3OUFA

Structure of a k+ selective nak mutant
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
93
structure length
93
Chain Sequence
DKEFQVLFVLTILTLISGTIFYSTVEGLRPIDALYFSVVTLTTVGYGDFSPQTDFGKIFTILYIFIGIGLVFGFIHKLAVNVQLPSILSNLVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Potassium channel protein
publication title Tuning the ion selectivity of tetrameric cation channels by changing the number of ion binding sites.
pubmed doi rcsb
source organism Bacillus cereus
molecule tags Membrane protein
total genus 34
structure length 93
sequence length 93
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-09-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3oufA00
2X6AA 4P9PA 3F7VC 3PJSK 2OCCC 2WLNA 1K4DC 3RBZA 3UKMA 3OR7C 3FB7C 4RAIA 4JTCB 2HVJC 4PDLA 5KUKA 3RVYA 2YEVA 3JYCA 4GX2A 3E86A 4MTGA 4RO2A 4MVSA 4MVQA 2W0FC 2DWDC 1LNQA 3RW0A 1M57C 3OGCC 2EIKC 2JK5C 4TWKA 4ZBMA 3VOUA 2EILC 4MSWC 5B1BC 3K04A 3E8BA 3K03A 5CBHA 2WLIB 4G27B 4MVOA 4WFFA 3BEHA 1J95A 1XL4A 3HPLC 2X6CA 5CBGA 3ASOC 3K08A 1V54C 3OUSA 4LP8A 2A79B 4RUFA 5E1AC 3OR6C 2P7TC 5CBFA 3SPJA 3EFFK 2AHYA 3STLC 3TETA 2A9HA 4GX5A 1QLEC 4JTDB 4CBCA 2WLKA 1ORQC 1R3JC 4P9OA 4R50A 1M56C 3SYQA 3SPGA 4QE7A 4GX1A 3SYCA 4J9ZB 4MS2A 4R8CA 5J9PC 2DYRC 3R65A 5EK0A 4MTFA 4PA6A 1K4CC 4PA4A 3ABMC 3IGAC 2BOCC 2EINC 4I9WA 4MVZA 4PDVA 2WLJA 4OXSA 3SYOA 4G28B 2A0LA 3ABLC 4XDKA 4X89A 1P7BA 4MVUA 4H37A 3LDCA 4H33A 3GB7C 2X6BA 4KFMA 4BW5A 3E83A 3F7YC 3SPIA 2HJFC 4WFEA 3FB8C 1OCZC 1JVMA 4EKWA 4F4LA 4PDRA 3TCUA 2K1EA 3FB5C 2ITCC 2ATKC 2EIMC 5B1AC 1ZWIC 2WLMA 3LNMB 2Q67A 5EC2C 3UM7A 5BZBA 4R6ZA 3FB6C 1S5HC 3K0GA 2WLLA 3AG2C 3OUFA 4MW8A 3AG3C 4MVRA 3SPHA 3ZRSA 3SYAA 1R3LC 3E8HA 3LDDA 4PA7A 2HVKC 4LCUC 4QNHB 3KG2A 4WFGA 2QKSA 2Y69C 2ITDC 3ABKC 3T1CA 1XL6A 2KB1A 5KUMA 4MTOA 2HG5C 3E8FA 3X2QC 5IY5C 4LBEC 2WLIA 2QTOA 3K0DA 4R7CA 4X88A 4MVMA 3STZC 3IFXA 2DWEC 1BL8A 1V55C 2Q6AA 3SJQC 4XDLA 4PDMA 5EBWC 2IH1C 3K06A 3SPCA 2BOBC 3SYPA 2ZD9A 1G4YB 2IH3C 2WLLB 2NLJC 2ZXWC 3RVZA 5B3SC 3WG7C 4WFHA 3T4DA 4PA3A 4GX0A 3AG4C 5EBMC 4P2ZA 4HZ3A 4J9YB 3E8GA 3LUTB 4PA9A 1R3IC 1OCOC 1KKDA 3T2MA 4XDJA 4DXWA 2AHZA 3ASNC 1R3KC 4HYOA 2WLHA 2DYSC 4P30A 4QE9A 5EBLC 1OCCC 4JTAB 3LDEA 3AG1C 4MW3A 4UUJC 4X8AA 2H8PC 2Q68A 2EIJC 5EC1C 4RUEA 3ZJZA 3E89A 1OCRC 2HFEC 2Q69A 2R9RB 3T4ZA 3F5WC
chains in the Genus database with same CATH superfamily
3JD0A 4PELA 2O57A 2ZDIA 3OTOO 1EN5A 1E1QG 4ZI7B 3RBZA 2Y4TA 1CPYA 5J2TB 4JI2O 4RAIA 4HNAB 1VF5B 2UUBB 2LW7A 4DV2O 1Q43A 2W6IG 3AG2B 2MK3A 3LSUA 3BCCH 2X0LA 2QA4V 3DGEA 1MMMA 3I56V 4AHCA 1JR9A 1GH6A 4GX5A 1JJ2U 5EZYB 2UXCB 4QPKA 1FYJA 1XNRO 2K9PA 4U3JA 4J80A 4PA4A 4GKKO 2EINC 1BGYH 3VQVA 5LA6B 1F7YA 2P90A 5C8YA 4HAMA 5E79Z 1BS3A 3CHXA 3K9AA 1GN3A 2CUGA 1K7DA 1RM1B 1WJZA 1THZA 4JI5B 4GKJO 3R66A 1S5HC 4NTWA 4DV0B 1QLEB 4W4KA 3UO2A 2YDEA 3RGBA 1GK9A 1WP8A 1EN6A 5JH7A 5FLXN 1VF7A 2VQEB 1HR0O 5L3GA 2UUCO 4WFGA 3ABKC 2KB1A 4GYCB 4DV6O 4NXMB 1GKFA 2VQFO 5FNVB 1SQVH 2OIEA 5B5EZ 2ZD9A 1IVSA 3B40A 2HP8A 2XHBA 3JD1A 5HFMA 4YIOA 4PA3A 4P2ZA 3VBBA 3FAVA 1KKDA 3APOA 2ZT9B 1K97A 4QE9A 2QM7A 3ZHVA 4ZKIA 1M56B 2WPDG 3A0BZ 3HB3B 4DV4O 3CC2V 4F6RA 3NXSA 4KXRA 1I94B 1LR1A 5KLVH 3SJCC 2VWKA 1OHHG 3KKYA 4DV3B 5DM6V 1SQBH 2KKWA 1K4DC 4B3SO 4I7ZB 5K1PA 2ZKOA 5KUKA 2ZM6O 4HBNA 4JZGA 4H44B 4JI3O 3RW0A 2DW4A 4J7ZA 1R6TA 2WLIB 1BQ0A 4JYCA 2P4VA 4RWUA 1NBMG 5H6RA 4BWAA 3SPJA 2Z3YA 3L9DA 2OWOA 1NR7A 4YJ3A 3JCZA 2N74A 4JYAB 1PNMA 4MTFA 1K4CC 3ABMC 2OCHA 4K0KO 4L8JA 3K79A 1OCCB 3HKBA 5CMUA 4RQEA 3O9OA 4J41A 2QTSA 5B1AC 3QG5A 1JCHA 3ZIAG 2WLLA 2CK3G 1EBOA 4QNHB 5CA1B 1SKVA 1OZ0A 2BE3A 4XBFA 1VEWA 2XNDG 2PTMA 4DR6O 1FFXA 3RVZA 2X7RB 1TA8A 1W0JG 3W7TA 4ZI7A 3FX7A 3CPWU 1V9PA 1Q82W 5J2TA 1UJWB 1XNQB 3HR0A 4HNAA 1AB3A 1VQOV 5EYPB 2H8PC 1ZTEA 1EN4A 2R9RB 4FZ0A 3U10A 3K5LA 3JSNA 4DR7O 5L3CA 3UKMA 1G1XB 3PN1A 4DV7O 4LF6O 4WCEV 1KQSU 4LF7B 3CB2A 4EB6B 2P22C 1SZXA 4NTYA 1BT8A 4AI8A 3CCRV 1AJQA 1L8DA 3J7AU 2YIAA 4LH7A 3JALA 2ZIOA 4FM0A 4NXNO 1RPOA 4DR5B 3CWBH 4PI2A 3R65A 1M9NA 1XHXA 4PA6A 3H1IH 1GM7A 5IE9A 2HHHB 3H9VA 2ADPA 1M4UA 2RQ6A 4AQYO 4X65B 4J11A 1M90W 4IIJB 3N2GB 1JVMA 3AEIA 4KL1A 1XILA 2YEVB 1BMFG 5LHIA 4PA7A 2XAJA 4JI7B 3ETEA 2R9IA 4FMTA 2B1IA 4UB6Z 4X88A 4WFBV 2EULA 3UCSC 1KBHA 5GTHZ 2ZR3A 2BOBC 4LF4B 2F66C 1YCIA 2ZXWC 4O4JA 5KA5A 1VMGA 5EBMC 2EX3A 4H13B 3Q4HB 3ASNC 2QSAA 1PM9A 5J2UB 5LMUB 4DYLA 2Q68A 1HP8A 4B3TB 2DMXA 1NKDA 1NU1H 4D7SA 1AI7A 4Z2WA 4X62B 3BFRA 3CCEV 4EEQA 5IJ9A 1Z5VA 3L72H 3JASA 2DWDC 1U97A 4FM2A 1JX9A 1VQLV 2EILC 4CC5A 5JJEB 2Q9LA 4MVOA 3EVKA 3ZHSA 4YHHO 3JD2A 1XL4A 2PF4E 4RUFA 1YJWV 1VQ7V 1JQ0A 4DUYB 1MSWD 4PHZA 2JJ2G 2ZQMA 2RNBA 4CBCA 1Y74B 1JA8A 3ETQA 4BIOA 3G71V 2FYUH 1LUVA 4JAAA 4MS2A 3D36C 3ZHRA 1H2GA 2IBZH 3AG4B 1VQKV 1QU7A 4PDVA 2Y0IA 2LFSA 2N04A 4I9WA 1BQZA 2XT9A 1IXBA 2F1MA 3QO8A 3T1HB 3LDCA 1R73A 4DV5B 1AVMA 2FL4A 4FZ1A 3FB8C 2VRZA 5KX5A 5JWPA 3DC6A 1IBLB 2Q67A 4O4IB 3OTFA 4BR6A 4OGQB 3E8HA 2F93B 1RPRA 3P3NA 1NTZH 5KAFZ 3JATB 1JOYA 4ZOLA 1MZEA 3OMNB 1VF6C 5EYPA 4X64B 4PDMA 3J80N 2Q4PA 2AXTZ 2GDSA 1FXKB 3B09A 3K3WA 4LF5B 1QLNA 1ZLZA 3B4SA 3JD3A 4U3JB 4MTXA 5L3BA 2LGQA 1XMOB 4O4LB 1FJGB 2ZIMA 2WLHA 4WBNB 5C93A 1BCCH 2HJDA 3IC9A 3OEEG 4B3MB 2E74B 1YVWA 4FJCC 1EZVH 1VQ4V 4R6ZA 3FKSG 5DN6G 2B9ZA 4Z1VA 3TJTA 1VQ8V 1D5AA 3CRCA 1I7FA 2Q0OC 3WB2A 1O9HA 2GHYA 1MA1A 1B3QA 2P6JA 2QKAA 2UXNA 2RMKB 4U7NA 4RO2A 2E3CA 2EIMB 1IBKO 2JK5C 2PYJA 3DSQA 3H1KH 1NZ6A 2X6CA 3CXHF 4LNUB 3K5OA 4K8XA 1D2DA 2UXXA 4FIPC 3VQXA 3C3SA 2XUMA 4LF8B 2JJ1G 2PI4A 4IIJA 3N2GA 2D3OW 3WFVA 1R3JC 4X1IB 1Z5WA 1Q3EA 2XTAA 2WSSG 4GX1A 3SYCA 3CP1A 1MG1A 1OCOB 4JPRA 1H2LA 2B1GA 3L71H 1WLEA 3GB7C 2X6BA 3B2EE 5IT9N 3SPIA 2F95B 3ETGA 1OCZC 2JDIG 5BY1A 2ITCC 3T1YO 2ZNJA 1BZKA 2BTOA 4DO2A 4K3AA 2XASA 2ZE8A 1G8MA 3FD9A 1GM9A 3Q4HA 3MHHC 2QTOA 5J2UA 4R7CA 5IWAB 3FYEB 2QWNB 2DWEC 3L70H 4LF9B 1WA8A 4YJ3B 3CEIA 2IH3C 2NLJC 4Z1MG 3A0HZ 1SRYA 3WG7C 1RFYA 4WFHA 2L35A 3LUTB 1YJNV 4C7UA 3IAYA 4DXWA 1NH2D 1KB9F 1BE3H 4HYOA 4P30A 5EBLC 5KHKA 1IBMO 1XQ8A 5IYZA 4JV5O 3OTOB 4JYBA 1UFIA 3T4ZA 1WB8A 3W7XA 3W7WA 4JI2B 1YZBA 3CRQA 5DECA 4DV2B 4IYHA 4DR3B 1WNSA 3WU2Z 2GV9A 3E86A 1Y74A 4LWSB 2Y48A 4UB8Z 1SQFA 4JASA 2ZE7A 3OGIB 4NR1A 1J95A 1W59A 1SS3A 5LHGA 1V54C 1FFXB 3DXRB 4K8ZA 1YTFB 3GVMA 3TETA 1N0JA 1XNRB 1TVKB 4TV9B 1CP9A 3G67A 3SPGA 3CCJV 2QWRB 4O4IA 2DYRC 2OTJV 3STLC 5LGUA 4MVZA 4RQFA 1EFRG 3TXSA 3JATA 1K33A 1SQXH 1FAFA 4GKJB 1OCRB 5CA3A 4EKWA 4ZHQB 2WWWA 3JAKA 2BSKB 3ZMZA 5LP6C 1PKXA 1OJHA 3H1JH 2C2AA 1HR0B 2LFRA 2UUCB 1FXKA 2E5LO 3SPHA 4DV6B 4DR4B 5A9GA 3CXCU 4DR1O 2QKSA 2YXYA 2ITDC 1P7GA 2VQFB 5L3FA 4O4LA 4WBNA 1K34A 5LL6Y 3AK1A 3JALB 2IH1C 1N32O 3ASOB 4B7EA 4KHPO 5B3SC 3FYIB 2JGUA 1TGOA 2RJZA 4PA9A 4J7JA 1W2BU 2XAGA 1CEZA 2XOKG 1Q6HA 3S3WA 4MW3A 5LBQA 1L0NH 3ZRWB 5ITZB 4B3SB 4X1YA 2ZM6B 2E76B 4LNUA 4JI3B 2OCCC 2WLNA 2LJ2A 4PDLA 2UXCO 1VQMV 4X1IA 1G6UA 3E8BA 5CBHA 3QNEA 1VIBA 4FPPA 3JD4A 1I5XA 5CBGA 4IL6Z 4I9QA 1S72V 5IY5B 2Y0PA 3OR6C 1JMKC 1FFTB 4FVMA 3JCUZ 4O4JB 1MZFA 1P49A 4JTDB 3CC7V 4LH6A 3ZN1A 4K0KB 3F5TA 4DV1O 3ZHTA 1QR8A 1WPXA 5IJ0A 3CC4V 1AI4A 2EIJB 4WFEA 3CCQV 4I0XB 3RYFB 5L3EA 2K1EA 2HLDG 1B06A 1ZWIC 2WLMA 5IJ9B 3UM7A 2UXBO 1M93A 3JASB 1K73W 3K59A 4UXNA 3HKDA 5L3DA 4BAYA 4CS4A 2F4VO 3X2QC 1Q8IA 1MNGA 1Q7YW 4DR6B 3DC5A 3STZC 4DK0A 2Q6AA 2Q0AA 1MOFA 1I5YA 1MABG 5K1XA 4B7KA 4GUNA 2Q7GA 3E8GA 3E35A 2V4DA 2AHZA 2ZE6A 4B3RO 4LWSA 3SJAC 2RDCA 5KHJA 1HW7A 5EC1C 3ZMVA 2Q7EA 1YHQV 3TGUH 1K5QA 5KX5B 3ABLB 1NS1A 4DV7B 4LF6B 4A5UB 3DXRA 2FMLA 3C3TA 5FL7G 1TUEB 4GX2A 1TVKA 2L6LA 1WAZA 1Y4MA 4TV9A 2M6YA 1YSCA 2CTWA 1RP3B 4ZOLB 3AG3B 1FPOA 5JVDB 2Q73A 3BEHA 2YUAA 1XMQO 1YIJV 3BHPA 5IDJA 4BW9A 4TUYB 2QWPB 4NXNB 5CBFA 5JJNB 4TV8A 4Q6GA 1N33O 3EHBB 4GCZA 4TOIA 4ZHQA 4DRXB 3RWRD 2BSKA 3K5NA 1MSDA 1N34O 5J9PC 4DW1A 1PP9H 4LFBO 3IJ4A 4AQYB 1ZUQA 4UCTA 4LR3A 1XREA 3BABA 4G28B 4OPAA 2DYSB 4QPJA 3D36A 1H38A 2A06H 1GMGA 1Z2GA 1NR1A 4PV1B 1AJNA 3FB5C 3APQA 3LNMB 3HKEA 1FXVA 2GUZB 1E79G 4YXWG 4LCUC 2IJIA 2Y69C 4OX9O 1R6NA 2HG5C 4JI1O 1KD1W 1XEQA 1WPBA 4JGSA 3I5DA 4JI0O 1GN2A 5JCOC 3ZRWA 3ICXA 1PD3A 5ITZA 1X59A 3SYPA 2ARHA 2GTSA 2YSUB 5LP6B 1J5EO 3T2MA 5KMGB 1R3KC 2JVDA 3ZRVA 4DR2O 3ZEDA 2Q69A 4ICGA 1FD9A 2EINB 5LYJB 1SESA 4P9PA 3F7VC 3SJBC 2QKCA 2QGNA 3THOA 1U96A 1K92A 4D7TA 1LNQA 3S3XA 4YHHB 3VOUA 2R9AA 3FFQA 2ZR2A 1US6A 1Y6XA 3ABKB 3K08A 3LNNA 1WA8B 3QTCA 1O9GA 3I55V 4JI6O 2EJ7A 2QR4A 3GWKC 4I0XA 3RYFA 2KQXA 1M1KW 3ZRXA 4LFAB 4FLUA 2IJHA 5IYZB 1GO3F 2GSMB 4KP4A 4G2KA 4CS3A 4MVUA 3OMAB 4UCUA 4BW5A 3G80A 4JAUA 1QQCA 2HJFC 2UUAO 1KP3A 3TCUA 2ATKC 1YDXA 1Y76A 3UO3A 1VQ9V 1N0NA 4LF4O 1QVFU 3AG2C 4NKGB 1LUWA 1KP2A 3QO7A 1PPJH 3BAAA 4X9QA 2BTQB 4GT1A 1NVPB 4PJ0Z 4I4TB 4TQDA 3KCXA 4CH3A 4B3TO 1VQ5V 5H6QA 3SPCA 5GONA 3K57A 3CYOA 3AK2A 3T4DA 3OW2U 2EZOA 3UQ8A 1WB7A 4J9YB 1R3IC 3CRMA 2Z0AA 2V7QG 4JTAB 4NTXA 3TK1A 3BA8A 1SA0B 4YIPA 2DJVA 2ZINA 1RM1C 2AW9A 3ABMB 4L87A 5JVDA 1BSMA 4UCRA 2P67A 5AG2A 3JAKB 3L74H 3CRRA 4BIZA 1DTOA 4TUYA 1B04A 2ILMA 3FB7C 3OR7C 4FLVA 1IBKB 2JGDA 1R1BA 1AROP 3CE2A 5B1AB 1M57C 4DRXA 4ZBMA 4K35A 1R6KA 5H9CA 1IDSA 2Z5UA 3OUSA 2F23A 2H94A 5BR8O 1L0LH 1PV0A 3ZN0A 1AI6A 1F23A 1GN6A 2IJJA 1ORQC 4P9OA 1ZL8B 1M56C 2LO1A 3M99B 1K9MW 3RYHA 1HNZB 2GUZA 2NN4A 1HDJA 4OXSA 3GWOA 4X1YB 1T5EA 1KMIZ 3E22B 1JFFA 1YITV 3T1YB 2UU9O 4X64O 2OIGA 4E2LA 2UXDB 1S76D 2CGNA 3WB0A 3K0GA 1X4TA 1Q6IA 4MVRA 1R3LC 4LC1A 4WF9V 2EJRA 1URFA 3KG2A 5LP6A 1FJGO 3D3IA 5KMGA 1TAEA 4OPHA 1S5LZ 2CTQA 1XUQA 5KAIZ 5IYBO 3L75H 1YXBA 5LYJA 4UV9A 3A0RA 4FFKA 2OTLV 3H1LH 3HKCA 3E2EA 4JV5B 5LOVA 4Q20A 3K9SA 1WP7A 1OCCC 5IJ0B 4ASUG 5A2QN 1AP5A 5FPOA 4YY3O 2WA4A 1VQ6V 2QDOA 4W4LA 1GAXA 3HKDB 4AILC 1Q6UA 4MVSA 2PZSA 1KKCA 1PNKA 2EIKC 2GTAA 4FM1A 5LXTA 3JAMN 3K04A 1XBLA 5BMVB 4FLXA 2CAZC 1Q90D 4EFBA 4JI4O 4LP8A 2A79B 2P5OA 5LMNO 1N4CA 1QBZA 5JQGA 4JI8O 3WB1A 3CCMV 2BCCH 2ZXWB 3SYQA 1QNMA 4R8CA 4LFCO 3OMIB 2AGAA 1XHZA 2Y4UA 3ASNB 3QVNA 3AK3A 2BTQA 2PGGA 2M7WA 4KFMA 4I4TA 4X66O 1HNXO 1AR4A 1EZJA 4PDRA 2E5LB 3G4SV 4DR1B 4H0LB 2P4KA 2LP7A 4MW8A 2LW1A 3SYAA 4GKKB 2YI9A 2N05A 3T1CA 3VQYA 2RN9A 1XL6A 2YIBA 4FLYA 1TUBB 2VS0A 2EILB 3K0DA 4DUZO 1N32B 1IURA 1SA0A 4KHPB 4TV8B 3SJQC 4XDLA 1RSOB 5EBWC 4EFEA 3KCYA 3ZMUA 3BRCA 1YI2V 4I50B 1K5SA 2B5UA 4WFAV 4GX0A 1N36O 4DR3O 2YXHA 2QEXV 3DTUB 1Q86W 3OE7G 1XOUA 5KA6A 3AG1C 1AJPA 4RUEA 1NQTA 1HNWO 5F2VO 1GRJA 4O2AB 5CA0A 2ETNA 5GW7A 3HKEB 1XI1A 2HVJC 2QM8A 4MTGA 3CMAV 2UUBO 2ODMA 3H1HH 1VQPV 3NR7A 1ZL8A 4DV4B 2PYLA 4DK1A 4G27B 4KUMA 2JS3A 3OT7A 1E1RG 4GZRB 4NB5A 3ZMTA 3CD6V 4NYKA 5JJJB 1AR1B 3RFRA 1ZAUA 3E22A 4IHJB 1NJIW 1IZ3A 1ROPA 1ZSPA 4DV1B 5LGNA 3JARB 3CCSV 4QE7A 2ZNIA 1M57B 4MT8A 2WLJA 4DR4O 4IGGA 2LQTA 3H01A 5FPRA 3F7YC 3JAWA 2UXBB 2OYQA 4O4HB 4UVBA 2KSDA 1SC5B 1KU9A 3OUFA 3CCVV 4JI5O 4N23A 1B6QA 2F4VB 2E75B 2HVKC 4DV0O 3M8AA 4MTOA 2VQEO 4TT3G 1I0HA 4NXMO 5B66Z 2VWJA 3W7UA 5JCOA 3CCLV 2HEPA 2CH7B 4B3RB 3AG4C 1S77D 4ZIBA 1AILA 2DN9A 2QWOB 2ZDIC 4I55A 1H2NA 2AZ0A 3ML0A 4TQFA 1EM1A 4X8AA 1FS0G 3RYIB 2JEXA 5CB4B 2Q5ZA 5BMVA 4J10A 1H8HG 5CN0A 3RT3C 1KYOF 3N2KB 4X20B 5H5NA 1JJOA 4IYIA 4YJ2B 4GLXA 1Y76B 5IYDO 2IJKA 1I94O 1W0KG 1DLBA 4DV3O 1OCZB 1SERA 3RVYA 2W0FC 3OGCC 1XMQB 3CJHA 2CDYA 3ABTA 4QJFB 1SQPH 2QE7G 1F4NA 4DR7B 1KUQA 1PL0A 5GONB 1N33B 2FB5A 1FXKC 4FFBB 5E1AC 1BHAA 1YTFD 2RCVA 3EFFK 3BY6A 2A9HA 4O2BA 1N34B 3CRAA 2FKXA 4LFBB 2ADQB 4R50A 1S0VA 2PY5A 3WG7B 4J9ZB 1SQGA 4QIWF 3IGAC 2EIKB 3CSXA 4JYAO 2A0LA 4XDKA 1DK1A 5IYCO 4H37A 1QCEA 5LHHA 1TUBA 1H2SB 2NNUA 1XDCA 2EIMC 3OFNG 1RSOA 2JGDB 1DGSA 3ZX6A 4I50A 4D6TH 1S5JA 1H2MA 4E4EA 2YC0A 2QWQB 3ZRSA 4OX9B 1GTOA 3L73H 1P4RA 3LDDA 4JI1B 2QM4A 3J81N 3D3QA 5KUMA 4JI0B 3ZS8C 2CE4A 2DQ0A 3OD4A 3D8CA 3QO5A 1PNLA 1V55C 3ZHQA 3OM3B 3BA9A 4O2AA 1V54B 2YI8A 1IXMA 1J5EB 3AG7A 2FTKA 3RYHB 4HZ3A 4IT5A 5EZYA 2KG7B 1OCOC 4DR2B 3KZIZ 2DE0X 1XNQO 1NI8A 2ZCEA 2CTPA 3SDLA 2JIZG 2DYRB 3ZJZA 1JFFB 2JRIA 3E89A 5LGTA 5LA6A 2DOSA 4X1KB 1VF6A 1S3JA 1K3EA 4IHJA 3JYCA 3MAQA 5KHGA 4MVQA 1HWYA 3ZBHA 1F4MA 3JARA 4TWKA 5B1BC 3U11A 3ZMSA 4LF7O 3HPLC 3MDSA 3AG1B 4JI6B 5BXZA 2P7TC 5FNVA 1L1FA 1KC8W 4O4HA 2AZ2A 3HKCB 5B3SB 5LOVB 3ZCCA 4DR5O 3A8TA 4JAVA 1KECA 2BOCC 2W0XA 1GN4A 3SYOA 3OEHG 1P7BA 2UUAB 2HHHO 4H33A 3RYCB 1AR5A 4CS2A 4X65O 4F4LA 4U3FH 1WN7A 3SR2C 2EZPA 4JZ2A 2OCCB 4ABMA 5LXTB 1BHBA 2G38A 2CH7A 1ENVA 2W6JG 1I08A 2HR3A 4LBEC 2CTRA 2WLIA 3O65A 4MVMA 4PD4F 3A2FA 3RYIA 4JI7O 3CMEV 5CB4A 5JQGB 1SETA 3K06A 1G4YB 2V1DA 3N2KA 4X20A 4YJ2A 2IM9A 3G6EV 1AP6A 3UT5B 5TISZ 5D5PA 1NH2B 3ZHUA 4UV8A 1OCRC 2HFEC 3JSLA 5LMUO 4CH4A 2X6AA 4B08A 4FLZA 3BVOA 5HFLA 4FFBA 4JTCB 3CCUV 2YS8A 3P30A 3RN4A 4X62O 2CGOA 1Y67A 2R72A 5B1NA 4LFAO 5CA1A 1VP7A 1YJ9V 2A3QA 5BR8B 4NVPA 3ASOC 2EBOA 3X2QB 2AHYA 4JF3A 1QLEC 4DUYO 1GM8A 2WLKA 5EIBD 1OV9A 2R70A 2XAFA 1SF9A 1NTMH 3LSQA 2PUSA 4F6EA 2P06A 1VQNV 4DW0A 2F43G 4UCSA 2XAHA 1P84F 1D5NA 1Y66A 4X89A 4CC6A 2UU9B 3EXAA 5CA0B 3MD0A 3B8MA 1YEWA 3T1HO 3OAAG 1NTKH 3P32A 4DV5O 3MHSC 2JEUA 1A32A 5H2FZ 2A7WA 2OT5A 5BZBA 3FB6C 1IBLO 4I5SA 3BPZA 1QVGU 5C8YB 2KG7A 4UFZA 1DF5A 3E8FA 5IY5C 3G6BA 4EB6A 1UPGA 3VQWA 4UCVA 3IFXA 1BL8A 2QJ1A 2D2CB 4UVCA 3LSSA 5JH7B 5GTIZ 2NR5A 4X1KA 1F51A 2H3OA 1QHTA 1COWG 4LF5O 3ABUA 3K5MA 3LDEA 4UUJC 1XMOO 2EIJC 2IU3A 4YY3B 3JAWB 3F5WC 4B3MO 2YICA 3PJSK 4BIUA 1YF2A 2JS5A 3CX5F 3C90A 1NT2B 1V55B 2GBOA 3FAVB 2LGWA 1ZX3A 2YEVA 4TSFG 2WA3A 1IBMB 5D5QA 4MSWC 4JI4B 2XAQA 4F6RB 3K03A 1DF4A 1HNZO 4WFFA 5LMNB 1M5IA 4CH6A 2WAMA 4U7OA 2Y69B 4JI8B 5B1OA 4FLTA 1JPXA 1N8RW 3ETDA 3RYCA 5DEDA 2UXDO 3CS5A 4LFCB 1QR9A 3W7SA 4LF8O 2YXLA 2IU0A 5KHIA 4FLWA 5KHHA 1Q81W 4I55B 5EK0A 1IX9A 1SZTA 5B1BB 3ABLC 4X66B 1HNXB 1H8EG 3E83A 2HKOA 3K58A 2Q7HA 3QF7A 3N27A 1SQQH 3IC7A 5EC2C 2DQ3A 3AG3C 4JYYA 2Q8VA 1AI5A 2YIDA 3CJHB 4PI0A 4N21A 1NVPD 4DUZB 3UT5A 1Q5OA 3SGIA 3TXQA 3HKBB 1H2KA 1PL4A 2ZE5A 5IWAO 4O2BB 1CXZB 4J42A 2WLLB 4UVAA 5EIBC 1N36B 3U0ZA 3P3PA 4LF9O 4CZZA 2PI5A 3B77A 4FK5C 2YIBD 4XDJA 4QGPA 2DYSC 1K8AW 3B8NA 2IW5A 4J7KA 1FKAO 1HNWB 3M7MX 2MW2B 4UCOA 1FXHA 4CH5A 1VARA
chains in the Genus database with same CATH topology
3JD0A 4PELA 5CN0A 1SESA 2ZDIA 3FKSG 4P9PA 5DN6G 1VQ8V 3F7VC 1E1QG 5IYDO 3RBZA 2IJKA 1CPYA 2GHYA 4RAIA 2P6JA 2UXNA 1W0KG 1DLBA 1K92A 1OCZB 1SERA 4U7NA 3RVYA 4RO2A 2EIMB 2W0FC 1LNQA 3OGCC 2JK5C 3VOUA 2W6IG 3AG2B 2MK3A 3ABTA 4QJFB 2QE7G 2ZR2A 1F4NA 2X6CA 2X0LA 1PL0A 3ABKB 3DGEA 3K08A 2QA4V 1FXKC 2UXXA 5E1AC 3I56V 1YTFD 1BHAA 4FIPC 3I55V 3EFFK 3BY6A 2JJ1G 2A9HA 4GX5A 1JJ2U 2PI4A 2D3OW 3WFVA 1R3JC 4QPKA 1M1KW 4R50A 3ZRXA 1S0VA 2WSSG 4GX1A 3SYCA 3WG7B 3CP1A 4J9ZB 2IJHA 1GO3F 1MG1A 2GSMB 1OCOB 2EINC 3IGAC 4PA4A 2EIKB 4QIWF 2P90A 4JPRA 4KP4A 2A0LA 4G2KA 4HAMA 4XDKA 2B1GA 5IYCO 4MVUA 4H37A 3K9AA 1QCEA 1WLEA 3GB7C 2X6BA 3OMAB 4BW5A 5LHHA 4JAUA 2NNUA 3SPIA 2HJFC 1K7DA 3ETGA 1OCZC 1RM1B 1KP3A 1THZA 2JDIG 3TCUA 2ITCC 2ATKC 2EIMC 3OFNG 1VQ9V 1QVFU 1S5HC 3AG2C 1QLEB 4DO2A 3ZRSA 1GK9A 1GTOA 1KP2A 3QO7A 1P4RA 2XASA 3LDDA 1G8MA 5L3GA 1GM9A 4WFGA 3ABKC 4GT1A 2KB1A 5KUMA 1NVPB 3MHHC 2DQ0A 1GKFA 2QTOA 4R7CA 3FYEB 3QO5A 2DWEC 1PNLA 1V55C 1VQ5V 3OM3B 5H6QA 3SPCA 2ZD9A 3CYOA 1V54B 2IH3C 2NLJC 3JD1A 4Z1MG 5HFMA 1IXMA 1SRYA 3WG7C 4WFHA 3T4DA 4PA3A 3OW2U 2EZOA 2FTKA 4P2ZA 4HZ3A 4J9YB 3LUTB 3VBBA 1YJNV 1OCOC 1R3IC 1KKDA 4DXWA 1NH2D 4HYOA 1K97A 4P30A 4QE9A 2QM7A 5EBLC 4ZKIA 1M56B 2V7QG 2WPDG 4JTAB 3TK1A 3HB3B 2JIZG 2DYRB 3ZJZA 3CC2V 3E89A 4JYBA 3NXSA 5LGTA 3T4ZA 1RM1C 3ABMB 4L87A 3W7XA 3W7WA 2P67A 1OHHG 4BIZA 5DM6V 1K4DC 1DTOA 3OR7C 3FB7C 1S3JA 1K3EA 5KUKA 3JYCA 1AROP 3E86A 5B1AB 4MVQA 1HWYA 3RW0A 1M57C 2Y48A 1F4MA 2DW4A 4TWKA 4ZBMA 5B1BC 1R6KA 4JASA 2WLIB 5H9CA 3ZMSA 1J95A 2Z5UA 4JYCA 3HPLC 3AG1B 5LHGA 1V54C 3OUSA 1NBMG 2P7TC 2H94A 5H6RA 1L1FA 3SPJA 1KC8W 1YTFB 2Z3YA 3TETA 3ZN0A 1AI6A 1F23A 1NR7A 1CP9A 2IJJA 1ORQC 4P9OA 1M56C 3SPGA 3CCJV 3JCZA 3M99B 5B3SB 3ZCCA 1K9MW 2DYRC 2OTJV 1PNMA 4JAVA 4MTFA 1K4CC 3STLC 3ABMC 1KECA 2BOCC 4MVZA 3SYOA 5LGUA 4RQFA 4OXSA 3GWOA 3OEHG 1EFRG 1P7BA 3K79A 4H33A 1OCCB 5CMUA 1K33A 1YITV 1OCRB 5CA3A 4EKWA 4F4LA 4E2LA 2WWWA 4RQEA 1S76D 5B1AC 3ZMZA 1PKXA 1JCHA 2EZPA 2C2AA 3ZIAG 3K0GA 2OCCB 2LFRA 2WLLA 1FXKA 4MVRA 2CK3G 3SPHA 1BHBA 1EBOA 1R3LC 1ENVA 4LC1A 4WF9V 4QNHB 2W6JG 2EJRA 3KG2A 3CXCU 2HR3A 2QKSA 2ITDC 5L3FA 3D3IA 1OZ0A 1K34A 4LBEC 4XBFA 2WLIA 4MVMA 3CMEV 2XNDG 1SETA 2IH1C 3K06A 5IYBO 1G4YB 2V1DA 3ASOB 4UV9A 3RVZA 3A0RA 5B3SC 2X7RB 3FYIB 1W0JG 3W7TA 3CPWU 1Q82W 2OTLV 1UJWB 4PA9A 3G6EV 1W2BU 2XAGA 3E2EA 1CEZA 2XOKG 4Q20A 1NH2B 1VQOV 1OCCC 4MW3A 5LBQA 2H8PC 4UV8A 3ZRWB 4ASUG 1OCRC 2HFEC 2R9RB 2X6AA 5L3CA 2OCCC 2WLNA 1VQ6V 5HFLA 3UKMA 4JTCB 4PDLA 3CCUV 3P30A 4MVSA 1VQMV 4WCEV 1PNKA 2EIKC 1KQSU 3K04A 3E8BA 5CBHA 3QNEA 5B1NA 4FPPA 1YJ9V 3JD4A 1I5XA 3CCRV 5CBGA 3ASOC 1S72V 1AJQA 2A79B 2EBOA 4LP8A 3X2QB 5IY5B 3OR6C 1FFTB 1QBZA 2AHYA 4JF3A 1QLEC 4JTDB 3CC7V 1GM8A 2WLKA 1RPOA 3ZN1A 3CCMV 2ZXWB 3SYQA 2XAFA 3LSQA 4R8CA 1QR8A 3OMIB 1M9NA 3R65A 4PA6A 1VQNV 1GM7A 1WPXA 2F43G 2XAHA 3ASNB 1Y66A 4X89A 3CC4V 3MD0A 3B8MA 1AI4A 2M7WA 4KFMA 1M90W 2EIJB 4WFEA 3OAAG 3CCQV 1JVMA 1EZJA 3AEIA 4PDRA 5L3EA 2K1EA 3P32A 2HLDG 3MHSC 1ZWIC 2WLMA 2JEUA 2YEVB 3UM7A 1BMFG 3G4SV 2OT5A 5BZBA 3FB6C 1K73W 4MW8A 2LP7A 5LHIA 4I5SA 3SYAA 4UXNA 4PA7A 1QVGU 5L3DA 3T1CA 4BAYA 1XL6A 1DF5A 2XAJA 3E8FA 3ETEA 2R9IA 4FMTA 3X2QC 5IY5C 2EILB 2B1IA 3K0DA 4WFBV 4X88A 1Q7YW 3STZC 3IFXA 1BL8A 2Q6AA 3SJQC 4XDLA 5EBWC 2ZR3A 1MOFA 3ZMUA 2BOBC 1YI2V 4UVCA 1I5YA 1MABG 2ZXWC 3LSSA 1K5SA 2B5UA 4WFAV 5KA5A 4GX0A 5EBMC 3E8GA 1F51A 3E35A 2AHZA 3ASNC 1COWG 3DTUB 1Q86W 2QEXV 3OE7G 3ABUA 3LDEA 3AG1C 4UUJC 5KA6A 1AJPA 2Q68A 2EIJC 5EC1C 4RUEA 2IU3A 3ZMVA 1NQTA 1YHQV 1K5QA 3F5WC 1NKDA 3ABLB 3PJSK 4BIUA 5GW7A 1AI7A 1V55B 3CCEV 2HVJC 2QM8A 5FL7G 1TUEB 2YEVA 4GX2A 4MTGA 4TSFG 3CMAV 1Y4MA 2DWDC 1VQPV 1YSCA 1JX9A 1VQLV 2EILC 4MSWC 2XAQA 3AG3B 3K03A 1DF4A 4G27B 4MVOA 4WFFA 3BEHA 4KUMA 3JD2A 1XL4A 1YIJV 2WAMA 4U7OA 2Y69B 3ZMTA 1E1RG 5IDJA 3CD6V 4RUFA 1YJWV 1VQ7V 1AR1B 1JQ0A 5B1OA 1MSWD 5CBFA 1JPXA 1N8RW 3ETDA 2JJ2G 2ZQMA 1NJIW 4CBCA 3EHBB 1ROPA 4GCZA 5LGNA 3W7SA 1QR9A 3G71V 2IU0A 3CCSV 4QE7A 1Q81W 4MS2A 5J9PC 1H2GA 3AG4B 5EK0A 1VQKV 4PDVA 2LFSA 1M57B 4I9WA 4MT8A 2WLJA 1SZTA 4G28B 5B1BB 3ABLC 2DYSB 3QO8A 3H01A 3LDCA 4QPJA 3D36A 1H38A 1H8EG 1R73A 3E83A 2HKOA 1GMGA 3F7YC 3FB8C 1NR1A 1AJNA 4UVBA 3FB5C 3LNMB 3IC7A 2Q67A 1FXVA 5EC2C 4R6ZA 2DQ3A 3OUFA 1E79G 3CCVV 3AG3C 4N23A 1AI5A 1B6QA 4YXWG 3E8HA 2HVKC 1RPRA 4LCUC 4N21A 1NVPD 2IJIA 2Y69C 1R6NA 4MTOA 2HG5C 1JOYA 3OMNB 1KD1W 4TT3G 4JGSA 3ZRWA 1PD3A 4PDMA 3SYPA 2WLLB 4UVAA 1FXKB 3W7UA 3CCLV 4CZZA 2PI5A 3K3WA 2YSUB 3AG4C 3B77A 1QLNA 4FK5C 3JD3A 4MTXA 5L3BA 3T2MA 4XDJA 1S77D 1R3KC 2WLHA 2DYSC 1K8AW 3B8NA 2IW5A 5C93A 2ZDIC 3ZRVA 3ML0A 3OEEG 4X8AA 1FS0G 2JEXA 1FXHA 4FJCC 2Q69A 1VQ4V 2EINB 1H8HG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2X6A A;  4P9P A;  3F7V C;  3PJS K;  2OCC C;  2WLN A;  1K4D C;  3RBZ A;  3UKM A;  3OR7 C;  3FB7 C;  4RAI A;  4JTC B;  2HVJ C;  4PDL A;  5KUK A;  3RVY A;  2YEV A;  3JYC A;  4GX2 A;  3E86 A;  4MTG A;  4RO2 A;  4MVS A;  4MVQ A;  2W0F C;  2DWD C;  1LNQ A;  3RW0 A;  1M57 C;  3OGC C;  2EIK C;  2JK5 C;  4TWK A;  4ZBM A;  3VOU A;  2EIL C;  4MSW C;  5B1B C;  3K04 A;  3E8B A;  3K03 A;  5CBH A;  2WLI B;  4G27 B;  4MVO A;  4WFF A;  3BEH A;  1J95 A;  1XL4 A;  3HPL C;  2X6C A;  5CBG A;  3ASO C;  3K08 A;  1V54 C;  3OUS A;  4LP8 A;  2A79 B;  4RUF A;  5E1A C;  3OR6 C;  2P7T C;  5CBF A;  3SPJ A;  3EFF K;  2AHY A;  3STL C;  3TET A;  2A9H A;  4GX5 A;  1QLE C;  4JTD B;  4CBC A;  2WLK A;  1ORQ C;  1R3J C;  4P9O A;  4R50 A;  1M56 C;  3SYQ A;  3SPG A;  4QE7 A;  4GX1 A;  3SYC A;  4J9Z B;  4MS2 A;  4R8C A;  5J9P C;  2DYR C;  3R65 A;  5EK0 A;  4MTF A;  4PA6 A;  1K4C C;  4PA4 A;  3ABM C;  3IGA C;  2BOC C;  2EIN C;  4I9W A;  4MVZ A;  4PDV A;  2WLJ A;  4OXS A;  3SYO A;  4G28 B;  2A0L A;  3ABL C;  4XDK A;  4X89 A;  1P7B A;  4MVU A;  4H37 A;  3LDC A;  4H33 A;  3GB7 C;  2X6B A;  4KFM A;  4BW5 A;  3E83 A;  3F7Y C;  3SPI A;  2HJF C;  4WFE A;  3FB8 C;  1OCZ C;  1JVM A;  4EKW A;  4F4L A;  4PDR A;  3TCU A;  2K1E A;  3FB5 C;  2ITC C;  2ATK C;  2EIM C;  5B1A C;  1ZWI C;  2WLM A;  3LNM B;  2Q67 A;  5EC2 C;  3UM7 A;  5BZB A;  4R6Z A;  3FB6 C;  1S5H C;  3K0G A;  2WLL A;  3AG2 C;  3OUF A;  4MW8 A;  3AG3 C;  4MVR A;  3SPH A;  3ZRS A;  3SYA A;  1R3L C;  3E8H A;  3LDD A;  4PA7 A;  2HVK C;  4LCU C;  4QNH B;  3KG2 A;  4WFG A;  2QKS A;  2Y69 C;  2ITD C;  3ABK C;  3T1C A;  1XL6 A;  2KB1 A;  5KUM A;  4MTO A;  2HG5 C;  3E8F A;  3X2Q C;  5IY5 C;  4LBE C;  2WLI A;  2QTO A;  3K0D A;  4R7C A;  4X88 A;  4MVM A;  3STZ C;  3IFX A;  2DWE C;  1BL8 A;  1V55 C;  2Q6A A;  3SJQ C;  4XDL A;  4PDM A;  5EBW C;  2IH1 C;  3K06 A;  3SPC A;  2BOB C;  3SYP A;  2ZD9 A;  1G4Y B;  2IH3 C;  2WLL B;  2NLJ C;  2ZXW C;  3RVZ A;  5B3S C;  3WG7 C;  4WFH A;  3T4D A;  4PA3 A;  4GX0 A;  3AG4 C;  5EBM C;  4P2Z A;  4HZ3 A;  4J9Y B;  3E8G A;  3LUT B;  4PA9 A;  1R3I C;  1OCO C;  1KKD A;  3T2M A;  4XDJ A;  4DXW A;  2AHZ A;  3ASN C;  1R3K C;  4HYO A;  2WLH A;  2DYS C;  4P30 A;  4QE9 A;  5EBL C;  1OCC C;  4JTA B;  3LDE A;  3AG1 C;  4MW3 A;  4UUJ C;  4X8A A;  2H8P C;  2Q68 A;  2EIJ C;  5EC1 C;  4RUE A;  3ZJZ A;  3E89 A;  1OCR C;  2HFE C;  2Q69 A;  2R9R B;  3T4Z A;  3F5W C; 
#chains in the Genus database with same CATH topology
 3JD0 A;  4PEL A;  2O57 A;  2ZDI A;  3OTO O;  1EN5 A;  1E1Q G;  4ZI7 B;  3RBZ A;  2Y4T A;  1CPY A;  5J2T B;  4JI2 O;  4RAI A;  4HNA B;  1VF5 B;  2UUB B;  2LW7 A;  4DV2 O;  1Q43 A;  2W6I G;  3AG2 B;  2MK3 A;  3LSU A;  3BCC H;  2X0L A;  2QA4 V;  3DGE A;  1MMM A;  3I56 V;  4AHC A;  1JR9 A;  1GH6 A;  4GX5 A;  1JJ2 U;  5EZY B;  2UXC B;  4QPK A;  1FYJ A;  1XNR O;  2K9P A;  4U3J A;  4J80 A;  4PA4 A;  4GKK O;  2EIN C;  1BGY H;  3VQV A;  5LA6 B;  1F7Y A;  2P90 A;  5C8Y A;  4HAM A;  5E79 Z;  1BS3 A;  3CHX A;  3K9A A;  1GN3 A;  2CUG A;  1K7D A;  1RM1 B;  1WJZ A;  1THZ A;  4JI5 B;  4GKJ O;  3R66 A;  1S5H C;  4NTW A;  4DV0 B;  1QLE B;  4W4K A;  3UO2 A;  2YDE A;  3RGB A;  1GK9 A;  1WP8 A;  1EN6 A;  5JH7 A;  5FLX N;  1VF7 A;  2VQE B;  1HR0 O;  5L3G A;  2UUC O;  4WFG A;  3ABK C;  2KB1 A;  4GYC B;  4DV6 O;  4NXM B;  1GKF A;  2VQF O;  5FNV B;  1SQV H;  2OIE A;  5B5E Z;  2ZD9 A;  1IVS A;  3B40 A;  2HP8 A;  2XHB A;  3JD1 A;  5HFM A;  4YIO A;  4PA3 A;  4P2Z A;  3VBB A;  3FAV A;  1KKD A;  3APO A;  2ZT9 B;  1K97 A;  4QE9 A;  2QM7 A;  3ZHV A;  4ZKI A;  1M56 B;  2WPD G;  3A0B Z;  3HB3 B;  4DV4 O;  3CC2 V;  4F6R A;  3NXS A;  4KXR A;  1I94 B;  1LR1 A;  5KLV H;  3SJC C;  2VWK A;  1OHH G;  3KKY A;  4DV3 B;  5DM6 V;  1SQB H;  2KKW A;  1K4D C;  4B3S O;  4I7Z B;  5K1P A;  2ZKO A;  5KUK A;  2ZM6 O;  4HBN A;  4JZG A;  4H44 B;  4JI3 O;  3RW0 A;  2DW4 A;  4J7Z A;  1R6T A;  2WLI B;  1BQ0 A;  4JYC A;  2P4V A;  4RWU A;  1NBM G;  5H6R A;  4BWA A;  3SPJ A;  2Z3Y A;  3L9D A;  2OWO A;  1NR7 A;  4YJ3 A;  3JCZ A;  2N74 A;  4JYA B;  1PNM A;  4MTF A;  1K4C C;  3ABM C;  2OCH A;  4K0K O;  4L8J A;  3K79 A;  1OCC B;  3HKB A;  5CMU A;  4RQE A;  3O9O A;  4J41 A;  2QTS A;  5B1A C;  3QG5 A;  1JCH A;  3ZIA G;  2WLL A;  2CK3 G;  1EBO A;  4QNH B;  5CA1 B;  1SKV A;  1OZ0 A;  2BE3 A;  4XBF A;  1VEW A;  2XND G;  2PTM A;  4DR6 O;  1FFX A;  3RVZ A;  2X7R B;  1TA8 A;  1W0J G;  3W7T A;  4ZI7 A;  3FX7 A;  3CPW U;  1V9P A;  1Q82 W;  5J2T A;  1UJW B;  1XNQ B;  3HR0 A;  4HNA A;  1AB3 A;  1VQO V;  5EYP B;  2H8P C;  1ZTE A;  1EN4 A;  2R9R B;  4FZ0 A;  3U10 A;  3K5L A;  3JSN A;  4DR7 O;  5L3C A;  3UKM A;  1G1X B;  3PN1 A;  4DV7 O;  4LF6 O;  4WCE V;  1KQS U;  4LF7 B;  3CB2 A;  4EB6 B;  2P22 C;  1SZX A;  4NTY A;  1BT8 A;  4AI8 A;  3CCR V;  1AJQ A;  1L8D A;  3J7A U;  2YIA A;  4LH7 A;  3JAL A;  2ZIO A;  4FM0 A;  4NXN O;  1RPO A;  4DR5 B;  3CWB H;  4PI2 A;  3R65 A;  1M9N A;  1XHX A;  4PA6 A;  3H1I H;  1GM7 A;  5IE9 A;  2HHH B;  3H9V A;  2ADP A;  1M4U A;  2RQ6 A;  4AQY O;  4X65 B;  4J11 A;  1M90 W;  4IIJ B;  3N2G B;  1JVM A;  3AEI A;  4KL1 A;  1XIL A;  2YEV B;  1BMF G;  5LHI A;  4PA7 A;  2XAJ A;  4JI7 B;  3ETE A;  2R9I A;  4FMT A;  2B1I A;  4UB6 Z;  4X88 A;  4WFB V;  2EUL A;  3UCS C;  1KBH A;  5GTH Z;  2ZR3 A;  2BOB C;  4LF4 B;  2F66 C;  1YCI A;  2ZXW C;  4O4J A;  5KA5 A;  1VMG A;  5EBM C;  2EX3 A;  4H13 B;  3Q4H B;  3ASN C;  2QSA A;  1PM9 A;  5J2U B;  5LMU B;  4DYL A;  2Q68 A;  1HP8 A;  4B3T B;  2DMX A;  1NKD A;  1NU1 H;  4D7S A;  1AI7 A;  4Z2W A;  4X62 B;  3BFR A;  3CCE V;  4EEQ A;  5IJ9 A;  1Z5V A;  3L72 H;  3JAS A;  2DWD C;  1U97 A;  4FM2 A;  1JX9 A;  1VQL V;  2EIL C;  4CC5 A;  5JJE B;  2Q9L A;  4MVO A;  3EVK A;  3ZHS A;  4YHH O;  3JD2 A;  1XL4 A;  2PF4 E;  4RUF A;  1YJW V;  1VQ7 V;  1JQ0 A;  4DUY B;  1MSW D;  4PHZ A;  2JJ2 G;  2ZQM A;  2RNB A;  4CBC A;  1Y74 B;  1JA8 A;  3ETQ A;  4BIO A;  3G71 V;  2FYU H;  1LUV A;  4JAA A;  4MS2 A;  3D36 C;  3ZHR A;  1H2G A;  2IBZ H;  3AG4 B;  1VQK V;  1QU7 A;  4PDV A;  2Y0I A;  2LFS A;  2N04 A;  4I9W A;  1BQZ A;  2XT9 A;  1IXB A;  2F1M A;  3QO8 A;  3T1H B;  3LDC A;  1R73 A;  4DV5 B;  1AVM A;  2FL4 A;  4FZ1 A;  3FB8 C;  2VRZ A;  5KX5 A;  5JWP A;  3DC6 A;  1IBL B;  2Q67 A;  4O4I B;  3OTF A;  4BR6 A;  4OGQ B;  3E8H A;  2F93 B;  1RPR A;  3P3N A;  1NTZ H;  5KAF Z;  3JAT B;  1JOY A;  4ZOL A;  1MZE A;  3OMN B;  1VF6 C;  5EYP A;  4X64 B;  4PDM A;  3J80 N;  2Q4P A;  2AXT Z;  2GDS A;  1FXK B;  3B09 A;  3K3W A;  4LF5 B;  1QLN A;  1ZLZ A;  3B4S A;  3JD3 A;  4U3J B;  4MTX A;  5L3B A;  2LGQ A;  1XMO B;  4O4L B;  1FJG B;  2ZIM A;  2WLH A;  4WBN B;  5C93 A;  1BCC H;  2HJD A;  3IC9 A;  3OEE G;  4B3M B;  2E74 B;  1YVW A;  4FJC C;  1EZV H;  1VQ4 V;  4R6Z A;  3FKS G;  5DN6 G;  2B9Z A;  4Z1V A;  3TJT A;  1VQ8 V;  1D5A A;  3CRC A;  1I7F A;  2Q0O C;  3WB2 A;  1O9H A;  2GHY A;  1MA1 A;  1B3Q A;  2P6J A;  2QKA A;  2UXN A;  2RMK B;  4U7N A;  4RO2 A;  2E3C A;  2EIM B;  1IBK O;  2JK5 C;  2PYJ A;  3DSQ A;  3H1K H;  1NZ6 A;  2X6C A;  3CXH F;  4LNU B;  3K5O A;  4K8X A;  1D2D A;  2UXX A;  4FIP C;  3VQX A;  3C3S A;  2XUM A;  4LF8 B;  2JJ1 G;  2PI4 A;  4IIJ A;  3N2G A;  2D3O W;  3WFV A;  1R3J C;  4X1I B;  1Z5W A;  1Q3E A;  2XTA A;  2WSS G;  4GX1 A;  3SYC A;  3CP1 A;  1MG1 A;  1OCO B;  4JPR A;  1H2L A;  2B1G A;  3L71 H;  1WLE A;  3GB7 C;  2X6B A;  3B2E E;  5IT9 N;  3SPI A;  2F95 B;  3ETG A;  1OCZ C;  2JDI G;  5BY1 A;  2ITC C;  3T1Y O;  2ZNJ A;  1BZK A;  2BTO A;  4DO2 A;  4K3A A;  2XAS A;  2ZE8 A;  1G8M A;  3FD9 A;  1GM9 A;  3Q4H A;  3MHH C;  2QTO A;  5J2U A;  4R7C A;  5IWA B;  3FYE B;  2QWN B;  2DWE C;  3L70 H;  4LF9 B;  1WA8 A;  4YJ3 B;  3CEI A;  2IH3 C;  2NLJ C;  4Z1M G;  3A0H Z;  1SRY A;  3WG7 C;  1RFY A;  4WFH A;  2L35 A;  3LUT B;  1YJN V;  4C7U A;  3IAY A;  4DXW A;  1NH2 D;  1KB9 F;  1BE3 H;  4HYO A;  4P30 A;  5EBL C;  5KHK A;  1IBM O;  1XQ8 A;  5IYZ A;  4JV5 O;  3OTO B;  4JYB A;  1UFI A;  3T4Z A;  1WB8 A;  3W7X A;  3W7W A;  4JI2 B;  1YZB A;  3CRQ A;  5DEC A;  4DV2 B;  4IYH A;  4DR3 B;  1WNS A;  3WU2 Z;  2GV9 A;  3E86 A;  1Y74 A;  4LWS B;  2Y48 A;  4UB8 Z;  1SQF A;  4JAS A;  2ZE7 A;  3OGI B;  4NR1 A;  1J95 A;  1W59 A;  1SS3 A;  5LHG A;  1V54 C;  1FFX B;  3DXR B;  4K8Z A;  1YTF B;  3GVM A;  3TET A;  1N0J A;  1XNR B;  1TVK B;  4TV9 B;  1CP9 A;  3G67 A;  3SPG A;  3CCJ V;  2QWR B;  4O4I A;  2DYR C;  2OTJ V;  3STL C;  5LGU A;  4MVZ A;  4RQF A;  1EFR G;  3TXS A;  3JAT A;  1K33 A;  1SQX H;  1FAF A;  4GKJ B;  1OCR B;  5CA3 A;  4EKW A;  4ZHQ B;  2WWW A;  3JAK A;  2BSK B;  3ZMZ A;  5LP6 C;  1PKX A;  1OJH A;  3H1J H;  2C2A A;  1HR0 B;  2LFR A;  2UUC B;  1FXK A;  2E5L O;  3SPH A;  4DV6 B;  4DR4 B;  5A9G A;  3CXC U;  4DR1 O;  2QKS A;  2YXY A;  2ITD C;  1P7G A;  2VQF B;  5L3F A;  4O4L A;  4WBN A;  1K34 A;  5LL6 Y;  3AK1 A;  3JAL B;  2IH1 C;  1N32 O;  3ASO B;  4B7E A;  4KHP O;  5B3S C;  3FYI B;  2JGU A;  1TGO A;  2RJZ A;  4PA9 A;  4J7J A;  1W2B U;  2XAG A;  1CEZ A;  2XOK G;  1Q6H A;  3S3W A;  4MW3 A;  5LBQ A;  1L0N H;  3ZRW B;  5ITZ B;  4B3S B;  4X1Y A;  2ZM6 B;  2E76 B;  4LNU A;  4JI3 B;  2OCC C;  2WLN A;  2LJ2 A;  4PDL A;  2UXC O;  1VQM V;  4X1I A;  1G6U A;  3E8B A;  5CBH A;  3QNE A;  1VIB A;  4FPP A;  3JD4 A;  1I5X A;  5CBG A;  4IL6 Z;  4I9Q A;  1S72 V;  5IY5 B;  2Y0P A;  3OR6 C;  1JMK C;  1FFT B;  4FVM A;  3JCU Z;  4O4J B;  1MZF A;  1P49 A;  4JTD B;  3CC7 V;  4LH6 A;  3ZN1 A;  4K0K B;  3F5T A;  4DV1 O;  3ZHT A;  1QR8 A;  1WPX A;  5IJ0 A;  3CC4 V;  1AI4 A;  2EIJ B;  4WFE A;  3CCQ V;  4I0X B;  3RYF B;  5L3E A;  2K1E A;  2HLD G;  1B06 A;  1ZWI C;  2WLM A;  5IJ9 B;  3UM7 A;  2UXB O;  1M93 A;  3JAS B;  1K73 W;  3K59 A;  4UXN A;  3HKD A;  5L3D A;  4BAY A;  4CS4 A;  2F4V O;  3X2Q C;  1Q8I A;  1MNG A;  1Q7Y W;  4DR6 B;  3DC5 A;  3STZ C;  4DK0 A;  2Q6A A;  2Q0A A;  1MOF A;  1I5Y A;  1MAB G;  5K1X A;  4B7K A;  4GUN A;  2Q7G A;  3E8G A;  3E35 A;  2V4D A;  2AHZ A;  2ZE6 A;  4B3R O;  4LWS A;  3SJA C;  2RDC A;  5KHJ A;  1HW7 A;  5EC1 C;  3ZMV A;  2Q7E A;  1YHQ V;  3TGU H;  1K5Q A;  5KX5 B;  3ABL B;  1NS1 A;  4DV7 B;  4LF6 B;  4A5U B;  3DXR A;  2FML A;  3C3T A;  5FL7 G;  1TUE B;  4GX2 A;  1TVK A;  2L6L A;  1WAZ A;  1Y4M A;  4TV9 A;  2M6Y A;  1YSC A;  2CTW A;  1RP3 B;  4ZOL B;  3AG3 B;  1FPO A;  5JVD B;  2Q73 A;  3BEH A;  2YUA A;  1XMQ O;  1YIJ V;  3BHP A;  5IDJ A;  4BW9 A;  4TUY B;  2QWP B;  4NXN B;  5CBF A;  5JJN B;  4TV8 A;  4Q6G A;  1N33 O;  3EHB B;  4GCZ A;  4TOI A;  4ZHQ A;  4DRX B;  3RWR D;  2BSK A;  3K5N A;  1MSD A;  1N34 O;  5J9P C;  4DW1 A;  1PP9 H;  4LFB O;  3IJ4 A;  4AQY B;  1ZUQ A;  4UCT A;  4LR3 A;  1XRE A;  3BAB A;  4G28 B;  4OPA A;  2DYS B;  4QPJ A;  3D36 A;  1H38 A;  2A06 H;  1GMG A;  1Z2G A;  1NR1 A;  4PV1 B;  1AJN A;  3FB5 C;  3APQ A;  3LNM B;  3HKE A;  1FXV A;  2GUZ B;  1E79 G;  4YXW G;  4LCU C;  2IJI A;  2Y69 C;  4OX9 O;  1R6N A;  2HG5 C;  4JI1 O;  1KD1 W;  1XEQ A;  1WPB A;  4JGS A;  3I5D A;  4JI0 O;  1GN2 A;  5JCO C;  3ZRW A;  3ICX A;  1PD3 A;  5ITZ A;  1X59 A;  3SYP A;  2ARH A;  2GTS A;  2YSU B;  5LP6 B;  1J5E O;  3T2M A;  5KMG B;  1R3K C;  2JVD A;  3ZRV A;  4DR2 O;  3ZED A;  2Q69 A;  4ICG A;  1FD9 A;  2EIN B;  5LYJ B;  1SES A;  4P9P A;  3F7V C;  3SJB C;  2QKC A;  2QGN A;  3THO A;  1U96 A;  1K92 A;  4D7T A;  1LNQ A;  3S3X A;  4YHH B;  3VOU A;  2R9A A;  3FFQ A;  2ZR2 A;  1US6 A;  1Y6X A;  3ABK B;  3K08 A;  3LNN A;  1WA8 B;  3QTC A;  1O9G A;  3I55 V;  4JI6 O;  2EJ7 A;  2QR4 A;  3GWK C;  4I0X A;  3RYF A;  2KQX A;  1M1K W;  3ZRX A;  4LFA B;  4FLU A;  2IJH A;  5IYZ B;  1GO3 F;  2GSM B;  4KP4 A;  4G2K A;  4CS3 A;  4MVU A;  3OMA B;  4UCU A;  4BW5 A;  3G80 A;  4JAU A;  1QQC A;  2HJF C;  2UUA O;  1KP3 A;  3TCU A;  2ATK C;  1YDX A;  1Y76 A;  3UO3 A;  1VQ9 V;  1N0N A;  4LF4 O;  1QVF U;  3AG2 C;  4NKG B;  1LUW A;  1KP2 A;  3QO7 A;  1PPJ H;  3BAA A;  4X9Q A;  2BTQ B;  4GT1 A;  1NVP B;  4PJ0 Z;  4I4T B;  4TQD A;  3KCX A;  4CH3 A;  4B3T O;  1VQ5 V;  5H6Q A;  3SPC A;  5GON A;  3K57 A;  3CYO A;  3AK2 A;  3T4D A;  3OW2 U;  2EZO A;  3UQ8 A;  1WB7 A;  4J9Y B;  1R3I C;  3CRM A;  2Z0A A;  2V7Q G;  4JTA B;  4NTX A;  3TK1 A;  3BA8 A;  1SA0 B;  4YIP A;  2DJV A;  2ZIN A;  1RM1 C;  2AW9 A;  3ABM B;  4L87 A;  5JVD A;  1BSM A;  4UCR A;  2P67 A;  5AG2 A;  3JAK B;  3L74 H;  3CRR A;  4BIZ A;  1DTO A;  4TUY A;  1B04 A;  2ILM A;  3FB7 C;  3OR7 C;  4FLV A;  1IBK B;  2JGD A;  1R1B A;  1ARO P;  3CE2 A;  5B1A B;  1M57 C;  4DRX A;  4ZBM A;  4K35 A;  1R6K A;  5H9C A;  1IDS A;  2Z5U A;  3OUS A;  2F23 A;  2H94 A;  5BR8 O;  1L0L H;  1PV0 A;  3ZN0 A;  1AI6 A;  1F23 A;  1GN6 A;  2IJJ A;  1ORQ C;  4P9O A;  1ZL8 B;  1M56 C;  2LO1 A;  3M99 B;  1K9M W;  3RYH A;  1HNZ B;  2GUZ A;  2NN4 A;  1HDJ A;  4OXS A;  3GWO A;  4X1Y B;  1T5E A;  1KMI Z;  3E22 B;  1JFF A;  1YIT V;  3T1Y B;  2UU9 O;  4X64 O;  2OIG A;  4E2L A;  2UXD B;  1S76 D;  2CGN A;  3WB0 A;  3K0G A;  1X4T A;  1Q6I A;  4MVR A;  1R3L C;  4LC1 A;  4WF9 V;  2EJR A;  1URF A;  3KG2 A;  5LP6 A;  1FJG O;  3D3I A;  5KMG A;  1TAE A;  4OPH A;  1S5L Z;  2CTQ A;  1XUQ A;  5KAI Z;  5IYB O;  3L75 H;  1YXB A;  5LYJ A;  4UV9 A;  3A0R A;  4FFK A;  2OTL V;  3H1L H;  3HKC A;  3E2E A;  4JV5 B;  5LOV A;  4Q20 A;  3K9S A;  1WP7 A;  1OCC C;  5IJ0 B;  4ASU G;  5A2Q N;  1AP5 A;  5FPO A;  4YY3 O;  2WA4 A;  1VQ6 V;  2QDO A;  4W4L A;  1GAX A;  3HKD B;  4AIL C;  1Q6U A;  4MVS A;  2PZS A;  1KKC A;  1PNK A;  2EIK C;  2GTA A;  4FM1 A;  5LXT A;  3JAM N;  3K04 A;  1XBL A;  5BMV B;  4FLX A;  2CAZ C;  1Q90 D;  4EFB A;  4JI4 O;  4LP8 A;  2A79 B;  2P5O A;  5LMN O;  1N4C A;  1QBZ A;  5JQG A;  4JI8 O;  3WB1 A;  3CCM V;  2BCC H;  2ZXW B;  3SYQ A;  1QNM A;  4R8C A;  4LFC O;  3OMI B;  2AGA A;  1XHZ A;  2Y4U A;  3ASN B;  3QVN A;  3AK3 A;  2BTQ A;  2PGG A;  2M7W A;  4KFM A;  4I4T A;  4X66 O;  1HNX O;  1AR4 A;  1EZJ A;  4PDR A;  2E5L B;  3G4S V;  4DR1 B;  4H0L B;  2P4K A;  2LP7 A;  4MW8 A;  2LW1 A;  3SYA A;  4GKK B;  2YI9 A;  2N05 A;  3T1C A;  3VQY A;  2RN9 A;  1XL6 A;  2YIB A;  4FLY A;  1TUB B;  2VS0 A;  2EIL B;  3K0D A;  4DUZ O;  1N32 B;  1IUR A;  1SA0 A;  4KHP B;  4TV8 B;  3SJQ C;  4XDL A;  1RSO B;  5EBW C;  4EFE A;  3KCY A;  3ZMU A;  3BRC A;  1YI2 V;  4I50 B;  1K5S A;  2B5U A;  4WFA V;  4GX0 A;  1N36 O;  4DR3 O;  2YXH A;  2QEX V;  3DTU B;  1Q86 W;  3OE7 G;  1XOU A;  5KA6 A;  3AG1 C;  1AJP A;  4RUE A;  1NQT A;  1HNW O;  5F2V O;  1GRJ A;  4O2A B;  5CA0 A;  2ETN A;  5GW7 A;  3HKE B;  1XI1 A;  2HVJ C;  2QM8 A;  4MTG A;  3CMA V;  2UUB O;  2ODM A;  3H1H H;  1VQP V;  3NR7 A;  1ZL8 A;  4DV4 B;  2PYL A;  4DK1 A;  4G27 B;  4KUM A;  2JS3 A;  3OT7 A;  1E1R G;  4GZR B;  4NB5 A;  3ZMT A;  3CD6 V;  4NYK A;  5JJJ B;  1AR1 B;  3RFR A;  1ZAU A;  3E22 A;  4IHJ B;  1NJI W;  1IZ3 A;  1ROP A;  1ZSP A;  4DV1 B;  5LGN A;  3JAR B;  3CCS V;  4QE7 A;  2ZNI A;  1M57 B;  4MT8 A;  2WLJ A;  4DR4 O;  4IGG A;  2LQT A;  3H01 A;  5FPR A;  3F7Y C;  3JAW A;  2UXB B;  2OYQ A;  4O4H B;  4UVB A;  2KSD A;  1SC5 B;  1KU9 A;  3OUF A;  3CCV V;  4JI5 O;  4N23 A;  1B6Q A;  2F4V B;  2E75 B;  2HVK C;  4DV0 O;  3M8A A;  4MTO A;  2VQE O;  4TT3 G;  1I0H A;  4NXM O;  5B66 Z;  2VWJ A;  3W7U A;  5JCO A;  3CCL V;  2HEP A;  2CH7 B;  4B3R B;  3AG4 C;  1S77 D;  4ZIB A;  1AIL A;  2DN9 A;  2QWO B;  2ZDI C;  4I55 A;  1H2N A;  2AZ0 A;  3ML0 A;  4TQF A;  1EM1 A;  4X8A A;  1FS0 G;  3RYI B;  2JEX A;  5CB4 B;  2Q5Z A;  5BMV A;  4J10 A;  1H8H G;  5CN0 A;  3RT3 C;  1KYO F;  3N2K B;  4X20 B;  5H5N A;  1JJO A;  4IYI A;  4YJ2 B;  4GLX A;  1Y76 B;  5IYD O;  2IJK A;  1I94 O;  1W0K G;  1DLB A;  4DV3 O;  1OCZ B;  1SER A;  3RVY A;  2W0F C;  3OGC C;  1XMQ B;  3CJH A;  2CDY A;  3ABT A;  4QJF B;  1SQP H;  2QE7 G;  1F4N A;  4DR7 B;  1KUQ A;  1PL0 A;  5GON B;  1N33 B;  2FB5 A;  1FXK C;  4FFB B;  5E1A C;  1BHA A;  1YTF D;  2RCV A;  3EFF K;  3BY6 A;  2A9H A;  4O2B A;  1N34 B;  3CRA A;  2FKX A;  4LFB B;  2ADQ B;  4R50 A;  1S0V A;  2PY5 A;  3WG7 B;  4J9Z B;  1SQG A;  4QIW F;  3IGA C;  2EIK B;  3CSX A;  4JYA O;  2A0L A;  4XDK A;  1DK1 A;  5IYC O;  4H37 A;  1QCE A;  5LHH A;  1TUB A;  1H2S B;  2NNU A;  1XDC A;  2EIM C;  3OFN G;  1RSO A;  2JGD B;  1DGS A;  3ZX6 A;  4I50 A;  4D6T H;  1S5J A;  1H2M A;  4E4E A;  2YC0 A;  2QWQ B;  3ZRS A;  4OX9 B;  1GTO A;  3L73 H;  1P4R A;  3LDD A;  4JI1 B;  2QM4 A;  3J81 N;  3D3Q A;  5KUM A;  4JI0 B;  3ZS8 C;  2CE4 A;  2DQ0 A;  3OD4 A;  3D8C A;  3QO5 A;  1PNL A;  1V55 C;  3ZHQ A;  3OM3 B;  3BA9 A;  4O2A A;  1V54 B;  2YI8 A;  1IXM A;  1J5E B;  3AG7 A;  2FTK A;  3RYH B;  4HZ3 A;  4IT5 A;  5EZY A;  2KG7 B;  1OCO C;  4DR2 B;  3KZI Z;  2DE0 X;  1XNQ O;  1NI8 A;  2ZCE A;  2CTP A;  3SDL A;  2JIZ G;  2DYR B;  3ZJZ A;  1JFF B;  2JRI A;  3E89 A;  5LGT A;  5LA6 A;  2DOS A;  4X1K B;  1VF6 A;  1S3J A;  1K3E A;  4IHJ A;  3JYC A;  3MAQ A;  5KHG A;  4MVQ A;  1HWY A;  3ZBH A;  1F4M A;  3JAR A;  4TWK A;  5B1B C;  3U11 A;  3ZMS A;  4LF7 O;  3HPL C;  3MDS A;  3AG1 B;  4JI6 B;  5BXZ A;  2P7T C;  5FNV A;  1L1F A;  1KC8 W;  4O4H A;  2AZ2 A;  3HKC B;  5B3S B;  5LOV B;  3ZCC A;  4DR5 O;  3A8T A;  4JAV A;  1KEC A;  2BOC C;  2W0X A;  1GN4 A;  3SYO A;  3OEH G;  1P7B A;  2UUA B;  2HHH O;  4H33 A;  3RYC B;  1AR5 A;  4CS2 A;  4X65 O;  4F4L A;  4U3F H;  1WN7 A;  3SR2 C;  2EZP A;  4JZ2 A;  2OCC B;  4ABM A;  5LXT B;  1BHB A;  2G38 A;  2CH7 A;  1ENV A;  2W6J G;  1I08 A;  2HR3 A;  4LBE C;  2CTR A;  2WLI A;  3O65 A;  4MVM A;  4PD4 F;  3A2F A;  3RYI A;  4JI7 O;  3CME V;  5CB4 A;  5JQG B;  1SET A;  3K06 A;  1G4Y B;  2V1D A;  3N2K A;  4X20 A;  4YJ2 A;  2IM9 A;  3G6E V;  1AP6 A;  3UT5 B;  5TIS Z;  5D5P A;  1NH2 B;  3ZHU A;  4UV8 A;  1OCR C;  2HFE C;  3JSL A;  5LMU O;  4CH4 A;  2X6A A;  4B08 A;  4FLZ A;  3BVO A;  5HFL A;  4FFB A;  4JTC B;  3CCU V;  2YS8 A;  3P30 A;  3RN4 A;  4X62 O;  2CGO A;  1Y67 A;  2R72 A;  5B1N A;  4LFA O;  5CA1 A;  1VP7 A;  1YJ9 V;  2A3Q A;  5BR8 B;  4NVP A;  3ASO C;  2EBO A;  3X2Q B;  2AHY A;  4JF3 A;  1QLE C;  4DUY O;  1GM8 A;  2WLK A;  5EIB D;  1OV9 A;  2R70 A;  2XAF A;  1SF9 A;  1NTM H;  3LSQ A;  2PUS A;  4F6E A;  2P06 A;  1VQN V;  4DW0 A;  2F43 G;  4UCS A;  2XAH A;  1P84 F;  1D5N A;  1Y66 A;  4X89 A;  4CC6 A;  2UU9 B;  3EXA A;  5CA0 B;  3MD0 A;  3B8M A;  1YEW A;  3T1H O;  3OAA G;  1NTK H;  3P32 A;  4DV5 O;  3MHS C;  2JEU A;  1A32 A;  5H2F Z;  2A7W A;  2OT5 A;  5BZB A;  3FB6 C;  1IBL O;  4I5S A;  3BPZ A;  1QVG U;  5C8Y B;  2KG7 A;  4UFZ A;  1DF5 A;  3E8F A;  5IY5 C;  3G6B A;  4EB6 A;  1UPG A;  3VQW A;  4UCV A;  3IFX A;  1BL8 A;  2QJ1 A;  2D2C B;  4UVC A;  3LSS A;  5JH7 B;  5GTI Z;  2NR5 A;  4X1K A;  1F51 A;  2H3O A;  1QHT A;  1COW G;  4LF5 O;  3ABU A;  3K5M A;  3LDE A;  4UUJ C;  1XMO O;  2EIJ C;  2IU3 A;  4YY3 B;  3JAW B;  3F5W C;  4B3M O;  2YIC A;  3PJS K;  4BIU A;  1YF2 A;  2JS5 A;  3CX5 F;  3C90 A;  1NT2 B;  1V55 B;  2GBO A;  3FAV B;  2LGW A;  1ZX3 A;  2YEV A;  4TSF G;  2WA3 A;  1IBM B;  5D5Q A;  4MSW C;  4JI4 B;  2XAQ A;  4F6R B;  3K03 A;  1DF4 A;  1HNZ O;  4WFF A;  5LMN B;  1M5I A;  4CH6 A;  2WAM A;  4U7O A;  2Y69 B;  4JI8 B;  5B1O A;  4FLT A;  1JPX A;  1N8R W;  3ETD A;  3RYC A;  5DED A;  2UXD O;  3CS5 A;  4LFC B;  1QR9 A;  3W7S A;  4LF8 O;  2YXL A;  2IU0 A;  5KHI A;  4FLW A;  5KHH A;  1Q81 W;  4I55 B;  5EK0 A;  1IX9 A;  1SZT A;  5B1B B;  3ABL C;  4X66 B;  1HNX B;  1H8E G;  3E83 A;  2HKO A;  3K58 A;  2Q7H A;  3QF7 A;  3N27 A;  1SQQ H;  3IC7 A;  5EC2 C;  2DQ3 A;  3AG3 C;  4JYY A;  2Q8V A;  1AI5 A;  2YID A;  3CJH B;  4PI0 A;  4N21 A;  1NVP D;  4DUZ B;  3UT5 A;  1Q5O A;  3SGI A;  3TXQ A;  3HKB B;  1H2K A;  1PL4 A;  2ZE5 A;  5IWA O;  4O2B B;  1CXZ B;  4J42 A;  2WLL B;  4UVA A;  5EIB C;  1N36 B;  3U0Z A;  3P3P A;  4LF9 O;  4CZZ A;  2PI5 A;  3B77 A;  4FK5 C;  2YIB D;  4XDJ A;  4QGP A;  2DYS C;  1K8A W;  3B8N A;  2IW5 A;  4J7K A;  1FKA O;  1HNW B;  3M7M X;  2MW2 B;  4UCO A;  1FXH A;  4CH5 A;  1VAR A; 
#chains in the Genus database with same CATH homology
 3JD0 A;  4PEL A;  5CN0 A;  1SES A;  2ZDI A;  3FKS G;  4P9P A;  5DN6 G;  1VQ8 V;  3F7V C;  1E1Q G;  5IYD O;  3RBZ A;  2IJK A;  1CPY A;  2GHY A;  4RAI A;  2P6J A;  2UXN A;  1W0K G;  1DLB A;  1K92 A;  1OCZ B;  1SER A;  4U7N A;  3RVY A;  4RO2 A;  2EIM B;  2W0F C;  1LNQ A;  3OGC C;  2JK5 C;  3VOU A;  2W6I G;  3AG2 B;  2MK3 A;  3ABT A;  4QJF B;  2QE7 G;  2ZR2 A;  1F4N A;  2X6C A;  2X0L A;  1PL0 A;  3ABK B;  3DGE A;  3K08 A;  2QA4 V;  1FXK C;  2UXX A;  5E1A C;  3I56 V;  1YTF D;  1BHA A;  4FIP C;  3I55 V;  3EFF K;  3BY6 A;  2JJ1 G;  2A9H A;  4GX5 A;  1JJ2 U;  2PI4 A;  2D3O W;  3WFV A;  1R3J C;  4QPK A;  1M1K W;  4R50 A;  3ZRX A;  1S0V A;  2WSS G;  4GX1 A;  3SYC A;  3WG7 B;  3CP1 A;  4J9Z B;  2IJH A;  1GO3 F;  1MG1 A;  2GSM B;  1OCO B;  2EIN C;  3IGA C;  4PA4 A;  2EIK B;  4QIW F;  2P90 A;  4JPR A;  4KP4 A;  2A0L A;  4G2K A;  4HAM A;  4XDK A;  2B1G A;  5IYC O;  4MVU A;  4H37 A;  3K9A A;  1QCE A;  1WLE A;  3GB7 C;  2X6B A;  3OMA B;  4BW5 A;  5LHH A;  4JAU A;  2NNU A;  3SPI A;  2HJF C;  1K7D A;  3ETG A;  1OCZ C;  1RM1 B;  1KP3 A;  1THZ A;  2JDI G;  3TCU A;  2ITC C;  2ATK C;  2EIM C;  3OFN G;  1VQ9 V;  1QVF U;  1S5H C;  3AG2 C;  1QLE B;  4DO2 A;  3ZRS A;  1GK9 A;  1GTO A;  1KP2 A;  3QO7 A;  1P4R A;  2XAS A;  3LDD A;  1G8M A;  5L3G A;  1GM9 A;  4WFG A;  3ABK C;  4GT1 A;  2KB1 A;  5KUM A;  1NVP B;  3MHH C;  2DQ0 A;  1GKF A;  2QTO A;  4R7C A;  3FYE B;  3QO5 A;  2DWE C;  1PNL A;  1V55 C;  1VQ5 V;  3OM3 B;  5H6Q A;  3SPC A;  2ZD9 A;  3CYO A;  1V54 B;  2IH3 C;  2NLJ C;  3JD1 A;  4Z1M G;  5HFM A;  1IXM A;  1SRY A;  3WG7 C;  4WFH A;  3T4D A;  4PA3 A;  3OW2 U;  2EZO A;  2FTK A;  4P2Z A;  4HZ3 A;  4J9Y B;  3LUT B;  3VBB A;  1YJN V;  1OCO C;  1R3I C;  1KKD A;  4DXW A;  1NH2 D;  4HYO A;  1K97 A;  4P30 A;  4QE9 A;  2QM7 A;  5EBL C;  4ZKI A;  1M56 B;  2V7Q G;  2WPD G;  4JTA B;  3TK1 A;  3HB3 B;  2JIZ G;  2DYR B;  3ZJZ A;  3CC2 V;  3E89 A;  4JYB A;  3NXS A;  5LGT A;  3T4Z A;  1RM1 C;  3ABM B;  4L87 A;  3W7X A;  3W7W A;  2P67 A;  1OHH G;  4BIZ A;  5DM6 V;  1K4D C;  1DTO A;  3OR7 C;  3FB7 C;  1S3J A;  1K3E A;  5KUK A;  3JYC A;  1ARO P;  3E86 A;  5B1A B;  4MVQ A;  1HWY A;  3RW0 A;  1M57 C;  2Y48 A;  1F4M A;  2DW4 A;  4TWK A;  4ZBM A;  5B1B C;  1R6K A;  4JAS A;  2WLI B;  5H9C A;  3ZMS A;  1J95 A;  2Z5U A;  4JYC A;  3HPL C;  3AG1 B;  5LHG A;  1V54 C;  3OUS A;  1NBM G;  2P7T C;  2H94 A;  5H6R A;  1L1F A;  3SPJ A;  1KC8 W;  1YTF B;  2Z3Y A;  3TET A;  3ZN0 A;  1AI6 A;  1F23 A;  1NR7 A;  1CP9 A;  2IJJ A;  1ORQ C;  4P9O A;  1M56 C;  3SPG A;  3CCJ V;  3JCZ A;  3M99 B;  5B3S B;  3ZCC A;  1K9M W;  2DYR C;  2OTJ V;  1PNM A;  4JAV A;  4MTF A;  1K4C C;  3STL C;  3ABM C;  1KEC A;  2BOC C;  4MVZ A;  3SYO A;  5LGU A;  4RQF A;  4OXS A;  3GWO A;  3OEH G;  1EFR G;  1P7B A;  3K79 A;  4H33 A;  1OCC B;  5CMU A;  1K33 A;  1YIT V;  1OCR B;  5CA3 A;  4EKW A;  4F4L A;  4E2L A;  2WWW A;  4RQE A;  1S76 D;  5B1A C;  3ZMZ A;  1PKX A;  1JCH A;  2EZP A;  2C2A A;  3ZIA G;  3K0G A;  2OCC B;  2LFR A;  2WLL A;  1FXK A;  4MVR A;  2CK3 G;  3SPH A;  1BHB A;  1EBO A;  1R3L C;  1ENV A;  4LC1 A;  4WF9 V;  4QNH B;  2W6J G;  2EJR A;  3KG2 A;  3CXC U;  2HR3 A;  2QKS A;  2ITD C;  5L3F A;  3D3I A;  1OZ0 A;  1K34 A;  4LBE C;  4XBF A;  2WLI A;  4MVM A;  3CME V;  2XND G;  1SET A;  2IH1 C;  3K06 A;  5IYB O;  1G4Y B;  2V1D A;  3ASO B;  4UV9 A;  3RVZ A;  3A0R A;  5B3S C;  2X7R B;  3FYI B;  1W0J G;  3W7T A;  3CPW U;  1Q82 W;  2OTL V;  1UJW B;  4PA9 A;  3G6E V;  1W2B U;  2XAG A;  3E2E A;  1CEZ A;  2XOK G;  4Q20 A;  1NH2 B;  1VQO V;  1OCC C;  4MW3 A;  5LBQ A;  2H8P C;  4UV8 A;  3ZRW B;  4ASU G;  1OCR C;  2HFE C;  2R9R B;  2X6A A;  5L3C A;  2OCC C;  2WLN A;  1VQ6 V;  5HFL A;  3UKM A;  4JTC B;  4PDL A;  3CCU V;  3P30 A;  4MVS A;  1VQM V;  4WCE V;  1PNK A;  2EIK C;  1KQS U;  3K04 A;  3E8B A;  5CBH A;  3QNE A;  5B1N A;  4FPP A;  1YJ9 V;  3JD4 A;  1I5X A;  3CCR V;  5CBG A;  3ASO C;  1S72 V;  1AJQ A;  2A79 B;  2EBO A;  4LP8 A;  3X2Q B;  5IY5 B;  3OR6 C;  1FFT B;  1QBZ A;  2AHY A;  4JF3 A;  1QLE C;  4JTD B;  3CC7 V;  1GM8 A;  2WLK A;  1RPO A;  3ZN1 A;  3CCM V;  2ZXW B;  3SYQ A;  2XAF A;  3LSQ A;  4R8C A;  1QR8 A;  3OMI B;  1M9N A;  3R65 A;  4PA6 A;  1VQN V;  1GM7 A;  1WPX A;  2F43 G;  2XAH A;  3ASN B;  1Y66 A;  4X89 A;  3CC4 V;  3MD0 A;  3B8M A;  1AI4 A;  2M7W A;  4KFM A;  1M90 W;  2EIJ B;  4WFE A;  3OAA G;  3CCQ V;  1JVM A;  1EZJ A;  3AEI A;  4PDR A;  5L3E A;  2K1E A;  3P32 A;  2HLD G;  3MHS C;  1ZWI C;  2WLM A;  2JEU A;  2YEV B;  3UM7 A;  1BMF G;  3G4S V;  2OT5 A;  5BZB A;  3FB6 C;  1K73 W;  4MW8 A;  2LP7 A;  5LHI A;  4I5S A;  3SYA A;  4UXN A;  4PA7 A;  1QVG U;  5L3D A;  3T1C A;  4BAY A;  1XL6 A;  1DF5 A;  2XAJ A;  3E8F A;  3ETE A;  2R9I A;  4FMT A;  3X2Q C;  5IY5 C;  2EIL B;  2B1I A;  3K0D A;  4WFB V;  4X88 A;  1Q7Y W;  3STZ C;  3IFX A;  1BL8 A;  2Q6A A;  3SJQ C;  4XDL A;  5EBW C;  2ZR3 A;  1MOF A;  3ZMU A;  2BOB C;  1YI2 V;  4UVC A;  1I5Y A;  1MAB G;  2ZXW C;  3LSS A;  1K5S A;  2B5U A;  4WFA V;  5KA5 A;  4GX0 A;  5EBM C;  3E8G A;  1F51 A;  3E35 A;  2AHZ A;  3ASN C;  1COW G;  3DTU B;  1Q86 W;  2QEX V;  3OE7 G;  3ABU A;  3LDE A;  3AG1 C;  4UUJ C;  5KA6 A;  1AJP A;  2Q68 A;  2EIJ C;  5EC1 C;  4RUE A;  2IU3 A;  3ZMV A;  1NQT A;  1YHQ V;  1K5Q A;  3F5W C;  1NKD A;  3ABL B;  3PJS K;  4BIU A;  5GW7 A;  1AI7 A;  1V55 B;  3CCE V;  2HVJ C;  2QM8 A;  5FL7 G;  1TUE B;  2YEV A;  4GX2 A;  4MTG A;  4TSF G;  3CMA V;  1Y4M A;  2DWD C;  1VQP V;  1YSC A;  1JX9 A;  1VQL V;  2EIL C;  4MSW C;  2XAQ A;  3AG3 B;  3K03 A;  1DF4 A;  4G27 B;  4MVO A;  4WFF A;  3BEH A;  4KUM A;  3JD2 A;  1XL4 A;  1YIJ V;  2WAM A;  4U7O A;  2Y69 B;  3ZMT A;  1E1R G;  5IDJ A;  3CD6 V;  4RUF A;  1YJW V;  1VQ7 V;  1AR1 B;  1JQ0 A;  5B1O A;  1MSW D;  5CBF A;  1JPX A;  1N8R W;  3ETD A;  2JJ2 G;  2ZQM A;  1NJI W;  4CBC A;  3EHB B;  1ROP A;  4GCZ A;  5LGN A;  3W7S A;  1QR9 A;  3G71 V;  2IU0 A;  3CCS V;  4QE7 A;  1Q81 W;  4MS2 A;  5J9P C;  1H2G A;  3AG4 B;  5EK0 A;  1VQK V;  4PDV A;  2LFS A;  1M57 B;  4I9W A;  4MT8 A;  2WLJ A;  1SZT A;  4G28 B;  5B1B B;  3ABL C;  2DYS B;  3QO8 A;  3H01 A;  3LDC A;  4QPJ A;  3D36 A;  1H38 A;  1H8E G;  1R73 A;  3E83 A;  2HKO A;  1GMG A;  3F7Y C;  3FB8 C;  1NR1 A;  1AJN A;  4UVB A;  3FB5 C;  3LNM B;  3IC7 A;  2Q67 A;  1FXV A;  5EC2 C;  4R6Z A;  2DQ3 A;  3OUF A;  1E79 G;  3CCV V;  3AG3 C;  4N23 A;  1AI5 A;  1B6Q A;  4YXW G;  3E8H A;  2HVK C;  1RPR A;  4LCU C;  4N21 A;  1NVP D;  2IJI A;  2Y69 C;  1R6N A;  4MTO A;  2HG5 C;  1JOY A;  3OMN B;  1KD1 W;  4TT3 G;  4JGS A;  3ZRW A;  1PD3 A;  4PDM A;  3SYP A;  2WLL B;  4UVA A;  1FXK B;  3W7U A;  3CCL V;  4CZZ A;  2PI5 A;  3K3W A;  2YSU B;  3AG4 C;  3B77 A;  1QLN A;  4FK5 C;  3JD3 A;  4MTX A;  5L3B A;  3T2M A;  4XDJ A;  1S77 D;  1R3K C;  2WLH A;  2DYS C;  1K8A W;  3B8N A;  2IW5 A;  5C93 A;  2ZDI C;  3ZRV A;  3ML0 A;  3OEE G;  4X8A A;  1FS0 G;  2JEX A;  1FXH A;  4FJC C;  2Q69 A;  1VQ4 V;  2EIN B;  1H8H G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...