3OUHA

Phd2-r127 with jnj41536014
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
216
structure length
212
Chain Sequence
LPALKLALEYIVPCMNKHGICVVDDFLGKETGQQIGDEVRALHDTGKFTDGQLVSQSKDIRGDKITWIEGKEPGCETIGLLMSSMDDLIRHCNGKLGSYKINGRTKAMVACYPGNGTGYVRHVDNPNGDGRCVTCIYYLNKDWDAKVSGGILRIFPEGKAQFADIEPKFDRLLFFWSDRRNPHEVQPAYATRYAITVWYFDADERARAKVKY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Benzimidazole-2-pyrazole HIF Prolyl 4-Hydroxylase Inhibitors as Oral Erythropoietin Secretagogues.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords Egl nine homolog 1
total genus 60
structure length 212
sequence length 216
ec nomenclature ec 1.14.11.29: Hypoxia-inducible factor-proline dioxygenase.
pdb deposition date 2010-09-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13640 2OG-FeII_Oxy_3 2OG-Fe(II) oxygenase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.620 Mainly Beta Sandwich Jelly Rolls q2cbj1_9rhob like domain 3ouhA00
2RDRA 4Y5SA 4JZRA 2RDQA 3DKQA 4NHKA 2A1XA 3NNMA 2OPWA 4NHLA 4XC9A 3KT4A 4NHYA 3OBZA 4ZONA 5HV0A 2JIJA 5DAVA 4XCBA 3NNJA 5IAVA 3NNLA 2JIGA 4IW3A 5DAXA 4XABA 5DAPA 5L9VA 4Y5TA 5M0TA 2G19A 4NHXA 4BQXA 3GJBA 2Y33A 5IAXA 5DAWA 5L9RA 4UWDA 5LA9A 5ERLA 4NAOA 4MHUA 5HV4A 3MGUA 4NHMA 3PL0A 2FCTA 5EP9A 3KT1A 2FCVA 5LBFA 4J25A 4XCAA 5LBEA 5EQUA 5C5TA 2HBUA 3NNFA 2RDSA 2G1MA 3OUJA 4NMIA 5LB6A 3W20A 5C5UA 5A3UA 2HBTA 3GJAA 3OUHA 3OUIA 4XACA 3KT7A 4BQWA 5LBCA 4Q5OA 4ZPIA 4BQYA 3HQUA 3HQRA 2RDNA 4KBZA 5IATA 4XAAA 3W21A 3EMRA 5EPAA 3ITQA 2FCUA 3GZEA 5LASA 2Y34A 3BVCA 5DAQA 5LATA 2V4AA 5LBBA 4MHRA 2RG4A 5L9BA
chains in the Genus database with same CATH superfamily
5CAZA 2YFZA 1LR5A 3POYA 2BTVC 4UFKA 3B9IA 4AGVA 1OA3A 2PQSA 3UJOA 4BJ0A 2R16A 2PAKA 4KG0A 3KQRA 1CAXA 1H8TB 3NNMA 3TBDA 1MEC1 5CFCC 1RB8G 4WM7B 1NXMA 2ZJCA 2P4EA 3OBZA 1REEA 1OFSA 4MXWB 5EJ3A 2VAUA 3NNGA 4TTGA 3ELNA 4H3WA 1QQP2 2E63A 3K4DA 4RYDA 5FMBA 5BY5A 1OKOA 1QH7A 3WNNA 4CPBA 5ACA3 4NPMA 1PGL2 4M4RA 4YZ5A 1GSLA 5M0TA 4C0HA 2W92A 3PHMA 1Y9QA 1JI6A 3ZSKA 3N9MA 4FP2A 1BYHA 2V5YA 3PMSA 1CGPA 1BXHA 4QDQA 1ZZ8A 4XVHA 3AZXA 3BPZA 5BNNB 1DBNA 2JDZA 3X29B 4XFFA 2BGOA 3JD71 3M7AA 4CDXC 3VDDC 3K48A 4MLOA 3AMNA 2UWAA 1XSRA 4LKEA 4YM2A 1LOFC 1QU0A 3WDUA 1JUHA 4TYSA 4HT1T 1V9U1 2XL7A 3DUIA 1Q56A 2WR9A 2ZHMA 3DPRC 3M1HA 3O0VA 3FLTA 1ZRDA 4FOVA 5DUWA 1W6PA 3P6BA 1REFA 2V4VA 1KJRA 4XHXA 3BTZA 3ZSEA 3LB9A 1DGWA 1Q43A 2GMMA 4JGZA 4PDWA 3VBRB 2QQPA 2WLPA 4COUA 4P08A 1H1MA 4DS0A 5JZGA 1TEIA 2P17A 2J22A 2HH9A 1KQRA 2P34A 4IE4A 3I59B 4IE7A 3ALQA 4Q4X2 5KHIA 4PBOA 4A41A 1OPOA 1X9TA 5BNPC 2FDKA 1UO9A 4JGYC 4CSWA 1DGRN 1WKYA 4LBQD 4BA6A 2IWGB 2IXIA 3HMYA 4UAPA 4AQ2A 3THPA 5IK7A 2WQ4A 1V6LA 2HWF3 2JB4A 4TSVA 2W46A 2ZGOA 3N36A 1RUJ1 1OOPA 1OI6A 3KB5A 2R32A 3SQOA 5FQ0A 1V70A 1PIV3 4ATFA 1D4M1 1IG3A 1WBFA 1VJ2A 2WLQA 4UT5A 1UIKA 2OPKA 2RDNA 5FYSA 2AACA 4P9WA 3A0KA 3ON7A 2ZMLA 1X7NA 3PJYA 4BIFA 4CCLA 2D5FA 3UNPA 1H6YA 4TWTA 5F2WA 2QBXA 1SLCA 4Y22B 2DCTA 2MNGA 2V09A 4DUXA 1OURA 5T5JA 1VLNA 5CZKA 4YW6A 4KU7A 4H14A 1BKZA 4RHV1 4AFBA 5A3TA 1SZBA 1XU2A 1QKQA 2GALA 1C1LA 5B4NA 1W8TA 2R042 1WMDA 4DEQA 1WD4A 3KGLA 2J1SA 4CRQA 1U5YA 1H9WA 1PZ8A 1HXS2 2QZ3A 2ARCA 1COV1 4QPYA 3RWNA 5LA1A 2ZGPA 4PT6A 4RA0A 1JZ3A 3URFA 1DZTA 1B35C 4CCMA 5AC91 1UZVA 2TUNA 2ZPXA 4BMEA 3ZYIB 3HT2A 2XJUA 3IN9A 2UU8A 4ARXA 4ES9A 2RDQA 1R64A 1RMU1 3WUDA 2Q0AA 4E4HA 4A3ZA 4ZZ5A 3PMEA 5GZEA 2R043 3VUOA 4NHYA 5JWPA 2WNVA 5DDJ1 1VBA3 3ZPOA 4CTEA 1CWPA 3WP4A 4RN5A 1BVP1 2CAVA 4BHPA 2EIBA 3RZLA 5IFPA 1CD3G 4UW3A 4KBBA 4QPIC 4D8MA 4X6QB 1H1AA 1XYNA 4LKDA 1ND2A 2ZGLA 1UF2C 4GH4C 2E7QA 2W1UA 1W0PA 5GLUA 4MXWA 4HLTA 1VBE3 2OZJA 3WNPA 5ACA2 2XVKA 2ZGTA 1QNWA 1ULEA 1ULGA 2VXRA 1N3OA 4OI2A 4BXFA 2DWRA 2ZEZA 4PI2A 2A6WA 3M8LA 4WVZA 4LO6B 1O3TA 3LEMA 2WINB 3RYPA 5BNNA 4UWDA 2WO1A 3BALA 5FFOC 1GWKA 4DIQA 1ULPA 1DU3D 2E53A 2P5BA 3A21A 4E8CA 5DMYA 2XQRA 5J98B 4P14A 2PLV3 3K75B 1ENRA 3ZN6A 3FLPA 4E2SA 4N9IA 5A80A 4DY3A 4AFAA 3VHNA 2UURA 4LT5A 1AYN2 1RUH3 5FQ0B 1U12A 2VCMA 3I2FA 4CXXA 1DGWX 1OH3A 4JQRA 1S2EA 2PELA 3U10A 3ZN5A 5FBJA 4JDNA 5LK7B 3WP6A 1RXGA 2VNRA 4XJUA 3VZOA 3QCWA 3U37A 3THDA 5FV3A 1IQAA 1FPN2 2IZWA 2XHKA 2GMEA 3AYCA 3WG1A 5KXBA 4HZFA 4GD4A 3MICA 3F2ZA 3RJRA 4YZ2A 1GQGA 3N3HA 4AEDA 1EV11 5CFDB 1WW4A 1OSGA 2BEOA 1K42A 1CVNA 2HWD1 1NY72 2RMU3 1GKBA 2RMU2 2VCAA 4KWUA 4XF1A 5T3NA 4CDUA 5DDJ3 3ZFEC 4QKBA 1FPN1 2WAAA 4BQWA 5GLTA 4L8QA 3VZMA 2YPDA 3J9SA 5FZOA 3GZTB 1MVQA 2ADDA 4XZUG 1XNTA 3OGSA 1WWYA 5FK7A 2WWJA 2IXJA 4P5YA 4ISQA 3DXUA 4L9BA 4XBNA 5FUPA 1QJY1 1WMFA 4AQTA 5BUVA 5DZEA 1RTVA 3DYPA 3MLJA 1C28A 2PXJA 3NQHA 4JTNA 3N9PA 5IK4A 1QQP1 3LD8A 1VBA2 5FYCA 3WF4A 3UGHA 1XXNA 4PLOA 3BTAA 3MIBA 1SLLA 3PVOA 1LULA 1NKGA 2RS12 3MFCA 4KI5M 5D8AA 1PX4A 3BIEA 2QFEA 2WO3A 1OHFA 2DU1A 4OFGA 2W2IA 1ZRFA 2RG4A 2VZTA 2DUOA 3IDBB 4E4DX 3B3QE 1JOBA 4GWMA 1W05A 3WDYA 1VBA1 3ZX7A 4CVUA 2D98A 3A23A 1YHFA 1DGLA 2G9ZA 2BRTA 2OYZA 5FP9A 1NCRB 3W5NA 4QB6A 4RL7A 4D7YA 4AE2A 5FZCA 1AX1A 1IS5A 2WS92 3C8XA 3WUCA 3ZFGB 2QCSB 4RR3C 3W59A 4OZOA 3WSOA 1PHMA 3BN6A 3FZ3A 3IZOA 3FC0A 4HXCA 4FTSA 4D69A 4Q0QA 2E32A 2N7GA 2XLFA 2RS31 1JOJA 4P9YA 4IEUA 4B7KA 3IIAA 5C7GA 4HONA 3TN93 5FBZA 2BERA 5L36A 3JBG1 5HI0A 4ZHNA 4QKDA 1QMJA 1WMXA 1RUF3 3A0NA 1UY1A 1RXFA 3OD4A 4M3CA 5I0UA 5LRRA 4B4PA 4CU7A 1MZ5A 1GUIA 3WDXA 5CU1A 3A4UA 1LHNA 2WZR2 3Q8CA 1O8PA 1DIWA 1LU1A 4D7SA 1HXS1 1COV2 1UZYA 2YBPA 2JECA 1Q3EA 1KJLA 1W6OB 2ZCWA 5JR2A 2NPIA 3H7JA 2YFUA 3ACFA 5JSOA 1I3HA 2I07B 2WNUA 3I2DA 5E1RA 3O1RA 3PL0A 4B7EA 2VOVA 2DF7A 2JDUA 1OD3A 2D44A 4LK6A 5CNAA 4ZXKA 1PK6A 4QPGA 2BGCA 2V73A 3KVBA 1NCQB 2FCVA 3KT1A 4YW4A 5FZGA 5IHRA 3S5AA 4FTEA 3WINE 1UYYA 4ASLA 2MEV2 3GF6A 3A7QA 4JDMA 1J58A 2WN2A 2H6BA 1NYWA 3MZHA 1QJY2 1UL9A 1DZRA 2NLRA 4MGKE 3N35A 2C9AA 5A6YA 1AR72 1W8UA 1X36A 1WCSA 1UOBA 2J1TA 5DZGA 5JCTA 4XFBA 2X5IA 3VDCA 3JD72 1S4CA 1IKPA 2ZGRA 3WG2A 4BXSV 2P3IA 1L7LA 1NZCA 2Z69A 5T50A 4P02B 1CAXB 3R4DB 1AF9A 1ND3B 1H4HA 3D5OA 1EV13 4QU2A 1HRI1 1XNDA 1FT9A 5F8PA 5GZGA 2GN3A 3POGA 2FMYA 4HETA 1JHJA 3DEMA 3HQRA 4LHLA 4BK5A 5KC6A 3SHRA 2EIEA 3S57A 4BU2A 4QX5A 1ZBE1 1JN2P 2DBIA 4GQ7A 3M70A 2SBAA 3O5SA 3TEWA 3THTA 4QHOA 4NRQA 4BK4A 1DQ6A 2GC3A 3HIFA 5FZ4A 4JHTA 2JG9B 4U2AA 1AXYA 1ND3C 4UF0B 4CCDA 5IVJA 4YM0A 2A6XA 1YI9A 1BBT2 3DL3A 3P1IA 3U78A 4AI0A 4DXSA 1RMU3 2Y34A 5EZWA 4E9KA 2ZEWA 3H3LA 2CGNA 4YZ4A 1LODA 5CADA 5HCFA 3LIGA 5ABJB 2G9FA 2V4AA 1AR92 2VMGA 1SHWB 3OGRA 5E88A 1F5JA 4Y1UA 3V0AA 4LO4B 3CU7A 3NV2A 1LAJA 1SBDA 2ERFA 1R081 4TLGA 3KSCA 4UBGA 4LLOA 4XUQA 1PGW2 1ASJ1 3AJZA 2P6CA 4QXKA 1OF4A 3K77A 2VZQA 1NCQC 5IVVA 1HQLA 3P5BA 3KT4A 4UI9L 3LA2A 1NCRA 1ACCA 3KV4A 4XMIA 3BOWA 2B8MA 4GULA 3LE0A 3M3IA 1IOAA 3SISA 3HN1A 1VP6A 1W8FA 4IEVA 4XFIA 4XHBA 2FMDA 3JD73 3POWA 4XF9A 3KS7A 5FYVA 4AGRA 5CISA 3OF1A 3H8UA 2D93A 2JIGA 3BYWA 3Q8BA 5FY9A 3CZUA 1XE0A 5DAXA 2HWE3 2YZ4A 3I59A 1R1A3 4LO8A 1AR83 2DCYA 4Q27A 2FDFA 3FJSA 1OLME 5F3IA 5FUIA 5LA0A 1ULDA 3TN92 2Q1ZB 1VB4A 2HWF1 3WG3A 5AVPA 3HBKA 4LKFA 4IV1A 2XQXA 4QQHA 2HEWF 4N43A 5LZ6A 4FPEA 5IAXA 4FOYA 3MIHA 4WZFA 1NE4A 4N9HA 4QD2A 4QAWA 3UT0A 4N53A 2ATFA 4Y5Z0 5JI7A 5IWFA 2BBVA 3ILRA 3J26N 3H9AA 3CDZB 4YGEA 3GBFA 4Y1VA 5LA9A 4EN8B 1RUG3 1C8M3 2JE9A 2Y26A 1H0BA 1HV1A 4YG0A 2HWB2 4W50A 3MIDA 2WA3A 3VD9A 3PUAA 4FTBA 3QACA 5FIXA 2CWMA 1OFNA 1DF0A 2FD8A 1CAWA 4CCOA 4EN6B 3HOBA 3T08A 2WSUA 1E5SA 3RMXA 2VTXA 4I0BA 1PVC2 4LE4A 1J3RA 1NA1C 3R05A 4UFIA 1L7RA 3T2TA 2ZZJA 2A75A 2K46A 4AHYA 4HANA 1HB1A 2F4PA 4NUBA 4DNYA 4ZXEA 1DQ1A 1I5ZA 2IXCA 3LPFA 1QXJA 1YCIA 3WNXA 5J1XA 2ZGQA 4LLFA 3KHCA 2VULA 2GP3A 3WDVA 1DYPA 4BOWA 1OA4A 1SLBA 3VBUC 2HYXA 3ZKYA 1XYOA 4PQ9A 2XL9A 4KNCA 2WZPP 4A3XA 4DRRA 3N9OA 4WVWA 1JOPA 1GP4A 1JTZX 2X5IB 4ET7A 4DFSA 4HVRA 2ZGKA 4XFAA 3SITA 1J3PA 1AR91 4U36A 3WOGA 4MV2A 4JGYB 1H8VA 3TEYA 4LPLA 1HX6A 4XJ9A 1YFUA 3ZFEA 1VRH1 2C0ZA 2DV9A 3O0XA 3ZN6B 1XE8A 2HEYF 1BEV1 1S0DA 4C90A 3D0JA 3KQ4B 2DUPA 2P1BA 2VZUA 2XWBB 5FP8A 1LGCA 3KLSA 4AZZA 3T0AA 2PHWA 5J3UA 2CYFA 4UBHA 3LQCA 2E26A 2ZTNA 5GLZA 4E8DA 3VKNA 1YQ2A 4IGQA 4Q29A 4K20A 1RUE2 4Q8LA 5EWSA 5IUQA 5FO7B 3IMMA 5A3WA 2W95A 5FAXA 4B1MA 5BXXA 1VBD1 1V9U3 2DTWA 1J1LA 5T5LA 2RM22 4QGLA 3VBSA 3OGVA 1GFF2 5AFEA 1NY71 1GZCA 4NIAA 2J7MA 4MX3A 2D6PA 1IGOA 3RQ0A 4LE3A 1EUUA 4Z92B 4KL1A 1LRHA 3VN4A 5EXOA 1XRUA 4JZRA 4OUSA 2QQIA 4M0HA 1O91A 1D2SA 3VD3A 1TME3 1TZOA 4ARYA 3J7NA 5A7QA 2QKDA 4LIUA 2BQPA 1HRV2 2R6QA 1VIWB 3PTRB 1SDDB 2XLGA 4BZ4A 2AYHA 1UIJA 1RHI3 1F4HA 4CDWA 4QT6A 4UW5A 1F2NA 2R041 1WUVA 4BPZA 2XKPA 5C4WA 2ZS6B 4AHWA 4EZ4A 3THCA 5FOJB 4UW6A 4LBOA 1EAH2 1AUYA 3ZYRA 5IVCA 2VUAA 2WS93 3QOPA 2TBVA 4IV3C 1MS0A 2CAUA 3S7EA 4E27A 4FAHA 4JHZA 2ZABA 1R091 5A32A 3T2QA 5E6HA 2ES3A 3C2UA 4XJWA 4A6SA 5C4WC 1Q8QA 3UV9A 3H8XA 5FYTA 5EJZB 1US3A 5EHDA 1ZBE3 3ILNA 1JBCA 1LESA 1YNAA 4W6XA 5FDBA 4C8DA 1GWMA 2XXZA 2YDEA 1UOGA 4HVOA 1PGW1 3LOBA 3RZZA 3OY8B 1MZ6A 3H1MA 3POFA 5HBAA 2JEMA 3SCHA 1DG6A 4WZCA 1O4ZA 3ZFFA 3LOIA 3VZKA 1JHNA 3MGUA 3FN9A 5FZLA 2VQTA 3AZZA 2RR12 1C8M2 1G9BA 1APNA 5F2SA 1QXPA 1OQEA 2WFPA 3RVHA 3VBFC 4RGGA 4FFFA 1A8MA 1RVF1 4AW7A 4QQ2A 2VQ0A 3Q8EA 1LECA 3MLKA 5JIUA 4AK3A 1ST8A 4CP0A 3WNMA 3HNYM 4EYUA 4QMAA 1OLRA 3FX3A 4QHBA 4YRDA 5FY5A 1JS9A 2CGOA 4CA9A 4YFZA 4WBBA 2WL1A 4Y26A 3N4MA 1W28A 3ASIA 1HQWA 4NIDA 4DMIA 4AR2A 1NQJA 3J7HA 4XJ8A 4M00A 3OD0A 1LHWA 4YW2A 1NXD1 1S1AA 4AFCA 4EJRA 1XC6A 1YUDA 2R071 4S2GA 3UETA 4COWA 1GOHA 3CZJA 3TRSB 1MQTC 4DXZA 3TNPB 2JWPA 2E31A 4MGQA 2RS32 5KXEA 4CP9B 4KGQA 2VM9A 4R9AA 1ZVFA 3NV1A 4NO4A 1AR81 3U4XA 4AGGA 3TOJA 1J1TA 3BU7A 5B2GB 4A44A 1C8NA 5FZMA 5JXIA 5LCWL 3ZFEB 1LTEA 3VBOB 4E2GA 2AUYA 1JU4A 2XVLA 4CDWB 2E51A 2EIGA 4JGYA 4LORA 2W08A 4FXKB 1CQ9A 3D0SA 1F31A 4K3UA 1PVC1 1HV0A 3N9LA 2ZHLA 4FI9A 4GJYA 1GICA 4OHWA 4Q0PA 5FYYA 1F35A 3VBHA 5LATA 4FPOB 4NVPA 1ZZ7A 1Z7S2 4B29A 4Z07A 1J3QA 3NV3A 1XNBA 4P9LA 2D3PA 4R52A 1PO23 4BQ4A 5FP4A 2ZBJA 5J96B 4ISRA 2A6VA 4BH9A 1J84A 2W0XA 3AYEA 2FBEA 2XMLA 3GXUA 2XH6A 4C91A 4LO7A 3IDAA 1IKQA 1VBD3 4FPYA 1JYWA 5FXZA 1UU6A 2RM21 4OMDA 5FZ9A 1ND3A 2WFF2 2LALA 4IDZA 4COYA 4F83A 3IPVB 4G4FA 1ZBE2 3E5XA 4LJHA 1TMF2 4MGYE 3ABZA 3T3YA 1GNHA 4QGNA 2PYTA 4UW4A 1UMZA 4A45A 2PQQA 3ZXGA 5FO8B 3CIHA 5T55A 1CAUA 2JXAA 4FFGA 4IV1C 2RR11 4B3NA 3E97A 3KV6A 2XG3A 2CV6A 5JXGA 1VMJA 2DCJA 1DP0A 1QY4A 3RRDA 2D6LX 4YVSC 2VNGA 3T1LA 2A6YA 2VW2A 1RJ7A 4MO3M 2X5IC 3LA7A 5C6CA 3NV4A 5LW9A 1GBGA 4H2AA 3GJBA 1B09A 5JI9A 1H2KA 1YC61 2F6BA 1W9TA 4OQ9A 4QPIB 3SH4A 3ES1A 3U11A 1R092 4N8MA 1DQ4A 2VJXA 5ERLA 4NAOA 1FNZA 2A73B 1YJLA 3DYOA 2GU9A 1FPN3 2TEPA 2BVBA 5F5QA 1WLWA 2Y6HA 2NZ9A 5JDBA 3ZPYA 1W9YA 1URXA 4BLIA 5LY2A 2GC2A 3RYKA 4NR1A 5LY1A 1AR63 5EJ1B 3GM8A 5H9QA 4B8EA 4OQ8A 4NN0A 4WM7C 5A7SA 4G9SB 4JX0A 4BLJA 3OEBA 1ZA4A 2BWCA 1EY2A 1D4M2 2RR13 2QTWB 5KWRA 2NP0A 2YBKA 2PLV2 1U5XA 3VDAA 5FXVA 3LEGA 4Y20A 3T1MA 1MS1A 1HN1A 2YROA 1W2AX 3KCCA 4JKKA 3RG0A 4XF4A 2PHTA 2VU9A 3ZYPA 1BBT3 3LDBA 2O1QA 4NMIA 5JSPA 3QD6A 4NWWA 1VBC3 3T0BA 1MVEA 1D4VB 1NLQA 2ORXA 3ZIXA 4Q1RA 2QQJA 1PMIA 4Y3OA 4D6SA 2DCZA 4Y1YA 2O8OA 1MS3A 3KWVA 2BGPA 4HKLA 1RIRA 5F1RA 3H0OA 1CZTA 5FLJA 1QJX1 2XR4A 1QGLA 2XJPA 4QX3A 5CYYA 5F3GA 2B5HA 5FZ0A 3OPTA 4I2OA 1JU3A 3CKHA 3ACLA 5D8AB 2PTMA 4C1WA 1YWKA 2LRPA 1GR3A 4Y4RA 3U0ZA 1ZREA 2AENA 2B7YA 5D21A 4CDUB 1QJZA 2D6MA 3ACHA 3MW4A 4RR3A 5T5PA 3U07A 3WP3A 1N1SA 3BI3A 5BNQA 1IPSA 4HL0A 2A3WA 4FP3A 4Q4Y2 2WZ8A 3U14A 1UZWA 4JGZB 5LWBA 1UKRA 1RVF2 1BHGA 4EZHA 3JCIA 4CEWC 1W8HA 4RS5A 2RV9A 4S2DA 4AQSA 5HCHA 1W6MA 2KXLA 2IVJA 4IL7A 3ZFFC 1U5IA 2W3JA 2JD9A 1OC1A 3E6BA 2K9ZA 4R8HA 1FMD3 2LW8A 4HKOA 1K5JA 1A6CA 2GN7A 1I5PA 1G9FA 4UYBA 4Y5SA 2WNUC 1PO22 5F6KA 4AI8A 2UWBA 3AMHA 1RUC2 2IFRA 3O1TA 1W2OA 1YFXA 3ROUA 5IVEA 3WNLA 3B69A 1X82A 1BEV3 1H8TA 1WCQA 3OTFA 4GALA 5FY7A 2ENRA 2RS11 2WZR1 3S5QA 3GDBA 2VBDA 3ZVXA 4YVWC 5I0SA 1UY4A 3C7FA 4OYUA 4YGDA 1VMFA 3MBWA 4XQ4A 4Q4V1 4K8RB 1V00A 4XFHA 2VZRA 2GNTA 1COV3 4AVCA 1KDKA 5JZGB 2OA2A 5F32A 1PNFA 5L9VA 3IWZA 3S7IA 1QJU2 4I3GA 2AH2A 2J1VA 3O1OA 1NZIA 3L2YA 1AL23 1GLHA 4TXWA 2W5FA 4IEOA 3ZXFA 1NG0A 2VGDA 4CDWC 4EN7B 4YSFA 5BNOB 1XYPA 1LHOA 1WLCA 3KHBA 3K2OA 4Y33A 1VBB3 2WNUB 4R9DA 4YZ3A 2X8KA 3AP6A 2VOXA 3W58A 4KGGA 1W6QB 2R1BA 4AYUA 3LFMA 1QXRA 5I0RA 1Q8OA 3I2GA 1CZSA 1BBT1 1SDWA 2WDBA 3AL6A 4DXTA 2PA7A 4OHVA 4E4SA 3PIGA 1V6NA 2ZGSA 4CP1A 3VBFA 2RJ2A 4LA2A 2X10A 1RJ8A 1VPHA 1GNYA 1S0BA 4QM9A 3ZYJB 1OA2A 2YB7A 2C6SA 1S0EA 1MS4A 3PTYA 1XB9A 3RZJA 1FOD2 2HWC2 4KH9A 5HXMA 4LBQA 3ZO0B 2QDNA 3AYDA 4J25A 4W4ZA 5A7NA 2C24A 4EE2A 5JOWA 4Y1XA 3RZHA 2VC9A 4CCJA 2CWSA 5D8AC 1W0OA 4AVTA 5JOYA 2ZA9A 3KZ4C 4QKFA 1FI2A 4FT8A 4PQQA 1IS3A 4TN7A 2G1MA 3T0DA 2NQYA 2WN3A 1F4AA 3JQXA 5LB6A 2P3KA 4XBQA 1AJKA 3RS6A 1N3QA 1DDLA 3UKVA 2DFCA 4OZXA 3WY6A 4CZSA 1Y3TA 1UOJA 3NAPB 4O65A 2HWD3 4OLLA 4YVWA 1JYIA 3B93A 3G6JB 2RMU1 5DPNA 1JZ5A 4XIOA 1H8TC 5CFCB 4ZPIA 1PIV2 5FZ7A 3EXUA 3PDQA 4Q0UA 3ZN4A 2F17A 4NIHA 1IHMA 3WNOA 5FR3A 4GJZA 3SMHA 3CBNA 2VTXJ 5DDJ2 3VHRA 3W5MA 5C4WB 1H30A 2MHFA 1RUC3 4MVTA 1RGSA 4AHXA 4AEDC 4JC1A 2Y6FA 5JVVA 2LS6A 4NPRA 4XXPA 5LEKA 5FPAA 5FPLA 5K8SA 4IV3B 4CE8A 5CKQA 2GNMA 2WT1A 5L73A 2LM3A 5F5CA 2NN8A 4RS5C 5FYZA 5E16A 1MZFA 5A1AA 3ILFA 4MGZE 4R4ZA 4GWNA 5DZFA 1BCXA 2EIDA 1AXZA 3IAPA 4OCTA 3VLBB 1Y43B 4AI1A 1WCDJ 1EYBA 5I8SA 3EYPA 2O14A 4FXGB 3WQ0A 3OBAA 3NJYA 2RS53 2D6KA 3I3BA 3ZXLA 5C8WA 3J7LA 3AFKA 1RHI1 4NHLA 4PBPA 4V2WA 1U0AA 3M3CA 2VTFA 3HBZA 2BW8A 5FYHA 1Q5OA 4D6QA 2UY8A 1YFWA 2QQVA 3AX4A 3D4KA 3PNAA 4IV1B 4CXYA 3ZOIA 3PVNA 3RZKA 3VKLA 4AVBA 4IW3A 4LBKA 4XABA 1U5ZA 2D3SA 5FRAA 4CP2A 1LOGA 2EAKA 2Q4SA 3M4FA 4LQRA 4XFGA 5FCCA 3NKTA 4AVSA 4PIXA 1HDKA 1JXNA 1SPPA 3T2PA 4RFT0 2WYSA 4QPIA 3DPRB 2D6OX 1LENA 3ZSJA 4WM7A 4XUTA 2JENA 4FPGA 1G86A 5DAWA 1WLDA 4AWDA 3TYJA 4NWVA 4CUGA 1V6MA 1YYNA 5CG9A 2WNVC 3MLLA 4AEKA 3IDCB 5JZGC 5KHKA 5IFTA 2AC1A 2RHPA 5FPVA 3E6DA 3O1UA 2MEV3 3VHPA 5A6XA 5FJHA 5KHHA 4EWDA 1SLIA 5A3PA 1B35A 2XDVA 3AXDA 2BNMA 3DXTA 2HWE1 1X8MA 5FWJA 3I8TA 1C1FA 3PUIA 5A3NA 3QH7A 2HKXA 1OLQA 2WC2A 5LA2A 1CPNA 4AXOA 5K9YA 3DGTA 4DB5A 3H3ZA 3VZNA 1C4RA 2QDRA 2O8QA 2HBUA 4DO0A 5KXCA 1O7FA 3FE5A 4FPHA 2HWB1 2VZ1A 3OUJA 3FFZA 2EXJA 2JDNA 4N43C 4Z82A 1EV12 5FMOL 1LOAA 1OBNA 1Q8PA 4A7ZA 2IFWA 2DVAA 1PM7A 4CEWB 1T2XA 1NLRA 1ZRIA 3MO4A 1XE7A 3H50A 3OYWB 3OUHA 2ETEA 4IE6A 3NL1A 2R062 1JW6A 2H0BA 3J8F1 5F3CA 4Q5OA 3IPVA 2V5DA 3N7MA 2W52A 4GB33 5T54A 4LBLA 3ZYFA 2A7AA 1K5MB 2B46X 3AKPA 3I54A 4S2HA 2ZX4A 5T52A 4I3PA 4L0PA 4A4AA 1RUH1 1LGBA 2JD4A 3V0BA 2VBBA 1BK1A 1X33A 2GZWA 2JDPA 4RD7A 4JQTA 5DG2A 1IPKA 1CJDA 3B01A 4HSLA 5JPMB 4I0WB 5A1FA 3HR9A 2EXIA 2VZVA 3H42B 3ITQA 4I30A 2ZGUA 1JMUB 4RS5B 4D6RA 4Q4V2 1PK6C 4QPGC 1PZ9A 5LASA 5BNPA 5C9AB 5JOZA 4CDQC 3BVCA 1X50A 2JDYA 4QX7A 2YYOA 3CLPA 4LULA 3WCSA 2CTVA 2LROA 3AVSA 3MF9A 4XAEA 5KBFA 1OOPB 2OX0A 4O61A 5L9BA 2OZ6A 4BCUA 1AX2A 4AF9A 5C3SA 4AHZA 3MHZA 1ZZ9A 2ZGNA 3AM2A 4Q1PA 2F4LA 2VZSA 2ZX3A 3FWEA 4X6RB 1H1IA 3WW1A 3ETPA 1JYTA 5FLHA 1VMHA 2UYAA 3AVRA 4Q4X1 2WQZC 3ACIA 1VR3A 3ZSMA 3EO6A 1D2QA 2PHUA 2D3RA 4M0NA 2YGLA 3LEIA 4IETA 1JZ7A 5DAVA 1AYM1 5CG8A 4YVSA 4IEXA 4JCKA 1QNYA 4M01A 4F3JA 3NNLA 5C3PA 3VKMA 4QX2A 2ZAAA 4L11A 2WYFA 1SCRA 3SEPA 5ABJC 3WG4A 3S30A 5SV5A 3E5QA 1RITA 4Q4X3 2A5ZA 2J42A 2QQWA 5H9SA 2XJSA 2NYYA 1I9RA 1Q8VA 4IQPA 4J1XA 1X9PA 5E8AA 2BV4A 5EFUA 3UGGA 1ZBA2 1KS4A 2AZ5A 2XLAA 3LPGA 2Y6JA 3EQEA 3RFRA 4CEYB 2BDRA 1Y7BA 5F7UA 2DTYA 5F3EA 3I4IA 4E2QA 1SLAA 3M3EA 3BKZA 1BMV1 3J7MA 2DBNA 1O8SA 1RUC1 2P6HA 3QLQA 4N7UA 5FY8A 3AP4A 3MV01 1EP0A 2GAUA 5CVRA 1F9KA 4UFHA 5CB7A 1VE0A 1DQ0A 1NUKA 2PHLA 3OPWA 4BM8A 2DVDA 4CCKA 1UU5A 1MS5A 2WA4A 2CY6A 4JAAA 5CKNA 3QBQA 2CGPA 1K12A 2HWC1 3P3PA 3OY8A 1HN0A 2GMPA 1Z0HA 3FUQA 3RYRA 4OHYA 4IEYA 3BPSA 1YQ8A 4QX0A 4RGKA 1GV9A 2AEZA 1DZQA 1PZ7A 3AP7A 4ZKTB 1HQNA 4BQ5A 5FZIA 1A34A 1UZ0A 4K6BA 2JG8B 2XONA 1RMU2 4Q4W1 1ULOA 4IE5A 2X09A 3TEXA 5L19A 4NOTA 1KFUL 2OS2A 2VH9A 3WZ1A 1G6NA 3LWCA 4K7JA 3PU3A 4QU1A 1EAH3 4BMBA 1VBE1 2C5DA 5G05L 3VL9A 1OMIA 3GJAA 1C5HA 1C57A 3AKQA 3C3VA 4CDUC 3K3OA 1CESA 4AOCA 3BTXA 1TG7A 4LNVA 5FZOB 3R4SA 4HN1A 1LJ7A 1DYKA 4Z2WA 4BQYA 5E89A 3MUY1 2UYBA 3IKWA 2R063 2P3YA 5IATA 5C3OA 4J1WA 1UQXA 3GHMA 4JV4A 1QJU1 4AAPA 1FAYA 1SCSA 3MIGA 4YPJA 2Z2SB 1POQA 1BEV2 1ALYA 4GKXA 2HWC3 1MQTB 4GAZA 1V9U2 2YG0A 3WQBA 5FXWA 2JE7A 3U4SA 1W6NB 1RUD3 4XYXA 3CHXA 1UNBA 4MADA 2A3YA 4DEVA 5C8CA 1N1TA 2WFF3 1UZZA 1RUNA 1TQ5A 2XB6C 5A7OA 3HJRA 2FDJA 3LAGA 3LF7A 4Q26A 4XBLA 4PF1A 4RHV2 3UL2A 4LUKA 1PO13 1V6KA 1S0CA 1R082 2IC1A 3FHIB 5A3OA 3ZFGC 4NHKA 1V6JA 1RUD2 5LRSA 2WZR3 1STMA 1NX9A 5A7WA 1N1VA 1PMHX 2ZMKA 1UU4A 1JODA 4AI9A 4HN0A 1QOSA 1YEWA 3GGLA 3DV8A 3OEAA 5FZEA 4HSJA 4E4ZA 1T6GC 4IV3A 4LMFA 2BNNA 1BLZA 1QDOA 4FFIA 4YG3A 3KVAA 1GOGA 4YM3A 1TNFA 3WP5A 4GH4A 3FL7A 4XILA 5HXVA 1SFNA 1QH6A 3VBUA 3C7HA 3ZXDA 1O3RA 1R1A2 1SFPA 5FMCA 5I0TA 1PO21 3UK9A 2OKXA 1DYOA 2D43A 2O0OA 1ZM1A 1IPJA 3QH6A 3BGAA 4WM8B 4CUBA 5JXHA 4R9CA 4O7XA 1AX0A 1NA1A 1TMF1 4HK9A 1ZA7A 1W90A 3PVBB 1KEXA 1PO12 1G8WA 1BZWA 4AEJA 2ADEA 3MI8A 1O4TA 5T5OA 4BQ2A 2Z4FA 3NSTA 2BOIA 1RUI3 1FV2A 4XF0A 1YFYA 5ACA1 2FDHA 4GMP1 4XUNA 1X8EA 2Q1MA 5HV4A 5A3MA 1N3PA 4LK7A 4META 5H9PA 1BJQA 1NT0A 2ZMNA 1UW8A 1E5HA 3MPPG 5JSRA 2VQAA 5LBFA 2OQ7A 4L2NA 1QJX2 2GSYA 1LU2A 5LBEA 1G9CA 2BUKA 3HN3A 2I2SA 4NRPA 3MIEA 5AC93 2VW0A 3LDRA 1AHSA 2RDSA 1CIYA 2BU9A 2VZPA 3Q8AA 4D3WA 2Y8KA 2R1DA 3MUZ1 1W6OA 3GCXA 4PDWB 3VBRA 3WLUA 2HBTA 1AXKA 2FQPA 1AYM3 1A8DA 3EB7A 3ST7A 2FZ2A 5FZBA 5A7PA 4LBMA 4PCRA 1W8OA 4IEWA 5FKCA 1WZXA 1JZ2A 4GMP0 4PLMA 4FVVA 4NROA 3CJIB 3V0BB 3MW2A 2VUJA 5CEHA 2AR6A 4K1YA 4BQ1A 5CKMA 4Z2AA 1ZX5A 5EPAA 1D4M3 3Q9OA 2XJTA 4JGZC 3R4UA 1XOYA 5D2AA 4FSJA 2D5HA 2FCUA 4TZDA 5KHJA 2VVFA 2WNEA 3CEWA 4CEWA 4XW3A 3FBYA 2BZDA 5C8CB 3I2IA 2WS91 1VBD2 4I02A 1YQ5A 3LIHA 3SH5A 3JB8A 5F9TA 4RSUA 4UXAA 4Z8BA 3DKWA 1OT5A 5DQ0A 5DUVA 1LOFA 4M3CF 4BYYA 2QQKA 3GBGA 2WIIB 4ZU7A 1LNSA 4HPKA 1W9SA 2YHJA 3OYWA 1JH5A 2PHXA 4O9GA 5A33B 3ZYGA 2A1XA 4JRLA 1ULCA 5FYIA 2ZHNA 3C7EA 4EV0A 4FBFA 2QVSB 4KWLA 2ZACA 4P5HA 2Q8CA 1L3JA 2W39A 2VZ3A 4I09A 4K21A 1VRH3 3ME2A 4ITCA 4XDOA 3WF0A 4DXRA 4YWAA 3L9JT 3I3DA 5HV0A 3NNJA 1FX5A 2ZAHA 1IS4A 3N9QA 5C3QA 2B45X 3B9CA 2BYVE 3JUUA 1TMF3 5EYYA 2VMDA 2HYKA 4NPLA 4C0BA 5J37A 1W39A 3I2KA 4Y5TA 1OOPC 4XDPA 1TVGA 2X05A 1ASJ2 4IESA 4QDRA 5CIRA 4CEYA 3K4ZA 1HRI2 1PIV1 1NCRC 2WBKA 1PVC3 3PUSA 1EPZA 3POIA 3U75A 1BMV2 1AL0G 1DQ2A 2YC4A 3NO8A 2QZ2A 4P00B 1J59A 5FUNA 5HPOA 1Y9MA 3K4AA 3W9AA 2ZHKA 4XE9A 1H2MA 2VUCA 1R1ZA 3WW3A 5J09A 1S0IA 5L9RA 2VMFA 3HAGA 2VECA 1TE1B 4HOOA 5CFDA 2RE9A 4F8AA 2P2KA 3SKJE 4CP9A 3RZGA 4Z1VA 4AFMA 1NLSA 3IDEA 3AB0A 1K5MA 2JDKA 4YYOA 4A6OA 1US2A 2MPFA 2ZZQA 2CNAA 4PLNA 3I3EA 5FPZA 1S0JA 3AL5A 4LO5B 5A70A 4JDOA 1OXCA 4K8FA 1D7PM 1HKDA 5C70A 1XNAA 3BODA 4LHSA 4ASKA 2WUHA 2C26A 5BNPB 5FLIA 3K46A 1AYN1 4OI1A 3ECQA 2DVFA 2I45A 5EQUA 1QDCA 2B4KA 1HRI3 2H0VA 4LA3A 4QB2A 5FMOS 4CDXA 4Q8KA 2QQNA 4DOUA 5TSWA 2JJ6A 5A1LA 3W20A 3KV5A 1ZBA3 5JR7B 5C5UA 2R7EB 2B9UA 5D1IA 4PIYA 3OCPA 3UGFA 4A42A 2Y6LA 3WD5A 4BDVB 1UX7A 3DCQA 4Y4YA 4MGTA 1ENXA 3EJKA 3TEZA 4CYDA 3O1MA 5FP7A 4EWAA 5IVYA 3Q8FA 1HB3A 3ZDSA 3GCWA 4JTOA 2QQOA 1VALA 1L7QA 2RS33 4YGCA 2VQUA 2VVEA 3HQUA 1RUOA 3J8F3 1NOVA 1OVSA 4PJYA 2D97A 1RINA 4BIOA 1HIXA 1QHDA 2G4IA 2YMZA 4XAAA 4OHZA 3HNMA 3MF6A 1GYKA 3UKTA 2BPA2 1W6PB 3HPNA 1SACA 1JZ6A 1WW6A 1UYXA 4A7YA 2QQMA 1W3XA 3H8RA 1ZZ6A 5CFCA 3I3MA 4ZZ8A 5DABA 3WVJA 2VXJA 4YARA 1XBFA 3CF6E 1OH4A 3VZLA 5FZ1A 3RSJA 1CAUB 2WRAA 3VBOC 4MOAA 3O1PA 3VBHC 2P3JA 1FOD3 3NJXA 1E57A 2PHRA 4XURA 3VBSB 3IAQA 4AVVA 4Q4Y3 1C3HA 3VKFC 3SC7X 1POV1 1CX1A 1RVF3 1LKNA 4H7LA 4HMZA 1D0GA 2L9LA 4AQ6A 3GHNA 4W6WA 5FYMA 1IQDC 2NM1A 3ETQA 1KRIA 1RUI1 3D8CA 3O14A 2Y0OA 5FY1A 1S0GA 2VMIA 1ENQA 3GALA 4O9EA 3VGIA 2OPWA 1LHUA 2Z42A 4WM8C 4ES8A 1UYPA 2XBO1 4ZONA 3WX5A 3JB4C 3JBG3 1MQTA 4YLZA 4XTPA 2JIJA 4IGPA 1UYZA 4M4PA 3OJBA 3ZYHA 4AVAA 2TNFA 1HB2A 2WKKA 1W0NA 1FV3A 4MXVA 2E6VA 1ND2B 1C5IA 2OXBA 2XJVA 4KMQA 1YRZA 2CL2A 2X29A 2YU1A 3RMYA 2JDHA 4P9GA 3CMGA 4LR4A 4EN9B 2VMCA 4Q0VA 2JB8A 2EVXA 4CDQB 1NAEA 5FOBB 2JICA 3H1WA 1ZRRA 3U1XA 1O5LA 1VBE2 3S6PA 4KU8A 4W6YA 4NHXA 3ZXAC 3O1SA 1W99A 1ZNPA 5FY4A 4I0AA 4AG4A 1VBB1 2ET1A 4M3CB 1VAKA 4CCEA 1WW5A 2Y6GA 2HEVF 5IT6A 1H4GA 4B4QA 4GB31 1EPWA 2R072 1PO11 3ORJA 3H8OA 3DN7A 1V6OA 3WF1A 1DGRA 5I93A 2E9QA 1ODMA 1AR73 2ZEYA 2PMWB 5EV7A 3N7LA 5GLWA 1MS8A 4Y1ZA 2AEYA 5FPBA 1CIWA 1YIPA 3LGRA 4Q2FA 1EAH1 3H1YA 4XEZA 2ZOEB 2WT2A 5FZDA 5JXJA 5G04L 2VMHA 1KS5A 2D6NA 4CCNA 1YIFA 3B00A 1LOCA 4NE9A 2W87A 1YQ6A 2VOKA 3I3QA 2FDIA 2OQ6A 3J8F2 4Q4Y1 3BTYA 3BU0A 1GZ9A 3VZJA 1WW7A 4OVEA 1QJU3 2EALA 2HWD2 3POSA 2VOTA 1ULFA 4BB3A 4X8NA 1NQDA 2ZEXA 2ZXQA 2E33A 1ND2C 2A6ZA 1CZVA 1GQHA 2J1AA 4P9JA 3WT3A 1IS6A 4FAGA 3B5LB 3RJ2X 4MZUA 5A3UA 4MSVA 5AFBA 4QX1A 1W03A 2OUHA 2BP6A 4XUOA 2DVBA 3NVCA 3WR0A 2ZKLA 1DFQA 1W2UA 2DURA 1QQP3 3LKJA 4D7TA 5F5IA 2BJSA 3HT1A 3ZMNA 4IUGA 2HWF2 5HCAA 4QKNA 2RVAA 5FP3A 1UY3A 4RFRB 4BISA 3H3UA 1DLCA 2W1QA 1HW5A 3O7OA 1R1A1 2B42B 1GZTA 3ATGA 3EHKA 4PI0A 4S2FA 4GA9A 2QE3A 4FCAA 4TLFA 5FZ8A 5I0DA 1QOOA 5A6ZA 4QDSA 3I2JA 1BK0A 1HXS3 1HLCA 1W04A 3GNEA 3VBSC 2BBAA 3L2HA 4P9XA 5K4LA 2WT0A 1Z7S3 1TME1 3GZEA 4MUVA 5BNOC 3PUQA 2ARXA 4OUMA 2AREA 2ZX0A 4JRAA 2D40A 4YW3A 3ZKUA 1ODNA 2ZX2A 1XSQA 5FXXA 2YGMA 4L99A 4EWEA 1AR62 4OUEA 2Z5WA 4UOJA 2W9XA 1VBB2 1LHVA 2VD7A 3E5UA 1PM4A 2ARAA 3LCPA 3R0RA 5BNNC 2RDRA 5C9AA 3P3NA 3OBRA 5JUVA 5L7OA 3VD7A 3TN91 3USSA 3K51A 5JPNB 2Q8EA 4RQPB 4GKYA 4DPNA 1UOFA 5IK5A 3GZUC 4QXCA 4URAA 3VD4A 4GB32 3UESA 2CDPA 3AXEA 3HWJA 4Y24A 2JDAA 2BFUL 4PIZA 5J7MA 2R30A 2W68A 3ZLIA 4LHNA 4IXLA 4JKLA 3JBG2 1GNZA 5A3LA 3PJQA 2B39A 2Z79A 1I1EA 2YU2A 4LEJA 4YW7A 3N7JA 3FBMA 2QQLA 4LBQB 3RI8A 5GLVA 1AR82 1OF3A 3AZYA 1PVXA 2XOMA 3WHTA 5HCBA 5FK8A 3C7GA 5A33A 2DDUA 1MZEA 2Y64A 4NJ4A 4HG6B 1UWWA 3VKOA 5JIAA 1WA4A 3AFGA 4V2VA 1RUE1 3OOXA 1KGYA 1XNKA 4HPKB 2KD7A 4HVQA 2J1EA 1REDA 1TME2 2W94A 2DYCA 4QQPA 2YBSA 4UFLA 4YM1A 1JYNA 3ZYBA 3CJIA 3HD8B 3LFIA 4P9IA 4IE0A 2W47A 3AYAA 1H9PA 2JE8A 2YPJA 2RS51 4XXAA 3TAYA 3TWIA 1PK6B 1WBLA 4QPGB 4FPJA 5C9AC 2PLV1 4FPLA 3VBFB 3S0MA 1Z7S1 2VPVA 1LCLA 4N53C 2NMOA 3ZSLA 1S55A 3I2OA 3JXSA 1SBFA 3ZIWA 2GC0A 4FPKA 5FMDA 5IW0A 2G9GA 5EYXA 3LEKA 2ORZA 3DECA 5GZDA 1RYYA 4CU8A 1XNCA 5FJKA 3PUHA 3RI9A 2Q1FA 3M3QA 1YO8A 3OBTA 5C8CC 1SMVA 3NNFA 1SG3A 1Q8SA 2ZGMA 1PGSA 2SLIA 4UFMA 4BWOA 2YY1A 1R093 1UXZA 1SPPB 4L92A 2XBO3 3BIWE 4WVMA 5K0UA 1JZ8A 1O3SA 1YJKA 3APBA 1ONAA 1ENSA 1N47A 4UFJA 5H9RA 3V64A 1F5FA 5IJRA 5FYBA 5BV6A 3CNAA 4HFSA 5GZFA 4SLIA 1K45A 1A3KA 4RR3B 3BUCA 3KT7A 4DRVA 3FMGA 1XJAA 3IB3A 1SLTA 1BVVA 2W1SA 2OVUA 3VDBA 1HJFA 3RZMA 1VAMA 2H6CA 3MPBA 4ZY9A 5CA6A 1NCQA 1FOD1 2BVVA 1W2TA 3MDPA 3AC0A 3ACGA 4V1PA 3T2OA 1O3QA 1UY2A 3HVDA 1GOFA 3OSDA 4RQPA 5DXDA 2EXKA 3W21A 1HRV1 2VUDA 2XBO2 5C3RA 2WWUA 3WHUA 2GC1A 4EROA 4FOQA 3HQXA 3ZMOA 2PN5A 2ET7A 1LGNA 5FY0A 1IG0A 3SKVA 5J36A 1AYN3 1RUH2 1VBC1 3O12A 5IVBA 3PIJA 1VRH2 5GKAC 2GP5A 3SCFA 3AZVA 1G7YA 4PHZA 1UPIA 1W8WA 2PAMA 1SQ4A 1W6MB 4K40A 4LKSA 2WQ8A 1W8ZA 4LOTA 4QHZA 4DINB 1AVBA 5FREA 5A7WB 1RUE3 4IEQA 4NRMA 3DPRA 4Y22A 3WW2A 3M2MA 2HJIA 2WNVB 1OQDA 4LTAA 5F5AA 2R49A 3KCYA 1KD7A 2RS13 3VDDA 3WNKA 1LB2A 2VNVA 1N1YA 4D0QA 2DU0A 3FHQA 2A71A 2K0GA 3ZXKA 5C33A 4EN0A 5JOXA 2GH2A 3AMPA 4Q4W2 1GANA 4XUPA 4MH0E 2BWAA 1E5IA 3IT8A 5B4XA 4IEZA 1SFYA 2J1RA 1CONA 1CAVA 3IMNA 4OI0A 1GWLA 4UF0A 3B02A 4AI3A 4LUMA 1XQNA 1MPXA 2BOJA 1RUF2 1IZ3A 3AJYA 4FFHA 2Y6KA 4MG2A 3KM5A 1W3VA 1QWRA 3DYMA 3I97A 5ANQA 1O4YA 4QXBA 4FO9A 3B94A 4SBVA 4OI4A 3V65A 3RGBA 3GZAA 3JQWA 4XDQA 1W06A 2WFF1 3IM0A 4FQZA 4XFCA 4CDXB 4AI2A 3V0AB 3PU8A 5FYUA 5GZCA 1W6QA 1KFXL 1YLLA 2WO7A 2Y38A 2VMEA 1RUF1 3WF3A 1SEFA 5ABJA 4MYEA 3I7DA 3OB8A 5FZHA 4XOGA 3LZZA 1AR61 1UXXX 1JYCA 3ENRA 1OPMA 4ZS3A 3VBUB 1UY0A 2VZOA 1M06G 3T30A 2XKOA 2VW1A 3CQOA 2NMNA 3IBMA 5GJ6A 5FZKA 1GP5A 1GP6A 1DLLA 2PHDA 2Y0IA 2AGSA 4WVMB 1MR5A 1PMJX 1T6BX 5K0UB 1JUIA 1QJX3 4NAMA 3O0WA 3POJA 3KV9A 5A32B 5DUXA 4MHUA 1NA1B 2BFUS 3B7MA 4W65A 2VY0A 1AL21 3HNBM 4K9SA 2R0FA 3MFAA 1DHKB 4KWJA 3RNSA 2R073 2ID4A 2JG9A 4XQWA 5EP9A 4QX8A 4AEDB 4HKWA 1GMMA 1LOEA 3UKNA 4CUAA 5F6LB 4Q4V3 4CDQA 2UY9A 3WDTA 2JX9A 3NAPA 5FKBA 1UKGA 2D7FA 1KITA 1OQ1A 2ILMA 3SH3A 5I8YA 1I6XA 1KDMA 2VVDA 4J6GA 4JKMA 2EICA 4KG8A 3WCRA 3ES4A 3CO2A 3ZM8A 5FO9B 1BQPA 4ORFA 2IXKA 3MW3A 3TB0A 5IK8A 3POEA 1WCKA 4GMP3 1POV0 4N53B 3MYXA 4FPCA 3JZVA 5FZ6A 1FYUA 3WEZA 2E7TA 5JAXA 5K0UC 1WCUA 3MV11 4CPBD 1YI7A 2WJSA 1OUSA 4W8JA 4A7KA 1V0AA 2YUEA 2J1UA 2V72A 4C1XA 5KHGA 2YV8A 2BNOA 2RS52 2EXHA 2HLEA 3EMRA 4X8PA 5FTTC 5BPXA 5K7PA 1RUD1 4F7ZA 5JMCA 4YFWA 1CAVB 1Y4WA 4D94A 1AZDA 1FNYA 4EQVA 4YVSB 3VB9A 4COVA 1FXZA 1S2BA 2XGXA 2OIIA 2DFBA 1RUJ3 1HRV3 3FHAA 1O59A 4BQ3A 1OKQA 1UD1A 4FQ4A 5DAQA 4LBJA 4RHV3 1YXWA 3RDIA 5FPUA 4QXHA 1QOTA 1R083 4MHRA 3CJIC 4IERA 4QQOA 1G9DA 4WVVA 2CSGA 4HK8A 1RUI2 5I91A 1CX4A 5KC5A 5L7OB 1POV3 1VAVA 3DKQA 4HBNA 2A3XA 5APAA 2VBPA 4OMCA 2XPJA 4N7IA 4LITA 2PFWA 5FPXA 4ASMB 5CFDC 3CJXA 1O6UA 1WD3A 1LEMA 1WGPA 4CUCA 1FMD1 4RQPC 2CHHA 4XCBA 2WAOA 1K3IA 3PLQA 4K1ZA 4YNIA 5IAVA 4RGAA 2IVIB 2CDOA 1XU1A 3SLIA 1VB2A 2LTNA 5FWEA 1C8M1 1UMIA 4CEYC 2GH8A 2JG8C 3NW4A 4M3CE 3KCXA 1PNGA 5CBLA 3HEIA 4XMAA 3N9NA 2JDMA 3RWKX 2X53S 2Q8DA 1QJY3 2OT7A 1MS9A 3N7KA 3VBRC 4Q0SA 2E7AA 3OGJA 3AKSA 3OG2A 5I8TA 2VR4A 3J4UH 4Y20B 4FOWA 3H7YA 1MEC2 3AKRA 1ZBA1 5L7OC 2Q5TA 2MEV1 3KMHA 1PX3A 4DUVA 4LBNA 3WDWA 1GZWA 2QQUA 2C9KA 1ZYBA 2K2SA 3ZFFB 2VCCA 1GQPA 2OUJA 4COZA 4XZPA 3MIFA 1AJOA 2JKXA 3AZWA 4YZ1A 5FZFA 5ISLA 2I74A 2OW4A 1RC6A 3POBA 4NHMA 4XQDA 4DQAA 1QJFA 2FCTA 3FFQA 3K3NA 1QJEA 1AR93 5J48A 3G7DA 2HWB3 4GIQA 4QGMA 1MEC3 1SBEA 5DUUA 4GH4B 4ATEA 1UPSA 3VL8A 3MEPA 2Q30A 3LSDA 3NMBA 3PURA 2Y60A 4XCAA 3GYDA 1ASJ3 2YC2A 3USUB 3LA3A 1F15A 2RJKA 5C5TA 2EA7A 3NRUA 3AK0A 2KM2A 3C7OA 1CR7A 1W8NA 4NIIA 2JG8A 4QB1A 1ZRCA 2FHRA 3SCGA 1JZ4A 4INDA 1QIQA 4LIVA 2LUWA 1VRBA 4YW1A 4B4RA 4QQLA 4DY5A 1WA6X 1UCXA 5LEJA 2DCKA 4XPVA 4ONUA 3D3AA 4QM8A 2PHFA 2W91A 5LBCA 2YC0A 5SV8A 1B35B 4B1LA 2Q8OA 2ZKNA 3KGZA 3M3OA 3SNMA 4ZU4A 3WQ7A 2VNOA 4WV8A 1AYM2 4XIKA 3R6SA 3FUOA 2HWE2 4YGBA 2FZ1A 3NKGA 5KR7A 2EAAA 2EF6A 1EUTA 5BYNA 1OVPA 3NJVA 1ZZBA 4PF5A 1PGL1 3LSEA 2VO5A 5F37A 2XWJB 1CPMA 1ZZCA 1LOBA 3AP5A 4KWKA 3SEEA 1GU3A 4XTMA 3PVEA 2XUEA 1FMD2 1W6NA 2JKBA 5LBBA 2R061 1H2LA 4MGIE 3VV1A 3D82A 1RUJ2 3FLRA 1RUG2 2XVGA 4MGSA 3ZXJA 2WO2A 4XETA 1H2NA 2XJRA 5FZ3A 4ZS2A 5BNOA 2KR2A 3LDKA 1M4WA 4DZGA 1YQCA 4FPFA 3AMQA 1HB4A 5DN2A 2WNOA 3BCWA 4XC9A 3SXWA 1KXGA 4QPWA 5GM0A 4GWJA 4BE3A 1QEXA 4CXWA 1J83A 3T4VA 3O1VA 3I2HA 1HJGA 2W1WA 1OUXA 2CU5A 2PAEA 4LXLA 3UYJA 3ZR6A 4N90A 5IYYA 2IXHA 4CCCA 1VBC2 1FATA 2VG9A 2VOWA 2VCBA 4N43B 5C71A 3A22A 3BB6A 1AL22 1W9WA 3F95A 1RHI2 5DAPA 2FDGA 3KF3A 4XJAA 1XPWA 2IXLA 2G19A 4R9BA 4GWIA 4LHKA 1Y9GA 1D0HA 1QF3A 1TNRA 3VBHB 3VHOA 2RJLA 4BQXA 4H55A 5AC92 4URTA 5KXDA 5EIYB 5DG1A 2DVGA 2Y33A 3RPQA 1UAIA 2B9VA 4WM8A 4PDWC 3E1F1 3USUA 1LEDA 2JG9C 1CN1A 1E5RA 1O5UA 2QUOA 1UMHA 2RM23 4XJZA 5JLVA 1A78A 4G3YC 2C1FA 3AP9A 3VDDB 4DUWA 4CU9A 3KD4A 5ANNA 4AEMA 3EBRA 3JU9A 2QNKA 3E6CC 4XF3A 4ZU5A 5LK5A 4NIGA 3OGGA 3ZFGA 3BOPA 1Z78A 2YXSA 3AKTA 3NWKA 4YVWB 3VBOA 4AL9A 3VD5A 2GNBA 2XJQA 5GALA 3I49A 3INAA 5F39A 1JYXA 3OPZA 5AVAA 2A70A 2QJVA 4IGOA 1GZWB 4YW5A 2GDFA 3UJQA 5JMOA 1RL3A 2R0HA 3T4HB 2KA3A 2XUMA 1NE6A 2WSVA 1P8JA 4H7MA 4OULA 2WABA 3IIIA 1CAWB 3ZXEA 1G9AA 1CJPA 2VE1A 3V56A 4AFDA 5IVFA 3D6EA 3WW4A 4R4XA 1F8VA 2WWSA 3NJZA 1DCSA 1AR71 4QWNA 1WLTA 4KQ7A 1V6IA 1RUG1 3OUIA 4L97A 4XACA 4JVAA 5FZAA 1UN1A 4CU6A 2ARBA 4LOSA 3DF0A 4GZ9A 3KF5A 1DQ5A 3WF2A 2P37A 3CL1A 1OLMA 2WZEA 4KBZA 2ZX1A 3ZR5A 1W9FA 2UWCA 2XHNA 4Q4W3 1S0FA 3AMMA 3NAPC 3WXPA 1JYVA 3GBWA 1H6XA 3WV6A 3TNQA 1OD5A 4GXLA 4OHXA 1UX6A 4AAXA 3T09A 1S2KA 3ZDVA 2GNDA 1W2NA 2C4XA 4I01A 2VL4A 5A6QA 3WQ1A 1K5MC 1WMEA 2DUQA 1MACA 2IUWA 4A2UA 4IEPA 4YG6A
chains in the Genus database with same CATH topology
2RDRA 4Y5SA 4JZRA 2RDQA 3DKQA 4NHKA 2A1XA 3NNMA 2OPWA 4NHLA 4XC9A 3KT4A 4NHYA 3OBZA 4ZONA 5HV0A 2JIJA 5DAVA 4XCBA 3NNJA 5IAVA 3NNLA 2JIGA 4IW3A 5DAXA 4XABA 5DAPA 5L9VA 4Y5TA 5M0TA 2G19A 4NHXA 4BQXA 3GJBA 2Y33A 5IAXA 5DAWA 5L9RA 4UWDA 5LA9A 5ERLA 4NAOA 4MHUA 5HV4A 3MGUA 4NHMA 3PL0A 2FCTA 5EP9A 3KT1A 2FCVA 5LBFA 4J25A 4XCAA 5LBEA 5EQUA 5C5TA 2HBUA 3NNFA 2RDSA 2G1MA 3OUJA 4NMIA 5LB6A 3W20A 5C5UA 5A3UA 2HBTA 3GJAA 3OUHA 3OUIA 4XACA 3KT7A 4BQWA 5LBCA 4Q5OA 4ZPIA 4BQYA 3HQUA 3HQRA 2RDNA 4KBZA 5IATA 4XAAA 3W21A 3EMRA 5EPAA 3ITQA 2FCUA 3GZEA 5LASA 2Y34A 3BVCA 5DAQA 5LATA 2V4AA 5LBBA 4MHRA 2RG4A 5L9BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RDR A;  4Y5S A;  4JZR A;  2RDQ A;  3DKQ A;  4NHK A;  2A1X A;  3NNM A;  2OPW A;  4NHL A;  4XC9 A;  3KT4 A;  4NHY A;  3OBZ A;  4ZON A;  5HV0 A;  2JIJ A;  5DAV A;  4XCB A;  3NNJ A;  5IAV A;  3NNL A;  2JIG A;  4IW3 A;  5DAX A;  4XAB A;  5DAP A;  5L9V A;  4Y5T A;  5M0T A;  2G19 A;  4NHX A;  4BQX A;  3GJB A;  2Y33 A;  5IAX A;  5DAW A;  5L9R A;  4UWD A;  5LA9 A;  5ERL A;  4NAO A;  4MHU A;  5HV4 A;  3MGU A;  4NHM A;  3PL0 A;  2FCT A;  5EP9 A;  3KT1 A;  2FCV A;  5LBF A;  4J25 A;  4XCA A;  5LBE A;  5EQU A;  5C5T A;  2HBU A;  3NNF A;  2RDS A;  2G1M A;  3OUJ A;  4NMI A;  5LB6 A;  3W20 A;  5C5U A;  5A3U A;  2HBT A;  3GJA A;  3OUH A;  3OUI A;  4XAC A;  3KT7 A;  4BQW A;  5LBC A;  4Q5O A;  4ZPI A;  4BQY A;  3HQU A;  3HQR A;  2RDN A;  4KBZ A;  5IAT A;  4XAA A;  3W21 A;  3EMR A;  5EPA A;  3ITQ A;  2FCU A;  3GZE A;  5LAS A;  2Y34 A;  3BVC A;  5DAQ A;  5LAT A;  2V4A A;  5LBB A;  4MHR A;  2RG4 A;  5L9B A; 
#chains in the Genus database with same CATH topology
 5CAZ A;  2YFZ A;  1LR5 A;  3POY A;  2BTV C;  4UFK A;  3B9I A;  4AGV A;  1OA3 A;  2PQS A;  3UJO A;  4BJ0 A;  2R16 A;  2PAK A;  4KG0 A;  3KQR A;  1CAX A;  1H8T B;  3NNM A;  3TBD A;  1MEC 1;  5CFC C;  1RB8 G;  4WM7 B;  1NXM A;  2ZJC A;  2P4E A;  3OBZ A;  1REE A;  1OFS A;  4MXW B;  5EJ3 A;  2VAU A;  3NNG A;  4TTG A;  3ELN A;  4H3W A;  1QQP 2;  2E63 A;  3K4D A;  4RYD A;  5FMB A;  5BY5 A;  1OKO A;  1QH7 A;  3WNN A;  4CPB A;  5ACA 3;  4NPM A;  1PGL 2;  4M4R A;  4YZ5 A;  1GSL A;  5M0T A;  4C0H A;  2W92 A;  3PHM A;  1Y9Q A;  1JI6 A;  3ZSK A;  3N9M A;  4FP2 A;  1BYH A;  2V5Y A;  3PMS A;  1CGP A;  1BXH A;  4QDQ A;  1ZZ8 A;  4XVH A;  3AZX A;  3BPZ A;  5BNN B;  1DBN A;  2JDZ A;  3X29 B;  4XFF A;  2BGO A;  3JD7 1;  3M7A A;  4CDX C;  3VDD C;  3K48 A;  4MLO A;  3AMN A;  2UWA A;  1XSR A;  4LKE A;  4YM2 A;  1LOF C;  1QU0 A;  3WDU A;  1JUH A;  4TYS A;  4HT1 T;  1V9U 1;  2XL7 A;  3DUI A;  1Q56 A;  2WR9 A;  2ZHM A;  3DPR C;  3M1H A;  3O0V A;  3FLT A;  1ZRD A;  4FOV A;  5DUW A;  1W6P A;  3P6B A;  1REF A;  2V4V A;  1KJR A;  4XHX A;  3BTZ A;  3ZSE A;  3LB9 A;  1DGW A;  1Q43 A;  2GMM A;  4JGZ A;  4PDW A;  3VBR B;  2QQP A;  2WLP A;  4COU A;  4P08 A;  1H1M A;  4DS0 A;  5JZG A;  1TEI A;  2P17 A;  2J22 A;  2HH9 A;  1KQR A;  2P34 A;  4IE4 A;  3I59 B;  4IE7 A;  3ALQ A;  4Q4X 2;  5KHI A;  4PBO A;  4A41 A;  1OPO A;  1X9T A;  5BNP C;  2FDK A;  1UO9 A;  4JGY C;  4CSW A;  1DGR N;  1WKY A;  4LBQ D;  4BA6 A;  2IWG B;  2IXI A;  3HMY A;  4UAP A;  4AQ2 A;  3THP A;  5IK7 A;  2WQ4 A;  1V6L A;  2HWF 3;  2JB4 A;  4TSV A;  2W46 A;  2ZGO A;  3N36 A;  1RUJ 1;  1OOP A;  1OI6 A;  3KB5 A;  2R32 A;  3SQO A;  5FQ0 A;  1V70 A;  1PIV 3;  4ATF A;  1D4M 1;  1IG3 A;  1WBF A;  1VJ2 A;  2WLQ A;  4UT5 A;  1UIK A;  2OPK A;  2RDN A;  5FYS A;  2AAC A;  4P9W A;  3A0K A;  3ON7 A;  2ZML A;  1X7N A;  3PJY A;  4BIF A;  4CCL A;  2D5F A;  3UNP A;  1H6Y A;  4TWT A;  5F2W A;  2QBX A;  1SLC A;  4Y22 B;  2DCT A;  2MNG A;  2V09 A;  4DUX A;  1OUR A;  5T5J A;  1VLN A;  5CZK A;  4YW6 A;  4KU7 A;  4H14 A;  1BKZ A;  4RHV 1;  4AFB A;  5A3T A;  1SZB A;  1XU2 A;  1QKQ A;  2GAL A;  1C1L A;  5B4N A;  1W8T A;  2R04 2;  1WMD A;  4DEQ A;  1WD4 A;  3KGL A;  2J1S A;  4CRQ A;  1U5Y A;  1H9W A;  1PZ8 A;  1HXS 2;  2QZ3 A;  2ARC A;  1COV 1;  4QPY A;  3RWN A;  5LA1 A;  2ZGP A;  4PT6 A;  4RA0 A;  1JZ3 A;  3URF A;  1DZT A;  1B35 C;  4CCM A;  5AC9 1;  1UZV A;  2TUN A;  2ZPX A;  4BME A;  3ZYI B;  3HT2 A;  2XJU A;  3IN9 A;  2UU8 A;  4ARX A;  4ES9 A;  2RDQ A;  1R64 A;  1RMU 1;  3WUD A;  2Q0A A;  4E4H A;  4A3Z A;  4ZZ5 A;  3PME A;  5GZE A;  2R04 3;  3VUO A;  4NHY A;  5JWP A;  2WNV A;  5DDJ 1;  1VBA 3;  3ZPO A;  4CTE A;  1CWP A;  3WP4 A;  4RN5 A;  1BVP 1;  2CAV A;  4BHP A;  2EIB A;  3RZL A;  5IFP A;  1CD3 G;  4UW3 A;  4KBB A;  4QPI C;  4D8M A;  4X6Q B;  1H1A A;  1XYN A;  4LKD A;  1ND2 A;  2ZGL A;  1UF2 C;  4GH4 C;  2E7Q A;  2W1U A;  1W0P A;  5GLU A;  4MXW A;  4HLT A;  1VBE 3;  2OZJ A;  3WNP A;  5ACA 2;  2XVK A;  2ZGT A;  1QNW A;  1ULE A;  1ULG A;  2VXR A;  1N3O A;  4OI2 A;  4BXF A;  2DWR A;  2ZEZ A;  4PI2 A;  2A6W A;  3M8L A;  4WVZ A;  4LO6 B;  1O3T A;  3LEM A;  2WIN B;  3RYP A;  5BNN A;  4UWD A;  2WO1 A;  3BAL A;  5FFO C;  1GWK A;  4DIQ A;  1ULP A;  1DU3 D;  2E53 A;  2P5B A;  3A21 A;  4E8C A;  5DMY A;  2XQR A;  5J98 B;  4P14 A;  2PLV 3;  3K75 B;  1ENR A;  3ZN6 A;  3FLP A;  4E2S A;  4N9I A;  5A80 A;  4DY3 A;  4AFA A;  3VHN A;  2UUR A;  4LT5 A;  1AYN 2;  1RUH 3;  5FQ0 B;  1U12 A;  2VCM A;  3I2F A;  4CXX A;  1DGW X;  1OH3 A;  4JQR A;  1S2E A;  2PEL A;  3U10 A;  3ZN5 A;  5FBJ A;  4JDN A;  5LK7 B;  3WP6 A;  1RXG A;  2VNR A;  4XJU A;  3VZO A;  3QCW A;  3U37 A;  3THD A;  5FV3 A;  1IQA A;  1FPN 2;  2IZW A;  2XHK A;  2GME A;  3AYC A;  3WG1 A;  5KXB A;  4HZF A;  4GD4 A;  3MIC A;  3F2Z A;  3RJR A;  4YZ2 A;  1GQG A;  3N3H A;  4AED A;  1EV1 1;  5CFD B;  1WW4 A;  1OSG A;  2BEO A;  1K42 A;  1CVN A;  2HWD 1;  1NY7 2;  2RMU 3;  1GKB A;  2RMU 2;  2VCA A;  4KWU A;  4XF1 A;  5T3N A;  4CDU A;  5DDJ 3;  3ZFE C;  4QKB A;  1FPN 1;  2WAA A;  4BQW A;  5GLT A;  4L8Q A;  3VZM A;  2YPD A;  3J9S A;  5FZO A;  3GZT B;  1MVQ A;  2ADD A;  4XZU G;  1XNT A;  3OGS A;  1WWY A;  5FK7 A;  2WWJ A;  2IXJ A;  4P5Y A;  4ISQ A;  3DXU A;  4L9B A;  4XBN A;  5FUP A;  1QJY 1;  1WMF A;  4AQT A;  5BUV A;  5DZE A;  1RTV A;  3DYP A;  3MLJ A;  1C28 A;  2PXJ A;  3NQH A;  4JTN A;  3N9P A;  5IK4 A;  1QQP 1;  3LD8 A;  1VBA 2;  5FYC A;  3WF4 A;  3UGH A;  1XXN A;  4PLO A;  3BTA A;  3MIB A;  1SLL A;  3PVO A;  1LUL A;  1NKG A;  2RS1 2;  3MFC A;  4KI5 M;  5D8A A;  1PX4 A;  3BIE A;  2QFE A;  2WO3 A;  1OHF A;  2DU1 A;  4OFG A;  2W2I A;  1ZRF A;  2RG4 A;  2VZT A;  2DUO A;  3IDB B;  4E4D X;  3B3Q E;  1JOB A;  4GWM A;  1W05 A;  3WDY A;  1VBA 1;  3ZX7 A;  4CVU A;  2D98 A;  3A23 A;  1YHF A;  1DGL A;  2G9Z A;  2BRT A;  2OYZ A;  5FP9 A;  1NCR B;  3W5N A;  4QB6 A;  4RL7 A;  4D7Y A;  4AE2 A;  5FZC A;  1AX1 A;  1IS5 A;  2WS9 2;  3C8X A;  3WUC A;  3ZFG B;  2QCS B;  4RR3 C;  3W59 A;  4OZO A;  3WSO A;  1PHM A;  3BN6 A;  3FZ3 A;  3IZO A;  3FC0 A;  4HXC A;  4FTS A;  4D69 A;  4Q0Q A;  2E32 A;  2N7G A;  2XLF A;  2RS3 1;  1JOJ A;  4P9Y A;  4IEU A;  4B7K A;  3IIA A;  5C7G A;  4HON A;  3TN9 3;  5FBZ A;  2BER A;  5L36 A;  3JBG 1;  5HI0 A;  4ZHN A;  4QKD A;  1QMJ A;  1WMX A;  1RUF 3;  3A0N A;  1UY1 A;  1RXF A;  3OD4 A;  4M3C A;  5I0U A;  5LRR A;  4B4P A;  4CU7 A;  1MZ5 A;  1GUI A;  3WDX A;  5CU1 A;  3A4U A;  1LHN A;  2WZR 2;  3Q8C A;  1O8P A;  1DIW A;  1LU1 A;  4D7S A;  1HXS 1;  1COV 2;  1UZY A;  2YBP A;  2JEC A;  1Q3E A;  1KJL A;  1W6O B;  2ZCW A;  5JR2 A;  2NPI A;  3H7J A;  2YFU A;  3ACF A;  5JSO A;  1I3H A;  2I07 B;  2WNU A;  3I2D A;  5E1R A;  3O1R A;  3PL0 A;  4B7E A;  2VOV A;  2DF7 A;  2JDU A;  1OD3 A;  2D44 A;  4LK6 A;  5CNA A;  4ZXK A;  1PK6 A;  4QPG A;  2BGC A;  2V73 A;  3KVB A;  1NCQ B;  2FCV A;  3KT1 A;  4YW4 A;  5FZG A;  5IHR A;  3S5A A;  4FTE A;  3WIN E;  1UYY A;  4ASL A;  2MEV 2;  3GF6 A;  3A7Q A;  4JDM A;  1J58 A;  2WN2 A;  2H6B A;  1NYW A;  3MZH A;  1QJY 2;  1UL9 A;  1DZR A;  2NLR A;  4MGK E;  3N35 A;  2C9A A;  5A6Y A;  1AR7 2;  1W8U A;  1X36 A;  1WCS A;  1UOB A;  2J1T A;  5DZG A;  5JCT A;  4XFB A;  2X5I A;  3VDC A;  3JD7 2;  1S4C A;  1IKP A;  2ZGR A;  3WG2 A;  4BXS V;  2P3I A;  1L7L A;  1NZC A;  2Z69 A;  5T50 A;  4P02 B;  1CAX B;  3R4D B;  1AF9 A;  1ND3 B;  1H4H A;  3D5O A;  1EV1 3;  4QU2 A;  1HRI 1;  1XND A;  1FT9 A;  5F8P A;  5GZG A;  2GN3 A;  3POG A;  2FMY A;  4HET A;  1JHJ A;  3DEM A;  3HQR A;  4LHL A;  4BK5 A;  5KC6 A;  3SHR A;  2EIE A;  3S57 A;  4BU2 A;  4QX5 A;  1ZBE 1;  1JN2 P;  2DBI A;  4GQ7 A;  3M70 A;  2SBA A;  3O5S A;  3TEW A;  3THT A;  4QHO A;  4NRQ A;  4BK4 A;  1DQ6 A;  2GC3 A;  3HIF A;  5FZ4 A;  4JHT A;  2JG9 B;  4U2A A;  1AXY A;  1ND3 C;  4UF0 B;  4CCD A;  5IVJ A;  4YM0 A;  2A6X A;  1YI9 A;  1BBT 2;  3DL3 A;  3P1I A;  3U78 A;  4AI0 A;  4DXS A;  1RMU 3;  2Y34 A;  5EZW A;  4E9K A;  2ZEW A;  3H3L A;  2CGN A;  4YZ4 A;  1LOD A;  5CAD A;  5HCF A;  3LIG A;  5ABJ B;  2G9F A;  2V4A A;  1AR9 2;  2VMG A;  1SHW B;  3OGR A;  5E88 A;  1F5J A;  4Y1U A;  3V0A A;  4LO4 B;  3CU7 A;  3NV2 A;  1LAJ A;  1SBD A;  2ERF A;  1R08 1;  4TLG A;  3KSC A;  4UBG A;  4LLO A;  4XUQ A;  1PGW 2;  1ASJ 1;  3AJZ A;  2P6C A;  4QXK A;  1OF4 A;  3K77 A;  2VZQ A;  1NCQ C;  5IVV A;  1HQL A;  3P5B A;  3KT4 A;  4UI9 L;  3LA2 A;  1NCR A;  1ACC A;  3KV4 A;  4XMI A;  3BOW A;  2B8M A;  4GUL A;  3LE0 A;  3M3I A;  1IOA A;  3SIS A;  3HN1 A;  1VP6 A;  1W8F A;  4IEV A;  4XFI A;  4XHB A;  2FMD A;  3JD7 3;  3POW A;  4XF9 A;  3KS7 A;  5FYV A;  4AGR A;  5CIS A;  3OF1 A;  3H8U A;  2D93 A;  2JIG A;  3BYW A;  3Q8B A;  5FY9 A;  3CZU A;  1XE0 A;  5DAX A;  2HWE 3;  2YZ4 A;  3I59 A;  1R1A 3;  4LO8 A;  1AR8 3;  2DCY A;  4Q27 A;  2FDF A;  3FJS A;  1OLM E;  5F3I A;  5FUI A;  5LA0 A;  1ULD A;  3TN9 2;  2Q1Z B;  1VB4 A;  2HWF 1;  3WG3 A;  5AVP A;  3HBK A;  4LKF A;  4IV1 A;  2XQX A;  4QQH A;  2HEW F;  4N43 A;  5LZ6 A;  4FPE A;  5IAX A;  4FOY A;  3MIH A;  4WZF A;  1NE4 A;  4N9H A;  4QD2 A;  4QAW A;  3UT0 A;  4N53 A;  2ATF A;  4Y5Z 0;  5JI7 A;  5IWF A;  2BBV A;  3ILR A;  3J26 N;  3H9A A;  3CDZ B;  4YGE A;  3GBF A;  4Y1V A;  5LA9 A;  4EN8 B;  1RUG 3;  1C8M 3;  2JE9 A;  2Y26 A;  1H0B A;  1HV1 A;  4YG0 A;  2HWB 2;  4W50 A;  3MID A;  2WA3 A;  3VD9 A;  3PUA A;  4FTB A;  3QAC A;  5FIX A;  2CWM A;  1OFN A;  1DF0 A;  2FD8 A;  1CAW A;  4CCO A;  4EN6 B;  3HOB A;  3T08 A;  2WSU A;  1E5S A;  3RMX A;  2VTX A;  4I0B A;  1PVC 2;  4LE4 A;  1J3R A;  1NA1 C;  3R05 A;  4UFI A;  1L7R A;  3T2T A;  2ZZJ A;  2A75 A;  2K46 A;  4AHY A;  4HAN A;  1HB1 A;  2F4P A;  4NUB A;  4DNY A;  4ZXE A;  1DQ1 A;  1I5Z A;  2IXC A;  3LPF A;  1QXJ A;  1YCI A;  3WNX A;  5J1X A;  2ZGQ A;  4LLF A;  3KHC A;  2VUL A;  2GP3 A;  3WDV A;  1DYP A;  4BOW A;  1OA4 A;  1SLB A;  3VBU C;  2HYX A;  3ZKY A;  1XYO A;  4PQ9 A;  2XL9 A;  4KNC A;  2WZP P;  4A3X A;  4DRR A;  3N9O A;  4WVW A;  1JOP A;  1GP4 A;  1JTZ X;  2X5I B;  4ET7 A;  4DFS A;  4HVR A;  2ZGK A;  4XFA A;  3SIT A;  1J3P A;  1AR9 1;  4U36 A;  3WOG A;  4MV2 A;  4JGY B;  1H8V A;  3TEY A;  4LPL A;  1HX6 A;  4XJ9 A;  1YFU A;  3ZFE A;  1VRH 1;  2C0Z A;  2DV9 A;  3O0X A;  3ZN6 B;  1XE8 A;  2HEY F;  1BEV 1;  1S0D A;  4C90 A;  3D0J A;  3KQ4 B;  2DUP A;  2P1B A;  2VZU A;  2XWB B;  5FP8 A;  1LGC A;  3KLS A;  4AZZ A;  3T0A A;  2PHW A;  5J3U A;  2CYF A;  4UBH A;  3LQC A;  2E26 A;  2ZTN A;  5GLZ A;  4E8D A;  3VKN A;  1YQ2 A;  4IGQ A;  4Q29 A;  4K20 A;  1RUE 2;  4Q8L A;  5EWS A;  5IUQ A;  5FO7 B;  3IMM A;  5A3W A;  2W95 A;  5FAX A;  4B1M A;  5BXX A;  1VBD 1;  1V9U 3;  2DTW A;  1J1L A;  5T5L A;  2RM2 2;  4QGL A;  3VBS A;  3OGV A;  1GFF 2;  5AFE A;  1NY7 1;  1GZC A;  4NIA A;  2J7M A;  4MX3 A;  2D6P A;  1IGO A;  3RQ0 A;  4LE3 A;  1EUU A;  4Z92 B;  4KL1 A;  1LRH A;  3VN4 A;  5EXO A;  1XRU A;  4JZR A;  4OUS A;  2QQI A;  4M0H A;  1O91 A;  1D2S A;  3VD3 A;  1TME 3;  1TZO A;  4ARY A;  3J7N A;  5A7Q A;  2QKD A;  4LIU A;  2BQP A;  1HRV 2;  2R6Q A;  1VIW B;  3PTR B;  1SDD B;  2XLG A;  4BZ4 A;  2AYH A;  1UIJ A;  1RHI 3;  1F4H A;  4CDW A;  4QT6 A;  4UW5 A;  1F2N A;  2R04 1;  1WUV A;  4BPZ A;  2XKP A;  5C4W A;  2ZS6 B;  4AHW A;  4EZ4 A;  3THC A;  5FOJ B;  4UW6 A;  4LBO A;  1EAH 2;  1AUY A;  3ZYR A;  5IVC A;  2VUA A;  2WS9 3;  3QOP A;  2TBV A;  4IV3 C;  1MS0 A;  2CAU A;  3S7E A;  4E27 A;  4FAH A;  4JHZ A;  2ZAB A;  1R09 1;  5A32 A;  3T2Q A;  5E6H A;  2ES3 A;  3C2U A;  4XJW A;  4A6S A;  5C4W C;  1Q8Q A;  3UV9 A;  3H8X A;  5FYT A;  5EJZ B;  1US3 A;  5EHD A;  1ZBE 3;  3ILN A;  1JBC A;  1LES A;  1YNA A;  4W6X A;  5FDB A;  4C8D A;  1GWM A;  2XXZ A;  2YDE A;  1UOG A;  4HVO A;  1PGW 1;  3LOB A;  3RZZ A;  3OY8 B;  1MZ6 A;  3H1M A;  3POF A;  5HBA A;  2JEM A;  3SCH A;  1DG6 A;  4WZC A;  1O4Z A;  3ZFF A;  3LOI A;  3VZK A;  1JHN A;  3MGU A;  3FN9 A;  5FZL A;  2VQT A;  3AZZ A;  2RR1 2;  1C8M 2;  1G9B A;  1APN A;  5F2S A;  1QXP A;  1OQE A;  2WFP A;  3RVH A;  3VBF C;  4RGG A;  4FFF A;  1A8M A;  1RVF 1;  4AW7 A;  4QQ2 A;  2VQ0 A;  3Q8E A;  1LEC A;  3MLK A;  5JIU A;  4AK3 A;  1ST8 A;  4CP0 A;  3WNM A;  3HNY M;  4EYU A;  4QMA A;  1OLR A;  3FX3 A;  4QHB A;  4YRD A;  5FY5 A;  1JS9 A;  2CGO A;  4CA9 A;  4YFZ A;  4WBB A;  2WL1 A;  4Y26 A;  3N4M A;  1W28 A;  3ASI A;  1HQW A;  4NID A;  4DMI A;  4AR2 A;  1NQJ A;  3J7H A;  4XJ8 A;  4M00 A;  3OD0 A;  1LHW A;  4YW2 A;  1NXD 1;  1S1A A;  4AFC A;  4EJR A;  1XC6 A;  1YUD A;  2R07 1;  4S2G A;  3UET A;  4COW A;  1GOH A;  3CZJ A;  3TRS B;  1MQT C;  4DXZ A;  3TNP B;  2JWP A;  2E31 A;  4MGQ A;  2RS3 2;  5KXE A;  4CP9 B;  4KGQ A;  2VM9 A;  4R9A A;  1ZVF A;  3NV1 A;  4NO4 A;  1AR8 1;  3U4X A;  4AGG A;  3TOJ A;  1J1T A;  3BU7 A;  5B2G B;  4A44 A;  1C8N A;  5FZM A;  5JXI A;  5LCW L;  3ZFE B;  1LTE A;  3VBO B;  4E2G A;  2AUY A;  1JU4 A;  2XVL A;  4CDW B;  2E51 A;  2EIG A;  4JGY A;  4LOR A;  2W08 A;  4FXK B;  1CQ9 A;  3D0S A;  1F31 A;  4K3U A;  1PVC 1;  1HV0 A;  3N9L A;  2ZHL A;  4FI9 A;  4GJY A;  1GIC A;  4OHW A;  4Q0P A;  5FYY A;  1F35 A;  3VBH A;  5LAT A;  4FPO B;  4NVP A;  1ZZ7 A;  1Z7S 2;  4B29 A;  4Z07 A;  1J3Q A;  3NV3 A;  1XNB A;  4P9L A;  2D3P A;  4R52 A;  1PO2 3;  4BQ4 A;  5FP4 A;  2ZBJ A;  5J96 B;  4ISR A;  2A6V A;  4BH9 A;  1J84 A;  2W0X A;  3AYE A;  2FBE A;  2XML A;  3GXU A;  2XH6 A;  4C91 A;  4LO7 A;  3IDA A;  1IKQ A;  1VBD 3;  4FPY A;  1JYW A;  5FXZ A;  1UU6 A;  2RM2 1;  4OMD A;  5FZ9 A;  1ND3 A;  2WFF 2;  2LAL A;  4IDZ A;  4COY A;  4F83 A;  3IPV B;  4G4F A;  1ZBE 2;  3E5X A;  4LJH A;  1TMF 2;  4MGY E;  3ABZ A;  3T3Y A;  1GNH A;  4QGN A;  2PYT A;  4UW4 A;  1UMZ A;  4A45 A;  2PQQ A;  3ZXG A;  5FO8 B;  3CIH A;  5T55 A;  1CAU A;  2JXA A;  4FFG A;  4IV1 C;  2RR1 1;  4B3N A;  3E97 A;  3KV6 A;  2XG3 A;  2CV6 A;  5JXG A;  1VMJ A;  2DCJ A;  1DP0 A;  1QY4 A;  3RRD A;  2D6L X;  4YVS C;  2VNG A;  3T1L A;  2A6Y A;  2VW2 A;  1RJ7 A;  4MO3 M;  2X5I C;  3LA7 A;  5C6C A;  3NV4 A;  5LW9 A;  1GBG A;  4H2A A;  3GJB A;  1B09 A;  5JI9 A;  1H2K A;  1YC6 1;  2F6B A;  1W9T A;  4OQ9 A;  4QPI B;  3SH4 A;  3ES1 A;  3U11 A;  1R09 2;  4N8M A;  1DQ4 A;  2VJX A;  5ERL A;  4NAO A;  1FNZ A;  2A73 B;  1YJL A;  3DYO A;  2GU9 A;  1FPN 3;  2TEP A;  2BVB A;  5F5Q A;  1WLW A;  2Y6H A;  2NZ9 A;  5JDB A;  3ZPY A;  1W9Y A;  1URX A;  4BLI A;  5LY2 A;  2GC2 A;  3RYK A;  4NR1 A;  5LY1 A;  1AR6 3;  5EJ1 B;  3GM8 A;  5H9Q A;  4B8E A;  4OQ8 A;  4NN0 A;  4WM7 C;  5A7S A;  4G9S B;  4JX0 A;  4BLJ A;  3OEB A;  1ZA4 A;  2BWC A;  1EY2 A;  1D4M 2;  2RR1 3;  2QTW B;  5KWR A;  2NP0 A;  2YBK A;  2PLV 2;  1U5X A;  3VDA A;  5FXV A;  3LEG A;  4Y20 A;  3T1M A;  1MS1 A;  1HN1 A;  2YRO A;  1W2A X;  3KCC A;  4JKK A;  3RG0 A;  4XF4 A;  2PHT A;  2VU9 A;  3ZYP A;  1BBT 3;  3LDB A;  2O1Q A;  4NMI A;  5JSP A;  3QD6 A;  4NWW A;  1VBC 3;  3T0B A;  1MVE A;  1D4V B;  1NLQ A;  2ORX A;  3ZIX A;  4Q1R A;  2QQJ A;  1PMI A;  4Y3O A;  4D6S A;  2DCZ A;  4Y1Y A;  2O8O A;  1MS3 A;  3KWV A;  2BGP A;  4HKL A;  1RIR A;  5F1R A;  3H0O A;  1CZT A;  5FLJ A;  1QJX 1;  2XR4 A;  1QGL A;  2XJP A;  4QX3 A;  5CYY A;  5F3G A;  2B5H A;  5FZ0 A;  3OPT A;  4I2O A;  1JU3 A;  3CKH A;  3ACL A;  5D8A B;  2PTM A;  4C1W A;  1YWK A;  2LRP A;  1GR3 A;  4Y4R A;  3U0Z A;  1ZRE A;  2AEN A;  2B7Y A;  5D21 A;  4CDU B;  1QJZ A;  2D6M A;  3ACH A;  3MW4 A;  4RR3 A;  5T5P A;  3U07 A;  3WP3 A;  1N1S A;  3BI3 A;  5BNQ A;  1IPS A;  4HL0 A;  2A3W A;  4FP3 A;  4Q4Y 2;  2WZ8 A;  3U14 A;  1UZW A;  4JGZ B;  5LWB A;  1UKR A;  1RVF 2;  1BHG A;  4EZH A;  3JCI A;  4CEW C;  1W8H A;  4RS5 A;  2RV9 A;  4S2D A;  4AQS A;  5HCH A;  1W6M A;  2KXL A;  2IVJ A;  4IL7 A;  3ZFF C;  1U5I A;  2W3J A;  2JD9 A;  1OC1 A;  3E6B A;  2K9Z A;  4R8H A;  1FMD 3;  2LW8 A;  4HKO A;  1K5J A;  1A6C A;  2GN7 A;  1I5P A;  1G9F A;  4UYB A;  4Y5S A;  2WNU C;  1PO2 2;  5F6K A;  4AI8 A;  2UWB A;  3AMH A;  1RUC 2;  2IFR A;  3O1T A;  1W2O A;  1YFX A;  3ROU A;  5IVE A;  3WNL A;  3B69 A;  1X82 A;  1BEV 3;  1H8T A;  1WCQ A;  3OTF A;  4GAL A;  5FY7 A;  2ENR A;  2RS1 1;  2WZR 1;  3S5Q A;  3GDB A;  2VBD A;  3ZVX A;  4YVW C;  5I0S A;  1UY4 A;  3C7F A;  4OYU A;  4YGD A;  1VMF A;  3MBW A;  4XQ4 A;  4Q4V 1;  4K8R B;  1V00 A;  4XFH A;  2VZR A;  2GNT A;  1COV 3;  4AVC A;  1KDK A;  5JZG B;  2OA2 A;  5F32 A;  1PNF A;  5L9V A;  3IWZ A;  3S7I A;  1QJU 2;  4I3G A;  2AH2 A;  2J1V A;  3O1O A;  1NZI A;  3L2Y A;  1AL2 3;  1GLH A;  4TXW A;  2W5F A;  4IEO A;  3ZXF A;  1NG0 A;  2VGD A;  4CDW C;  4EN7 B;  4YSF A;  5BNO B;  1XYP A;  1LHO A;  1WLC A;  3KHB A;  3K2O A;  4Y33 A;  1VBB 3;  2WNU B;  4R9D A;  4YZ3 A;  2X8K A;  3AP6 A;  2VOX A;  3W58 A;  4KGG A;  1W6Q B;  2R1B A;  4AYU A;  3LFM A;  1QXR A;  5I0R A;  1Q8O A;  3I2G A;  1CZS A;  1BBT 1;  1SDW A;  2WDB A;  3AL6 A;  4DXT A;  2PA7 A;  4OHV A;  4E4S A;  3PIG A;  1V6N A;  2ZGS A;  4CP1 A;  3VBF A;  2RJ2 A;  4LA2 A;  2X10 A;  1RJ8 A;  1VPH A;  1GNY A;  1S0B A;  4QM9 A;  3ZYJ B;  1OA2 A;  2YB7 A;  2C6S A;  1S0E A;  1MS4 A;  3PTY A;  1XB9 A;  3RZJ A;  1FOD 2;  2HWC 2;  4KH9 A;  5HXM A;  4LBQ A;  3ZO0 B;  2QDN A;  3AYD A;  4J25 A;  4W4Z A;  5A7N A;  2C24 A;  4EE2 A;  5JOW A;  4Y1X A;  3RZH A;  2VC9 A;  4CCJ A;  2CWS A;  5D8A C;  1W0O A;  4AVT A;  5JOY A;  2ZA9 A;  3KZ4 C;  4QKF A;  1FI2 A;  4FT8 A;  4PQQ A;  1IS3 A;  4TN7 A;  2G1M A;  3T0D A;  2NQY A;  2WN3 A;  1F4A A;  3JQX A;  5LB6 A;  2P3K A;  4XBQ A;  1AJK A;  3RS6 A;  1N3Q A;  1DDL A;  3UKV A;  2DFC A;  4OZX A;  3WY6 A;  4CZS A;  1Y3T A;  1UOJ A;  3NAP B;  4O65 A;  2HWD 3;  4OLL A;  4YVW A;  1JYI A;  3B93 A;  3G6J B;  2RMU 1;  5DPN A;  1JZ5 A;  4XIO A;  1H8T C;  5CFC B;  4ZPI A;  1PIV 2;  5FZ7 A;  3EXU A;  3PDQ A;  4Q0U A;  3ZN4 A;  2F17 A;  4NIH A;  1IHM A;  3WNO A;  5FR3 A;  4GJZ A;  3SMH A;  3CBN A;  2VTX J;  5DDJ 2;  3VHR A;  3W5M A;  5C4W B;  1H30 A;  2MHF A;  1RUC 3;  4MVT A;  1RGS A;  4AHX A;  4AED C;  4JC1 A;  2Y6F A;  5JVV A;  2LS6 A;  4NPR A;  4XXP A;  5LEK A;  5FPA A;  5FPL A;  5K8S A;  4IV3 B;  4CE8 A;  5CKQ A;  2GNM A;  2WT1 A;  5L73 A;  2LM3 A;  5F5C A;  2NN8 A;  4RS5 C;  5FYZ A;  5E16 A;  1MZF A;  5A1A A;  3ILF A;  4MGZ E;  4R4Z A;  4GWN A;  5DZF A;  1BCX A;  2EID A;  1AXZ A;  3IAP A;  4OCT A;  3VLB B;  1Y43 B;  4AI1 A;  1WCD J;  1EYB A;  5I8S A;  3EYP A;  2O14 A;  4FXG B;  3WQ0 A;  3OBA A;  3NJY A;  2RS5 3;  2D6K A;  3I3B A;  3ZXL A;  5C8W A;  3J7L A;  3AFK A;  1RHI 1;  4NHL A;  4PBP A;  4V2W A;  1U0A A;  3M3C A;  2VTF A;  3HBZ A;  2BW8 A;  5FYH A;  1Q5O A;  4D6Q A;  2UY8 A;  1YFW A;  2QQV A;  3AX4 A;  3D4K A;  3PNA A;  4IV1 B;  4CXY A;  3ZOI A;  3PVN A;  3RZK A;  3VKL A;  4AVB A;  4IW3 A;  4LBK A;  4XAB A;  1U5Z A;  2D3S A;  5FRA A;  4CP2 A;  1LOG A;  2EAK A;  2Q4S A;  3M4F A;  4LQR A;  4XFG A;  5FCC A;  3NKT A;  4AVS A;  4PIX A;  1HDK A;  1JXN A;  1SPP A;  3T2P A;  4RFT 0;  2WYS A;  4QPI A;  3DPR B;  2D6O X;  1LEN A;  3ZSJ A;  4WM7 A;  4XUT A;  2JEN A;  4FPG A;  1G86 A;  5DAW A;  1WLD A;  4AWD A;  3TYJ A;  4NWV A;  4CUG A;  1V6M A;  1YYN A;  5CG9 A;  2WNV C;  3MLL A;  4AEK A;  3IDC B;  5JZG C;  5KHK A;  5IFT A;  2AC1 A;  2RHP A;  5FPV A;  3E6D A;  3O1U A;  2MEV 3;  3VHP A;  5A6X A;  5FJH A;  5KHH A;  4EWD A;  1SLI A;  5A3P A;  1B35 A;  2XDV A;  3AXD A;  2BNM A;  3DXT A;  2HWE 1;  1X8M A;  5FWJ A;  3I8T A;  1C1F A;  3PUI A;  5A3N A;  3QH7 A;  2HKX A;  1OLQ A;  2WC2 A;  5LA2 A;  1CPN A;  4AXO A;  5K9Y A;  3DGT A;  4DB5 A;  3H3Z A;  3VZN A;  1C4R A;  2QDR A;  2O8Q A;  2HBU A;  4DO0 A;  5KXC A;  1O7F A;  3FE5 A;  4FPH A;  2HWB 1;  2VZ1 A;  3OUJ A;  3FFZ A;  2EXJ A;  2JDN A;  4N43 C;  4Z82 A;  1EV1 2;  5FMO L;  1LOA A;  1OBN A;  1Q8P A;  4A7Z A;  2IFW A;  2DVA A;  1PM7 A;  4CEW B;  1T2X A;  1NLR A;  1ZRI A;  3MO4 A;  1XE7 A;  3H50 A;  3OYW B;  3OUH A;  2ETE A;  4IE6 A;  3NL1 A;  2R06 2;  1JW6 A;  2H0B A;  3J8F 1;  5F3C A;  4Q5O A;  3IPV A;  2V5D A;  3N7M A;  2W52 A;  4GB3 3;  5T54 A;  4LBL A;  3ZYF A;  2A7A A;  1K5M B;  2B46 X;  3AKP A;  3I54 A;  4S2H A;  2ZX4 A;  5T52 A;  4I3P A;  4L0P A;  4A4A A;  1RUH 1;  1LGB A;  2JD4 A;  3V0B A;  2VBB A;  1BK1 A;  1X33 A;  2GZW A;  2JDP A;  4RD7 A;  4JQT A;  5DG2 A;  1IPK A;  1CJD A;  3B01 A;  4HSL A;  5JPM B;  4I0W B;  5A1F A;  3HR9 A;  2EXI A;  2VZV A;  3H42 B;  3ITQ A;  4I30 A;  2ZGU A;  1JMU B;  4RS5 B;  4D6R A;  4Q4V 2;  1PK6 C;  4QPG C;  1PZ9 A;  5LAS A;  5BNP A;  5C9A B;  5JOZ A;  4CDQ C;  3BVC A;  1X50 A;  2JDY A;  4QX7 A;  2YYO A;  3CLP A;  4LUL A;  3WCS A;  2CTV A;  2LRO A;  3AVS A;  3MF9 A;  4XAE A;  5KBF A;  1OOP B;  2OX0 A;  4O61 A;  5L9B A;  2OZ6 A;  4BCU A;  1AX2 A;  4AF9 A;  5C3S A;  4AHZ A;  3MHZ A;  1ZZ9 A;  2ZGN A;  3AM2 A;  4Q1P A;  2F4L A;  2VZS A;  2ZX3 A;  3FWE A;  4X6R B;  1H1I A;  3WW1 A;  3ETP A;  1JYT A;  5FLH A;  1VMH A;  2UYA A;  3AVR A;  4Q4X 1;  2WQZ C;  3ACI A;  1VR3 A;  3ZSM A;  3EO6 A;  1D2Q A;  2PHU A;  2D3R A;  4M0N A;  2YGL A;  3LEI A;  4IET A;  1JZ7 A;  5DAV A;  1AYM 1;  5CG8 A;  4YVS A;  4IEX A;  4JCK A;  1QNY A;  4M01 A;  4F3J A;  3NNL A;  5C3P A;  3VKM A;  4QX2 A;  2ZAA A;  4L11 A;  2WYF A;  1SCR A;  3SEP A;  5ABJ C;  3WG4 A;  3S30 A;  5SV5 A;  3E5Q A;  1RIT A;  4Q4X 3;  2A5Z A;  2J42 A;  2QQW A;  5H9S A;  2XJS A;  2NYY A;  1I9R A;  1Q8V A;  4IQP A;  4J1X A;  1X9P A;  5E8A A;  2BV4 A;  5EFU A;  3UGG A;  1ZBA 2;  1KS4 A;  2AZ5 A;  2XLA A;  3LPG A;  2Y6J A;  3EQE A;  3RFR A;  4CEY B;  2BDR A;  1Y7B A;  5F7U A;  2DTY A;  5F3E A;  3I4I A;  4E2Q A;  1SLA A;  3M3E A;  3BKZ A;  1BMV 1;  3J7M A;  2DBN A;  1O8S A;  1RUC 1;  2P6H A;  3QLQ A;  4N7U A;  5FY8 A;  3AP4 A;  3MV0 1;  1EP0 A;  2GAU A;  5CVR A;  1F9K A;  4UFH A;  5CB7 A;  1VE0 A;  1DQ0 A;  1NUK A;  2PHL A;  3OPW A;  4BM8 A;  2DVD A;  4CCK A;  1UU5 A;  1MS5 A;  2WA4 A;  2CY6 A;  4JAA A;  5CKN A;  3QBQ A;  2CGP A;  1K12 A;  2HWC 1;  3P3P A;  3OY8 A;  1HN0 A;  2GMP A;  1Z0H A;  3FUQ A;  3RYR A;  4OHY A;  4IEY A;  3BPS A;  1YQ8 A;  4QX0 A;  4RGK A;  1GV9 A;  2AEZ A;  1DZQ A;  1PZ7 A;  3AP7 A;  4ZKT B;  1HQN A;  4BQ5 A;  5FZI A;  1A34 A;  1UZ0 A;  4K6B A;  2JG8 B;  2XON A;  1RMU 2;  4Q4W 1;  1ULO A;  4IE5 A;  2X09 A;  3TEX A;  5L19 A;  4NOT A;  1KFU L;  2OS2 A;  2VH9 A;  3WZ1 A;  1G6N A;  3LWC A;  4K7J A;  3PU3 A;  4QU1 A;  1EAH 3;  4BMB A;  1VBE 1;  2C5D A;  5G05 L;  3VL9 A;  1OMI A;  3GJA A;  1C5H A;  1C57 A;  3AKQ A;  3C3V A;  4CDU C;  3K3O A;  1CES A;  4AOC A;  3BTX A;  1TG7 A;  4LNV A;  5FZO B;  3R4S A;  4HN1 A;  1LJ7 A;  1DYK A;  4Z2W A;  4BQY A;  5E89 A;  3MUY 1;  2UYB A;  3IKW A;  2R06 3;  2P3Y A;  5IAT A;  5C3O A;  4J1W A;  1UQX A;  3GHM A;  4JV4 A;  1QJU 1;  4AAP A;  1FAY A;  1SCS A;  3MIG A;  4YPJ A;  2Z2S B;  1POQ A;  1BEV 2;  1ALY A;  4GKX A;  2HWC 3;  1MQT B;  4GAZ A;  1V9U 2;  2YG0 A;  3WQB A;  5FXW A;  2JE7 A;  3U4S A;  1W6N B;  1RUD 3;  4XYX A;  3CHX A;  1UNB A;  4MAD A;  2A3Y A;  4DEV A;  5C8C A;  1N1T A;  2WFF 3;  1UZZ A;  1RUN A;  1TQ5 A;  2XB6 C;  5A7O A;  3HJR A;  2FDJ A;  3LAG A;  3LF7 A;  4Q26 A;  4XBL A;  4PF1 A;  4RHV 2;  3UL2 A;  4LUK A;  1PO1 3;  1V6K A;  1S0C A;  1R08 2;  2IC1 A;  3FHI B;  5A3O A;  3ZFG C;  4NHK A;  1V6J A;  1RUD 2;  5LRS A;  2WZR 3;  1STM A;  1NX9 A;  5A7W A;  1N1V A;  1PMH X;  2ZMK A;  1UU4 A;  1JOD A;  4AI9 A;  4HN0 A;  1QOS A;  1YEW A;  3GGL A;  3DV8 A;  3OEA A;  5FZE A;  4HSJ A;  4E4Z A;  1T6G C;  4IV3 A;  4LMF A;  2BNN A;  1BLZ A;  1QDO A;  4FFI A;  4YG3 A;  3KVA A;  1GOG A;  4YM3 A;  1TNF A;  3WP5 A;  4GH4 A;  3FL7 A;  4XIL A;  5HXV A;  1SFN A;  1QH6 A;  3VBU A;  3C7H A;  3ZXD A;  1O3R A;  1R1A 2;  1SFP A;  5FMC A;  5I0T A;  1PO2 1;  3UK9 A;  2OKX A;  1DYO A;  2D43 A;  2O0O A;  1ZM1 A;  1IPJ A;  3QH6 A;  3BGA A;  4WM8 B;  4CUB A;  5JXH A;  4R9C A;  4O7X A;  1AX0 A;  1NA1 A;  1TMF 1;  4HK9 A;  1ZA7 A;  1W90 A;  3PVB B;  1KEX A;  1PO1 2;  1G8W A;  1BZW A;  4AEJ A;  2ADE A;  3MI8 A;  1O4T A;  5T5O A;  4BQ2 A;  2Z4F A;  3NST A;  2BOI A;  1RUI 3;  1FV2 A;  4XF0 A;  1YFY A;  5ACA 1;  2FDH A;  4GMP 1;  4XUN A;  1X8E A;  2Q1M A;  5HV4 A;  5A3M A;  1N3P A;  4LK7 A;  4MET A;  5H9P A;  1BJQ A;  1NT0 A;  2ZMN A;  1UW8 A;  1E5H A;  3MPP G;  5JSR A;  2VQA A;  5LBF A;  2OQ7 A;  4L2N A;  1QJX 2;  2GSY A;  1LU2 A;  5LBE A;  1G9C A;  2BUK A;  3HN3 A;  2I2S A;  4NRP A;  3MIE A;  5AC9 3;  2VW0 A;  3LDR A;  1AHS A;  2RDS A;  1CIY A;  2BU9 A;  2VZP A;  3Q8A A;  4D3W A;  2Y8K A;  2R1D A;  3MUZ 1;  1W6O A;  3GCX A;  4PDW B;  3VBR A;  3WLU A;  2HBT A;  1AXK A;  2FQP A;  1AYM 3;  1A8D A;  3EB7 A;  3ST7 A;  2FZ2 A;  5FZB A;  5A7P A;  4LBM A;  4PCR A;  1W8O A;  4IEW A;  5FKC A;  1WZX A;  1JZ2 A;  4GMP 0;  4PLM A;  4FVV A;  4NRO A;  3CJI B;  3V0B B;  3MW2 A;  2VUJ A;  5CEH A;  2AR6 A;  4K1Y A;  4BQ1 A;  5CKM A;  4Z2A A;  1ZX5 A;  5EPA A;  1D4M 3;  3Q9O A;  2XJT A;  4JGZ C;  3R4U A;  1XOY A;  5D2A A;  4FSJ A;  2D5H A;  2FCU A;  4TZD A;  5KHJ A;  2VVF A;  2WNE A;  3CEW A;  4CEW A;  4XW3 A;  3FBY A;  2BZD A;  5C8C B;  3I2I A;  2WS9 1;  1VBD 2;  4I02 A;  1YQ5 A;  3LIH A;  3SH5 A;  3JB8 A;  5F9T A;  4RSU A;  4UXA A;  4Z8B A;  3DKW A;  1OT5 A;  5DQ0 A;  5DUV A;  1LOF A;  4M3C F;  4BYY A;  2QQK A;  3GBG A;  2WII B;  4ZU7 A;  1LNS A;  4HPK A;  1W9S A;  2YHJ A;  3OYW A;  1JH5 A;  2PHX A;  4O9G A;  5A33 B;  3ZYG A;  2A1X A;  4JRL A;  1ULC A;  5FYI A;  2ZHN A;  3C7E A;  4EV0 A;  4FBF A;  2QVS B;  4KWL A;  2ZAC A;  4P5H A;  2Q8C A;  1L3J A;  2W39 A;  2VZ3 A;  4I09 A;  4K21 A;  1VRH 3;  3ME2 A;  4ITC A;  4XDO A;  3WF0 A;  4DXR A;  4YWA A;  3L9J T;  3I3D A;  5HV0 A;  3NNJ A;  1FX5 A;  2ZAH A;  1IS4 A;  3N9Q A;  5C3Q A;  2B45 X;  3B9C A;  2BYV E;  3JUU A;  1TMF 3;  5EYY A;  2VMD A;  2HYK A;  4NPL A;  4C0B A;  5J37 A;  1W39 A;  3I2K A;  4Y5T A;  1OOP C;  4XDP A;  1TVG A;  2X05 A;  1ASJ 2;  4IES A;  4QDR A;  5CIR A;  4CEY A;  3K4Z A;  1HRI 2;  1PIV 1;  1NCR C;  2WBK A;  1PVC 3;  3PUS A;  1EPZ A;  3POI A;  3U75 A;  1BMV 2;  1AL0 G;  1DQ2 A;  2YC4 A;  3NO8 A;  2QZ2 A;  4P00 B;  1J59 A;  5FUN A;  5HPO A;  1Y9M A;  3K4A A;  3W9A A;  2ZHK A;  4XE9 A;  1H2M A;  2VUC A;  1R1Z A;  3WW3 A;  5J09 A;  1S0I A;  5L9R A;  2VMF A;  3HAG A;  2VEC A;  1TE1 B;  4HOO A;  5CFD A;  2RE9 A;  4F8A A;  2P2K A;  3SKJ E;  4CP9 A;  3RZG A;  4Z1V A;  4AFM A;  1NLS A;  3IDE A;  3AB0 A;  1K5M A;  2JDK A;  4YYO A;  4A6O A;  1US2 A;  2MPF A;  2ZZQ A;  2CNA A;  4PLN A;  3I3E A;  5FPZ A;  1S0J A;  3AL5 A;  4LO5 B;  5A70 A;  4JDO A;  1OXC A;  4K8F A;  1D7P M;  1HKD A;  5C70 A;  1XNA A;  3BOD A;  4LHS A;  4ASK A;  2WUH A;  2C26 A;  5BNP B;  5FLI A;  3K46 A;  1AYN 1;  4OI1 A;  3ECQ A;  2DVF A;  2I45 A;  5EQU A;  1QDC A;  2B4K A;  1HRI 3;  2H0V A;  4LA3 A;  4QB2 A;  5FMO S;  4CDX A;  4Q8K A;  2QQN A;  4DOU A;  5TSW A;  2JJ6 A;  5A1L A;  3W20 A;  3KV5 A;  1ZBA 3;  5JR7 B;  5C5U A;  2R7E B;  2B9U A;  5D1I A;  4PIY A;  3OCP A;  3UGF A;  4A42 A;  2Y6L A;  3WD5 A;  4BDV B;  1UX7 A;  3DCQ A;  4Y4Y A;  4MGT A;  1ENX A;  3EJK A;  3TEZ A;  4CYD A;  3O1M A;  5FP7 A;  4EWA A;  5IVY A;  3Q8F A;  1HB3 A;  3ZDS A;  3GCW A;  4JTO A;  2QQO A;  1VAL A;  1L7Q A;  2RS3 3;  4YGC A;  2VQU A;  2VVE A;  3HQU A;  1RUO A;  3J8F 3;  1NOV A;  1OVS A;  4PJY A;  2D97 A;  1RIN A;  4BIO A;  1HIX A;  1QHD A;  2G4I A;  2YMZ A;  4XAA A;  4OHZ A;  3HNM A;  3MF6 A;  1GYK A;  3UKT A;  2BPA 2;  1W6P B;  3HPN A;  1SAC A;  1JZ6 A;  1WW6 A;  1UYX A;  4A7Y A;  2QQM A;  1W3X A;  3H8R A;  1ZZ6 A;  5CFC A;  3I3M A;  4ZZ8 A;  5DAB A;  3WVJ A;  2VXJ A;  4YAR A;  1XBF A;  3CF6 E;  1OH4 A;  3VZL A;  5FZ1 A;  3RSJ A;  1CAU B;  2WRA A;  3VBO C;  4MOA A;  3O1P A;  3VBH C;  2P3J A;  1FOD 3;  3NJX A;  1E57 A;  2PHR A;  4XUR A;  3VBS B;  3IAQ A;  4AVV A;  4Q4Y 3;  1C3H A;  3VKF C;  3SC7 X;  1POV 1;  1CX1 A;  1RVF 3;  1LKN A;  4H7L A;  4HMZ A;  1D0G A;  2L9L A;  4AQ6 A;  3GHN A;  4W6W A;  5FYM A;  1IQD C;  2NM1 A;  3ETQ A;  1KRI A;  1RUI 1;  3D8C A;  3O14 A;  2Y0O A;  5FY1 A;  1S0G A;  2VMI A;  1ENQ A;  3GAL A;  4O9E A;  3VGI A;  2OPW A;  1LHU A;  2Z42 A;  4WM8 C;  4ES8 A;  1UYP A;  2XBO 1;  4ZON A;  3WX5 A;  3JB4 C;  3JBG 3;  1MQT A;  4YLZ A;  4XTP A;  2JIJ A;  4IGP A;  1UYZ A;  4M4P A;  3OJB A;  3ZYH A;  4AVA A;  2TNF A;  1HB2 A;  2WKK A;  1W0N A;  1FV3 A;  4MXV A;  2E6V A;  1ND2 B;  1C5I A;  2OXB A;  2XJV A;  4KMQ A;  1YRZ A;  2CL2 A;  2X29 A;  2YU1 A;  3RMY A;  2JDH A;  4P9G A;  3CMG A;  4LR4 A;  4EN9 B;  2VMC A;  4Q0V A;  2JB8 A;  2EVX A;  4CDQ B;  1NAE A;  5FOB B;  2JIC A;  3H1W A;  1ZRR A;  3U1X A;  1O5L A;  1VBE 2;  3S6P A;  4KU8 A;  4W6Y A;  4NHX A;  3ZXA C;  3O1S A;  1W99 A;  1ZNP A;  5FY4 A;  4I0A A;  4AG4 A;  1VBB 1;  2ET1 A;  4M3C B;  1VAK A;  4CCE A;  1WW5 A;  2Y6G A;  2HEV F;  5IT6 A;  1H4G A;  4B4Q A;  4GB3 1;  1EPW A;  2R07 2;  1PO1 1;  3ORJ A;  3H8O A;  3DN7 A;  1V6O A;  3WF1 A;  1DGR A;  5I93 A;  2E9Q A;  1ODM A;  1AR7 3;  2ZEY A;  2PMW B;  5EV7 A;  3N7L A;  5GLW A;  1MS8 A;  4Y1Z A;  2AEY A;  5FPB A;  1CIW A;  1YIP A;  3LGR A;  4Q2F A;  1EAH 1;  3H1Y A;  4XEZ A;  2ZOE B;  2WT2 A;  5FZD A;  5JXJ A;  5G04 L;  2VMH A;  1KS5 A;  2D6N A;  4CCN A;  1YIF A;  3B00 A;  1LOC A;  4NE9 A;  2W87 A;  1YQ6 A;  2VOK A;  3I3Q A;  2FDI A;  2OQ6 A;  3J8F 2;  4Q4Y 1;  3BTY A;  3BU0 A;  1GZ9 A;  3VZJ A;  1WW7 A;  4OVE A;  1QJU 3;  2EAL A;  2HWD 2;  3POS A;  2VOT A;  1ULF A;  4BB3 A;  4X8N A;  1NQD A;  2ZEX A;  2ZXQ A;  2E33 A;  1ND2 C;  2A6Z A;  1CZV A;  1GQH A;  2J1A A;  4P9J A;  3WT3 A;  1IS6 A;  4FAG A;  3B5L B;  3RJ2 X;  4MZU A;  5A3U A;  4MSV A;  5AFB A;  4QX1 A;  1W03 A;  2OUH A;  2BP6 A;  4XUO A;  2DVB A;  3NVC A;  3WR0 A;  2ZKL A;  1DFQ A;  1W2U A;  2DUR A;  1QQP 3;  3LKJ A;  4D7T A;  5F5I A;  2BJS A;  3HT1 A;  3ZMN A;  4IUG A;  2HWF 2;  5HCA A;  4QKN A;  2RVA A;  5FP3 A;  1UY3 A;  4RFR B;  4BIS A;  3H3U A;  1DLC A;  2W1Q A;  1HW5 A;  3O7O A;  1R1A 1;  2B42 B;  1GZT A;  3ATG A;  3EHK A;  4PI0 A;  4S2F A;  4GA9 A;  2QE3 A;  4FCA A;  4TLF A;  5FZ8 A;  5I0D A;  1QOO A;  5A6Z A;  4QDS A;  3I2J A;  1BK0 A;  1HXS 3;  1HLC A;  1W04 A;  3GNE A;  3VBS C;  2BBA A;  3L2H A;  4P9X A;  5K4L A;  2WT0 A;  1Z7S 3;  1TME 1;  3GZE A;  4MUV A;  5BNO C;  3PUQ A;  2ARX A;  4OUM A;  2ARE A;  2ZX0 A;  4JRA A;  2D40 A;  4YW3 A;  3ZKU A;  1ODN A;  2ZX2 A;  1XSQ A;  5FXX A;  2YGM A;  4L99 A;  4EWE A;  1AR6 2;  4OUE A;  2Z5W A;  4UOJ A;  2W9X A;  1VBB 2;  1LHV A;  2VD7 A;  3E5U A;  1PM4 A;  2ARA A;  3LCP A;  3R0R A;  5BNN C;  2RDR A;  5C9A A;  3P3N A;  3OBR A;  5JUV A;  5L7O A;  3VD7 A;  3TN9 1;  3USS A;  3K51 A;  5JPN B;  2Q8E A;  4RQP B;  4GKY A;  4DPN A;  1UOF A;  5IK5 A;  3GZU C;  4QXC A;  4URA A;  3VD4 A;  4GB3 2;  3UES A;  2CDP A;  3AXE A;  3HWJ A;  4Y24 A;  2JDA A;  2BFU L;  4PIZ A;  5J7M A;  2R30 A;  2W68 A;  3ZLI A;  4LHN A;  4IXL A;  4JKL A;  3JBG 2;  1GNZ A;  5A3L A;  3PJQ A;  2B39 A;  2Z79 A;  1I1E A;  2YU2 A;  4LEJ A;  4YW7 A;  3N7J A;  3FBM A;  2QQL A;  4LBQ B;  3RI8 A;  5GLV A;  1AR8 2;  1OF3 A;  3AZY A;  1PVX A;  2XOM A;  3WHT A;  5HCB A;  5FK8 A;  3C7G A;  5A33 A;  2DDU A;  1MZE A;  2Y64 A;  4NJ4 A;  4HG6 B;  1UWW A;  3VKO A;  5JIA A;  1WA4 A;  3AFG A;  4V2V A;  1RUE 1;  3OOX A;  1KGY A;  1XNK A;  4HPK B;  2KD7 A;  4HVQ A;  2J1E A;  1RED A;  1TME 2;  2W94 A;  2DYC A;  4QQP A;  2YBS A;  4UFL A;  4YM1 A;  1JYN A;  3ZYB A;  3CJI A;  3HD8 B;  3LFI A;  4P9I A;  4IE0 A;  2W47 A;  3AYA A;  1H9P A;  2JE8 A;  2YPJ A;  2RS5 1;  4XXA A;  3TAY A;  3TWI A;  1PK6 B;  1WBL A;  4QPG B;  4FPJ A;  5C9A C;  2PLV 1;  4FPL A;  3VBF B;  3S0M A;  1Z7S 1;  2VPV A;  1LCL A;  4N53 C;  2NMO A;  3ZSL A;  1S55 A;  3I2O A;  3JXS A;  1SBF A;  3ZIW A;  2GC0 A;  4FPK A;  5FMD A;  5IW0 A;  2G9G A;  5EYX A;  3LEK A;  2ORZ A;  3DEC A;  5GZD A;  1RYY A;  4CU8 A;  1XNC A;  5FJK A;  3PUH A;  3RI9 A;  2Q1F A;  3M3Q A;  1YO8 A;  3OBT A;  5C8C C;  1SMV A;  3NNF A;  1SG3 A;  1Q8S A;  2ZGM A;  1PGS A;  2SLI A;  4UFM A;  4BWO A;  2YY1 A;  1R09 3;  1UXZ A;  1SPP B;  4L92 A;  2XBO 3;  3BIW E;  4WVM A;  5K0U A;  1JZ8 A;  1O3S A;  1YJK A;  3APB A;  1ONA A;  1ENS A;  1N47 A;  4UFJ A;  5H9R A;  3V64 A;  1F5F A;  5IJR A;  5FYB A;  5BV6 A;  3CNA A;  4HFS A;  5GZF A;  4SLI A;  1K45 A;  1A3K A;  4RR3 B;  3BUC A;  3KT7 A;  4DRV A;  3FMG A;  1XJA A;  3IB3 A;  1SLT A;  1BVV A;  2W1S A;  2OVU A;  3VDB A;  1HJF A;  3RZM A;  1VAM A;  2H6C A;  3MPB A;  4ZY9 A;  5CA6 A;  1NCQ A;  1FOD 1;  2BVV A;  1W2T A;  3MDP A;  3AC0 A;  3ACG A;  4V1P A;  3T2O A;  1O3Q A;  1UY2 A;  3HVD A;  1GOF A;  3OSD A;  4RQP A;  5DXD A;  2EXK A;  3W21 A;  1HRV 1;  2VUD A;  2XBO 2;  5C3R A;  2WWU A;  3WHU A;  2GC1 A;  4ERO A;  4FOQ A;  3HQX A;  3ZMO A;  2PN5 A;  2ET7 A;  1LGN A;  5FY0 A;  1IG0 A;  3SKV A;  5J36 A;  1AYN 3;  1RUH 2;  1VBC 1;  3O12 A;  5IVB A;  3PIJ A;  1VRH 2;  5GKA C;  2GP5 A;  3SCF A;  3AZV A;  1G7Y A;  4PHZ A;  1UPI A;  1W8W A;  2PAM A;  1SQ4 A;  1W6M B;  4K40 A;  4LKS A;  2WQ8 A;  1W8Z A;  4LOT A;  4QHZ A;  4DIN B;  1AVB A;  5FRE A;  5A7W B;  1RUE 3;  4IEQ A;  4NRM A;  3DPR A;  4Y22 A;  3WW2 A;  3M2M A;  2HJI A;  2WNV B;  1OQD A;  4LTA A;  5F5A A;  2R49 A;  3KCY A;  1KD7 A;  2RS1 3;  3VDD A;  3WNK A;  1LB2 A;  2VNV A;  1N1Y A;  4D0Q A;  2DU0 A;  3FHQ A;  2A71 A;  2K0G A;  3ZXK A;  5C33 A;  4EN0 A;  5JOX A;  2GH2 A;  3AMP A;  4Q4W 2;  1GAN A;  4XUP A;  4MH0 E;  2BWA A;  1E5I A;  3IT8 A;  5B4X A;  4IEZ A;  1SFY A;  2J1R A;  1CON A;  1CAV A;  3IMN A;  4OI0 A;  1GWL A;  4UF0 A;  3B02 A;  4AI3 A;  4LUM A;  1XQN A;  1MPX A;  2BOJ A;  1RUF 2;  1IZ3 A;  3AJY A;  4FFH A;  2Y6K A;  4MG2 A;  3KM5 A;  1W3V A;  1QWR A;  3DYM A;  3I97 A;  5ANQ A;  1O4Y A;  4QXB A;  4FO9 A;  3B94 A;  4SBV A;  4OI4 A;  3V65 A;  3RGB A;  3GZA A;  3JQW A;  4XDQ A;  1W06 A;  2WFF 1;  3IM0 A;  4FQZ A;  4XFC A;  4CDX B;  4AI2 A;  3V0A B;  3PU8 A;  5FYU A;  5GZC A;  1W6Q A;  1KFX L;  1YLL A;  2WO7 A;  2Y38 A;  2VME A;  1RUF 1;  3WF3 A;  1SEF A;  5ABJ A;  4MYE A;  3I7D A;  3OB8 A;  5FZH A;  4XOG A;  3LZZ A;  1AR6 1;  1UXX X;  1JYC A;  3ENR A;  1OPM A;  4ZS3 A;  3VBU B;  1UY0 A;  2VZO A;  1M06 G;  3T30 A;  2XKO A;  2VW1 A;  3CQO A;  2NMN A;  3IBM A;  5GJ6 A;  5FZK A;  1GP5 A;  1GP6 A;  1DLL A;  2PHD A;  2Y0I A;  2AGS A;  4WVM B;  1MR5 A;  1PMJ X;  1T6B X;  5K0U B;  1JUI A;  1QJX 3;  4NAM A;  3O0W A;  3POJ A;  3KV9 A;  5A32 B;  5DUX A;  4MHU A;  1NA1 B;  2BFU S;  3B7M A;  4W65 A;  2VY0 A;  1AL2 1;  3HNB M;  4K9S A;  2R0F A;  3MFA A;  1DHK B;  4KWJ A;  3RNS A;  2R07 3;  2ID4 A;  2JG9 A;  4XQW A;  5EP9 A;  4QX8 A;  4AED B;  4HKW A;  1GMM A;  1LOE A;  3UKN A;  4CUA A;  5F6L B;  4Q4V 3;  4CDQ A;  2UY9 A;  3WDT A;  2JX9 A;  3NAP A;  5FKB A;  1UKG A;  2D7F A;  1KIT A;  1OQ1 A;  2ILM A;  3SH3 A;  5I8Y A;  1I6X A;  1KDM A;  2VVD A;  4J6G A;  4JKM A;  2EIC A;  4KG8 A;  3WCR A;  3ES4 A;  3CO2 A;  3ZM8 A;  5FO9 B;  1BQP A;  4ORF A;  2IXK A;  3MW3 A;  3TB0 A;  5IK8 A;  3POE A;  1WCK A;  4GMP 3;  1POV 0;  4N53 B;  3MYX A;  4FPC A;  3JZV A;  5FZ6 A;  1FYU A;  3WEZ A;  2E7T A;  5JAX A;  5K0U C;  1WCU A;  3MV1 1;  4CPB D;  1YI7 A;  2WJS A;  1OUS A;  4W8J A;  4A7K A;  1V0A A;  2YUE A;  2J1U A;  2V72 A;  4C1X A;  5KHG A;  2YV8 A;  2BNO A;  2RS5 2;  2EXH A;  2HLE A;  3EMR A;  4X8P A;  5FTT C;  5BPX A;  5K7P A;  1RUD 1;  4F7Z A;  5JMC A;  4YFW A;  1CAV B;  1Y4W A;  4D94 A;  1AZD A;  1FNY A;  4EQV A;  4YVS B;  3VB9 A;  4COV A;  1FXZ A;  1S2B A;  2XGX A;  2OII A;  2DFB A;  1RUJ 3;  1HRV 3;  3FHA A;  1O59 A;  4BQ3 A;  1OKQ A;  1UD1 A;  4FQ4 A;  5DAQ A;  4LBJ A;  4RHV 3;  1YXW A;  3RDI A;  5FPU A;  4QXH A;  1QOT A;  1R08 3;  4MHR A;  3CJI C;  4IER A;  4QQO A;  1G9D A;  4WVV A;  2CSG A;  4HK8 A;  1RUI 2;  5I91 A;  1CX4 A;  5KC5 A;  5L7O B;  1POV 3;  1VAV A;  3DKQ A;  4HBN A;  2A3X A;  5APA A;  2VBP A;  4OMC A;  2XPJ A;  4N7I A;  4LIT A;  2PFW A;  5FPX A;  4ASM B;  5CFD C;  3CJX A;  1O6U A;  1WD3 A;  1LEM A;  1WGP A;  4CUC A;  1FMD 1;  4RQP C;  2CHH A;  4XCB A;  2WAO A;  1K3I A;  3PLQ A;  4K1Z A;  4YNI A;  5IAV A;  4RGA A;  2IVI B;  2CDO A;  1XU1 A;  3SLI A;  1VB2 A;  2LTN A;  5FWE A;  1C8M 1;  1UMI A;  4CEY C;  2GH8 A;  2JG8 C;  3NW4 A;  4M3C E;  3KCX A;  1PNG A;  5CBL A;  3HEI A;  4XMA A;  3N9N A;  2JDM A;  3RWK X;  2X53 S;  2Q8D A;  1QJY 3;  2OT7 A;  1MS9 A;  3N7K A;  3VBR C;  4Q0S A;  2E7A A;  3OGJ A;  3AKS A;  3OG2 A;  5I8T A;  2VR4 A;  3J4U H;  4Y20 B;  4FOW A;  3H7Y A;  1MEC 2;  3AKR A;  1ZBA 1;  5L7O C;  2Q5T A;  2MEV 1;  3KMH A;  1PX3 A;  4DUV A;  4LBN A;  3WDW A;  1GZW A;  2QQU A;  2C9K A;  1ZYB A;  2K2S A;  3ZFF B;  2VCC A;  1GQP A;  2OUJ A;  4COZ A;  4XZP A;  3MIF A;  1AJO A;  2JKX A;  3AZW A;  4YZ1 A;  5FZF A;  5ISL A;  2I74 A;  2OW4 A;  1RC6 A;  3POB A;  4NHM A;  4XQD A;  4DQA A;  1QJF A;  2FCT A;  3FFQ A;  3K3N A;  1QJE A;  1AR9 3;  5J48 A;  3G7D A;  2HWB 3;  4GIQ A;  4QGM A;  1MEC 3;  1SBE A;  5DUU A;  4GH4 B;  4ATE A;  1UPS A;  3VL8 A;  3MEP A;  2Q30 A;  3LSD A;  3NMB A;  3PUR A;  2Y60 A;  4XCA A;  3GYD A;  1ASJ 3;  2YC2 A;  3USU B;  3LA3 A;  1F15 A;  2RJK A;  5C5T A;  2EA7 A;  3NRU A;  3AK0 A;  2KM2 A;  3C7O A;  1CR7 A;  1W8N A;  4NII A;  2JG8 A;  4QB1 A;  1ZRC A;  2FHR A;  3SCG A;  1JZ4 A;  4IND A;  1QIQ A;  4LIV A;  2LUW A;  1VRB A;  4YW1 A;  4B4R A;  4QQL A;  4DY5 A;  1WA6 X;  1UCX A;  5LEJ A;  2DCK A;  4XPV A;  4ONU A;  3D3A A;  4QM8 A;  2PHF A;  2W91 A;  5LBC A;  2YC0 A;  5SV8 A;  1B35 B;  4B1L A;  2Q8O A;  2ZKN A;  3KGZ A;  3M3O A;  3SNM A;  4ZU4 A;  3WQ7 A;  2VNO A;  4WV8 A;  1AYM 2;  4XIK A;  3R6S A;  3FUO A;  2HWE 2;  4YGB A;  2FZ1 A;  3NKG A;  5KR7 A;  2EAA A;  2EF6 A;  1EUT A;  5BYN A;  1OVP A;  3NJV A;  1ZZB A;  4PF5 A;  1PGL 1;  3LSE A;  2VO5 A;  5F37 A;  2XWJ B;  1CPM A;  1ZZC A;  1LOB A;  3AP5 A;  4KWK A;  3SEE A;  1GU3 A;  4XTM A;  3PVE A;  2XUE A;  1FMD 2;  1W6N A;  2JKB A;  5LBB A;  2R06 1;  1H2L A;  4MGI E;  3VV1 A;  3D82 A;  1RUJ 2;  3FLR A;  1RUG 2;  2XVG A;  4MGS A;  3ZXJ A;  2WO2 A;  4XET A;  1H2N A;  2XJR A;  5FZ3 A;  4ZS2 A;  5BNO A;  2KR2 A;  3LDK A;  1M4W A;  4DZG A;  1YQC A;  4FPF A;  3AMQ A;  1HB4 A;  5DN2 A;  2WNO A;  3BCW A;  4XC9 A;  3SXW A;  1KXG A;  4QPW A;  5GM0 A;  4GWJ A;  4BE3 A;  1QEX A;  4CXW A;  1J83 A;  3T4V A;  3O1V A;  3I2H A;  1HJG A;  2W1W A;  1OUX A;  2CU5 A;  2PAE A;  4LXL A;  3UYJ A;  3ZR6 A;  4N90 A;  5IYY A;  2IXH A;  4CCC A;  1VBC 2;  1FAT A;  2VG9 A;  2VOW A;  2VCB A;  4N43 B;  5C71 A;  3A22 A;  3BB6 A;  1AL2 2;  1W9W A;  3F95 A;  1RHI 2;  5DAP A;  2FDG A;  3KF3 A;  4XJA A;  1XPW A;  2IXL A;  2G19 A;  4R9B A;  4GWI A;  4LHK A;  1Y9G A;  1D0H A;  1QF3 A;  1TNR A;  3VBH B;  3VHO A;  2RJL A;  4BQX A;  4H55 A;  5AC9 2;  4URT A;  5KXD A;  5EIY B;  5DG1 A;  2DVG A;  2Y33 A;  3RPQ A;  1UAI A;  2B9V A;  4WM8 A;  4PDW C;  3E1F 1;  3USU A;  1LED A;  2JG9 C;  1CN1 A;  1E5R A;  1O5U A;  2QUO A;  1UMH A;  2RM2 3;  4XJZ A;  5JLV A;  1A78 A;  4G3Y C;  2C1F A;  3AP9 A;  3VDD B;  4DUW A;  4CU9 A;  3KD4 A;  5ANN A;  4AEM A;  3EBR A;  3JU9 A;  2QNK A;  3E6C C;  4XF3 A;  4ZU5 A;  5LK5 A;  4NIG A;  3OGG A;  3ZFG A;  3BOP A;  1Z78 A;  2YXS A;  3AKT A;  3NWK A;  4YVW B;  3VBO A;  4AL9 A;  3VD5 A;  2GNB A;  2XJQ A;  5GAL A;  3I49 A;  3INA A;  5F39 A;  1JYX A;  3OPZ A;  5AVA A;  2A70 A;  2QJV A;  4IGO A;  1GZW B;  4YW5 A;  2GDF A;  3UJQ A;  5JMO A;  1RL3 A;  2R0H A;  3T4H B;  2KA3 A;  2XUM A;  1NE6 A;  2WSV A;  1P8J A;  4H7M A;  4OUL A;  2WAB A;  3III A;  1CAW B;  3ZXE A;  1G9A A;  1CJP A;  2VE1 A;  3V56 A;  4AFD A;  5IVF A;  3D6E A;  3WW4 A;  4R4X A;  1F8V A;  2WWS A;  3NJZ A;  1DCS A;  1AR7 1;  4QWN A;  1WLT A;  4KQ7 A;  1V6I A;  1RUG 1;  3OUI A;  4L97 A;  4XAC A;  4JVA A;  5FZA A;  1UN1 A;  4CU6 A;  2ARB A;  4LOS A;  3DF0 A;  4GZ9 A;  3KF5 A;  1DQ5 A;  3WF2 A;  2P37 A;  3CL1 A;  1OLM A;  2WZE A;  4KBZ A;  2ZX1 A;  3ZR5 A;  1W9F A;  2UWC A;  2XHN A;  4Q4W 3;  1S0F A;  3AMM A;  3NAP C;  3WXP A;  1JYV A;  3GBW A;  1H6X A;  3WV6 A;  3TNQ A;  1OD5 A;  4GXL A;  4OHX A;  1UX6 A;  4AAX A;  3T09 A;  1S2K A;  3ZDV A;  2GND A;  1W2N A;  2C4X A;  4I01 A;  2VL4 A;  5A6Q A;  3WQ1 A;  1K5M C;  1WME A;  2DUQ A;  1MAC A;  2IUW A;  4A2U A;  4IEP A;  4YG6 A; 
#chains in the Genus database with same CATH homology
 2RDR A;  4Y5S A;  4JZR A;  2RDQ A;  3DKQ A;  4NHK A;  2A1X A;  3NNM A;  2OPW A;  4NHL A;  4XC9 A;  3KT4 A;  4NHY A;  3OBZ A;  4ZON A;  5HV0 A;  2JIJ A;  5DAV A;  4XCB A;  3NNJ A;  5IAV A;  3NNL A;  2JIG A;  4IW3 A;  5DAX A;  4XAB A;  5DAP A;  5L9V A;  4Y5T A;  5M0T A;  2G19 A;  4NHX A;  4BQX A;  3GJB A;  2Y33 A;  5IAX A;  5DAW A;  5L9R A;  4UWD A;  5LA9 A;  5ERL A;  4NAO A;  4MHU A;  5HV4 A;  3MGU A;  4NHM A;  3PL0 A;  2FCT A;  5EP9 A;  3KT1 A;  2FCV A;  5LBF A;  4J25 A;  4XCA A;  5LBE A;  5EQU A;  5C5T A;  2HBU A;  3NNF A;  2RDS A;  2G1M A;  3OUJ A;  4NMI A;  5LB6 A;  3W20 A;  5C5U A;  5A3U A;  2HBT A;  3GJA A;  3OUH A;  3OUI A;  4XAC A;  3KT7 A;  4BQW A;  5LBC A;  4Q5O A;  4ZPI A;  4BQY A;  3HQU A;  3HQR A;  2RDN A;  4KBZ A;  5IAT A;  4XAA A;  3W21 A;  3EMR A;  5EPA A;  3ITQ A;  2FCU A;  3GZE A;  5LAS A;  2Y34 A;  3BVC A;  5DAQ A;  5LAT A;  2V4A A;  5LBB A;  4MHR A;  2RG4 A;  5L9B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...