3OUHA

Phd2-r127 with jnj41536014
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
216
structure length
212
Chain Sequence
LPALKLALEYIVPCMNKHGICVVDDFLGKETGQQIGDEVRALHDTGKFTDGQLVSQSKDIRGDKITWIEGKEPGCETIGLLMSSMDDLIRHCNGKLGSYKINGRTKAMVACYPGNGTGYVRHVDNPNGDGRCVTCIYYLNKDWDAKVSGGILRIFPEGKAQFADIEPKFDRLLFFWSDRRNPHEVQPAYATRYAITVWYFDADERARAKVKY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Benzimidazole-2-pyrazole HIF Prolyl 4-Hydroxylase Inhibitors as Oral Erythropoietin Secretagogues.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords Egl nine homolog 1
total genus 60
structure length 212
sequence length 216
ec nomenclature ec 1.14.11.29: Hypoxia-inducible factor-proline dioxygenase.
pdb deposition date 2010-09-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13640 2OG-FeII_Oxy_3 2OG-Fe(II) oxygenase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.620 Mainly Beta Sandwich Jelly Rolls q2cbj1_9rhob like domain 3ouhA00
4NMIA 3EMRA 5LB6A 2RG4A 4NHXA 2Y33A 4XCBA 3HQRA 2JIGA 3OUIA 3NNMA 3OBZA 4XABA 5LBFA 3W20A 5L9BA 5M0TA 5EP9A 4NHKA 5A3UA 3MGUA 2JIJA 5HV4A 5DAWA 4BQYA 4MHUA 5DAXA 4Y5TA 4BQWA 4Q5OA 2RDRA 4J25A 2G19A 5EPAA 5IAVA 4XAAA 2A1XA 4BQXA 5L9RA 3GJAA 4NHLA 5LBEA 3GZEA 3GJBA 2FCVA 2V4AA 4ZPIA 2HBUA 5C5UA 4JZRA 4KBZA 2Y34A 5IAXA 2G1MA 5LA9A 2OPWA 5IATA 3ITQA 3OUJA 4MHRA 5HV0A 4XACA 3KT1A 4Y5SA 4NHYA 3KT4A 2HBTA 5LASA 3BVCA 3W21A 5C5TA 2RDSA 5EQUA 2RDQA 4UWDA 4ZONA 3OUHA 3KT7A 5LBCA 3PL0A 4XC9A 4IW3A 3NNJA 3NNFA 2FCUA 5DAVA 4NHMA 5ERLA 3NNLA 2RDNA 3HQUA 3DKQA 4XCAA 5LATA 5L9VA 4NAOA 5DAPA 5LBBA 5DAQA 2FCTA
chains in the Genus database with same CATH superfamily
4NE9A 4D7YA 4Y22A 1AYM1 4Q4X3 3WV6A 3HD8B 5F5AA 3PTRB 1MACA 2PHWA 1JODA 2ZKLA 5FZKA 5GALA 1XB9A 5I0DA 4RA0A 2A3YA 4JHTA 2EIBA 5IYYA 1R1A3 3NNGA 5JI9A 3VDBA 5LWBA 3HQRA 2OQ6A 3SHRA 4BH9A 2PFWA 5DZEA 1R1ZA 3OBZA 2ET7A 2D5HA 2GH8A 2ZKNA 3FLTA 4CCEA 5LK7B 1NCQB 4YVSB 3T4VA 1RUJ3 3P3PA 2Y0OA 3MPPG 3GCXA 1FX5A 2AZ5A 4ITCA 4ES9A 2WN3A 1QJX2 4GMP0 2D6KA 3HIFA 4LKDA 4UFMA 4I0WB 3ST7A 1W28A 4P08A 2NMNA 4XFCA 1QXJA 5CB7A 1ND3A 1VB2A 3NJXA 1NT0A 5IJRA 2XUMA 3ILRA 4CXWA 2WLPA 1DFQA 5CU1A 4BQ1A 1RB8G 3OPZA 1R091 4LKFA 4E27A 4ZHNA 1O3QA 4FXGB 5BNNA 1W6MA 2E63A 1YEWA 4GKYA 2WZPP 4BYYA 3HBKA 1LHVA 4EN8B 2JICA 4URTA 4R9DA 1H9WA 2AENA 1J1TA 1W8UA 4YW1A 1FXZA 4LO6B 4Q0PA 2EICA 5EPAA 5CZKA 2WS93 3BPZA 2HH9A 3SQOA 5C8CA 1DZRA 4HKWA 1PZ7A 1BEV1 5JXIA 1RINA 4NR1A 2H0BA 1CPNA 1Q8VA 5IK4A 4UF0B 1XOYA 2YU1A 4NHLA 1AR83 2PHTA 5LRRA 5DG1A 2GNMA 5J96B 2PA7A 1S0EA 3E1F1 3LEMA 4HK8A 1UYXA 4LLFA 5CNAA 1ZBE3 3IWZA 3OGVA 2VU9A 4WM7B 5DUXA 4KBZA 3FUQA 4KH9A 3ACIA 3SKJE 4OYUA 1RC6A 1LCLA 1PO12 1NE6A 2WYSA 5FZ3A 5LA9A 3C7OA 3ZOIA 2WNEA 2LROA 5FK8A 5K4LA 5FZ7A 3THCA 1BYHA 4MGZE 4CPBD 4NIAA 2XBO2 1WBLA 4NWWA 4AQ2A 5FZ0A 1FPN3 2VMDA 3IMMA 1GOGA 2D43A 4K40A 3THDA 3K3OA 5L7OB 2RM21 3GBFA 5HV0A 2ZGQA 4LBJA 2RMU3 1DGRN 2H6CA 1CD3G 1XPWA 3DECA 3M8LA 1PM7A 1IGOA 3VBSB 3LSEA 2W68A 1RUI3 2BRTA 2QQKA 3VBOB 5HCFA 2X05A 1BLZA 2H6BA 2BNNA 4XHBA 2WNUB 1QMJA 4IUGA 2DTWA 4QPYA 5FQ0B 4AEMA 3ZXDA 4AEJA 3DGTA 3K3NA 4JGZA 2JDHA 3OB8A 2C9KA 2ID4A 2VR4A 3TOJA 4FPKA 4DY5A 1IS5A 2YG0A 4G9SB 1SDWA 3FMGA 4J6GA 1UN1A 3UKTA 2JKBA 5FYBA 3T0BA 3ZR5A 4YW2A 4BQ5A 3CZUA 4A7YA 1QXRA 2V73A 2DCZA 2QQLA 4CDQA 1QH6A 1VAVA 1WBFA 5A33B 4BDVB 5FO9B 3WT3A 3WP6A 5T50A 2P2KA 4W6YA 3ZYIB 4NAOA 2WDBA 3LAGA 4QX7A 1H30A 3QH6A 2VECA 3IAPA 3TBDA 5H9PA 4D6SA 3KQ4B 3M3OA 5HXMA 1ND2B 1W9TA 3WF3A 2RG4A 3ZM8A 2EXJA 1UYZA 1MS8A 2WR9A 4LBQA 4BMEA 4XCBA 3MIFA 1GOFA 2X5IC 5FZLA 2CSGA 1SFPA 1W6MB 3WLUA 4AEDB 1GWKA 3RZHA 5A1AA 4NN0A 2LUWA 3LF7A 3T0AA 2B4KA 1GYKA 2DVDA 2K2SA 4AF9A 3V0AB 4INDA 4IXLA 4Y5Z0 1WGPA 3FHIB 3I59B 5FP4A 5FR3A 1ND3B 1VMHA 1OHFA 3JCIA 5LY1A 1HRI2 1YI7A 2BTVC 3H3UA 4AYUA 2J1SA 3VBOC 4NHKA 3TEXA 2VVDA 4CP2A 1PO23 3VBSC 1S0CA 1EP0A 3BOPA 4P5YA 2W47A 3OCPA 3J7NA 4LOTA 5D1IA 3U4SA 3UJQA 1AR93 3AZVA 1ULOA 3NKGA 4QX2A 4LOSA 4YVSA 3VKNA 1W3VA 1LOGA 2SBAA 4LK6A 5FMCA 2XWJB 1YQ6A 4AVCA 4UBGA 5K7PA 2C4XA 3L2HA 3MV01 3AB0A 4C1WA 1EAH2 1ZZCA 2Q8OA 5FYIA 1NA1A 3QLQA 1WWYA 2QCSB 2VZRA 1PO11 3VHPA 5L73A 4AOCA 1NG0A 1CAWA 1WW7A 1DBNA 2FZ1A 5A7SA 3N7KA 1YQ5A 1VRH1 5ACA2 5SV5A 4NIDA 5L9RA 2BDRA 3ETQA 1IS4A 4H3WA 1Z0HA 4BQ4A 1AYN3 4AHXA 2YPJA 1KFUL 1E5HA 3AP6A 3UNPA 1KD7A 1SLLA 2NMOA 5FLHA 3N9NA 5KBFA 1XNCA 4MXWA 3M70A 2F4LA 5GLVA 1PIV1 4FTSA 4R8HA 3ZFFA 4F8AA 2B46X 1OI6A 1P8JA 3WCRA 4JGYC 3ZX7A 3DPRB 1R092 3VHNA 4EWAA 2JKXA 4QQHA 4GB31 1J59A 1VJ2A 5DABA 3WQ1A 2BW8A 3AKTA 5CA6A 1JU4A 3K48A 4COWA 3W21A 1CZTA 2A75A 3AMQA 2NZ9A 1XNTA 3KM5A 1UMIA 1YUDA 3U14A 1LTEA 2UY9A 2YV8A 3AMHA 5APAA 1CN1A 1VAKA 4ZU5A 5JWPA 4DUVA 2G9ZA 1GP6A 1SPPB 4FQ4A 1KJLA 1S0BA 2R7EB 2VVEA 4GAZA 2JB4A 3S5QA 2DCJA 4GD4A 3OUHA 4LUMA 1NCQC 3Q8FA 3CBNA 3CJIB 1YIFA 2OX0A 4QQLA 5LBCA 3SXWA 1V9U3 5AVAA 5BXXA 4IW3A 2EIDA 3NNFA 3D5OA 4JGYB 2J1RA 3MO4A 4S2GA 4S2HA 4WBBA 4GALA 3MIGA 3RQ0A 3RRDA 1YXWA 4IETA 5DZFA 3WUDA 4MYEA 4BU2A 3TWIA 2VZVA 3B5LB 1PGL1 2E53A 2VMEA 4UXAA 2ZHLA 5K8SA 1MZFA 2EALA 4R9BA 2D6MA 4NJ4A 4AI2A 4DINB 3PIJA 5DAPA 1UMHA 1H2LA 4YW7A 1K5MB 3VHRA 1DG6A 1YRZA 1GANA 2WA3A 5IVEA 2ZX0A 3R05A 1GV9A 3N7LA 4IE6A 4XMAA 3O12A 3EHKA 5AFBA 3GALA 5J36A 4RL7A 4OI1A 2Y33A 1LU1A 1DZTA 1NE4A 3JXSA 2MHFA 2XONA 1SMVA 1D4M3 3GHMA 3WQ7A 2WFF2 1XU2A 3OUIA 3KSCA 2W3JA 3T0DA 1C28A 3VD4A 1V6MA 1VBE3 1VBA1 1EYBA 1CESA 1MVQA 1NZIA 3CMGA 2W95A 1JZ4A 3POIA 1VB4A 5IVBA 4DFSA 1MVEA 4AGGA 3ZIXA 1Y9GA 2W08A 2O0OA 2HWB2 3IBMA 4Q4V1 1W6NB 4B4PA 1VMJA 1ZZBA 4META 2X29A 4WVWA 5A3UA 5B2GB 2DBIA 3AP9A 1N1TA 3M7AA 4CDWC 4AFMA 2QDRA 4P02B 5I0RA 2F4PA 3KLSA 4MSVA 3RMYA 3LDRA 1ZZ9A 4Q29A 4E4HA 4JDMA 3WNXA 3ILFA 4CDXA 1VPHA 3SMHA 4FBFA 4E9KA 1W2OA 2YUEA 1H8TC 3ACFA 1JS9A 1W6OA 4MHUA 3UYJA 4HVQA 5FY7A 2VH9A 3LOBA 4M01A 2WWJA 5FDBA 1JH5A 3NAPA 4FVVA 2XVKA 1TEIA 5IAVA 5A6QA 4XAEA 2JE7A 1IQAA 1OLME 1OBNA 5FK7A 1MS4A 1UPSA 2IC1A 4RHV3 4XDQA 4XJUA 2YFZA 1B09A 1XU1A 1W8HA 3GZEA 1W8ZA 1YFYA 1YFXA 5FREA 3T30A 3WP3A 1AUYA 2Y6JA 1VBC3 1DP0A 1N3PA 1RUJ2 2ZGTA 3LDBA 5EJZB 3ZXKA 1JZ2A 1QQP2 2Y34A 5T5LA 2D40A 1G9BA 3V0BB 1WCQA 1ACCA 2QZ3A 4JKKA 4SLIA 3EYPA 1KQRA 3QBQA 4WVVA 3ZIWA 1NA1B 1KRIA 2A73B 4QPWA 4H7LA 3OOXA 1L7LA 2R041 1W9WA 3HQXA 4H55A 4XBLA 5KC5A 2D6OX 2CU5A 1YJLA 4RD7A 5ABJB 3HVDA 5KXEA 1W06A 4OULA 4MX3A 5CISA 4IGOA 3TNQA 3ZFFC 1QH7A 3DEMA 1D0GA 3H8UA 3U4XA 2P3KA 1HW5A 5AC92 2BQPA 1X36A 2VL4A 4RHV2 1XQNA 2OA2A 5JI7A 1OF3A 2JD4A 2VXRA 4JV4A 3UJOA 1H1AA 2Y8KA 4C8DA 4CEWB 2CAVA 4CRQA 4L92A 4Z2WA 4KBBA 2ZHNA 3JB8A 2KR2A 5J37A 3A0KA 3BU0A 4FCAA 2ZX3A 5FYCA 4WVMA 2BGOA 4BK5A 4FTBA 4RQPC 1R082 3I2KA 3PL0A 3WF2A 1LEMA 2YXSA 3WNPA 2JJ6A 4XFIA 5FY4A 4NIHA 3HOBA 3I3QA 3SNMA 2HYXA 1C1FA 1FMD1 4DUXA 2UWBA 2ZX4A 1EAH3 4Z1VA 4CDUC 4D6QA 1ULGA 2VZOA 5CVRA 5A3MA 3KQRA 2XBO1 4KWLA 1G8WA 2IXIA 4KL1A 3NNLA 3WHTA 2VQ0A 1DGWX 2R062 4AI9A 5BNNC 1JZ8A 1OUXA 1OQ1A 3N9MA 3FC0A 1C3HA 2Q8EA 2W0XA 1C5HA 5F6KA 1UY0A 4J1XA 5LBBA 3X29B 2JXAA 4IV3C 4LKEA 4XFBA 1ZX5A 2DBNA 4E2GA 2XLGA 3LA3A 3I97A 4RYDA 3J7HA 3AC0A 4CDQB 1Y7BA 1YFUA 2RS33 2YPDA 5CYYA 4YM2A 1OLRA 1FMD2 5CKQA 1IG3A 1QIQA 1Y3TA 2ZACA 3LGRA 4FAGA 2RR13 2XKOA 2RVAA 2ZGKA 3KV6A 4YW4A 3OF1A 5IWFA 2VVFA 4QGMA 3WDXA 1FOD2 4AAXA 5CFCB 5FYVA 1HX6A 3NQHA 3VZJA 4A6OA 4ZKTB 1BVVA 5FZ8A 4JVAA 2FDHA 4Q2FA 4IV1B 1CX1A 1UWWA 4GIQA 5DAQA 4AQTA 3D0SA 5C71A 1ZVFA 3E5UA 4R4XA 1NLQA 2JIJA 1SFYA 3WX5A 5F5IA 3UGGA 4M3CE 2K0GA 4QDSA 5C8CC 3VDDB 5DAWA 2ZGLA 4P9GA 3ZDVA 4HKLA 4BQYA 1RXGA 5H9RA 5JXJA 4DB5A 5DAXA 1BMV2 4YVWC 1V0AA 4Q8LA 2BEOA 1IHMA 2GC1A 1GZCA 5FMOL 5IW0A 3Q8BA 2PAEA 5FYHA 3HNMA 1LGNA 2GNDA 1Q56A 4FFHA 4PBPA 1IG0A 3A4UA 3ACGA 5LBEA 1XE8A 3LEKA 4HL0A 4R9AA 2LRPA 2IVJA 3Q8EA 2Y64A 2AACA 3H3ZA 3J7MA 4AK3A 2WT2A 4BB3A 2X8KA 5C3QA 1GMMA 1UY4A 1WMEA 1YLLA 4FP2A 3ZFGB 3J9SA 3I8TA 1C8M1 2RS51 1IPKA 2YBSA 1K3IA 5C3OA 2HWC3 1H6XA 1A34A 1W2NA 1SEFA 2ZJCA 2OKXA 4OHXA 1OF4A 4IE0A 4LBKA 1JXNA 2X09A 3P1IA 3WF0A 4HT1T 3RZGA 4P14A 4CDWA 4QX5A 2UY8A 2WO2A 3WXPA 2HBTA 5LASA 2OXBA 2P1BA 3ZYRA 3M2MA 5FAXA 2JG9B 4COVA 2HWB1 3RZKA 1W6QB 4KG8A 3RYKA 2UU8A 3E97A 1OVSA 2YROA 4A41A 4DEVA 3EB7A 2VUJA 2GMPA 3T4HB 1JUIA 3LA2A 1ULEA 3VKOA 1C57A 4N43A 4QB1A 3IIAA 5E88A 5T3NA 5T5OA 5AFEA 4CDQC 1AJKA 2WYFA 4EZ4A 4P9LA 4LBLA 2QTWB 4FPCA 3KGZA 3ZFFB 1NAEA 3M4FA 3BN6A 2VBPA 3POFA 1V6NA 4LE3A 1C8M2 4O61A 4XJAA 1B35A 5HBAA 1BBT1 1DCSA 2ZTNA 2IWGB 4XHXA 1C4RA 1J1LA 3SCGA 1Q3EA 5JZGC 1NA1C 2XB6C 3KB5A 2BU9A 1H8VA 2R6QA 5DDJ2 1RUD3 3VHOA 4EWEA 3LZZA 1MQTC 3RI8A 5AC93 2D6PA 4Q4W1 3WNKA 4BPZA 2QQJA 4BWOA 4CP0A 1HRV2 1U5ZA 1N1VA 2ERFA 4E8DA 5JDBA 2A70A 1REDA 3J4UH 4LORA 4QXKA 5DUVA 3AP5A 2DTYA 5SV8A 3SISA 5FPVA 3WNNA 3VBHC 1S2BA 1EPZA 4GMP1 4XYXA 4N9IA 2A7AA 3RMXA 5T55A 2XL7A 4LHKA 2HWD3 1BQPA 5K0UA 3USUB 1QEXA 1RMU2 4N43B 4PQ9A 1H9PA 1DIWA 3M3IA 2UWCA 1RUG1 1ALYA 1WCSA 1FATA 4CCDA 1OQEA 4K1YA 1H4HA 3IB3A 2R0FA 1RJ8A 4EN7B 5FZFA 1HV1A 1RUD2 5EP9A 1GQGA 2LTNA 1UQXA 4XW3A 4XDOA 5CFDA 1U5XA 4JTNA 2PAKA 5LA1A 1O3TA 4RS5A 1TVGA 1AXYA 2E51A 3AKSA 3PIGA 1O5UA 3QH7A 1WCUA 2BNMA 5LK5A 5IFPA 1RUF3 5GZEA 1LOFC 2RE9A 4CDWB 1S55A 2OPKA 4AEDA 3CQOA 1O3SA 5F5CA 5DQ0A 1FOD1 1EV12 2C0ZA 3IDBB 3R6SA 4CUCA 2GC3A 1SQ4A 3K4DA 4D3WA 5KHJA 4HONA 1FNZA 4AFAA 5A7WA 1ASJ2 2WT1A 3JU9A 1LOEA 2JECA 4HVRA 1J3RA 4X6QB 1XYPA 5FXXA 3JUUA 2E7TA 1RUE2 4ORFA 1KEXA 2VZTA 1I3HA 1RVF3 3AZYA 4NRPA 1AXKA 4JRAA 4XF9A 2CAUA 3S7IA 1TMF3 2ZOEB 3GHNA 2QVSB 4R52A 4YZ4A 3H9AA 1H8TB 4LMFA 5JR2A 1A78A 1QJU3 3KCCA 3KV4A 3NWKA 3SCFA 1OKOA 3THTA 5JOWA 1CAXA 2XGXA 3TRSB 5F37A 1JZ7A 1N1YA 4NOTA 3AKPA 3IKWA 4QQPA 4NVPA 1LODA 3U0ZA 3I4IA 2VMHA 2E32A 1MS5A 5DUWA 5KXCA 1GOHA 1ULCA 3B7MA 3H1MA 2OT7A 1D4VB 1JYXA 4L9BA 4GA9A 3NL1A 4AVVA 1AX0A 1JOJA 3MW3A 1SDDB 2WNUA 4QQ2A 1AR82 3PVOA 3A21A 1OPOA 4AZZA 1OOPB 2CL2A 5FZDA 1TME1 3JBG1 5FO7B 4BK4A 4N8MA 2ARAA 3DF0A 4M0NA 4A4AA 3UGFA 2QFEA 2MEV1 1G9DA 3N9OA 3IMNA 3KZ4C 5JSOA 5ISLA 4XQDA 2JDAA 2Z5WA 3G7DA 5DXDA 4YW5A 2ORZA 2XVLA 1UY1A 4O65A 4O7XA 3ZXGA 2IXLA 1AX2A 3TB0A 2NM1A 2HWF3 3J8F2 3M3EA 4IEVA 4LKSA 2CV6A 5CADA 1W90A 1X9TA 2D7FA 4EJRA 5C9AC 2R1BA 1VBD3 5F3EA 3V64A 1UX6A 4LO4B 1H8TA 1QQP1 2VUCA 2A6XA 2JDPA 3DKQA 2WO7A 4V2WA 1APNA 1GU3A 4KWUA 4XUPA 2FCTA 1UO9A 2VTXA 4FSJA 1IS3A 3AK0A 5FYUA 4QPIA 1QJY2 4Q4Y1 2D6LX 4NMIA 1NZCA 1I6XA 1JOBA 2AR6A 4EN6B 3J8F1 5A7WB 4MZUA 4NHXA 1X82A 2W2IA 3GZAA 1OFNA 3CLPA 4YFWA 1O8SA 1COV1 1JYVA 2WO3A 5TSWA 3N9QA 2XJQA 3NNMA 3VDAA 1JI6A 4WVMB 3HN1A 3A7QA 1YCIA 5BNOA 1CAVA 2VBDA 2RS32 1TME2 4LHLA 2K9ZA 4MADA 3VBRA 3BIWE 4P9XA 4BIFA 1RHI1 3J7LA 2JD9A 1VALA 2HKXA 3PDQA 4OCTA 1O59A 3TN93 3LIGA 2ZEWA 1UU5A 4PJYA 4GXLA 4MGSA 4K20A 1OA4A 1NXD1 2LW8A 1S0GA 1PVC3 2JEMA 1HXS3 4Y20B 3T08A 1H6YA 1VBA2 2C1FA 1XSQA 4Q0QA 4CEYC 1NX9A 1WD3A 1ZBA2 3WG3A 3R4UA 3OGSA 2EXHA 3AYDA 4DEQA 3MW4A 1LESA 1LHUA 3APBA 4ZXKA 2ZXQA 4ZY9A 2PHLA 2IXKA 5FBZA 1R083 2BWCA 3VKLA 1ZREA 4PIZA 3ZN5A 1UU4A 4HPKA 1UXZA 2OZ6A 3AXDA 2CWSA 3WW3A 1GR3A 3QCWA 4AVTA 1PO22 2HLEA 3LOIA 3JD71 4PLOA 4XJZA 5FUNA 1YWKA 2GMEA 2OYZA 3SEPA 2VQAA 1ZA4A 4JZRA 2R1DA 1GWLA 4MGIE 1RITA 1ASJ1 4Z82A 5EWSA 3WSOA 2OPWA 1XXNA 4Y1XA 5BNPC 1I5ZA 4JCKA 4D7TA 3BKZA 3EBRA 1OLQA 5H9QA 5GLTA 4OUSA 5FPLA 2CWMA 3IDEA 4GZ9A 1LU2A 2GP3A 2DFBA 2FDIA 5JSPA 5F39A 4LT5A 4XACA 3KT4A 5A7QA 4Y3OA 1J58A 2WZR2 4CE8A 1POV1 1QJY3 1YQ2A 1FV2A 1GQPA 1XE0A 3LPFA 1W6NA 4IEOA 2XKPA 3DYPA 4UYBA 3ZSEA 2XLFA 3RWNA 1VBD2 3H50A 2UYBA 4X8NA 3AL6A 4D94A 2KM2A 4GQ7A 4IEPA 4XBNA 1ND2C 1VBB2 1OLMA 2E7QA 1BKZA 2WNUC 2B5HA 1AXZA 2DDUA 2ZGRA 4LR4A 3WOGA 4U36A 5T54A 2P3IA 3NV1A 4C91A 1GKBA 4DY3A 2B9UA 2WQ8A 5EZWA 3WINE 1AR63 3SITA 3A22A 2V4VA 3LD8A 4PF5A 1WUVA 4XEZA 3WZ1A 1RIRA 1UCXA 4C0BA 1JZ5A 3VD5A 4U2AA 3PJQA 4N53A 3WHUA 1W04A 2D44A 3H3LA 1HQLA 5A7NA 4CU7A 4AE2A 5L7OC 5DDJ1 1XNBA 1B35C 5LA0A 3O1UA 4GWNA 3BU7A 1DQ2A 3O1RA 1I9RA 4YVWA 3RZLA 2I74A 3MW2A 3ZYJB 1BBT2 4UFHA 3VZNA 1JU3A 4YFZA 3I54A 2R30A 3DL3A 3ZXLA 1X9PA 4Y1UA 5C8WA 3PUAA 4XPVA 1XRUA 4N53B 1JHJA 4Y1ZA 4AWDA 3H8OA 1F2NA 4J1WA 1FNYA 4LXLA 5FKBA 5CEHA 2JDZA 1OMIA 3AKQA 1LR5A 1VP6A 3WP4A 4RSUA 1XYNA 3GNEA 4LNVA 3NRUA 5FYZA 3ZKYA 2XLAA 5LW9A 3BI3A 5FYTA 1PZ9A 3B69A 4MLOA 3VDDA 4XJWA 3ZPYA 1PGSA 3H7JA 4HANA 1RUC3 4PQQA 3I2OA 4P00B 4AG4A 2C9AA 4ISRA 1HN0A 1WLCA 5FZEA 1QJU2 5HPOA 1JUHA 4LHSA 1GFF2 2VTFA 3F2ZA 2W9XA 1STMA 1RHI2 4PBOA 2DCYA 5G04L 2BV4A 3LKJA 5FWJA 3P6BA 1MEC1 3AP4A 4NRMA 4FTEA 1OPMA 1XNDA 2VE1A 1ZRRA 3FHQA 4E4SA 1NY71 1NYWA 2VZSA 4PHZA 4AQ6A 2DV9A 4RQPA 1N1SA 2WS92 4KQ7A 5GZCA 2NP0A 1WLWA 4OLLA 4XFAA 3TEWA 2KA3A 2VZ3A 4FPEA 4Q5OA 3TAYA 4LHNA 1E5IA 1ZYBA 2DCTA 1RUF2 2YMZA 4CDUA 3WNMA 4OI0A 1HJGA 3ZN6B 4Y24A 1VBB3 2I07B 2EF6A 4Q4Y2 1NQDA 3H7YA 3KS7A 5FY5A 1QJX3 4RFT0 1S2EA 1RUOA 4IL7A 3VZLA 4ZPIA 2HBUA 1G9AA 3NMBA 4TXWA 2GH2A 2A3XA 3N9LA 1GZ9A 4LA2A 1LHWA 1ZZ8A 2XJRA 5A1FA 4XBQA 3N36A 4BZ4A 4TLFA 1W3XA 3USSA 1KDMA 3PUIA 2DUOA 5KHIA 1HRV3 4OMCA 3PUQA 5HCHA 2XJVA 1H2MA 5BNQA 3CIHA 4Y5SA 3GBWA 2CHHA 2VNGA 4IEQA 4XUTA 5IFTA 3KD4A 4YZ2A 1CX4A 1IKQA 2GN3A 2RS13 4YM0A 5C33A 3PVBB 3T2PA 2XJTA 2Q1FA 2VNVA 2WC2A 3JBG2 4BXSV 4IEUA 1JN2P 5K0UC 5BY5A 2WA4A 4A42A 5LZ6A 1G9CA 1VLNA 1CAVB 2YY1A 1DZQA 1W39A 5ACA3 2W1WA 3ZXEA 2VC9A 5LEJA 4B4QA 5CFCC 3DYOA 3PUSA 5B4XA 4NIIA 1ZZ7A 1U5IA 5DUUA 3JQWA 1W2TA 3KHBA 5CFDC 4TTGA 1IS6A 3OEBA 4QX0A 4Q0UA 2JG8B 1JYIA 1TZOA 1W2AX 3FJSA 3J26N 3MF9A 1HB3A 3U10A 1ND2A 2R073 2R16A 5GZGA 5JAXA 5C9AA 2W52A 2NN8A 5FY1A 1ULFA 2VCMA 2ZMNA 4IV3B 4HN0A 4XCAA 2Q8DA 3VKFC 1GNYA 4PI0A 2P37A 4YGDA 3TYJA 1YYNA 4HG6B 1LOBA 3I2GA 5GM0A 4A7KA 1T6BX 2ZEZA 1SG3A 1HB2A 3E5QA 3DCQA 4KGQA 1AL21 4X6RB 5C4WC 4EN9B 5JOYA 3ZN6A 1RUE1 3ZXJA 3NAPB 4JRLA 1LB2A 1E5RA 3I49A 3L9JT 4CDUB 2PLV1 2ZZJA 3W9AA 2JX9A 2ZX2A 1QU0A 2ZMKA 1W6OB 1H0BA 2B42B 2JDYA 3CHXA 1AZDA 1F35A 4CUGA 1EV11 4RQPB 2EIEA 4BIOA 1UKRA 1W8NA 2DU0A 3CF6E 4JGZB 1YIPA 2VOWA 4X8PA 4CEWC 5K9YA 2UWAA 2JENA 3ENRA 5FQ0A 5M0TA 1GQHA 5HCBA 1EPWA 2PN5A 4CCCA 3BTYA 3IDCB 1HDKA 2HWE2 3FFZA 4LIVA 4D0QA 1OOPA 3MF6A 3PU3A 4S2DA 3VBOA 2PHDA 4AI8A 3EJKA 2YFUA 2CGOA 1KS4A 3VBSA 3ZYHA 1H1MA 2CNAA 4BQ2A 3GBGA 4Q4X1 1I5PA 4FQZA 3ABZA 3GCWA 4COUA 5HV4A 4N43C 2ET1A 1KS5A 3MUY1 4DNYA 2D3PA 5ABJC 1J84A 4XF3A 4GWMA 4FPFA 1R1A1 2WNVC 4Y5TA 4BQWA 3T2TA 4FPGA 4IE5A 4RN5A 2Q8CA 3MIBA 4CU9A 5FZOA 2ES3A 3BGAA 4FPHA 2IXJA 1Q8QA 1FAYA 1RUJ1 2EVXA 1LHOA 1QDCA 3N7JA 2XQXA 3OY8A 3PLQA 1MQTB 2GNBA 4RR3B 1REFA 2WSUA 5FPAA 2HWE3 2XWBB 3BTAA 1JYTA 1UKGA 4BHPA 4Q0SA 1ENSA 2PYTA 3PMEA 1LRHA 4UW4A 4MGYE 1GICA 3MZHA 3FBYA 3NV3A 4HKOA 5I0TA 5IVJA 5FP3A 4DZGA 1Q5OA 2RR12 2PAMA 3FFQA 4CYDA 2VQUA 1V6IA 2ZPXA 4LO8A 2K46A 2VCAA 1NY72 4L2NA 3FBMA 4Z8BA 2FMYA 1VE0A 1UOFA 4P5HA 4DIQA 1SLBA 1BEV3 5C5TA 2F6BA 1SPPA 3VB9A 3C7GA 3LFMA 4QXBA 5CFDB 2MPFA 1PNFA 4UFIA 1MR5A 3O1OA 2R063 4N7IA 1K12A 4NAMA 5FP9A 3WP5A 4IE7A 4N9HA 5A7PA 2W87A 3USUA 4CZSA 5K0UB 2YBPA 3B9IA 1W6PB 4DUWA 2R072 4SBVA 3AYCA 5C4WB 1S1AA 2JDNA 1W0OA 5J3UA 4GH4B 2WQZC 4AVSA 1FPN1 1OD5A 3AVSA 4YYOA 5JPNB 1R64A 1XBFA 3AFKA 3K2OA 4QHOA 4IEXA 4KGGA 2BGPA 3SCHA 4JKMA 3O7OA 1UOBA 1Y9QA 3U37A 1K5MC 4FOQA 2DVBA 3CNAA 4M3CA 5EHDA 3TEYA 2DCKA 1RUI1 2X10A 3D8CA 1XJAA 4MUVA 5C3RA 1O3RA 2OIIA 1QJFA 2VCBA 4A6SA 1ENXA 2ZEXA 5A3NA 4DXTA 1GUIA 4QKDA 1AR73 1JW6A 2TNFA 4HPKB 5JCTA 3Q9OA 1MZ5A 3AXEA 3MIEA 4MV2A 1F5FA 1BVP1 3D82A 4HXCA 4M4RA 5KC6A 2OS2A 3VL9A 1RMU3 3HWJA 3I2HA 4L11A 1G6NA 3ZYBA 1ZRCA 2WFPA 4PCRA 5FUPA 4CPBA 4GH4A 4NUBA 4GJZA 1R1A2 3H1WA 1O91A 5FZCA 2DF7A 2VULA 4Y20A 4XJ8A 3W5MA 2VY0A 2WQ4A 3K4ZA 5I8SA 4A45A 4MXVA 2Y60A 2IFWA 5A3PA 4Q4X2 3BALA 2TBVA 4UFLA 5ANQA 4W6XA 3T09A 2Y0IA 3MUZ1 4CU8A 2C26A 1JYCA 3KCXA 1LECA 4GULA 1W99A 2WZR1 1TNFA 5FRAA 2E9QA 2JG9A 3UT0A 3LEIA 1T6GC 3GDBA 5A6YA 3OYWB 2QQWA 3NJVA 1EUTA 2QQVA 4QM8A 1Z7S1 3VZKA 5KR7A 4M00A 4DXZA 1WA6X 4YGBA 2D98A 2RDRA 1PIV2 3IT8A 4W6WA 4P9IA 4F83A 1MS9A 1C5IA 2J7MA 2PLV2 2G9GA 3PMSA 1H2KA 3ZFGA 1OA3A 5IVFA 1XNKA 1AL22 4AHZA 2PQQA 5E6HA 3ZXFA 4FXKB 2FCVA 2P3JA 4EE2A 4NIGA 1VRH2 4MOAA 5FLIA 1M4WA 5JLVA 4YRDA 4D69A 5C5UA 5F3GA 2ZGSA 3WG4A 5FZMA 4PIYA 5D8AB 3RJRA 1AR91 5A33A 1JOPA 2G1MA 2WFF3 3KGLA 4CTEA 3OD4A 3ATGA 1ZBA1 4H7MA 1O5LA 4TLGA 1BK1A 3MIHA 4K9SA 2X5IA 3PNAA 4ONUA 3O5SA 3ZMNA 4ZZ5A 2WO1A 5C3PA 4DRRA 2BPA2 4HETA 1SHWB 1QOTA 1ZBE2 2PQSA 4QPGC 1QOOA 3SC7X 5C70A 3G6JB 1ODMA 3PU8A 4HSLA 5KHKA 1QY4A 2VW2A 1PX3A 3N4MA 2EAKA 1DQ0A 2FQPA 1HRI1 2QZ2A 3VBRC 4ES8A 2SLIA 1RUH3 1SLAA 4XIKA 4YW6A 4OMDA 2DUPA 1AYM3 4BLIA 3S0MA 5A6XA 5JMCA 2ETEA 4N53C 1V6OA 2HYKA 4K8FA 3DXUA 1PIV3 2R49A 2XQRA 4FFFA 4YWAA 2A6ZA 3PURA 5T52A 5DMYA 5L7OA 1L3JA 4YSFA 3LWCA 2X5IB 1O7FA 4WM8C 5KWRA 2ZHKA 4XUQA 4XQ4A 4QM9A 1PMHX 4B7EA 3OD0A 3ZLIA 5JXHA 3O1TA 2E26A 4GB33 1U5YA 4HK9A 4WZFA 5I8YA 3D4KA 1BZWA 1CAXB 3BCWA 1FV3A 3OJBA 4TZDA 1FI2A 5CG8A 4BLJA 2ZGUA 4AHWA 1E57A 4G4FA 1CIWA 3H1YA 1WMXA 4LE4A 3ZSJA 2VNRA 3RGBA 3SH5A 2GALA 2QUOA 1CVNA 2GC2A 1YQ8A 1L7RA 2ZX1A 4MVTA 3KCYA 1GLHA 1ZA7A 2O1QA 1R093 4XF1A 1DQ4A 1V9U1 1ZM1A 5IK5A 1MZ6A 1V6KA 5FPBA 3WG2A 2XJSA 1CQ9A 5E89A 4EQVA 4KNCA 3FE5A 3SLIA 2VOVA 3H42B 4LO7A 4ZU4A 3POJA 4NWVA 2I2SA 2WS91 4H2AA 2GZWA 4QU1A 4UI9L 5L9BA 5IT6A 2VZPA 4K8RB 1NLSA 4CEWA 4A3XA 3PVNA 3GZUC 2VZQA 2ZZQA 1MEC2 5T5JA 1AR81 1ONAA 1DGLA 2Y6KA 2WL1A 3AMMA 4B3NA 4XVHA 2E33A 3FX3A 3Q8AA 4L99A 1ZBE1 4FI9A 4CCKA 4DXRA 3I3MA 5A80A 1ST8A 3NO8A 3WW1A 1F9KA 2BVVA 1NCQA 2RM22 3U78A 3AM2A 5FY8A 1X33A 4JHZA 4YW3A 3NW4A 5LA2A 4Q1RA 1D4M1 2QBXA 2VMCA 3HT2A 1V6LA 2RM23 2VG9A 1N3OA 2G19A 3INAA 4J25A 1VBE1 2RMU1 3ACLA 1IKPA 3AYEA 2P17A 3MI8A 4FO9A 3KF5A 1SACA 2A6YA 5FMDA 2VPVA 2OQ7A 3GJAA 3LDKA 2VJXA 3JB4C 2WUHA 3VUOA 4B8EA 1UX7A 4O9GA 2V5YA 2FDFA 4W50A 3RDIA 3WY6A 1REEA 3AMPA 1X8EA 4FT8A 3WQ0A 2RS12 3VD3A 1WW4A 1CGPA 1URXA 3VD7A 3I3EA 4URAA 3PUHA 4XZPA 5IVYA 5FJHA 1ZNPA 1D0HA 3S30A 3I2IA 2ZBJA 1POV0 4K1ZA 1LULA 4QB6A 5C4WA 1WLDA 4QDQA 4YGEA 4WZCA 4QU2A 4CDXB 2C6SA 4PDWA 2QNKA 3UETA 1OKQA 1WCDJ 4IESA 1JMUB 4OI2A 1K45A 3PTYA 2RHPA 2RDSA 2AEYA 2VOKA 3CDZB 4OQ8A 2OUJA 1W6QA 5FWEA 1GWMA 2QQPA 3ELNA 3MBWA 2JB8A 3ZN4A 3HEIA 3VBUB 1S0DA 2XG3A 1SBDA 3OBRA 2B8MA 1NOVA 4QPGA 4AI1A 4YVSC 3KT7A 2Y26A 3NVCA 3HAGA 2HWF2 1DGWA 1Z78A 5AVPA 4CDXC 1RUNA 2OW4A 4XXPA 3NNJA 3AJZA 5JIAA 4MGTA 1GZWA 3HT1A 3VD9A 5GLZA 4DO0A 1EY2A 2EXKA 1O4ZA 5F6LB 1D7PM 2L9LA 2AUYA 2Q30A 1A3KA 5F3IA 2HEWF 2R0HA 2RDNA 3ZPOA 3K51A 2FDGA 2B7YA 2WAAA 2J1VA 1N47A 2Q1MA 4HVOA 3JQXA 1A8MA 1WMDA 3KF3A 1RUI2 5L9VA 1PO21 2J1UA 2H0VA 1LKNA 1TE1B 2A71A 4PLMA 3M3CA 4NROA 2IZWA 3OY8B 5FZIA 3AJYA 4UOJA 2E6VA 1QXPA 4I3PA 3VBFA 1BK0A 1WCKA 3IDAA 1HN1A 5JVVA 4JGYA 1FMD3 4E2SA 5LRSA 3KHCA 1EAH1 5FIXA 1D4M2 4LO5B 1X50A 1PO13 4L8QA 2XBO3 4ZXEA 1UY3A 3CJXA 4Q27A 1SLCA 3ZR6A 3SKVA 5FFOC 3B94A 1H4GA 1VRH3 2ZS6B 5FPUA 3VBUA 4Q0VA 4HLTA 1K42A 4XUOA 3QACA 2V09A 3K75B 1AYN1 3ROUA 1V70A 1TMF2 2Y6LA 4YG6A 4XF0A 4BMBA 3WCSA 3M1HA 1RVF2 4IV1A 4K6BA 3WD5A 3E6BA 5I0SA 2ZEYA 1YFWA 5IUQA 3CO2A 1C1LA 2RS31 2AGSA 3OGJA 4PDWB 5CFCA 3MPBA 3S6PA 4CP1A 2BFUL 4AEDC 5A32A 3DPRA 3RSJA 2ARCA 4K3UA 5FZGA 2RR11 1KGYA 1COV2 3POBA 3O1SA 3AZZA 3MFAA 1H1IA 2RS52 3OGRA 3GYDA 3RG0A 1HB4A 4ATFA 2QQNA 3C8XA 2ZGNA 2XJPA 1HV0A 3OPTA 1M06G 2FDJA 3AL5A 4Y1YA 4Y4RA 4CCOA 1QWRA 2LS6A 3POYA 3LFIA 4OZOA 3HJRA 5FZ4A 2WKKA 3WVJA 3ZO0B 5BUVA 5JXGA 2WN2A 5F2WA 4CCJA 2D5FA 4LTAA 4XURA 3GM8A 4P9YA 4RR3C 4LUKA 4IV3A 2WJSA 2FD8A 5F32A 3HNBM 5GKAC 5J48A 5HCAA 3IM0A 4ARYA 2DVFA 5FJKA 3Q8CA 5CAZA 1FYUA 3MV11 4QQOA 3FLPA 4HZFA 2JG8A 4XFGA 1UOGA 4LBNA 2WNVB 4Y4YA 1PVXA 2ENRA 2VW1A 5EFUA 4RGKA 1PGW1 4IEZA 1XYOA 1AR72 4M3CF 1VBC2 2OUHA 1FT9A 2BJSA 1GSLA 4OUEA 2QKDA 1D2QA 1PX4A 1W03A 3MEPA 1GNZA 2DFCA 4QWNA 2TUNA 3VBRB 3IAQA 4AHYA 4MGKE 4XTPA 3V0AA 1YI9A 1D2SA 2AREA 4JGZC 4YG3A 5EYXA 4LPLA 1X7NA 3BYWA 1C8M3 2RS53 3D6EA 1JBCA 3RJ2X 3O1PA 5FPXA 4V1PA 3HN3A 4BOWA 2JG9C 2YYOA 3V65A 4JDNA 3HMYA 4UBHA 5F8PA 1W0PA 2ILMA 4QXCA 1A8DA 1VBA3 1AX1A 4XUNA 5FZBA 3WNLA 5ERLA 1DYPA 4XF4A 3WNOA 2D6NA 5FYSA 3HQUA 2XH6A 4CP9B 3ZFEC 1DGRA 1SLIA 1TG7A 2VM9A 4Q4V3 2HWB3 5LATA 4IEWA 2JE9A 4GWJA 3ZMOA 3DXTA 4AGRA 2JE8A 2QJVA 4MGQA 5D2AA 5IVCA 5A3TA 2ARXA 2QQUA 2X53S 1QNWA 1NCRC 2BOJA 1POQA 2ZABA 5F3CA 3KVBA 1BEV2 3U75A 1CAUB 2NLRA 4GKXA 3I3BA 3ZXAC 5A3LA 3ACHA 2RJKA 4FFIA 4DRVA 1UZWA 2D3SA 1WMFA 4XDPA 2UYAA 3ZDSA 4I30A 4ET7A 2NQYA 4OVEA 4QX8A 2DWRA 5GLWA 1RYYA 4XABA 4FFGA 1S0IA 2YGLA 2WIIB 3VGIA 4F3JA 1DQ5A 2PTMA 4R9CA 1XNAA 1SFNA 1Y43B 3RNSA 4CSWA 4I09A 1UZVA 3M3QA 3MYXA 4RHV1 1MZEA 4F7ZA 2OZJA 1YC61 3FN9A 1KJRA 2G4IA 5FP8A 2P6HA 1RUD1 3RZZA 1VBC1 4D6RA 4Q4W3 1PGW2 1WD4A 2PELA 2JWPA 1DQ6A 2Z69A 5T5PA 4XMIA 3MFCA 3N7MA 3ZFGC 2QDNA 3NKTA 1HB1A 1SCSA 2R042 4QAWA 5F7UA 2BFUS 3B9CA 3WQBA 4RGAA 1SBEA 3BTZA 4AFDA 1Y9MA 4CEYA 1PHMA 2P6CA 2R043 4GMP3 1UYPA 4W65A 5EJ1B 1Q43A 5EJ3A 2HWD1 1RXFA 1US2A 1YNAA 4FAHA 2B39A 2XHNA 2XUEA 2YBKA 5JOZA 4JC1A 3O1MA 1IPJA 3AKRA 4XAAA 1WKYA 4LULA 4WM8A 1K5MA 3WW2A 1IPSA 3FL7A 5FZAA 2XJUA 1SLTA 3EQEA 5C3SA 1W05A 2JDKA 4LLOA 5JZGA 4YM1A 4QHZA 4YVWB 1WW6A 3WDTA 1UOJA 3RYRA 4HFSA 1DQ1A 1UNBA 3ZSKA 5A3OA 2WINB 4LK7A 5C8CB 2Q5TA 1RUF1 1NUKA 2VW0A 2VOXA 3ON7A 5IATA 1WLTA 1FOD3 5I8TA 1J83A 1NQJA 4LA3A 1ZRDA 2WBKA 3VBHA 4GH4C 5L36A 1FPN2 2YGMA 5BPXA 4QT6A 3THPA 5BNNB 4IEYA 2PHRA 1GBGA 3CJIA 3KT1A 2QQIA 2CDPA 3LEGA 4IV1C 3OYWA 4XFHA 4OHYA 1LJ7A 3AZXA 1OVPA 4QXHA 4RS5B 4AFCA 1EUUA 5EQUA 3IPVA 3O1VA 5JMOA 4XILA 1G7YA 2BZDA 2BUKA 3OSDA 2DYCA 3NV4A 1CZVA 4DXSA 5FZHA 2WZ8A 4ATEA 4CA9A 2OVUA 4ASMB 1QKQA 2EXIA 4YNIA 1KITA 5E16A 1LOCA 2BGCA 4JQTA 2DURA 3OTFA 2W91A 2ORXA 4BA6A 3I2FA 3WDUA 4KMQA 2KD7A 2AC1A 1PVC2 1F5JA 2WRAA 1VR3A 5DAVA 4M0HA 4XIOA 3TN92 3ZFEB 3LA7A 4HMZA 4COZA 4LEJA 4H14A 3POGA 4OQ9A 3C7EA 3TNPB 1SBFA 4BXFA 5FYYA 5LCWL 2Q4SA 2Y6FA 3O0XA 3OG2A 2QQMA 1W8TA 3C2UA 5A7OA 1O6UA 3JBG3 3VLBB 4JTOA 4LQRA 1ENRA 4M3CB 4CUBA 2ARBA 2NPIA 4AXOA 1OD3A 2A6VA 5LB6A 1QDOA 1LAJA 1YO8A 4AVAA 1KXGA 2WABA 3VBFC 1U0AA 3HR9A 3LIHA 3URFA 3EO6A 1C8NA 3L2YA 4ZS3A 2WZEA 5FZ6A 5J98B 1UY2A 3LSDA 1DYOA 2HWF1 2EA7A 1CONA 5JSRA 1BHGA 2F17A 2VXJA 3B01A 4UFJA 1VBD1 3MIDA 3RZMA 4DOUA 3FZ3A 4IGQA 3DYMA 1HQNA 4NPRA 1S0JA 2WLQA 2J1AA 1LNSA 4XTMA 3CKHA 1G9FA 3QOPA 4PDWC 3I59A 4ASKA 4Z2AA 2JDUA 1X8MA 4Q4Y3 3B93A 3ZKUA 4GB32 1HIXA 3O0VA 3UK9A 1F8VA 3J8F3 4XOGA 2HWC1 1CIYA 3O0WA 2D3RA 4Z07A 4KWJA 1COV3 4N7UA 2PMWB 2N7GA 1UXXX 4YZ5A 4NRQA 4D7SA 2PHXA 2AYHA 1SZBA 1OUSA 4QPIB 5IVVA 2J42A 4E4ZA 2GC0A 1I1EA 4O9EA 1W8WA 3LB9A 1RHI3 2V4AA 2XXZA 3VKMA 2VO5A 2GMMA 2YC0A 4UT5A 2YZ4A 5CKNA 2VGDA 4YZ3A 4QGNA 1RUC2 3VL8A 3DKWA 4AW7A 4PF1A 2JG8C 4FOYA 3C7FA 1U12A 4CEYB 3BB6A 1LOAA 4YLZA 1Q8SA 1CWPA 4COYA 3EXUA 1PMIA 4BQ3A 2ZGPA 1A6CA 2UURA 3B3QE 1R081 3MHZA 3P5BA 4JDOA 5I0UA 4OHZA 4S2FA 3V56A 5BNOC 1XSRA 3BVCA 1BBT3 5FZ1A 4CU6A 1ODNA 5CKMA 1JHNA 1XC6A 3NJYA 1PZ8A 1CR7A 3ZSMA 3NV2A 2RDQA 3AZWA 4UW6A 2CTVA 2Y6HA 3WEZA 3KVAA 2W94A 2EIGA 3WUCA 5AC91 4AAPA 2P3YA 1O8PA 3WG1A 1QNYA 4XZUG 1LOFA 3P3NA 1F31A 4QGLA 2IXHA 5J1XA 1ENQA 3ECQA 4N90A 1UAIA 1CAUA 3FHAA 2W39A 1KFXL 5FMOS 5D8AA 1RUG3 2XR4A 2GDFA 3DPRC 4E4DX 3IZOA 3FWEA 4XXAA 1VMFA 2O14A 1ZZ6A 4RFRB 1VRBA 4EWDA 1OT5A 1J3QA 1UW8A 3R4DB 2D97A 4OHWA 4A44A 4AI0A 4QMAA 3ZVXA 1E5SA 5FYMA 3T1MA 3VZOA 3ES4A 4HOOA 4CP9A 5BV6A 3EMRA 5C9AB 4CUAA 4YPJA 3CJIC 5DPNA 4GJYA 1LENA 1Q8PA 2YB7A 3VBUC 4JAAA 4TWTA 3WDYA 1AR61 1S0FA 5LEKA 1OXCA 4OFGA 5F5QA 4FP3A 2CGNA 1CZSA 3MLJA 1HQWA 2PXJA 4Y33A 3UKVA 2MEV2 3T2OA 3WF4A 1O4TA 3GZTB 1RL3A 1W2UA 4ZS2A 5IK7A 3ASIA 1RVF1 4CCMA 2PHFA 1TMF1 1L7QA 4C1XA 3IN9A 1AYN2 4JKLA 2W46A 4K21A 5FP7A 4Q8KA 2FHRA 2RJ2A 4Q4V2 1PNGA 1QJU1 3PVEA 5G05L 3C7HA 3BPSA 4PI2A 4FPLA 2PHUA 2A6WA 2DU1A 4MH0E 3UESA 4OZXA 4EYUA 4P9JA 1NLRA 3ILNA 2TEPA 5JR7B 3T3YA 5IK8A 3A23A 2WNVA 2AEZA 5EXOA 2ZGOA 3HPNA 4FPJA 3UGHA 4BCUA 4LBOA 4Y22B 5JOXA 4QHBA 5FTTC 3POSA 3WR0A 1W9SA 1HJFA 5JUVA 3GJBA 3KMHA 5CBLA 1IOAA 1AJOA 1TME3 5CIRA 4QPIC 1K5JA 2B9VA 1UPIA 2VMIA 3WDWA 1B35B 2MEV3 5I91A 1OFSA 3T2QA 1PGL2 2ZGMA 1DF0A 5E8AA 3ZFEA 2VNOA 1QF3A 3H8RA 5J09A 1AHSA 2HEYF 5FMBA 3ZYGA 1BJQA 3I3DA 2HWC2 3AFGA 3BTXA 2R32A 1AL0G 4CXXA 3OUJA 1UMZA 1W6PA 1ND3C 2YDEA 5A70A 3WW4A 4R4ZA 1OH3A 1W8FA 2A5ZA 1VBB1 5GZDA 5FXVA 3FLRA 2WWSA 4LBQD 4I2OA 1QQP3 4CXYA 2CY6A 3GXUA 5A3WA 2P34A 1QJX1 2E31A 4QX3A 3W59A 4KI5M 4B4RA 1F4AA 3VV1A 3IPVB 4AQSA 1OQDA 5IHRA 1AF9A 2DUQA 2VQTA 1RTVA 2Z2SB 2ZAAA 3U11A 3RWKX 1MPXA 3A0NA 3ORJA 3K4AA 4OUMA 2LALA 3VBHB 1RGSA 3KV9A 4I0BA 3MICA 3OEAA 2FCUA 1ZRIA 4XETA 5DN2A 3U1XA 4EV0A 1CJDA 5I93A 3AYAA 5BNPB 1HRV1 3R4SA 1S2KA 4FPOB 2ZHMA 3RS6A 1AYM2 5D21A 3IIIA 2VUDA 1LGBA 2XHKA 1J3PA 5FPZA 2RS11 4Y1VA 3N35A 3C3VA 1W8OA 5JZGB 4PT6A 3JD72 2BP6A 4HN1A 5FY9A 4RR3A 1MQTA 2DVGA 1IQDC 3OBTA 4WM8B 3MDPA 3B00A 2VAUA 3UV9A 2G9FA 5D8AC 3TN91 2CDOA 4YM3A 4E2QA 2XMLA 5ACA1 5CG9A 4WM7C 2O8OA 5FZOB 1PVC1 5BNPA 1HXS1 4CVUA 4XQWA 2RMU2 1VBE2 4DQAA 1ULPA 2QQOA 3POWA 1UD1A 4EN0A 3N9PA 3O14A 2XL9A 5F1RA 2IUWA 4LIUA 1YHFA 1PK6A 5JIUA 5FXWA 5LY2A 5LBFA 1UIKA 1H2NA 1AVBA 1JTZX 5EIYB 5E1RA 5FY0A 4IGPA 4QPGB 2GN7A 3DN7A 3AP7A 4G3YC 4AEKA 5FCCA 4AFBA 2DVAA 4AGVA 3S57A 4BJ0A 3AX4A 3JD73 1F15A 2BYVE 2V72A 4RS5C 2YU2A 4EROA 4ZZ8A 3AVRA 4KU8A 3OPWA 3ZYPA 1AL23 4ISQA 1ASJ3 3WDVA 5FOJB 4IQPA 2Z4FA 4I3GA 2W1QA 2YC4A 4MO3M 4YG0A 1JYNA 2V5DA 2MNGA 2PLV3 5GJ6A 1G86A 4B1LA 5A1LA 1VAMA 1AR62 4FPYA 4L0PA 4TSVA 3H0OA 1EV13 1TQ5A 2AH2A 2GAUA 2JDMA 3BOWA 2LM3A 1MS3A 3RZJA 1V9U2 3CU7A 3OGGA 3CL1A 4NPLA 4GWIA 5FUIA 4UW3A 4AR2A 4B1MA 2A1XA 1POV3 1QJY1 4Y26A 3D3AA 1JZ3A 4AVBA 4LBMA 4TN7A 3ES1A 3TEZA 1VIWB 1QGLA 5GZFA 2BBVA 1HKDA 2E7AA 1US3A 2FBEA 4KU7A 1JZ6A 1DYKA 1PM4A 2HWD2 1NCRA 4Z92B 1CAWB 2J22A 1UZZA 4I0AA 1DU3D 4V2VA 5KHHA 4CCLA 5BYNA 2FDKA 3QD6A 4IERA 2RJLA 1BMV1 4I02A 1YQCA 3DUIA 4K7JA 2KXLA 5FV3A 4C0HA 4Q1PA 4ARXA 3VDDC 4UW5A 4BE3A 3ITQA 4MHRA 5FOBB 1OH4A 2IFRA 4NO4A 1S4CA 2P5BA 4A3ZA 4NHYA 1Y4WA 3ZYFA 3LE0A 4JX0A 5DDJ3 2BBAA 5KHGA 4QX1A 3AMNA 2BWAA 4W4ZA 5B4NA 5C7GA 1UF2C 1QJZA 2HWE1 2XOMA 1TNRA 1OOPC 1UZ0A 2Q0AA 3NSTA 3FUOA 3N3HA 5H9SA 4YZ1A 1QJEA 4JQRA 3UKNA 5DZGA 1OURA 1SCRA 3B02A 2BVBA 2O8QA 5BNOB 2D93A 2VCCA 1NKGA 1PMJX 5F2SA 4QKBA 1WW5A 5ABJA 4BM8A 2IXCA 2ZAHA 2XPJA 5GLUA 5EYYA 1ZRFA 1UU6A 2RV9A 1QHDA 4YGCA 1GP5A 3I2DA 4CCNA 3W5NA 4LBQB 2W5FA 1IZ3A 3GGLA 4UFKA 1WA4A 1Q8OA 3UL2A 1NCRB 1RUC1 3T1LA 4E8CA 3V0BA 4QB2A 4MG2A 3SH3A 4AI3A 3VN4A 1CJPA 1AR92 4QKFA 3RI9A 1BXHA 3ME2A 4IE4A 1DLCA 3I2JA 4OI4A 2P4EA 5FXZA 2Z79A 2R061 3PJYA 1MEC3 3RFRA 4A7ZA 1GP4A 2ADEA 3SEEA 1LHNA 2WNOA 4L97A 3R0RA 2C5DA 1F4HA 2XVGA 2VTXJ 1MS0A 4LITA 4XE9A 3KV5A 2VZUA 2HEVF 2YC2A 4FOWA 2VUAA 2W92A 1UIJA 2JIGA 2W1UA 3CZJA 2I45A 2CYFA 2ZMLA 4M4PA 5A32B 3U07A 2ZCWA 5KXBA 1Z7S2 2WAOA 3W20A 3WF1A 5FO8B 3HNYM 1W9FA 2C24A 3RYPA 3OBAA 2Q1ZB 3GF6A 1XE7A 3LCPA 1V00A 1LEDA 1OC1A 2GSYA 4WVZA 4NPMA 1PK6C 3PHMA 3S5AA 1OSGA 1DDLA 3MGUA 5J7MA 2BNOA 2EAAA 2VZ1A 3POEA 1AR71 3LPGA 4XFFA 1V6JA 2B45X 4PIXA 1RUG2 1DLLA 5FZ9A 2Y38A 1QOSA 4AL9A 1RMU1 4TYSA 5F9TA 1PK6B 4ASLA 3E5XA 2QE3A 3ETPA 4XJ9A 2BERA 1T2XA 3SH4A 2XDVA 3VBFB 1UL9A 1YJKA 2Z42A 3MLKA 5DG2A 2VBBA 4BISA 3K77A 4WM7A 3JZVA 4Q4W2 4BQXA 3E6CC 3W58A 2WWUA 3E6DA 1JYWA 2WZR3 1RUH2 2GP5A 2NYYA 5HI0A 3KWVA 5JPMB 4UF0A 4RGGA 5C6CA 3NAPC 4WV8A 2GU9A 2YHJA 4W8JA 4IDZA 2VMGA 4EZHA 5IAXA 3H8XA 4B7KA 4P9WA 4ZU7A 4Q26A 3VZMA 2J1TA 1Z7S3 4D8MA 3HBZA 1W0NA 1GZWB 1N3QA 4A2UA 5KXDA 4LJHA 2ZA9A 3BODA 1WZXA 4DMIA 2R071 3LQCA 3ZSLA 2ATFA 1RJ7A 3RVHA 1UYYA 1NXMA 3DV8A 3BIEA 4B29A 4C90A 1GZTA 5HXVA 4FOVA 1W9YA 4UWDA 5L19A 2VD7A 1BCXA 2IVIB 2WT0A 4UAPA 3S7EA 2A3WA 1GNHA 2ADDA 5FKCA 2VOTA 5ANNA 4ZONA 4HSJA 2HJIA 3MLLA 3CEWA 2BOIA 1RUE3 4KWKA 1OA2A 4QKNA 3RPQA 4DS0A 3BUCA 2WFF1 5FLJA 4XC9A 1ZBA3 1LGCA 5EV7A 2WSVA 4PLNA 1DHKB 2VMFA 4DPNA 4YARA 1HLCA 1UZYA 1MS1A 3ALQA 1HXS2 4HBNA 4KG0A 4QDRA 5FBJA 2FZ2A 2GNTA 1CPMA 2J1EA 4QD2A 3K46A 2Y6GA 4NHMA 2CGPA 4MXWB 3I7DA 1ULDA 3F95A 3D0JA 4OHVA 1HRI3 3NJZA 5A6ZA 1KDKA 1O4YA 2FMDA 4I01A 3VDCA 1RUH1 2W1SA
chains in the Genus database with same CATH topology
4NMIA 3EMRA 5LB6A 2RG4A 4NHXA 2Y33A 4XCBA 3HQRA 2JIGA 3OUIA 3NNMA 3OBZA 4XABA 5LBFA 3W20A 5L9BA 5M0TA 5EP9A 4NHKA 5A3UA 3MGUA 2JIJA 5HV4A 5DAWA 4BQYA 4MHUA 5DAXA 4Y5TA 4BQWA 4Q5OA 2RDRA 4J25A 2G19A 5EPAA 5IAVA 4XAAA 2A1XA 4BQXA 5L9RA 3GJAA 4NHLA 5LBEA 3GZEA 3GJBA 2FCVA 2V4AA 4ZPIA 2HBUA 5C5UA 4JZRA 4KBZA 2Y34A 5IAXA 2G1MA 5LA9A 2OPWA 5IATA 3ITQA 3OUJA 4MHRA 5HV0A 4XACA 3KT1A 4Y5SA 4NHYA 3KT4A 2HBTA 5LASA 3BVCA 3W21A 5C5TA 2RDSA 5EQUA 2RDQA 4UWDA 4ZONA 3OUHA 3KT7A 5LBCA 3PL0A 4XC9A 4IW3A 3NNJA 3NNFA 2FCUA 5DAVA 4NHMA 5ERLA 3NNLA 2RDNA 3HQUA 3DKQA 4XCAA 5LATA 5L9VA 4NAOA 5DAPA 5LBBA 5DAQA 2FCTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NMI A;  3EMR A;  5LB6 A;  2RG4 A;  4NHX A;  2Y33 A;  4XCB A;  3HQR A;  2JIG A;  3OUI A;  3NNM A;  3OBZ A;  4XAB A;  5LBF A;  3W20 A;  5L9B A;  5M0T A;  5EP9 A;  4NHK A;  5A3U A;  3MGU A;  2JIJ A;  5HV4 A;  5DAW A;  4BQY A;  4MHU A;  5DAX A;  4Y5T A;  4BQW A;  4Q5O A;  2RDR A;  4J25 A;  2G19 A;  5EPA A;  5IAV A;  4XAA A;  2A1X A;  4BQX A;  5L9R A;  3GJA A;  4NHL A;  5LBE A;  3GZE A;  3GJB A;  2FCV A;  2V4A A;  4ZPI A;  2HBU A;  5C5U A;  4JZR A;  4KBZ A;  2Y34 A;  5IAX A;  2G1M A;  5LA9 A;  2OPW A;  5IAT A;  3ITQ A;  3OUJ A;  4MHR A;  5HV0 A;  4XAC A;  3KT1 A;  4Y5S A;  4NHY A;  3KT4 A;  2HBT A;  5LAS A;  3BVC A;  3W21 A;  5C5T A;  2RDS A;  5EQU A;  2RDQ A;  4UWD A;  4ZON A;  3OUH A;  3KT7 A;  5LBC A;  3PL0 A;  4XC9 A;  4IW3 A;  3NNJ A;  3NNF A;  2FCU A;  5DAV A;  4NHM A;  5ERL A;  3NNL A;  2RDN A;  3HQU A;  3DKQ A;  4XCA A;  5LAT A;  5L9V A;  4NAO A;  5DAP A;  5LBB A;  5DAQ A;  2FCT A; 
#chains in the Genus database with same CATH topology
 4NE9 A;  4D7Y A;  4Y22 A;  1AYM 1;  4Q4X 3;  3WV6 A;  3HD8 B;  5F5A A;  3PTR B;  1MAC A;  2PHW A;  1JOD A;  2ZKL A;  5FZK A;  5GAL A;  1XB9 A;  5I0D A;  4RA0 A;  2A3Y A;  4JHT A;  2EIB A;  5IYY A;  1R1A 3;  3NNG A;  5JI9 A;  3VDB A;  5LWB A;  3HQR A;  2OQ6 A;  3SHR A;  4BH9 A;  2PFW A;  5DZE A;  1R1Z A;  3OBZ A;  2ET7 A;  2D5H A;  2GH8 A;  2ZKN A;  3FLT A;  4CCE A;  5LK7 B;  1NCQ B;  4YVS B;  3T4V A;  1RUJ 3;  3P3P A;  2Y0O A;  3MPP G;  3GCX A;  1FX5 A;  2AZ5 A;  4ITC A;  4ES9 A;  2WN3 A;  1QJX 2;  4GMP 0;  2D6K A;  3HIF A;  4LKD A;  4UFM A;  4I0W B;  3ST7 A;  1W28 A;  4P08 A;  2NMN A;  4XFC A;  1QXJ A;  5CB7 A;  1ND3 A;  1VB2 A;  3NJX A;  1NT0 A;  5IJR A;  2XUM A;  3ILR A;  4CXW A;  2WLP A;  1DFQ A;  5CU1 A;  4BQ1 A;  1RB8 G;  3OPZ A;  1R09 1;  4LKF A;  4E27 A;  4ZHN A;  1O3Q A;  4FXG B;  5BNN A;  1W6M A;  2E63 A;  1YEW A;  4GKY A;  2WZP P;  4BYY A;  3HBK A;  1LHV A;  4EN8 B;  2JIC A;  4URT A;  4R9D A;  1H9W A;  2AEN A;  1J1T A;  1W8U A;  4YW1 A;  1FXZ A;  4LO6 B;  4Q0P A;  2EIC A;  5EPA A;  5CZK A;  2WS9 3;  3BPZ A;  2HH9 A;  3SQO A;  5C8C A;  1DZR A;  4HKW A;  1PZ7 A;  1BEV 1;  5JXI A;  1RIN A;  4NR1 A;  2H0B A;  1CPN A;  1Q8V A;  5IK4 A;  4UF0 B;  1XOY A;  2YU1 A;  4NHL A;  1AR8 3;  2PHT A;  5LRR A;  5DG1 A;  2GNM A;  5J96 B;  2PA7 A;  1S0E A;  3E1F 1;  3LEM A;  4HK8 A;  1UYX A;  4LLF A;  5CNA A;  1ZBE 3;  3IWZ A;  3OGV A;  2VU9 A;  4WM7 B;  5DUX A;  4KBZ A;  3FUQ A;  4KH9 A;  3ACI A;  3SKJ E;  4OYU A;  1RC6 A;  1LCL A;  1PO1 2;  1NE6 A;  2WYS A;  5FZ3 A;  5LA9 A;  3C7O A;  3ZOI A;  2WNE A;  2LRO A;  5FK8 A;  5K4L A;  5FZ7 A;  3THC A;  1BYH A;  4MGZ E;  4CPB D;  4NIA A;  2XBO 2;  1WBL A;  4NWW A;  4AQ2 A;  5FZ0 A;  1FPN 3;  2VMD A;  3IMM A;  1GOG A;  2D43 A;  4K40 A;  3THD A;  3K3O A;  5L7O B;  2RM2 1;  3GBF A;  5HV0 A;  2ZGQ A;  4LBJ A;  2RMU 3;  1DGR N;  2H6C A;  1CD3 G;  1XPW A;  3DEC A;  3M8L A;  1PM7 A;  1IGO A;  3VBS B;  3LSE A;  2W68 A;  1RUI 3;  2BRT A;  2QQK A;  3VBO B;  5HCF A;  2X05 A;  1BLZ A;  2H6B A;  2BNN A;  4XHB A;  2WNU B;  1QMJ A;  4IUG A;  2DTW A;  4QPY A;  5FQ0 B;  4AEM A;  3ZXD A;  4AEJ A;  3DGT A;  3K3N A;  4JGZ A;  2JDH A;  3OB8 A;  2C9K A;  2ID4 A;  2VR4 A;  3TOJ A;  4FPK A;  4DY5 A;  1IS5 A;  2YG0 A;  4G9S B;  1SDW A;  3FMG A;  4J6G A;  1UN1 A;  3UKT A;  2JKB A;  5FYB A;  3T0B A;  3ZR5 A;  4YW2 A;  4BQ5 A;  3CZU A;  4A7Y A;  1QXR A;  2V73 A;  2DCZ A;  2QQL A;  4CDQ A;  1QH6 A;  1VAV A;  1WBF A;  5A33 B;  4BDV B;  5FO9 B;  3WT3 A;  3WP6 A;  5T50 A;  2P2K A;  4W6Y A;  3ZYI B;  4NAO A;  2WDB A;  3LAG A;  4QX7 A;  1H30 A;  3QH6 A;  2VEC A;  3IAP A;  3TBD A;  5H9P A;  4D6S A;  3KQ4 B;  3M3O A;  5HXM A;  1ND2 B;  1W9T A;  3WF3 A;  2RG4 A;  3ZM8 A;  2EXJ A;  1UYZ A;  1MS8 A;  2WR9 A;  4LBQ A;  4BME A;  4XCB A;  3MIF A;  1GOF A;  2X5I C;  5FZL A;  2CSG A;  1SFP A;  1W6M B;  3WLU A;  4AED B;  1GWK A;  3RZH A;  5A1A A;  4NN0 A;  2LUW A;  3LF7 A;  3T0A A;  2B4K A;  1GYK A;  2DVD A;  2K2S A;  4AF9 A;  3V0A B;  4IND A;  4IXL A;  4Y5Z 0;  1WGP A;  3FHI B;  3I59 B;  5FP4 A;  5FR3 A;  1ND3 B;  1VMH A;  1OHF A;  3JCI A;  5LY1 A;  1HRI 2;  1YI7 A;  2BTV C;  3H3U A;  4AYU A;  2J1S A;  3VBO C;  4NHK A;  3TEX A;  2VVD A;  4CP2 A;  1PO2 3;  3VBS C;  1S0C A;  1EP0 A;  3BOP A;  4P5Y A;  2W47 A;  3OCP A;  3J7N A;  4LOT A;  5D1I A;  3U4S A;  3UJQ A;  1AR9 3;  3AZV A;  1ULO A;  3NKG A;  4QX2 A;  4LOS A;  4YVS A;  3VKN A;  1W3V A;  1LOG A;  2SBA A;  4LK6 A;  5FMC A;  2XWJ B;  1YQ6 A;  4AVC A;  4UBG A;  5K7P A;  2C4X A;  3L2H A;  3MV0 1;  3AB0 A;  4C1W A;  1EAH 2;  1ZZC A;  2Q8O A;  5FYI A;  1NA1 A;  3QLQ A;  1WWY A;  2QCS B;  2VZR A;  1PO1 1;  3VHP A;  5L73 A;  4AOC A;  1NG0 A;  1CAW A;  1WW7 A;  1DBN A;  2FZ1 A;  5A7S A;  3N7K A;  1YQ5 A;  1VRH 1;  5ACA 2;  5SV5 A;  4NID A;  5L9R A;  2BDR A;  3ETQ A;  1IS4 A;  4H3W A;  1Z0H A;  4BQ4 A;  1AYN 3;  4AHX A;  2YPJ A;  1KFU L;  1E5H A;  3AP6 A;  3UNP A;  1KD7 A;  1SLL A;  2NMO A;  5FLH A;  3N9N A;  5KBF A;  1XNC A;  4MXW A;  3M70 A;  2F4L A;  5GLV A;  1PIV 1;  4FTS A;  4R8H A;  3ZFF A;  4F8A A;  2B46 X;  1OI6 A;  1P8J A;  3WCR A;  4JGY C;  3ZX7 A;  3DPR B;  1R09 2;  3VHN A;  4EWA A;  2JKX A;  4QQH A;  4GB3 1;  1J59 A;  1VJ2 A;  5DAB A;  3WQ1 A;  2BW8 A;  3AKT A;  5CA6 A;  1JU4 A;  3K48 A;  4COW A;  3W21 A;  1CZT A;  2A75 A;  3AMQ A;  2NZ9 A;  1XNT A;  3KM5 A;  1UMI A;  1YUD A;  3U14 A;  1LTE A;  2UY9 A;  2YV8 A;  3AMH A;  5APA A;  1CN1 A;  1VAK A;  4ZU5 A;  5JWP A;  4DUV A;  2G9Z A;  1GP6 A;  1SPP B;  4FQ4 A;  1KJL A;  1S0B A;  2R7E B;  2VVE A;  4GAZ A;  2JB4 A;  3S5Q A;  2DCJ A;  4GD4 A;  3OUH A;  4LUM A;  1NCQ C;  3Q8F A;  3CBN A;  3CJI B;  1YIF A;  2OX0 A;  4QQL A;  5LBC A;  3SXW A;  1V9U 3;  5AVA A;  5BXX A;  4IW3 A;  2EID A;  3NNF A;  3D5O A;  4JGY B;  2J1R A;  3MO4 A;  4S2G A;  4S2H A;  4WBB A;  4GAL A;  3MIG A;  3RQ0 A;  3RRD A;  1YXW A;  4IET A;  5DZF A;  3WUD A;  4MYE A;  4BU2 A;  3TWI A;  2VZV A;  3B5L B;  1PGL 1;  2E53 A;  2VME A;  4UXA A;  2ZHL A;  5K8S A;  1MZF A;  2EAL A;  4R9B A;  2D6M A;  4NJ4 A;  4AI2 A;  4DIN B;  3PIJ A;  5DAP A;  1UMH A;  1H2L A;  4YW7 A;  1K5M B;  3VHR A;  1DG6 A;  1YRZ A;  1GAN A;  2WA3 A;  5IVE A;  2ZX0 A;  3R05 A;  1GV9 A;  3N7L A;  4IE6 A;  4XMA A;  3O12 A;  3EHK A;  5AFB A;  3GAL A;  5J36 A;  4RL7 A;  4OI1 A;  2Y33 A;  1LU1 A;  1DZT A;  1NE4 A;  3JXS A;  2MHF A;  2XON A;  1SMV A;  1D4M 3;  3GHM A;  3WQ7 A;  2WFF 2;  1XU2 A;  3OUI A;  3KSC A;  2W3J A;  3T0D A;  1C28 A;  3VD4 A;  1V6M A;  1VBE 3;  1VBA 1;  1EYB A;  1CES A;  1MVQ A;  1NZI A;  3CMG A;  2W95 A;  1JZ4 A;  3POI A;  1VB4 A;  5IVB A;  4DFS A;  1MVE A;  4AGG A;  3ZIX A;  1Y9G A;  2W08 A;  2O0O A;  2HWB 2;  3IBM A;  4Q4V 1;  1W6N B;  4B4P A;  1VMJ A;  1ZZB A;  4MET A;  2X29 A;  4WVW A;  5A3U A;  5B2G B;  2DBI A;  3AP9 A;  1N1T A;  3M7A A;  4CDW C;  4AFM A;  2QDR A;  4P02 B;  5I0R A;  2F4P A;  3KLS A;  4MSV A;  3RMY A;  3LDR A;  1ZZ9 A;  4Q29 A;  4E4H A;  4JDM A;  3WNX A;  3ILF A;  4CDX A;  1VPH A;  3SMH A;  4FBF A;  4E9K A;  1W2O A;  2YUE A;  1H8T C;  3ACF A;  1JS9 A;  1W6O A;  4MHU A;  3UYJ A;  4HVQ A;  5FY7 A;  2VH9 A;  3LOB A;  4M01 A;  2WWJ A;  5FDB A;  1JH5 A;  3NAP A;  4FVV A;  2XVK A;  1TEI A;  5IAV A;  5A6Q A;  4XAE A;  2JE7 A;  1IQA A;  1OLM E;  1OBN A;  5FK7 A;  1MS4 A;  1UPS A;  2IC1 A;  4RHV 3;  4XDQ A;  4XJU A;  2YFZ A;  1B09 A;  1XU1 A;  1W8H A;  3GZE A;  1W8Z A;  1YFY A;  1YFX A;  5FRE A;  3T30 A;  3WP3 A;  1AUY A;  2Y6J A;  1VBC 3;  1DP0 A;  1N3P A;  1RUJ 2;  2ZGT A;  3LDB A;  5EJZ B;  3ZXK A;  1JZ2 A;  1QQP 2;  2Y34 A;  5T5L A;  2D40 A;  1G9B A;  3V0B B;  1WCQ A;  1ACC A;  2QZ3 A;  4JKK A;  4SLI A;  3EYP A;  1KQR A;  3QBQ A;  4WVV A;  3ZIW A;  1NA1 B;  1KRI A;  2A73 B;  4QPW A;  4H7L A;  3OOX A;  1L7L A;  2R04 1;  1W9W A;  3HQX A;  4H55 A;  4XBL A;  5KC5 A;  2D6O X;  2CU5 A;  1YJL A;  4RD7 A;  5ABJ B;  3HVD A;  5KXE A;  1W06 A;  4OUL A;  4MX3 A;  5CIS A;  4IGO A;  3TNQ A;  3ZFF C;  1QH7 A;  3DEM A;  1D0G A;  3H8U A;  3U4X A;  2P3K A;  1HW5 A;  5AC9 2;  2BQP A;  1X36 A;  2VL4 A;  4RHV 2;  1XQN A;  2OA2 A;  5JI7 A;  1OF3 A;  2JD4 A;  2VXR A;  4JV4 A;  3UJO A;  1H1A A;  2Y8K A;  4C8D A;  4CEW B;  2CAV A;  4CRQ A;  4L92 A;  4Z2W A;  4KBB A;  2ZHN A;  3JB8 A;  2KR2 A;  5J37 A;  3A0K A;  3BU0 A;  4FCA A;  2ZX3 A;  5FYC A;  4WVM A;  2BGO A;  4BK5 A;  4FTB A;  4RQP C;  1R08 2;  3I2K A;  3PL0 A;  3WF2 A;  1LEM A;  2YXS A;  3WNP A;  2JJ6 A;  4XFI A;  5FY4 A;  4NIH A;  3HOB A;  3I3Q A;  3SNM A;  2HYX A;  1C1F A;  1FMD 1;  4DUX A;  2UWB A;  2ZX4 A;  1EAH 3;  4Z1V A;  4CDU C;  4D6Q A;  1ULG A;  2VZO A;  5CVR A;  5A3M A;  3KQR A;  2XBO 1;  4KWL A;  1G8W A;  2IXI A;  4KL1 A;  3NNL A;  3WHT A;  2VQ0 A;  1DGW X;  2R06 2;  4AI9 A;  5BNN C;  1JZ8 A;  1OUX A;  1OQ1 A;  3N9M A;  3FC0 A;  1C3H A;  2Q8E A;  2W0X A;  1C5H A;  5F6K A;  1UY0 A;  4J1X A;  5LBB A;  3X29 B;  2JXA A;  4IV3 C;  4LKE A;  4XFB A;  1ZX5 A;  2DBN A;  4E2G A;  2XLG A;  3LA3 A;  3I97 A;  4RYD A;  3J7H A;  3AC0 A;  4CDQ B;  1Y7B A;  1YFU A;  2RS3 3;  2YPD A;  5CYY A;  4YM2 A;  1OLR A;  1FMD 2;  5CKQ A;  1IG3 A;  1QIQ A;  1Y3T A;  2ZAC A;  3LGR A;  4FAG A;  2RR1 3;  2XKO A;  2RVA A;  2ZGK A;  3KV6 A;  4YW4 A;  3OF1 A;  5IWF A;  2VVF A;  4QGM A;  3WDX A;  1FOD 2;  4AAX A;  5CFC B;  5FYV A;  1HX6 A;  3NQH A;  3VZJ A;  4A6O A;  4ZKT B;  1BVV A;  5FZ8 A;  4JVA A;  2FDH A;  4Q2F A;  4IV1 B;  1CX1 A;  1UWW A;  4GIQ A;  5DAQ A;  4AQT A;  3D0S A;  5C71 A;  1ZVF A;  3E5U A;  4R4X A;  1NLQ A;  2JIJ A;  1SFY A;  3WX5 A;  5F5I A;  3UGG A;  4M3C E;  2K0G A;  4QDS A;  5C8C C;  3VDD B;  5DAW A;  2ZGL A;  4P9G A;  3ZDV A;  4HKL A;  4BQY A;  1RXG A;  5H9R A;  5JXJ A;  4DB5 A;  5DAX A;  1BMV 2;  4YVW C;  1V0A A;  4Q8L A;  2BEO A;  1IHM A;  2GC1 A;  1GZC A;  5FMO L;  5IW0 A;  3Q8B A;  2PAE A;  5FYH A;  3HNM A;  1LGN A;  2GND A;  1Q56 A;  4FFH A;  4PBP A;  1IG0 A;  3A4U A;  3ACG A;  5LBE A;  1XE8 A;  3LEK A;  4HL0 A;  4R9A A;  2LRP A;  2IVJ A;  3Q8E A;  2Y64 A;  2AAC A;  3H3Z A;  3J7M A;  4AK3 A;  2WT2 A;  4BB3 A;  2X8K A;  5C3Q A;  1GMM A;  1UY4 A;  1WME A;  1YLL A;  4FP2 A;  3ZFG B;  3J9S A;  3I8T A;  1C8M 1;  2RS5 1;  1IPK A;  2YBS A;  1K3I A;  5C3O A;  2HWC 3;  1H6X A;  1A34 A;  1W2N A;  1SEF A;  2ZJC A;  2OKX A;  4OHX A;  1OF4 A;  4IE0 A;  4LBK A;  1JXN A;  2X09 A;  3P1I A;  3WF0 A;  4HT1 T;  3RZG A;  4P14 A;  4CDW A;  4QX5 A;  2UY8 A;  2WO2 A;  3WXP A;  2HBT A;  5LAS A;  2OXB A;  2P1B A;  3ZYR A;  3M2M A;  5FAX A;  2JG9 B;  4COV A;  2HWB 1;  3RZK A;  1W6Q B;  4KG8 A;  3RYK A;  2UU8 A;  3E97 A;  1OVS A;  2YRO A;  4A41 A;  4DEV A;  3EB7 A;  2VUJ A;  2GMP A;  3T4H B;  1JUI A;  3LA2 A;  1ULE A;  3VKO A;  1C57 A;  4N43 A;  4QB1 A;  3IIA A;  5E88 A;  5T3N A;  5T5O A;  5AFE A;  4CDQ C;  1AJK A;  2WYF A;  4EZ4 A;  4P9L A;  4LBL A;  2QTW B;  4FPC A;  3KGZ A;  3ZFF B;  1NAE A;  3M4F A;  3BN6 A;  2VBP A;  3POF A;  1V6N A;  4LE3 A;  1C8M 2;  4O61 A;  4XJA A;  1B35 A;  5HBA A;  1BBT 1;  1DCS A;  2ZTN A;  2IWG B;  4XHX A;  1C4R A;  1J1L A;  3SCG A;  1Q3E A;  5JZG C;  1NA1 C;  2XB6 C;  3KB5 A;  2BU9 A;  1H8V A;  2R6Q A;  5DDJ 2;  1RUD 3;  3VHO A;  4EWE A;  3LZZ A;  1MQT C;  3RI8 A;  5AC9 3;  2D6P A;  4Q4W 1;  3WNK A;  4BPZ A;  2QQJ A;  4BWO A;  4CP0 A;  1HRV 2;  1U5Z A;  1N1V A;  2ERF A;  4E8D A;  5JDB A;  2A70 A;  1RED A;  3J4U H;  4LOR A;  4QXK A;  5DUV A;  3AP5 A;  2DTY A;  5SV8 A;  3SIS A;  5FPV A;  3WNN A;  3VBH C;  1S2B A;  1EPZ A;  4GMP 1;  4XYX A;  4N9I A;  2A7A A;  3RMX A;  5T55 A;  2XL7 A;  4LHK A;  2HWD 3;  1BQP A;  5K0U A;  3USU B;  1QEX A;  1RMU 2;  4N43 B;  4PQ9 A;  1H9P A;  1DIW A;  3M3I A;  2UWC A;  1RUG 1;  1ALY A;  1WCS A;  1FAT A;  4CCD A;  1OQE A;  4K1Y A;  1H4H A;  3IB3 A;  2R0F A;  1RJ8 A;  4EN7 B;  5FZF A;  1HV1 A;  1RUD 2;  5EP9 A;  1GQG A;  2LTN A;  1UQX A;  4XW3 A;  4XDO A;  5CFD A;  1U5X A;  4JTN A;  2PAK A;  5LA1 A;  1O3T A;  4RS5 A;  1TVG A;  1AXY A;  2E51 A;  3AKS A;  3PIG A;  1O5U A;  3QH7 A;  1WCU A;  2BNM A;  5LK5 A;  5IFP A;  1RUF 3;  5GZE A;  1LOF C;  2RE9 A;  4CDW B;  1S55 A;  2OPK A;  4AED A;  3CQO A;  1O3S A;  5F5C A;  5DQ0 A;  1FOD 1;  1EV1 2;  2C0Z A;  3IDB B;  3R6S A;  4CUC A;  2GC3 A;  1SQ4 A;  3K4D A;  4D3W A;  5KHJ A;  4HON A;  1FNZ A;  4AFA A;  5A7W A;  1ASJ 2;  2WT1 A;  3JU9 A;  1LOE A;  2JEC A;  4HVR A;  1J3R A;  4X6Q B;  1XYP A;  5FXX A;  3JUU A;  2E7T A;  1RUE 2;  4ORF A;  1KEX A;  2VZT A;  1I3H A;  1RVF 3;  3AZY A;  4NRP A;  1AXK A;  4JRA A;  4XF9 A;  2CAU A;  3S7I A;  1TMF 3;  2ZOE B;  3GHN A;  2QVS B;  4R52 A;  4YZ4 A;  3H9A A;  1H8T B;  4LMF A;  5JR2 A;  1A78 A;  1QJU 3;  3KCC A;  3KV4 A;  3NWK A;  3SCF A;  1OKO A;  3THT A;  5JOW A;  1CAX A;  2XGX A;  3TRS B;  5F37 A;  1JZ7 A;  1N1Y A;  4NOT A;  3AKP A;  3IKW A;  4QQP A;  4NVP A;  1LOD A;  3U0Z A;  3I4I A;  2VMH A;  2E32 A;  1MS5 A;  5DUW A;  5KXC A;  1GOH A;  1ULC A;  3B7M A;  3H1M A;  2OT7 A;  1D4V B;  1JYX A;  4L9B A;  4GA9 A;  3NL1 A;  4AVV A;  1AX0 A;  1JOJ A;  3MW3 A;  1SDD B;  2WNU A;  4QQ2 A;  1AR8 2;  3PVO A;  3A21 A;  1OPO A;  4AZZ A;  1OOP B;  2CL2 A;  5FZD A;  1TME 1;  3JBG 1;  5FO7 B;  4BK4 A;  4N8M A;  2ARA A;  3DF0 A;  4M0N A;  4A4A A;  3UGF A;  2QFE A;  2MEV 1;  1G9D A;  3N9O A;  3IMN A;  3KZ4 C;  5JSO A;  5ISL A;  4XQD A;  2JDA A;  2Z5W A;  3G7D A;  5DXD A;  4YW5 A;  2ORZ A;  2XVL A;  1UY1 A;  4O65 A;  4O7X A;  3ZXG A;  2IXL A;  1AX2 A;  3TB0 A;  2NM1 A;  2HWF 3;  3J8F 2;  3M3E A;  4IEV A;  4LKS A;  2CV6 A;  5CAD A;  1W90 A;  1X9T A;  2D7F A;  4EJR A;  5C9A C;  2R1B A;  1VBD 3;  5F3E A;  3V64 A;  1UX6 A;  4LO4 B;  1H8T A;  1QQP 1;  2VUC A;  2A6X A;  2JDP A;  3DKQ A;  2WO7 A;  4V2W A;  1APN A;  1GU3 A;  4KWU A;  4XUP A;  2FCT A;  1UO9 A;  2VTX A;  4FSJ A;  1IS3 A;  3AK0 A;  5FYU A;  4QPI A;  1QJY 2;  4Q4Y 1;  2D6L X;  4NMI A;  1NZC A;  1I6X A;  1JOB A;  2AR6 A;  4EN6 B;  3J8F 1;  5A7W B;  4MZU A;  4NHX A;  1X82 A;  2W2I A;  3GZA A;  1OFN A;  3CLP A;  4YFW A;  1O8S A;  1COV 1;  1JYV A;  2WO3 A;  5TSW A;  3N9Q A;  2XJQ A;  3NNM A;  3VDA A;  1JI6 A;  4WVM B;  3HN1 A;  3A7Q A;  1YCI A;  5BNO A;  1CAV A;  2VBD A;  2RS3 2;  1TME 2;  4LHL A;  2K9Z A;  4MAD A;  3VBR A;  3BIW E;  4P9X A;  4BIF A;  1RHI 1;  3J7L A;  2JD9 A;  1VAL A;  2HKX A;  3PDQ A;  4OCT A;  1O59 A;  3TN9 3;  3LIG A;  2ZEW A;  1UU5 A;  4PJY A;  4GXL A;  4MGS A;  4K20 A;  1OA4 A;  1NXD 1;  2LW8 A;  1S0G A;  1PVC 3;  2JEM A;  1HXS 3;  4Y20 B;  3T08 A;  1H6Y A;  1VBA 2;  2C1F A;  1XSQ A;  4Q0Q A;  4CEY C;  1NX9 A;  1WD3 A;  1ZBA 2;  3WG3 A;  3R4U A;  3OGS A;  2EXH A;  3AYD A;  4DEQ A;  3MW4 A;  1LES A;  1LHU A;  3APB A;  4ZXK A;  2ZXQ A;  4ZY9 A;  2PHL A;  2IXK A;  5FBZ A;  1R08 3;  2BWC A;  3VKL A;  1ZRE A;  4PIZ A;  3ZN5 A;  1UU4 A;  4HPK A;  1UXZ A;  2OZ6 A;  3AXD A;  2CWS A;  3WW3 A;  1GR3 A;  3QCW A;  4AVT A;  1PO2 2;  2HLE A;  3LOI A;  3JD7 1;  4PLO A;  4XJZ A;  5FUN A;  1YWK A;  2GME A;  2OYZ A;  3SEP A;  2VQA A;  1ZA4 A;  4JZR A;  2R1D A;  1GWL A;  4MGI E;  1RIT A;  1ASJ 1;  4Z82 A;  5EWS A;  3WSO A;  2OPW A;  1XXN A;  4Y1X A;  5BNP C;  1I5Z A;  4JCK A;  4D7T A;  3BKZ A;  3EBR A;  1OLQ A;  5H9Q A;  5GLT A;  4OUS A;  5FPL A;  2CWM A;  3IDE A;  4GZ9 A;  1LU2 A;  2GP3 A;  2DFB A;  2FDI A;  5JSP A;  5F39 A;  4LT5 A;  4XAC A;  3KT4 A;  5A7Q A;  4Y3O A;  1J58 A;  2WZR 2;  4CE8 A;  1POV 1;  1QJY 3;  1YQ2 A;  1FV2 A;  1GQP A;  1XE0 A;  3LPF A;  1W6N A;  4IEO A;  2XKP A;  3DYP A;  4UYB A;  3ZSE A;  2XLF A;  3RWN A;  1VBD 2;  3H50 A;  2UYB A;  4X8N A;  3AL6 A;  4D94 A;  2KM2 A;  4GQ7 A;  4IEP A;  4XBN A;  1ND2 C;  1VBB 2;  1OLM A;  2E7Q A;  1BKZ A;  2WNU C;  2B5H A;  1AXZ A;  2DDU A;  2ZGR A;  4LR4 A;  3WOG A;  4U36 A;  5T54 A;  2P3I A;  3NV1 A;  4C91 A;  1GKB A;  4DY3 A;  2B9U A;  2WQ8 A;  5EZW A;  3WIN E;  1AR6 3;  3SIT A;  3A22 A;  2V4V A;  3LD8 A;  4PF5 A;  1WUV A;  4XEZ A;  3WZ1 A;  1RIR A;  1UCX A;  4C0B A;  1JZ5 A;  3VD5 A;  4U2A A;  3PJQ A;  4N53 A;  3WHU A;  1W04 A;  2D44 A;  3H3L A;  1HQL A;  5A7N A;  4CU7 A;  4AE2 A;  5L7O C;  5DDJ 1;  1XNB A;  1B35 C;  5LA0 A;  3O1U A;  4GWN A;  3BU7 A;  1DQ2 A;  3O1R A;  1I9R A;  4YVW A;  3RZL A;  2I74 A;  3MW2 A;  3ZYJ B;  1BBT 2;  4UFH A;  3VZN A;  1JU3 A;  4YFZ A;  3I54 A;  2R30 A;  3DL3 A;  3ZXL A;  1X9P A;  4Y1U A;  5C8W A;  3PUA A;  4XPV A;  1XRU A;  4N53 B;  1JHJ A;  4Y1Z A;  4AWD A;  3H8O A;  1F2N A;  4J1W A;  1FNY A;  4LXL A;  5FKB A;  5CEH A;  2JDZ A;  1OMI A;  3AKQ A;  1LR5 A;  1VP6 A;  3WP4 A;  4RSU A;  1XYN A;  3GNE A;  4LNV A;  3NRU A;  5FYZ A;  3ZKY A;  2XLA A;  5LW9 A;  3BI3 A;  5FYT A;  1PZ9 A;  3B69 A;  4MLO A;  3VDD A;  4XJW A;  3ZPY A;  1PGS A;  3H7J A;  4HAN A;  1RUC 3;  4PQQ A;  3I2O A;  4P00 B;  4AG4 A;  2C9A A;  4ISR A;  1HN0 A;  1WLC A;  5FZE A;  1QJU 2;  5HPO A;  1JUH A;  4LHS A;  1GFF 2;  2VTF A;  3F2Z A;  2W9X A;  1STM A;  1RHI 2;  4PBO A;  2DCY A;  5G04 L;  2BV4 A;  3LKJ A;  5FWJ A;  3P6B A;  1MEC 1;  3AP4 A;  4NRM A;  4FTE A;  1OPM A;  1XND A;  2VE1 A;  1ZRR A;  3FHQ A;  4E4S A;  1NY7 1;  1NYW A;  2VZS A;  4PHZ A;  4AQ6 A;  2DV9 A;  4RQP A;  1N1S A;  2WS9 2;  4KQ7 A;  5GZC A;  2NP0 A;  1WLW A;  4OLL A;  4XFA A;  3TEW A;  2KA3 A;  2VZ3 A;  4FPE A;  4Q5O A;  3TAY A;  4LHN A;  1E5I A;  1ZYB A;  2DCT A;  1RUF 2;  2YMZ A;  4CDU A;  3WNM A;  4OI0 A;  1HJG A;  3ZN6 B;  4Y24 A;  1VBB 3;  2I07 B;  2EF6 A;  4Q4Y 2;  1NQD A;  3H7Y A;  3KS7 A;  5FY5 A;  1QJX 3;  4RFT 0;  1S2E A;  1RUO A;  4IL7 A;  3VZL A;  4ZPI A;  2HBU A;  1G9A A;  3NMB A;  4TXW A;  2GH2 A;  2A3X A;  3N9L A;  1GZ9 A;  4LA2 A;  1LHW A;  1ZZ8 A;  2XJR A;  5A1F A;  4XBQ A;  3N36 A;  4BZ4 A;  4TLF A;  1W3X A;  3USS A;  1KDM A;  3PUI A;  2DUO A;  5KHI A;  1HRV 3;  4OMC A;  3PUQ A;  5HCH A;  2XJV A;  1H2M A;  5BNQ A;  3CIH A;  4Y5S A;  3GBW A;  2CHH A;  2VNG A;  4IEQ A;  4XUT A;  5IFT A;  3KD4 A;  4YZ2 A;  1CX4 A;  1IKQ A;  2GN3 A;  2RS1 3;  4YM0 A;  5C33 A;  3PVB B;  3T2P A;  2XJT A;  2Q1F A;  2VNV A;  2WC2 A;  3JBG 2;  4BXS V;  4IEU A;  1JN2 P;  5K0U C;  5BY5 A;  2WA4 A;  4A42 A;  5LZ6 A;  1G9C A;  1VLN A;  1CAV B;  2YY1 A;  1DZQ A;  1W39 A;  5ACA 3;  2W1W A;  3ZXE A;  2VC9 A;  5LEJ A;  4B4Q A;  5CFC C;  3DYO A;  3PUS A;  5B4X A;  4NII A;  1ZZ7 A;  1U5I A;  5DUU A;  3JQW A;  1W2T A;  3KHB A;  5CFD C;  4TTG A;  1IS6 A;  3OEB A;  4QX0 A;  4Q0U A;  2JG8 B;  1JYI A;  1TZO A;  1W2A X;  3FJS A;  3J26 N;  3MF9 A;  1HB3 A;  3U10 A;  1ND2 A;  2R07 3;  2R16 A;  5GZG A;  5JAX A;  5C9A A;  2W52 A;  2NN8 A;  5FY1 A;  1ULF A;  2VCM A;  2ZMN A;  4IV3 B;  4HN0 A;  4XCA A;  2Q8D A;  3VKF C;  1GNY A;  4PI0 A;  2P37 A;  4YGD A;  3TYJ A;  1YYN A;  4HG6 B;  1LOB A;  3I2G A;  5GM0 A;  4A7K A;  1T6B X;  2ZEZ A;  1SG3 A;  1HB2 A;  3E5Q A;  3DCQ A;  4KGQ A;  1AL2 1;  4X6R B;  5C4W C;  4EN9 B;  5JOY A;  3ZN6 A;  1RUE 1;  3ZXJ A;  3NAP B;  4JRL A;  1LB2 A;  1E5R A;  3I49 A;  3L9J T;  4CDU B;  2PLV 1;  2ZZJ A;  3W9A A;  2JX9 A;  2ZX2 A;  1QU0 A;  2ZMK A;  1W6O B;  1H0B A;  2B42 B;  2JDY A;  3CHX A;  1AZD A;  1F35 A;  4CUG A;  1EV1 1;  4RQP B;  2EIE A;  4BIO A;  1UKR A;  1W8N A;  2DU0 A;  3CF6 E;  4JGZ B;  1YIP A;  2VOW A;  4X8P A;  4CEW C;  5K9Y A;  2UWA A;  2JEN A;  3ENR A;  5FQ0 A;  5M0T A;  1GQH A;  5HCB A;  1EPW A;  2PN5 A;  4CCC A;  3BTY A;  3IDC B;  1HDK A;  2HWE 2;  3FFZ A;  4LIV A;  4D0Q A;  1OOP A;  3MF6 A;  3PU3 A;  4S2D A;  3VBO A;  2PHD A;  4AI8 A;  3EJK A;  2YFU A;  2CGO A;  1KS4 A;  3VBS A;  3ZYH A;  1H1M A;  2CNA A;  4BQ2 A;  3GBG A;  4Q4X 1;  1I5P A;  4FQZ A;  3ABZ A;  3GCW A;  4COU A;  5HV4 A;  4N43 C;  2ET1 A;  1KS5 A;  3MUY 1;  4DNY A;  2D3P A;  5ABJ C;  1J84 A;  4XF3 A;  4GWM A;  4FPF A;  1R1A 1;  2WNV C;  4Y5T A;  4BQW A;  3T2T A;  4FPG A;  4IE5 A;  4RN5 A;  2Q8C A;  3MIB A;  4CU9 A;  5FZO A;  2ES3 A;  3BGA A;  4FPH A;  2IXJ A;  1Q8Q A;  1FAY A;  1RUJ 1;  2EVX A;  1LHO A;  1QDC A;  3N7J A;  2XQX A;  3OY8 A;  3PLQ A;  1MQT B;  2GNB A;  4RR3 B;  1REF A;  2WSU A;  5FPA A;  2HWE 3;  2XWB B;  3BTA A;  1JYT A;  1UKG A;  4BHP A;  4Q0S A;  1ENS A;  2PYT A;  3PME A;  1LRH A;  4UW4 A;  4MGY E;  1GIC A;  3MZH A;  3FBY A;  3NV3 A;  4HKO A;  5I0T A;  5IVJ A;  5FP3 A;  4DZG A;  1Q5O A;  2RR1 2;  2PAM A;  3FFQ A;  4CYD A;  2VQU A;  1V6I A;  2ZPX A;  4LO8 A;  2K46 A;  2VCA A;  1NY7 2;  4L2N A;  3FBM A;  4Z8B A;  2FMY A;  1VE0 A;  1UOF A;  4P5H A;  4DIQ A;  1SLB A;  1BEV 3;  5C5T A;  2F6B A;  1SPP A;  3VB9 A;  3C7G A;  3LFM A;  4QXB A;  5CFD B;  2MPF A;  1PNF A;  4UFI A;  1MR5 A;  3O1O A;  2R06 3;  4N7I A;  1K12 A;  4NAM A;  5FP9 A;  3WP5 A;  4IE7 A;  4N9H A;  5A7P A;  2W87 A;  3USU A;  4CZS A;  5K0U B;  2YBP A;  3B9I A;  1W6P B;  4DUW A;  2R07 2;  4SBV A;  3AYC A;  5C4W B;  1S1A A;  2JDN A;  1W0O A;  5J3U A;  4GH4 B;  2WQZ C;  4AVS A;  1FPN 1;  1OD5 A;  3AVS A;  4YYO A;  5JPN B;  1R64 A;  1XBF A;  3AFK A;  3K2O A;  4QHO A;  4IEX A;  4KGG A;  2BGP A;  3SCH A;  4JKM A;  3O7O A;  1UOB A;  1Y9Q A;  3U37 A;  1K5M C;  4FOQ A;  2DVB A;  3CNA A;  4M3C A;  5EHD A;  3TEY A;  2DCK A;  1RUI 1;  2X10 A;  3D8C A;  1XJA A;  4MUV A;  5C3R A;  1O3R A;  2OII A;  1QJF A;  2VCB A;  4A6S A;  1ENX A;  2ZEX A;  5A3N A;  4DXT A;  1GUI A;  4QKD A;  1AR7 3;  1JW6 A;  2TNF A;  4HPK B;  5JCT A;  3Q9O A;  1MZ5 A;  3AXE A;  3MIE A;  4MV2 A;  1F5F A;  1BVP 1;  3D82 A;  4HXC A;  4M4R A;  5KC6 A;  2OS2 A;  3VL9 A;  1RMU 3;  3HWJ A;  3I2H A;  4L11 A;  1G6N A;  3ZYB A;  1ZRC A;  2WFP A;  4PCR A;  5FUP A;  4CPB A;  4GH4 A;  4NUB A;  4GJZ A;  1R1A 2;  3H1W A;  1O91 A;  5FZC A;  2DF7 A;  2VUL A;  4Y20 A;  4XJ8 A;  3W5M A;  2VY0 A;  2WQ4 A;  3K4Z A;  5I8S A;  4A45 A;  4MXV A;  2Y60 A;  2IFW A;  5A3P A;  4Q4X 2;  3BAL A;  2TBV A;  4UFL A;  5ANQ A;  4W6X A;  3T09 A;  2Y0I A;  3MUZ 1;  4CU8 A;  2C26 A;  1JYC A;  3KCX A;  1LEC A;  4GUL A;  1W99 A;  2WZR 1;  1TNF A;  5FRA A;  2E9Q A;  2JG9 A;  3UT0 A;  3LEI A;  1T6G C;  3GDB A;  5A6Y A;  3OYW B;  2QQW A;  3NJV A;  1EUT A;  2QQV A;  4QM8 A;  1Z7S 1;  3VZK A;  5KR7 A;  4M00 A;  4DXZ A;  1WA6 X;  4YGB A;  2D98 A;  2RDR A;  1PIV 2;  3IT8 A;  4W6W A;  4P9I A;  4F83 A;  1MS9 A;  1C5I A;  2J7M A;  2PLV 2;  2G9G A;  3PMS A;  1H2K A;  3ZFG A;  1OA3 A;  5IVF A;  1XNK A;  1AL2 2;  4AHZ A;  2PQQ A;  5E6H A;  3ZXF A;  4FXK B;  2FCV A;  2P3J A;  4EE2 A;  4NIG A;  1VRH 2;  4MOA A;  5FLI A;  1M4W A;  5JLV A;  4YRD A;  4D69 A;  5C5U A;  5F3G A;  2ZGS A;  3WG4 A;  5FZM A;  4PIY A;  5D8A B;  3RJR A;  1AR9 1;  5A33 A;  1JOP A;  2G1M A;  2WFF 3;  3KGL A;  4CTE A;  3OD4 A;  3ATG A;  1ZBA 1;  4H7M A;  1O5L A;  4TLG A;  1BK1 A;  3MIH A;  4K9S A;  2X5I A;  3PNA A;  4ONU A;  3O5S A;  3ZMN A;  4ZZ5 A;  2WO1 A;  5C3P A;  4DRR A;  2BPA 2;  4HET A;  1SHW B;  1QOT A;  1ZBE 2;  2PQS A;  4QPG C;  1QOO A;  3SC7 X;  5C70 A;  3G6J B;  1ODM A;  3PU8 A;  4HSL A;  5KHK A;  1QY4 A;  2VW2 A;  1PX3 A;  3N4M A;  2EAK A;  1DQ0 A;  2FQP A;  1HRI 1;  2QZ2 A;  3VBR C;  4ES8 A;  2SLI A;  1RUH 3;  1SLA A;  4XIK A;  4YW6 A;  4OMD A;  2DUP A;  1AYM 3;  4BLI A;  3S0M A;  5A6X A;  5JMC A;  2ETE A;  4N53 C;  1V6O A;  2HYK A;  4K8F A;  3DXU A;  1PIV 3;  2R49 A;  2XQR A;  4FFF A;  4YWA A;  2A6Z A;  3PUR A;  5T52 A;  5DMY A;  5L7O A;  1L3J A;  4YSF A;  3LWC A;  2X5I B;  1O7F A;  4WM8 C;  5KWR A;  2ZHK A;  4XUQ A;  4XQ4 A;  4QM9 A;  1PMH X;  4B7E A;  3OD0 A;  3ZLI A;  5JXH A;  3O1T A;  2E26 A;  4GB3 3;  1U5Y A;  4HK9 A;  4WZF A;  5I8Y A;  3D4K A;  1BZW A;  1CAX B;  3BCW A;  1FV3 A;  3OJB A;  4TZD A;  1FI2 A;  5CG8 A;  4BLJ A;  2ZGU A;  4AHW A;  1E57 A;  4G4F A;  1CIW A;  3H1Y A;  1WMX A;  4LE4 A;  3ZSJ A;  2VNR A;  3RGB A;  3SH5 A;  2GAL A;  2QUO A;  1CVN A;  2GC2 A;  1YQ8 A;  1L7R A;  2ZX1 A;  4MVT A;  3KCY A;  1GLH A;  1ZA7 A;  2O1Q A;  1R09 3;  4XF1 A;  1DQ4 A;  1V9U 1;  1ZM1 A;  5IK5 A;  1MZ6 A;  1V6K A;  5FPB A;  3WG2 A;  2XJS A;  1CQ9 A;  5E89 A;  4EQV A;  4KNC A;  3FE5 A;  3SLI A;  2VOV A;  3H42 B;  4LO7 A;  4ZU4 A;  3POJ A;  4NWV A;  2I2S A;  2WS9 1;  4H2A A;  2GZW A;  4QU1 A;  4UI9 L;  5L9B A;  5IT6 A;  2VZP A;  4K8R B;  1NLS A;  4CEW A;  4A3X A;  3PVN A;  3GZU C;  2VZQ A;  2ZZQ A;  1MEC 2;  5T5J A;  1AR8 1;  1ONA A;  1DGL A;  2Y6K A;  2WL1 A;  3AMM A;  4B3N A;  4XVH A;  2E33 A;  3FX3 A;  3Q8A A;  4L99 A;  1ZBE 1;  4FI9 A;  4CCK A;  4DXR A;  3I3M A;  5A80 A;  1ST8 A;  3NO8 A;  3WW1 A;  1F9K A;  2BVV A;  1NCQ A;  2RM2 2;  3U78 A;  3AM2 A;  5FY8 A;  1X33 A;  4JHZ A;  4YW3 A;  3NW4 A;  5LA2 A;  4Q1R A;  1D4M 1;  2QBX A;  2VMC A;  3HT2 A;  1V6L A;  2RM2 3;  2VG9 A;  1N3O A;  2G19 A;  3INA A;  4J25 A;  1VBE 1;  2RMU 1;  3ACL A;  1IKP A;  3AYE A;  2P17 A;  3MI8 A;  4FO9 A;  3KF5 A;  1SAC A;  2A6Y A;  5FMD A;  2VPV A;  2OQ7 A;  3GJA A;  3LDK A;  2VJX A;  3JB4 C;  2WUH A;  3VUO A;  4B8E A;  1UX7 A;  4O9G A;  2V5Y A;  2FDF A;  4W50 A;  3RDI A;  3WY6 A;  1REE A;  3AMP A;  1X8E A;  4FT8 A;  3WQ0 A;  2RS1 2;  3VD3 A;  1WW4 A;  1CGP A;  1URX A;  3VD7 A;  3I3E A;  4URA A;  3PUH A;  4XZP A;  5IVY A;  5FJH A;  1ZNP A;  1D0H A;  3S30 A;  3I2I A;  2ZBJ A;  1POV 0;  4K1Z A;  1LUL A;  4QB6 A;  5C4W A;  1WLD A;  4QDQ A;  4YGE A;  4WZC A;  4QU2 A;  4CDX B;  2C6S A;  4PDW A;  2QNK A;  3UET A;  1OKQ A;  1WCD J;  4IES A;  1JMU B;  4OI2 A;  1K45 A;  3PTY A;  2RHP A;  2RDS A;  2AEY A;  2VOK A;  3CDZ B;  4OQ8 A;  2OUJ A;  1W6Q A;  5FWE A;  1GWM A;  2QQP A;  3ELN A;  3MBW A;  2JB8 A;  3ZN4 A;  3HEI A;  3VBU B;  1S0D A;  2XG3 A;  1SBD A;  3OBR A;  2B8M A;  1NOV A;  4QPG A;  4AI1 A;  4YVS C;  3KT7 A;  2Y26 A;  3NVC A;  3HAG A;  2HWF 2;  1DGW A;  1Z78 A;  5AVP A;  4CDX C;  1RUN A;  2OW4 A;  4XXP A;  3NNJ A;  3AJZ A;  5JIA A;  4MGT A;  1GZW A;  3HT1 A;  3VD9 A;  5GLZ A;  4DO0 A;  1EY2 A;  2EXK A;  1O4Z A;  5F6L B;  1D7P M;  2L9L A;  2AUY A;  2Q30 A;  1A3K A;  5F3I A;  2HEW F;  2R0H A;  2RDN A;  3ZPO A;  3K51 A;  2FDG A;  2B7Y A;  2WAA A;  2J1V A;  1N47 A;  2Q1M A;  4HVO A;  3JQX A;  1A8M A;  1WMD A;  3KF3 A;  1RUI 2;  5L9V A;  1PO2 1;  2J1U A;  2H0V A;  1LKN A;  1TE1 B;  2A71 A;  4PLM A;  3M3C A;  4NRO A;  2IZW A;  3OY8 B;  5FZI A;  3AJY A;  4UOJ A;  2E6V A;  1QXP A;  4I3P A;  3VBF A;  1BK0 A;  1WCK A;  3IDA A;  1HN1 A;  5JVV A;  4JGY A;  1FMD 3;  4E2S A;  5LRS A;  3KHC A;  1EAH 1;  5FIX A;  1D4M 2;  4LO5 B;  1X50 A;  1PO1 3;  4L8Q A;  2XBO 3;  4ZXE A;  1UY3 A;  3CJX A;  4Q27 A;  1SLC A;  3ZR6 A;  3SKV A;  5FFO C;  3B94 A;  1H4G A;  1VRH 3;  2ZS6 B;  5FPU A;  3VBU A;  4Q0V A;  4HLT A;  1K42 A;  4XUO A;  3QAC A;  2V09 A;  3K75 B;  1AYN 1;  3ROU A;  1V70 A;  1TMF 2;  2Y6L A;  4YG6 A;  4XF0 A;  4BMB A;  3WCS A;  3M1H A;  1RVF 2;  4IV1 A;  4K6B A;  3WD5 A;  3E6B A;  5I0S A;  2ZEY A;  1YFW A;  5IUQ A;  3CO2 A;  1C1L A;  2RS3 1;  2AGS A;  3OGJ A;  4PDW B;  5CFC A;  3MPB A;  3S6P A;  4CP1 A;  2BFU L;  4AED C;  5A32 A;  3DPR A;  3RSJ A;  2ARC A;  4K3U A;  5FZG A;  2RR1 1;  1KGY A;  1COV 2;  3POB A;  3O1S A;  3AZZ A;  3MFA A;  1H1I A;  2RS5 2;  3OGR A;  3GYD A;  3RG0 A;  1HB4 A;  4ATF A;  2QQN A;  3C8X A;  2ZGN A;  2XJP A;  1HV0 A;  3OPT A;  1M06 G;  2FDJ A;  3AL5 A;  4Y1Y A;  4Y4R A;  4CCO A;  1QWR A;  2LS6 A;  3POY A;  3LFI A;  4OZO A;  3HJR A;  5FZ4 A;  2WKK A;  3WVJ A;  3ZO0 B;  5BUV A;  5JXG A;  2WN2 A;  5F2W A;  4CCJ A;  2D5F A;  4LTA A;  4XUR A;  3GM8 A;  4P9Y A;  4RR3 C;  4LUK A;  4IV3 A;  2WJS A;  2FD8 A;  5F32 A;  3HNB M;  5GKA C;  5J48 A;  5HCA A;  3IM0 A;  4ARY A;  2DVF A;  5FJK A;  3Q8C A;  5CAZ A;  1FYU A;  3MV1 1;  4QQO A;  3FLP A;  4HZF A;  2JG8 A;  4XFG A;  1UOG A;  4LBN A;  2WNV B;  4Y4Y A;  1PVX A;  2ENR A;  2VW1 A;  5EFU A;  4RGK A;  1PGW 1;  4IEZ A;  1XYO A;  1AR7 2;  4M3C F;  1VBC 2;  2OUH A;  1FT9 A;  2BJS A;  1GSL A;  4OUE A;  2QKD A;  1D2Q A;  1PX4 A;  1W03 A;  3MEP A;  1GNZ A;  2DFC A;  4QWN A;  2TUN A;  3VBR B;  3IAQ A;  4AHY A;  4MGK E;  4XTP A;  3V0A A;  1YI9 A;  1D2S A;  2ARE A;  4JGZ C;  4YG3 A;  5EYX A;  4LPL A;  1X7N A;  3BYW A;  1C8M 3;  2RS5 3;  3D6E A;  1JBC A;  3RJ2 X;  3O1P A;  5FPX A;  4V1P A;  3HN3 A;  4BOW A;  2JG9 C;  2YYO A;  3V65 A;  4JDN A;  3HMY A;  4UBH A;  5F8P A;  1W0P A;  2ILM A;  4QXC A;  1A8D A;  1VBA 3;  1AX1 A;  4XUN A;  5FZB A;  3WNL A;  5ERL A;  1DYP A;  4XF4 A;  3WNO A;  2D6N A;  5FYS A;  3HQU A;  2XH6 A;  4CP9 B;  3ZFE C;  1DGR A;  1SLI A;  1TG7 A;  2VM9 A;  4Q4V 3;  2HWB 3;  5LAT A;  4IEW A;  2JE9 A;  4GWJ A;  3ZMO A;  3DXT A;  4AGR A;  2JE8 A;  2QJV A;  4MGQ A;  5D2A A;  5IVC A;  5A3T A;  2ARX A;  2QQU A;  2X53 S;  1QNW A;  1NCR C;  2BOJ A;  1POQ A;  2ZAB A;  5F3C A;  3KVB A;  1BEV 2;  3U75 A;  1CAU B;  2NLR A;  4GKX A;  3I3B A;  3ZXA C;  5A3L A;  3ACH A;  2RJK A;  4FFI A;  4DRV A;  1UZW A;  2D3S A;  1WMF A;  4XDP A;  2UYA A;  3ZDS A;  4I30 A;  4ET7 A;  2NQY A;  4OVE A;  4QX8 A;  2DWR A;  5GLW A;  1RYY A;  4XAB A;  4FFG A;  1S0I A;  2YGL A;  2WII B;  3VGI A;  4F3J A;  1DQ5 A;  2PTM A;  4R9C A;  1XNA A;  1SFN A;  1Y43 B;  3RNS A;  4CSW A;  4I09 A;  1UZV A;  3M3Q A;  3MYX A;  4RHV 1;  1MZE A;  4F7Z A;  2OZJ A;  1YC6 1;  3FN9 A;  1KJR A;  2G4I A;  5FP8 A;  2P6H A;  1RUD 1;  3RZZ A;  1VBC 1;  4D6R A;  4Q4W 3;  1PGW 2;  1WD4 A;  2PEL A;  2JWP A;  1DQ6 A;  2Z69 A;  5T5P A;  4XMI A;  3MFC A;  3N7M A;  3ZFG C;  2QDN A;  3NKT A;  1HB1 A;  1SCS A;  2R04 2;  4QAW A;  5F7U A;  2BFU S;  3B9C A;  3WQB A;  4RGA A;  1SBE A;  3BTZ A;  4AFD A;  1Y9M A;  4CEY A;  1PHM A;  2P6C A;  2R04 3;  4GMP 3;  1UYP A;  4W65 A;  5EJ1 B;  1Q43 A;  5EJ3 A;  2HWD 1;  1RXF A;  1US2 A;  1YNA A;  4FAH A;  2B39 A;  2XHN A;  2XUE A;  2YBK A;  5JOZ A;  4JC1 A;  3O1M A;  1IPJ A;  3AKR A;  4XAA A;  1WKY A;  4LUL A;  4WM8 A;  1K5M A;  3WW2 A;  1IPS A;  3FL7 A;  5FZA A;  2XJU A;  1SLT A;  3EQE A;  5C3S A;  1W05 A;  2JDK A;  4LLO A;  5JZG A;  4YM1 A;  4QHZ A;  4YVW B;  1WW6 A;  3WDT A;  1UOJ A;  3RYR A;  4HFS A;  1DQ1 A;  1UNB A;  3ZSK A;  5A3O A;  2WIN B;  4LK7 A;  5C8C B;  2Q5T A;  1RUF 1;  1NUK A;  2VW0 A;  2VOX A;  3ON7 A;  5IAT A;  1WLT A;  1FOD 3;  5I8T A;  1J83 A;  1NQJ A;  4LA3 A;  1ZRD A;  2WBK A;  3VBH A;  4GH4 C;  5L36 A;  1FPN 2;  2YGM A;  5BPX A;  4QT6 A;  3THP A;  5BNN B;  4IEY A;  2PHR A;  1GBG A;  3CJI A;  3KT1 A;  2QQI A;  2CDP A;  3LEG A;  4IV1 C;  3OYW A;  4XFH A;  4OHY A;  1LJ7 A;  3AZX A;  1OVP A;  4QXH A;  4RS5 B;  4AFC A;  1EUU A;  5EQU A;  3IPV A;  3O1V A;  5JMO A;  4XIL A;  1G7Y A;  2BZD A;  2BUK A;  3OSD A;  2DYC A;  3NV4 A;  1CZV A;  4DXS A;  5FZH A;  2WZ8 A;  4ATE A;  4CA9 A;  2OVU A;  4ASM B;  1QKQ A;  2EXI A;  4YNI A;  1KIT A;  5E16 A;  1LOC A;  2BGC A;  4JQT A;  2DUR A;  3OTF A;  2W91 A;  2ORX A;  4BA6 A;  3I2F A;  3WDU A;  4KMQ A;  2KD7 A;  2AC1 A;  1PVC 2;  1F5J A;  2WRA A;  1VR3 A;  5DAV A;  4M0H A;  4XIO A;  3TN9 2;  3ZFE B;  3LA7 A;  4HMZ A;  4COZ A;  4LEJ A;  4H14 A;  3POG A;  4OQ9 A;  3C7E A;  3TNP B;  1SBF A;  4BXF A;  5FYY A;  5LCW L;  2Q4S A;  2Y6F A;  3O0X A;  3OG2 A;  2QQM A;  1W8T A;  3C2U A;  5A7O A;  1O6U A;  3JBG 3;  3VLB B;  4JTO A;  4LQR A;  1ENR A;  4M3C B;  4CUB A;  2ARB A;  2NPI A;  4AXO A;  1OD3 A;  2A6V A;  5LB6 A;  1QDO A;  1LAJ A;  1YO8 A;  4AVA A;  1KXG A;  2WAB A;  3VBF C;  1U0A A;  3HR9 A;  3LIH A;  3URF A;  3EO6 A;  1C8N A;  3L2Y A;  4ZS3 A;  2WZE A;  5FZ6 A;  5J98 B;  1UY2 A;  3LSD A;  1DYO A;  2HWF 1;  2EA7 A;  1CON A;  5JSR A;  1BHG A;  2F17 A;  2VXJ A;  3B01 A;  4UFJ A;  1VBD 1;  3MID A;  3RZM A;  4DOU A;  3FZ3 A;  4IGQ A;  3DYM A;  1HQN A;  4NPR A;  1S0J A;  2WLQ A;  2J1A A;  1LNS A;  4XTM A;  3CKH A;  1G9F A;  3QOP A;  4PDW C;  3I59 A;  4ASK A;  4Z2A A;  2JDU A;  1X8M A;  4Q4Y 3;  3B93 A;  3ZKU A;  4GB3 2;  1HIX A;  3O0V A;  3UK9 A;  1F8V A;  3J8F 3;  4XOG A;  2HWC 1;  1CIY A;  3O0W A;  2D3R A;  4Z07 A;  4KWJ A;  1COV 3;  4N7U A;  2PMW B;  2N7G A;  1UXX X;  4YZ5 A;  4NRQ A;  4D7S A;  2PHX A;  2AYH A;  1SZB A;  1OUS A;  4QPI B;  5IVV A;  2J42 A;  4E4Z A;  2GC0 A;  1I1E A;  4O9E A;  1W8W A;  3LB9 A;  1RHI 3;  2V4A A;  2XXZ A;  3VKM A;  2VO5 A;  2GMM A;  2YC0 A;  4UT5 A;  2YZ4 A;  5CKN A;  2VGD A;  4YZ3 A;  4QGN A;  1RUC 2;  3VL8 A;  3DKW A;  4AW7 A;  4PF1 A;  2JG8 C;  4FOY A;  3C7F A;  1U12 A;  4CEY B;  3BB6 A;  1LOA A;  4YLZ A;  1Q8S A;  1CWP A;  4COY A;  3EXU A;  1PMI A;  4BQ3 A;  2ZGP A;  1A6C A;  2UUR A;  3B3Q E;  1R08 1;  3MHZ A;  3P5B A;  4JDO A;  5I0U A;  4OHZ A;  4S2F A;  3V56 A;  5BNO C;  1XSR A;  3BVC A;  1BBT 3;  5FZ1 A;  4CU6 A;  1ODN A;  5CKM A;  1JHN A;  1XC6 A;  3NJY A;  1PZ8 A;  1CR7 A;  3ZSM A;  3NV2 A;  2RDQ A;  3AZW A;  4UW6 A;  2CTV A;  2Y6H A;  3WEZ A;  3KVA A;  2W94 A;  2EIG A;  3WUC A;  5AC9 1;  4AAP A;  2P3Y A;  1O8P A;  3WG1 A;  1QNY A;  4XZU G;  1LOF A;  3P3N A;  1F31 A;  4QGL A;  2IXH A;  5J1X A;  1ENQ A;  3ECQ A;  4N90 A;  1UAI A;  1CAU A;  3FHA A;  2W39 A;  1KFX L;  5FMO S;  5D8A A;  1RUG 3;  2XR4 A;  2GDF A;  3DPR C;  4E4D X;  3IZO A;  3FWE A;  4XXA A;  1VMF A;  2O14 A;  1ZZ6 A;  4RFR B;  1VRB A;  4EWD A;  1OT5 A;  1J3Q A;  1UW8 A;  3R4D B;  2D97 A;  4OHW A;  4A44 A;  4AI0 A;  4QMA A;  3ZVX A;  1E5S A;  5FYM A;  3T1M A;  3VZO A;  3ES4 A;  4HOO A;  4CP9 A;  5BV6 A;  3EMR A;  5C9A B;  4CUA A;  4YPJ A;  3CJI C;  5DPN A;  4GJY A;  1LEN A;  1Q8P A;  2YB7 A;  3VBU C;  4JAA A;  4TWT A;  3WDY A;  1AR6 1;  1S0F A;  5LEK A;  1OXC A;  4OFG A;  5F5Q A;  4FP3 A;  2CGN A;  1CZS A;  3MLJ A;  1HQW A;  2PXJ A;  4Y33 A;  3UKV A;  2MEV 2;  3T2O A;  3WF4 A;  1O4T A;  3GZT B;  1RL3 A;  1W2U A;  4ZS2 A;  5IK7 A;  3ASI A;  1RVF 1;  4CCM A;  2PHF A;  1TMF 1;  1L7Q A;  4C1X A;  3IN9 A;  1AYN 2;  4JKL A;  2W46 A;  4K21 A;  5FP7 A;  4Q8K A;  2FHR A;  2RJ2 A;  4Q4V 2;  1PNG A;  1QJU 1;  3PVE A;  5G05 L;  3C7H A;  3BPS A;  4PI2 A;  4FPL A;  2PHU A;  2A6W A;  2DU1 A;  4MH0 E;  3UES A;  4OZX A;  4EYU A;  4P9J A;  1NLR A;  3ILN A;  2TEP A;  5JR7 B;  3T3Y A;  5IK8 A;  3A23 A;  2WNV A;  2AEZ A;  5EXO A;  2ZGO A;  3HPN A;  4FPJ A;  3UGH A;  4BCU A;  4LBO A;  4Y22 B;  5JOX A;  4QHB A;  5FTT C;  3POS A;  3WR0 A;  1W9S A;  1HJF A;  5JUV A;  3GJB A;  3KMH A;  5CBL A;  1IOA A;  1AJO A;  1TME 3;  5CIR A;  4QPI C;  1K5J A;  2B9V A;  1UPI A;  2VMI A;  3WDW A;  1B35 B;  2MEV 3;  5I91 A;  1OFS A;  3T2Q A;  1PGL 2;  2ZGM A;  1DF0 A;  5E8A A;  3ZFE A;  2VNO A;  1QF3 A;  3H8R A;  5J09 A;  1AHS A;  2HEY F;  5FMB A;  3ZYG A;  1BJQ A;  3I3D A;  2HWC 2;  3AFG A;  3BTX A;  2R32 A;  1AL0 G;  4CXX A;  3OUJ A;  1UMZ A;  1W6P A;  1ND3 C;  2YDE A;  5A70 A;  3WW4 A;  4R4Z A;  1OH3 A;  1W8F A;  2A5Z A;  1VBB 1;  5GZD A;  5FXV A;  3FLR A;  2WWS A;  4LBQ D;  4I2O A;  1QQP 3;  4CXY A;  2CY6 A;  3GXU A;  5A3W A;  2P34 A;  1QJX 1;  2E31 A;  4QX3 A;  3W59 A;  4KI5 M;  4B4R A;  1F4A A;  3VV1 A;  3IPV B;  4AQS A;  1OQD A;  5IHR A;  1AF9 A;  2DUQ A;  2VQT A;  1RTV A;  2Z2S B;  2ZAA A;  3U11 A;  3RWK X;  1MPX A;  3A0N A;  3ORJ A;  3K4A A;  4OUM A;  2LAL A;  3VBH B;  1RGS A;  3KV9 A;  4I0B A;  3MIC A;  3OEA A;  2FCU A;  1ZRI A;  4XET A;  5DN2 A;  3U1X A;  4EV0 A;  1CJD A;  5I93 A;  3AYA A;  5BNP B;  1HRV 1;  3R4S A;  1S2K A;  4FPO B;  2ZHM A;  3RS6 A;  1AYM 2;  5D21 A;  3III A;  2VUD A;  1LGB A;  2XHK A;  1J3P A;  5FPZ A;  2RS1 1;  4Y1V A;  3N35 A;  3C3V A;  1W8O A;  5JZG B;  4PT6 A;  3JD7 2;  2BP6 A;  4HN1 A;  5FY9 A;  4RR3 A;  1MQT A;  2DVG A;  1IQD C;  3OBT A;  4WM8 B;  3MDP A;  3B00 A;  2VAU A;  3UV9 A;  2G9F A;  5D8A C;  3TN9 1;  2CDO A;  4YM3 A;  4E2Q A;  2XML A;  5ACA 1;  5CG9 A;  4WM7 C;  2O8O A;  5FZO B;  1PVC 1;  5BNP A;  1HXS 1;  4CVU A;  4XQW A;  2RMU 2;  1VBE 2;  4DQA A;  1ULP A;  2QQO A;  3POW A;  1UD1 A;  4EN0 A;  3N9P A;  3O14 A;  2XL9 A;  5F1R A;  2IUW A;  4LIU A;  1YHF A;  1PK6 A;  5JIU A;  5FXW A;  5LY2 A;  5LBF A;  1UIK A;  1H2N A;  1AVB A;  1JTZ X;  5EIY B;  5E1R A;  5FY0 A;  4IGP A;  4QPG B;  2GN7 A;  3DN7 A;  3AP7 A;  4G3Y C;  4AEK A;  5FCC A;  4AFB A;  2DVA A;  4AGV A;  3S57 A;  4BJ0 A;  3AX4 A;  3JD7 3;  1F15 A;  2BYV E;  2V72 A;  4RS5 C;  2YU2 A;  4ERO A;  4ZZ8 A;  3AVR A;  4KU8 A;  3OPW A;  3ZYP A;  1AL2 3;  4ISQ A;  1ASJ 3;  3WDV A;  5FOJ B;  4IQP A;  2Z4F A;  4I3G A;  2W1Q A;  2YC4 A;  4MO3 M;  4YG0 A;  1JYN A;  2V5D A;  2MNG A;  2PLV 3;  5GJ6 A;  1G86 A;  4B1L A;  5A1L A;  1VAM A;  1AR6 2;  4FPY A;  4L0P A;  4TSV A;  3H0O A;  1EV1 3;  1TQ5 A;  2AH2 A;  2GAU A;  2JDM A;  3BOW A;  2LM3 A;  1MS3 A;  3RZJ A;  1V9U 2;  3CU7 A;  3OGG A;  3CL1 A;  4NPL A;  4GWI A;  5FUI A;  4UW3 A;  4AR2 A;  4B1M A;  2A1X A;  1POV 3;  1QJY 1;  4Y26 A;  3D3A A;  1JZ3 A;  4AVB A;  4LBM A;  4TN7 A;  3ES1 A;  3TEZ A;  1VIW B;  1QGL A;  5GZF A;  2BBV A;  1HKD A;  2E7A A;  1US3 A;  2FBE A;  4KU7 A;  1JZ6 A;  1DYK A;  1PM4 A;  2HWD 2;  1NCR A;  4Z92 B;  1CAW B;  2J22 A;  1UZZ A;  4I0A A;  1DU3 D;  4V2V A;  5KHH A;  4CCL A;  5BYN A;  2FDK A;  3QD6 A;  4IER A;  2RJL A;  1BMV 1;  4I02 A;  1YQC A;  3DUI A;  4K7J A;  2KXL A;  5FV3 A;  4C0H A;  4Q1P A;  4ARX A;  3VDD C;  4UW5 A;  4BE3 A;  3ITQ A;  4MHR A;  5FOB B;  1OH4 A;  2IFR A;  4NO4 A;  1S4C A;  2P5B A;  4A3Z A;  4NHY A;  1Y4W A;  3ZYF A;  3LE0 A;  4JX0 A;  5DDJ 3;  2BBA A;  5KHG A;  4QX1 A;  3AMN A;  2BWA A;  4W4Z A;  5B4N A;  5C7G A;  1UF2 C;  1QJZ A;  2HWE 1;  2XOM A;  1TNR A;  1OOP C;  1UZ0 A;  2Q0A A;  3NST A;  3FUO A;  3N3H A;  5H9S A;  4YZ1 A;  1QJE A;  4JQR A;  3UKN A;  5DZG A;  1OUR A;  1SCR A;  3B02 A;  2BVB A;  2O8Q A;  5BNO B;  2D93 A;  2VCC A;  1NKG A;  1PMJ X;  5F2S A;  4QKB A;  1WW5 A;  5ABJ A;  4BM8 A;  2IXC A;  2ZAH A;  2XPJ A;  5GLU A;  5EYY A;  1ZRF A;  1UU6 A;  2RV9 A;  1QHD A;  4YGC A;  1GP5 A;  3I2D A;  4CCN A;  3W5N A;  4LBQ B;  2W5F A;  1IZ3 A;  3GGL A;  4UFK A;  1WA4 A;  1Q8O A;  3UL2 A;  1NCR B;  1RUC 1;  3T1L A;  4E8C A;  3V0B A;  4QB2 A;  4MG2 A;  3SH3 A;  4AI3 A;  3VN4 A;  1CJP A;  1AR9 2;  4QKF A;  3RI9 A;  1BXH A;  3ME2 A;  4IE4 A;  1DLC A;  3I2J A;  4OI4 A;  2P4E A;  5FXZ A;  2Z79 A;  2R06 1;  3PJY A;  1MEC 3;  3RFR A;  4A7Z A;  1GP4 A;  2ADE A;  3SEE A;  1LHN A;  2WNO A;  4L97 A;  3R0R A;  2C5D A;  1F4H A;  2XVG A;  2VTX J;  1MS0 A;  4LIT A;  4XE9 A;  3KV5 A;  2VZU A;  2HEV F;  2YC2 A;  4FOW A;  2VUA A;  2W92 A;  1UIJ A;  2JIG A;  2W1U A;  3CZJ A;  2I45 A;  2CYF A;  2ZML A;  4M4P A;  5A32 B;  3U07 A;  2ZCW A;  5KXB A;  1Z7S 2;  2WAO A;  3W20 A;  3WF1 A;  5FO8 B;  3HNY M;  1W9F A;  2C24 A;  3RYP A;  3OBA A;  2Q1Z B;  3GF6 A;  1XE7 A;  3LCP A;  1V00 A;  1LED A;  1OC1 A;  2GSY A;  4WVZ A;  4NPM A;  1PK6 C;  3PHM A;  3S5A A;  1OSG A;  1DDL A;  3MGU A;  5J7M A;  2BNO A;  2EAA A;  2VZ1 A;  3POE A;  1AR7 1;  3LPG A;  4XFF A;  1V6J A;  2B45 X;  4PIX A;  1RUG 2;  1DLL A;  5FZ9 A;  2Y38 A;  1QOS A;  4AL9 A;  1RMU 1;  4TYS A;  5F9T A;  1PK6 B;  4ASL A;  3E5X A;  2QE3 A;  3ETP A;  4XJ9 A;  2BER A;  1T2X A;  3SH4 A;  2XDV A;  3VBF B;  1UL9 A;  1YJK A;  2Z42 A;  3MLK A;  5DG2 A;  2VBB A;  4BIS A;  3K77 A;  4WM7 A;  3JZV A;  4Q4W 2;  4BQX A;  3E6C C;  3W58 A;  2WWU A;  3E6D A;  1JYW A;  2WZR 3;  1RUH 2;  2GP5 A;  2NYY A;  5HI0 A;  3KWV A;  5JPM B;  4UF0 A;  4RGG A;  5C6C A;  3NAP C;  4WV8 A;  2GU9 A;  2YHJ A;  4W8J A;  4IDZ A;  2VMG A;  4EZH A;  5IAX A;  3H8X A;  4B7K A;  4P9W A;  4ZU7 A;  4Q26 A;  3VZM A;  2J1T A;  1Z7S 3;  4D8M A;  3HBZ A;  1W0N A;  1GZW B;  1N3Q A;  4A2U A;  5KXD A;  4LJH A;  2ZA9 A;  3BOD A;  1WZX A;  4DMI A;  2R07 1;  3LQC A;  3ZSL A;  2ATF A;  1RJ7 A;  3RVH A;  1UYY A;  1NXM A;  3DV8 A;  3BIE A;  4B29 A;  4C90 A;  1GZT A;  5HXV A;  4FOV A;  1W9Y A;  4UWD A;  5L19 A;  2VD7 A;  1BCX A;  2IVI B;  2WT0 A;  4UAP A;  3S7E A;  2A3W A;  1GNH A;  2ADD A;  5FKC A;  2VOT A;  5ANN A;  4ZON A;  4HSJ A;  2HJI A;  3MLL A;  3CEW A;  2BOI A;  1RUE 3;  4KWK A;  1OA2 A;  4QKN A;  3RPQ A;  4DS0 A;  3BUC A;  2WFF 1;  5FLJ A;  4XC9 A;  1ZBA 3;  1LGC A;  5EV7 A;  2WSV A;  4PLN A;  1DHK B;  2VMF A;  4DPN A;  4YAR A;  1HLC A;  1UZY A;  1MS1 A;  3ALQ A;  1HXS 2;  4HBN A;  4KG0 A;  4QDR A;  5FBJ A;  2FZ2 A;  2GNT A;  1CPM A;  2J1E A;  4QD2 A;  3K46 A;  2Y6G A;  4NHM A;  2CGP A;  4MXW B;  3I7D A;  1ULD A;  3F95 A;  3D0J A;  4OHV A;  1HRI 3;  3NJZ A;  5A6Z A;  1KDK A;  1O4Y A;  2FMD A;  4I01 A;  3VDC A;  1RUH 1;  2W1S A; 
#chains in the Genus database with same CATH homology
 4NMI A;  3EMR A;  5LB6 A;  2RG4 A;  4NHX A;  2Y33 A;  4XCB A;  3HQR A;  2JIG A;  3OUI A;  3NNM A;  3OBZ A;  4XAB A;  5LBF A;  3W20 A;  5L9B A;  5M0T A;  5EP9 A;  4NHK A;  5A3U A;  3MGU A;  2JIJ A;  5HV4 A;  5DAW A;  4BQY A;  4MHU A;  5DAX A;  4Y5T A;  4BQW A;  4Q5O A;  2RDR A;  4J25 A;  2G19 A;  5EPA A;  5IAV A;  4XAA A;  2A1X A;  4BQX A;  5L9R A;  3GJA A;  4NHL A;  5LBE A;  3GZE A;  3GJB A;  2FCV A;  2V4A A;  4ZPI A;  2HBU A;  5C5U A;  4JZR A;  4KBZ A;  2Y34 A;  5IAX A;  2G1M A;  5LA9 A;  2OPW A;  5IAT A;  3ITQ A;  3OUJ A;  4MHR A;  5HV0 A;  4XAC A;  3KT1 A;  4Y5S A;  4NHY A;  3KT4 A;  2HBT A;  5LAS A;  3BVC A;  3W21 A;  5C5T A;  2RDS A;  5EQU A;  2RDQ A;  4UWD A;  4ZON A;  3OUH A;  3KT7 A;  5LBC A;  3PL0 A;  4XC9 A;  4IW3 A;  3NNJ A;  3NNF A;  2FCU A;  5DAV A;  4NHM A;  5ERL A;  3NNL A;  2RDN A;  3HQU A;  3DKQ A;  4XCA A;  5LAT A;  5L9V A;  4NAO A;  5DAP A;  5LBB A;  5DAQ A;  2FCT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...