3OUHA

Phd2-r127 with jnj41536014
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
216
structure length
212
Chain Sequence
b'LPALKLALEYIVPCMNKHGICVVDDFLGKETGQQIGDEVRALHDTGKFTDGQLVSQSKDIRGDKITWIEGKEPGCETIGLLMSSMDDLIRHCNGKLGSYKINGRTKAMVACYPGNGTGYVRHVDNPNGDGRCVTCIYYLNKDWDAKVSGGILRIFPEGKAQFADIEPKFDRLLFFWSDRRNPHEVQPAYATRYAITVWYFDADERARAKVKY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Egl nine homolog 1
molecule tags Oxidoreductase
source organism Homo sapiens
publication title Benzimidazole-2-pyrazole HIF Prolyl 4-Hydroxylase Inhibitors as Oral Erythropoietin Secretagogues.
pubmed doi rcsb
total genus 60
structure length 212
sequence length 216
ec nomenclature ec 1.14.11.29: Hypoxia-inducible factor-proline dioxygenase.
pdb deposition date 2010-09-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13640 2OG-FeII_Oxy_3 2OG-Fe(II) oxygenase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.620 Mainly Beta Sandwich Jelly Rolls q2cbj1_9rhob like domain 3ouhA00
4NMIA 2FCUA 4XC9A 5DAPA 2FCVA 3GJAA 5LB6A 5L9RA 4NHLA 3OBZA 4UWDA 2Y33A 4NHXA 3NNLA 2RDNA 2FCTA 5LA9A 5DAVA 2HBUA 2G19A 5LBFA 4BQWA 4Y5TA 3ITQA 4Q5OA 3W20A 3W21A 2Y34A 2OPWA 3NNJA 4MHRA 4XACA 4Y5SA 5EQUA 5C5TA 4BQXA 4IW3A 4BQYA 3KT1A 2JIJA 3DKQA 5LBBA 4MHUA 4J25A 5C5UA 3GJBA 3HQUA 5IAVA 3OUJA 5LATA 4NHKA 2RDQA 3EMRA 4KBZA 2G1MA 5L9BA 3BVCA 3OUHA 3NNMA 2V4AA 4XCBA 3NNFA 5EP9A 2HBTA 3OUIA 3KT4A 5DAQA 4XCAA 3MGUA 5ERLA 2A1XA 5A3UA 3GZEA 5EPAA 5HV4A 5LBCA 5IATA 2RDSA 2RG4A 4NHMA 4NHYA 4ZONA 5M0TA 5LBEA 5DAWA 3KT7A 2JIGA 4ZPIA 4XABA 5L9VA 3HQRA 5HV0A 5LASA 5DAXA 2RDRA 4NAOA 5IAXA 4XAAA 3PL0A 4JZRA
chains in the Genus database with same CATH superfamily
3USSA 3NV2A 3VDDB 4JDOA 1EAH1 3WXPA 1VBB3 3QCWA 2OW4A 4Y1XA 1LHVA 4DINB 3PUQA 4A41A 2OUHA 5DUWA 1EAH3 4G9SB 3AZWA 2WT0A 4AXOA 1PNFA 1GU3A 2HWC3 2JDNA 3THDA 4M3CE 1GNYA 2DUQA 4OCTA 4AFDA 1AXKA 3KV6A 3ZSEA 1W8NA 3LFMA 2WL1A 5JVVA 3SNMA 4WVMA 1UZZA 4FQZA 3W5MA 1RUOA 1W6QB 2XDVA 3VHRA 1DYKA 1Q3EA 2Q1ZB 3IDAA 4AR2A 1BK1A 4DRVA 5JXHA 1A34A 1JZ5A 3SH5A 1FOD1 1D4M3 1FAYA 2RDNA 3RJRA 4AI1A 1S2BA 1O7FA 5A3WA 5A7WB 5FWEA 5L36A 4P9GA 1CONA 1C8M1 3UV9A 1Q8SA 4HN0A 1JMUB 1WCUA 1XPWA 2HWD1 2NLRA 2QQWA 1GP5A 2WN3A 1IG0A 2DBIA 3D4KA 1AYN2 4HT1T 1QJX3 2X29A 1AR61 3HQXA 4P9XA 3Q8BA 3U11A 3U07A 2VE1A 4P9LA 1W8WA 1ONAA 2ZAAA 5A3LA 4CPBA 4GA9A 3KLSA 5GLUA 4AQTA 2ZCWA 2ZGPA 3IB3A 4XPVA 3WG4A 1NCQB 4E8CA 4BMBA 1OC1A 3ZYRA 4LE3A 2GNDA 4R4XA 4FOYA 1QWRA 3ES4A 4MSVA 4YG3A 4BQYA 4EN9B 1KS4A 5C3RA 5FYIA 2ZBJA 3AK0A 3TYJA 5T54A 1CAUB 2YC4A 3HQUA 3O14A 4FVVA 4IESA 3ZN4A 4AI3A 4BPZA 1FMD3 4LNVA 1HV1A 3AJYA 1AVBA 1V0AA 2BOIA 5C4WA 3ZSKA 3LF7A 4QHZA 4AVCA 5F7UA 1V6LA 4O7XA 5J96B 1UX6A 5L7OA 2VY0A 5JXGA 3C7OA 1HRV3 3E6DA 5A7QA 2FDKA 3AKRA 3THTA 3HIFA 2R062 4CRQA 2R043 4URTA 5IFTA 2YMZA 1R083 3LA2A 4OLLA 2QQKA 4YM1A 4E4SA 2GSYA 3DV8A 2W91A 2JG9A 1AR91 2OYZA 1ENXA 1GWKA 3ZN6A 3SMHA 4DOUA 1UOJA 4QPGA 4CDWC 3VKNA 2WO2A 4NIAA 2YUEA 2ZGSA 2OIIA 2FQPA 1DHKB 2LROA 2AACA 1YNAA 1H9WA 1NOVA 2G9ZA 1PX3A 3DL3A 1XYNA 1E5RA 4RGAA 2Q30A 4YGDA 4NHYA 1OLME 3WP4A 2QQNA 2EIDA 2PN5A 2JE8A 2DCJA 1UY3A 4V2VA 4ZZ5A 1UF2C 1HN1A 1W04A 1OBNA 2JKBA 1W6QA 3GZTB 3E5XA 1DQ6A 3DYPA 2VOXA 2WZPP 3OBAA 5A6ZA 4NRQA 5DAXA 3VBUA 2ID4A 2JG9C 2QQVA 4Y22A 1PK6A 1RUE2 1YXWA 1W39A 1DBNA 2BEOA 2HJIA 3KV9A 5AVAA 3HR9A 5F5QA 4CEYA 4JAAA 2VVEA 4L8QA 1BVP1 1WMXA 1XE0A 3VBOA 5EXOA 3WW2A 5FLJA 3ZX7A 1YCIA 3VZJA 5HCFA 3QOPA 1X33A 5F5AA 3VBUB 1UY2A 1CAWA 2SBAA 2OZJA 3MBWA 4QGNA 5GLTA 4QT6A 2E33A 2UWAA 2QQUA 1PO23 4LHNA 1EYBA 1RHI3 3N9PA 3V0BB 1UPIA 2Q4SA 2Q8CA 1QJX1 2GP5A 1LJ7A 1S4CA 4FXKB 3MIEA 4BE3A 1L7RA 2OUJA 5CB7A 1GZWB 3N35A 5T50A 2F4PA 3AKTA 4UW3A 2HLEA 3N4MA 3T09A 2G19A 4BJ0A 5A33A 4YM3A 1TMF2 4GQ7A 2VG9A 1CJPA 3AP6A 3ZN5A 2C4XA 4XHBA 4ZU5A 2Y34A 4N7IA 1C28A 4XF3A 1HB4A 3MIBA 3LOBA 1H1MA 1OLMA 3KM5A 4Q4V3 4Y4RA 1HXS3 1UOBA 1SLBA 5FP4A 4BIOA 3CMGA 1W2NA 2VD7A 1KDMA 2W0XA 4AEDC 2WDBA 2WWSA 1Q43A 3HBKA 5F3IA 1YQ5A 4O61A 3DPRC 3FMGA 4GWMA 1RUF2 3WNXA 5FJKA 1N47A 3B9IA 4HK9A 1DGRA 1QIQA 5LBBA 1LGBA 1AYN1 3LEIA 4OUMA 4QX5A 4MHUA 3ZYGA 5K0UC 3ACIA 2QQPA 1PMHX 2BP6A 3SEEA 4XJ8A 4NHKA 5HXMA 1S2KA 3GHMA 5L9BA 4EYUA 3IBMA 4H55A 5JI7A 1CIWA 2JX9A 1O3TA 4B4QA 2X53S 1QOTA 1XSRA 1SLAA 4P9IA 1CQ9A 4EROA 2PAMA 3TEYA 5GLWA 2ADEA 3T3YA 1S0JA 3O0WA 1KJLA 5EYYA 1RUH2 1H6YA 3OBRA 3VD7A 4A6OA 2Z42A 3WDYA 4JVAA 1EPWA 1LKNA 2D40A 2V4VA 2QFEA 4M4PA 5FBZA 5FUIA 3T2QA 3T0DA 4CCMA 5K0UA 3OCPA 4QAWA 2GN3A 3VHNA 4Y22B 2ZX2A 3N9QA 3GDBA 1OVSA 1O4ZA 3OYWB 1AJOA 1Y3TA 1NYWA 4OI4A 3QD6A 2VCMA 2PLV1 3PUAA 1Q8QA 4ASKA 3DXTA 1OLQA 3HNYM 4DY3A 5I0DA 3M3EA 2I74A 3OGRA 4GZ9A 5IWFA 2FD8A 2QDRA 1QQP3 5F3CA 1GOGA 1JYWA 4AHWA 2VVFA 2N7GA 2W92A 1FATA 4Y24A 5FZLA 5M0TA 1NUKA 3C7HA 3CF6E 4LBLA 4TTGA 3PIGA 3VV1A 2VCBA 2BVBA 3PNAA 4QPIB 2W3JA 1HQWA 1HX6A 3L9JT 1M06G 2P17A 4E8DA 2ZEZA 2RS31 2HWE1 5EHDA 4C90A 4FPYA 4I0AA 5FP7A 1PZ7A 4LA3A 4ZU4A 2RS13 3SH3A 1O3QA 3H3ZA 2HWF1 5I93A 1MEC2 2EF6A 2BVVA 4LK6A 2D6NA 3MEPA 1OT5A 2BOJA 4ZKTB 2FCUA 1D4M1 4DUVA 5DG1A 1OKQA 4LORA 4EN8B 3F95A 4AFAA 1IKQA 3NO8A 2E31A 2YXSA 4NOTA 3I2KA 3NJVA 1TZOA 1LB2A 2AC1A 2YY1A 2WA3A 1RINA 5FJHA 3OBZA 4J6GA 4CP1A 2CV6A 1U12A 1WKYA 3UT0A 1AR72 1O5LA 1PVC2 5JXIA 3IPVA 4O9EA 2E63A 2P6HA 3M8LA 4QGLA 4GWJA 4CCNA 1Y43B 1PIV1 3WNKA 1IQAA 2VMCA 3MIDA 4DO0A 1UMHA 1H1AA 1W6MA 1XNCA 2ZMNA 3AC0A 1QJFA 1QXPA 2RS11 4KWUA 2XPJA 2VW1A 1TMF1 1BXHA 2WZR3 4URAA 3AP5A 4Q4Y1 4NAMA 4RR3B 3V0AA 3GBWA 2Y26A 4FPHA 1QH6A 4XFGA 2KXLA 1U5XA 4XIKA 2RR13 2JDMA 4Q8KA 5A3OA 3NNJA 1OF4A 1JZ3A 2EALA 2PQSA 2VMGA 2A6WA 2MPFA 5DZGA 1NAEA 1HJFA 3WF1A 3D3AA 4QPGC 3DUIA 5LWBA 2WFF3 4OHYA 3DKQA 1OFSA 4XUOA 2Q0AA 4QPWA 4YRDA 3GYDA 1ZBE3 3C7FA 2JKXA 5C5UA 5H9SA 3VLBB 2X8KA 1JUIA 1LOCA 1MEC1 1PHMA 1UY0A 1VBE1 1F9KA 3KGZA 5CAZA 1V70A 1WBLA 2HWE3 2R0HA 1QOSA 3PUHA 4Y20B 2W1UA 4AEKA 4DEVA 2YPDA 5CEHA 3WX5A 3ZYPA 2RS32 3LD8A 2VUCA 5FY8A 2JD9A 2VZQA 1RIRA 2ENRA 3UYJA 2QBXA 1YFXA 1ZYBA 1ULGA 4B4PA 1PNGA 4HVOA 5DAQA 5DUUA 4UFMA 3ZO0B 2HYKA 3AP7A 3NKTA 1MS8A 3G7DA 3ORJA 4QDRA 4NIHA 1UW8A 2MEV2 1KITA 2C5DA 3B9CA 4ATEA 1CZSA 2QQOA 4RR3A 4XUNA 3ZIWA 4UAPA 3O5SA 2J1SA 5F32A 1MS5A 2D5HA 1A8DA 1LCLA 3A21A 2Z5WA 1ZNPA 4JRLA 4AAXA 1DYPA 2XL7A 3WF3A 2R49A 1CAUA 5H9QA 5IUQA 3ZM8A 4I3GA 5KXCA 4IEQA 3B02A 3DF0A 1ACCA 4RGGA 3I49A 3ELNA 4G3YC 3OGVA 2GC3A 4XW3A 2JDHA 2YGMA 4YM2A 2E26A 1AR92 4YW1A 1A8MA 3BTZA 5HCBA 2BFUL 3H1YA 1STMA 3RZZA 5D2AA 4Q4Y3 3VBHA 2WZR1 4IDZA 5LY2A 1V6OA 2WNUC 4MGTA 2CY6A 4LTAA 1LGNA 4XE9A 3ZXLA 4A2UA 5JUVA 2F17A 3I54A 3J26N 3OD0A 4K8FA 5LK5A 3S6PA 3WDWA 4TLGA 1RUJ2 4BK4A 3ACLA 2XWJB 2B7YA 4HKWA 1PIV3 1AR82 2E32A 3UESA 4GALA 4PIXA 1H2NA 2XH6A 5FBJA 2XONA 5IK7A 4WM7A 1N3QA 4YW5A 3RMYA 1WA4A 2WUHA 4NHLA 1DP0A 4RA0A 1W9WA 2XHNA 4GJYA 5DQ0A 5A3PA 1GWMA 4MGQA 1QOOA 5D8AB 4D7SA 2Y33A 1W2UA 4K9SA 3FBMA 3JBG2 1US2A 4YGEA 4GKXA 4UBHA 4FTEA 3FC0A 2QE3A 4WVWA 5FP3A 4DY5A 4IGOA 4Q0UA 4LPLA 3I2FA 4WVVA 5AC93 3NJYA 1U5IA 2D7FA 1JU4A 2QVSB 4B7KA 3MYXA 1CAVB 1RJ7A 5I8SA 3I8TA 4OZXA 1PVXA 3D5OA 4V2WA 4TXWA 2VBDA 3ACGA 3PTYA 1XU2A 4I09A 3VD3A 2VXJA 4PBPA 2A6VA 3MV01 4LBMA 2OPWA 2VO5A 4Q1RA 3HVDA 4LBJA 4X6QB 2QDNA 1UY1A 1VJ2A 1X8EA 3B3QE 2J42A 3U75A 1XYPA 2PHDA 5A32A 1OPOA 4OI2A 1XU1A 1KJRA 2ZGQA 3P6BA 5FZ8A 2WYSA 2JIJA 3IAQA 3KT1A 3RS6A 3AMMA 3W59A 4EWDA 2BGOA 1H9PA 4BLIA 3DCQA 4D0QA 3SC7X 3K77A 4BM8A 4DIQA 1COV1 2BBAA 2BGPA 2VZOA 2GNTA 2CWSA 5GLZA 4AHXA 3PVNA 4NRMA 3O1TA 2AENA 2OA2A 2XBO2 1WMFA 4P02B 1L7QA 1ZA4A 2HWD3 3ZYHA 2MHFA 2HWB1 4H7MA 2YHJA 4QX0A 2AGSA 4MGIE 1BMV2 2A5ZA 1GUIA 2YDEA 3OUIA 5FYZA 4W6WA 3VZNA 3RYRA 4BU2A 2P37A 1ENSA 4F7ZA 2EAKA 3X29B 1L3JA 1PK6C 1HQNA 3I59A 3M3QA 3D6EA 4RFRB 3AVRA 5ERLA 4LR4A 2D3PA 1C8NA 2DV9A 5ANQA 1WLWA 1FI2A 4PLMA 2BRTA 2DVGA 4HFSA 1YO8A 4Q29A 5DDJ1 5APAA 4KL1A 5LBCA 4PQ9A 2ZX0A 3AMPA 2LALA 3UGFA 2HH9A 5CADA 4CYDA 5FPBA 1N1VA 1QH7A 3ACHA 5ACA3 3EO6A 2XJQA 4LBQB 3O1OA 5KR7A 3WQBA 2I2SA 4CDUB 1HXS1 3NQHA 5ABJB 2X05A 3CEWA 5CZKA 4P9YA 2MNGA 4CDWA 1BEV3 1V00A 2VR4A 4K1ZA 5KHKA 1PO13 4N43A 3WNMA 1LTEA 2XJRA 4Q0SA 1K5JA 3W9AA 1CZTA 2ORZA 4RFT0 1B35A 3BU0A 1I6XA 5C9AB 2JD4A 2O8QA 3HEIA 4IEUA 1YEWA 1TME3 3AP4A 1CAVA 4Q27A 4FPKA 2XKOA 3S7IA 5EJ1B 3OGSA 2FCVA 4DFSA 4IV1C 5JZGB 4KNCA 1VRH3 2B8MA 5IFPA 5CFDA 4LHSA 3R0RA 5FZKA 2W87A 3AB0A 1RUI2 1MQTC 4CUCA 1YIPA 1Q56A 4PLOA 5BNNC 2RMU2 3FFZA 3S5QA 2W39A 4XIOA 2PHWA 3LA7A 3PUIA 1ULPA 2JDKA 4KGGA 1S0BA 2R16A 4AQ2A 4W6YA 3U4XA 3HNMA 3BTXA 3VBUC 2EXKA 2YFUA 3I4IA 5FXVA 2FZ2A 2GMEA 1C8M2 3AZYA 3CBNA 4B1LA 5A80A 2WA4A 1AX0A 3CZJA 1VBD3 2BWAA 4UW5A 3RNSA 4M01A 3TAYA 3WG1A 2Y64A 3ZFGA 2XUEA 3QH6A 1H4HA 2VAUA 3TEWA 1UOGA 2RS53 1DYOA 2JB8A 4HZFA 3R6SA 3ZXEA 5IT6A 1NQJA 2P6CA 4FPCA 1AF9A 2RVAA 4D6RA 4CUBA 4IV3B 4WM7B 1WW4A 2LUWA 4QM8A 4QQPA 5KWRA 4ATFA 4CA9A 4LXLA 1CWPA 1J59A 5C5TA 2E53A 3R05A 1O59A 4IE0A 4AVBA 4W6XA 2JG8C 2FDFA 1QJZA 1ULCA 1D7PM 1Q8PA 1SG3A 2YU2A 3KD4A 4XUPA 1PGW2 1GP4A 2IXLA 1NCQC 1POV1 2GDFA 5CA6A 1KFXL 1AYM1 4FQ4A 2J7MA 5IJRA 3WD5A 3C3VA 3DPRB 4ISRA 4CXXA 3U37A 4MH0E 2ZX1A 1Z78A 1GV9A 2XMLA 3GCWA 4XBNA 5F3EA 1YQCA 1JN2P 1WD3A 4YM0A 3WV6A 5K0UB 4QX2A 1AXYA 1Z0HA 1JI6A 3A0KA 4KWJA 4R9BA 1ASJ2 1UNBA 1R091 1W6OA 2RM21 4LOSA 3OPZA 1HRI3 5EJ3A 3WNNA 5GZGA 1AR62 2P3IA 1NG0A 1Q5OA 4J1WA 4P5YA 3ZFFA 2YBSA 5EIYB 1LU1A 3VBHC 1BLZA 2YGLA 3DPRA 4WZCA 3WOGA 5CFDC 5DUXA 2Y6LA 5FY1A 2PHRA 4SLIA 3VN4A 1J84A 2DU0A 4BXFA 3WCSA 3RWNA 4XFIA 4F3JA 1LEDA 1QNYA 1VBA1 1RUNA 1DGWA 2ARCA 1W8UA 2ZMKA 1ULOA 2ZHNA 5FYCA 3OG2A 4QGMA 1UPSA 3RJ2X 1F35A 3NSTA 1Y7BA 2WT1A 4QDSA 4WM8C 5FY7A 4EWEA 2IXIA 2CNAA 1BKZA 3S5AA 4G4FA 4LHKA 1LULA 3NNGA 1UWWA 2JDZA 2I07B 2OQ6A 4RR3C 2H6CA 2B45X 2P2KA 4A3XA 1J3RA 1CAWB 2RM22 4XTPA 2AREA 1NZCA 3WLUA 3FWEA 3OYWA 5CISA 1ND3B 2IWGB 2PHLA 2VOWA 4KU8A 4NVPA 3AZZA 3L2HA 2VULA 3I3BA 1ENRA 5I0SA 4XC9A 2JB4A 1JOPA 1R1A3 3U4SA 5GZCA 1KGYA 4JGYA 2LRPA 1GNZA 4DRRA 4L99A 4U2AA 1H0BA 4Q4W1 1GKBA 1PGL2 1VE0A 3KVAA 1KD7A 2WC2A 2J1RA 1DGRN 2X5IB 4JTNA 4QB1A 3BOPA 3NMBA 4QU1A 3AYAA 2D5FA 2HEVF 2ZGRA 5CKMA 2DCTA 5D1IA 2A75A 3AFKA 4QXHA 1HRI1 1LHUA 5BY5A 2IVJA 4IE7A 2PLV2 1ODMA 4FBFA 1GZTA 2ZXQA 2VBBA 5EZWA 1QXRA 2JDAA 5LRSA 1PMJX 1LESA 1LOFA 1S0FA 2VZPA 4P08A 4YG6A 5DAVA 3LCPA 2QJVA 4YARA 4KMQA 1OA3A 2ARBA 1OOPB 4Q5OA 3IDEA 1FT9A 3RYPA 4GXLA 2ZGNA 3NKGA 3SCGA 3GGLA 3MW3A 3WW3A 1YWKA 4IEWA 5DDJ3 1OF3A 1W2AX 1VP6A 4XMIA 4CEWA 4YVSC 3OY8A 4B29A 2FBEA 2JENA 4IEOA 2OT7A 1EPZA 4QKBA 4AVSA 4LIVA 1O8PA 1ND3A 1RUC2 1NLQA 4GB31 4R4ZA 1DQ4A 1L7LA 2HWB3 3BTAA 1XE7A 3K4DA 5FYTA 5C70A 4CEWB 3U14A 4RL7A 1PO11 4EE2A 3V65A 4GMP1 4YW7A 4GWIA 2YFZA 5F6KA 4MGKE 4N9IA 5FKBA 4BISA 4QQHA 4YZ3A 4PT6A 4YZ5A 3PURA 2YB7A 3D0JA 2YC2A 1LOGA 3GCXA 3ZR5A 4LO6B 1S1AA 2DUPA 2DVBA 2BU9A 1LU2A 2ZA9A 1JXNA 1XB9A 2GP3A 4QHBA 5IVYA 5BNOB 1VB2A 3H1MA 3W5NA 1POV0 2D6MA 3I7DA 5DZEA 1WGPA 3K4ZA 4XCAA 1BCXA 5FYBA 4QX7A 3WQ1A 1XNBA 1DZRA 2VXRA 1C4RA 1O8SA 3NW4A 1V9U3 1GANA 3V64A 3ZMOA 1REFA 2CGPA 3U0ZA 2WO3A 4IUGA 3GZAA 4Y4YA 5FPAA 5T5JA 4XF0A 1AR81 1FMD2 5FPZA 1SQ4A 4XJZA 3MI8A 2CAUA 2C9KA 1LHOA 4ZONA 1VBE2 5F9TA 1X82A 1HRV2 2XL9A 3RQ0A 4ZPIA 1ASJ1 1C5IA 1SACA 3T2OA 3WINE 3BKZA 2EIEA 3HNBM 4OZOA 1G8WA 2EXJA 2HKXA 1B35B 1V6KA 2ZEYA 3PIJA 2RDRA 2VMDA 1MS3A 3T0AA 1QJY1 2DDUA 5FZ4A 2VZVA 5H9RA 4DXTA 4CU6A 1GLHA 4CP9B 3MW4A 2RJ2A 3RG0A 4LK7A 1N1SA 4COVA 2JEMA 1SDDB 2RJKA 1OH4A 3MFCA 4GH4B 3POGA 1WA6X 4HXCA 4UFHA 3SKJE 4B7EA 3AZVA 2FDHA 4AI9A 2UU8A 2PELA 1OLRA 1OI6A 2HYXA 2XVKA 4GB32 1SMVA 2ERFA 4DXZA 4KG8A 2W08A 3USUB 2R071 1RUJ1 2XLFA 3PTRB 4O65A 2ZACA 4XJUA 1WLDA 4WVMB 4X8NA 3UKVA 5FYSA 5FZEA 4ZXEA 4XDQA 2JECA 4JV4A 3N9MA 4AHYA 1V6IA 1WLTA 4BQ2A 3U10A 2VQ0A 2VOVA 3S30A 4OYUA 3J7MA 3TNPB 1CGPA 1AL0G 2O14A 5FZHA 1UZVA 1SFNA 4AEDA 5GKAC 4UF0B 4E4DX 3GBFA 3U1XA 1VBC2 3A4UA 2TUNA 1LOEA 1CESA 4FP2A 5K7PA 3GM8A 3WDUA 4AVVA 3ZFEA 2CDPA 1PGW1 2QKDA 3JCIA 3TN92 3LAGA 4FPJA 1NXMA 4IXLA 5FUNA 2RMU1 3S0MA 1YC61 1T6GC 3LOIA 1AUYA 1REDA 1UAIA 2PFWA 2R073 5FZ1A 5K4LA 4CP0A 3O1SA 1J3PA 2IXJA 1O3SA 3B94A 1W03A 1NE6A 1DIWA 2VMHA 3A23A 3JXSA 4IW3A 4XEZA 4UFLA 3I97A 3UKNA 1MZFA 4CSWA 4JGZA 4HETA 4OVEA 3B00A 3U78A 4A7YA 2FDIA 1ZVFA 2PHXA 3IMNA 3M4FA 1QJU1 1RVF1 3QACA 4L2NA 3A0NA 1F4HA 1SFPA 3HAGA 4MGZE 5DABA 4CDWB 5I0RA 4KBZA 3ZXJA 1G6NA 3P3PA 3ZKYA 1REEA 5J37A 2D97A 3VKFC 4YW2A 1QJY2 4OI1A 1TMF3 2QTWB 2NMNA 4R9DA 1K5MB 3EBRA 1BYHA 4XCBA 2W46A 4ZS2A 2D44A 3OGGA 4OFGA 2D3RA 2HBTA 4IGPA 1G9CA 3ZFGB 3FLTA 1OXCA 5HCHA 4LBOA 2BGCA 1CAXB 1JOBA 4NO4A 4RS5C 1ZRFA 1JZ7A 4I0WB 2VTXJ 4H14A 3VDDA 1ALYA 2IXCA 1JZ6A 3LEMA 5FOJB 2NP0A 4GJZA 2WINB 4CE8A 1VBA3 4QPGB 4Q26A 3ZVXA 5FY9A 3OF1A 2D6PA 4Q0PA 4BA6A 3ZXFA 1NA1A 1NCRA 1NT0A 1CJDA 4N8MA 4RS5B 3WHUA 1EV11 4CEYC 3EXUA 2ZAHA 1G9FA 3INAA 4WBBA 3WDTA 2VZUA 1D0HA 1EP0A 1CIYA 5FIXA 2FMYA 2V73A 2ZHLA 1T2XA 4HPKB 1HN0A 1ND2B 4AWDA 4AFMA 1HQLA 4NR1A 5E8AA 2BNOA 3TEXA 4CCKA 2ZX4A 1BMV1 4XFFA 3VB9A 2ZGKA 1YI7A 1RMU2 1CPNA 1OOPC 4YVWC 4LO7A 1Z7S3 3Q9OA 4JKLA 1LR5A 4BLJA 1PVC1 5C71A 2BNNA 4EV0A 5IK8A 1SLTA 2ZX3A 3PL0A 3ROUA 3ZFFB 1LOAA 2WLPA 1FPN2 3J8F2 3O1MA 2ARAA 1Y9MA 2W1SA 2ZGUA 3PVOA 4GAZA 4AEDB 4JKMA 5ABJC 2YU1A 1XOYA 3WG3A 3T08A 1JTZX 3R4DB 4I02A 1W8HA 5DAPA 4BDVB 1JYXA 4AOCA 4YVWB 1QQP2 4S2HA 5F1RA 1IZ3A 1UXZA 3BALA 1MZEA 5EJZB 2VGDA 5C9AC 2X5IC 1R092 1VIWB 5HCAA 5KBFA 2B9VA 3VBRA 1G7YA 4Q4W2 2VZRA 4A45A 1PGL1 2EXIA 4QPIC 4AEMA 4DUWA 4XQ4A 1YQ8A 2Q1MA 3GBGA 4AFCA 2ZHKA 1MVQA 1UMIA 3N36A 5J36A 1JZ8A 1UYZA 2XLAA 4NWWA 4B4RA 5HXVA 2H0BA 4XZPA 5E16A 3VBFC 5SV8A 1RUG1 4Z92B 2KM2A 1OHFA 4XETA 5K9YA 2NN8A 2Y0OA 1AL23 5LA9A 4BZ4A 4C1WA 3AX4A 4YZ1A 5BNOC 4DEQA 1RUG3 2GNMA 4HLTA 1SCSA 3NAPC 5FY4A 3VZLA 1C3HA 4PBOA 5D8AC 3WF4A 4DPNA 3AJZA 4C1XA 4QB6A 2VJXA 2YZ4A 2C1FA 3A22A 3C7EA 3M2MA 4Y20A 2Q1FA 3MV11 5FKCA 4IEZA 3I2IA 2A6ZA 4FPFA 3WNLA 4BIFA 3MIFA 3SHRA 5FZOA 2XJSA 2A71A 5BNOA 2WFF1 4A7KA 5JR7B 1SBEA 5FMBA 1W3XA 1OQEA 1KQRA 3AZXA 5A6XA 1ODNA 1QF3A 3VBFA 2NYYA 5LRRA 2PQQA 1ZM1A 3P5BA 3PUSA 4WVZA 4D7YA 4Q4V1 4EN7B 1X9TA 4H7LA 2HWF3 1D4VB 1P8JA 1GMMA 1KEXA 2TNFA 3LA3A 3NVCA 4GWNA 4MZUA 5ISLA 4IEVA 3ZPYA 3H42B 1POQA 2IUWA 1QKQA 1WCQA 2WZR2 3NJXA 4HPKA 5K8SA 1LODA 1ZA7A 3BN6A 3FLPA 4QHOA 1OURA 4CXWA 5CKNA 2QZ3A 4MX3A 3N7LA 2VUJA 4LULA 2VUAA 3SEPA 2Z4FA 4XQDA 4KGQA 2DVAA 4MGYE 5FQ0B 1NCQA 4UBGA 3HN3A 5H9PA 4XXAA 1EV13 3I2OA 1QJU2 1RVF2 2DCZA 1I5PA 2UY8A 2WFF2 3GZEA 1G9BA 2DFBA 1X36A 3CL1A 3QLQA 4HBNA 1VBB2 5C3PA 2R0FA 1GZ9A 4RYDA 2CAVA 1K12A 5JZGA 4EN6B 3HJRA 4CVUA 5JDBA 2DCYA 3POSA 1GSLA 2HWC2 4RQPA 1VLNA 5LA2A 4RSUA 4JHTA 4XVHA 4DNYA 2W5FA 1MVEA 2PHFA 3FN9A 4HKOA 5T5PA 3O1UA 1DCSA 3LDKA 3MO4A 5JMCA 3LGRA 5A1FA 4ARXA 3IMMA 5D8AA 4LITA 1AYM3 1MS0A 4RGKA 3FZ3A 3KF3A 5LASA 4M4RA 5FZ9A 4Z2WA 3KHCA 1RXGA 3MLLA 3KV5A 1PO21 2ZMLA 3E6BA 3NJZA 1YFYA 2ET7A 2YBKA 2ZGLA 4XQWA 2XLGA 4JRAA 3RYKA 1UO9A 1JU3A 4AQSA 5I8TA 2X09A 3ZYIB 4DXRA 2AEYA 1VMHA 2W9XA 1IPKA 3MW2A 4UOJA 5CVRA 3N9OA 5FK7A 1QQP1 3KMHA 4LO5B 1Q8VA 4MXWB 5FZGA 2V72A 5L19A 1S0GA 1LHNA 4KWLA 3GJAA 3VBRC 5IVEA 1FXZA 3VD9A 1COV2 5GM0A 2GC0A 1O4TA 4KG0A 3TWIA 4OHVA 2VZ3A 5SV5A 4AGVA 4E2QA 1UQXA 3QH7A 4QD2A 4NHXA 4DS0A 5LA0A 5AVPA 5FZ0A 1FX5A 1OSGA 1UKGA 2B9UA 3JD73 1RB8G 1HV0A 2CSGA 4FP3A 2EIGA 4Q4Y2 4YFWA 5FPLA 3AYCA 1V6JA 3VBFB 5JOWA 1ZBA2 1NKGA 4XJWA 2ATFA 4IQPA 4BCUA 1W8TA 3Q8EA 4JTOA 5L73A 3J9SA 4JQRA 1C57A 4C0HA 4HMZA 5C3QA 1RUF1 1GNHA 1PIV2 4JKKA 3KGLA 5FYHA 2V09A 4CDUC 1AX1A 2YROA 2R063 3BU7A 3RGBA 5IYYA 4CDXC 4MYEA 1R082 3AXEA 1DLLA 4KWKA 3JBG1 2ES3A 3Q8CA 3WQ7A 4CEYB 1FYUA 4XACA 5ACA1 4BMEA 1W6NA 2CYFA 2WO7A 1TEIA 4Y33A 2PAKA 5FLIA 1LOFC 1R64A 1IS5A 3JBG3 3WUCA 1WUVA 2DTWA 4UFJA 4EN0A 4FPGA 4FPLA 4L97A 4YPJA 4K3UA 5C7GA 3P1IA 4Q4X2 3CU7A 3FUQA 3ZYFA 4Y5Z0 2VZ1A 1EY2A 1YQ2A 1UOFA 4QKFA 4PIYA 1QJX2 2VQAA 3ETPA 4PI0A 1ZREA 5JI9A 1QDCA 4DMIA 3WW1A 1S2EA 2UWCA 3SH4A 2ILMA 4LO8A 5EV7A 3OPWA 1Y4WA 3T0BA 2BDRA 1SHWB 2D93A 3DYOA 3N3HA 1N1TA 3PJQA 5BUVA 4AL9A 1PZ8A 4AI8A 3OSDA 2E9QA 1OQDA 1VBC1 3CZUA 2R1BA 2PXJA 1BBT3 3BPZA 3LDRA 5LEJA 4L11A 4N43B 2UURA 4COUA 1UIKA 3MIGA 1C1LA 2Y0IA 2QQLA 1W9SA 1ZZ9A 4O9GA 1UIJA 3POYA 3O12A 4FFIA 4N90A 2XWBB 1YFUA 1ND2A 2IFRA 3VKMA 2OQ7A 1W2OA 4QXBA 1MZ5A 3AP9A 5LBEA 3CJIB 4RQPC 5IW0A 1PO22 2FDGA 5I0UA 1IGOA 1VAVA 1XE8A 3BCWA 2DU1A 4LLOA 2OXBA 1NX9A 2R042 2VOKA 4K21A 5FR3A 1XJAA 2RS51 1VAMA 2WWUA 1QEXA 3ZOIA 5FYVA 4JHZA 4OUSA 2JG8B 2ET1A 2WNVA 4PDWA 4XUTA 4COWA 3ZIXA 1W06A 1S0CA 1LENA 2VVDA 2QQJA 3AYEA 3DYMA 3GHNA 5CKQA 1DQ5A 1HW5A 4NMIA 3ZFFC 4OMCA 4NIIA 3EHKA 5IVCA 4OHXA 5C9AA 1I1EA 3NWKA 4CUGA 3KV4A 1J1TA 3PJYA 5FZIA 2OPKA 2UYAA 4JQTA 4YSFA 1H2MA 4PDWB 1HXS2 3GXUA 4CCLA 1SZBA 4LKDA 4P14A 3WNPA 3CDZB 5FPUA 1KS5A 1OVPA 2VZTA 3MPPG 3WVJA 4P00B 2GU9A 3MIHA 1RUF3 3BPSA 4AI2A 2W68A 4QM9A 4OHWA 3ZN6B 1OH3A 1G9AA 4Q0VA 4Z2AA 1X50A 1MS9A 3NV1A 3H7YA 4BH9A 1SLCA 1VRBA 1V6NA 2XKPA 1RUE3 3KCYA 4HOOA 3PLQA 4XFCA 5A7OA 4BQWA 4CCCA 4Y5TA 1JHJA 3ITQA 1MACA 2VZSA 2Z79A 5LY1A 4U36A 3UGHA 1RUH3 2BPA2 4LIUA 2Q8OA 5KXBA 3ASIA 3AM2A 1IOAA 3CJIC 1DQ1A 3THPA 5FQ0A 2B42B 3E5QA 4RHV3 4D3WA 5JOYA 1RHI2 1RMU1 4BQXA 4FXGB 5FXXA 1XNDA 4E2GA 5J09A 2CTVA 4UFIA 1YQ6A 2I45A 3FUOA 3I2GA 3AKQA 3LEGA 3GJBA 1W9YA 4XZUG 1RUD2 2HEYF 3MHZA 5FZMA 1OMIA 3KVBA 4NE9A 1AXZA 1UYPA 5B4XA 1FV3A 3UETA 1VBD2 1DQ2A 2V4AA 5FK8A 3AVSA 3H3LA 1QGLA 3E5UA 3ILFA 4FFHA 4YW6A 2VPVA 2RS52 2WNOA 1I9RA 2PTMA 1G86A 3B01A 5E6HA 3O1VA 4AG4A 2WAAA 4A6SA 1W2TA 5FTTC 1VALA 2YC0A 3AXDA 1DGWX 3M3OA 5CFCB 5I8YA 4OMDA 3B69A 3KT4A 3VZOA 3THCA 5A6YA 3RVHA 3R4SA 1GZWA 3LPGA 3KZ4C 4UW4A 1PM7A 3I2HA 3H0OA 2H6BA 1ZZ6A 2WS93 3B7MA 3J7HA 1SFYA 2WBKA 3TNQA 1J3QA 2OZ6A 4QXKA 1OOPA 3WUDA 1W9FA 1UU6A 4QMAA 4TYSA 5A33B 1PM4A 5IATA 4CEWC 1CX4A 3ILRA 2RDSA 3VKOA 5A6QA 1H30A 2CGNA 4CTEA 1WCSA 3LKJA 2B4KA 1PX4A 2P3JA 5JOXA 3K3NA 5DAWA 2A6YA 1AR73 2GNBA 4BXSV 4ARYA 4OUEA 3V0BA 2R061 3KS7A 4EQVA 1YRZA 2ORXA 1YYNA 5L9VA 3E6CC 3K3OA 4B8EA 3JZVA 3MICA 3AL6A 1QJEA 4BK5A 5E88A 4CDXB 4FO9A 2Q8DA 3VL8A 2HEWF 2WN2A 5A7PA 5KC6A 4NPMA 2VMEA 3UGGA 1C1FA 2A73B 2G9GA 4XMAA 1JH5A 3TN91 3WDVA 2IXKA 4A4AA 1TQ5A 4Q8LA 5DN2A 1RXFA 3V56A 3KCCA 2RR12 2WIIB 3HD8B 4A7ZA 1O3RA 1NLRA 4C0BA 3JB8A 4EZHA 1LRHA 1J1LA 2GZWA 2WQ8A 4K6BA 1WW5A 4N53B 5DMYA 2BBVA 3EQEA 4HK8A 4M0NA 2ZOEB 2VBPA 5A7WA 5IHRA 5FMDA 1VR3A 1MS1A 2RM23 2RJLA 2WT2A 4N9HA 4XFHA 3CKHA 4BB3A 1UX7A 4QX3A 3RFRA 5A1LA 2DUOA 4LEJA 5TSWA 4DZGA 1BVVA 4MVTA 5F2WA 3SCHA 4K7JA 1QXJA 1UKRA 2WAOA 2PHTA 1F31A 3WHTA 3WW4A 2ZKNA 5BYNA 1BHGA 1X7NA 4HN1A 2HWE2 4Q1PA 3PHMA 1S0IA 2WFPA 3WR0A 4Q4X1 4PCRA 4Y1VA 2XHKA 4QB2A 3W20A 1R1A2 1RHI1 1ND2C 3K75B 1DFQA 1VB4A 3T4VA 3UKTA 5B4NA 1QU0A 2A6XA 4MHRA 4MV2A 5J98B 5HBAA 3OJBA 5F3GA 5ANNA 4JDNA 5A3MA 3I3DA 3JU9A 4IE6A 2AZ5A 3SXWA 5C8CC 4QQ2A 3KHBA 3CLPA 3RZMA 1A3KA 3O0XA 2BFUS 2ZHMA 5JSPA 4WM8B 3VBHB 4K40A 5LW9A 5CFCC 2H0VA 2Y6JA 3O1PA 5CFDB 3EYPA 5HPOA 2EAAA 5FPVA 1JODA 1ZZCA 1U0AA 2X5IA 4LJHA 4ORFA 3T1LA 3K51A 4B1MA 4M3CF 2ZZQA 1K42A 2Z2SB 4M3CB 4LKSA 1FMD1 3IKWA 1AL21 3NNFA 5A3NA 1FOD2 2WQZC 3ENRA 4LUMA 5DDJ2 1GQGA 5C3SA 3CQOA 1UY4A 1Y9GA 1KRIA 2BJSA 4Q0QA 4YW4A 2DWRA 1WMDA 4HANA 5CG8A 3OPTA 3AFGA 2OS2A 2WKKA 4HL0A 5J48A 2A1XA 5A3UA 1UD1A 1BJQA 5HV4A 1IKPA 1OUXA 1RUC3 4LOTA 4I30A 1NZIA 1ZBE2 3IDCB 2GAUA 4IEXA 2P5BA 2C24A 2HWB2 1T6BX 3GF6A 3IDBB 1EAH2 2XQRA 4D7TA 2VTXA 1I3HA 1HLCA 1BZWA 3A7QA 2WLQA 5FZ7A 4XF1A 5FYYA 5FRAA 2EICA 3ZPOA 5FY0A 4AAPA 3KQ4B 2PHUA 3ETQA 2XJTA 4GD4A 2R041 4LKFA 3WG2A 3ILNA 5EFUA 2IC1A 3URFA 1RUH1 1UU4A 4ITCA 4FAHA 1TVGA 5KXEA 4XDOA 1I5ZA 4AVTA 4ISQA 5FCCA 1D4M2 3MF9A 4Y26A 5T3NA 4AW7A 2CGOA 4Y1UA 3B5LB 3BODA 3Q8FA 4NAOA 5KC5A 3VDAA 4CCOA 1YHFA 2Y8KA 4V1PA 1OFNA 4MADA 4WV8A 5FO8B 1XYOA 2MEV3 3VDCA 3GNEA 4L0PA 1AYN3 3WEZA 3SQOA 2Y6GA 4BOWA 3HT1A 4BYYA 1W0PA 2WNUB 3VUOA 4TSVA 1VBB1 3H8UA 4B3NA 1XNAA 4PQQA 4AK3A 4M3CA 4ZXKA 5L9RA 3VL9A 1H1IA 4CZSA 2D6KA 1F5JA 1IHMA 2VCCA 2KA3A 2C9AA 2G9FA 4CP2A 1MS4A 2XVLA 1AR93 5FMOS 3FLRA 5ABJA 3IZOA 2O8OA 4JGZC 4N53C 3ZXKA 2TEPA 4KI5M 2PYTA 3FHQA 5F5CA 5F2SA 4KBBA 3VBRB 2WZEA 3ZXDA 5BNPB 1YI9A 2DFCA 1ULEA 4F83A 3TEZA 3RRDA 2OKXA 2AUYA 5JCTA 3IPVB 1E5IA 2ADDA 5FZ3A 5A32B 4COZA 5A70A 2XBO3 2R6QA 2J1UA 4P5HA 4XJAA 1BK0A 1EUTA 1ST8A 1WLCA 2HWD2 1NY72 2BQPA 4DXSA 1AR83 1XSQA 2P1BA 3HOBA 4AGRA 5F6LB 4CDXA 4RD7A 3IWZA 3WNOA 4GB33 1CR7A 2FMDA 2E7AA 3T1MA 3OGJA 1VAKA 3CJXA 5JIAA 4PJYA 4R9CA 3MFAA 2AYHA 3DGTA 4QKNA 5FWJA 2KD7A 2WR9A 4Y5SA 2RHPA 3FBYA 4QX8A 5T5OA 4Q2FA 3KWVA 3H50A 4BWOA 4OQ9A 3N9LA 5FLHA 1JW6A 5FXWA 4YGCA 2K2SA 2NM1A 1XQNA 5C8CB 1OKOA 1M4WA 5FXZA 3H8OA 3ZDSA 2AH2A 4FFFA 3LWCA 3LB9A 3S57A 4XOGA 3SITA 5LATA 2VW0A 3BB6A 4N53A 5IVFA 3EMRA 1A78A 2WS91 4OULA 3ZMNA 2VNRA 4QXCA 1WMEA 3NNMA 1ZRCA 1IS4A 1LAJA 2NZ9A 3KQRA 4Z1VA 1URXA 4R8HA 4A3ZA 4K8RB 5AFEA 1X9PA 4QQOA 1J58A 2VTFA 4X6RB 5CFCA 3JD71 3O1RA 5FZAA 4CCDA 4AI0A 3FE5A 4UW6A 2CHHA 3CO2A 2W2IA 3IIAA 2LTNA 4IGQA 4TLFA 2Y38A 5FO9B 3WF2A 4IETA 4K20A 5EPAA 2VC9A 4TN7A 1GQPA 3VHPA 4ES8A 1H2LA 2R30A 5EYXA 2V5DA 1BBT1 3N7JA 1LEMA 1SLIA 2YPJA 4I2OA 1QNWA 3CJIA 3IN9A 5FAXA 1GYKA 1Q8OA 4K1YA 4XHXA 4IV1B 1RL3A 4QWNA 4NWVA 2QCSB 3MF6A 4MXWA 4CUAA 3LSDA 5KHJA 2YYOA 4YYOA 2RMU3 3RPQA 1DLCA 3OEAA 3C2UA 5FMCA 1IPSA 3UJQA 2BWCA 4GKYA 4DB5A 5IVBA 3JQXA 4L92A 3VD4A 2P3KA 1CN1A 4W8JA 5IVJA 1IQDC 4XAAA 3ZSJA 1ZBA1 4CU9A 4CXYA 4FT8A 1RUE1 3QBQA 1C8M3 4FFGA 1F4AA 1WWYA 3VBOB 1OA4A 5E1RA 3PVBB 1GOFA 2VNOA 1CAXA 2DYCA 5BNQA 4P9WA 5KHIA 5GZFA 5LB6A 2L9LA 1SLLA 1TG7A 4KQ7A 4Q4V2 5ACA2 3LZZA 1YIFA 1WZXA 4UI9L 4CDQA 5L7OB 2ZPXA 4BHPA 2RR11 3TOJA 1IS6A 3T2TA 2WWJA 2XUMA 3AKSA 4M0HA 1W8OA 1SCRA 1S0EA 1ZZ8A 2C26A 2ZGTA 1K3IA 2ZS6B 3NRUA 1BEV1 1US3A 1RITA 5DZFA 2EA7A 4AF9A 2DF7A 4N43C 4PI2A 5FP8A 1D2SA 1S0DA 2UY9A 5KHGA 4CU8A 1PGSA 4PDWC 3WZ1A 4BQ1A 4FTSA 5D21A 2O1QA 2HBUA 4W4ZA 2A7AA 3B93A 1W28A 3SLIA 2UYBA 1E57A 2A70A 4S2GA 5KXDA 1UYXA 2ZGMA 3LE0A 3RZKA 4YZ2A 2D6LX 4XBLA 4LQRA 3W21A 1NQDA 2EIBA 2WSUA 4QKDA 1UU5A 3ZFEB 1ASJ3 1NLSA 2JICA 1HRI2 1UXXX 1RUI3 3BGAA 3D8CA 4Q4W3 3WY6A 3ZFGC 2WNEA 4BQ3A 5IVVA 5JAXA 2IVIB 1F2NA 1ZRRA 4QPYA 3I2DA 1JS9A 5FOBB 2WJSA 3P3NA 2BZDA 3DXUA 2GC1A 3H7JA 3I3EA 2DTYA 4XF9A 4FOQA 4XBQA 1ZX5A 2A3YA 1UCXA 2WSVA 5FZ6A 5C6CA 5A1AA 1R081 5DPNA 1GWLA 2Q8EA 3POFA 4JGYB 4MXVA 1ZRIA 4JCKA 4JX0A 4OHZA 3RWKX 3ZYBA 2B5HA 3LEKA 3FL7A 5GZDA 4E9KA 3K48A 3ATGA 1FNYA 1CX1A 2K0GA 2LS6A 1O6UA 3DN7A 3MDPA 4A44A 4DUXA 2RS12 1FV2A 3ZKUA 4YLZA 4SBVA 1EUUA 1RUI1 2K9ZA 1LHWA 1MEC3 2FDJA 3HPNA 1QY4A 2WQ4A 3PVEA 3RMXA 2IFWA 3ECQA 3LPFA 1ULFA 3POEA 2XOMA 3VHOA 3AMNA 1VRH1 2XVGA 3LQCA 4J1XA 4N7UA 3RZJA 1R1A1 4FTBA 1DZTA 1ENQA 1KXGA 4QQLA 4S2DA 4WM8A 3VKLA 4NHMA 5B2GB 5I91A 3N7KA 1W8FA 3ZFEC 2EVXA 2VMFA 3AYDA 1K45A 4IEYA 4LO4B 5FY5A 2JWPA 3KT7A 1JBCA 1XBFA 3H9AA 2A3XA 5JZGC 3ZDVA 1W6NB 3VZMA 1CVNA 1PVC3 3PU3A 3K2OA 2XJVA 4QU2A 2GMPA 3MPBA 2XJUA 3ME2A 4YFZA 1IPJA 3NAPB 5HV0A 4YZ4A 1YJKA 4LUKA 4YWAA 1AR63 4MGSA 4P9JA 5BPXA 4XTMA 2R1DA 3SKVA 2WO1A 1TNRA 3MUY1 4YW3A 3RDIA 1JYIA 1MQTB 1WBFA 5LA1A 4GIQA 2BTVC 5BNNB 4CDQC 2AR6A 4HSJA 5GZEA 5A3TA 1JHNA 2W1QA 1B09A 4IEPA 1R1ZA 1S55A 3AMQA 4RHV1 4BQ5A 4E27A 4ZHNA 2X10A 3BOWA 1ZZ7A 4XJ9A 2DVDA 2XG3A 1F8VA 4D6SA 5L7OC 1XRUA 4D94A 3POBA 3WT3A 1AX2A 5C4WC 3NNLA 3BIWE 1ZRDA 3POJA 4EZ4A 4CDQB 5CBLA 2E7QA 1AYM2 2WNVC 1QMJA 3H1WA 4META 2OX0A 5C8CA 2V5YA 4NN0A 1W99A 2QQIA 5JWPA 5JXJA 3NL1A 5E89A 1W0NA 2PAEA 1KDKA 1SDWA 1SBFA 3TBDA 5A7NA 3M7AA 4RN5A 4ONUA 4ASLA 5BXXA 2VM9A 3RI9A 4GH4A 3WP6A 5T55A 3O0VA 5JPMB 3ZYJB 2RS33 2BW8A 5AFBA 2E7TA 3O7OA 1SPPB 1X8MA 3NV4A 3OEBA 3C7GA 1O91A 4QDQA 3UJOA 1COV3 1RTVA 3CNAA 5JSOA 3NAPA 4CPBD 2RE9A 2F4LA 2BUKA 3LFIA 1F15A 1W90A 2B46X 2XGXA 2LM3A 3I2JA 5EQUA 4I3PA 1PK6B 1H8VA 2E51A 5T5LA 1V9U2 3JD72 1QJU3 1GBGA 5FUPA 1E5SA 3C8XA 1G9DA 1XC6A 2CDOA 2PLV3 4TZDA 3H8RA 1FPN1 3J8F1 1UL9A 1ZBA3 3AMHA 5FZFA 1H2KA 3DECA 4IE5A 4FSJA 4XYXA 2J1TA 4GMP3 4JC1A 5FYUA 1VBD1 2Y6HA 1VBE3 2J1EA 4MUVA 4Z07A 1DG6A 4CCEA 1UZ0A 1W05A 2UWBA 4W65A 4HSLA 4NJ4A 1YJLA 2SLIA 2Y6KA 3AL5A 4IERA 5LCWL 3IT8A 3M3IA 5C8WA 3ABZA 3SCFA 5C33A 2J1VA 2ZEXA 4NPRA 1U5ZA 4XUQA 1H6XA 3K46A 1JYCA 2JG8A 2WNVB 5F5IA 1RUJ3 1GQHA 2DBNA 2FHRA 1JZ2A 1GR3A 3MZHA 3IIIA 4I0BA 4Q4X3 5FPXA 1W6MB 1IS3A 2JDPA 2TBVA 5J3UA 3D82A 3GZUC 1NY71 2D98A 3F2ZA 4CDUA 1HB1A 5BNPA 3FHAA 1WD4A 4CU7A 3VBSB 4LBQA 1HB2A 2W47A 1K5MA 2CWMA 2PMWB 4NROA 1OQ1A 2GMMA 3VZKA 4EJRA 3RSJA 5FDBA 4OQ8A 3OY8B 2XR4A 2P3YA 4KU7A 4E4HA 3HBZA 5DUVA 1APNA 1DGLA 1QHDA 3KB5A 4QX1A 2XXZA 4GULA 1GP6A 5AC92 1AJKA 1ZZBA 3RZGA 1BBT2 1O5UA 3I3MA 3W58A 3POWA 4PF1A 3VDDC 1BQPA 1F5FA 1UZYA 3ZSLA 3VGIA 1W6OB 5JSRA 2D6OX 4XURA 4Z82A 1YFWA 5CNAA 4LBQD 1CD3G 2Y60A 5G04L 1XNKA 3TN93 1UZWA 3MLJA 1NXD1 2K46A 4COYA 3BTYA 1VMFA 1GFF2 3MLKA 2MEV1 3T4HB 2R072 1H8TA 1LGCA 3H3UA 3R4UA 1HIXA 3HMYA 3G6JB 2JDUA 1LNSA 3WSOA 3JQWA 3TRSB 4LKEA 1HDKA 1RYYA 4H3WA 3Q8AA 1JUHA 1VPHA 2RV9A 4ZZ8A 1B35C 2W94A 1TME1 1D0GA 2WRAA 2FCTA 4D69A 4FCAA 1AR71 3CHXA 5A7SA 4TWTA 1WW7A 1OA2A 5AC91 4UXAA 1QJY3 3UNPA 1UMZA 5FYMA 1LOBA 4I01A 2VECA 4LT5A 3KF5A 2VNGA 4XFAA 2ZKLA 2LW8A 4NUBA 3E97A 1K5MC 1W6PA 1H4GA 1DZQA 2JE7A 2JG9B 2W95A 4X8PA 2OVUA 1DDLA 4ZU7A 5FO7B 1HJGA 4UF0A 2BV4A 5HI0A 3HWJA 1NA1C 1NCRC 2PA7A 4FOVA 4GMP0 5G05L 4ET7A 4HVQA 1W0OA 4KH9A 5JIUA 1RJ8A 5JMOA 4RQPB 5FZDA 4J25A 3BYWA 3RZHA 3VBSC 1V6MA 1HKDA 3ON7A 1GICA 3M3CA 3LSEA 4HVRA 2RDQA 3NV3A 4PHZA 1OD3A 1YUDA 5LEKA 1VBC3 1H8TB 2WYFA 3BVCA 2NQYA 1JOJA 2J1AA 2YBPA 3N9NA 2BERA 3ST7A 2JXAA 1CPMA 3RZLA 3T2PA 3UL2A 4UYBA 4ZS3A 2R32A 3I59B 5LK7B 3OTFA 2B39A 1BEV2 2VW2A 2VCAA 3HT2A 4AFBA 1FNZA 5FZOB 1HRV1 1RMU3 2WZ8A 5F8PA 3SISA 5J1XA 1PO12 4RHV2 4FI9A 4D8MA 3BUCA 4BQ4A 4YGBA 3MGUA 1SPPA 5T52A 3WCRA 1U5YA 1E5HA 4IV3C 3CIHA 1FPN3 3J8F3 4WM7C 5FZBA 1RUC1 1TME2 5CU1A 5FFOC 1W9TA 3S7EA 5IK4A 2C6SA 3APBA 4FPOB 1RUD3 3FX3A 5FZCA 3EB7A 1DQ0A 2J22A 2P34A 3RI8A 4YVSB 1VRH2 4UT5A 1N3PA 2C0ZA 2A3WA 2QNKA 2ZZJA 4XXPA 1R093 2XJPA 4LBNA 4XAEA 5JR2A 3BIEA 2JIGA 3MUZ1 1O4YA 2D3SA 2GH8A 4NRPA 4XABA 1NA1B 1LECA 1NCRB 2ARXA 4GH4C 4LA2A 4PIZA 1N1YA 4XFBA 4Z8BA 5JLVA 2JE9A 3DKWA 1J83A 2ZTNA 4LE4A 1OD5A 2NMOA 2XB6C 5IAXA 2XBO1 4L9BA 3GALA 2GALA 1AL22 1VBA2 2E6VA 4EWAA 2G4IA 3ZR6A 3EJKA 2WS92 1JYTA 2VL4A 1RUG2 4MOAA 5BNNA 4MLOA 1ULDA 4HKLA 1MQTA 2JDYA 3JUUA 1DU3D 5JPNB 1UYYA 1KFUL 1CZVA 4FAGA 3WF0A 5BV6A 4CP9A 3ACFA 4IV1A 3OOXA 4A42A 1VMJA 4LLFA 3VDBA 4MO3M 1W8ZA 2DVFA 3N7MA 5FV3A 3VBOC 5KHHA 2W52A 4C91A 2VH9A 3IM0A 4AE2A 2HWC1 3L2YA 2XQXA 3JB4C 4UWDA 5CG9A 2GC2A 3IAPA 4FOWA 3T30A 1ND3C 2VUDA 5EWSA 1AHSA 4R52A 1PZ9A 1XXNA 3USUA 4IL7A 3VBSA 3FJSA 3POIA 3PU8A 4YVWA 1Z7S2 2WABA 3UK9A 4IE4A 2WNUA 1GZCA 3OBTA 3J4UH 3PMEA 4YVSA 4NIGA 3KCXA 2VQTA 1RC6A 2IZWA 2QZ2A 5LBFA 1Y9QA 4ASMB 1QDOA 1HB3A 1JYVA 3PMSA 5J7MA 5GLVA 2QUOA 3ALQA 3BI3A 1RUD1 2EXHA 4UFKA 5DG2A 2ETEA 3PDQA 1N3OA 2P4EA 2Y6FA 5LZ6A 1JZ4A 1MR5A 2FZ1A 4NPLA 4AEJA 3ZXAC 4PLNA 3LDBA 2VNVA 2CL2A 1JYNA 3HN1A 4FPEA 1EV12 4LHLA 3ES1A 1A6CA 5DXDA 3WP5A 5JOZA 3ZSMA 1GOHA 4Y1ZA 5IAVA 2GH2A 1V9U1 4AVAA 2GN7A 2VMIA 3OUJA 4RS5A 3TB0A 3VD5A 4E4ZA 2G1MA 2KR2A 5FREA 3ZLIA 4YG0A 3WDXA 4CCJA 1DF0A 3OUHA 4QPIA 2ZABA 2Z69A 2AEZA 3E1F1 1H8TC 2ZGOA 3M1HA 4JGYC 5IK5A 4ES9A 5EP9A 5FMOL 3KSCA 2F6BA 4HONA 2YG0A 1TE1B 1WCKA 3OB8A 2ZEWA 2YV8A 4Y1YA 4LBKA 4F8AA 2DURA 4OI0A 2ZJCA 2BYVE 4XF4A 4AGGA 2CU5A 5F39A 2VU9A 1OPMA 1POV3 5GALA 3H8XA 2Q5TA 5FP9A 4S2FA 3J7LA 1W6PB 2D43A 5C3OA 1MZ6A 5CIRA 1W3VA 4XILA 1WW6A 4HG6B 4YNIA 3V0AB 3ZXGA 3I3QA 1WCDJ 1SEFA 2BNMA 4AHZA 4AQ6A 5C4WB 1ZBE1 2QQMA 3AKPA 4C8DA 4MG2A 5F37A 1NE4A 4E2SA 2HWF2 2W1WA 2IXHA 1TNFA 2NPIA 2RG4A 1OUSA 4AZZA 3LIGA 1AZDA 4INDA 4JGZB 3WP3A 3J7NA 4D6QA 2JJ6A 4XDPA 4DQAA 3OD4A 5CYYA 1SBDA 2R7EB 5BNPC 1D2QA 3K4AA 1FOD3 1PMIA 1XNTA 2VOTA 1YLLA 3FFQA 1RGSA 1Z7S1 4WZFA 5I0TA 1C5HA 3DEMA 3HQRA 1MPXA 2O0OA 4IV3A 4R9AA 4JDMA 2VQUA 3FHIB 4H2AA 1IG3A 2DCKA 4M00A 5GJ6A 4ZY9A 3D0SA 3LIHA 4AYUA 3M70A 4LMFA 1UN1A 3WQ0A 4NIDA 4Y3OA 4W50A 4PF5A 1RVF3 4JZRA
chains in the Genus database with same CATH topology
4NMIA 2FCUA 4XC9A 5DAPA 2FCVA 3GJAA 5LB6A 5L9RA 4NHLA 3OBZA 4UWDA 2Y33A 4NHXA 3NNLA 2RDNA 2FCTA 5LA9A 5DAVA 2HBUA 2G19A 5LBFA 4BQWA 4Y5TA 3ITQA 4Q5OA 3W20A 3W21A 2Y34A 2OPWA 3NNJA 4MHRA 4XACA 4Y5SA 5EQUA 5C5TA 4BQXA 4IW3A 4BQYA 3KT1A 2JIJA 3DKQA 5LBBA 4MHUA 4J25A 5C5UA 3GJBA 3HQUA 5IAVA 3OUJA 5LATA 4NHKA 2RDQA 3EMRA 4KBZA 2G1MA 5L9BA 3BVCA 3OUHA 3NNMA 2V4AA 4XCBA 3NNFA 5EP9A 2HBTA 3OUIA 3KT4A 5DAQA 4XCAA 3MGUA 5ERLA 2A1XA 5A3UA 3GZEA 5EPAA 5HV4A 5LBCA 5IATA 2RDSA 2RG4A 4NHMA 4NHYA 4ZONA 5M0TA 5LBEA 5DAWA 3KT7A 2JIGA 4ZPIA 4XABA 5L9VA 3HQRA 5HV0A 5LASA 5DAXA 2RDRA 4NAOA 5IAXA 4XAAA 3PL0A 4JZRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NMI A;  2FCU A;  4XC9 A;  5DAP A;  2FCV A;  3GJA A;  5LB6 A;  5L9R A;  4NHL A;  3OBZ A;  4UWD A;  2Y33 A;  4NHX A;  3NNL A;  2RDN A;  2FCT A;  5LA9 A;  5DAV A;  2HBU A;  2G19 A;  5LBF A;  4BQW A;  4Y5T A;  3ITQ A;  4Q5O A;  3W20 A;  3W21 A;  2Y34 A;  2OPW A;  3NNJ A;  4MHR A;  4XAC A;  4Y5S A;  5EQU A;  5C5T A;  4BQX A;  4IW3 A;  4BQY A;  3KT1 A;  2JIJ A;  3DKQ A;  5LBB A;  4MHU A;  4J25 A;  5C5U A;  3GJB A;  3HQU A;  5IAV A;  3OUJ A;  5LAT A;  4NHK A;  2RDQ A;  3EMR A;  4KBZ A;  2G1M A;  5L9B A;  3BVC A;  3OUH A;  3NNM A;  2V4A A;  4XCB A;  3NNF A;  5EP9 A;  2HBT A;  3OUI A;  3KT4 A;  5DAQ A;  4XCA A;  3MGU A;  5ERL A;  2A1X A;  5A3U A;  3GZE A;  5EPA A;  5HV4 A;  5LBC A;  5IAT A;  2RDS A;  2RG4 A;  4NHM A;  4NHY A;  4ZON A;  5M0T A;  5LBE A;  5DAW A;  3KT7 A;  2JIG A;  4ZPI A;  4XAB A;  5L9V A;  3HQR A;  5HV0 A;  5LAS A;  5DAX A;  2RDR A;  4NAO A;  5IAX A;  4XAA A;  3PL0 A;  4JZR A; 
#chains in the Genus database with same CATH topology
 3USS A;  3NV2 A;  3VDD B;  4JDO A;  1EAH 1;  3WXP A;  1VBB 3;  3QCW A;  2OW4 A;  4Y1X A;  1LHV A;  4DIN B;  3PUQ A;  4A41 A;  2OUH A;  5DUW A;  1EAH 3;  4G9S B;  3AZW A;  2WT0 A;  4AXO A;  1PNF A;  1GU3 A;  2HWC 3;  2JDN A;  3THD A;  4M3C E;  1GNY A;  2DUQ A;  4OCT A;  4AFD A;  1AXK A;  3KV6 A;  3ZSE A;  1W8N A;  3LFM A;  2WL1 A;  5JVV A;  3SNM A;  4WVM A;  1UZZ A;  4FQZ A;  3W5M A;  1RUO A;  1W6Q B;  2XDV A;  3VHR A;  1DYK A;  1Q3E A;  2Q1Z B;  3IDA A;  4AR2 A;  1BK1 A;  4DRV A;  5JXH A;  1A34 A;  1JZ5 A;  3SH5 A;  1FOD 1;  1D4M 3;  1FAY A;  2RDN A;  3RJR A;  4AI1 A;  1S2B A;  1O7F A;  5A3W A;  5A7W B;  5FWE A;  5L36 A;  4P9G A;  1CON A;  1C8M 1;  3UV9 A;  1Q8S A;  4HN0 A;  1JMU B;  1WCU A;  1XPW A;  2HWD 1;  2NLR A;  2QQW A;  1GP5 A;  2WN3 A;  1IG0 A;  2DBI A;  3D4K A;  1AYN 2;  4HT1 T;  1QJX 3;  2X29 A;  1AR6 1;  3HQX A;  4P9X A;  3Q8B A;  3U11 A;  3U07 A;  2VE1 A;  4P9L A;  1W8W A;  1ONA A;  2ZAA A;  5A3L A;  4CPB A;  4GA9 A;  3KLS A;  5GLU A;  4AQT A;  2ZCW A;  2ZGP A;  3IB3 A;  4XPV A;  3WG4 A;  1NCQ B;  4E8C A;  4BMB A;  1OC1 A;  3ZYR A;  4LE3 A;  2GND A;  4R4X A;  4FOY A;  1QWR A;  3ES4 A;  4MSV A;  4YG3 A;  4BQY A;  4EN9 B;  1KS4 A;  5C3R A;  5FYI A;  2ZBJ A;  3AK0 A;  3TYJ A;  5T54 A;  1CAU B;  2YC4 A;  3HQU A;  3O14 A;  4FVV A;  4IES A;  3ZN4 A;  4AI3 A;  4BPZ A;  1FMD 3;  4LNV A;  1HV1 A;  3AJY A;  1AVB A;  1V0A A;  2BOI A;  5C4W A;  3ZSK A;  3LF7 A;  4QHZ A;  4AVC A;  5F7U A;  1V6L A;  4O7X A;  5J96 B;  1UX6 A;  5L7O A;  2VY0 A;  5JXG A;  3C7O A;  1HRV 3;  3E6D A;  5A7Q A;  2FDK A;  3AKR A;  3THT A;  3HIF A;  2R06 2;  4CRQ A;  2R04 3;  4URT A;  5IFT A;  2YMZ A;  1R08 3;  3LA2 A;  4OLL A;  2QQK A;  4YM1 A;  4E4S A;  2GSY A;  3DV8 A;  2W91 A;  2JG9 A;  1AR9 1;  2OYZ A;  1ENX A;  1GWK A;  3ZN6 A;  3SMH A;  4DOU A;  1UOJ A;  4QPG A;  4CDW C;  3VKN A;  2WO2 A;  4NIA A;  2YUE A;  2ZGS A;  2OII A;  2FQP A;  1DHK B;  2LRO A;  2AAC A;  1YNA A;  1H9W A;  1NOV A;  2G9Z A;  1PX3 A;  3DL3 A;  1XYN A;  1E5R A;  4RGA A;  2Q30 A;  4YGD A;  4NHY A;  1OLM E;  3WP4 A;  2QQN A;  2EID A;  2PN5 A;  2JE8 A;  2DCJ A;  1UY3 A;  4V2V A;  4ZZ5 A;  1UF2 C;  1HN1 A;  1W04 A;  1OBN A;  2JKB A;  1W6Q A;  3GZT B;  3E5X A;  1DQ6 A;  3DYP A;  2VOX A;  2WZP P;  3OBA A;  5A6Z A;  4NRQ A;  5DAX A;  3VBU A;  2ID4 A;  2JG9 C;  2QQV A;  4Y22 A;  1PK6 A;  1RUE 2;  1YXW A;  1W39 A;  1DBN A;  2BEO A;  2HJI A;  3KV9 A;  5AVA A;  3HR9 A;  5F5Q A;  4CEY A;  4JAA A;  2VVE A;  4L8Q A;  1BVP 1;  1WMX A;  1XE0 A;  3VBO A;  5EXO A;  3WW2 A;  5FLJ A;  3ZX7 A;  1YCI A;  3VZJ A;  5HCF A;  3QOP A;  1X33 A;  5F5A A;  3VBU B;  1UY2 A;  1CAW A;  2SBA A;  2OZJ A;  3MBW A;  4QGN A;  5GLT A;  4QT6 A;  2E33 A;  2UWA A;  2QQU A;  1PO2 3;  4LHN A;  1EYB A;  1RHI 3;  3N9P A;  3V0B B;  1UPI A;  2Q4S A;  2Q8C A;  1QJX 1;  2GP5 A;  1LJ7 A;  1S4C A;  4FXK B;  3MIE A;  4BE3 A;  1L7R A;  2OUJ A;  5CB7 A;  1GZW B;  3N35 A;  5T50 A;  2F4P A;  3AKT A;  4UW3 A;  2HLE A;  3N4M A;  3T09 A;  2G19 A;  4BJ0 A;  5A33 A;  4YM3 A;  1TMF 2;  4GQ7 A;  2VG9 A;  1CJP A;  3AP6 A;  3ZN5 A;  2C4X A;  4XHB A;  4ZU5 A;  2Y34 A;  4N7I A;  1C28 A;  4XF3 A;  1HB4 A;  3MIB A;  3LOB A;  1H1M A;  1OLM A;  3KM5 A;  4Q4V 3;  4Y4R A;  1HXS 3;  1UOB A;  1SLB A;  5FP4 A;  4BIO A;  3CMG A;  1W2N A;  2VD7 A;  1KDM A;  2W0X A;  4AED C;  2WDB A;  2WWS A;  1Q43 A;  3HBK A;  5F3I A;  1YQ5 A;  4O61 A;  3DPR C;  3FMG A;  4GWM A;  1RUF 2;  3WNX A;  5FJK A;  1N47 A;  3B9I A;  4HK9 A;  1DGR A;  1QIQ A;  5LBB A;  1LGB A;  1AYN 1;  3LEI A;  4OUM A;  4QX5 A;  4MHU A;  3ZYG A;  5K0U C;  3ACI A;  2QQP A;  1PMH X;  2BP6 A;  3SEE A;  4XJ8 A;  4NHK A;  5HXM A;  1S2K A;  3GHM A;  5L9B A;  4EYU A;  3IBM A;  4H55 A;  5JI7 A;  1CIW A;  2JX9 A;  1O3T A;  4B4Q A;  2X53 S;  1QOT A;  1XSR A;  1SLA A;  4P9I A;  1CQ9 A;  4ERO A;  2PAM A;  3TEY A;  5GLW A;  2ADE A;  3T3Y A;  1S0J A;  3O0W A;  1KJL A;  5EYY A;  1RUH 2;  1H6Y A;  3OBR A;  3VD7 A;  4A6O A;  2Z42 A;  3WDY A;  4JVA A;  1EPW A;  1LKN A;  2D40 A;  2V4V A;  2QFE A;  4M4P A;  5FBZ A;  5FUI A;  3T2Q A;  3T0D A;  4CCM A;  5K0U A;  3OCP A;  4QAW A;  2GN3 A;  3VHN A;  4Y22 B;  2ZX2 A;  3N9Q A;  3GDB A;  1OVS A;  1O4Z A;  3OYW B;  1AJO A;  1Y3T A;  1NYW A;  4OI4 A;  3QD6 A;  2VCM A;  2PLV 1;  3PUA A;  1Q8Q A;  4ASK A;  3DXT A;  1OLQ A;  3HNY M;  4DY3 A;  5I0D A;  3M3E A;  2I74 A;  3OGR A;  4GZ9 A;  5IWF A;  2FD8 A;  2QDR A;  1QQP 3;  5F3C A;  1GOG A;  1JYW A;  4AHW A;  2VVF A;  2N7G A;  2W92 A;  1FAT A;  4Y24 A;  5FZL A;  5M0T A;  1NUK A;  3C7H A;  3CF6 E;  4LBL A;  4TTG A;  3PIG A;  3VV1 A;  2VCB A;  2BVB A;  3PNA A;  4QPI B;  2W3J A;  1HQW A;  1HX6 A;  3L9J T;  1M06 G;  2P17 A;  4E8D A;  2ZEZ A;  2RS3 1;  2HWE 1;  5EHD A;  4C90 A;  4FPY A;  4I0A A;  5FP7 A;  1PZ7 A;  4LA3 A;  4ZU4 A;  2RS1 3;  3SH3 A;  1O3Q A;  3H3Z A;  2HWF 1;  5I93 A;  1MEC 2;  2EF6 A;  2BVV A;  4LK6 A;  2D6N A;  3MEP A;  1OT5 A;  2BOJ A;  4ZKT B;  2FCU A;  1D4M 1;  4DUV A;  5DG1 A;  1OKQ A;  4LOR A;  4EN8 B;  3F95 A;  4AFA A;  1IKQ A;  3NO8 A;  2E31 A;  2YXS A;  4NOT A;  3I2K A;  3NJV A;  1TZO A;  1LB2 A;  2AC1 A;  2YY1 A;  2WA3 A;  1RIN A;  5FJH A;  3OBZ A;  4J6G A;  4CP1 A;  2CV6 A;  1U12 A;  1WKY A;  3UT0 A;  1AR7 2;  1O5L A;  1PVC 2;  5JXI A;  3IPV A;  4O9E A;  2E63 A;  2P6H A;  3M8L A;  4QGL A;  4GWJ A;  4CCN A;  1Y43 B;  1PIV 1;  3WNK A;  1IQA A;  2VMC A;  3MID A;  4DO0 A;  1UMH A;  1H1A A;  1W6M A;  1XNC A;  2ZMN A;  3AC0 A;  1QJF A;  1QXP A;  2RS1 1;  4KWU A;  2XPJ A;  2VW1 A;  1TMF 1;  1BXH A;  2WZR 3;  4URA A;  3AP5 A;  4Q4Y 1;  4NAM A;  4RR3 B;  3V0A A;  3GBW A;  2Y26 A;  4FPH A;  1QH6 A;  4XFG A;  2KXL A;  1U5X A;  4XIK A;  2RR1 3;  2JDM A;  4Q8K A;  5A3O A;  3NNJ A;  1OF4 A;  1JZ3 A;  2EAL A;  2PQS A;  2VMG A;  2A6W A;  2MPF A;  5DZG A;  1NAE A;  1HJF A;  3WF1 A;  3D3A A;  4QPG C;  3DUI A;  5LWB A;  2WFF 3;  4OHY A;  3DKQ A;  1OFS A;  4XUO A;  2Q0A A;  4QPW A;  4YRD A;  3GYD A;  1ZBE 3;  3C7F A;  2JKX A;  5C5U A;  5H9S A;  3VLB B;  2X8K A;  1JUI A;  1LOC A;  1MEC 1;  1PHM A;  1UY0 A;  1VBE 1;  1F9K A;  3KGZ A;  5CAZ A;  1V70 A;  1WBL A;  2HWE 3;  2R0H A;  1QOS A;  3PUH A;  4Y20 B;  2W1U A;  4AEK A;  4DEV A;  2YPD A;  5CEH A;  3WX5 A;  3ZYP A;  2RS3 2;  3LD8 A;  2VUC A;  5FY8 A;  2JD9 A;  2VZQ A;  1RIR A;  2ENR A;  3UYJ A;  2QBX A;  1YFX A;  1ZYB A;  1ULG A;  4B4P A;  1PNG A;  4HVO A;  5DAQ A;  5DUU A;  4UFM A;  3ZO0 B;  2HYK A;  3AP7 A;  3NKT A;  1MS8 A;  3G7D A;  3ORJ A;  4QDR A;  4NIH A;  1UW8 A;  2MEV 2;  1KIT A;  2C5D A;  3B9C A;  4ATE A;  1CZS A;  2QQO A;  4RR3 A;  4XUN A;  3ZIW A;  4UAP A;  3O5S A;  2J1S A;  5F32 A;  1MS5 A;  2D5H A;  1A8D A;  1LCL A;  3A21 A;  2Z5W A;  1ZNP A;  4JRL A;  4AAX A;  1DYP A;  2XL7 A;  3WF3 A;  2R49 A;  1CAU A;  5H9Q A;  5IUQ A;  3ZM8 A;  4I3G A;  5KXC A;  4IEQ A;  3B02 A;  3DF0 A;  1ACC A;  4RGG A;  3I49 A;  3ELN A;  4G3Y C;  3OGV A;  2GC3 A;  4XW3 A;  2JDH A;  2YGM A;  4YM2 A;  2E26 A;  1AR9 2;  4YW1 A;  1A8M A;  3BTZ A;  5HCB A;  2BFU L;  3H1Y A;  1STM A;  3RZZ A;  5D2A A;  4Q4Y 3;  3VBH A;  2WZR 1;  4IDZ A;  5LY2 A;  1V6O A;  2WNU C;  4MGT A;  2CY6 A;  4LTA A;  1LGN A;  4XE9 A;  3ZXL A;  4A2U A;  5JUV A;  2F17 A;  3I54 A;  3J26 N;  3OD0 A;  4K8F A;  5LK5 A;  3S6P A;  3WDW A;  4TLG A;  1RUJ 2;  4BK4 A;  3ACL A;  2XWJ B;  2B7Y A;  4HKW A;  1PIV 3;  1AR8 2;  2E32 A;  3UES A;  4GAL A;  4PIX A;  1H2N A;  2XH6 A;  5FBJ A;  2XON A;  5IK7 A;  4WM7 A;  1N3Q A;  4YW5 A;  3RMY A;  1WA4 A;  2WUH A;  4NHL A;  1DP0 A;  4RA0 A;  1W9W A;  2XHN A;  4GJY A;  5DQ0 A;  5A3P A;  1GWM A;  4MGQ A;  1QOO A;  5D8A B;  4D7S A;  2Y33 A;  1W2U A;  4K9S A;  3FBM A;  3JBG 2;  1US2 A;  4YGE A;  4GKX A;  4UBH A;  4FTE A;  3FC0 A;  2QE3 A;  4WVW A;  5FP3 A;  4DY5 A;  4IGO A;  4Q0U A;  4LPL A;  3I2F A;  4WVV A;  5AC9 3;  3NJY A;  1U5I A;  2D7F A;  1JU4 A;  2QVS B;  4B7K A;  3MYX A;  1CAV B;  1RJ7 A;  5I8S A;  3I8T A;  4OZX A;  1PVX A;  3D5O A;  4V2W A;  4TXW A;  2VBD A;  3ACG A;  3PTY A;  1XU2 A;  4I09 A;  3VD3 A;  2VXJ A;  4PBP A;  2A6V A;  3MV0 1;  4LBM A;  2OPW A;  2VO5 A;  4Q1R A;  3HVD A;  4LBJ A;  4X6Q B;  2QDN A;  1UY1 A;  1VJ2 A;  1X8E A;  3B3Q E;  2J42 A;  3U75 A;  1XYP A;  2PHD A;  5A32 A;  1OPO A;  4OI2 A;  1XU1 A;  1KJR A;  2ZGQ A;  3P6B A;  5FZ8 A;  2WYS A;  2JIJ A;  3IAQ A;  3KT1 A;  3RS6 A;  3AMM A;  3W59 A;  4EWD A;  2BGO A;  1H9P A;  4BLI A;  3DCQ A;  4D0Q A;  3SC7 X;  3K77 A;  4BM8 A;  4DIQ A;  1COV 1;  2BBA A;  2BGP A;  2VZO A;  2GNT A;  2CWS A;  5GLZ A;  4AHX A;  3PVN A;  4NRM A;  3O1T A;  2AEN A;  2OA2 A;  2XBO 2;  1WMF A;  4P02 B;  1L7Q A;  1ZA4 A;  2HWD 3;  3ZYH A;  2MHF A;  2HWB 1;  4H7M A;  2YHJ A;  4QX0 A;  2AGS A;  4MGI E;  1BMV 2;  2A5Z A;  1GUI A;  2YDE A;  3OUI A;  5FYZ A;  4W6W A;  3VZN A;  3RYR A;  4BU2 A;  2P37 A;  1ENS A;  4F7Z A;  2EAK A;  3X29 B;  1L3J A;  1PK6 C;  1HQN A;  3I59 A;  3M3Q A;  3D6E A;  4RFR B;  3AVR A;  5ERL A;  4LR4 A;  2D3P A;  1C8N A;  2DV9 A;  5ANQ A;  1WLW A;  1FI2 A;  4PLM A;  2BRT A;  2DVG A;  4HFS A;  1YO8 A;  4Q29 A;  5DDJ 1;  5APA A;  4KL1 A;  5LBC A;  4PQ9 A;  2ZX0 A;  3AMP A;  2LAL A;  3UGF A;  2HH9 A;  5CAD A;  4CYD A;  5FPB A;  1N1V A;  1QH7 A;  3ACH A;  5ACA 3;  3EO6 A;  2XJQ A;  4LBQ B;  3O1O A;  5KR7 A;  3WQB A;  2I2S A;  4CDU B;  1HXS 1;  3NQH A;  5ABJ B;  2X05 A;  3CEW A;  5CZK A;  4P9Y A;  2MNG A;  4CDW A;  1BEV 3;  1V00 A;  2VR4 A;  4K1Z A;  5KHK A;  1PO1 3;  4N43 A;  3WNM A;  1LTE A;  2XJR A;  4Q0S A;  1K5J A;  3W9A A;  1CZT A;  2ORZ A;  4RFT 0;  1B35 A;  3BU0 A;  1I6X A;  5C9A B;  2JD4 A;  2O8Q A;  3HEI A;  4IEU A;  1YEW A;  1TME 3;  3AP4 A;  1CAV A;  4Q27 A;  4FPK A;  2XKO A;  3S7I A;  5EJ1 B;  3OGS A;  2FCV A;  4DFS A;  4IV1 C;  5JZG B;  4KNC A;  1VRH 3;  2B8M A;  5IFP A;  5CFD A;  4LHS A;  3R0R A;  5FZK A;  2W87 A;  3AB0 A;  1RUI 2;  1MQT C;  4CUC A;  1YIP A;  1Q56 A;  4PLO A;  5BNN C;  2RMU 2;  3FFZ A;  3S5Q A;  2W39 A;  4XIO A;  2PHW A;  3LA7 A;  3PUI A;  1ULP A;  2JDK A;  4KGG A;  1S0B A;  2R16 A;  4AQ2 A;  4W6Y A;  3U4X A;  3HNM A;  3BTX A;  3VBU C;  2EXK A;  2YFU A;  3I4I A;  5FXV A;  2FZ2 A;  2GME A;  1C8M 2;  3AZY A;  3CBN A;  4B1L A;  5A80 A;  2WA4 A;  1AX0 A;  3CZJ A;  1VBD 3;  2BWA A;  4UW5 A;  3RNS A;  4M01 A;  3TAY A;  3WG1 A;  2Y64 A;  3ZFG A;  2XUE A;  3QH6 A;  1H4H A;  2VAU A;  3TEW A;  1UOG A;  2RS5 3;  1DYO A;  2JB8 A;  4HZF A;  3R6S A;  3ZXE A;  5IT6 A;  1NQJ A;  2P6C A;  4FPC A;  1AF9 A;  2RVA A;  4D6R A;  4CUB A;  4IV3 B;  4WM7 B;  1WW4 A;  2LUW A;  4QM8 A;  4QQP A;  5KWR A;  4ATF A;  4CA9 A;  4LXL A;  1CWP A;  1J59 A;  5C5T A;  2E53 A;  3R05 A;  1O59 A;  4IE0 A;  4AVB A;  4W6X A;  2JG8 C;  2FDF A;  1QJZ A;  1ULC A;  1D7P M;  1Q8P A;  1SG3 A;  2YU2 A;  3KD4 A;  4XUP A;  1PGW 2;  1GP4 A;  2IXL A;  1NCQ C;  1POV 1;  2GDF A;  5CA6 A;  1KFX L;  1AYM 1;  4FQ4 A;  2J7M A;  5IJR A;  3WD5 A;  3C3V A;  3DPR B;  4ISR A;  4CXX A;  3U37 A;  4MH0 E;  2ZX1 A;  1Z78 A;  1GV9 A;  2XML A;  3GCW A;  4XBN A;  5F3E A;  1YQC A;  1JN2 P;  1WD3 A;  4YM0 A;  3WV6 A;  5K0U B;  4QX2 A;  1AXY A;  1Z0H A;  1JI6 A;  3A0K A;  4KWJ A;  4R9B A;  1ASJ 2;  1UNB A;  1R09 1;  1W6O A;  2RM2 1;  4LOS A;  3OPZ A;  1HRI 3;  5EJ3 A;  3WNN A;  5GZG A;  1AR6 2;  2P3I A;  1NG0 A;  1Q5O A;  4J1W A;  4P5Y A;  3ZFF A;  2YBS A;  5EIY B;  1LU1 A;  3VBH C;  1BLZ A;  2YGL A;  3DPR A;  4WZC A;  3WOG A;  5CFD C;  5DUX A;  2Y6L A;  5FY1 A;  2PHR A;  4SLI A;  3VN4 A;  1J84 A;  2DU0 A;  4BXF A;  3WCS A;  3RWN A;  4XFI A;  4F3J A;  1LED A;  1QNY A;  1VBA 1;  1RUN A;  1DGW A;  2ARC A;  1W8U A;  2ZMK A;  1ULO A;  2ZHN A;  5FYC A;  3OG2 A;  4QGM A;  1UPS A;  3RJ2 X;  1F35 A;  3NST A;  1Y7B A;  2WT1 A;  4QDS A;  4WM8 C;  5FY7 A;  4EWE A;  2IXI A;  2CNA A;  1BKZ A;  3S5A A;  4G4F A;  4LHK A;  1LUL A;  3NNG A;  1UWW A;  2JDZ A;  2I07 B;  2OQ6 A;  4RR3 C;  2H6C A;  2B45 X;  2P2K A;  4A3X A;  1J3R A;  1CAW B;  2RM2 2;  4XTP A;  2ARE A;  1NZC A;  3WLU A;  3FWE A;  3OYW A;  5CIS A;  1ND3 B;  2IWG B;  2PHL A;  2VOW A;  4KU8 A;  4NVP A;  3AZZ A;  3L2H A;  2VUL A;  3I3B A;  1ENR A;  5I0S A;  4XC9 A;  2JB4 A;  1JOP A;  1R1A 3;  3U4S A;  5GZC A;  1KGY A;  4JGY A;  2LRP A;  1GNZ A;  4DRR A;  4L99 A;  4U2A A;  1H0B A;  4Q4W 1;  1GKB A;  1PGL 2;  1VE0 A;  3KVA A;  1KD7 A;  2WC2 A;  2J1R A;  1DGR N;  2X5I B;  4JTN A;  4QB1 A;  3BOP A;  3NMB A;  4QU1 A;  3AYA A;  2D5F A;  2HEV F;  2ZGR A;  5CKM A;  2DCT A;  5D1I A;  2A75 A;  3AFK A;  4QXH A;  1HRI 1;  1LHU A;  5BY5 A;  2IVJ A;  4IE7 A;  2PLV 2;  1ODM A;  4FBF A;  1GZT A;  2ZXQ A;  2VBB A;  5EZW A;  1QXR A;  2JDA A;  5LRS A;  1PMJ X;  1LES A;  1LOF A;  1S0F A;  2VZP A;  4P08 A;  4YG6 A;  5DAV A;  3LCP A;  2QJV A;  4YAR A;  4KMQ A;  1OA3 A;  2ARB A;  1OOP B;  4Q5O A;  3IDE A;  1FT9 A;  3RYP A;  4GXL A;  2ZGN A;  3NKG A;  3SCG A;  3GGL A;  3MW3 A;  3WW3 A;  1YWK A;  4IEW A;  5DDJ 3;  1OF3 A;  1W2A X;  1VP6 A;  4XMI A;  4CEW A;  4YVS C;  3OY8 A;  4B29 A;  2FBE A;  2JEN A;  4IEO A;  2OT7 A;  1EPZ A;  4QKB A;  4AVS A;  4LIV A;  1O8P A;  1ND3 A;  1RUC 2;  1NLQ A;  4GB3 1;  4R4Z A;  1DQ4 A;  1L7L A;  2HWB 3;  3BTA A;  1XE7 A;  3K4D A;  5FYT A;  5C70 A;  4CEW B;  3U14 A;  4RL7 A;  1PO1 1;  4EE2 A;  3V65 A;  4GMP 1;  4YW7 A;  4GWI A;  2YFZ A;  5F6K A;  4MGK E;  4N9I A;  5FKB A;  4BIS A;  4QQH A;  4YZ3 A;  4PT6 A;  4YZ5 A;  3PUR A;  2YB7 A;  3D0J A;  2YC2 A;  1LOG A;  3GCX A;  3ZR5 A;  4LO6 B;  1S1A A;  2DUP A;  2DVB A;  2BU9 A;  1LU2 A;  2ZA9 A;  1JXN A;  1XB9 A;  2GP3 A;  4QHB A;  5IVY A;  5BNO B;  1VB2 A;  3H1M A;  3W5N A;  1POV 0;  2D6M A;  3I7D A;  5DZE A;  1WGP A;  3K4Z A;  4XCA A;  1BCX A;  5FYB A;  4QX7 A;  3WQ1 A;  1XNB A;  1DZR A;  2VXR A;  1C4R A;  1O8S A;  3NW4 A;  1V9U 3;  1GAN A;  3V64 A;  3ZMO A;  1REF A;  2CGP A;  3U0Z A;  2WO3 A;  4IUG A;  3GZA A;  4Y4Y A;  5FPA A;  5T5J A;  4XF0 A;  1AR8 1;  1FMD 2;  5FPZ A;  1SQ4 A;  4XJZ A;  3MI8 A;  2CAU A;  2C9K A;  1LHO A;  4ZON A;  1VBE 2;  5F9T A;  1X82 A;  1HRV 2;  2XL9 A;  3RQ0 A;  4ZPI A;  1ASJ 1;  1C5I A;  1SAC A;  3T2O A;  3WIN E;  3BKZ A;  2EIE A;  3HNB M;  4OZO A;  1G8W A;  2EXJ A;  2HKX A;  1B35 B;  1V6K A;  2ZEY A;  3PIJ A;  2RDR A;  2VMD A;  1MS3 A;  3T0A A;  1QJY 1;  2DDU A;  5FZ4 A;  2VZV A;  5H9R A;  4DXT A;  4CU6 A;  1GLH A;  4CP9 B;  3MW4 A;  2RJ2 A;  3RG0 A;  4LK7 A;  1N1S A;  4COV A;  2JEM A;  1SDD B;  2RJK A;  1OH4 A;  3MFC A;  4GH4 B;  3POG A;  1WA6 X;  4HXC A;  4UFH A;  3SKJ E;  4B7E A;  3AZV A;  2FDH A;  4AI9 A;  2UU8 A;  2PEL A;  1OLR A;  1OI6 A;  2HYX A;  2XVK A;  4GB3 2;  1SMV A;  2ERF A;  4DXZ A;  4KG8 A;  2W08 A;  3USU B;  2R07 1;  1RUJ 1;  2XLF A;  3PTR B;  4O65 A;  2ZAC A;  4XJU A;  1WLD A;  4WVM B;  4X8N A;  3UKV A;  5FYS A;  5FZE A;  4ZXE A;  4XDQ A;  2JEC A;  4JV4 A;  3N9M A;  4AHY A;  1V6I A;  1WLT A;  4BQ2 A;  3U10 A;  2VQ0 A;  2VOV A;  3S30 A;  4OYU A;  3J7M A;  3TNP B;  1CGP A;  1AL0 G;  2O14 A;  5FZH A;  1UZV A;  1SFN A;  4AED A;  5GKA C;  4UF0 B;  4E4D X;  3GBF A;  3U1X A;  1VBC 2;  3A4U A;  2TUN A;  1LOE A;  1CES A;  4FP2 A;  5K7P A;  3GM8 A;  3WDU A;  4AVV A;  3ZFE A;  2CDP A;  1PGW 1;  2QKD A;  3JCI A;  3TN9 2;  3LAG A;  4FPJ A;  1NXM A;  4IXL A;  5FUN A;  2RMU 1;  3S0M A;  1YC6 1;  1T6G C;  3LOI A;  1AUY A;  1RED A;  1UAI A;  2PFW A;  2R07 3;  5FZ1 A;  5K4L A;  4CP0 A;  3O1S A;  1J3P A;  2IXJ A;  1O3S A;  3B94 A;  1W03 A;  1NE6 A;  1DIW A;  2VMH A;  3A23 A;  3JXS A;  4IW3 A;  4XEZ A;  4UFL A;  3I97 A;  3UKN A;  1MZF A;  4CSW A;  4JGZ A;  4HET A;  4OVE A;  3B00 A;  3U78 A;  4A7Y A;  2FDI A;  1ZVF A;  2PHX A;  3IMN A;  3M4F A;  1QJU 1;  1RVF 1;  3QAC A;  4L2N A;  3A0N A;  1F4H A;  1SFP A;  3HAG A;  4MGZ E;  5DAB A;  4CDW B;  5I0R A;  4KBZ A;  3ZXJ A;  1G6N A;  3P3P A;  3ZKY A;  1REE A;  5J37 A;  2D97 A;  3VKF C;  4YW2 A;  1QJY 2;  4OI1 A;  1TMF 3;  2QTW B;  2NMN A;  4R9D A;  1K5M B;  3EBR A;  1BYH A;  4XCB A;  2W46 A;  4ZS2 A;  2D44 A;  3OGG A;  4OFG A;  2D3R A;  2HBT A;  4IGP A;  1G9C A;  3ZFG B;  3FLT A;  1OXC A;  5HCH A;  4LBO A;  2BGC A;  1CAX B;  1JOB A;  4NO4 A;  4RS5 C;  1ZRF A;  1JZ7 A;  4I0W B;  2VTX J;  4H14 A;  3VDD A;  1ALY A;  2IXC A;  1JZ6 A;  3LEM A;  5FOJ B;  2NP0 A;  4GJZ A;  2WIN B;  4CE8 A;  1VBA 3;  4QPG B;  4Q26 A;  3ZVX A;  5FY9 A;  3OF1 A;  2D6P A;  4Q0P A;  4BA6 A;  3ZXF A;  1NA1 A;  1NCR A;  1NT0 A;  1CJD A;  4N8M A;  4RS5 B;  3WHU A;  1EV1 1;  4CEY C;  3EXU A;  2ZAH A;  1G9F A;  3INA A;  4WBB A;  3WDT A;  2VZU A;  1D0H A;  1EP0 A;  1CIY A;  5FIX A;  2FMY A;  2V73 A;  2ZHL A;  1T2X A;  4HPK B;  1HN0 A;  1ND2 B;  4AWD A;  4AFM A;  1HQL A;  4NR1 A;  5E8A A;  2BNO A;  3TEX A;  4CCK A;  2ZX4 A;  1BMV 1;  4XFF A;  3VB9 A;  2ZGK A;  1YI7 A;  1RMU 2;  1CPN A;  1OOP C;  4YVW C;  4LO7 A;  1Z7S 3;  3Q9O A;  4JKL A;  1LR5 A;  4BLJ A;  1PVC 1;  5C71 A;  2BNN A;  4EV0 A;  5IK8 A;  1SLT A;  2ZX3 A;  3PL0 A;  3ROU A;  3ZFF B;  1LOA A;  2WLP A;  1FPN 2;  3J8F 2;  3O1M A;  2ARA A;  1Y9M A;  2W1S A;  2ZGU A;  3PVO A;  4GAZ A;  4AED B;  4JKM A;  5ABJ C;  2YU1 A;  1XOY A;  3WG3 A;  3T08 A;  1JTZ X;  3R4D B;  4I02 A;  1W8H A;  5DAP A;  4BDV B;  1JYX A;  4AOC A;  4YVW B;  1QQP 2;  4S2H A;  5F1R A;  1IZ3 A;  1UXZ A;  3BAL A;  1MZE A;  5EJZ B;  2VGD A;  5C9A C;  2X5I C;  1R09 2;  1VIW B;  5HCA A;  5KBF A;  2B9V A;  3VBR A;  1G7Y A;  4Q4W 2;  2VZR A;  4A45 A;  1PGL 1;  2EXI A;  4QPI C;  4AEM A;  4DUW A;  4XQ4 A;  1YQ8 A;  2Q1M A;  3GBG A;  4AFC A;  2ZHK A;  1MVQ A;  1UMI A;  3N36 A;  5J36 A;  1JZ8 A;  1UYZ A;  2XLA A;  4NWW A;  4B4R A;  5HXV A;  2H0B A;  4XZP A;  5E16 A;  3VBF C;  5SV8 A;  1RUG 1;  4Z92 B;  2KM2 A;  1OHF A;  4XET A;  5K9Y A;  2NN8 A;  2Y0O A;  1AL2 3;  5LA9 A;  4BZ4 A;  4C1W A;  3AX4 A;  4YZ1 A;  5BNO C;  4DEQ A;  1RUG 3;  2GNM A;  4HLT A;  1SCS A;  3NAP C;  5FY4 A;  3VZL A;  1C3H A;  4PBO A;  5D8A C;  3WF4 A;  4DPN A;  3AJZ A;  4C1X A;  4QB6 A;  2VJX A;  2YZ4 A;  2C1F A;  3A22 A;  3C7E A;  3M2M A;  4Y20 A;  2Q1F A;  3MV1 1;  5FKC A;  4IEZ A;  3I2I A;  2A6Z A;  4FPF A;  3WNL A;  4BIF A;  3MIF A;  3SHR A;  5FZO A;  2XJS A;  2A71 A;  5BNO A;  2WFF 1;  4A7K A;  5JR7 B;  1SBE A;  5FMB A;  1W3X A;  1OQE A;  1KQR A;  3AZX A;  5A6X A;  1ODN A;  1QF3 A;  3VBF A;  2NYY A;  5LRR A;  2PQQ A;  1ZM1 A;  3P5B A;  3PUS A;  4WVZ A;  4D7Y A;  4Q4V 1;  4EN7 B;  1X9T A;  4H7L A;  2HWF 3;  1D4V B;  1P8J A;  1GMM A;  1KEX A;  2TNF A;  3LA3 A;  3NVC A;  4GWN A;  4MZU A;  5ISL A;  4IEV A;  3ZPY A;  3H42 B;  1POQ A;  2IUW A;  1QKQ A;  1WCQ A;  2WZR 2;  3NJX A;  4HPK A;  5K8S A;  1LOD A;  1ZA7 A;  3BN6 A;  3FLP A;  4QHO A;  1OUR A;  4CXW A;  5CKN A;  2QZ3 A;  4MX3 A;  3N7L A;  2VUJ A;  4LUL A;  2VUA A;  3SEP A;  2Z4F A;  4XQD A;  4KGQ A;  2DVA A;  4MGY E;  5FQ0 B;  1NCQ A;  4UBG A;  3HN3 A;  5H9P A;  4XXA A;  1EV1 3;  3I2O A;  1QJU 2;  1RVF 2;  2DCZ A;  1I5P A;  2UY8 A;  2WFF 2;  3GZE A;  1G9B A;  2DFB A;  1X36 A;  3CL1 A;  3QLQ A;  4HBN A;  1VBB 2;  5C3P A;  2R0F A;  1GZ9 A;  4RYD A;  2CAV A;  1K12 A;  5JZG A;  4EN6 B;  3HJR A;  4CVU A;  5JDB A;  2DCY A;  3POS A;  1GSL A;  2HWC 2;  4RQP A;  1VLN A;  5LA2 A;  4RSU A;  4JHT A;  4XVH A;  4DNY A;  2W5F A;  1MVE A;  2PHF A;  3FN9 A;  4HKO A;  5T5P A;  3O1U A;  1DCS A;  3LDK A;  3MO4 A;  5JMC A;  3LGR A;  5A1F A;  4ARX A;  3IMM A;  5D8A A;  4LIT A;  1AYM 3;  1MS0 A;  4RGK A;  3FZ3 A;  3KF3 A;  5LAS A;  4M4R A;  5FZ9 A;  4Z2W A;  3KHC A;  1RXG A;  3MLL A;  3KV5 A;  1PO2 1;  2ZML A;  3E6B A;  3NJZ A;  1YFY A;  2ET7 A;  2YBK A;  2ZGL A;  4XQW A;  2XLG A;  4JRA A;  3RYK A;  1UO9 A;  1JU3 A;  4AQS A;  5I8T A;  2X09 A;  3ZYI B;  4DXR A;  2AEY A;  1VMH A;  2W9X A;  1IPK A;  3MW2 A;  4UOJ A;  5CVR A;  3N9O A;  5FK7 A;  1QQP 1;  3KMH A;  4LO5 B;  1Q8V A;  4MXW B;  5FZG A;  2V72 A;  5L19 A;  1S0G A;  1LHN A;  4KWL A;  3GJA A;  3VBR C;  5IVE A;  1FXZ A;  3VD9 A;  1COV 2;  5GM0 A;  2GC0 A;  1O4T A;  4KG0 A;  3TWI A;  4OHV A;  2VZ3 A;  5SV5 A;  4AGV A;  4E2Q A;  1UQX A;  3QH7 A;  4QD2 A;  4NHX A;  4DS0 A;  5LA0 A;  5AVP A;  5FZ0 A;  1FX5 A;  1OSG A;  1UKG A;  2B9U A;  3JD7 3;  1RB8 G;  1HV0 A;  2CSG A;  4FP3 A;  2EIG A;  4Q4Y 2;  4YFW A;  5FPL A;  3AYC A;  1V6J A;  3VBF B;  5JOW A;  1ZBA 2;  1NKG A;  4XJW A;  2ATF A;  4IQP A;  4BCU A;  1W8T A;  3Q8E A;  4JTO A;  5L73 A;  3J9S A;  4JQR A;  1C57 A;  4C0H A;  4HMZ A;  5C3Q A;  1RUF 1;  1GNH A;  1PIV 2;  4JKK A;  3KGL A;  5FYH A;  2V09 A;  4CDU C;  1AX1 A;  2YRO A;  2R06 3;  3BU7 A;  3RGB A;  5IYY A;  4CDX C;  4MYE A;  1R08 2;  3AXE A;  1DLL A;  4KWK A;  3JBG 1;  2ES3 A;  3Q8C A;  3WQ7 A;  4CEY B;  1FYU A;  4XAC A;  5ACA 1;  4BME A;  1W6N A;  2CYF A;  2WO7 A;  1TEI A;  4Y33 A;  2PAK A;  5FLI A;  1LOF C;  1R64 A;  1IS5 A;  3JBG 3;  3WUC A;  1WUV A;  2DTW A;  4UFJ A;  4EN0 A;  4FPG A;  4FPL A;  4L97 A;  4YPJ A;  4K3U A;  5C7G A;  3P1I A;  4Q4X 2;  3CU7 A;  3FUQ A;  3ZYF A;  4Y5Z 0;  2VZ1 A;  1EY2 A;  1YQ2 A;  1UOF A;  4QKF A;  4PIY A;  1QJX 2;  2VQA A;  3ETP A;  4PI0 A;  1ZRE A;  5JI9 A;  1QDC A;  4DMI A;  3WW1 A;  1S2E A;  2UWC A;  3SH4 A;  2ILM A;  4LO8 A;  5EV7 A;  3OPW A;  1Y4W A;  3T0B A;  2BDR A;  1SHW B;  2D93 A;  3DYO A;  3N3H A;  1N1T A;  3PJQ A;  5BUV A;  4AL9 A;  1PZ8 A;  4AI8 A;  3OSD A;  2E9Q A;  1OQD A;  1VBC 1;  3CZU A;  2R1B A;  2PXJ A;  1BBT 3;  3BPZ A;  3LDR A;  5LEJ A;  4L11 A;  4N43 B;  2UUR A;  4COU A;  1UIK A;  3MIG A;  1C1L A;  2Y0I A;  2QQL A;  1W9S A;  1ZZ9 A;  4O9G A;  1UIJ A;  3POY A;  3O12 A;  4FFI A;  4N90 A;  2XWB B;  1YFU A;  1ND2 A;  2IFR A;  3VKM A;  2OQ7 A;  1W2O A;  4QXB A;  1MZ5 A;  3AP9 A;  5LBE A;  3CJI B;  4RQP C;  5IW0 A;  1PO2 2;  2FDG A;  5I0U A;  1IGO A;  1VAV A;  1XE8 A;  3BCW A;  2DU1 A;  4LLO A;  2OXB A;  1NX9 A;  2R04 2;  2VOK A;  4K21 A;  5FR3 A;  1XJA A;  2RS5 1;  1VAM A;  2WWU A;  1QEX A;  3ZOI A;  5FYV A;  4JHZ A;  4OUS A;  2JG8 B;  2ET1 A;  2WNV A;  4PDW A;  4XUT A;  4COW A;  3ZIX A;  1W06 A;  1S0C A;  1LEN A;  2VVD A;  2QQJ A;  3AYE A;  3DYM A;  3GHN A;  5CKQ A;  1DQ5 A;  1HW5 A;  4NMI A;  3ZFF C;  4OMC A;  4NII A;  3EHK A;  5IVC A;  4OHX A;  5C9A A;  1I1E A;  3NWK A;  4CUG A;  3KV4 A;  1J1T A;  3PJY A;  5FZI A;  2OPK A;  2UYA A;  4JQT A;  4YSF A;  1H2M A;  4PDW B;  1HXS 2;  3GXU A;  4CCL A;  1SZB A;  4LKD A;  4P14 A;  3WNP A;  3CDZ B;  5FPU A;  1KS5 A;  1OVP A;  2VZT A;  3MPP G;  3WVJ A;  4P00 B;  2GU9 A;  3MIH A;  1RUF 3;  3BPS A;  4AI2 A;  2W68 A;  4QM9 A;  4OHW A;  3ZN6 B;  1OH3 A;  1G9A A;  4Q0V A;  4Z2A A;  1X50 A;  1MS9 A;  3NV1 A;  3H7Y A;  4BH9 A;  1SLC A;  1VRB A;  1V6N A;  2XKP A;  1RUE 3;  3KCY A;  4HOO A;  3PLQ A;  4XFC A;  5A7O A;  4BQW A;  4CCC A;  4Y5T A;  1JHJ A;  3ITQ A;  1MAC A;  2VZS A;  2Z79 A;  5LY1 A;  4U36 A;  3UGH A;  1RUH 3;  2BPA 2;  4LIU A;  2Q8O A;  5KXB A;  3ASI A;  3AM2 A;  1IOA A;  3CJI C;  1DQ1 A;  3THP A;  5FQ0 A;  2B42 B;  3E5Q A;  4RHV 3;  4D3W A;  5JOY A;  1RHI 2;  1RMU 1;  4BQX A;  4FXG B;  5FXX A;  1XND A;  4E2G A;  5J09 A;  2CTV A;  4UFI A;  1YQ6 A;  2I45 A;  3FUO A;  3I2G A;  3AKQ A;  3LEG A;  3GJB A;  1W9Y A;  4XZU G;  1RUD 2;  2HEY F;  3MHZ A;  5FZM A;  1OMI A;  3KVB A;  4NE9 A;  1AXZ A;  1UYP A;  5B4X A;  1FV3 A;  3UET A;  1VBD 2;  1DQ2 A;  2V4A A;  5FK8 A;  3AVS A;  3H3L A;  1QGL A;  3E5U A;  3ILF A;  4FFH A;  4YW6 A;  2VPV A;  2RS5 2;  2WNO A;  1I9R A;  2PTM A;  1G86 A;  3B01 A;  5E6H A;  3O1V A;  4AG4 A;  2WAA A;  4A6S A;  1W2T A;  5FTT C;  1VAL A;  2YC0 A;  3AXD A;  1DGW X;  3M3O A;  5CFC B;  5I8Y A;  4OMD A;  3B69 A;  3KT4 A;  3VZO A;  3THC A;  5A6Y A;  3RVH A;  3R4S A;  1GZW A;  3LPG A;  3KZ4 C;  4UW4 A;  1PM7 A;  3I2H A;  3H0O A;  2H6B A;  1ZZ6 A;  2WS9 3;  3B7M A;  3J7H A;  1SFY A;  2WBK A;  3TNQ A;  1J3Q A;  2OZ6 A;  4QXK A;  1OOP A;  3WUD A;  1W9F A;  1UU6 A;  4QMA A;  4TYS A;  5A33 B;  1PM4 A;  5IAT A;  4CEW C;  1CX4 A;  3ILR A;  2RDS A;  3VKO A;  5A6Q A;  1H30 A;  2CGN A;  4CTE A;  1WCS A;  3LKJ A;  2B4K A;  1PX4 A;  2P3J A;  5JOX A;  3K3N A;  5DAW A;  2A6Y A;  1AR7 3;  2GNB A;  4BXS V;  4ARY A;  4OUE A;  3V0B A;  2R06 1;  3KS7 A;  4EQV A;  1YRZ A;  2ORX A;  1YYN A;  5L9V A;  3E6C C;  3K3O A;  4B8E A;  3JZV A;  3MIC A;  3AL6 A;  1QJE A;  4BK5 A;  5E88 A;  4CDX B;  4FO9 A;  2Q8D A;  3VL8 A;  2HEW F;  2WN2 A;  5A7P A;  5KC6 A;  4NPM A;  2VME A;  3UGG A;  1C1F A;  2A73 B;  2G9G A;  4XMA A;  1JH5 A;  3TN9 1;  3WDV A;  2IXK A;  4A4A A;  1TQ5 A;  4Q8L A;  5DN2 A;  1RXF A;  3V56 A;  3KCC A;  2RR1 2;  2WII B;  3HD8 B;  4A7Z A;  1O3R A;  1NLR A;  4C0B A;  3JB8 A;  4EZH A;  1LRH A;  1J1L A;  2GZW A;  2WQ8 A;  4K6B A;  1WW5 A;  4N53 B;  5DMY A;  2BBV A;  3EQE A;  4HK8 A;  4M0N A;  2ZOE B;  2VBP A;  5A7W A;  5IHR A;  5FMD A;  1VR3 A;  1MS1 A;  2RM2 3;  2RJL A;  2WT2 A;  4N9H A;  4XFH A;  3CKH A;  4BB3 A;  1UX7 A;  4QX3 A;  3RFR A;  5A1L A;  2DUO A;  4LEJ A;  5TSW A;  4DZG A;  1BVV A;  4MVT A;  5F2W A;  3SCH A;  4K7J A;  1QXJ A;  1UKR A;  2WAO A;  2PHT A;  1F31 A;  3WHT A;  3WW4 A;  2ZKN A;  5BYN A;  1BHG A;  1X7N A;  4HN1 A;  2HWE 2;  4Q1P A;  3PHM A;  1S0I A;  2WFP A;  3WR0 A;  4Q4X 1;  4PCR A;  4Y1V A;  2XHK A;  4QB2 A;  3W20 A;  1R1A 2;  1RHI 1;  1ND2 C;  3K75 B;  1DFQ A;  1VB4 A;  3T4V A;  3UKT A;  5B4N A;  1QU0 A;  2A6X A;  4MHR A;  4MV2 A;  5J98 B;  5HBA A;  3OJB A;  5F3G A;  5ANN A;  4JDN A;  5A3M A;  3I3D A;  3JU9 A;  4IE6 A;  2AZ5 A;  3SXW A;  5C8C C;  4QQ2 A;  3KHB A;  3CLP A;  3RZM A;  1A3K A;  3O0X A;  2BFU S;  2ZHM A;  5JSP A;  4WM8 B;  3VBH B;  4K40 A;  5LW9 A;  5CFC C;  2H0V A;  2Y6J A;  3O1P A;  5CFD B;  3EYP A;  5HPO A;  2EAA A;  5FPV A;  1JOD A;  1ZZC A;  1U0A A;  2X5I A;  4LJH A;  4ORF A;  3T1L A;  3K51 A;  4B1M A;  4M3C F;  2ZZQ A;  1K42 A;  2Z2S B;  4M3C B;  4LKS A;  1FMD 1;  3IKW A;  1AL2 1;  3NNF A;  5A3N A;  1FOD 2;  2WQZ C;  3ENR A;  4LUM A;  5DDJ 2;  1GQG A;  5C3S A;  3CQO A;  1UY4 A;  1Y9G A;  1KRI A;  2BJS A;  4Q0Q A;  4YW4 A;  2DWR A;  1WMD A;  4HAN A;  5CG8 A;  3OPT A;  3AFG A;  2OS2 A;  2WKK A;  4HL0 A;  5J48 A;  2A1X A;  5A3U A;  1UD1 A;  1BJQ A;  5HV4 A;  1IKP A;  1OUX A;  1RUC 3;  4LOT A;  4I30 A;  1NZI A;  1ZBE 2;  3IDC B;  2GAU A;  4IEX A;  2P5B A;  2C24 A;  2HWB 2;  1T6B X;  3GF6 A;  3IDB B;  1EAH 2;  2XQR A;  4D7T A;  2VTX A;  1I3H A;  1HLC A;  1BZW A;  3A7Q A;  2WLQ A;  5FZ7 A;  4XF1 A;  5FYY A;  5FRA A;  2EIC A;  3ZPO A;  5FY0 A;  4AAP A;  3KQ4 B;  2PHU A;  3ETQ A;  2XJT A;  4GD4 A;  2R04 1;  4LKF A;  3WG2 A;  3ILN A;  5EFU A;  2IC1 A;  3URF A;  1RUH 1;  1UU4 A;  4ITC A;  4FAH A;  1TVG A;  5KXE A;  4XDO A;  1I5Z A;  4AVT A;  4ISQ A;  5FCC A;  1D4M 2;  3MF9 A;  4Y26 A;  5T3N A;  4AW7 A;  2CGO A;  4Y1U A;  3B5L B;  3BOD A;  3Q8F A;  4NAO A;  5KC5 A;  3VDA A;  4CCO A;  1YHF A;  2Y8K A;  4V1P A;  1OFN A;  4MAD A;  4WV8 A;  5FO8 B;  1XYO A;  2MEV 3;  3VDC A;  3GNE A;  4L0P A;  1AYN 3;  3WEZ A;  3SQO A;  2Y6G A;  4BOW A;  3HT1 A;  4BYY A;  1W0P A;  2WNU B;  3VUO A;  4TSV A;  1VBB 1;  3H8U A;  4B3N A;  1XNA A;  4PQQ A;  4AK3 A;  4M3C A;  4ZXK A;  5L9R A;  3VL9 A;  1H1I A;  4CZS A;  2D6K A;  1F5J A;  1IHM A;  2VCC A;  2KA3 A;  2C9A A;  2G9F A;  4CP2 A;  1MS4 A;  2XVL A;  1AR9 3;  5FMO S;  3FLR A;  5ABJ A;  3IZO A;  2O8O A;  4JGZ C;  4N53 C;  3ZXK A;  2TEP A;  4KI5 M;  2PYT A;  3FHQ A;  5F5C A;  5F2S A;  4KBB A;  3VBR B;  2WZE A;  3ZXD A;  5BNP B;  1YI9 A;  2DFC A;  1ULE A;  4F83 A;  3TEZ A;  3RRD A;  2OKX A;  2AUY A;  5JCT A;  3IPV B;  1E5I A;  2ADD A;  5FZ3 A;  5A32 B;  4COZ A;  5A70 A;  2XBO 3;  2R6Q A;  2J1U A;  4P5H A;  4XJA A;  1BK0 A;  1EUT A;  1ST8 A;  1WLC A;  2HWD 2;  1NY7 2;  2BQP A;  4DXS A;  1AR8 3;  1XSQ A;  2P1B A;  3HOB A;  4AGR A;  5F6L B;  4CDX A;  4RD7 A;  3IWZ A;  3WNO A;  4GB3 3;  1CR7 A;  2FMD A;  2E7A A;  3T1M A;  3OGJ A;  1VAK A;  3CJX A;  5JIA A;  4PJY A;  4R9C A;  3MFA A;  2AYH A;  3DGT A;  4QKN A;  5FWJ A;  2KD7 A;  2WR9 A;  4Y5S A;  2RHP A;  3FBY A;  4QX8 A;  5T5O A;  4Q2F A;  3KWV A;  3H50 A;  4BWO A;  4OQ9 A;  3N9L A;  5FLH A;  1JW6 A;  5FXW A;  4YGC A;  2K2S A;  2NM1 A;  1XQN A;  5C8C B;  1OKO A;  1M4W A;  5FXZ A;  3H8O A;  3ZDS A;  2AH2 A;  4FFF A;  3LWC A;  3LB9 A;  3S57 A;  4XOG A;  3SIT A;  5LAT A;  2VW0 A;  3BB6 A;  4N53 A;  5IVF A;  3EMR A;  1A78 A;  2WS9 1;  4OUL A;  3ZMN A;  2VNR A;  4QXC A;  1WME A;  3NNM A;  1ZRC A;  1IS4 A;  1LAJ A;  2NZ9 A;  3KQR A;  4Z1V A;  1URX A;  4R8H A;  4A3Z A;  4K8R B;  5AFE A;  1X9P A;  4QQO A;  1J58 A;  2VTF A;  4X6R B;  5CFC A;  3JD7 1;  3O1R A;  5FZA A;  4CCD A;  4AI0 A;  3FE5 A;  4UW6 A;  2CHH A;  3CO2 A;  2W2I A;  3IIA A;  2LTN A;  4IGQ A;  4TLF A;  2Y38 A;  5FO9 B;  3WF2 A;  4IET A;  4K20 A;  5EPA A;  2VC9 A;  4TN7 A;  1GQP A;  3VHP A;  4ES8 A;  1H2L A;  2R30 A;  5EYX A;  2V5D A;  1BBT 1;  3N7J A;  1LEM A;  1SLI A;  2YPJ A;  4I2O A;  1QNW A;  3CJI A;  3IN9 A;  5FAX A;  1GYK A;  1Q8O A;  4K1Y A;  4XHX A;  4IV1 B;  1RL3 A;  4QWN A;  4NWV A;  2QCS B;  3MF6 A;  4MXW A;  4CUA A;  3LSD A;  5KHJ A;  2YYO A;  4YYO A;  2RMU 3;  3RPQ A;  1DLC A;  3OEA A;  3C2U A;  5FMC A;  1IPS A;  3UJQ A;  2BWC A;  4GKY A;  4DB5 A;  5IVB A;  3JQX A;  4L92 A;  3VD4 A;  2P3K A;  1CN1 A;  4W8J A;  5IVJ A;  1IQD C;  4XAA A;  3ZSJ A;  1ZBA 1;  4CU9 A;  4CXY A;  4FT8 A;  1RUE 1;  3QBQ A;  1C8M 3;  4FFG A;  1F4A A;  1WWY A;  3VBO B;  1OA4 A;  5E1R A;  3PVB B;  1GOF A;  2VNO A;  1CAX A;  2DYC A;  5BNQ A;  4P9W A;  5KHI A;  5GZF A;  5LB6 A;  2L9L A;  1SLL A;  1TG7 A;  4KQ7 A;  4Q4V 2;  5ACA 2;  3LZZ A;  1YIF A;  1WZX A;  4UI9 L;  4CDQ A;  5L7O B;  2ZPX A;  4BHP A;  2RR1 1;  3TOJ A;  1IS6 A;  3T2T A;  2WWJ A;  2XUM A;  3AKS A;  4M0H A;  1W8O A;  1SCR A;  1S0E A;  1ZZ8 A;  2C26 A;  2ZGT A;  1K3I A;  2ZS6 B;  3NRU A;  1BEV 1;  1US3 A;  1RIT A;  5DZF A;  2EA7 A;  4AF9 A;  2DF7 A;  4N43 C;  4PI2 A;  5FP8 A;  1D2S A;  1S0D A;  2UY9 A;  5KHG A;  4CU8 A;  1PGS A;  4PDW C;  3WZ1 A;  4BQ1 A;  4FTS A;  5D21 A;  2O1Q A;  2HBU A;  4W4Z A;  2A7A A;  3B93 A;  1W28 A;  3SLI A;  2UYB A;  1E57 A;  2A70 A;  4S2G A;  5KXD A;  1UYX A;  2ZGM A;  3LE0 A;  3RZK A;  4YZ2 A;  2D6L X;  4XBL A;  4LQR A;  3W21 A;  1NQD A;  2EIB A;  2WSU A;  4QKD A;  1UU5 A;  3ZFE B;  1ASJ 3;  1NLS A;  2JIC A;  1HRI 2;  1UXX X;  1RUI 3;  3BGA A;  3D8C A;  4Q4W 3;  3WY6 A;  3ZFG C;  2WNE A;  4BQ3 A;  5IVV A;  5JAX A;  2IVI B;  1F2N A;  1ZRR A;  4QPY A;  3I2D A;  1JS9 A;  5FOB B;  2WJS A;  3P3N A;  2BZD A;  3DXU A;  2GC1 A;  3H7J A;  3I3E A;  2DTY A;  4XF9 A;  4FOQ A;  4XBQ A;  1ZX5 A;  2A3Y A;  1UCX A;  2WSV A;  5FZ6 A;  5C6C A;  5A1A A;  1R08 1;  5DPN A;  1GWL A;  2Q8E A;  3POF A;  4JGY B;  4MXV A;  1ZRI A;  4JCK A;  4JX0 A;  4OHZ A;  3RWK X;  3ZYB A;  2B5H A;  3LEK A;  3FL7 A;  5GZD A;  4E9K A;  3K48 A;  3ATG A;  1FNY A;  1CX1 A;  2K0G A;  2LS6 A;  1O6U A;  3DN7 A;  3MDP A;  4A44 A;  4DUX A;  2RS1 2;  1FV2 A;  3ZKU A;  4YLZ A;  4SBV A;  1EUU A;  1RUI 1;  2K9Z A;  1LHW A;  1MEC 3;  2FDJ A;  3HPN A;  1QY4 A;  2WQ4 A;  3PVE A;  3RMX A;  2IFW A;  3ECQ A;  3LPF A;  1ULF A;  3POE A;  2XOM A;  3VHO A;  3AMN A;  1VRH 1;  2XVG A;  3LQC A;  4J1X A;  4N7U A;  3RZJ A;  1R1A 1;  4FTB A;  1DZT A;  1ENQ A;  1KXG A;  4QQL A;  4S2D A;  4WM8 A;  3VKL A;  4NHM A;  5B2G B;  5I91 A;  3N7K A;  1W8F A;  3ZFE C;  2EVX A;  2VMF A;  3AYD A;  1K45 A;  4IEY A;  4LO4 B;  5FY5 A;  2JWP A;  3KT7 A;  1JBC A;  1XBF A;  3H9A A;  2A3X A;  5JZG C;  3ZDV A;  1W6N B;  3VZM A;  1CVN A;  1PVC 3;  3PU3 A;  3K2O A;  2XJV A;  4QU2 A;  2GMP A;  3MPB A;  2XJU A;  3ME2 A;  4YFZ A;  1IPJ A;  3NAP B;  5HV0 A;  4YZ4 A;  1YJK A;  4LUK A;  4YWA A;  1AR6 3;  4MGS A;  4P9J A;  5BPX A;  4XTM A;  2R1D A;  3SKV A;  2WO1 A;  1TNR A;  3MUY 1;  4YW3 A;  3RDI A;  1JYI A;  1MQT B;  1WBF A;  5LA1 A;  4GIQ A;  2BTV C;  5BNN B;  4CDQ C;  2AR6 A;  4HSJ A;  5GZE A;  5A3T A;  1JHN A;  2W1Q A;  1B09 A;  4IEP A;  1R1Z A;  1S55 A;  3AMQ A;  4RHV 1;  4BQ5 A;  4E27 A;  4ZHN A;  2X10 A;  3BOW A;  1ZZ7 A;  4XJ9 A;  2DVD A;  2XG3 A;  1F8V A;  4D6S A;  5L7O C;  1XRU A;  4D94 A;  3POB A;  3WT3 A;  1AX2 A;  5C4W C;  3NNL A;  3BIW E;  1ZRD A;  3POJ A;  4EZ4 A;  4CDQ B;  5CBL A;  2E7Q A;  1AYM 2;  2WNV C;  1QMJ A;  3H1W A;  4MET A;  2OX0 A;  5C8C A;  2V5Y A;  4NN0 A;  1W99 A;  2QQI A;  5JWP A;  5JXJ A;  3NL1 A;  5E89 A;  1W0N A;  2PAE A;  1KDK A;  1SDW A;  1SBF A;  3TBD A;  5A7N A;  3M7A A;  4RN5 A;  4ONU A;  4ASL A;  5BXX A;  2VM9 A;  3RI9 A;  4GH4 A;  3WP6 A;  5T55 A;  3O0V A;  5JPM B;  3ZYJ B;  2RS3 3;  2BW8 A;  5AFB A;  2E7T A;  3O7O A;  1SPP B;  1X8M A;  3NV4 A;  3OEB A;  3C7G A;  1O91 A;  4QDQ A;  3UJO A;  1COV 3;  1RTV A;  3CNA A;  5JSO A;  3NAP A;  4CPB D;  2RE9 A;  2F4L A;  2BUK A;  3LFI A;  1F15 A;  1W90 A;  2B46 X;  2XGX A;  2LM3 A;  3I2J A;  5EQU A;  4I3P A;  1PK6 B;  1H8V A;  2E51 A;  5T5L A;  1V9U 2;  3JD7 2;  1QJU 3;  1GBG A;  5FUP A;  1E5S A;  3C8X A;  1G9D A;  1XC6 A;  2CDO A;  2PLV 3;  4TZD A;  3H8R A;  1FPN 1;  3J8F 1;  1UL9 A;  1ZBA 3;  3AMH A;  5FZF A;  1H2K A;  3DEC A;  4IE5 A;  4FSJ A;  4XYX A;  2J1T A;  4GMP 3;  4JC1 A;  5FYU A;  1VBD 1;  2Y6H A;  1VBE 3;  2J1E A;  4MUV A;  4Z07 A;  1DG6 A;  4CCE A;  1UZ0 A;  1W05 A;  2UWB A;  4W65 A;  4HSL A;  4NJ4 A;  1YJL A;  2SLI A;  2Y6K A;  3AL5 A;  4IER A;  5LCW L;  3IT8 A;  3M3I A;  5C8W A;  3ABZ A;  3SCF A;  5C33 A;  2J1V A;  2ZEX A;  4NPR A;  1U5Z A;  4XUQ A;  1H6X A;  3K46 A;  1JYC A;  2JG8 A;  2WNV B;  5F5I A;  1RUJ 3;  1GQH A;  2DBN A;  2FHR A;  1JZ2 A;  1GR3 A;  3MZH A;  3III A;  4I0B A;  4Q4X 3;  5FPX A;  1W6M B;  1IS3 A;  2JDP A;  2TBV A;  5J3U A;  3D82 A;  3GZU C;  1NY7 1;  2D98 A;  3F2Z A;  4CDU A;  1HB1 A;  5BNP A;  3FHA A;  1WD4 A;  4CU7 A;  3VBS B;  4LBQ A;  1HB2 A;  2W47 A;  1K5M A;  2CWM A;  2PMW B;  4NRO A;  1OQ1 A;  2GMM A;  3VZK A;  4EJR A;  3RSJ A;  5FDB A;  4OQ8 A;  3OY8 B;  2XR4 A;  2P3Y A;  4KU7 A;  4E4H A;  3HBZ A;  5DUV A;  1APN A;  1DGL A;  1QHD A;  3KB5 A;  4QX1 A;  2XXZ A;  4GUL A;  1GP6 A;  5AC9 2;  1AJK A;  1ZZB A;  3RZG A;  1BBT 2;  1O5U A;  3I3M A;  3W58 A;  3POW A;  4PF1 A;  3VDD C;  1BQP A;  1F5F A;  1UZY A;  3ZSL A;  3VGI A;  1W6O B;  5JSR A;  2D6O X;  4XUR A;  4Z82 A;  1YFW A;  5CNA A;  4LBQ D;  1CD3 G;  2Y60 A;  5G04 L;  1XNK A;  3TN9 3;  1UZW A;  3MLJ A;  1NXD 1;  2K46 A;  4COY A;  3BTY A;  1VMF A;  1GFF 2;  3MLK A;  2MEV 1;  3T4H B;  2R07 2;  1H8T A;  1LGC A;  3H3U A;  3R4U A;  1HIX A;  3HMY A;  3G6J B;  2JDU A;  1LNS A;  3WSO A;  3JQW A;  3TRS B;  4LKE A;  1HDK A;  1RYY A;  4H3W A;  3Q8A A;  1JUH A;  1VPH A;  2RV9 A;  4ZZ8 A;  1B35 C;  2W94 A;  1TME 1;  1D0G A;  2WRA A;  2FCT A;  4D69 A;  4FCA A;  1AR7 1;  3CHX A;  5A7S A;  4TWT A;  1WW7 A;  1OA2 A;  5AC9 1;  4UXA A;  1QJY 3;  3UNP A;  1UMZ A;  5FYM A;  1LOB A;  4I01 A;  2VEC A;  4LT5 A;  3KF5 A;  2VNG A;  4XFA A;  2ZKL A;  2LW8 A;  4NUB A;  3E97 A;  1K5M C;  1W6P A;  1H4G A;  1DZQ A;  2JE7 A;  2JG9 B;  2W95 A;  4X8P A;  2OVU A;  1DDL A;  4ZU7 A;  5FO7 B;  1HJG A;  4UF0 A;  2BV4 A;  5HI0 A;  3HWJ A;  1NA1 C;  1NCR C;  2PA7 A;  4FOV A;  4GMP 0;  5G05 L;  4ET7 A;  4HVQ A;  1W0O A;  4KH9 A;  5JIU A;  1RJ8 A;  5JMO A;  4RQP B;  5FZD A;  4J25 A;  3BYW A;  3RZH A;  3VBS C;  1V6M A;  1HKD A;  3ON7 A;  1GIC A;  3M3C A;  3LSE A;  4HVR A;  2RDQ A;  3NV3 A;  4PHZ A;  1OD3 A;  1YUD A;  5LEK A;  1VBC 3;  1H8T B;  2WYF A;  3BVC A;  2NQY A;  1JOJ A;  2J1A A;  2YBP A;  3N9N A;  2BER A;  3ST7 A;  2JXA A;  1CPM A;  3RZL A;  3T2P A;  3UL2 A;  4UYB A;  4ZS3 A;  2R32 A;  3I59 B;  5LK7 B;  3OTF A;  2B39 A;  1BEV 2;  2VW2 A;  2VCA A;  3HT2 A;  4AFB A;  1FNZ A;  5FZO B;  1HRV 1;  1RMU 3;  2WZ8 A;  5F8P A;  3SIS A;  5J1X A;  1PO1 2;  4RHV 2;  4FI9 A;  4D8M A;  3BUC A;  4BQ4 A;  4YGB A;  3MGU A;  1SPP A;  5T52 A;  3WCR A;  1U5Y A;  1E5H A;  4IV3 C;  3CIH A;  1FPN 3;  3J8F 3;  4WM7 C;  5FZB A;  1RUC 1;  1TME 2;  5CU1 A;  5FFO C;  1W9T A;  3S7E A;  5IK4 A;  2C6S A;  3APB A;  4FPO B;  1RUD 3;  3FX3 A;  5FZC A;  3EB7 A;  1DQ0 A;  2J22 A;  2P34 A;  3RI8 A;  4YVS B;  1VRH 2;  4UT5 A;  1N3P A;  2C0Z A;  2A3W A;  2QNK A;  2ZZJ A;  4XXP A;  1R09 3;  2XJP A;  4LBN A;  4XAE A;  5JR2 A;  3BIE A;  2JIG A;  3MUZ 1;  1O4Y A;  2D3S A;  2GH8 A;  4NRP A;  4XAB A;  1NA1 B;  1LEC A;  1NCR B;  2ARX A;  4GH4 C;  4LA2 A;  4PIZ A;  1N1Y A;  4XFB A;  4Z8B A;  5JLV A;  2JE9 A;  3DKW A;  1J83 A;  2ZTN A;  4LE4 A;  1OD5 A;  2NMO A;  2XB6 C;  5IAX A;  2XBO 1;  4L9B A;  3GAL A;  2GAL A;  1AL2 2;  1VBA 2;  2E6V A;  4EWA A;  2G4I A;  3ZR6 A;  3EJK A;  2WS9 2;  1JYT A;  2VL4 A;  1RUG 2;  4MOA A;  5BNN A;  4MLO A;  1ULD A;  4HKL A;  1MQT A;  2JDY A;  3JUU A;  1DU3 D;  5JPN B;  1UYY A;  1KFU L;  1CZV A;  4FAG A;  3WF0 A;  5BV6 A;  4CP9 A;  3ACF A;  4IV1 A;  3OOX A;  4A42 A;  1VMJ A;  4LLF A;  3VDB A;  4MO3 M;  1W8Z A;  2DVF A;  3N7M A;  5FV3 A;  3VBO C;  5KHH A;  2W52 A;  4C91 A;  2VH9 A;  3IM0 A;  4AE2 A;  2HWC 1;  3L2Y A;  2XQX A;  3JB4 C;  4UWD A;  5CG9 A;  2GC2 A;  3IAP A;  4FOW A;  3T30 A;  1ND3 C;  2VUD A;  5EWS A;  1AHS A;  4R52 A;  1PZ9 A;  1XXN A;  3USU A;  4IL7 A;  3VBS A;  3FJS A;  3POI A;  3PU8 A;  4YVW A;  1Z7S 2;  2WAB A;  3UK9 A;  4IE4 A;  2WNU A;  1GZC A;  3OBT A;  3J4U H;  3PME A;  4YVS A;  4NIG A;  3KCX A;  2VQT A;  1RC6 A;  2IZW A;  2QZ2 A;  5LBF A;  1Y9Q A;  4ASM B;  1QDO A;  1HB3 A;  1JYV A;  3PMS A;  5J7M A;  5GLV A;  2QUO A;  3ALQ A;  3BI3 A;  1RUD 1;  2EXH A;  4UFK A;  5DG2 A;  2ETE A;  3PDQ A;  1N3O A;  2P4E A;  2Y6F A;  5LZ6 A;  1JZ4 A;  1MR5 A;  2FZ1 A;  4NPL A;  4AEJ A;  3ZXA C;  4PLN A;  3LDB A;  2VNV A;  2CL2 A;  1JYN A;  3HN1 A;  4FPE A;  1EV1 2;  4LHL A;  3ES1 A;  1A6C A;  5DXD A;  3WP5 A;  5JOZ A;  3ZSM A;  1GOH A;  4Y1Z A;  5IAV A;  2GH2 A;  1V9U 1;  4AVA A;  2GN7 A;  2VMI A;  3OUJ A;  4RS5 A;  3TB0 A;  3VD5 A;  4E4Z A;  2G1M A;  2KR2 A;  5FRE A;  3ZLI A;  4YG0 A;  3WDX A;  4CCJ A;  1DF0 A;  3OUH A;  4QPI A;  2ZAB A;  2Z69 A;  2AEZ A;  3E1F 1;  1H8T C;  2ZGO A;  3M1H A;  4JGY C;  5IK5 A;  4ES9 A;  5EP9 A;  5FMO L;  3KSC A;  2F6B A;  4HON A;  2YG0 A;  1TE1 B;  1WCK A;  3OB8 A;  2ZEW A;  2YV8 A;  4Y1Y A;  4LBK A;  4F8A A;  2DUR A;  4OI0 A;  2ZJC A;  2BYV E;  4XF4 A;  4AGG A;  2CU5 A;  5F39 A;  2VU9 A;  1OPM A;  1POV 3;  5GAL A;  3H8X A;  2Q5T A;  5FP9 A;  4S2F A;  3J7L A;  1W6P B;  2D43 A;  5C3O A;  1MZ6 A;  5CIR A;  1W3V A;  4XIL A;  1WW6 A;  4HG6 B;  4YNI A;  3V0A B;  3ZXG A;  3I3Q A;  1WCD J;  1SEF A;  2BNM A;  4AHZ A;  4AQ6 A;  5C4W B;  1ZBE 1;  2QQM A;  3AKP A;  4C8D A;  4MG2 A;  5F37 A;  1NE4 A;  4E2S A;  2HWF 2;  2W1W A;  2IXH A;  1TNF A;  2NPI A;  2RG4 A;  1OUS A;  4AZZ A;  3LIG A;  1AZD A;  4IND A;  4JGZ B;  3WP3 A;  3J7N A;  4D6Q A;  2JJ6 A;  4XDP A;  4DQA A;  3OD4 A;  5CYY A;  1SBD A;  2R7E B;  5BNP C;  1D2Q A;  3K4A A;  1FOD 3;  1PMI A;  1XNT A;  2VOT A;  1YLL A;  3FFQ A;  1RGS A;  1Z7S 1;  4WZF A;  5I0T A;  1C5H A;  3DEM A;  3HQR A;  1MPX A;  2O0O A;  4IV3 A;  4R9A A;  4JDM A;  2VQU A;  3FHI B;  4H2A A;  1IG3 A;  2DCK A;  4M00 A;  5GJ6 A;  4ZY9 A;  3D0S A;  3LIH A;  4AYU A;  3M70 A;  4LMF A;  1UN1 A;  3WQ0 A;  4NID A;  4Y3O A;  4W50 A;  4PF5 A;  1RVF 3;  4JZR A; 
#chains in the Genus database with same CATH homology
 4NMI A;  2FCU A;  4XC9 A;  5DAP A;  2FCV A;  3GJA A;  5LB6 A;  5L9R A;  4NHL A;  3OBZ A;  4UWD A;  2Y33 A;  4NHX A;  3NNL A;  2RDN A;  2FCT A;  5LA9 A;  5DAV A;  2HBU A;  2G19 A;  5LBF A;  4BQW A;  4Y5T A;  3ITQ A;  4Q5O A;  3W20 A;  3W21 A;  2Y34 A;  2OPW A;  3NNJ A;  4MHR A;  4XAC A;  4Y5S A;  5EQU A;  5C5T A;  4BQX A;  4IW3 A;  4BQY A;  3KT1 A;  2JIJ A;  3DKQ A;  5LBB A;  4MHU A;  4J25 A;  5C5U A;  3GJB A;  3HQU A;  5IAV A;  3OUJ A;  5LAT A;  4NHK A;  2RDQ A;  3EMR A;  4KBZ A;  2G1M A;  5L9B A;  3BVC A;  3OUH A;  3NNM A;  2V4A A;  4XCB A;  3NNF A;  5EP9 A;  2HBT A;  3OUI A;  3KT4 A;  5DAQ A;  4XCA A;  3MGU A;  5ERL A;  2A1X A;  5A3U A;  3GZE A;  5EPA A;  5HV4 A;  5LBC A;  5IAT A;  2RDS A;  2RG4 A;  4NHM A;  4NHY A;  4ZON A;  5M0T A;  5LBE A;  5DAW A;  3KT7 A;  2JIG A;  4ZPI A;  4XAB A;  5L9V A;  3HQR A;  5HV0 A;  5LAS A;  5DAX A;  2RDR A;  4NAO A;  5IAX A;  4XAA A;  3PL0 A;  4JZR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...