3OU9A

Crystal structure of gamma-carbonic anhydrase w19f mutant from methanosarcina thermophila
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
205
structure length
205
Chain Sequence
SNIRENPVTPFNPEPSAPVIDPTAYIDPQASVIGEVTIGANVMVSPMASIRSDEGMPIFVGDRSNVQDGVVLHALETINEEGEPIEDNIVEVDGKEYAVYIGNNVSLAHQSQVHGPAAVGDDTFIGMQAFVFKSKVGNNCVLEPRSAAIGVTIPDGRYIPAGMVVTSQAEADKLPEVTDDYAYSHTNEAVVYVNVHLAEGYKETS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Carbonic anhydrase
publication title Crystal structure of gamma-carbonic anhydrase W19F mutant from Methanosarcina thermophila
rcsb
source organism Methanosarcina thermophila
molecule tags Lyase
total genus 70
structure length 205
sequence length 205
ec nomenclature ec 4.2.1.1: Carbonic anhydrase.
pdb deposition date 2010-09-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00132 Hexapep Bacterial transferase hexapeptide (six repeats)
A PF14602 Hexapep_2 Hexapeptide repeat of succinyl-transferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.10.10 Mainly Beta 3 Solenoid UDP N-Acetylglucosamine Acyltransferase; domain 1 Hexapeptide repeat proteins 3ou9A00
2WLGA 3TK8A 3ECTA 3IXCA 1LXAA 3JQYA 2IU9A 2XATA 2FKOA 2VD4A 1FWYA 2NPOA 4EAAA 3VBKA 2IUAA 3TISA 4FCEA 1KGQA 1J2ZA 1HM8A 2ICYA 3FTTA 3HJJA 2GGQA 3C8VA 3TWDA 5E3PA 1THJA 3FSYA 3PMOA 2QIVX 2WLDA 3VBIA 5DEPA 4N69A 1QREA 3TDTA 3BRKX 3F1XA 1MR7A 3BSWA 3FOQA 2VHEA 5AFUV 3R8YA 3R5AA 3DHOA 2OI5A 3MC4A 4HCQA 4HURA 3T57A 4E79A 4M9CA 4HZCA 3I3AA 3OTMA 3Q1XA 1KHRA 1SSMA 4G87A 4H7OA 1KK6A 4KPXA 4M99A 4MZUA 2GGOA 3BFPA 3VBJA 1QRMA 3FSBA 4G3PA 3BSYA 1KK4A 3EH0A 3MQHA 2TDTA 3NZ2A 4EQYA 3KWCA 1YP4A 3VNPA 1KRVA 3BSSA 3BXYA 2WLFA 1XATA 5DEMA 4EA9A 3R3RA 3SRTA 3HSQA 4ISXA 1MR9A 1TDTA 2ICXA 1XHDA 4N27A 4E6TA 1HV9A 2WLEA 2QIAA 3R0SA 2JF2A 3D8VA 5L6VA 1FXJA 1SSQA 3GOSA 4HZDA 3R5DA 3DK5A 4IHHA 4E75A 1KQAA 3DJ4A 1MRLA 1QQ0A 3MQGA 3OTZA 4MYOA 4R37A 3VBMA 3VBNA 2P2OA 1OCXA 1Z90A 2IC7A 2OEFA 3OU9A 2AQ9A 3R3IA 4AAWA 1QRLA 3EEVA 4M2AA 2RIJA 1V3WA 3SPTA 5ADXU 1KRUA 3FSCA 4J18A 4EA8A 3FSXA 5DG3A 1S80A 5U2KA 3OUPA 4M98A 4AC3A 3ST8A 4G3QA 3V4EA 1SSTA 3R5BA 1T3DA 3P47A 2V0LA 4HUSA 2WLCA 1YP2A 2V0KA 5F42A 2V0IA 3OW5A 1KGTA 2V0HA 3VBPA 4E6UA 4J09A 3IGJA 1HM0A 1KK5A 4N6BA 3FS8A 2OI7A 4MFGA 3TIOA 4E1KA 4KNXA 1KRRA 3D98A 1HM9A 1G97A 3R2WA 5E3RA 4KNRA 3R5CA 5E3QA 1G95A 3KWDA 4EA7A 4R36A 3R1WA 3CJ8A 4KPZA 3TV0A 3I3XA 4DCLA 4M28A 3EG4A 3KWEA 2Q4JA 2V0JA 2W0VA 3FWWA 4AA7A 2W0WA 5ADXV 2IU8A 2OI6A 4EGGA 5L6SA 1QRFA 3GUEA 4KQLA 2JF3A 2OEGA 4EABA 1QRGA 4G3SA 5AFUU 1V67A 4R7PA 3P1BA 4N6AA 4IHFA 4K6RA 1YP3A 2I5KA 4M2BA 3VBLA 3GVDA 4IHGA 2QKXA
chains in the Genus database with same CATH superfamily
2WLGA 3GQ8A 3TK8A 3ECTA 3IXCA 1LXAA 3JQYA 2IU9A 2XATA 2FKOA 2VD4A 1FWYA 2NPOA 4EAAA 3VBKA 2IUAA 3TISA 4FCEA 1KGQA 1J2ZA 1HM8A 1M8NA 2ICYA 3FTTA 3HJJA 2GGQA 3C8VA 3TWDA 1N4IA 5E3PA 1THJA 3FSYA 3PMOA 2QIVX 2WLDA 3OH1A 3VBIA 5DEPA 4N69A 1QREA 3GQAA 3TDTA 3BRKX 3F1XA 3OH3A 1MR7A 3BSWA 3FOQA 2VHEA 5AFUV 3R8YA 3R5AA 3DHOA 2OI5A 3MC4A 4HCQA 4HURA 3T57A 4E79A 4M9CA 4HZCA 3I3AA 3OTMA 3Q1XA 1KHRA 1SSMA 4G87A 4H7OA 1KK6A 4KPXA 4M99A 4MZUA 2GGOA 3BFPA 3VBJA 1QRMA 3FSBA 4G3PA 3BSYA 1L0SA 1KK4A 3OH4A 3EH0A 3MQHA 2TDTA 3NZ2A 4EQYA 3KWCA 1YP4A 3VNPA 1KRVA 3BSSA 3BXYA 2WLFA 1XATA 5DEMA 4EA9A 3R3RA 1Z2FA 3HSQA 3SRTA 4ISXA 1MR9A 1TDTA 2ICXA 1XHDA 4N27A 4E6TA 1HV9A 2WLEA 3OH0A 2QIAA 3R0SA 2JF2A 3D8VA 5L6VA 1FXJA 1SSQA 3GOSA 4HZDA 3R5DA 3DK5A 4IHHA 4E75A 1KQAA 3DJ4A 1MRLA 1QQ0A 3MQGA 3OTZA 4MYOA 4R37A 3VBMA 3VBNA 2P2OA 1OCXA 1Z90A 2IC7A 2OEFA 3OU9A 2AQ9A 3R3IA 4AAWA 1QRLA 3EEVA 4M2AA 2RIJA 1V3WA 3SPTA 5ADXU 1KRUA 3FSCA 4J18A 4EA8A 3FSXA 5DG3A 1S80A 5U2KA 3OUPA 4M98A 4AC3A 3OGZA 3ST8A 4G3QA 3V4EA 1SSTA 3R5BA 1T3DA 3P47A 2V0LA 4HUSA 2WLCA 1YP2A 2V0KA 5F42A 2V0IA 3OW5A 1KGTA 2V0HA 3VBPA 4E6UA 4J09A 3IGJA 1HM0A 1KK5A 4N6BA 3FS8A 2OI7A 1EWWA 4MFGA 3TIOA 4E1KA 4KNXA 1KRRA 3D98A 1HM9A 1G97A 3R2WA 5E3RA 4KNRA 3R5CA 5E3QA 1G95A 3KWDA 3GQ7A 4EA7A 4R36A 3R1WA 3CJ8A 4KPZA 3TV0A 3I3XA 4DCLA 4M28A 3GQ9A 3EG4A 3KWEA 3SUCA 2Q4JA 2V0JA 2W0VA 3FWWA 4AA7A 2W0WA 5ADXV 2IU8A 2OI6A 4EGGA 3OH2A 5L6SA 1QRFA 3GUEA 4KQLA 2JF3A 2OEGA 4EABA 1QRGA 4G3SA 5AFUU 1V67A 4R7PA 3P1BA 4N6AA 4IHFA 4K6RA 1YP3A 2I5KA 4M2BA 3VBLA 3GVDA 4IHGA 2QKXA
chains in the Genus database with same CATH topology
2WLGA 3TK8A 3ECTA 3IXCA 1LXAA 3JQYA 2IU9A 2XATA 2FKOA 2VD4A 1FWYA 2NPOA 4EAAA 3VBKA 2IUAA 3TISA 4FCEA 1KGQA 1J2ZA 1HM8A 2ICYA 3FTTA 3HJJA 2GGQA 3C8VA 3TWDA 5E3PA 1THJA 3FSYA 3PMOA 2QIVX 2WLDA 3VBIA 5DEPA 4N69A 1QREA 3TDTA 3BRKX 3F1XA 1MR7A 3BSWA 3FOQA 2VHEA 5AFUV 3R8YA 3R5AA 3DHOA 2OI5A 3MC4A 4HCQA 4HURA 3T57A 4E79A 4M9CA 4HZCA 3I3AA 3OTMA 3Q1XA 1KHRA 1SSMA 4G87A 4H7OA 1KK6A 4KPXA 4M99A 4MZUA 2GGOA 3BFPA 3VBJA 1QRMA 3FSBA 4G3PA 3BSYA 1KK4A 3EH0A 3MQHA 2TDTA 3NZ2A 4EQYA 3KWCA 1YP4A 3VNPA 1KRVA 3BSSA 3BXYA 2WLFA 1XATA 5DEMA 4EA9A 3R3RA 3SRTA 3HSQA 4ISXA 1MR9A 1TDTA 2ICXA 1XHDA 4N27A 4E6TA 1HV9A 2WLEA 2QIAA 3R0SA 2JF2A 3D8VA 5L6VA 1FXJA 1SSQA 3GOSA 4HZDA 3R5DA 3DK5A 4IHHA 4E75A 1KQAA 3DJ4A 1MRLA 1QQ0A 3MQGA 3OTZA 4MYOA 4R37A 3VBMA 3VBNA 2P2OA 1OCXA 1Z90A 2IC7A 2OEFA 3OU9A 2AQ9A 3R3IA 4AAWA 1QRLA 3EEVA 4M2AA 2RIJA 1V3WA 3SPTA 5ADXU 1KRUA 3FSCA 4J18A 4EA8A 3FSXA 5DG3A 1S80A 5U2KA 3OUPA 4M98A 4AC3A 3ST8A 4G3QA 3V4EA 1SSTA 3R5BA 1T3DA 3P47A 2V0LA 4HUSA 2WLCA 1YP2A 2V0KA 5F42A 2V0IA 3OW5A 1KGTA 2V0HA 3VBPA 4E6UA 4J09A 3IGJA 1HM0A 1KK5A 4N6BA 3FS8A 2OI7A 4MFGA 3TIOA 4E1KA 4KNXA 1KRRA 3D98A 1HM9A 1G97A 3R2WA 5E3RA 4KNRA 3R5CA 5E3QA 1G95A 3KWDA 4EA7A 4R36A 3R1WA 3CJ8A 4KPZA 3TV0A 3I3XA 4DCLA 4M28A 3EG4A 3KWEA 2Q4JA 2V0JA 2W0VA 3FWWA 4AA7A 2W0WA 5ADXV 2IU8A 2OI6A 4EGGA 5L6SA 1QRFA 3GUEA 4KQLA 2JF3A 2OEGA 4EABA 1QRGA 4G3SA 5AFUU 1V67A 4R7PA 3P1BA 4N6AA 4IHFA 4K6RA 1YP3A 2I5KA 4M2BA 3VBLA 3GVDA 4IHGA 2QKXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WLG A;  3TK8 A;  3ECT A;  3IXC A;  1LXA A;  3JQY A;  2IU9 A;  2XAT A;  2FKO A;  2VD4 A;  1FWY A;  2NPO A;  4EAA A;  3VBK A;  2IUA A;  3TIS A;  4FCE A;  1KGQ A;  1J2Z A;  1HM8 A;  2ICY A;  3FTT A;  3HJJ A;  2GGQ A;  3C8V A;  3TWD A;  5E3P A;  1THJ A;  3FSY A;  3PMO A;  2QIV X;  2WLD A;  3VBI A;  5DEP A;  4N69 A;  1QRE A;  3TDT A;  3BRK X;  3F1X A;  1MR7 A;  3BSW A;  3FOQ A;  2VHE A;  5AFU V;  3R8Y A;  3R5A A;  3DHO A;  2OI5 A;  3MC4 A;  4HCQ A;  4HUR A;  3T57 A;  4E79 A;  4M9C A;  4HZC A;  3I3A A;  3OTM A;  3Q1X A;  1KHR A;  1SSM A;  4G87 A;  4H7O A;  1KK6 A;  4KPX A;  4M99 A;  4MZU A;  2GGO A;  3BFP A;  3VBJ A;  1QRM A;  3FSB A;  4G3P A;  3BSY A;  1KK4 A;  3EH0 A;  3MQH A;  2TDT A;  3NZ2 A;  4EQY A;  3KWC A;  1YP4 A;  3VNP A;  1KRV A;  3BSS A;  3BXY A;  2WLF A;  1XAT A;  5DEM A;  4EA9 A;  3R3R A;  3SRT A;  3HSQ A;  4ISX A;  1MR9 A;  1TDT A;  2ICX A;  1XHD A;  4N27 A;  4E6T A;  1HV9 A;  2WLE A;  2QIA A;  3R0S A;  2JF2 A;  3D8V A;  5L6V A;  1FXJ A;  1SSQ A;  3GOS A;  4HZD A;  3R5D A;  3DK5 A;  4IHH A;  4E75 A;  1KQA A;  3DJ4 A;  1MRL A;  1QQ0 A;  3MQG A;  3OTZ A;  4MYO A;  4R37 A;  3VBM A;  3VBN A;  2P2O A;  1OCX A;  1Z90 A;  2IC7 A;  2OEF A;  3OU9 A;  2AQ9 A;  3R3I A;  4AAW A;  1QRL A;  3EEV A;  4M2A A;  2RIJ A;  1V3W A;  3SPT A;  5ADX U;  1KRU A;  3FSC A;  4J18 A;  4EA8 A;  3FSX A;  5DG3 A;  1S80 A;  5U2K A;  3OUP A;  4M98 A;  4AC3 A;  3ST8 A;  4G3Q A;  3V4E A;  1SST A;  3R5B A;  1T3D A;  3P47 A;  2V0L A;  4HUS A;  2WLC A;  1YP2 A;  2V0K A;  5F42 A;  2V0I A;  3OW5 A;  1KGT A;  2V0H A;  3VBP A;  4E6U A;  4J09 A;  3IGJ A;  1HM0 A;  1KK5 A;  4N6B A;  3FS8 A;  2OI7 A;  4MFG A;  3TIO A;  4E1K A;  4KNX A;  1KRR A;  3D98 A;  1HM9 A;  1G97 A;  3R2W A;  5E3R A;  4KNR A;  3R5C A;  5E3Q A;  1G95 A;  3KWD A;  4EA7 A;  4R36 A;  3R1W A;  3CJ8 A;  4KPZ A;  3TV0 A;  3I3X A;  4DCL A;  4M28 A;  3EG4 A;  3KWE A;  2Q4J A;  2V0J A;  2W0V A;  3FWW A;  4AA7 A;  2W0W A;  5ADX V;  2IU8 A;  2OI6 A;  4EGG A;  5L6S A;  1QRF A;  3GUE A;  4KQL A;  2JF3 A;  2OEG A;  4EAB A;  1QRG A;  4G3S A;  5AFU U;  1V67 A;  4R7P A;  3P1B A;  4N6A A;  4IHF A;  4K6R A;  1YP3 A;  2I5K A;  4M2B A;  3VBL A;  3GVD A;  4IHG A;  2QKX A; 
#chains in the Genus database with same CATH topology
 2WLG A;  3GQ8 A;  3TK8 A;  3ECT A;  3IXC A;  1LXA A;  3JQY A;  2IU9 A;  2XAT A;  2FKO A;  2VD4 A;  1FWY A;  2NPO A;  4EAA A;  3VBK A;  2IUA A;  3TIS A;  4FCE A;  1KGQ A;  1J2Z A;  1HM8 A;  1M8N A;  2ICY A;  3FTT A;  3HJJ A;  2GGQ A;  3C8V A;  3TWD A;  1N4I A;  5E3P A;  1THJ A;  3FSY A;  3PMO A;  2QIV X;  2WLD A;  3OH1 A;  3VBI A;  5DEP A;  4N69 A;  1QRE A;  3GQA A;  3TDT A;  3BRK X;  3F1X A;  3OH3 A;  1MR7 A;  3BSW A;  3FOQ A;  2VHE A;  5AFU V;  3R8Y A;  3R5A A;  3DHO A;  2OI5 A;  3MC4 A;  4HCQ A;  4HUR A;  3T57 A;  4E79 A;  4M9C A;  4HZC A;  3I3A A;  3OTM A;  3Q1X A;  1KHR A;  1SSM A;  4G87 A;  4H7O A;  1KK6 A;  4KPX A;  4M99 A;  4MZU A;  2GGO A;  3BFP A;  3VBJ A;  1QRM A;  3FSB A;  4G3P A;  3BSY A;  1L0S A;  1KK4 A;  3OH4 A;  3EH0 A;  3MQH A;  2TDT A;  3NZ2 A;  4EQY A;  3KWC A;  1YP4 A;  3VNP A;  1KRV A;  3BSS A;  3BXY A;  2WLF A;  1XAT A;  5DEM A;  4EA9 A;  3R3R A;  1Z2F A;  3HSQ A;  3SRT A;  4ISX A;  1MR9 A;  1TDT A;  2ICX A;  1XHD A;  4N27 A;  4E6T A;  1HV9 A;  2WLE A;  3OH0 A;  2QIA A;  3R0S A;  2JF2 A;  3D8V A;  5L6V A;  1FXJ A;  1SSQ A;  3GOS A;  4HZD A;  3R5D A;  3DK5 A;  4IHH A;  4E75 A;  1KQA A;  3DJ4 A;  1MRL A;  1QQ0 A;  3MQG A;  3OTZ A;  4MYO A;  4R37 A;  3VBM A;  3VBN A;  2P2O A;  1OCX A;  1Z90 A;  2IC7 A;  2OEF A;  3OU9 A;  2AQ9 A;  3R3I A;  4AAW A;  1QRL A;  3EEV A;  4M2A A;  2RIJ A;  1V3W A;  3SPT A;  5ADX U;  1KRU A;  3FSC A;  4J18 A;  4EA8 A;  3FSX A;  5DG3 A;  1S80 A;  5U2K A;  3OUP A;  4M98 A;  4AC3 A;  3OGZ A;  3ST8 A;  4G3Q A;  3V4E A;  1SST A;  3R5B A;  1T3D A;  3P47 A;  2V0L A;  4HUS A;  2WLC A;  1YP2 A;  2V0K A;  5F42 A;  2V0I A;  3OW5 A;  1KGT A;  2V0H A;  3VBP A;  4E6U A;  4J09 A;  3IGJ A;  1HM0 A;  1KK5 A;  4N6B A;  3FS8 A;  2OI7 A;  1EWW A;  4MFG A;  3TIO A;  4E1K A;  4KNX A;  1KRR A;  3D98 A;  1HM9 A;  1G97 A;  3R2W A;  5E3R A;  4KNR A;  3R5C A;  5E3Q A;  1G95 A;  3KWD A;  3GQ7 A;  4EA7 A;  4R36 A;  3R1W A;  3CJ8 A;  4KPZ A;  3TV0 A;  3I3X A;  4DCL A;  4M28 A;  3GQ9 A;  3EG4 A;  3KWE A;  3SUC A;  2Q4J A;  2V0J A;  2W0V A;  3FWW A;  4AA7 A;  2W0W A;  5ADX V;  2IU8 A;  2OI6 A;  4EGG A;  3OH2 A;  5L6S A;  1QRF A;  3GUE A;  4KQL A;  2JF3 A;  2OEG A;  4EAB A;  1QRG A;  4G3S A;  5AFU U;  1V67 A;  4R7P A;  3P1B A;  4N6A A;  4IHF A;  4K6R A;  1YP3 A;  2I5K A;  4M2B A;  3VBL A;  3GVD A;  4IHG A;  2QKX A; 
#chains in the Genus database with same CATH homology
 2WLG A;  3TK8 A;  3ECT A;  3IXC A;  1LXA A;  3JQY A;  2IU9 A;  2XAT A;  2FKO A;  2VD4 A;  1FWY A;  2NPO A;  4EAA A;  3VBK A;  2IUA A;  3TIS A;  4FCE A;  1KGQ A;  1J2Z A;  1HM8 A;  2ICY A;  3FTT A;  3HJJ A;  2GGQ A;  3C8V A;  3TWD A;  5E3P A;  1THJ A;  3FSY A;  3PMO A;  2QIV X;  2WLD A;  3VBI A;  5DEP A;  4N69 A;  1QRE A;  3TDT A;  3BRK X;  3F1X A;  1MR7 A;  3BSW A;  3FOQ A;  2VHE A;  5AFU V;  3R8Y A;  3R5A A;  3DHO A;  2OI5 A;  3MC4 A;  4HCQ A;  4HUR A;  3T57 A;  4E79 A;  4M9C A;  4HZC A;  3I3A A;  3OTM A;  3Q1X A;  1KHR A;  1SSM A;  4G87 A;  4H7O A;  1KK6 A;  4KPX A;  4M99 A;  4MZU A;  2GGO A;  3BFP A;  3VBJ A;  1QRM A;  3FSB A;  4G3P A;  3BSY A;  1KK4 A;  3EH0 A;  3MQH A;  2TDT A;  3NZ2 A;  4EQY A;  3KWC A;  1YP4 A;  3VNP A;  1KRV A;  3BSS A;  3BXY A;  2WLF A;  1XAT A;  5DEM A;  4EA9 A;  3R3R A;  3SRT A;  3HSQ A;  4ISX A;  1MR9 A;  1TDT A;  2ICX A;  1XHD A;  4N27 A;  4E6T A;  1HV9 A;  2WLE A;  2QIA A;  3R0S A;  2JF2 A;  3D8V A;  5L6V A;  1FXJ A;  1SSQ A;  3GOS A;  4HZD A;  3R5D A;  3DK5 A;  4IHH A;  4E75 A;  1KQA A;  3DJ4 A;  1MRL A;  1QQ0 A;  3MQG A;  3OTZ A;  4MYO A;  4R37 A;  3VBM A;  3VBN A;  2P2O A;  1OCX A;  1Z90 A;  2IC7 A;  2OEF A;  3OU9 A;  2AQ9 A;  3R3I A;  4AAW A;  1QRL A;  3EEV A;  4M2A A;  2RIJ A;  1V3W A;  3SPT A;  5ADX U;  1KRU A;  3FSC A;  4J18 A;  4EA8 A;  3FSX A;  5DG3 A;  1S80 A;  5U2K A;  3OUP A;  4M98 A;  4AC3 A;  3ST8 A;  4G3Q A;  3V4E A;  1SST A;  3R5B A;  1T3D A;  3P47 A;  2V0L A;  4HUS A;  2WLC A;  1YP2 A;  2V0K A;  5F42 A;  2V0I A;  3OW5 A;  1KGT A;  2V0H A;  3VBP A;  4E6U A;  4J09 A;  3IGJ A;  1HM0 A;  1KK5 A;  4N6B A;  3FS8 A;  2OI7 A;  4MFG A;  3TIO A;  4E1K A;  4KNX A;  1KRR A;  3D98 A;  1HM9 A;  1G97 A;  3R2W A;  5E3R A;  4KNR A;  3R5C A;  5E3Q A;  1G95 A;  3KWD A;  4EA7 A;  4R36 A;  3R1W A;  3CJ8 A;  4KPZ A;  3TV0 A;  3I3X A;  4DCL A;  4M28 A;  3EG4 A;  3KWE A;  2Q4J A;  2V0J A;  2W0V A;  3FWW A;  4AA7 A;  2W0W A;  5ADX V;  2IU8 A;  2OI6 A;  4EGG A;  5L6S A;  1QRF A;  3GUE A;  4KQL A;  2JF3 A;  2OEG A;  4EAB A;  1QRG A;  4G3S A;  5AFU U;  1V67 A;  4R7P A;  3P1B A;  4N6A A;  4IHF A;  4K6R A;  1YP3 A;  2I5K A;  4M2B A;  3VBL A;  3GVD A;  4IHG A;  2QKX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...