJHA 1F6YA 3FAXA 4X3ZA 1V79A 4OKDA 1V93A 2XVLA 2QUTA 2Z27A 3USZA 3T0AA 2NLYA 4LUYA 3V1PA 3TH6A 3XISA 3EA1A 2HSAA 1G01A 2WHLA 1SO5A 1PZ0A 1AH4A 4TVCA 2XINA 4O19A 2DZWA 4JEJA 3I6TA 3VIPA 4DNMA 4IPJA 3WQVA 2Y7EA 2YGYA 4E8DA 1V02E 1W5MA 3B8TA 1QW9A 1W3HA 5I00A 3FCPA 1W3LA 3W7PA 3GTXA 3U57A 1UASA 4MKVA 2WMGA 4P2VA 4HJWA 3CT2A 5LHEA 3QY7A 3FVDA 5D2XA 2PDFA 1FWGC 3M46A 3WUFA 2Z6JA 1GKRA 2I9UA 3UXKA 2QCLA 3PFRA 4ADSA 4E3TA 1WPCA 1BYAA 1DHPA 2BSLA 2DORA 3AIQA 1V0LA 1UPMB 4AZ5A 4O57A 4EWND 3MS8A 1G5AA 2YPIA 3LBOA 1W2PA 3MT1A 4B9YA 4AMCA 3O0KA 2GVGA 1ADDA 4W9TA 2VEPA 1YHTA 2NSOA 3U2CA 3OODA 4HOWA 2Z1BA 3TAKA 4EIVA 2QDGA 2J27A 3I6RA 3FA3A 7REQB 4W8LA 1PX4A 2YKKA 5DN1A 2OOFA 5IDZA 3VOHA 1XCFA 3S0CA 3EPOA 5A2CA 1VFTA 4MUZA 3WX7A 3ITTA 3CXOA 2DZSA 3AICA 4XAYA 3AZTA 4K7YA 1XLDA 4PH6A 3QYSA 2IPFA 3SCQA 1A5MC 1GHRA 2ZUSA 4ONVA 1A53A 3CJPA 3WELA 3LCXA 3WH6A 2YLAA 4PCFA 1H7PA 4L4PA 5CKSA 4O1BA 1E3XA 4GO8A 3KM8A 3LXCA 1ZSXA 5CZKA 3BG9A 2P1FA 3I10A 1OG0A 2GQ3A 3RFAA 4PBFA 5I3KA 5A6BD 4UTTC 4D2JA 1LTDA 1K02A 4O15A 4HKPA 3NXFA 4GYFA 1THFD 1KRBC 3E9AA 1K8XA 5FJJA 4ML9A 2ABBA 5BWFA 1FCVA 5AB3A 1W5NA 1TIWA 3Q4DA 2XVGA 3QQ0A 5BMXA 3SUTA 2OZ3A 3I3DA 1AZ1A 1PDYA 4HB7A 3G1RA 3LK6A 4L65A 1SSGA 1DL3A 1VFLA 1HX0A 2J88A 1W54A 1J0KA 1MEHA 2J74A 4FNSA 1UZ1A 2G37A 1GOIA 3KL3A 1O5RA 3ABOA 3T2PA 4F2UA 3W1LA 2G97A 3H2FA 4IGSA 4MY1A 1E4NA 3GXDA 1QR7A 5BRPA 1SMDA 3NL5A 3WQDA 3MC5A 3L2MA 3M6DA 3ZVIA 4DQWA 3N4EA 1LT8A 1XW8A 4ZSUA 2SFPA 2FJKA 4GKLA 2PTZA 3AALA 4JHMA 2QAPA 3R94A 5GNYA 3V4BA 2E3ZA 4XBKA 2XFWA 2J79A 4L1GA 5BCAA 4LW7A 2HNHA 3RJYA 4HNVA 1G4TA 1GUVA 4J1OA 3CS2A 1V6WA 3UZJA 1MNSA 2V3GA 1MYRA 2ONEA 3TKFA 4I9TA 1R5YA 3GVWA 1GQKA 2HE8A 2IMRA 1PIFA 1DJNA 3WJWA 2X41A 5DCEA 1FH9A 3T81A 4HK5A 4C7GA 4XVDA 3BARA 3E2SA 1US0A 4X63A 4P7NA 3MSDA 3OBAA 3PWGA 4QLLA 3IJ7A 4QNWA 3LS9A 4PB4A 4Q8MA 2J66A 4O1FA 3VOFA 3ARUA 3FYPA 2WJEA 2WHMA 4XV0A 4ZOEA 4JTLA 3O05A 4LV4A 2UY4A 4GUGA 4JTQA 1MDLA 3RM9A 4K36A 2PTYA 1IYXA 4LVBA 5CGMA 5PTDA 3ECQA 1TREA 8RUCA 9RUBA 2VFFA 3V1HA 1E72M 5I3GA 4IJCA 1W9VA 4R85A 4GGBA 1IWBA 2WMHA 4LUJA 1OK4A 3RDKA 4MJ4A 4H1ZA 1TV7A 1VD6A 3GVGA 1I0BA 4QSHA 5I0DA 2XFYA 1T40A 3WMSA 3CUGA 1DP0A 4Y9NA 1E9LA 1E55A 1K77A 3URBA 3GO2A 3WQFA 1JI2A 2QYGA 3U5YA 1RY0A 4E2BA 3DHPA 3CB8A 1OD8A 3PTMA 3HMCA 1MWOA 3VE7A 4PEEA 2NQLA 1RH9A 4LAZA 3RMEA 5C55A 1KXTA 1RAKA 3LI0A 4P8VA 1X8FA 2QDHA 1QOPA 2QCMA 3N18A 4GVHA 3PR2A 4NRSA 3TN4A 1EGMA 3MCMA 4NXSA 1VPYA 3MHFA 4QG6A 4EX4A 3WLIA 2VJXA 2XVKA 2H3DA 3OZOA 1KWKA 4GPNA 3G5EA 3L2LA 4U3AA 5HR6A 3W29A 5HXMA 1F73A 4I7UA 2PZNA 2NT1A 1HN1A 5G4EA 1NFPA 2X1IA 1X38A 4DIAA 1LWIA 1HP5A 3HV9A 3T44A 4DX3A 3P5YA 5FD0A 4BY3A 4AF0A 3Q67A 3Q45A 2DT2A 3IK4A 3CUIA 1F3WA 2IS7A 4J27A 4PMDA 3HQOA 2NV2A 5K9DA 5A6AA 1U33A 3G1SA 1B0IA 1TWZA 3RM4A 3IUDA 3NSXA 1L6SA 2WC7A 4PTWA 4M6UA 4S23A 1UP3A 2OYLA 3H2OA 3W2MA 4QS5A 2CBJA 3CHFA 5EMUA 3MJYA 5CEWA 4CVUA 3JUGA 4DBUA 3W7DA 1NTHA 3B4UA 4EOUA 5DBTA 4DM1A 1H7WA 4LS1A 3W1UA 4HNNA 1I9CB 4I5UA 1CNVA 4P7OA 5FJUA 1MEIA 1JFHA 3MP4A 3LNPA 1LBLA 4HJFA 3DBNA 1JYXA 1XLLA 3PJUA 2QCNA 1VFFA 4WOQA 4IXXA 4REQB 4XUYA 3N2XA 4K2SA 1DV7A 3E0VA 5FA5A 2CBVA 3NEVA 3L4ZA 3R13A 2NW0A 3MWCA 2PDJA 1JPMA 4WY0B 4NILA 1GOQA 3GTFA 3F2DA 3OPSA 3RX4A 3TTEA 4KMQA 1LWHA 1LOLA 3GRIA 3UR8A 3V75A 2PRMA 5CAKA 3LXAA 4XZLX 2PS2A 4QJ3B 4R5EA 4FF5A 1HGWA 1PKYA 2W9MA 3K46A 4DO4A 2QCFA 4DYEA 2FGLA 3SADA 1P4CA 2DSZA 3L65A 4LS0A 1IGSA 3K30A 1C8QA 4ACZB 5CZTA 4QBXA 1BSLA 1W8SA 4ZQMA 3G6LA 2XWEA 3INPA 1VCVA 1UZDA 3GU1A 2JF7A 4B5TA 2PDYA 4Y9PA 1XJBA 1KR0A 3MBFA 3WD4A 4ZTYA 3BLLA 3BW3A 2QCHA 1WKDA 3L0KA 2J9XA 2VEMA 1UWRA 2VL4A 3L4WA 1AJ0A 3MA8A 1IEIA 3IV3A 3PJTA 1NF7A 3CZ8A 3W73A 1TR9A 1DIOA 4KKXA 2DUXA 3EOOA 4F0SA 3BC9A 1UWTA 2WPBA 1FHUA 2G50A 3B8VA 2WBKA 2OELA 2BX7A 3W6LA 2DDXA 3M0HA 1ZTVA 1GZJA 3OGSA 1HKWA 5LA1A 8A3HA 2HVOA 1J4EA 3SRHA 1O68A 3VVGA 3PF3A 4ZTXA 1WZMA 3MCNA 1QI0A 3GYCA 4KWSA 1TPVA 4CNSA 3QQWA 4A3RA 2OO6A 3MHGA 4O1DA 4QDWA 1Q66A 4D72A 5E6ZA 2V3DA 2WSPA 3I7RA 4H8NA 1W1VA 3BAXA 2I7GA 4HA4A 2QUUA 3CK5A 1RD6A 5K4XA 3WQ8A 1V3MA 4M1BA 3WNLA 1BQGA 2KAUC 1XP3A 3LRLA 4AUBA 4WVXA 1VH7A 3LV6A 1E4LA 2PDKA 2V81A 3MANA 1GNXA 1ITXA 1NWRA 1F9CA 2ISDA 5GNXA 2A85A 1UWSA 1BEUA 4LQ1A 1M6JA 1FDYA 2E5CA 1S5VA 3GDRA 4L61A 4FX8A 3CPGA 3H2NA 5LA0A 4PGLA 1TVLA 4J3XA 1G4SA 3HFTA 5CSSA 4MOZA 2EPOA 2PC8A 2D0FA 3OB8A 3BURA 4MNKA 1SFSA 3ZLHA 3O15A 4FOKA 3M44A 3QC3A 4WDTA 3QV6A 3SUVA 3ABXA 2CZEA 4ZO6A 5REQA 1OY0A 4QIUA 1GKPA 3AIEA 4M29A 6REQA 4CVWA 3LDVA 2VURA 1V0KA 2WZHA 1XDMA 3UWUA 1I0DA 2GZXA 3QY6A 4QE1A 1M65A 3BSHA 5I03A 5A6MA 1CB2A 4PR4A 5EY5A 2QCDB 1K3UA 4K8HA 1N55A 1F2JA 2FLIA 4GQGA 3LMYA 2ISVA 5FOOA 3VNMA 2CCRA 4Z1BA 5BU9A 2WC4A 1OGGA 1K8CA 4JR5A 1HVXA 1R87A 3MKVA 3O0FA 3LNMA 5CZ0A 4HMDA 3VZYA 1TX2A 2OWWA 3S42A 4MLJA 1AQMA 4W85A 1UP0A 3DIPA 3F4DA 3IJ9A 4KCVA 1U22A 4WCJA 1TTPA 4U2YA 4ZB5A 2WLZA 3GZ3A 4IUGA 3MTWA 1DOSA 2YBUA 3O07A 3H4WA 4NYUA 4J5NA 3NYDA 2XIOA 2Y8KA 3G8RA 3N6HA 2Y8VA 1EBHA 2QQ6A 2WVVA 1K03A 1ISZA 1CDGA 3G77A 3VMPA 3BPWA 1WKFA 1BTMA 1J18A 2EF9A 2JE8A 3U48A 3GH4A 1CGYA 2O4MA 1TPEA 3MP3A 3EXTA 4MDPA 3CHDA 3UZYA 2FFIA 2YA2A 5M1TA 4H7CA 4J3TA 3WF0A 3HURA 2WNZA 2CZ5A 4JHZA 1E6QM 1JF5A 1CGXA 5CZSA 3W84A 2G3NA 5H8UA 4AZBA 4F40A 1H1YA 3HGOA 1TV5A 3VD7A 6TAAA 5GJPA 3BGJA 3E1F1 4GUIA 1OJXA 4LUTB 1NEYA 4HSHA 1SJCA 3BGAA 1O66A 3WLSA 2FMNA 2YX0A 2JGYA 2ANUA 2X0HA 4YXGA 5AKQA 4AZIA 4GRSA 1QWGA 4UFIA 4IGMA 4RW3A 4GLEA 4Z0JA 1H7RA 4LWWA 4KFNA 5LZLA 3CH0A 1VFSA 2BS9A 2VKZG 2CZFA 5AHMA 3JVAA 4BWLA 2A7NA 4W93A 4DF1A 3PZMA 4JY8A 1Q6CA 1RCXB 3CQIA 3R25A 1OX6A 2D2HA 3PZ9A 1R38A 3VFLA 2WAGA 2OQHA 1W1YA 3F1QA 3UCCA 4O13A 4TVDA 4HVXA 3M1ZA 2Y24A 2BGQA 4LOCA 3ARPA 4FXRA 1KRCC 2XVPA 4F66A 3BUVA 2FHFA 4BF5A 2Z1VA 3WDIA 2PFHA 2A1YA 4JNZA 1UPPA 1OT1A 5A6TC 3CO4A 3EPMA 1E40A 1JEZA 2PDHA 2GGHA 1OSEA 3I4EA 4L6OA 1XX1A 4L80A 4PMUA 4O16A 2WZTA 5KITA 4YNGA 1PIGA 7PTDA 1GW1A 4DZHA 3CQHA 1DXFA 4C6QA 1VB9A 3C0SA 4GXWA 1FKXA 4GI4A 3VD5A 4O54A 4AFYA 2EHHA 4ZOCA 2V8ZA 2VEKA 1C93A 2XFFA 1QOQA 4Q6JA 4QHRA 2ZXBA 3MW7A 1H7XA 2W27A 4FX6M 2DT0A 4JIIX 1JZ7A 4IXHA 1PWLA 1WUFA 4IG2A 3GTNA 1NWUA 5C9RA 2VM8A 2RDTA 2FB2A 1XLKA 3B9DA 2V5DA 1Q3NA 3H4XA 5LNRA 4WZHA 3KS6A 4Q8OA 1KLZA 3HM7A 4Q7IA 2ZUTA 4DI8A 3ZLGA 4AC7C 2PLKA 3B4YA 1OIMA 4NJGA 2C0HA 3SEPA 2GGIA 2BY1A 2V2DA 3WKZA 3UXLA 1XH2A 2NV1A 4H41A 1H60A 1YW1A 2QDEA 3W7NA 4HZ7A 3ID7A 1LZOA 2OQLA 4HPXA 1AODA 2DV0A 3NZGA 1AFSA 3DC0A 1MEWA 5RUBA 1WX0A 2JKPA 4AVFA 5DT5A 2XIJA 5D05A 1MUWA 1F3EA 2JQXA 2VP8A 4BEUA 4QQ3A 1SQ7A 4C1KA 2DZAA 2F2HA 4IL0A 4O11A 1WA3A 3NQGA 4A8NA 1OYBA 1B9ZA 4DXKA 5ABEA 1TV3A 1TMQA 3R10A 4CU7A 1ICPA 1KFCA 3AQUA 1UKOA 3LSBA 1WNOA 1E6SM 1IXQA 3DECA 3M5XA 4IFRA 4IQLA 4XAFA 4AU0A 1TJ0A 1EC9A 2ZKMX 5XINA 4NSBA 5LXXA 2YXGA 1KRAC 2PWEA 4MB1A 3RPMA 2WHJA 4OZOA 2DIKA 1E6NA 1WKEA 4DEFA 1XD0A 4D9PA 4RL3A 3NIYA 2BXVA 3QMSA 2QJHA 1DE5A 4QM1A 5ABGA 5H2ZA 4A8IA 3G1AA 3IPWA 4AH7A 4NJKA 1OK6A 3NCOA 3U8GA 4GY1A 3ZM8A 3VA8A 5I3JA 1LRNA 1WDPA 4GH1A 1UW9A 2VGFA 1H62A 4O14A 2WSQA 3LHUA 2WNWA 4QE4A 4V28A 5TAOA 3EPNA 3IGXA 3IEBA 3LTSA 4J3UA 3WMBA 2BOEX 4GUFA 3OQEA 4CCEA 1Q8AA 1WDRA 1W3TA 3W2UA 3HZ3A 2UWFA 3G1XA 2QLYA 3VMNA 2NXHA 4R7JA 3UG5A 4CKQA 1BRLB 2X05A 4OHQA 2EJAA 5E1QA 3BMWA 1X6LA 3PANA 2PDUA 4M3PA 2NQZA 3MV11 5D9PA 4P7RA 3AS3A 3FV9A 2D69A 2P53A 1UQZA 3CH9A 1EF2A 4MSSA 1PTDA 2PWGA 2NUYA 1Q6DA 4BF9A 1D2KA 2ISFA 1BQCA 2D3NA 3N14A 1PZ1A 4H2CA 1EIXA 4C6OA 4A3YA 4ZE5A 1KTCA 3DC8A 4AHOA 5I02A 3A4XA 1TQXA 5CLTA 1PX8A 5B7ZA 2PGFA 5ENLA 3AWNA 4IMGA 4YN5A 4HNCA 2G4JA 3VGFA 2XUCA 3ITOA 2P0OA 4NNBA 3GR8A 3DZ1A 3ARWA 4EF8A 2Z0IA 5AN7A 1W1A1 1SW7A 2FB3A 2ZDRA 1R9ZA 1UIPA 4IFKB 1KM0A 3WLNA 2OZ0A 2VGBA 6A3HA 4PCSA 1UMYA 1BVZA 1KXVA 3MHUA 2VEIA 1K4GA 2PDBA 1UQYA 3NO1A 5LIWX 1L6GA 3DDMA 1VLIA 4JKLA 1TJ2A 1V3IA 3PBUA 2POZA 1GKQA 3P67A 3KL5A 3VDGA 1TPC1 3N73A 3NG3A 2CLMA 3OZYA 1P48A 3TTYA 3B0YA 1CI1A 3ARTA 5FAJA 3EWYA 1OWQA 2Y63A 1ADOA 4ZO8A 1S38A 1JGMA 3EMZA 1EP2A 3CZKA 3KE0A 4GNJA 4O17A 3DFTA 5HANA 3I68A 5CJMA 1H51A 2BFGA 1P6CA 2J47A 1FA2A 1UP2A 3LUTA 1XIMA 3KLLA 1F6KA 2B4GA 3QFWA 1UOZA 1UKTA 1BD0A 4EVZA 3LGEA 4ASTA 4HN4A 4S38A 6CGTA 3W7CA 1G4EA 5AYYA 3ES7A 1IR2A 2NX3A 1J2BA 4FI4A 4YLWA 3G0UA 1LQ0A 5C70A 3U2EA 3FAWA 1R86A 4P7QA 4A3QA 2ACSA 2J62A 3R89A 1TCDA 1FWCC 5DFAA 1B30A 2A21A 4GIAA 4F8XA 1KO0A 2PDWA 4EPBC 1SVDA 1HFBA 4LC6A 3RLGA 2OB3A 4Z2JA 2VR2A 3WEOA 2AAMA 1VRDA 1HG3A 1NDVA 3TYUA 1W1IE 2PDQA 1E9IA 5G2HA 5KINA 2A7RA 1Q5MA 1DTNA 3P84A 1U2YA 3AHTA 1HZYA 4AEOA 4RJEA 4IH3A 4LF1A 2QXWA 3W75A 2P0IA 4GUHA 4FK9A 2D20A 1EWEA 4Q33A 4XZNX 3FLUA 2GSHA 3K8KA 3AYTA 3VKJA 5KETA 4Z08A 4IQJA 2WC3A 3LBMA 1VP5A 2FTPA 4WIWA 2DZBA 3E0WA 3UEQA 2NQHA 4MAVA 1E5NA 1M1BA 1YRRA 2YB4A 4IISA 1VPXA 1V02A 1UR0A 7REQA 2QMKA 1ISVA 1JI1A 3S46A 2G41A 3E12A 7TAAA 2AOSA 4PMOA 4P5UA 5A6JA 3LCHA 4LY8A 3LU2A 2V82A 1BVWA 1RQBA 2J78A 3KFTA 3QHNA 4MWAB 3RCYA 1KM1A 3GB6A 2R1PA 4L56A 1CLVA 1OC6A 1V3JA 2W92A 4GIYA 3MMWA 3WH8A 2E67A 3SBFA 3T9PA 3B04A 1WBHA 1YBQB 1O5KA 3KTXA 3N3TA 1H5YA 1TZ9A 1EH9A 4JCMA 1CLKA 3EKLA 3MP5A 3FSTA 3W7HA 3OHIA 1WZLA 1E15A 2OKOA 4V1XA 4YTRA 4URIA 1NELA 1XRFA 3LENA 4C1NA 2OG9A 3CNYA 3GY1A 3A22A 4H6QA 4WKFA 5C5YA 3VILA 2HRWA 2XM1A 4PC8A 4TMBA 3NPWA 2YOCA 2Z1XA 4XD5A 5DMLA 1S39A 5BXRA 1UCWA 3GHRA 2ABAA 1A5AA 3NQVA 3TTSA 2A2IA 5C7VA 4OECA 3RM8A 3TW7A 5EBAA 4QGCA 1XLIA 4B3KA 2RDUA 3HN3A 1DQUA 1CECA 4Q32A 5U4NA 4KQNA 4PBEA 2GSEA 5KZMA 4S3DA 2Z28A 1KLYA 4ES4A 4D6JA 5D30A 3VIJA 3LCLA 4V15A 1Z6KA 3UGVA 3E0IA 2HPIA 2R9RA 1V3LA 3L0GA 4BF7A 1EX5A 1G69A 4OBTA 3BWWA 4C6MA 3D0CA 1OFQA 3CO8A 3GHUA 4DAFA 1UR1A 1RJQA 4WQ6A 1XRVA 2HBVA 1LCOA 2RDWA 2OKTA 4ZQOA 4O4WA 3GR4A 4LUSB 2BY3A 4Z17A 3QGKC 3AOFA 2YCEA 3T40A 1C3FA 4L9ZA 4B5XA 2BVDA 2VVSA 3CGTA 4B90A 3VKKA 4D6EA 4Y8FA 5T8GA 1YIXA 3EDKA 1A3WA 1EC7A 2AL1A 3AZSA 3SIZA 1ECQA 5FF2A 1B3ZA 1H4PA 4GI9A 4KESA 4HIBA 1K9FA 1XM3A 4LUIA 4R9XA 1JRBA 2WZMA 5GVJA 5TBOA 4QITA 4DELA 2QAFA 1XDJA 5M03A 1H3GA 1BVNP 4XB3A 4HHPA 1EHNA 1XUZA 2IUZA 2QS8A 3RXZA 4YS1A 3OA5A 2W0UA 4I90A 2O7QA 2Y7GA 2JFEX 4GI6A 2J9YA 3ZWTA 3A3WA 4W89A 1NWSA 3MWAA 4D8ZA 1RQEA 1PBGA 3N1AA 4O53A 3TNOA 3SM0A 1FCBA 3TMLA 3N12A 5G4WA 1HP4A 3F4NA 5CC7A 4LF2A 5GNZA 1TA3A 2VRJA 3AUOA 4E38A 1G67A 3S2NA 4B5WA 3BSGA 3N2CA 3FN9A 3WNNA 2BXYA 1HF6A 4UCGA 1RJRA 4XZMX 4D1JA 1SSDA 2Y7DA 4PUDA 3UNTA 5BRBA 2VX4A 3S6TA 1SMAA 3BMVA 4Y6GA 1XSKA 3EGJA 1KFEA 2J7DA 3NURA 4AYGA 4KF1A 4M6VA 3VKDA 1SFJA 1OC5A 1DWAM 4W84A 3S5OA 3BAJA 2ZRYA 1XH0A 1POKA 3H22A 3NPUA 2OXNA 2CHOA 2A3EA 3FEMA 1AMYA 3SFWA 5D8WA 2F8QA 2A0NA 2NZLA 4PUEA 1XQKA 4TO8A 2WBGA 1KM2A 1I1WA 3K8MA 1W2VA 3TJLA 3ARVA 3N2MA 3P74A 2DIJA 4DLFA 2G3FA 4CGTA 1QO2A 1XD1A 4O0KA 1C8YA 2VZSA 1F8MA 3WMLA 3N29A 1OABA 4R53A 3GUWA 1TPWA 3MU7A 4F9JA 1XIEA 2QJGA 5BOOA 1E9ZB 1T0OA 5E0FA 5FL0A 3DYMA 3KWSA 3PJXA 5FL1A 3UA4A 3LCWA 1VKFA 4C6LA 4JX4A 3R43A 4HZMA 4L9XA 2BGNE 2D23A 1Q6LA 3B06A 1NFGA 2DIEA 4MGGA 1QPOA 1KGXA 2Z25A 2DZTA 2DJLA 3VCNA 2FHBA 1RP8A 4NX5A 1O1ZA 3KVJA 4UQDA 3UWQA 1PHQA 3TLQA 3WH7A 5EBUA 4WK9A 4A3UA 4P8UA 3OVPA 1Q2RA 3MZ2A 1W9XA 3QVQA 1XGEA 3KUMA 3QV9A 1PPIA 1O5QA 2YSWA 4O12A 2DUAA 3VMOA 2DZVA 3C3UA 2E6AA 4WKAA 3T05A 3KS5A 1U30A 3MVTA 1Z89A 1UKQA 3EOSA 2D3LA 3ANYA 5ABTA 1XYFA 3NDYA 2PTXA 3W0KA 4HYWA 4FPSA 1KV8A 4DYJA 2VELA 4YTQA 3IUIA 3VC5A 1XUUA 3ZVHB 4FXJA 5C9WA 4O10A 2NLIA 1Q2SA 4CN6A 4H9MA 1AVAA 4UMCA 1LBFA 3NQ2A 1Y5WA 1XGDA 1FBAA 4Z1YA 4QLKA 2W61A 2R94A 3IJ6A 4H6KA 4UTWA 4GX8A 4QEEA 1YDNA 1SJDA 1O5XA 4MIMA 1YX1A 4F3HA 3GG1A 4S3FA 1JCMP 3T8LA 4MYAA 4ZB2A 4QEHA 3A12A 4ZZ9A 3G3MA 4U33A 4ORMA 1K6AA 4DJFD 3LV5A 3ZS4A 3FW6A 2RUSA 3QW3A 2XPKA 5DLCA 3Q65A 3ZLFA 4B2DD 3RU6A 2J77A 1CX9A 1X98A 4M7SA 4D6IA 1H11A 1S2WA 2D0GA 3PWAA 4XAGA 3AXMA 3E02A 3JZEA 1QCWA 4XTIA 4ZVJA 2YL8A 1OFRA 2HBXA 5H6HA 3SY8A 2ZZ5A 2GDVA 2E0PA 3WD1A 4KEMA 1UUQA 4X2PA 2ISWA 4WY0A 2VVNA 3RGTA 3FVMA 3SCSA 1POJA 2O7SA 3W07A 1GVYA 1JDCA 4TV5A 1JD7A 2EPHA 1JJKA 4YWSA 2FDSA 3F5LA 1B57A 2IPGA 2NQJA 4PTVA 2G0WA 1Q7ZA 4QJ4B 1UR3M 1F8IA 1UJPA 3DAQA 3WMCA 4MZ1A 4GK8A 3LHYA 5FEPA 1AW2A 3UJEA 3R4IA 4HT3A 4M0XA 3TA9A 2I5QA 3LA4A 1EB3A 3W3OA 1GVQA 2J25A 4DZ5A 3HJZA 1XYLA 2QJNA 4UC5A 3APYA 4H04A 3BLKA 3U5UA 4F2BA 2VHLA 3AZRA 2NQ9A 1OCNA 1N2VA 4MKNA 3AYRA 4S2CA 4OE7A 2F2KA 4FX7A 4DWSA 3D47A 1YPIA 3WUBA 3KXQA 5FJRA 1W5OA 3TQPA 1TPH1 2R1NA 3G0SA 4YIWA 1H09A 1ONXA 1UC5A 2VX6A 4LBSA 1UKPA 1ZBCA 3Q58A 3A24A 4DJEC 4JN8A 2PDPA 3TIMA 2BTMA 5DELA 1E0TA 1R2SA 3MKKA 1FWAC 3NR0A 3QGAC 4HP5A 3GM8A 3EB2A 5I24A 4QDMA 3QEZA 5HPCA 1KM3A 2Z2AA 3H2AA 3SSZA 4C6NA 1MXGA 2YW3A 3MVIA 4JTDA 4PRWA 3W01A 1OGSA 5JQ9A 4B4HA 1E71M 3ARRA 2WSYA 1SJAA 4W88A 4QFUA 4PCPA 1ONEA 3W85A 3WLPA 3PG8A 4DWSB 1QTWA 4OBRA 4OQVA 3PUDA 4QLJA 2J7BA 3UG8A 4S39A 3S2MA 3LSCA 2WNNA 4PMXA 1LQ2A 4W87A 1OF6A 1KD0A 2WZEA 4O18A 1MZRA 3V5FA 3UVIA 2OSWA 3RR1A 1EA9C 3IAPA 3MO4A 2Z2UA 1LYXA 2J6VA 1T7LA 3LBCA 4JTTA 3V3WA 9XIAA 4E0CA 3N4AA 3VNDA 1MQQA 4LB3A 3F4VA 3LHTA 3H7VA 1XWYA 1OF8A 4JTEA 1Q65A 4JTSA 1E0VA 2INEA 1R9YA 4HMCA 3WO8A 3LXBA 4WSJA 4Q4QA 4UFLA 5M2FX 4CNUA 2ZRVA 4MTVA 4H2HA 4ICMA 5CBBA 2FZBA 4W7VA 4S1FA 4GIRA 1LBMA 1O12A 3S1XA 2XZ7A 4XKYA 1TTJA 3VIOA 3KVLA 2YFNA 4XTDA 4JD4A 1X6NA 1G1YA 4Q4PA 1AK5A 2BXZA 3DH7A 4EF9A 4D6FA 3TYEA 1AD1A 3DFNA 4X9YA 5H8PA 2QGYA 3WFLA 1S5TA 2VZVA 1RP9A 2OTDA 5LNVA 1ZP3A 1BF6A 1A0CA 2GSJA 2WJZA 4H00A 1JGIA 1GYLA 5GPRA 1MUCA 2DT1A 3UD6A 4INFA 3OJGA 2VUNA 3CWHA 1OFPA 4AX7A 2JALA 4MB4A 1TV4A 1JDAA 2XIMA 4A3HA 4JTHA 1XGZA 6XIAA 1JUEA 3WNPA 2VENA 3BAYA 4B3LA 3L7RA 1UHVA 3H7RA 3M6YA 3QQ1A 2PLCA 1IHIA 2IW0A 4IIFA 1FP8A 2XH0A 3UWWA 3TU9A 1TA3B 3LPOA 5HBFA 5CPTA 3CUZA 1L0PA 1VFHA 2CXGA 3FA4A 4DNHA 2YCIX 4C1NB 2ZWYA 2VEGA 5KEZA 3LPFA 3EOEA 2I17A 1CTNA 1ZL1A 4Q4RA 3SURA 1DJHA 4P7LA 3DYPA 4QP0A 4WRHA 4AD2A 1HO4A 5J8LA 4W8BA 2BG5A 5FJOA 3JW7A 1DIDA 2FTYA 1RUSA 4R88A 3KBVA 5EYWA 1MW0A 4HK7A 4DPPA 3LHWA 3PSWA 3CWNA 4PULA 2E7FA 5MHBA 1JCJA 2BHZA 2PBOA 5CCZA 3ENLA 5HNRA 3FGCB 4RW5A 3W22A 4E8GA 2IXVA 2V5CA 1JYNA 1XDLA 4G6CA 4UOQA 2PODA 4DUOA 4L4OA 2ALDA 4JQ1A 1N8IA 3AUJA 4IX2A 3KX6A 3SCVA 1GEHA 4GBUA 4UB9A 4AZHA 2FZDA 2HS8A 2Z6IA 3SCNA 4LBRA 2FVLA 4RR4A 4L6DA 2OSXA 3N9RA 4ZXOA 3ABZA 3R0KA 4CEXC 1KXQA 5H1WA 3TROA 3PZTA 3QR1A 3NUKA 3XIMA 1ZHAA 5L9FA 2VC5A 1IZJA 4NUWA 3NQEA 1T8QA 3WLKX 1WQ5A 1KCKA 1CB7B 2ZX6A 4FIRA 4K8EA 1XLHA 4I7VA 1PUDA 5D38A 3UZZA 3PZQA 3RLHA 4HCDA 6TIMA 3NSNA 3PZIA 2FMOA 3IV8A 3O3RA 2GJXA 4FLSA 1OHLA 1UH2A 4OWGA 1VBUA 4MNLA 3DHDA 3GD6A 1K8ZA 2X16A 4RZ5A 1FHLA 5LYRA 5D2VA 4ZFCA 3ICJA 1I1XA 1BYBA 3EX4A 2XSBA 4JEQA 5KZDA 1QBAA 3RLVA 5HINA 1R3VA 3W27A 5G4HC 1C8VA 2VRQA 3BO9A 4NHVA 1L8PA 5JXQA 1E0WA 4RXFA 4H9YA 3ZT7A 3EKGA 4M24A 1FWIC 2NVAA 4E2VA 3ZQ9A 3CAWA 4L1WA 2HROA 1KFWA 1F07A 3HV8A 1EPVA 2OLHA 2X09A 3BJTA 2Q8XA 3L5AA 2NV9A 1PWMA 5FF3A 4Q7NA 1X7FA 3DGBA 3LRKA 3SQLA 5AC8A 4LAUA 1ZPTA 1XYZA 3SY1A 4NVTA 1L2QA 4ZA0A 1XLJA 3VD3A 3SFKA 1LF1A 3MB9A 1QI4A 5HJYA 4JPGA 3VD4A 2OCZA 3WZ0E 3RHGA 4WJEA 1TV8A 2BOFX 5F4SA 3O6AA 4LBUA 3NTYA 2Q8ZA 4GVGA 1DJGA 1H5VA 1G9HA 3NO5A 5DRIA 2WWCA 3PM6A 4WUIA 1UROA 4LVGA 1O60A 2AL2B 2VZOA 3B0VC 1W3KA 2QDDA 2XH2A 2R24A 4AZCB 2QT3A 1TPB1 3P3BA 5DRCA 4XSMA 4IQDA 5FJPA 4UCFA 3GNDA 1I2PA 1ZBVA 3VGBA 3O6YX 2WKGA 4EPDC 4A35A 2C79A 4HPGA 4IX0A 1QOXA 2FFCA 2W63A 4NL1A 1V7AA 5EMYA 1JR1A 4O8AA 4Y9MA 4MUPA 1OADA 1I2NA 2CHNA 4TOQA 3THAA 4JBRA 4I6VA 1JVNA 5HNUA 2H8ZA 1TE6A 4QTGA 1FQ0A 1EF3A 2GK1A 1ZALA 1R2RA 1XIJA 3ALGA 1UUMA 3FS2A 3WDRA 3CYJA 3VZZA 2XZ9A 3U3HA 3AMCA 4YCPA 2W4XA 4MY8A 4GX9A 5BOFA 4DAIA 3ZIZA 3LTPA 1M7JA 2QEZA 1HJUA 3LTYA 4MVAA 3MUIA 1R3RA 4HQVA 1LDCA 5C9ZA 1PX3A 3RX2A 1JFXA 3T4CA 1XPGA 2XTKA 1LL4A 4YHGA 4JDYA 1R47A 3TOYA 4UTKA 2XFRA 3O63A 2C19A 4NT0A 2RKXA 5I5RA 5KSWA 3TOPA 9XIMA 3IIZA 3HG5A 2VQTA 5EMLA 1VEMA 5D02A 2QIIA 1PB0A 2H6RA 3W74A 3SR7A 4F0HA 2YZRA 2Z7KA 3I7QA 4XD6A 1JUBA 1V8EA 1TZ7A 3L5MA 4JTGA 4MWAD 3GNRA 2Q6ZA 3QR0A 2VR5A 4HZ8A 1GTEA 4J28A 3QBUA 2XJ7A 1SPQA 4LRSA 2EAWA 3W1MA 2GFTA 3NQ7A 1EHAA 1B3VA 1PVNA 5EB8A 1NF0A 4DJFA 4FP1A 4R7OA 1ZNNA 1ZZMA 4AEFA 3TVAA 1F61A 1VCGA 1AZ2A 1P1MA 2XVNA 3NNTA 3QV8A 4ZE4A 3N2OA 4G8TA 4I3GA 1O95A 4AG0A 4L6HA 4PTNA 4H9XA 3FDKA 2V5LA 1HKJA 3YPIA 2G96A 1J0HA 3THQA 2DH2A 1UD8A 3SIMA 3WN6A 1L6YA 5AHLA 4M81A 2X0YA 3PBMA 2DW6A 5J04A 1UD3A 2MANA 2QV4A 4AIEA 1EXPA 3BZGA 4MWAA 1HO1A 5BWAA 3PG9A 4IICA 2C14A 4B92A 3M0MA 4PBGA 3HQPA 4JKMA 3WCZA 4C7FA 2RDXA 4MJ2A 4HOZA 1R6WA 4PSPA 1LJYA 2GQAA 2WANA 2YCLB 4XZ9A 3WLOA 5A6KA 4HHMA 3EMQA 1Y8BA 5ABHA 2AAAA 3ITVA 2ZZ3A 3W26A 3AC0A 1DQWA 3QMRA 2VOMA 1ZJIA 1A5UA 3CPRA 1EJ7L 3TV8A 3IJ8A 3BQ6A 1F7BA 1MW1A 3GNPA 1MZHA 4DB7A 1W9BM 1KV5A 4NI8A 3ZJ6A 1OC7A 4S3CA 1IEWA 4XVEA 4GHRA 5DY3A 5JU6A 2VXNA 4BR1A 1BGAA 3GIPA 1TCMA 2Y7FA 4LCSA 4DY1A 1YDOA 3EKZA 2FGBA 3CQJA 3ORWA 3C0JA 2E9LA 5K9CA 4C6EA 3TQVA 1TV2A 1QW7A 1SZEA 4NAEB 3WK0A 1A3HA 2Z1KA 4JQAA 4JTAA 3PNUA 4A4AA 3PN8A 3OYZA 4NKCA 5FJIA 4MWAE 4K6AA 2E6YA 1LWJA 4JIRA 1DWHM 3QXBA 1AQHA 2PP1A 2BHUA 3LLXA 1FCQA 4BWLC 3LZ3A 4FXFA 4R7WA 4CU6A 2PA6A 1NY1A 3O2LA 5BOEA 1ENUA 1NDYA 5I2UA 4L7ZA 2Z7GA 1CYGA 3B9OA 2E1DA 3T1GA 1H7NA 4PZVA 4AB4A 1R3QA 1I45A 3UCDA 4UTFA 3BE7A 3EX3A 3W88A 1TX0A 3DN5A 3PY2A 1SZRA 3RJXA 2O9RA 3BAKA 3N4FA 3FY1A 5KZEA 2ZUNA 1TPUA 4JIQA 5D9NA 3CZLA 1A80A 1S5WA 4HU8A 3OIXA 5AVHA 2OT0A 1F05A 4LVDA 2VD8A 4HN8A 1X7IA 5T26A 4KRZA 1RD5A 1SW3A 3DEQA 4QROA 3W1PA 3U9IA 4OOUA 1ZENA 1R2TA 2DP3A 4D6DA 3OOQA 1MW3A 1HL9A 1Q6OA 3UYIA 4M19A 3MUCA 4L4MA 2W67A 3OW1A 1GVFA 3SAZA 5F2GA 2PDCA 2J7FA 4LCQA 4J3WA 3CYVA 3MUAA 2GVJA 1ZQ5A 5D09A 1OCJA 2WKLA 3SGZA 4J40A 3TTOA 3BICA 4LUSA 3B8SA 3EDFA 5HPOA 1IT7A 2GDUA 4UTMA 5CBIA 2FZ9A 3AXHA 2B7QA 1W6TA 3C8FA 2VZUA 1SJBA 2XGZA 5E0CA 4IPPA 4GFIA 3MO7A 3S9ZA 1FFQA 1M68A 2VR4A 5FF0A 1AUSL 1AJZA 2UZ9A 1YE4A 4IIGA 2PDIA 4E4UA 5IHSA 2PWUA 3W87A 3KLKA 4KFPA 4HPNA 4H83A 4XUGA 1E73M 4LALA 3KRZA 1J0YA 2ISSA 3NQDA 3M0XA 1DE6A 4JFWA 3WEZA 5C8BB 2IXUA 2PMQA 4XD4A 3FXYA 1RSCA 1ITQA 5HNTA 3NQ8A 3EDEA 1W31A 1YKWA 2YCKX 2XWDA 3NDZA 2DQWA 2OGYA 4O0ZA 1EPXA 4HBKA 1U5JA 5G1TA 3E0FA 3VDAA 4AIBA 4CNTA 1SZFA 2WNQA 1E70M 3M0VA 2PF0A 2DSUA 3TDFA 3M64A 4TX8A 1EOMA 4JXCA 4O8RA 3GBDA 1MXDA 3FFSA 1NOUA 3F2BA 4GINA 2O9PA 1PTGA 4F2TA 1ZAHA 4FNTA 1YPXA 3JZUA 1LM1A 5HQLA 3FNDA 1TELA 1XG3A 5D04C 3W1QA 1NAL1 4JICA 3ARZA 4C6JA 3IIPA 4WX2A 3LLDA 4LC8A 5HR7A 5TF0A 1LOSA 4MPKA 3OVQA 3PK7A 1RCOB 1REQB 4RDVA 4UTUA 2XDFA 3WF3A 4RNFA 2WSKA 5HQMA 5CPLA 2UV8G 3AHVA 2BHYA 1E43A 4LTSA 1R8LA 3WY1A 3KOYA 2HZGA 3VFCA 3W1RA 4KIEA 1EYWA 1A5LC 1PKMA 4W8AA 3TR2A 1J2WA 4PUWA 4MZYA 4AWUA 3ZMRA 3IVUA 3UA3A 1GPWA 2A5HA 1HL8A 3SCOA 3WK3A 2A3LA 3WLRA 1Q6FA 1FP9A 1OZMA 3LGGA 4LNYA 5I3HA 3K13A 5FJTA 2NVDA 4J3SA 3P5ZA 2J6XA 2WO5A 3H21A 2I5IA 3CEUA 2NQ5A 1CGTA 4AWEA 3VZXA 3W24A 4UUIA 2Q3OA 2X0SA 4MLRA 4I9AA 3CMFA 2WMKA 4KRUA 4M7TA 4PN2A 4RDZA 3M16A 2GUUA 3W7MA 1XLFA 1BYDA 2G5WA 1SU5A 3C4UA 3P2VA 3H53A 1GEQA 1VZWA 3DOPA 3VGDA 1Z9AA 4ZO7A 1ZRQA 3OLGA 3UESA 4CQBA 1AQ0A 3DFYA 3VM5A 4XQ6A 3LPPA 3TXVA 3VC6A 3SGUA 3R5EA 5HWJA 2I14A 4B5NA 4PUKA 1NQ6A 4Y96A 1HTIA 1JQVA 4YWIA 1P6BA 4HYVA 3M5VA 3P0WA 3C6CA 1CXHA 2INFA 3AXIA 4DF0A 2ZUUA 4RUBA 4M6PA 2Y70A 4PMVA 2WCAA 3T42A 2HNEA 1HJWA 3NGJA 3P62A 2FIQA 3UVAA 3L23A 2DSWA 3A23A 2OSYA 3RO8A 3M41A 2B31A 3C3NA 1ZFJA 2PEVA 4HPJA 1XG4A 3T2OA 2PZ0A 1EOKA 3U0HA 3QSRA 3U7VA 4EPKA 4B5SA 1J96A 5EMMA 3K4AA 3H24A 5JMUA 5EPDA 1J8VA 1T8XA 3GWQA 2NXIA 4XIAA 4F0LA 1C91A 4GZJA 5HMEA 1KCLA 4WDXA 3B3DA 4ERAA 5EFFA 2EJ1A 4MNMA 1ITUA 3NVTA 2V2HA 3G1YA 1EJXC 3SO7A 3HU7A 2QHAA 3R58A 2ZA1A 3AU2A 5AHNA 3VD9A 1YNQA 4LV9A 1Q4NX 3PUOA 2G3MA 3CT7A 1JL8A 4KT2A 3GU9A 2YBVA 3RRXA 3F5KA 1Y65A 2WV8A 4DO7A 2OT1A 1NP0A 4JZ5A 4AZ7A 1UZ4A 1KBJA 4KBXA 3AJ7A 2Q01A 2QKFA 3UG3A 4PMZA 2PP3A 2O92A 3R79A 5E0KA 3GFZA 4IL2A 1VIWA 2AQOA 2Y2WA 1H0IA 4LX4A 2BBFA 4J3VA 3NZRA 2PF8A 4ZB0A 3VOIA 1PEZA 1R0MA 3VCCA 3HPSA 2DU2A 4AVOA 1GZ1A 5I6SA 1DJXA 2E4TA 3BK0A 1UD4A 3A4AA 5A8OA 4AXKA 2C15A 4GQBA 3K1DA 3G8EA 5CSUA 1RPKA 2RH9A 4OU1A 4O1EA 2ZDSA 4PMYA 4M1RA 2FZ8A 2A3AA 1VCFA 1DKWA 2XN0A 4Z1DA 1K9EA 3QKZA 3L66A 3BLFA 1M53A 2DVXA 2CYGA 7XIMA 1GCYA 1JDDA 2W91A 2VFGA 3BW4A 3IJLA 1V08A 2ZIDA 4EAYA 3AMKA 4MAZA 1Z42A 2EG6A 2VC9A 4AMAA 2PPGA 2QCEA 2YBTA 1F5ZA 2E25A 2Z2BA 2V63A 3T6CA 1X6UA 4ZL1A 3QW4B 1GVSA 3K1GA 3TWBA 3PPGA 4NJHA 4DO6A 5EMJA 3UERA 2EPNA 3OU8A 1H7OA 4RE0A 3LPGA 1EYEA 2OX1A 5D03A 2V69A 1FWSA 4LT9A 3LG3A 4F4RA 2ZYFA 1M7XA 4AXNA 1TFVA 4YL2A 1TUFA 5B80A 3LERA 3VCRA 4AZGA 2MNRA 1T96A 3TX9A 4FNUA 1FWDC 1VFUA 1BG9A 1CBGA 4IP5A 5FESA 4C6IA 3QOKA 2WCSA 1KFKA 4WGHA 1R3SA 1PO9A 5KZ6A 1HQTA 3KCLA 5CGTA 1LRQA 3UJFA 4AD4A 2WVSA 4IGHA 4H9VA 1I2RA 3URNA 2HXTA 5REQB 5IBXC 4GA8A 1A0EA 1PKLA 3PB2A 3WQWA 4WY0F 1BXNA 3DU0A 1W0MA 1H41A 3GAYA 2A79A 3CL7A 3COTA 3VOCA 3MSGA 3UYCA 2GOUA 3AJXA 2R1LA 3GVQA 1RQHA 2VO5A 3KVKA 3APGA 1OG6A 3AO0A 3ISIX 4DM2A 4FLOA 3EWDA 5KMYA 1JPHA 2HWGA 2VCBA 4C60A 2YDSA 3B0PA 1HGYA 1CIUA 1X96A 3I4KA 4D1IA 2C6QA 5BYWA 1OX5A 4TV6A 4HSOA 4EAMA 4ZBCA 3GXNA 4E4PA 4B4FA 1OM0A 1FWTA 3FDGA 4RPQA 1J01A 1AG1O 4N2YA 1JAEA 3RYSA 5IDIA 3GIQA 4LS2A 2GJPA 3PPFA 3N17A 5GJMA 4M80A 1UZHA 1KQYA 2VWTA 3SQMA 2KX9A 3O9NA 4UTTA 3J7HA 3W7EA 4U3CA 4ZSTA 2L5HA 4GZIA 4DUXA 3NL3A 1QNQA 1IWPA 1WE5A 1DXIA 5G2WA 5EFDA 5D33A 3W72A 2CITA 1HJVA 1IXNA 1KA9F 5AHEA 1ODZA 1WB0A 2ZRWA 2E09A 3UR7A 5BU6A 5CJ5A 3BJFA 4AYSA 1W5QA 4MFDA 5G5IA 3DG7A 5G1YA 3A4JA 4MADA 3HPFA 2PDGA 4AF0B 3NL6A 1XXXA 1J5TA 3RR4A 4BI7A 4Z2GA 4DXXA 3S2LA 5C0QA 4GNVA 3W2JA 3E0LA 2NX1A 3W7KA 1LRTA 1TO3A 3DKJA 4K68A 4GC3A 6ALDA 1L2UA 1US2A 3GC4A 1AH3A 4Y9OA 4F48A 3EBVA 1RXOB 2GGGA 1GQIA 3EYPA 3AHZA 3BDKA 3UJRA 4ICCX 1GYMA 3OLDA 4BK9A 3WLTA 4LEFA 3OVGA 1FY6A 3ZJ8A 2HXUA 3ZR4A 3LGDA 5AC4A 1FXPA 1YTEA 2YDAA 2VFIA 4AVNA 1L6WA 1DEDA 4XZIA 5HWMA 4UQBA 4O4VA 3ME3A 3ABQA 4MJMA 4UFMA 4I8YA 4LANA 1YTKA 5GJNA 3WF1A 2VYOA 3GH7A 4CQCA 4GE8A 4UQEA 1NQKA 3NQAA 4HMNA 5DY2A 4US6A 3VNKA 4YU1A 3VNIA 2X1RA 4LVFA 3GLCA 1ME9A 3E2RA 3CAVA 5XIMA 1PDZA 2E5DA 5LNWA 8XIAA 1ELSA 4PMRA 1AD4A 3S1WA 4S3JA 1QAPA 2HVNA 1R7OA 2DJXA 5I3DA 4DHGA 3W38A 1EFZA 3WENA 3WLQA 4XSLA 2AL2A 1MRAA 3S2JA 3UXDA 1KGUA 3A5VA 2P3EA 2QULA 1VEPA 3GXIA 1J11A 4IQEA 3PBWA 3WJYA 2PTDA 3CQ0A 2HISA 3WLJA 4YJ5A 4JTKA 1NU5A 1UR8A 3FGCA 3FXGA 3QC0A 2NUXA 4BQ2A 4RX0A 3SUUA 1GJWA 4JY9A 4NZ1A 3TONA 3LZ5A 2VUYA 5A2AA 2X2GA 1XC4A 1HKMA 2CLPA 1OVDA 5HJLA 1G6CA 1EEPA 2ZRXA 4GCXA 3EX2A 3T07A 4UTJA 4LCRA 2EKCA 5MKGB 3WQOA 4DZAA 3UETA 4J2MA 3EA2A 2XM2A 4GVFA 3PHAA 4JFVA 3UR2A 3DYOA 1Z8AA 1JAKA 3M0JA 3HO8A 1V6VA 4N42A 3VU2A 2VQUA 1XLCA 1A5CA 2UY2A 1P0EA 3UP8A 1ZB5A 1WXZA 4BFAA 4DBSA 1IIHA 2H9AB 3M0KA 4E2OA 3BVJA 4DJDC 5H91A 4IP7A 4NQ1A 3LQLA 1GOWA 1GVEA 3UT0A 2GUYA 3KTCA 3H12A 1QPQA 2QUNA 5HA7A 2GOKA 1OFOA 4K1GA 5CC3A 1OD0A 4OV4A 3WQGA 3GG8A 5F1UA 5A3HA 4HD5A 1PAMA 4NX0A 2GVEA 1QASA 5A94A 4ORIA 1M3UA 2ZZ7A 4RE3A 1UG6A 1KQZA 4P61A 3IGSA 1DJYA 4ATLA 3O7UA 1QATA 1XPYA 3AMLA 2J7CA 1D3GA 3VKAA 3IRSA 4J35A 3TLLA 1YDYA 2J9ZA 1BTCA 1DIKA 2VT0A 3EWCA 4ZQPA 3KZSA 1DWJM 5FACA 1PIIA 2VOTA 3SCRA 3ZSTA 3MJMA 2H9AA 3GDTA 3UXIA 3IIXA 1ZAIA 4LYPA 4Z2IA 3Q94A 1IEVA 2C18A 4S2BA 3REQB 4UQCA 1XFCA 4N6FA 2XH4A 3IJDA 1JD9A 1BXBA 1OCQA 2PWDA 4REQA 3GW0A 5IFPA 3VDBA 4AY1A 3CB3A 3NYZA 5IOBA 2BB0A 1UBPC 2J13A 5CC5A 5A69A 1CXLA 5D2TA 1JCLA 3LM7A 3NWRA 1S2UA 3II1A 5FEZA 1WUEA 1G94A 3UW6A 4GJJA 4LH8A 1B2YA 3N19B 5CAHA 2VFHA 4LYQA 4ZQNA 2REQA 1HKIA 4NF7A 5TQLA 3B8DA 2E6FA 4CCZA 1SGJA 4B5VA 4A2SA 1EZ2A 4MHBA 2C13A 1F4HA 4UTHA 3L4UA 4C6BA 2NUWA 3WG6A 1VBJA 5MF5A 3HQ1A 2H3BA 4NZJA 2PSNA 3WLHA 1KM4A 3SUSA 1AW5A 1QNOA 3ZT6A 3NFUA 2JGQA 3SN4A 5K3VA 3UPBA 2DY3A 1QI5A 2E68A 3V0UA 5C9XA 3HQNA 1OGBA 4J4KA 4JAWA 2V0TA 3VDCA 2J8GA 3NSMA 3A21A 3LQGA 3NM1A 4YHEA 1XYAA 1GZGA 3APTA 1TB3A 3ZXWA 4K38A 1DIEA 1W56A 3MSYA 4I6KA 1QHZA 5AHIA 4JNMA 3VNLA 3AHXA 2YA0A 3O1NA 3W76A 3OEXA 2XH7A 4L5ZA 1KCXA 4QAIA 4AIUA 3GQYA 3N9SA 3N6QA 4E5TA 4GG9A 4AX6A 1W1ZA 2ZZ1A 1OT2A 1YPFA 1XCWA 4A8RA 3E49A 4MM1A 4GY7A 4ALDA 2VDHA 3RCMA 5JIWA 3GXTA 2Y85A 1PSCA 4NZ5A 1ZJBA 2X7WA 3R12A 2C3ZA 1JZ5A 3W2KA 8TIMA 3RCNA 1JRCA 2E6DA 3A3HA 4PCTA 4KERA 3AS0A 3TC6A 3H55A 1EDQA 1GG0A 1FH8A 5EKYA 1B3OA 4PTXA 4FOUA 3T8QA 1C29A 1FWRA 5C2XA 4XO7A 2TODA 3SRFA 2ZUVA 3H8AA 3M9YA 2F38A 4QG9A 4U4MA 2GQ8A 3FJ6A 3AIBA 4TUFA 4FAMA 1ADSA 1IEQA 3E74A 1UB3A 3BXWA 4KEUA 3N25A 2C8NA 4W7UA 1GJPA 1UA7A 3WDJA 3CHVA 1H0GA 4UNIA 3TR9A 1HJXA 1ISYA 2C1GA 3W9ZA 3NXLA 4MF4A 3CAKA 3B40A 3VIHA 5C54A 4JFSA 4RV8A 4JTCA 3AROA 4U5KA 1TRDA 3CWOX 5BNKA 4JTRA 2VI0A 1CCWB 4IFOA 2EQDA 2FZNA 2GJRA 3C2EA 3ZSSA 2ZICA 4I8DA 1DPMA 4BS0A 3GFXA 4BI6A 1VS1A 4IMCA 3G22A 4HPHA 3I3EA 3C0LA 3LCGA 1R3TA 4N7QA 2HTMA 3SRKA 2TMDA 4HTYA 3ONCA 4MB3A 2VC6A 4ZO9A 3FSUA 5DMYA 3R2GA 1GQLA 4KS0A 5E9XA 5D9OA 1TIMA 2VDGA 3BTNA 5CXPA 2C1HA 4GISA 1K9TA 4PUMA 1BXCA 3WNMA 2I9EA 4JOMA 4Y2WA 3A9IA 1QI3A 4NZCA 2BP1A 3L5LA 1E6RA 1U5HA 3N2TA 2JEPA 1GPFA 1GWJA 3QHOA 4K3ZA 3LM3A 2ZBTA 4DVOA 4V27A 1U83A 3C8NA 2PE4A 3OHMB 4PRRA 2GJNA 4AWSA 2Y89A 3KHDA 2CLFA 1RY8A 1C92A 1X8CA 4QX4A 1EX1A 1XBXA 2ZZ6A 2P8BA 3WIJA 3M7WA 3OG2A 4NAEA 1WAWA 3V36A 4KGLA 2NX9A 3C2YA 3UXAA 3W7RA 3TYAA 1J12A 3TYDA 4E4FA 3ZZ1A 3L0NA 2WK2A 2WOQA 3R6IA 3BLIA 2HE5A 3R1ZA 1VAHA 3UZWA 5IBXA 4IOTA 1U1HA 3MQTA 2HPMA 3VABA 5B7YA 2PUZA 1K7FA 3NQFA 1IT0A 3QRHA 4G2DA 1X39A 3CU2A 1JCYA 1Q6GA 1BWVA 1M9HA 1CPUA 2PDMA 1E6XM 4R33A 4LVAA 2ZADA 2V6AA 3G1DA 3TQKA 1ISWA 4MNJA 4XO6A 3KDOA 1KCZA 3KP1A 1EJWC 3N3MA 2WB5A 3P0XA 1OFAA 2GGJA 1OYAA 5AC5A 1EL3A 3KRUA 2WJFA 1KTBA 3WEMA 1ZY9A 3GTIA 4UOJA 4UR8A 4GABA 5A8GA 4KCTA 1JDFA 3W23A 3ZJKA 4KWUA 4O50A 1S1RA 2E9MA 3K4DA 3BL3A 6XIMA 2FPYA 1QFEA 1R7AA 3P8JA 1PCKA 3DBPA 3BLOA 4OBSA 1V03A 2QCGA 3Q37A 1VFOA 3F7JA 4S3AA 2ATSA 2EPKX 3VKBA 3GXFA 3MUY1 4XG1A 4UFJA 3GVRA 4KRTA 5LXEA 1OYCA 3DFPA 4S3BA 4HGXA 1F6PA 3QSTA 1SM9A 1NH6A 2WW5A 2YA1A 2I16A 4L9YA 2C1IA 4WSKA 2NWSA 2NWRA 4FNQA 3AISA 3VGGA 2VRKA 2PD5A 1KFJA 1XFBA 4CD6A 4S3KA 3AIRA 2XHYA 2QGHA 3OBKA 3GNXA 3H2MA 3CM4A 2ASHA 4N4QA 5MKGA 4NNAA 1QRQA 1F4AA 2CC0A 4C1LA 1NJJA 4H6EA 1TWDA 4Y7EA 4MYXA 3A64A 3IGHX 1R46A 1RK6A 1VGAA 3SN0A 1ONRA 3TUUA 5IHRA 1W9UA 2WM0A 3G1VA 3R8HA 2QNEA 4H19A 2HDJA 1ZS2A 3CIWA 4R34A 4F9DA 4WDUA 4N6EA 3CV7A 2OMAA 3RNDA 3RK8A 1KXHA 5F4XA 3B97A 3BQ5A 4PTMA 3TYZA 3ANVA 4LY4A 2WWDA 1P0KA 5M5DA 2ZXQA 1WDWA 4FLQA 5TNVA 5JBDA 4RZ6A 3JS3A 3IK2A 3AMDA 1NDZA 2HEJA 1UD5A 5CG7A 3ABRA 4FXSA 3UF9A 4ZMGA 1W1TA 4F0KA 3BGGA 2H90A 3QTPA 1S3HA 4YCOA 1TTQA 4UNLA 5BZAA 1M5WA 1WXYA 2E40A 2QVNA 1CXFA 3AFBA 1LG2A 4FA3A 1IXOA 2ACUA 3UJ2A 3U2OA 2PB1A 3B8WA 3TYCA 3W7JA 2DEPA 1VPQA 4DBEA 2GK1B 1V0NA 2ZE0A 3W7QA 3P81A 4DJEA 4IM4A 4LB4A 1SYTA 4FOJA 2VGIA 4PSRA 5ABFA 4TVUA 1RBAA 4FO4A 3ANUA 3DXIA 4HNUA 2CBUA 3TN3A 2TAAA 2DZUA 4CEUC 5HK4A 4RZBA 1P0NA 4YPJA 3QZ6A 1XF0A 4LAMA 3VUPA 5KTLA 1KRMA 3A3XA 2VEFA 4G7EB 1WXJA 4H4IA 4PFMA 1YNPA 1QT1A 3LX9A 2E9BA 1QNSA 2QUMA 3VOGA 3GH5A 5I79A 1GOKA 3T0BA 1OX4B 2C0AA 3P80A 4ATWA 3HG2A 4WSHA 1A50A 1TJ1A 4PL2A 2OEKA 5DMNA 4M82A 1XIIA 4M8UA 2RAGA 1XH1A 2I5GA 1REQA 2DGAA 1XINA 4ZGYA 3EWXA 4W5UA 4G1KA 3N34A 3A13A 4LU0A 3GR7A 4JTFA 1KFLA 4ERGA 2FHCA 3POCA 4QR6A 4GACA 4RNIA 4IUOA 1FCUA 3SDOA 2RGLA 4H8VA 1H49A 4JKKA 5D32A 2GLKA 3P8IA 4ROPA 3PFMA 3CPUA 1Z3NA 1VR6A 3GXPA 4TR9A 4HOXA 3OLIA 2VCAA 1UKSA 3D3AA 4B9ZA 3DERA 2RJHA 3SZ8A 2DZXA 3ARXA 4RZ4A 3WK1A 3C52A 3WD2A 5HULA 3G1FA 4NAFA 3LD5A 5FEWA 3QZAA 2F7FA 2CU0A 4R9OA 1E3ZA 4QNEA 1YXCA 2Z24A 4AAJA 4QG8A 3EWWA 5C6MA 1MXSA 3PUEA 3WDHA 5DQPA 1MUMA 2OODA 4CUCA 2C71A 4GQQA 1T41A 1OX4A 2V30A 4YTSA 1V51A 4BA0A 3M0IA 3CIXA 5F2LA 1V3KA 4NZFA 1WDSA 3W28A 1JG9A 1XR2A 2EO7A 3SJ3A 1TR1A 3IVTA 1K7EA 2BLEA 2IQ0A 2HJPA 3RPDA 3QMTA 2E77A 5AZ1A 3WJSA 1EO5A 2YFOA 1KM6A 4Q8TA 1NDWA 1QUMA 4RV3A 3O6CA 4DO5A 1RLDA 2VX5A 3TAOA 2A3BA 3H4GA 4UQ9A 2ZFAA 1TJPA 3UWVA 4RNJA 1PJ9A 2P88A 3N6JA 5LGZA 1C9DA 4UNKA 3ZYZA 5DF0A 1EQCA 1VQTA 4BHYA 4UTWC 2P3ZA 3JU2A 4JGDA 4ICNA 5AHFA 3R8GA 3KRBA 4OTKA 2QCDA 4AY7A 2WMFA 5M3WA 3IUHA 1OEPA 2CFFA 2YXOA 3KZPA 4GO9A 3WBYA 1ITCA 2QPUA 2PBGA 1QVBA 1CENA 4BEQA 4NXKA 3CV1A 5LIYX 2OLAA 1UYQA 3RO6A 4E3VA 1OFBA 1S3TC 1LL6A 1NP2A 4E6MA 1IXPA 1TPFA 3TFCA 3WQCA 1QNPA 2W5FA 4N9CA 3W1TA 2V3EA 1RPXA 4D8LA 1L6FA 4HNLA 2V5JA 3MUXA 4HU0A 3B8UA 4LSBA 1GVOA 1TTIA 3EWBX 1ZBKA 4RLIA 1TRIA 3WUGA 5JVLA 2DH3A 3EB3A 1AQFA 3ITCA 3SCTA 1JULA 3H26A 3SRDA 1VYSX 4CQ8A 3V35A 4WJ8A 5LGXA 1DHKA 1FKWA 3DFOA 3CQKA 5EU9A 4GUJA 4GMEA 4PB5A 3RN6A 4PE8A 1J0ZA 4N4PA 3TSDA 2DQXA 1XICA 3C86A 3M07A 4ERIA 1K4HA 2PDXA 1VHCA 3AAMA 2AQWA 2DVTA 1ICQA 1D3CA 5A6LA 3S6OA 2ZRZA 4ATDA 3EOLA 2E28A 4XISA 1QO5A 5XIAA 1QMLA 4TX9A 1JXJA 4F0MA 1IWAA 1MFVA 1TYGA 1SO3A 1BKSA 2QF7A 2P8CA 2YR1A 4Z1AA 1V0MA 2XSAA 3PWIA 4YTTA 3CLMA 3WLLA 1I75A 1OIFA 2I56A 4RKAA 4UR7A 1VJIA 2R8WA 2Q3RA 3T55A 3ALFA 5J5RA 2X8RA 1Z69A 4LEQA 4CD4A 4UMBA 1ODUA 2WPGA 3C2FA 5F4WA 1BSIA 3MMUA 4C6KA 1BGGA 3N9KA 4X60A 3WQ6A 1QK0A 4XD3A 1CGWA 5AVNA 1Z41A 4RNHA 3WF4A 1TWIA 2HK1A 4DWDA 4U5IA 3DFSA 5FF4A 1RA5A 3W7LA 1UWQA 5LIKX 1JZ8A 1TWSA 5DBUA 4RE4A 1X97A 1AJ2A 4TXEA 3DHFA 2EGZA 1GQNA 3HGSA 2WMIB 1EWDA 3NOYA 1AW1A 3NA8A 3B03A 5A5WA 1C7SA 4KWVA 3UY8A 1I6NA 2OX4A 3QKEA 4GGHA 3VNYA 3C2RA 1XV8A 3W1XA 3PZOA 1YNYA 1IZCA 2PWHA 5E9AA 3ZFHA 3AWOA 1HW6A 4G5DA 3M0LA 3K2GA 5H8MA 3CIVA 2WXDM 3TCSA 3PAJA 1DXEA 2CLEA 2V67A 3RUBL 2GVYA 5IFTA 3OIHA 2JF6A 5I7GA 4DPQA 1Y0EA 7ENLA 5LKYA 1EBGA 4CD5A 3KEHA 4OFCA 4MY9A 5T9CE 2DUZA 4UTLA 5HWNA 1UMLA 1CEOA 2G3JA 3KTSA 4W4QA 2Y0FA 1XKJA 2RGMA 3SN1A 3TTQA 3JRKA 1FUYA 3STFA 1KTNA 5FAGA 5HUOA 2EXOA 5BROA 4XAPA 3WBAA 4W5ZA 2G4FA 4HU4A 2ICSA 3AIVA 4JDBA 1Q7MA 5I09A 3PP7A 4H9TA 4YTUA 3FKRA 2I1OA 3UJSA 3IRDA 2WCGA 2ZQ0A 9CGTA 3W1NA 3NGFA 4F79A 2HS6A 1LROA 5I3FA 4GNKB 1OZQA 3GZAA 3WBEA 2OVLA 3CEPA 2OGJA 3HFYA 3PC0A 3W53A 3DHUA 3STPA 3CAQA 1M7OA 2INZA 2VFEA 1WDQA 2Q09A 1UWIA 1M03A 1TMHA 4HZ6A 3BAIA 1J6PA 1LQAA 5I3IA 4EP8C 1JUKA 2D1ZA 3AS2A 3VUSA 4DWSC 1J79A 3BOFA 2FH8A 3QN3A 1Z48A 4HHLA 1UR4A 3KBWA 3MI6A 2JKAA 1XIBA 4H7VA 4AIOA 1YTDA 3TZFA 3E2VA 1NOFA 2FGZA 4QDPA 4UR9A 4B16A 5HMDA 1JF6A 5J5DA 4AD5A 4FIQA 4B5UA 1Q45A 3CZJA 3TSMA 1TKKA 2ZC8A 1MMFA 4JQ2A 3NPVA 3QHMA 4US5D 1FHVA 1S2VA 2VMFA 3SI9A 4PYSA 3VGHA 5U7SA 4Q6XA 4L64A 2QJJA 5I78A 1DWGM 2YYTA 5DMMA 2F61A 1W17A 1DWIM 1JZ3A 1LLZA 1NM9A 4XWUA 4A6GA 3M47A 3U4FA 4OJYA 1C9WA 2Q8LA 2NSXA 4ADUA 4EXBA 4C5YA 4DWSD 3E38A 1ESWA 2D22A 1JZ2A 5CPMA 2ZOXA 3ZR5A 3R0DA 2CBIA 1I4NA 1XL9A 3L21A 4EKJA 2VDIA 3QYQA 2I57A 2ZUMA 5D37A 1JCTA 3G1HA 4R3UA 1I2OA 1EJRC 2Z1WA 3SCUA 3KHJA 3O16A 2O4QA 2A7PA 3GXMA 4PUUA 1DORA 3LMZA 1E9YB 2PLJA 1DWFM 3L9CA 3QGVA 2AQVA 3TN6A 4H8UA 5A1AA 4KCWA 3PULA 3KBJA 3FHAA 4IPIA 4JFTA 3R7MA 1GGOA 3B9AA 4TIMA 2VX7A 4C65A 1EO7A 1NOWA 3STGA 1V7YA 1YXYA 5HMSA 1J9YA 3GVVA 3TJXA 2UY5A 4PEKA 2WYSA 4Z1CA 1Q13A 1ZU8A 4X9SA 3DI1A 4NZ4A 2PRLA 1W37A 1DTUA 1J5SA 4Q4KA 4AZCA 3GDBA 1EJUC 1MSSA 3URAA 3N2BA 1TUXA 2GGEA 1OINA 1FOBA 2REQB 3FJ4A 3PTKA 4FLRA 1TVPA 3VGEA 4Q8QA 4AHQA 2G95A 1P7TB 1FXQA 3QM3A 2UBPC 4WD0A 5AZ0A 2VWSA 1EZWA 3U7BA 5CSRA 3WBWA 1EUAA 1A5KC 2WSRA 1UC4A 3UWZA 1RVGA 3DCPA 4O1AA 2WHKA 3BZJA 4CNOA 3DFHA 3S4TA 5DT7A 1BRLA 3THUA 1KBIA 6PTDA 2CPUA 3CUJA 1JPDX 3S8HA 3E96A 5AY7A 4OGZA 2ZA3A 4JFUA 3BAWA 2D73A 3DG3A 4JYEA 4KPLA 1US3A 3ITXA 1JXKA 4B3ZA 4IMDA 3IVSA 1GOOA 1V6XA 1SO6A 1QHOA 2OEJA 3LHVA 1WOAA 1QW8A 4LYKA 3REQA 1WKYA 1RA0A 4RPPA 1LOQA 1IGWA 1UH4A 1HKVA 1XQLA 2EPLX 2YW4A 3U6WA 4QJ5B 1D7FA 1FX6A 4GC4A 4KWWA 4L1XA 3LCIA 1A5SA 1GVRA 5HJXA 1BLIA 2YB1A 3FYOA 3T09A 3NO3A 3CHEA 1E6PA 2MUCA 1C8XA 2ZRUA 5I77A 3ZVHA 2D0HA 3T0TA 1J0JA 1E1EA 3DKLA 3QPZA 1OBAA 4FR6A 2ZVRA 3K5XA 3P14A 4C6FA 1JDEA 3HTWA 5CPOA 3C56A 2PLMA 3MY9A 3MBDA 4U28A 4JL1A 4B15A 3BOXA 1K70A 3SY5A 3SCWA 2A3HA 3HPAA 4IHCA 2OFJA 3PVFA 1HIZA 5D8ZA 4IFKA 2IKHA 4NRRA 1A5NC 4QAWA 4GXMA 5C2CA 1QNVA 3W70A 2IKJA 1MRQA 3QY8A 3WK2A 5ECVA 2R14A 2ZCGA 3V0TA 3PPHA 3GU2A 1XBYA 4XIMA 3PBGA 2OR2A 4AWTA 1LUCA 5AYZA 2GYIA 4WR3A 3VTRA 3LRMA 3P82A 3WBXA 3A5FA 3KRSA 4QJ1A 5LNSA 2OYKA 3MI3A 2F6KA 3KOZA 1U1UA 1B1YA 3M7SA 1HJSA 3WF2A 5A8QA 1MDRA 1QPKA 4PUJA 2OPJA 4CCCA 2IKGA 1YADA 3IGUA 4IMEA 3NQCA 2FJUB 3W00A 4S3EA 2PDNA 4Q4SA 1VHNA 1VBGA 3CC1A 2FVKA 1IT8A 1CGVA 1GK8A 4Q8WA 3GFYA 4GYPA 3BJSA 3OG3A 3GK0A 2ON3A 1XLGA 3F4WA 1O6IA 2JBMA 3HGJA 2XGIA 4MFEA 2X40A 4GY0A 3WUEA 4O28A 3MPGA 5SWUA 2W3ZA 3B9EA 3D46A 1S2TA 3RG6A 2OOGA 3VNJA 3AXKA 3NL2A 3HMJG 4EK7A 1HUVA 3IAQA 3TXZA 3WFAA 1XRTA 1UOKA 1VYPX 4AD0A 1TPDA 4MWAC 1B3XA 2VFDA 4M56A 1RZMA 1P6WA 2ZA2A 4ZCWA 1QK2A 4FB7A 4DJED 1XC6A 3FOKA 2XN2A 1XIFA 4NASA 1FDJA 5CZJA 1E56A 3S1UA 2OQYA 4LRTA 1JNEA 1GHSA 2CXEA 1B31A 2EKGA 1R3YA 4PA8A 1CXIA 1B9BA 4YYCA 4M5PA 3TFXA 1R85A 2WJDA 2ZZ2A 4X0VA 1LUCB 5JH2A 1MFUA 3VE9A 3VK5A 1DQXA 3ZJ7A 1KBBA 3SJNA 3W6MA 3S83A 4CN1A 2QF8A 2CETA 4B2DA 1GG1A 3IIVA 4KCUA 4ZOBA 2YCLA 3V5CA 4WKHA 3HGRA 3S6DA 4ZEPA 1XIGA 1XLEA 3GW3A 4J2PA 3ITYA 3FA5A 1QHPA 1TMLA 5E09A 3QLLA 3MCOA 2BASA 3TW6A 1UR9A 2R1MA 1FWHC 3A4WA 4CQ9A 1PYMA 4HYRA 1Q7QA 4TTUA 1XSIA 1KBLA 1NFBA 5D2YA 4IPNB 2H8XA 2XYLA 5C7HA 2PD9A 4Y8EA 4IWWA 3TP4A 3MMTA 3OO2A 5HAOA 1VC4A 3ONBA 2W62A 3QPEA 3THCA 1E0UA 3LY0A 1TQJA 3LOTA 2ALRA 4GH3A 1NSJA 5AYBA 3UBPC 5CPQA 3M0ZA 4RDYA 3AXXA 1P43A 4FR1A 4D6CA 3ZOAA 4X0NA 3W2LA 3RMJA 1EJTC 4J3ZA 3QFEA 3M5YA 1CW2A 4DJFC 2LLEA 4HNOA 1P5BA 1ZAJA 3SUWA 2BVTA 4JX6A 3ARYA 1CGUA 4NU7A 1B5TA 3DGRA 1RBLA 5CPNA 2WQDA 1MO0A 1GONA 2HVMA 4CN4A 1QDSA 3CTTA 1B4KA 4KIRA 2IQTA 1SFLA 3LHZA 2W6RA 3KL0A 4AW7A 2OEMA 4N02A 3VXGA 3VX0A 2O56A 1E4MM 4FHAA 2CESA 3NDOA 3S47A 7A3HA 5AECA 1EJVC 3KW3A 4JCLA 3S2CA 2BVYA 1D3HA 2ACQA 5D2WA 4NP7A 1SR0A 1KM5A 1SR9A 3KOFA 3WJZA 1S5NA 3PJWA 1Z32X 3BCJA 4WDWA 4JIEA 5HUPA 3STEA 3WD3A 3PZUA 2C91A 4DN1A 4EANA 3IIOA 4GYPC 3K4WA 1WO2A 2ZTJA 5HDRA 3K8LA 1XYBA 1W1PA 2D24A 1XSJA 3NVDA 5AC6A 3W2NA 1LG1A 1GQJA 3AS1A 4S3GA 3ERPA 3VIIA 2BGSA 3PZNA 1RHCA 2CEQA 4Y90A 4D8AA 3AYVA 3CL8A 2R82A 4O1CA 3OGRA 2WZIA 3CZEA 1HJQA 2A6LA 1HXJA 3XINA 4HTBA 3NJ3A 3OP2A 1JCNA 1XLAA 3IWPA 4U10A 5JH1A 4LUTA 5I07A 2HK0A 1LLOA 4M51A 3GUGA 7TIMA 2X1SA 4D6HA 4RE2A 4JX5A 1VENA 4C6DA 1L8NA 1XCXA 1YXDA 1JZ6A 1U5VA 1M41A 4OUEA 3DG6A 4GZEA 1DBTA 3ARQA 1PS9A 4AQLA 4NJJA 1SFTA 1T6MA 4H9UA 4MKSA 2O9OA 1ZGDA 4XZBA 2PCEA 3EEZA 2GJXB 2FPTA 3FEQA 2AKZA 1QXLA 2QJMA 3QR3A 2AGKA 3RIKA 1SW0A 5DX7A 3PTQA 4H3DA 4A29A 2FH6A 1GOXA 3ZO9A 1X1OA 3Q2DA 2V2CA 3UR5A 1QWKA 4DI9A 1XYMA 3M4HA 2ZVIA 4JTUA 1GORA 3MYPA 2CZVA 3PBVA 4YVXA 3W7GA 3EMCA 1PZ3A 2YL6A 3NEHA 1XS2A 5JBEA 3SQSA 4WF7A 1W1B1 4H8HA 2ZX7A 1WDDA 5A6SA 4CD7A 2ATMA 3AI0A 1RCQA 4DLMA 4Z42C 3GS6A 3HIJA 2J4GA 3F2CA 3KCJA 3UFYA 4A22A 4IF2A 1EA0A 4WLCA 3KCOA 2XSXA 1Q85A 3RAOA 1KWGA 5BXTA 1J0IA 2YXXA 5HOSA 4UZSA 1QPNA 1LORA 3VPLA 4C90A 1WYIA 3CUHA 1RJPA 3S9YA 6ENLA 2A4AA 3B9NA 5FF7A 1RVKA 4ROQA 4FEZA 2ODOA 3CMGA 1S5MA 3BANA 3WH9A 1YEYA 1DYSA 3KP0A 1ZCCA 2FPVA 1H61A 4JQ4A 3I65A 4GIEA 1DJQA 3I3BA 3O8AA 4Q8PA 3VIKA 2QJIA 2WQPA 2DPEA 5F2IA 3WNOA 1JPIA 1WAUA 2F9RA 2B7NA 3PAOA 1A49A 4FMVA 3TC3A 3ZT5A 1B90A 3W71A 2ZE3A 1K9DA 3L4TA 5JBFA 4MB5A 3PS7A 4GD0A 4W86A 1RV8A 4IGNA 3HG3A 2X1UA 3D6NA 2FZMA 2WVUA 1J10A 1QNRA 2B81A 1PZ2A 1CWYA 3EWZA 2ZXDA 2QVHA 1O1HA 4WGXA 4ACYA 1Z44A 2E5BA 3GHSA 1OFDA 5CQ1A 3PTDA 1S46A 4GJ1A 1S2AA 3PPCA 4IJRA 3EWUA 3WQ4A 2F6UA 3VX1A 4FSAA 1V3HA 2YCJA 3OBEA 5FKYA 3UPMA 4Q4MA 2FQIA 3T0DA 3N15A 3SW6A 1C90A 1A0DA 1QPRA 3I7SA 4BQ5A 5T91A 4NYYA 4GBDA 2P5NA 2PI6A 3LCFA 4KEVA 3KAOA 2AMGA 4Z0SA 5IXEA 8CGTA 1YDVA 4KETA 3TZNA 1K7XA 2PU1A 5G1MA 2Z00A 2PU0A 2ESCA 2RFGA 5K7JA 3RPTA 1T99A 2ZUWA 2HMCA 2Z29A 2Z1SA 1FWNA 4H01A 2ZXAA 2BMBA 4MPQA 1WBJA 3FJLA 4N9EA 1EIBA 3VNZA 1YE6A 2J8FA 4ZQCA 2Q02A 3F5JA 3WH5A 4IPLA 4BKNA 3GDKA 4H6RA 2ZC1A 2V9DA 4AC1X 1E0XA 2OU4A 3LN3A 4PL1A 2AKMA 3W4RA 3TE9A 1FDZA 1DJZA 1Q6EA 1W5PA 1XIHA 4DUVA 5CG0A 1UBSA 4V2XA 3GAKA 3GNNA 1JPKA 1N8FA 5DO8A 2O9TA 4XX6A 1F3XA 4U2ZA 3H7UA 3VIMA 2XN1A 3PBYA 5LIUX 1D8CA 1F3TA 4JQ3A 1SZNA 1C7TA 2V5BA 2ZTKA 3FHQA 2DSVA 4ZQRA 1G4PA 4K39A 5F2MA 1PCWA 2CIPA 1ME8A 1FWFC 3EAUA 5HNNA 2POTA 4Q8UA 4RCXA 4ADTA 1GOMA 3JR2A