3OUFA

Structure of a k+ selective nak mutant
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
93
structure length
93
Chain Sequence
DKEFQVLFVLTILTLISGTIFYSTVEGLRPIDALYFSVVTLTTVGYGDFSPQTDFGKIFTILYIFIGIGLVFGFIHKLAVNVQLPSILSNLVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Potassium channel protein
publication title Tuning the ion selectivity of tetrameric cation channels by changing the number of ion binding sites.
pubmed doi rcsb
source organism Bacillus cereus
molecule tags Membrane protein
total genus 34
structure length 93
sequence length 93
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-09-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3oufA00
4G27B 1OCOC 1M57C 3EFFK 5EBLC 3SYOA 4X89A 5KUMA 4H33A 3SPHA 3ABKC 2DYSC 3E8FA 5EBMC 2IH1C 4PDMA 3RVZA 2QKSA 4PDRA 3GB7C 2AHYA 3ABLC 2WLMA 1XL4A 2BOBC 5KUKA 4H37A 5IY5C 3WG7C 2EIMC 4MVQA 2AHZA 4GX2A 2Q6AA 2A9HA 2WLLB 3ASOC 3E8GA 4TWKA 2X6BA 5B1AC 4MTGA 3SYCA 1OCRC 5CBFA 1V55C 3SPJA 2Q68A 4P9OA 4PDVA 1R3KC 2YEVA 4JTDB 3FB8C 4X88A 3JYCA 2BOCC 2DWEC 2Q69A 4KFMA 3K0GA 3OUSA 2Y69C 4LCUC 4MS2A 4PA7A 4QE7A 3SJQC 4QE9A 4J9ZB 4BW5A 3PJSK 3K0DA 3E83A 5J9PC 4WFHA 4PA4A 4HYOA 2A79B 4EKWA 4CBCA 4RUFA 3AG3C 4R6ZA 1P7BA 4G28B 4MSWC 2WLIB 2HVJC 4MTOA 4XDJA 4P30A 4R50A 4MTFA 3LDDA 3BEHA 3E89A 4XDLA 3K03A 1OCZC 4MW8A 3LUTB 2WLLA 2ZXWC 3OUFA 4P9PA 4UUJC 2EIJC 5EK0A 2QTOA 1R3IC 3UKMA 2K1EA 2HFEC 3LNMB 4JTAB 4LBEC 3OR7C 5EBWC 1QLEC 2EINC 4MVRA 3SPGA 1OCCC 1JVMA 1XL6A 3KG2A 4J9YB 5BZBA 4GX5A 2ZD9A 3K04A 3RVYA 2P7TC 4LP8A 3UM7A 3ZJZA 2WLJA 1V54C 4ZBMA 3IFXA 3K06A 3LDEA 3E8HA 4MVOA 3F5WC 4PDLA 3TCUA 3X2QC 2ITDC 2A0LA 3TETA 2X6AA 4R7CA 4WFEA 5B1BC 2NLJC 2R9RB 4QNHB 1ORQC 3IGAC 3STLC 3E8BA 3OGCC 1R3JC 3OR6C 2ATKC 2KB1A 4MVZA 4F4LA 2EIKC 2HVKC 3RW0A 3VOUA 4RUEA 3F7VC 2EILC 4RAIA 4I9WA 1J95A 4MVSA 3SYAA 2WLIA 3ZRSA 2IH3C 3AG4C 4P2ZA 3T1CA 5CBGA 2DWDC 3E86A 1M56C 1R3LC 2WLKA 1KKDA 2OCCC 4GX0A 5B3SC 1K4CC 2W0FC 3RBZA 2X6CA 4MVUA 1K4DC 2WLHA 4R8CA 1ZWIC 3FB5C 2Q67A 3K08A 5E1AC 2H8PC 5CBHA 3F7YC 2HG5C 3SYPA 4JTCB 3SYQA 4OXSA 2ITCC 2HJFC 2WLNA 3FB7C 4MVMA 4PA6A 4WFFA 1S5HC 4X8AA 5EC2C 3HPLC 3T4ZA 3R65A 4PA9A 3AG2C 3T2MA 3AG1C 4PA3A 1G4YB 2JK5C 4XDKA 1BL8A 4MW3A 3ASNC 3SPIA 3LDCA 4GX1A 4HZ3A 1LNQA 3SPCA 3STZC 5EC1C 4DXWA 4RO2A 3T4DA 2DYRC 3ABMC 4WFGA 3FB6C
chains in the Genus database with same CATH superfamily
2YXHA 1JOYA 4LNUB 3A8TA 1FPOA 2DE0X 4Q20A 1WA8A 1S77D 5JH7B 5CA3A 3QO7A 4N21A 3UT5B 2XOKG 2JEXA 5KHIA 2Y4TA 1NTZH 5KMGA 1VQ4V 3JASB 4MTGA 1TVKA 3ZBHA 2P90A 1XBLA 2VWJA 3FB8C 4DK0A 3QG5A 5LOVB 4NB5A 1Q43A 4LCUC 1VQ5V 4JASA 4LWSA 4GYCB 4CH5A 3GVMA 4JI8O 2OTLV 1X4TA 4LFBO 4HYOA 1TAEA 2R9AA 4P30A 2E75B 2P6JA 3CHXA 2EIJC 1JJ2U 5L3FA 1VQ9V 1PP9H 4EFBA 2BE3A 5B3SB 3KG2A 1JVMA 3ZMTA 1P7GA 2UUBO 3RVYA 1VF6C 3ABUA 4K8XA 3A0BZ 1Q81W 1RPRA 3R66A 1N34B 3FD9A 2NLJC 4JF3A 5FL7G 1NH2D 2LP7A 3VOUA 5HFLA 3L9DA 3CC7V 4MTXA 5LMNB 5FLXN 4UCOA 3GWKC 1FXKA 4MVUA 3F7YC 4X65B 2IBZH 3RT3C 4LF8O 3J80N 4TSFG 3AG2C 2GTSA 1VMGA 1BL8A 1SQVH 4J10A 4OX9B 2HLDG 2QWNB 3ASOB 3ZIAG 3SPCA 2GSMB 3CYOA 1HDJA 3RYCB 1HNZB 3FYIB 4KXRA 3LSUA 3JCUZ 4YHHB 1W2BU 3ABLC 4JI7B 3WB1A 2D3OW 1XL4A 2RDCA 4WBNA 4TWKA 1FXVA 1EZJA 5LHIA 1PKXA 2ZXWB 2DWEC 1F4NA 1SS3A 4QE7A 3W7TA 1H2LA 3BAAA 3S3WA 2JVDA 2ZM6O 4R6ZA 5IJ0B 2Q7EA 2QKCA 5EZYA 1FJGB 4LR3A 4XDLA 5J2UB 4CH3A 2P06A 1QVGU 4JYCA 1SQQH 2K1EA 2E5LO 1OZ0A 1BHBA 3OGIB 1K97A 3UM7A 3K79A 3K5MA 2Q4PA 3B09A 3O65A 1VF5B 2PZSA 4CC6A 1JPXA 5IYCO 4DV4O 2X7RB 4DR5B 2L6LA 3OMNB 3ABTA 4DV3B 3SYQA 4FK5C 2HHHO 1BE3H 4LC1A 2OWOA 3WG7B 4LFAB 2UXBB 4DK1A 2YIBD 4QPKA 5KA6A 1YI2V 5LYJA 4JV5B 1MZFA 3FB6C 4DV1O 2QTSA 2ZE6A 5EBLC 2XAJA 1A32A 1B3QA 4H33A 2UUAO 1FAFA 2FTKA 1XMQO 1JA8A 4PDRA 2VQEB 2ILMA 3EHBB 2YC0A 1P84F 5KUKA 4NXMO 1FFTB 3SJAC 4IIJB 2Q6AA 3BFRA 2DMXA 1KUQA 3SPJA 1MSDA 2UXXA 1K3EA 4JYAO 1S5JA 4FLTA 2CAZC 1QLEB 4UFZA 3CEIA 4DV0O 1AROP 4BW5A 1XNQB 3E83A 2W6IG 2YDEA 4B3TO 5H9CA 1J5EB 5JVDA 2HVJC 3ZS8C 2RQ6A 1IBMB 2WLLA 2QTOA 2KG7B 5J2TB 1CP9A 2L35A 4BIOA 5ITZB 3TCUA 3JSNA 4R7CA 4O4IB 2R9RB 4ZOLA 3OEHG 4NXNB 1KMIZ 3OR6C 4RWUA 3ASNB 3D3QA 1AI7A 2ZCEA 4IYHA 1J95A 2WLIA 4DYLA 1QNMA 4F6RA 2WAMA 1WA8B 5B3SC 4B3MO 1FS0G 1K4DC 2WLHA 3MD0A 4R8CA 3FB5C 2DYSB 4N23A 4CH6A 4QGPA 1HNWB 2DQ0A 4JI4O 5KMGB 3OW2U 1KP2A 1TVKB 4DV6O 1I94O 5JCOA 2Q0OC 5KX5A 2ZE5A 3KCYA 3CCUV 2KSDA 1LUVA 4QJFB 4LWSB 4FFKA 4U3FH 1L0NH 3VQWA 1Z2GA 1KD1W 1MSWD 5EBMC 2XNDG 3CS5A 1QR9A 2WPDG 5LHGA 2EIMC 3ASOC 2HJDA 4IHJA 4GKJO 3SYCA 3W7UA 1R3KC 4IL6Z 5JJEB 2V4DA 1K8AW 1Q5OA 1EBOA 1EN4A 4JGSA 3CCEV 3FX7A 3ZN1A 2R72A 1XNRO 2AXTZ 4CH4A 1CPYA 1MABG 3WU2Z 1GH6A 4ZHQA 1AP6A 3B40A 3JD4A 4J7JA 1AJQA 2ZXWC 1FXKB 3UCSC 2Y0IA 5FNVA 3UKMA 1Y4MA 1R6TA 1XL6A 2K9PA 3L70H 1IBKO 5KHHA 2F4VB 3F5WC 3TGUH 3CD6V 2P22C 5HFMA 3K5NA 4FLWA 4JI6B 4P2ZA 5CB4A 1M57B 2X6CA 2GTAA 1I5YA 1JX9A 3OTOO 2H8PC 4UB8Z 2OTJV 2WLNA 2AGAA 4DV7B 5FPOA 4WBNB 1G4YB 3A0RA 1FXHA 3SPIA 2E74B 4DUZB 2BTQA 1B04A 5H2FZ 4HZ3A 2XASA 5K1PA 1Y67A 1YIJV 2UXDO 2KKWA 4UCTA 4Z1MG 3AK2A 1RM1B 1PD3A 5BR8O 2BTOA 1M1KW 1WB7A 2AHYA 3CMAV 5CA0A 4DR1O 1BGYH 5EZYB 3CRAA 3WG7C 3CCQV 1DLBA 2BSKA 1NJIW 2LJ2A 5C8YA 4I4TA 1VIBA 3JYCA 2ZDIA 4DV2B 2ZT9B 3SJQC 1YJ9V 2EX3A 1NR7A 1PL0A 1WB8A 2F23A 1IX9A 1GM7A 4DR2B 2P5OA 1YJWV 4JAAA 4MTOA 4AQYB 2VQFO 4DUYO 4KP4A 3G71V 3K03A 4LF4O 3FKSG 5A2QN 4TT3G 3I5DA 1QLEC 3OFNG 5BZBA 4TOIA 4X1KA 3TK1A 4LP8A 2WLJA 3IFXA 4J7KA 5EYPA 4KHPO 4JZ2A 2HKOA 3ZN0A 1YHQV 2CDYA 2A0LA 1NU1H 1JMKC 2CTWA 1XI1A 1OJHA 3S3XA 1AVMA 4PI2A 5IJ9A 4WFBV 1AP5A 4X64O 4D6TH 5LYJB 4J42A 4J7ZA 2E3CA 4KUMA 3T1CA 4JI2B 3ABMB 2P4KA 1HNXO 1KKDA 5LGUA 1N0JA 3ZRVA 4I9QA 3HKDA 2O57A 3ABKB 4DR4O 1BS3A 3CJHA 1SC5B 3ZMZA 5KAIZ 4DR7O 4DW0A 1XEQA 2UU9B 2Q5ZA 4LH7A 2JK5C 3ASNC 4F6EA 3QNEA 1XMOB 2JS5A 3SJBC 3G80A 3LNNA 2WA3A 1Z5WA 5DM6V 1OCOC 3RYHA 4JI5O 1VEWA 2IJHA 2DYSC 2PYJA 2Y69B 3H1IH 3TJTA 2Q0AA 5IDJA 4NVPA 5GW7A 1HR0O 3BHPA 2IM9A 3ZEDA 5JVDB 1WN7A 3B8NA 3J7AU 4I0XA 2WLLB 2AZ0A 1MMMA 1KKCA 1YEWA 1AI6A 4JPRA 2CK3G 1K33A 1OCZB 3A0HZ 3D8CA 3HKCA 1BT8A 2YIDA 1THZA 3ICXA 2Y0PA 1US6A 4ZOLB 3CCMV 5IYDO 2JDIG 4FFBA 1SRYA 2WLIB 3OD4A 5DN6G 4F6RB 1QLNA 3B4SA 4LFCB 1AILA 5GTHZ 3LNMB 5IT9N 3SPGA 3GWOA 1L0LH 4K0KB 1VQPV 1SF9A 4FMTA 1NTKH 2YI8A 4ZBMA 3WFVA 1N34O 1FFXA 2X6AA 2QSAA 3IGAC 3OTFA 3FFQA 5KX5B 3T1HB 3JAKA 3OGCC 4Q6GA 2R70A 1FXKC 2F1MA 1TUBA 2EULA 2IH3C 3L72H 4OGQB 1K7DA 1KC8W 2DQ3A 2LW7A 4X65O 1NR1A 3SYPA 1LR1A 2GUZA 3D36A 3APOA 3FB7C 3DSQA 4JI0O 3MHHC 4B08A 4ZI7A 1ROPA 3ETEA 4L8JA 3VQVA 4IHJB 2JIZG 4OX9O 3AG1C 5IY5B 4KL1A 2JS3A 4DXWA 3LSQA 1HNZO 1NT2B 3CMEV 1WAZA 2LQTA 1M57C 5L3CA 2M7WA 4J11A 1YTFB 5GTIZ 3RN4A 3JATA 5IWAB 1SQBH 3GB7C 1EM1A 1JFFA 4ZHQB 2IU3A 1SQFA 2BOBC 4JI8B 4JZGA 2B9ZA 1WP8A 1N33B 1AR5A 4MVQA 1QU7A 2EIMB 5FNVB 1M93A 3B77A 2Q68A 5BMVA 2PUSA 3JAMN 1RM1C 3FYEB 3T1YO 5F2VO 5H6QA 1PM9A 4LF6B 2NR5A 3BA8A 1PPJH 2ODMA 2QJ1A 4QPJA 4C7UA 1ZTEA 5KAFZ 3H1HH 2QM4A 1FJGO 4XDJA 5CB4B 1JQ0A 4UUJC 4QIWF 1ZLZA 1R3IC 4BR6A 1BQZA 2LFSA 4NTYA 3SGIA 3HKBA 3ETGA 1BZKA 3U11A 1IVSA 4GZRB 4CC5A 3THOA 1XUQA 1W0KG 1Q3EA 4H0LB 2BTQB 4L87A 2FYUH 3IAYA 4DR5O 2X0LA 2XT9A 2MK3A 5IE9A 3JAWA 2DWDC 3U0ZA 2DOSA 3BPZA 3OMAB 1MOFA 5CA0B 4LH6A 1WPXA 2PF4E 2QE7G 1M5IA 2HJFC 3R65A 1QHTA 4RQFA 2BSKB 3W7WA 3G6EV 4LFAO 1KQSU 1WJZA 3ZHRA 5C8YB 4I4TB 1W0JG 2ZNIA 3C3TA 3ABMC 3MAQA 4J80A 1Q82W 4O4JA 1M90W 3JALA 1AB3A 3L71H 1Y76A 3ABKC 2VQEO 2Y4UA 1KU9A 1YF2A 2YUAA 3SJCC 2UXNA 1YTFD 3CCLV 4E4EA 1NVPB 5GONB 5B1OA 4O4LA 3DTUB 2ZM6B 4U3JA 3L75H 1IXBA 2F66C 4FLYA 1MG1A 1R6KA 1U97A 4X1KB 3N2GA 1I5XA 4X62B 2Y69C 5EYPB 2ARHA 1D2DA 1XNQO 5J9PC 4WFHA 4YJ3A 2UUCO 4GKKO 3M7MX 1IURA 3ZHUA 2CH7A 2PYLA 1D5AA 2XAGA 3BEHA 3AK3A 1OCZC 3HKDB 4DV4B 3CWBH 4LBEC 4D7TA 1Y74A 4XBFA 3CJHB 4JI3O 2P7TC 4K35A 3K57A 1V54C 5BXZA 5L3GA 5LXTA 1E1RG 5KHGA 4CZZA 1ZAUA 2HHHB 3N2KA 2FB5A 4MVZA 4FVMA 4TQFA 2HVKC 2M6YA 4FZ1A 2OT5A 3RYHB 4X9QA 2YS8A 3K5LA 4JAUA 3E2EA 1SQPH 3EVKA 1CXZB 1BHAA 5CBHA 3JD0A 2A06H 2ZE7A 1K5QA 1XMQB 1HNWO 5JCOC 3K9AA 4GLXA 1M4UA 3T4ZA 4I0XB 3T2MA 4NXMB 5B5EZ 4AI8A 2Q9LA 3STZC 5B1AB 3HKCB 5L3DA 4I5SA 2IJIA 1B06A 2EZOA 4X66O 4JYAB 3BY6A 5KUMA 1OCOB 3QO5A 4PJ0Z 4W4LA 2N05A 1KBHA 4O2BA 4FFBB 1GN6A 4H37A 4B3TB 5IY5C 2XTAA 1BSMA 1KECA 1NVPD 2Z5UA 3E8GA 3C90A 2P4VA 4PDVA 5KLVH 4JTDB 1DF4A 2EZPA 2CGOA 3K0GA 1ZX3A 4OPAA 5C93A 1Q6HA 4PA7A 1FFXB 1XREA 1ZSPA 4PA4A 2W6JG 3JAKB 4EKWA 4CBCA 3KCXA 2YICA 1GRJA 1TUBB 3OEEG 1F7YA 1B6QA 1WLEA 3OAAG 2EILB 1QR8A 3OR7C 4MVRA 4B3MB 2GUZB 2IW5A 4ZI7B 5LMUO 3ZJZA 1Q7YW 5KA5A 4PDLA 2GV9A 3E35A 2JJ2G 3TETA 4WFEA 2UXCO 1ORQC 4JI4B 1RFYA 3E8BA 3QVNA 3CC4V 4DV6B 1I94B 4K8ZA 3DGEA 3F7VC 3ZRSA 1YZBA 3VQYA 2DYRB 3HB3B 2N74A 4U7OA 3JATB 4HNAA 1JFFB 1N0NA 1U96A 3CCJV 1N32O 4X8AA 1IZ3A 4TQDA 4PA3A 1XHXA 1W59A 4XDKA 3AG1B 3B2EE 3LDCA 5BMVB 2YIBA 4IT5A 4I55A 5LL6Y 4LF5O 1V55B 4LF7B 4DRXA 3ZMUA 4X20A 4YIOA 3SYOA 1PNKA 2QWOB 2FMLA 4D7SA 3BRCA 3JARA 2LGWA 1YITV 5IYBO 3ML0A 4YY3O 4GX2A 1VP7A 4FM1A 3DC6A 2ZDIC 2NN4A 1XDCA 3APQA 3HKBB 4DV2O 2QKAA 3CXCU 2Q69A 5LP6A 2ZR2A 3WB2A 4WFAV 1HWYA 4B3RO 2CGNA 4MS2A 1IBKB 4JAVA 1JR9A 4DR2O 4O4HA 1Q6UA 4FJCC 1IXMA 2CTPA 3ZMSA 4R50A 4DR6B 3U10A 1Q8IA 1GAXA 1YSCA 1O9HA 4GX5A 3OTOB 2A7WA 2XAQA 1IBLB 3UO3A 2H3OA 2A3QA 3ZHVA 3QF7A 1R3JC 3WB0A 2IJJA 2OYQA 1EN6A 1GKFA 4I9WA 4O4JB 3SYAA 3JALB 1Y76B 1H38A 2UXDB 2OIEA 2W0FC 3DXRA 4PD4F 3K08A 5BR8B 3K5OA 4B3SB 5FPRA 4K3AA 1VF7A 1UFIA 4OXSA 1S5HC 4O4LB 4U3JB 1N36O 3OE7G 4DR3O 4MW3A 2RN9A 4J41A 1PL4A 2VS0A 3N2GB 3T4DA 2WWWA 3RYFA 4LF9O 4G27B 3BCCH 4TV8A 3ETDA 3SPHA 1L1FA 1QVFU 4YJ3B 2IH1C 2ETNA 3K3WA 4W4KA 4FZ0A 2CH7B 5JQGA 2NNUA 2LFRA 4FLVA 2AHZA 5B1AC 1BMFG 4DUYB 1Y74B 4EB6A 4DV5O 2XUMA 2QGNA 4LF4B 3CRRA 1RPOA 2VWKA 3OMIB 2ADPA 5LXTB 1OCCB 4Z1VA 4HAMA 2PI4A 4BIZA 3PJSK 4JI1B 3N2KB 4KHPB 3X2QB 4UVBA 1NH2B 2YIAA 2IU0A 1P7BA 1IDSA 1GO3F 4LFCO 2FL4A 1XHZA 1GN2A 2FKXA 1MZEA 4CS3A 2QR4A 4UCVA 4K0KO 1M56B 2LW1A 1HNXB 3F5TA 4PV1B 4I7ZB 1FYJA 3JD1A 5LA6A 4DR4B 1K34A 1DGSA 4U7NA 1V54B 2F95B 3ZMVA 3P3NA 4TV9A 2JGUA 1PNMA 3RW0A 2EILC 5IYZA 3L74H 4MT8A 1R3LC 2WLKA 3ETQA 3D36C 4JI5B 2B1IA 3SDLA 1H2GA 1I7FA 4O2BB 4IGGA 2OIGA 4ZIBA 1SZTA 1HR0B 1GTOA 1H8HG 3JSLA 1NKDA 1SQGA 4NTWA 2RMKB 1QCEA 2RJZA 3W7XA 1VQKV 3K9SA 1N8RW 4E2LA 4ASUG 5LMNO 2DYRC 3NXSA 1LUWA 1AR1B 2YXYA 1WNSA 1SERA 1JJOA 1T5EA 5IWAO 1XQ8A 3E8FA 4PDMA 1ZL8A 5CMUA 2QKSA 4JYBA 3O9OA 4I50A 1N33O 1RP3B 3RWRD 3E22A 3HKEA 3AG3B 4YJ2A 2A9HA 3LSSA 2X6BA 1V55C 3H9VA 5LBQA 1CEZA 1YDXA 4LF6O 3CSXA 1G1XB 4YHHO 1VQOV 1F23A 4X1YA 4JI7O 1Z5VA 4UCSA 2CUGA 5AG2A 4RUFA 4LFBB 1UJWB 4UV9A 2E76B 3OUFA 4TUYA 4UCUA 1GK9A 4GUNA 4HNAB 4J9YB 1X59A 4BAYA 4DO2A 2BCCH 2AW9A 3UQ8A 2UUBB 1OV9A 2JGDA 4MVOA 2ZR3A 2ITDC 5L3EA 2PY5A 4JI0B 1VQ6V 1VF6A 1JCHA 4I55B 2Q7GA 4IYIA 2N04A 4X1IA 4DRXB 4MVSA 4X20B 4H44B 3RBZA 3RFRA 3JARB 1ZWIC 3I55V 1FD9A 4B7EA 1TGOA 4MVMA 3TXQA 3CRCA 3HPLC 2CTRA 4LF8B 2QM7A 2YXLA 1GM9A 3G6BA 1EFRG 1I0HA 4FM2A 1LNQA 1D5NA 3JD2A 4UB6Z 5EC1C 3CP1A 4WFGA 1YVWA 5LP6B 3OT7A 3D3IA 4NKGB 4Z2WA 3K59A 3T1YB 3ZCCA 3ZHTA 4UVCA 4DV3O 1YJNV 4O4HB 2VRZA 2UXBO 3G4SV 3L73H 3QTCA 3H1KH 4JV5O 5L3BA 1P4RA 1WP7A 3CB2A 4X62O 1G6UA 2P67A 1VARA 3OUSA 4WCEV 4H13B 2RNBA 2QA4V 4RQEA 4QE9A 4GT1A 3RYIA 2EJRA 3FAVA 4PI0A 3JCZA 2A79B 5B1BB 1DK1A 3JD3A 1M9NA 4G28B 4MSWC 3ZRWA 1WPBA 3E89A 4P9PA 2Y48A 3AG4B 3DXRB 2PI5A 5KHKA 3J81N 2V7QG 1G8MA 1RSOA 1OCCC 3P3PA 2E5LB 3MDSA 3K04A 1S5LZ 3K06A 3X2QC 2B5UA 4OPHA 2XHBA 1PNLA 3PN1A 1J5EO 5CN0A 5IJ9B 1ENVA 3EXAA 2ZIOA 4FLZA 5K1XA 1E79G 3CRMA 3RYFB 2ZINA 2W0XA 1IBMO 2B1GA 4TV8B 1Y6XA 2GHYA 1SA0A 5CA1A 4BW9A 1M56C 2Q7HA 3ZRXA 3HR0A 3P32A 2QWPB 2F43G 2Q67A 2HG5C 5JQGB 4HBNA 4WFFA 4O2AA 5D5QA 4NXNO 1K9MW 3IC7A 4EB6B 4GX1A 2F93B 1H8EG 2GBOA 2QEXV 1OCRB 1EZVH 3CXHF 5H5NA 2EJ7A 4DV1B 4X89A 5LHHA 1GN3A 2XAHA 2YSUB 2UUAB 3RVZA 2LGQA 2WLMA 3IC9A 3Q4HA 1AI4A 2UUCB 4GKKB 1QBZA 3KKYA 3C3SA 3ZHSA 2Z3YA 1R1BA 2PTMA 2YEVA 1ZUQA 4KFMA 5LA6B 2EINB 2Q8VA 4LNUA 4JI3B 1GM8A 2RCVA 4DV0B 1AJPA 5JH7A 4TV9B 1NBMG 1O9GA 3AG3C 4CS4A 1S72V 3CE2A 5IYZB 3UT5A 3CCSV 2G38A 2ADQB 1Y66A 2EIKB 3CRQA 3LUTB 1BCCH 5EK0A 3JASA 4JTAB 2V1DA 3I56V 2OCCB 1GMGA 4PELA 5LOVA 3DC5A 3G67A 4QNHB 5DEDA 4G2KA 1URFA 1SQXH 2EBOA 1NS1A 4RAIA 2GDSA 1XOUA 1EN5A 1VQLV 4X66B 2ZIMA 1ZL8B 4FPPA 2YI9A 4CS2A 4I50B 5E1AC 2F4VO 4FLUA 4NR1A 5LGTA 3E22B 3HKEB 1UPGA 4YJ2B 3CPWU 4BIUA 4JI6O 2ZKOA 2PGGA 1HW7A 4LF7O 5B1NA 4RO2A 2JRIA 1GN4A 3BA9A 1H2MA 3OM3B 5LGNA 3NR7A 5H6RA 1TUEB 4X1YB 4AILC 3VBBA 1V9PA 3MHSC 2QWQB 3AEIA 3H01A 1YCIA 4BWAA 1F4MA 4DV7O 4FIPC 2WSSG 4FLXA 4DUZO 4NYKA 1YXBA 4TUYB 3SR2C 1H2NA 3K58A 3H1LH 1K92A 5CBFA 4GKJB 5LP6C 3ZX6A 3W7SA 2EIJB 1NZ6A 2DJVA 2BOCC 1PV0A 3RYCA 2JGDB 3CCRV 1H2SB 1FKAO 1Q90D 1HP8A 5LMUB 3K0DA 3TXSA 2AZ2A 1KB9F 5B66Z 1XNRB 4ABMA 4X1IB 2D2CB 2DW4A 2UXCB 1AI5A 4DR6O 5D5PA 3LDDA 1N4CA 4A5UB 3M8AA 1L8DA 4AHCA 4EEQA 1Q6IA 3ZHQA 2HFEC 2QDOA 3M99B 1I08A 3BVOA 2CE4A 1IBLO 5EIBD 3H1JH 1AR4A 3LDEA 2JJ1G 1N32B 2ZNJA 1VQNV 1DF5A 5B1BC 3AG2B 4AQYO 1OHHG 2ATKC 2KB1A 4F4LA 4ZKIA 1COWG 1Q86W 3JAWB 5IJ0A 1AJNA 5BY1A 3AG4C 4UVAA 1XILA 4LF5B 4UXNA 5J2UA 3E86A 4DW1A 1K4CC 1H2KA 4UV8A 4B3SO 1MNGA 2IJKA 2ITCC 3RGBA 3ABLB 5EC2C 1R73A 5DECA 3CX5F 4YY3B 2XAFA 1S76D 4ICGA 5A9GA 4JI2O 1S0VA 1KYOF 3BABA 5JJNB 1F51A 1NQTA 2ZQMA 3EFFK 5TISZ 3RYIB 3P30A 3AG7A 3FAVB 1R6NA 4B3RB 2UU9O 3ZRWB 1SETA 1SESA 4UCRA 4DR1B 2ZE8A 5GONA 1XMOO 4EFEA 4PHZA 1P49A 1NTMH 1K73W 1OCRC 4P9OA 1RSOB 4GCZA 4X88A 1QQCA 1VQMV 1VQ7V 1SKVA 2HP8A 1TA8A 4YXWG 2QWRB 4JI1O 2HR3A 4J9ZB 5JWPA 1BQ0A 1DTOA 3A2FA 5JJJB 2CTQA 2JEUA 3CCVV 2H94A 1SA0B 4MTFA 5CA1B 4IIJA 2OCHA 4MW8A 2VQFB 4B7KA 3N27A 3VQXA 5EBWC 2EINC 2MW2B 4O2AB 2ZD9A 1VQ8V 4YIPA 3E8HA 2Z0AA 1S3JA 3IJ4A 3AK1A 1N36B 4DR3B 2QM8A 2HEPA 3STLC 1NI8A 2EIKC 4RUEA 4X64B 1SZXA 2LO1A 3CC2V 5CBGA 1E1QG 2C2AA 4LF9B 2OCCC 4GX0A 3QO8A 5EIBC 4WF9V 5E79Z 1MA1A 2KG7A 2KQXA 5J2TA 3Q4HB 4JYYA 5KHJA 4JTCB 3KZIZ 4PA6A 2DN9A 4PA9A 5ITZA 4DR7B 1KP3A 2R9IA 3T1HO 4NTXA 3UO2A 4O4IA 2YEVB 2WA4A 3B8MA 2Q73A 1K5SA 4DV5B 4FM0A
chains in the Genus database with same CATH topology
3D3IA 2EZOA 4Z1MG 1JOYA 1RM1B 3BY6A 1PD3A 5KUMA 1OCOB 3QO5A 3ZCCA 4Q20A 4UVCA 1YJNV 1S77D 1M1KW 2AHYA 3CMAV 5CA3A 3QO7A 4N21A 2XOKG 4H37A 5IY5C 2JEXA 3WG7C 3CCQV 1DLBA 3G4SV 1KECA 1NVPD 2Z5UA 3E8GA 1VQ4V 4MTGA 1NJIW 2P90A 5L3BA 1P4RA 4PDVA 4JTDB 1DF4A 2EZPA 3FB8C 3JYCA 2P67A 2ZDIA 3K0GA 3OUSA 4WCEV 4LCUC 5C93A 2QA4V 4PA7A 1VQ5V 4JASA 4QE9A 3SJQC 4RQEA 4GT1A 1YJ9V 2EJRA 4PA4A 1NR7A 2OTLV 2W6JG 4HYOA 3JCZA 1PL0A 2A79B 4EKWA 4CBCA 5B1BB 1GM7A 3JD3A 1YJWV 1M9NA 4G28B 4MSWC 4MTOA 3OEEG 3ZRWA 4P30A 2P6JA 3E89A 4KP4A 1B6QA 1WLEA 3K03A 3G71V 3OAAG 2EILB 1QR8A 4P9PA 2EIJC 2Y48A 3FKSG 1JJ2U 5L3FA 1VQ9V 3AG4B 2PI5A 4TT3G 3OR7C 1QLEC 4MVRA 2V7QG 1G8MA 5B3SB 3OFNG 1OCCC 1JVMA 3KG2A 5BZBA 3ZMTA 3K04A 3RVYA 2IW5A 3TK1A 4LP8A 3ZJZA 2WLJA 1Q7YW 3ABUA 5KA5A 3IFXA 3K06A 4PDLA 3X2QC 2HKOA 3ZN0A 1Q81W 2B5UA 1RPRA 3E35A 1YHQV 2A0LA 2JJ2G 1PNLA 3TETA 4WFEA 5CN0A 2NLJC 4JF3A 1ORQC 1ENVA 3E8BA 4WFBV 3CC4V 1E79G 5FL7G 1NH2D 2LP7A 3VOUA 5HFLA 2B1GA 3DGEA 3F7VC 4KUMA 3ZRSA 3CC7V 2GHYA 3T1CA 4MTXA 2DYRB 3ABMB 3HB3B 1M56C 1KKDA 5LGUA 4U7OA 3ZRXA 3ZRVA 1FXKA 4MVUA 3P32A 2F43G 2Q67A 3ABKB 3F7YC 2HG5C 3CCJV 3ZMZA 4WFFA 4X8AA 4TSFG 3AG2C 4PA3A 2JK5C 1K9MW 4XDKA 1BL8A 3ASNC 3IC7A 3AG1B 3LDCA 3QNEA 4GX1A 2HLDG 3ASOB 3ZIAG 3SPCA 2GSMB 1H8EG 3CYOA 2QEXV 1OCRB 1V55B 5DM6V 3FYIB 1OCOC 3ZMUA 3SYOA 4X89A 5LHHA 2IJHA 1PNKA 2XAHA 2DYSC 2YSUB 2Y69B 5IDJA 3RVZA 5GW7A 1W2BU 3ABLC 2WLMA 2D3OW 1YITV 1XL4A 1AI4A 1QBZA 3B8NA 5IYBO 3ML0A 4GX2A 5L3DA 2WLLB 2Z3YA 4TWKA 1FXVA 1AI6A 1EZJA 4JPRA 2ZDIC 5LHIA 1PKXA 2CK3G 1K33A 1OCZB 2YEVA 2ZXWB 3CXCU 2DWEC 2Q69A 4KFMA 2ZR2A 4WFAV 2EINB 1F4NA 1HWYA 1THZA 4MS2A 4QE7A 4JAVA 1GM8A 3W7TA 1AJPA 3CCMV 5IYDO 1NBMG 2JDIG 3AG3C 1S72V 4R6ZA 1SRYA 4FJCC 2WLIB 3CCSV 1IXMA 3ZMSA 4R50A 5DN6G 4XDLA 1QLNA 1Y66A 2EIKB 3LUTB 5EK0A 1QVGU 4JYCA 2K1EA 3LNMB 4JTAB 2V1DA 3SPGA 1YSCA 2OCCB 3I56V 3GWOA 1GMGA 1OZ0A 4PELA 1VQPV 4GX5A 1BHBA 1K97A 4FMTA 3UM7A 2XAQA 4ZBMA 3WFVA 3K79A 2X6AA 4QNHB 3IGAC 4G2KA 3OGCC 1R3JC 2EBOA 2IJJA 1JPXA 1GKFA 1FXKC 4RAIA 4I9WA 3SYAA 5IYCO 2IH3C 2X7RB 1H38A 3OMNB 1VQLV 1K7DA 3ABTA 1KC8W 2W0FC 2DQ3A 4FPPA 3K08A 5E1AC 1NR1A 3SYPA 3D36A 3SYQA 4OXSA 3FB7C 5LGTA 1S5HC 3MHHC 1ROPA 4FK5C 3ETEA 3CPWU 3OE7G 2JIZG 3AG1C 4LC1A 4MW3A 5IY5B 3WG7B 4BIUA 4DXWA 3LSQA 4QPKA 4RO2A 5B1NA 3T4DA 2WWWA 5KA6A 1YI2V 3FB6C 3CMEV 4G27B 1M57C 5L3CA 3ETDA 3OM3B 5LGNA 2M7WA 5EBLC 5H6RA 2XAJA 1TUEB 3SPHA 4H33A 3VBBA 3MHSC 1YTFB 3AEIA 1L1FA 2FTKA 3H01A 1QVFU 2IH1C 4PDRA 3GB7C 3EHBB 3K3WA 2IU3A 1F4MA 2BOBC 5KUKA 1FFTB 2NNUA 2WSSG 4FIPC 2LFRA 4MVQA 2AHZA 2Q6AA 2EIMB 5B1AC 1K92A 3B77A 1BMFG 5CBFA 3SPJA 2Q68A 3W7SA 2UXXA 1K3EA 2EIJB 1RM1C 1RPOA 2BOCC 3FYEB 3OMIB 1QLEB 3CCRV 1OCCB 5H6QA 4HAMA 2PI4A 4BIZA 1AROP 4BW5A 3PJSK 3K0DA 3E83A 2W6IG 4QPJA 3X2QB 4UVBA 1NH2B 5H9CA 2IU0A 2DW4A 1AI5A 1P7BA 4XDJA 2HVJC 1GO3F 3LDDA 1JQ0A 2WLLA 4UUJC 4QIWF 2QTOA 1R3IC 2HFEC 1M56B 3M99B 1CP9A 2LFSA 3ETGA 3JD1A 1K34A 3LDEA 3TCUA 2JJ1G 4U7NA 1W0KG 1V54B 1VQNV 4R7CA 1DF5A 5B1BC 2R9RB 4L87A 3AG2B 3OEHG 1OHHG 3OR6C 3ZMVA 2ATKC 2KB1A 4F4LA 3ASNB 1PNMA 4ZKIA 1COWG 3RW0A 1Q86W 1AI7A 2EILC 1AJNA 2X0LA 1J95A 2WLIA 2MK3A 4MT8A 3AG4C 4UVAA 4UXNA 2DWDC 2WAMA 3E86A 1R3LC 2WLKA 5B3SC 1FS0G 1K4CC 3OMAB 1K4DC 2B1IA 2WLHA 3MD0A 1H2GA 4UV8A 4R8CA 3FB5C 1MOFA 2IJKA 2DYSB 1WPXA 4N23A 2ITCC 2QE7G 2HJFC 1SZTA 1GTOA 1H8HG 3ABLB 5EC2C 1R73A 3R65A 2DQ0A 1NKDA 4RQFA 3W7WA 3G6EV 1KQSU 3OW2U 1KP2A 1QCEA 3W7XA 2XAFA 1W0JG 1VQKV 1S76D 1N8RW 4E2LA 4ASUG 2DYRC 3ABMC 3NXSA 1S0VA 1F51A 1AR1B 1NQTA 3CCUV 1Q82W 2ZQMA 1M90W 3EFFK 4QJFB 1SERA 3ABKC 3P30A 1KD1W 1R6NA 3E8FA 1MSWD 5EBMC 4PDMA 5CMUA 2QKSA 2XNDG 4JYBA 2UXNA 1YTFD 1QR9A 3CCLV 2WPDG 1NVPB 3ZRWB 1SETA 1SESA 5B1OA 5LHGA 2EIMC 3AG3B 3DTUB 3ASOC 2A9HA 3LSSA 2X6BA 3SYCA 1K73W 1OCRC 1V55C 3W7UA 5LBQA 1CEZA 4P9OA 1MG1A 4GCZA 1R3KC 1R6KA 4X88A 1VQMV 1VQ7V 1K8AW 1I5XA 4WFGA 1EBOA 2Y69C 4YXWG 1VQOV 4JGSA 3CCEV 3ZN1A 1F23A 2HR3A 4J9ZB 5J9PC 4WFHA 1DTOA 1CPYA 1MABG 4RUFA 2JEUA 3JD4A 3CCVV 2XAGA 2H94A 1UJWB 4MTFA 3BEHA 4UV9A 1OCZC 4MW8A 1AJQA 2ZXWC 3OUFA 1GK9A 1FXKB 3UKMA 4LBEC 1Y4MA 4XBFA 5EBWC 2EINC 1XL6A 4J9YB 4BAYA 2ZD9A 4DO2A 2P7TC 1VQ8V 1V54C 5L3GA 1E1RG 4MVOA 3E8HA 3F5WC 2ZR3A 2ITDC 1S3JA 5L3EA 3CD6V 4CZZA 1VQ6V 5HFMA 1JCHA 2QM8A 3STLC 4MVZA 2EIKC 2HVKC 4RUEA 2OT5A 4MVSA 3CC2V 4P2ZA 5CBGA 1E1QG 2C2AA 2OCCC 4GX0A 3QO8A 4JAUA 3RBZA 4WF9V 1M57B 2X6CA 3E2EA 1I5YA 1JX9A 1ZWIC 1BHAA 5CBHA 2H8PC 3JD0A 3I55V 4JTCB 2OTJV 1K5QA 2WLNA 4MVMA 4PA6A 3K9AA 3HPLC 3T4ZA 4PA9A 3T2MA 1KP3A 2QM7A 1G4YB 1GM9A 2R9IA 1EFRG 3A0RA 1FXHA 3SPIA 2YEVB 4HZ3A 1LNQA 2XASA 3STZC 3JD2A 5B1AB 5EC1C 1YIJV 3B8MA 3CP1A 4I5SA 1K5SA 2IJIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4G27 B;  1OCO C;  1M57 C;  3EFF K;  5EBL C;  3SYO A;  4X89 A;  5KUM A;  4H33 A;  3SPH A;  3ABK C;  2DYS C;  3E8F A;  5EBM C;  2IH1 C;  4PDM A;  3RVZ A;  2QKS A;  4PDR A;  3GB7 C;  2AHY A;  3ABL C;  2WLM A;  1XL4 A;  2BOB C;  5KUK A;  4H37 A;  5IY5 C;  3WG7 C;  2EIM C;  4MVQ A;  2AHZ A;  4GX2 A;  2Q6A A;  2A9H A;  2WLL B;  3ASO C;  3E8G A;  4TWK A;  2X6B A;  5B1A C;  4MTG A;  3SYC A;  1OCR C;  5CBF A;  1V55 C;  3SPJ A;  2Q68 A;  4P9O A;  4PDV A;  1R3K C;  2YEV A;  4JTD B;  3FB8 C;  4X88 A;  3JYC A;  2BOC C;  2DWE C;  2Q69 A;  4KFM A;  3K0G A;  3OUS A;  2Y69 C;  4LCU C;  4MS2 A;  4PA7 A;  4QE7 A;  3SJQ C;  4QE9 A;  4J9Z B;  4BW5 A;  3PJS K;  3K0D A;  3E83 A;  5J9P C;  4WFH A;  4PA4 A;  4HYO A;  2A79 B;  4EKW A;  4CBC A;  4RUF A;  3AG3 C;  4R6Z A;  1P7B A;  4G28 B;  4MSW C;  2WLI B;  2HVJ C;  4MTO A;  4XDJ A;  4P30 A;  4R50 A;  4MTF A;  3LDD A;  3BEH A;  3E89 A;  4XDL A;  3K03 A;  1OCZ C;  4MW8 A;  3LUT B;  2WLL A;  2ZXW C;  3OUF A;  4P9P A;  4UUJ C;  2EIJ C;  5EK0 A;  2QTO A;  1R3I C;  3UKM A;  2K1E A;  2HFE C;  3LNM B;  4JTA B;  4LBE C;  3OR7 C;  5EBW C;  1QLE C;  2EIN C;  4MVR A;  3SPG A;  1OCC C;  1JVM A;  1XL6 A;  3KG2 A;  4J9Y B;  5BZB A;  4GX5 A;  2ZD9 A;  3K04 A;  3RVY A;  2P7T C;  4LP8 A;  3UM7 A;  3ZJZ A;  2WLJ A;  1V54 C;  4ZBM A;  3IFX A;  3K06 A;  3LDE A;  3E8H A;  4MVO A;  3F5W C;  4PDL A;  3TCU A;  3X2Q C;  2ITD C;  2A0L A;  3TET A;  2X6A A;  4R7C A;  4WFE A;  5B1B C;  2NLJ C;  2R9R B;  4QNH B;  1ORQ C;  3IGA C;  3STL C;  3E8B A;  3OGC C;  1R3J C;  3OR6 C;  2ATK C;  2KB1 A;  4MVZ A;  4F4L A;  2EIK C;  2HVK C;  3RW0 A;  3VOU A;  4RUE A;  3F7V C;  2EIL C;  4RAI A;  4I9W A;  1J95 A;  4MVS A;  3SYA A;  2WLI A;  3ZRS A;  2IH3 C;  3AG4 C;  4P2Z A;  3T1C A;  5CBG A;  2DWD C;  3E86 A;  1M56 C;  1R3L C;  2WLK A;  1KKD A;  2OCC C;  4GX0 A;  5B3S C;  1K4C C;  2W0F C;  3RBZ A;  2X6C A;  4MVU A;  1K4D C;  2WLH A;  4R8C A;  1ZWI C;  3FB5 C;  2Q67 A;  3K08 A;  5E1A C;  2H8P C;  5CBH A;  3F7Y C;  2HG5 C;  3SYP A;  4JTC B;  3SYQ A;  4OXS A;  2ITC C;  2HJF C;  2WLN A;  3FB7 C;  4MVM A;  4PA6 A;  4WFF A;  1S5H C;  4X8A A;  5EC2 C;  3HPL C;  3T4Z A;  3R65 A;  4PA9 A;  3AG2 C;  3T2M A;  3AG1 C;  4PA3 A;  1G4Y B;  2JK5 C;  4XDK A;  1BL8 A;  4MW3 A;  3ASN C;  3SPI A;  3LDC A;  4GX1 A;  4HZ3 A;  1LNQ A;  3SPC A;  3STZ C;  5EC1 C;  4DXW A;  4RO2 A;  3T4D A;  2DYR C;  3ABM C;  4WFG A;  3FB6 C; 
#chains in the Genus database with same CATH topology
 2YXH A;  1JOY A;  4LNU B;  3A8T A;  1FPO A;  2DE0 X;  4Q20 A;  1WA8 A;  1S77 D;  5JH7 B;  5CA3 A;  3QO7 A;  4N21 A;  3UT5 B;  2XOK G;  2JEX A;  5KHI A;  2Y4T A;  1NTZ H;  5KMG A;  1VQ4 V;  3JAS B;  4MTG A;  1TVK A;  3ZBH A;  2P90 A;  1XBL A;  2VWJ A;  3FB8 C;  4DK0 A;  3QG5 A;  5LOV B;  4NB5 A;  1Q43 A;  4LCU C;  1VQ5 V;  4JAS A;  4LWS A;  4GYC B;  4CH5 A;  3GVM A;  4JI8 O;  2OTL V;  1X4T A;  4LFB O;  4HYO A;  1TAE A;  2R9A A;  4P30 A;  2E75 B;  2P6J A;  3CHX A;  2EIJ C;  1JJ2 U;  5L3F A;  1VQ9 V;  1PP9 H;  4EFB A;  2BE3 A;  5B3S B;  3KG2 A;  1JVM A;  3ZMT A;  1P7G A;  2UUB O;  3RVY A;  1VF6 C;  3ABU A;  4K8X A;  3A0B Z;  1Q81 W;  1RPR A;  3R66 A;  1N34 B;  3FD9 A;  2NLJ C;  4JF3 A;  5FL7 G;  1NH2 D;  2LP7 A;  3VOU A;  5HFL A;  3L9D A;  3CC7 V;  4MTX A;  5LMN B;  5FLX N;  4UCO A;  3GWK C;  1FXK A;  4MVU A;  3F7Y C;  4X65 B;  2IBZ H;  3RT3 C;  4LF8 O;  3J80 N;  4TSF G;  3AG2 C;  2GTS A;  1VMG A;  1BL8 A;  1SQV H;  4J10 A;  4OX9 B;  2HLD G;  2QWN B;  3ASO B;  3ZIA G;  3SPC A;  2GSM B;  3CYO A;  1HDJ A;  3RYC B;  1HNZ B;  3FYI B;  4KXR A;  3LSU A;  3JCU Z;  4YHH B;  1W2B U;  3ABL C;  4JI7 B;  3WB1 A;  2D3O W;  1XL4 A;  2RDC A;  4WBN A;  4TWK A;  1FXV A;  1EZJ A;  5LHI A;  1PKX A;  2ZXW B;  2DWE C;  1F4N A;  1SS3 A;  4QE7 A;  3W7T A;  1H2L A;  3BAA A;  3S3W A;  2JVD A;  2ZM6 O;  4R6Z A;  5IJ0 B;  2Q7E A;  2QKC A;  5EZY A;  1FJG B;  4LR3 A;  4XDL A;  5J2U B;  4CH3 A;  2P06 A;  1QVG U;  4JYC A;  1SQQ H;  2K1E A;  2E5L O;  1OZ0 A;  1BHB A;  3OGI B;  1K97 A;  3UM7 A;  3K79 A;  3K5M A;  2Q4P A;  3B09 A;  3O65 A;  1VF5 B;  2PZS A;  4CC6 A;  1JPX A;  5IYC O;  4DV4 O;  2X7R B;  4DR5 B;  2L6L A;  3OMN B;  3ABT A;  4DV3 B;  3SYQ A;  4FK5 C;  2HHH O;  1BE3 H;  4LC1 A;  2OWO A;  3WG7 B;  4LFA B;  2UXB B;  4DK1 A;  2YIB D;  4QPK A;  5KA6 A;  1YI2 V;  5LYJ A;  4JV5 B;  1MZF A;  3FB6 C;  4DV1 O;  2QTS A;  2ZE6 A;  5EBL C;  2XAJ A;  1A32 A;  1B3Q A;  4H33 A;  2UUA O;  1FAF A;  2FTK A;  1XMQ O;  1JA8 A;  4PDR A;  2VQE B;  2ILM A;  3EHB B;  2YC0 A;  1P84 F;  5KUK A;  4NXM O;  1FFT B;  3SJA C;  4IIJ B;  2Q6A A;  3BFR A;  2DMX A;  1KUQ A;  3SPJ A;  1MSD A;  2UXX A;  1K3E A;  4JYA O;  1S5J A;  4FLT A;  2CAZ C;  1QLE B;  4UFZ A;  3CEI A;  4DV0 O;  1ARO P;  4BW5 A;  1XNQ B;  3E83 A;  2W6I G;  2YDE A;  4B3T O;  5H9C A;  1J5E B;  5JVD A;  2HVJ C;  3ZS8 C;  2RQ6 A;  1IBM B;  2WLL A;  2QTO A;  2KG7 B;  5J2T B;  1CP9 A;  2L35 A;  4BIO A;  5ITZ B;  3TCU A;  3JSN A;  4R7C A;  4O4I B;  2R9R B;  4ZOL A;  3OEH G;  4NXN B;  1KMI Z;  3OR6 C;  4RWU A;  3ASN B;  3D3Q A;  1AI7 A;  2ZCE A;  4IYH A;  1J95 A;  2WLI A;  4DYL A;  1QNM A;  4F6R A;  2WAM A;  1WA8 B;  5B3S C;  4B3M O;  1FS0 G;  1K4D C;  2WLH A;  3MD0 A;  4R8C A;  3FB5 C;  2DYS B;  4N23 A;  4CH6 A;  4QGP A;  1HNW B;  2DQ0 A;  4JI4 O;  5KMG B;  3OW2 U;  1KP2 A;  1TVK B;  4DV6 O;  1I94 O;  5JCO A;  2Q0O C;  5KX5 A;  2ZE5 A;  3KCY A;  3CCU V;  2KSD A;  1LUV A;  4QJF B;  4LWS B;  4FFK A;  4U3F H;  1L0N H;  3VQW A;  1Z2G A;  1KD1 W;  1MSW D;  5EBM C;  2XND G;  3CS5 A;  1QR9 A;  2WPD G;  5LHG A;  2EIM C;  3ASO C;  2HJD A;  4IHJ A;  4GKJ O;  3SYC A;  3W7U A;  1R3K C;  4IL6 Z;  5JJE B;  2V4D A;  1K8A W;  1Q5O A;  1EBO A;  1EN4 A;  4JGS A;  3CCE V;  3FX7 A;  3ZN1 A;  2R72 A;  1XNR O;  2AXT Z;  4CH4 A;  1CPY A;  1MAB G;  3WU2 Z;  1GH6 A;  4ZHQ A;  1AP6 A;  3B40 A;  3JD4 A;  4J7J A;  1AJQ A;  2ZXW C;  1FXK B;  3UCS C;  2Y0I A;  5FNV A;  3UKM A;  1Y4M A;  1R6T A;  1XL6 A;  2K9P A;  3L70 H;  1IBK O;  5KHH A;  2F4V B;  3F5W C;  3TGU H;  3CD6 V;  2P22 C;  5HFM A;  3K5N A;  4FLW A;  4JI6 B;  4P2Z A;  5CB4 A;  1M57 B;  2X6C A;  2GTA A;  1I5Y A;  1JX9 A;  3OTO O;  2H8P C;  4UB8 Z;  2OTJ V;  2WLN A;  2AGA A;  4DV7 B;  5FPO A;  4WBN B;  1G4Y B;  3A0R A;  1FXH A;  3SPI A;  2E74 B;  4DUZ B;  2BTQ A;  1B04 A;  5H2F Z;  4HZ3 A;  2XAS A;  5K1P A;  1Y67 A;  1YIJ V;  2UXD O;  2KKW A;  4UCT A;  4Z1M G;  3AK2 A;  1RM1 B;  1PD3 A;  5BR8 O;  2BTO A;  1M1K W;  1WB7 A;  2AHY A;  3CMA V;  5CA0 A;  4DR1 O;  1BGY H;  5EZY B;  3CRA A;  3WG7 C;  3CCQ V;  1DLB A;  2BSK A;  1NJI W;  2LJ2 A;  5C8Y A;  4I4T A;  1VIB A;  3JYC A;  2ZDI A;  4DV2 B;  2ZT9 B;  3SJQ C;  1YJ9 V;  2EX3 A;  1NR7 A;  1PL0 A;  1WB8 A;  2F23 A;  1IX9 A;  1GM7 A;  4DR2 B;  2P5O A;  1YJW V;  4JAA A;  4MTO A;  4AQY B;  2VQF O;  4DUY O;  4KP4 A;  3G71 V;  3K03 A;  4LF4 O;  3FKS G;  5A2Q N;  4TT3 G;  3I5D A;  1QLE C;  3OFN G;  5BZB A;  4TOI A;  4X1K A;  3TK1 A;  4LP8 A;  2WLJ A;  3IFX A;  4J7K A;  5EYP A;  4KHP O;  4JZ2 A;  2HKO A;  3ZN0 A;  1YHQ V;  2CDY A;  2A0L A;  1NU1 H;  1JMK C;  2CTW A;  1XI1 A;  1OJH A;  3S3X A;  1AVM A;  4PI2 A;  5IJ9 A;  4WFB V;  1AP5 A;  4X64 O;  4D6T H;  5LYJ B;  4J42 A;  4J7Z A;  2E3C A;  4KUM A;  3T1C A;  4JI2 B;  3ABM B;  2P4K A;  1HNX O;  1KKD A;  5LGU A;  1N0J A;  3ZRV A;  4I9Q A;  3HKD A;  2O57 A;  3ABK B;  4DR4 O;  1BS3 A;  3CJH A;  1SC5 B;  3ZMZ A;  5KAI Z;  4DR7 O;  4DW0 A;  1XEQ A;  2UU9 B;  2Q5Z A;  4LH7 A;  2JK5 C;  3ASN C;  4F6E A;  3QNE A;  1XMO B;  2JS5 A;  3SJB C;  3G80 A;  3LNN A;  2WA3 A;  1Z5W A;  5DM6 V;  1OCO C;  3RYH A;  4JI5 O;  1VEW A;  2IJH A;  2DYS C;  2PYJ A;  2Y69 B;  3H1I H;  3TJT A;  2Q0A A;  5IDJ A;  4NVP A;  5GW7 A;  1HR0 O;  3BHP A;  2IM9 A;  3ZED A;  5JVD B;  1WN7 A;  3B8N A;  3J7A U;  4I0X A;  2WLL B;  2AZ0 A;  1MMM A;  1KKC A;  1YEW A;  1AI6 A;  4JPR A;  2CK3 G;  1K33 A;  1OCZ B;  3A0H Z;  3D8C A;  3HKC A;  1BT8 A;  2YID A;  1THZ A;  3ICX A;  2Y0P A;  1US6 A;  4ZOL B;  3CCM V;  5IYD O;  2JDI G;  4FFB A;  1SRY A;  2WLI B;  3OD4 A;  5DN6 G;  4F6R B;  1QLN A;  3B4S A;  4LFC B;  1AIL A;  5GTH Z;  3LNM B;  5IT9 N;  3SPG A;  3GWO A;  1L0L H;  4K0K B;  1VQP V;  1SF9 A;  4FMT A;  1NTK H;  2YI8 A;  4ZBM A;  3WFV A;  1N34 O;  1FFX A;  2X6A A;  2QSA A;  3IGA C;  3OTF A;  3FFQ A;  5KX5 B;  3T1H B;  3JAK A;  3OGC C;  4Q6G A;  2R70 A;  1FXK C;  2F1M A;  1TUB A;  2EUL A;  2IH3 C;  3L72 H;  4OGQ B;  1K7D A;  1KC8 W;  2DQ3 A;  2LW7 A;  4X65 O;  1NR1 A;  3SYP A;  1LR1 A;  2GUZ A;  3D36 A;  3APO A;  3FB7 C;  3DSQ A;  4JI0 O;  3MHH C;  4B08 A;  4ZI7 A;  1ROP A;  3ETE A;  4L8J A;  3VQV A;  4IHJ B;  2JIZ G;  4OX9 O;  3AG1 C;  5IY5 B;  4KL1 A;  2JS3 A;  4DXW A;  3LSQ A;  1HNZ O;  1NT2 B;  3CME V;  1WAZ A;  2LQT A;  1M57 C;  5L3C A;  2M7W A;  4J11 A;  1YTF B;  5GTI Z;  3RN4 A;  3JAT A;  5IWA B;  1SQB H;  3GB7 C;  1EM1 A;  1JFF A;  4ZHQ B;  2IU3 A;  1SQF A;  2BOB C;  4JI8 B;  4JZG A;  2B9Z A;  1WP8 A;  1N33 B;  1AR5 A;  4MVQ A;  1QU7 A;  2EIM B;  5FNV B;  1M93 A;  3B77 A;  2Q68 A;  5BMV A;  2PUS A;  3JAM N;  1RM1 C;  3FYE B;  3T1Y O;  5F2V O;  5H6Q A;  1PM9 A;  4LF6 B;  2NR5 A;  3BA8 A;  1PPJ H;  2ODM A;  2QJ1 A;  4QPJ A;  4C7U A;  1ZTE A;  5KAF Z;  3H1H H;  2QM4 A;  1FJG O;  4XDJ A;  5CB4 B;  1JQ0 A;  4UUJ C;  4QIW F;  1ZLZ A;  1R3I C;  4BR6 A;  1BQZ A;  2LFS A;  4NTY A;  3SGI A;  3HKB A;  3ETG A;  1BZK A;  3U11 A;  1IVS A;  4GZR B;  4CC5 A;  3THO A;  1XUQ A;  1W0K G;  1Q3E A;  4H0L B;  2BTQ B;  4L87 A;  2FYU H;  3IAY A;  4DR5 O;  2X0L A;  2XT9 A;  2MK3 A;  5IE9 A;  3JAW A;  2DWD C;  3U0Z A;  2DOS A;  3BPZ A;  3OMA B;  1MOF A;  5CA0 B;  4LH6 A;  1WPX A;  2PF4 E;  2QE7 G;  1M5I A;  2HJF C;  3R65 A;  1QHT A;  4RQF A;  2BSK B;  3W7W A;  3G6E V;  4LFA O;  1KQS U;  1WJZ A;  3ZHR A;  5C8Y B;  4I4T B;  1W0J G;  2ZNI A;  3C3T A;  3ABM C;  3MAQ A;  4J80 A;  1Q82 W;  4O4J A;  1M90 W;  3JAL A;  1AB3 A;  3L71 H;  1Y76 A;  3ABK C;  2VQE O;  2Y4U A;  1KU9 A;  1YF2 A;  2YUA A;  3SJC C;  2UXN A;  1YTF D;  3CCL V;  4E4E A;  1NVP B;  5GON B;  5B1O A;  4O4L A;  3DTU B;  2ZM6 B;  4U3J A;  3L75 H;  1IXB A;  2F66 C;  4FLY A;  1MG1 A;  1R6K A;  1U97 A;  4X1K B;  3N2G A;  1I5X A;  4X62 B;  2Y69 C;  5EYP B;  2ARH A;  1D2D A;  1XNQ O;  5J9P C;  4WFH A;  4YJ3 A;  2UUC O;  4GKK O;  3M7M X;  1IUR A;  3ZHU A;  2CH7 A;  2PYL A;  1D5A A;  2XAG A;  3BEH A;  3AK3 A;  1OCZ C;  3HKD B;  4DV4 B;  3CWB H;  4LBE C;  4D7T A;  1Y74 A;  4XBF A;  3CJH B;  4JI3 O;  2P7T C;  4K35 A;  3K57 A;  1V54 C;  5BXZ A;  5L3G A;  5LXT A;  1E1R G;  5KHG A;  4CZZ A;  1ZAU A;  2HHH B;  3N2K A;  2FB5 A;  4MVZ A;  4FVM A;  4TQF A;  2HVK C;  2M6Y A;  4FZ1 A;  2OT5 A;  3RYH B;  4X9Q A;  2YS8 A;  3K5L A;  4JAU A;  3E2E A;  1SQP H;  3EVK A;  1CXZ B;  1BHA A;  5CBH A;  3JD0 A;  2A06 H;  2ZE7 A;  1K5Q A;  1XMQ B;  1HNW O;  5JCO C;  3K9A A;  4GLX A;  1M4U A;  3T4Z A;  4I0X B;  3T2M A;  4NXM B;  5B5E Z;  4AI8 A;  2Q9L A;  3STZ C;  5B1A B;  3HKC B;  5L3D A;  4I5S A;  2IJI A;  1B06 A;  2EZO A;  4X66 O;  4JYA B;  3BY6 A;  5KUM A;  1OCO B;  3QO5 A;  4PJ0 Z;  4W4L A;  2N05 A;  1KBH A;  4O2B A;  4FFB B;  1GN6 A;  4H37 A;  4B3T B;  5IY5 C;  2XTA A;  1BSM A;  1KEC A;  1NVP D;  2Z5U A;  3E8G A;  3C90 A;  2P4V A;  4PDV A;  5KLV H;  4JTD B;  1DF4 A;  2EZP A;  2CGO A;  3K0G A;  1ZX3 A;  4OPA A;  5C93 A;  1Q6H A;  4PA7 A;  1FFX B;  1XRE A;  1ZSP A;  4PA4 A;  2W6J G;  3JAK B;  4EKW A;  4CBC A;  3KCX A;  2YIC A;  1GRJ A;  1TUB B;  3OEE G;  1F7Y A;  1B6Q A;  1WLE A;  3OAA G;  2EIL B;  1QR8 A;  3OR7 C;  4MVR A;  4B3M B;  2GUZ B;  2IW5 A;  4ZI7 B;  5LMU O;  3ZJZ A;  1Q7Y W;  5KA5 A;  4PDL A;  2GV9 A;  3E35 A;  2JJ2 G;  3TET A;  4WFE A;  2UXC O;  1ORQ C;  4JI4 B;  1RFY A;  3E8B A;  3QVN A;  3CC4 V;  4DV6 B;  1I94 B;  4K8Z A;  3DGE A;  3F7V C;  3ZRS A;  1YZB A;  3VQY A;  2DYR B;  3HB3 B;  2N74 A;  4U7O A;  3JAT B;  4HNA A;  1JFF B;  1N0N A;  1U96 A;  3CCJ V;  1N32 O;  4X8A A;  1IZ3 A;  4TQD A;  4PA3 A;  1XHX A;  1W59 A;  4XDK A;  3AG1 B;  3B2E E;  3LDC A;  5BMV B;  2YIB A;  4IT5 A;  4I55 A;  5LL6 Y;  4LF5 O;  1V55 B;  4LF7 B;  4DRX A;  3ZMU A;  4X20 A;  4YIO A;  3SYO A;  1PNK A;  2QWO B;  2FML A;  4D7S A;  3BRC A;  3JAR A;  2LGW A;  1YIT V;  5IYB O;  3ML0 A;  4YY3 O;  4GX2 A;  1VP7 A;  4FM1 A;  3DC6 A;  2ZDI C;  2NN4 A;  1XDC A;  3APQ A;  3HKB B;  4DV2 O;  2QKA A;  3CXC U;  2Q69 A;  5LP6 A;  2ZR2 A;  3WB2 A;  4WFA V;  1HWY A;  4B3R O;  2CGN A;  4MS2 A;  1IBK B;  4JAV A;  1JR9 A;  4DR2 O;  4O4H A;  1Q6U A;  4FJC C;  1IXM A;  2CTP A;  3ZMS A;  4R50 A;  4DR6 B;  3U10 A;  1Q8I A;  1GAX A;  1YSC A;  1O9H A;  4GX5 A;  3OTO B;  2A7W A;  2XAQ A;  1IBL B;  3UO3 A;  2H3O A;  2A3Q A;  3ZHV A;  3QF7 A;  1R3J C;  3WB0 A;  2IJJ A;  2OYQ A;  1EN6 A;  1GKF A;  4I9W A;  4O4J B;  3SYA A;  3JAL B;  1Y76 B;  1H38 A;  2UXD B;  2OIE A;  2W0F C;  3DXR A;  4PD4 F;  3K08 A;  5BR8 B;  3K5O A;  4B3S B;  5FPR A;  4K3A A;  1VF7 A;  1UFI A;  4OXS A;  1S5H C;  4O4L B;  4U3J B;  1N36 O;  3OE7 G;  4DR3 O;  4MW3 A;  2RN9 A;  4J41 A;  1PL4 A;  2VS0 A;  3N2G B;  3T4D A;  2WWW A;  3RYF A;  4LF9 O;  4G27 B;  3BCC H;  4TV8 A;  3ETD A;  3SPH A;  1L1F A;  1QVF U;  4YJ3 B;  2IH1 C;  2ETN A;  3K3W A;  4W4K A;  4FZ0 A;  2CH7 B;  5JQG A;  2NNU A;  2LFR A;  4FLV A;  2AHZ A;  5B1A C;  1BMF G;  4DUY B;  1Y74 B;  4EB6 A;  4DV5 O;  2XUM A;  2QGN A;  4LF4 B;  3CRR A;  1RPO A;  2VWK A;  3OMI B;  2ADP A;  5LXT B;  1OCC B;  4Z1V A;  4HAM A;  2PI4 A;  4BIZ A;  3PJS K;  4JI1 B;  3N2K B;  4KHP B;  3X2Q B;  4UVB A;  1NH2 B;  2YIA A;  2IU0 A;  1P7B A;  1IDS A;  1GO3 F;  4LFC O;  2FL4 A;  1XHZ A;  1GN2 A;  2FKX A;  1MZE A;  4CS3 A;  2QR4 A;  4UCV A;  4K0K O;  1M56 B;  2LW1 A;  1HNX B;  3F5T A;  4PV1 B;  4I7Z B;  1FYJ A;  3JD1 A;  5LA6 A;  4DR4 B;  1K34 A;  1DGS A;  4U7N A;  1V54 B;  2F95 B;  3ZMV A;  3P3N A;  4TV9 A;  2JGU A;  1PNM A;  3RW0 A;  2EIL C;  5IYZ A;  3L74 H;  4MT8 A;  1R3L C;  2WLK A;  3ETQ A;  3D36 C;  4JI5 B;  2B1I A;  3SDL A;  1H2G A;  1I7F A;  4O2B B;  4IGG A;  2OIG A;  4ZIB A;  1SZT A;  1HR0 B;  1GTO A;  1H8H G;  3JSL A;  1NKD A;  1SQG A;  4NTW A;  2RMK B;  1QCE A;  2RJZ A;  3W7X A;  1VQK V;  3K9S A;  1N8R W;  4E2L A;  4ASU G;  5LMN O;  2DYR C;  3NXS A;  1LUW A;  1AR1 B;  2YXY A;  1WNS A;  1SER A;  1JJO A;  1T5E A;  5IWA O;  1XQ8 A;  3E8F A;  4PDM A;  1ZL8 A;  5CMU A;  2QKS A;  4JYB A;  3O9O A;  4I50 A;  1N33 O;  1RP3 B;  3RWR D;  3E22 A;  3HKE A;  3AG3 B;  4YJ2 A;  2A9H A;  3LSS A;  2X6B A;  1V55 C;  3H9V A;  5LBQ A;  1CEZ A;  1YDX A;  4LF6 O;  3CSX A;  1G1X B;  4YHH O;  1VQO V;  1F23 A;  4X1Y A;  4JI7 O;  1Z5V A;  4UCS A;  2CUG A;  5AG2 A;  4RUF A;  4LFB B;  1UJW B;  4UV9 A;  2E76 B;  3OUF A;  4TUY A;  4UCU A;  1GK9 A;  4GUN A;  4HNA B;  4J9Y B;  1X59 A;  4BAY A;  4DO2 A;  2BCC H;  2AW9 A;  3UQ8 A;  2UUB B;  1OV9 A;  2JGD A;  4MVO A;  2ZR3 A;  2ITD C;  5L3E A;  2PY5 A;  4JI0 B;  1VQ6 V;  1VF6 A;  1JCH A;  4I55 B;  2Q7G A;  4IYI A;  2N04 A;  4X1I A;  4DRX B;  4MVS A;  4X20 B;  4H44 B;  3RBZ A;  3RFR A;  3JAR B;  1ZWI C;  3I55 V;  1FD9 A;  4B7E A;  1TGO A;  4MVM A;  3TXQ A;  3CRC A;  3HPL C;  2CTR A;  4LF8 B;  2QM7 A;  2YXL A;  1GM9 A;  3G6B A;  1EFR G;  1I0H A;  4FM2 A;  1LNQ A;  1D5N A;  3JD2 A;  4UB6 Z;  5EC1 C;  3CP1 A;  4WFG A;  1YVW A;  5LP6 B;  3OT7 A;  3D3I A;  4NKG B;  4Z2W A;  3K59 A;  3T1Y B;  3ZCC A;  3ZHT A;  4UVC A;  4DV3 O;  1YJN V;  4O4H B;  2VRZ A;  2UXB O;  3G4S V;  3L73 H;  3QTC A;  3H1K H;  4JV5 O;  5L3B A;  1P4R A;  1WP7 A;  3CB2 A;  4X62 O;  1G6U A;  2P67 A;  1VAR A;  3OUS A;  4WCE V;  4H13 B;  2RNB A;  2QA4 V;  4RQE A;  4QE9 A;  4GT1 A;  3RYI A;  2EJR A;  3FAV A;  4PI0 A;  3JCZ A;  2A79 B;  5B1B B;  1DK1 A;  3JD3 A;  1M9N A;  4G28 B;  4MSW C;  3ZRW A;  1WPB A;  3E89 A;  4P9P A;  2Y48 A;  3AG4 B;  3DXR B;  2PI5 A;  5KHK A;  3J81 N;  2V7Q G;  1G8M A;  1RSO A;  1OCC C;  3P3P A;  2E5L B;  3MDS A;  3K04 A;  1S5L Z;  3K06 A;  3X2Q C;  2B5U A;  4OPH A;  2XHB A;  1PNL A;  3PN1 A;  1J5E O;  5CN0 A;  5IJ9 B;  1ENV A;  3EXA A;  2ZIO A;  4FLZ A;  5K1X A;  1E79 G;  3CRM A;  3RYF B;  2ZIN A;  2W0X A;  1IBM O;  2B1G A;  4TV8 B;  1Y6X A;  2GHY A;  1SA0 A;  5CA1 A;  4BW9 A;  1M56 C;  2Q7H A;  3ZRX A;  3HR0 A;  3P32 A;  2QWP B;  2F43 G;  2Q67 A;  2HG5 C;  5JQG B;  4HBN A;  4WFF A;  4O2A A;  5D5Q A;  4NXN O;  1K9M W;  3IC7 A;  4EB6 B;  4GX1 A;  2F93 B;  1H8E G;  2GBO A;  2QEX V;  1OCR B;  1EZV H;  3CXH F;  5H5N A;  2EJ7 A;  4DV1 B;  4X89 A;  5LHH A;  1GN3 A;  2XAH A;  2YSU B;  2UUA B;  3RVZ A;  2LGQ A;  2WLM A;  3IC9 A;  3Q4H A;  1AI4 A;  2UUC B;  4GKK B;  1QBZ A;  3KKY A;  3C3S A;  3ZHS A;  2Z3Y A;  1R1B A;  2PTM A;  2YEV A;  1ZUQ A;  4KFM A;  5LA6 B;  2EIN B;  2Q8V A;  4LNU A;  4JI3 B;  1GM8 A;  2RCV A;  4DV0 B;  1AJP A;  5JH7 A;  4TV9 B;  1NBM G;  1O9G A;  3AG3 C;  4CS4 A;  1S72 V;  3CE2 A;  5IYZ B;  3UT5 A;  3CCS V;  2G38 A;  2ADQ B;  1Y66 A;  2EIK B;  3CRQ A;  3LUT B;  1BCC H;  5EK0 A;  3JAS A;  4JTA B;  2V1D A;  3I56 V;  2OCC B;  1GMG A;  4PEL A;  5LOV A;  3DC5 A;  3G67 A;  4QNH B;  5DED A;  4G2K A;  1URF A;  1SQX H;  2EBO A;  1NS1 A;  4RAI A;  2GDS A;  1XOU A;  1EN5 A;  1VQL V;  4X66 B;  2ZIM A;  1ZL8 B;  4FPP A;  2YI9 A;  4CS2 A;  4I50 B;  5E1A C;  2F4V O;  4FLU A;  4NR1 A;  5LGT A;  3E22 B;  3HKE B;  1UPG A;  4YJ2 B;  3CPW U;  4BIU A;  4JI6 O;  2ZKO A;  2PGG A;  1HW7 A;  4LF7 O;  5B1N A;  4RO2 A;  2JRI A;  1GN4 A;  3BA9 A;  1H2M A;  3OM3 B;  5LGN A;  3NR7 A;  5H6R A;  1TUE B;  4X1Y B;  4AIL C;  3VBB A;  1V9P A;  3MHS C;  2QWQ B;  3AEI A;  3H01 A;  1YCI A;  4BWA A;  1F4M A;  4DV7 O;  4FIP C;  2WSS G;  4FLX A;  4DUZ O;  4NYK A;  1YXB A;  4TUY B;  3SR2 C;  1H2N A;  3K58 A;  3H1L H;  1K92 A;  5CBF A;  4GKJ B;  5LP6 C;  3ZX6 A;  3W7S A;  2EIJ B;  1NZ6 A;  2DJV A;  2BOC C;  1PV0 A;  3RYC A;  2JGD B;  3CCR V;  1H2S B;  1FKA O;  1Q90 D;  1HP8 A;  5LMU B;  3K0D A;  3TXS A;  2AZ2 A;  1KB9 F;  5B66 Z;  1XNR B;  4ABM A;  4X1I B;  2D2C B;  2DW4 A;  2UXC B;  1AI5 A;  4DR6 O;  5D5P A;  3LDD A;  1N4C A;  4A5U B;  3M8A A;  1L8D A;  4AHC A;  4EEQ A;  1Q6I A;  3ZHQ A;  2HFE C;  2QDO A;  3M99 B;  1I08 A;  3BVO A;  2CE4 A;  1IBL O;  5EIB D;  3H1J H;  1AR4 A;  3LDE A;  2JJ1 G;  1N32 B;  2ZNJ A;  1VQN V;  1DF5 A;  5B1B C;  3AG2 B;  4AQY O;  1OHH G;  2ATK C;  2KB1 A;  4F4L A;  4ZKI A;  1COW G;  1Q86 W;  3JAW B;  5IJ0 A;  1AJN A;  5BY1 A;  3AG4 C;  4UVA A;  1XIL A;  4LF5 B;  4UXN A;  5J2U A;  3E86 A;  4DW1 A;  1K4C C;  1H2K A;  4UV8 A;  4B3S O;  1MNG A;  2IJK A;  2ITC C;  3RGB A;  3ABL B;  5EC2 C;  1R73 A;  5DEC A;  3CX5 F;  4YY3 B;  2XAF A;  1S76 D;  4ICG A;  5A9G A;  4JI2 O;  1S0V A;  1KYO F;  3BAB A;  5JJN B;  1F51 A;  1NQT A;  2ZQM A;  3EFF K;  5TIS Z;  3RYI B;  3P30 A;  3AG7 A;  3FAV B;  1R6N A;  4B3R B;  2UU9 O;  3ZRW B;  1SET A;  1SES A;  4UCR A;  4DR1 B;  2ZE8 A;  5GON A;  1XMO O;  4EFE A;  4PHZ A;  1P49 A;  1NTM H;  1K73 W;  1OCR C;  4P9O A;  1RSO B;  4GCZ A;  4X88 A;  1QQC A;  1VQM V;  1VQ7 V;  1SKV A;  2HP8 A;  1TA8 A;  4YXW G;  2QWR B;  4JI1 O;  2HR3 A;  4J9Z B;  5JWP A;  1BQ0 A;  1DTO A;  3A2F A;  5JJJ B;  2CTQ A;  2JEU A;  3CCV V;  2H94 A;  1SA0 B;  4MTF A;  5CA1 B;  4IIJ A;  2OCH A;  4MW8 A;  2VQF B;  4B7K A;  3N27 A;  3VQX A;  5EBW C;  2EIN C;  2MW2 B;  4O2A B;  2ZD9 A;  1VQ8 V;  4YIP A;  3E8H A;  2Z0A A;  1S3J A;  3IJ4 A;  3AK1 A;  1N36 B;  4DR3 B;  2QM8 A;  2HEP A;  3STL C;  1NI8 A;  2EIK C;  4RUE A;  4X64 B;  1SZX A;  2LO1 A;  3CC2 V;  5CBG A;  1E1Q G;  2C2A A;  4LF9 B;  2OCC C;  4GX0 A;  3QO8 A;  5EIB C;  4WF9 V;  5E79 Z;  1MA1 A;  2KG7 A;  2KQX A;  5J2T A;  3Q4H B;  4JYY A;  5KHJ A;  4JTC B;  3KZI Z;  4PA6 A;  2DN9 A;  4PA9 A;  5ITZ A;  4DR7 B;  1KP3 A;  2R9I A;  3T1H O;  4NTX A;  3UO2 A;  4O4I A;  2YEV B;  2WA4 A;  3B8M A;  2Q73 A;  1K5S A;  4DV5 B;  4FM0 A; 
#chains in the Genus database with same CATH homology
 3D3I A;  2EZO A;  4Z1M G;  1JOY A;  1RM1 B;  3BY6 A;  1PD3 A;  5KUM A;  1OCO B;  3QO5 A;  3ZCC A;  4Q20 A;  4UVC A;  1YJN V;  1S77 D;  1M1K W;  2AHY A;  3CMA V;  5CA3 A;  3QO7 A;  4N21 A;  2XOK G;  4H37 A;  5IY5 C;  2JEX A;  3WG7 C;  3CCQ V;  1DLB A;  3G4S V;  1KEC A;  1NVP D;  2Z5U A;  3E8G A;  1VQ4 V;  4MTG A;  1NJI W;  2P90 A;  5L3B A;  1P4R A;  4PDV A;  4JTD B;  1DF4 A;  2EZP A;  3FB8 C;  3JYC A;  2P67 A;  2ZDI A;  3K0G A;  3OUS A;  4WCE V;  4LCU C;  5C93 A;  2QA4 V;  4PA7 A;  1VQ5 V;  4JAS A;  4QE9 A;  3SJQ C;  4RQE A;  4GT1 A;  1YJ9 V;  2EJR A;  4PA4 A;  1NR7 A;  2OTL V;  2W6J G;  4HYO A;  3JCZ A;  1PL0 A;  2A79 B;  4EKW A;  4CBC A;  5B1B B;  1GM7 A;  3JD3 A;  1YJW V;  1M9N A;  4G28 B;  4MSW C;  4MTO A;  3OEE G;  3ZRW A;  4P30 A;  2P6J A;  3E89 A;  4KP4 A;  1B6Q A;  1WLE A;  3K03 A;  3G71 V;  3OAA G;  2EIL B;  1QR8 A;  4P9P A;  2EIJ C;  2Y48 A;  3FKS G;  1JJ2 U;  5L3F A;  1VQ9 V;  3AG4 B;  2PI5 A;  4TT3 G;  3OR7 C;  1QLE C;  4MVR A;  2V7Q G;  1G8M A;  5B3S B;  3OFN G;  1OCC C;  1JVM A;  3KG2 A;  5BZB A;  3ZMT A;  3K04 A;  3RVY A;  2IW5 A;  3TK1 A;  4LP8 A;  3ZJZ A;  2WLJ A;  1Q7Y W;  3ABU A;  5KA5 A;  3IFX A;  3K06 A;  4PDL A;  3X2Q C;  2HKO A;  3ZN0 A;  1Q81 W;  2B5U A;  1RPR A;  3E35 A;  1YHQ V;  2A0L A;  2JJ2 G;  1PNL A;  3TET A;  4WFE A;  5CN0 A;  2NLJ C;  4JF3 A;  1ORQ C;  1ENV A;  3E8B A;  4WFB V;  3CC4 V;  1E79 G;  5FL7 G;  1NH2 D;  2LP7 A;  3VOU A;  5HFL A;  2B1G A;  3DGE A;  3F7V C;  4KUM A;  3ZRS A;  3CC7 V;  2GHY A;  3T1C A;  4MTX A;  2DYR B;  3ABM B;  3HB3 B;  1M56 C;  1KKD A;  5LGU A;  4U7O A;  3ZRX A;  3ZRV A;  1FXK A;  4MVU A;  3P32 A;  2F43 G;  2Q67 A;  3ABK B;  3F7Y C;  2HG5 C;  3CCJ V;  3ZMZ A;  4WFF A;  4X8A A;  4TSF G;  3AG2 C;  4PA3 A;  2JK5 C;  1K9M W;  4XDK A;  1BL8 A;  3ASN C;  3IC7 A;  3AG1 B;  3LDC A;  3QNE A;  4GX1 A;  2HLD G;  3ASO B;  3ZIA G;  3SPC A;  2GSM B;  1H8E G;  3CYO A;  2QEX V;  1OCR B;  1V55 B;  5DM6 V;  3FYI B;  1OCO C;  3ZMU A;  3SYO A;  4X89 A;  5LHH A;  2IJH A;  1PNK A;  2XAH A;  2DYS C;  2YSU B;  2Y69 B;  5IDJ A;  3RVZ A;  5GW7 A;  1W2B U;  3ABL C;  2WLM A;  2D3O W;  1YIT V;  1XL4 A;  1AI4 A;  1QBZ A;  3B8N A;  5IYB O;  3ML0 A;  4GX2 A;  5L3D A;  2WLL B;  2Z3Y A;  4TWK A;  1FXV A;  1AI6 A;  1EZJ A;  4JPR A;  2ZDI C;  5LHI A;  1PKX A;  2CK3 G;  1K33 A;  1OCZ B;  2YEV A;  2ZXW B;  3CXC U;  2DWE C;  2Q69 A;  4KFM A;  2ZR2 A;  4WFA V;  2EIN B;  1F4N A;  1HWY A;  1THZ A;  4MS2 A;  4QE7 A;  4JAV A;  1GM8 A;  3W7T A;  1AJP A;  3CCM V;  5IYD O;  1NBM G;  2JDI G;  3AG3 C;  1S72 V;  4R6Z A;  1SRY A;  4FJC C;  2WLI B;  3CCS V;  1IXM A;  3ZMS A;  4R50 A;  5DN6 G;  4XDL A;  1QLN A;  1Y66 A;  2EIK B;  3LUT B;  5EK0 A;  1QVG U;  4JYC A;  2K1E A;  3LNM B;  4JTA B;  2V1D A;  3SPG A;  1YSC A;  2OCC B;  3I56 V;  3GWO A;  1GMG A;  1OZ0 A;  4PEL A;  1VQP V;  4GX5 A;  1BHB A;  1K97 A;  4FMT A;  3UM7 A;  2XAQ A;  4ZBM A;  3WFV A;  3K79 A;  2X6A A;  4QNH B;  3IGA C;  4G2K A;  3OGC C;  1R3J C;  2EBO A;  2IJJ A;  1JPX A;  1GKF A;  1FXK C;  4RAI A;  4I9W A;  3SYA A;  5IYC O;  2IH3 C;  2X7R B;  1H38 A;  3OMN B;  1VQL V;  1K7D A;  3ABT A;  1KC8 W;  2W0F C;  2DQ3 A;  4FPP A;  3K08 A;  5E1A C;  1NR1 A;  3SYP A;  3D36 A;  3SYQ A;  4OXS A;  3FB7 C;  5LGT A;  1S5H C;  3MHH C;  1ROP A;  4FK5 C;  3ETE A;  3CPW U;  3OE7 G;  2JIZ G;  3AG1 C;  4LC1 A;  4MW3 A;  5IY5 B;  3WG7 B;  4BIU A;  4DXW A;  3LSQ A;  4QPK A;  4RO2 A;  5B1N A;  3T4D A;  2WWW A;  5KA6 A;  1YI2 V;  3FB6 C;  3CME V;  4G27 B;  1M57 C;  5L3C A;  3ETD A;  3OM3 B;  5LGN A;  2M7W A;  5EBL C;  5H6R A;  2XAJ A;  1TUE B;  3SPH A;  4H33 A;  3VBB A;  3MHS C;  1YTF B;  3AEI A;  1L1F A;  2FTK A;  3H01 A;  1QVF U;  2IH1 C;  4PDR A;  3GB7 C;  3EHB B;  3K3W A;  2IU3 A;  1F4M A;  2BOB C;  5KUK A;  1FFT B;  2NNU A;  2WSS G;  4FIP C;  2LFR A;  4MVQ A;  2AHZ A;  2Q6A A;  2EIM B;  5B1A C;  1K92 A;  3B77 A;  1BMF G;  5CBF A;  3SPJ A;  2Q68 A;  3W7S A;  2UXX A;  1K3E A;  2EIJ B;  1RM1 C;  1RPO A;  2BOC C;  3FYE B;  3OMI B;  1QLE B;  3CCR V;  1OCC B;  5H6Q A;  4HAM A;  2PI4 A;  4BIZ A;  1ARO P;  4BW5 A;  3PJS K;  3K0D A;  3E83 A;  2W6I G;  4QPJ A;  3X2Q B;  4UVB A;  1NH2 B;  5H9C A;  2IU0 A;  2DW4 A;  1AI5 A;  1P7B A;  4XDJ A;  2HVJ C;  1GO3 F;  3LDD A;  1JQ0 A;  2WLL A;  4UUJ C;  4QIW F;  2QTO A;  1R3I C;  2HFE C;  1M56 B;  3M99 B;  1CP9 A;  2LFS A;  3ETG A;  3JD1 A;  1K34 A;  3LDE A;  3TCU A;  2JJ1 G;  4U7N A;  1W0K G;  1V54 B;  1VQN V;  4R7C A;  1DF5 A;  5B1B C;  2R9R B;  4L87 A;  3AG2 B;  3OEH G;  1OHH G;  3OR6 C;  3ZMV A;  2ATK C;  2KB1 A;  4F4L A;  3ASN B;  1PNM A;  4ZKI A;  1COW G;  3RW0 A;  1Q86 W;  1AI7 A;  2EIL C;  1AJN A;  2X0L A;  1J95 A;  2WLI A;  2MK3 A;  4MT8 A;  3AG4 C;  4UVA A;  4UXN A;  2DWD C;  2WAM A;  3E86 A;  1R3L C;  2WLK A;  5B3S C;  1FS0 G;  1K4C C;  3OMA B;  1K4D C;  2B1I A;  2WLH A;  3MD0 A;  1H2G A;  4UV8 A;  4R8C A;  3FB5 C;  1MOF A;  2IJK A;  2DYS B;  1WPX A;  4N23 A;  2ITC C;  2QE7 G;  2HJF C;  1SZT A;  1GTO A;  1H8H G;  3ABL B;  5EC2 C;  1R73 A;  3R65 A;  2DQ0 A;  1NKD A;  4RQF A;  3W7W A;  3G6E V;  1KQS U;  3OW2 U;  1KP2 A;  1QCE A;  3W7X A;  2XAF A;  1W0J G;  1VQK V;  1S76 D;  1N8R W;  4E2L A;  4ASU G;  2DYR C;  3ABM C;  3NXS A;  1S0V A;  1F51 A;  1AR1 B;  1NQT A;  3CCU V;  1Q82 W;  2ZQM A;  1M90 W;  3EFF K;  4QJF B;  1SER A;  3ABK C;  3P30 A;  1KD1 W;  1R6N A;  3E8F A;  1MSW D;  5EBM C;  4PDM A;  5CMU A;  2QKS A;  2XND G;  4JYB A;  2UXN A;  1YTF D;  1QR9 A;  3CCL V;  2WPD G;  1NVP B;  3ZRW B;  1SET A;  1SES A;  5B1O A;  5LHG A;  2EIM C;  3AG3 B;  3DTU B;  3ASO C;  2A9H A;  3LSS A;  2X6B A;  3SYC A;  1K73 W;  1OCR C;  1V55 C;  3W7U A;  5LBQ A;  1CEZ A;  4P9O A;  1MG1 A;  4GCZ A;  1R3K C;  1R6K A;  4X88 A;  1VQM V;  1VQ7 V;  1K8A W;  1I5X A;  4WFG A;  1EBO A;  2Y69 C;  4YXW G;  1VQO V;  4JGS A;  3CCE V;  3ZN1 A;  1F23 A;  2HR3 A;  4J9Z B;  5J9P C;  4WFH A;  1DTO A;  1CPY A;  1MAB G;  4RUF A;  2JEU A;  3JD4 A;  3CCV V;  2XAG A;  2H94 A;  1UJW B;  4MTF A;  3BEH A;  4UV9 A;  1OCZ C;  4MW8 A;  1AJQ A;  2ZXW C;  3OUF A;  1GK9 A;  1FXK B;  3UKM A;  4LBE C;  1Y4M A;  4XBF A;  5EBW C;  2EIN C;  1XL6 A;  4J9Y B;  4BAY A;  2ZD9 A;  4DO2 A;  2P7T C;  1VQ8 V;  1V54 C;  5L3G A;  1E1R G;  4MVO A;  3E8H A;  3F5W C;  2ZR3 A;  2ITD C;  1S3J A;  5L3E A;  3CD6 V;  4CZZ A;  1VQ6 V;  5HFM A;  1JCH A;  2QM8 A;  3STL C;  4MVZ A;  2EIK C;  2HVK C;  4RUE A;  2OT5 A;  4MVS A;  3CC2 V;  4P2Z A;  5CBG A;  1E1Q G;  2C2A A;  2OCC C;  4GX0 A;  3QO8 A;  4JAU A;  3RBZ A;  4WF9 V;  1M57 B;  2X6C A;  3E2E A;  1I5Y A;  1JX9 A;  1ZWI C;  1BHA A;  5CBH A;  2H8P C;  3JD0 A;  3I55 V;  4JTC B;  2OTJ V;  1K5Q A;  2WLN A;  4MVM A;  4PA6 A;  3K9A A;  3HPL C;  3T4Z A;  4PA9 A;  3T2M A;  1KP3 A;  2QM7 A;  1G4Y B;  1GM9 A;  2R9I A;  1EFR G;  3A0R A;  1FXH A;  3SPI A;  2YEV B;  4HZ3 A;  1LNQ A;  2XAS A;  3STZ C;  3JD2 A;  5B1A B;  5EC1 C;  1YIJ V;  3B8M A;  3CP1 A;  4I5S A;  1K5S A;  2IJI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...