3OVNA

Fragment-based approach to the design of ligands targeting a novel site on hiv-1 integrase
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
152
structure length
143
Chain Sequence
SSPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACDWAGIKQEDGIPESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGGIGGYSAGERIVDIIATD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords POL polyprotein
publication title Fragment-based design of ligands targeting a novel site on the integrase enzyme of human immunodeficiency virus 1
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein/transferase inhibitor
total genus 52
structure length 143
sequence length 152
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-09-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3ovnA00
1VSFA 1C1CA 5J1EA 3VA3A 4FCYA 1B9FA 1S1VA 4CERA 3JSMA 1R0AA 4N76A 1SKRA 1ASUA 4O4GA 1RDDA 2FC0A 4WE1A 4DTJA 1HNVA 3RTVA 1IG9A 2G8FA 3L8BA 2A1RA 3ZT0A 4RW4A 3LALA 3CM5A 1VSJA 3KKSA 3HVTA 4IDKA 3CG7A 3O4QA 2P51A 1ZBHA 4DQRA 1JL2A 1KFDA 4W5NA 4NCGA 3AVFA 3THVA 1J54A 2KFZA 1U04A 3OYKA 4DQIA 4DFPA 1VSIA 4CEBA 1LWFA 3M8SA 1CZ9A 1JLQA 3G0ZA 4MFBA 3ZT4A 3OYIA 3DOLA 3HSTB 3TAGA 4M3UA 1NK7A 4B9NA 1HYSA 4FLUA 4FK4A 1TKTA 3CFRA 1QSLA 1ZBFA 4OJRA 4DSIA 1FKOA 3NGZA 4OGEA 1TL1A 3OYBA 3VQQA 4FLWA 4LD0A 1WN7A 4DQQA 1T7PA 2A1SA 4BDZA 1XHZA 2JGUA 2YKMA 2GBZA 4HUEA 3TWHA 3WNGA 3VQ6A 4K8ZA 1ASVA 3NGIA 3OYMA 3V1QA 3K58A 4DFJA 2QXFA 2B5JA 4CJWA 2ZQBA 4CJRA 3V9ZA 1RT3A 3ZT3A 1S1WA 4DFMA 2W42A 3ALYA 4H8KA 5DMRA 3OYLA 4KTZA 1HJRA 2IDOA 4HHTA 4PWDA 4E3SA 3QNOA 1L5UA 3DRPA 4O55A 3TAQA 1JLGA 1C0UA 1JLBA 4CFAA 1ZBLA 4DSKA 4CGDA 4CF2A 3V9WA 3SPYA 4FZXC 3CFOA 3VQCA 4FLZA 4HVJA 4B3OA 3LP1A 1BI4A 3T3FA 4N41A 4E7JA 2G8WA 3S9HA 4IFVA 2OPQA 4PUOA 4DQPA 3MEEA 1RILA 2EHGA 4FW2A 4NYNA 4DF4A 4M3ZA 1SUQA 2KQ2A 1NOZA 3ZSVA 4KPYA 1NOYA 3LPUA 4CJ4A 1LWEA 3SUOA 3SNNA 3MXIA 4HUGA 1X9MA 1C6VA 3V9UA 1D9DA 2X6SA 4PQUA 4CIFA 4OKKA 4CGJA 2F8TA 3AA3A 1WSFA 4CF8A 2OA8A 3DYAA 4CHZA 5SZTA 1HYZA 3I0RA 3ITHA 2XY7A 1NK6A 1X9SA 3WNEA 3SZ2A 4FJXA 3K5OA 4FJJA 4OLBA 3OYHA 3DMJA 4RG8A 5KI6A 3S3MA 3IRXA 4N56A 2FBYA 1VSHA 2OPRA 3AVGA 4BE2A 3PO4A 4FJNA 3ASMA 2HVHA 1Z25A 3K5MA 1DTTA 3LZJA 1NKCA 4Q0BA 1RDCA 4MQ3A 2IAJA 4RW8A 4LSNA 1LAVA 1UAXA 4CEDA 4CFCA 4O0JA 2OPSA 1A5VA 4J2DA 1SL2A 4E89A 1RDAA 1VSKA 3IS9A 1BCOA 4KO0A 4F3OA 4J2EA 4DTUA 4I7FA 2G8UA 1WAJA 4RW9A 2YHAA 4Z0UA 1Y97A 4DLGA 4KB1A 4E19A 3OYJA 3AA4A 4F3TA 3HVRA 4R5PA 3AVNA 4E7IA 3LPTA 1JLAA 3V4IA 1Q8IA 1SL1A 2KFNA 4CCHA 4FLYA 1SV5A 3ZSXA 4AHTA 3QEXA 3TABA 1WAFA 3AVMA 2E6MA 2ZE2A 4CHYA 4B08A 2QK9A 1A5XA 1VK0A 1B9DA 4CEEA 3LANA 3NGYA 3H08A 1QE1A 4H4OA 4M3WA 3HXMA 4CJ3A 3DM2A 1B92A 1HYVA 1S6QA 3AO2A 5T7BA 3KLGA 1ZBUA 3G10A 2YNFA 3AVHA 1BI4B 4CEQA 3RWUA 4FK2A 4CESA 4KHQA 4OLAA 1RBSA 2RN2A 2HB5A 4LSLA 4OPJA 1S1TA 2Q3SA 3RMBA 1J5OA 2HHXA 1KSPA 4DSEA 1XC9A 3VQ5A 3S3NA 2PYLA 4KTQA 3K5NA 2BGGA 4DU1A 4B9TA 1S1XA 1TAUA 3NFAA 4LH5A 4DSFA 1S6PA 4DU3A 1IKVA 4HCBA 4B9SA 4KB0A 4FJIA 4CJSA 3V9SA 1HQEA 3K2PA 2E6LA 3K59A 4C8KA 1EETA 4IBNA 5CYMA 1VRTA 2KW4A 3WNHA 3V6DA 2VWJA 3DLRA 1LW2A 1FKPA 3VQ4A 3VQ8A 4E7LA 4FM1A 4KHNA 3RMAA 4KTWA 1UA0A 5FDLA 1WNSA 4EZ9A 2XO7A 3QERA 1KTQA 2QKKA 2BE2A 2E4LA 4DS4A 2WONA 1REVA 3QIPA 4M3YA 1UA1A 4CGIA 3O3HA 1TKXA 3AO1A 3F9KA 4CFDA 5I42A 3BDPA 4M3TA 1HRHA 1FXXA 3OS2A 4CJUA 2G8KA 2KZZA 3TARA 4O0IA 3AO5A 2O4IA 4AH9A 4CJTA 1TK0A 2IOCA 1XHXA 2VG7A 1BQMA 3DLEA 1N6QA 4FYDA 3TAEA 1CLQA 4AHCA 3DRRA 1IKYA 3O4NA 3L2VA 3K5LA 1D5AA 3AVBA 4BWJA 4BDYA 1BCMA 4B9LA 4EP5A 2R7YA 3NAEA 3AVLA 3OVNA 1C1BA 2JLEA 4IG0A 3KLFA 3SV4A 4DSLA 1VSDA 5J2MA 4F2SA 5C24A 1TKZA 4KKOA 4DTXA 4DTNA 4Q5VA 1RT1A 5EU7A 3LP2A 4NCAA 3VQDA 4Z4IA 4ZHRA 4FZZA 1NJWA 3NHGA 4BDPA 3VQ7A 2OZMA 4FJ5A 4PA1A 3L2RA 3NH1A 1KVBA 3OYDA 3PX0A 4M42A 1RBTA 4IG3A 4OPKA 4KHUA 1DTQA 4AHUA 1I3AA 3V9XA 4CHQA 5HP1A 4NCBA 3AO3A 1BL3A 1KVCA 3AVIA 2XRIA 4CJPA 4E7HA 4ELUA 4FJ8A 3U3YA 2LSNA 4AHRA 1O1WA 1TVRA 3OYFA 1WSHA 1QTMA 3RR8A 2Z1GA 4ICLA 5DK5A 3NDKA 1T05A 4M3RA 1U47A 1CZBA 2IGIA 3OS1A 3SQ0A 3V1RA 1NK5A 4F2RA 4E0DA 3EZ5A 1RT7A 3HYFA 3ZSRA 4FLVA 4YFUA 1QSSA 3I8DA 3EY1A 2DFHA 3ZSZA 1RT2A 1BQNA 3CQ8A 1QHTA 2G8IA 1U4BA 4KV8A 2I5JA 1QQCA 1UOCA 1K6YA 3DRSA 3KKRA 4E7KA 4I9LA 2DFFA 4YNQA 3OS0A 3HO1A 3KK3A 4CGFA 4E1MA 3QESA 3QO9A 5FRMA 2YV0X 2ETJA 2D0CA 4BWMA 2RKIA 3LAKA 3LZIA 4FW1A 2YKNA 4NYFA 3WNFA 3VA0A 3CYMA 3D45A 2VG5A 3ISNC 3TAPA 4M3XA 3QIOA 3AVJA 2D0AA 4OKEA 2AJQA 4RW7A 2B6AA 5KGXA 2ATQA 3FFIA 3EYZA 1GOAA 4TSXA 1L3UA 3IAYA 3L2WA 2BANA 3NF9A 1VSLA 4CIGA 3OYEA 1JLCA 1S9GA 2ZD1A 3K57A 3MAQA 3V1OA 3AVKA 1RBRA 4ELTA 1WSJA 4BACA 3SJJA 1JLEA 1S9EA 3DLKA 2BDPA 4GMJB 4ZTJA 4I9QA 1N5YA 1HQUA 4C8NA 4DTRA 2HW3A 3AA5X 1S1UA 1KLNA 5KRSA 3SUPA 2X6NA 3NH0A 1EXQA 2YHBA 2HHTA 1J9AA 3PV8A 4DS5A 4EP4A 4DFKA 3A2FA 4DSJA 4PY5A 3AA2A 3KTQA 5CYQA 2HHWA 5HRRA 1SL0A 1KFSA 2Z1HA 1HPZA 3AVCA 3OJUA 1X1PA 3QNNA 4HUFA 2VG6A 4HTUA 3AVAA 1TGOA 3SQ2A 3KD1E 2DY4A 2HHUA 1KLMA 3QINA 2PZSA 4KHWA 3V81A 1RDBA 1TK5A 1X9WA 3ZSQA 2EX3A 4CF0A 2Y1JA 1SKWA 1IO2A 1RCHA 4B8CA 2VWKA 5HRNA 3TAFA 5JS1A 2PY5A 4CGHA 1J53A 1Z26A 2WOMA 3P1GA 5HBMA 4KI6A 1JL1A 1EX4A 1LWCA 4KI4A 4CK1A 4CJ5A 2KTQA 4FLTA 4OVLA 2P5OA 1SKSA 2YNHA 3SQ4A 2FBTA 1WSEA 5FROA 3ZT2A 4CF1A 2FBXA 3LWLA 3B6PA 3NCIA 5JS2A 4BE1A 1NKEA 1RT6A 4CJKA 1RTIA 3L2UA 3KD5E 5CZ2A 2XY8A 5K14A 2DFEA 4CEOA 1L3SA 3ZSWA 4W5QA 1TV6A 1RBVA 3HPHA 5KGWA 1KVAA 2YNIA 3LWMA 4ID1A 4ZTFA 1NJZA 2HHQA 1ZYQA 3NF7A 1TAQA 3LP0A 4DWIA 1RT4A 4FJMA 3HM9A 2YNGA 4KREA 1WLJA 3VQEA 2RPIA 1HNIA 3DI6A 2FBVA 1QS4A 3C6UA 3MEDA 3MXJA 2D5RA 3LP3A 4G1QA 3ZSYA 1BISA 5HRSA 3KLEA 3SUQA 4FJHA 1DLOA 2HNDA 4C8OA 4F4KA 4RW6A 4H4MA 3OYGA 1NKBA 4JRQA 4CEFA 3VQPA 2GV9A 1NK8A 4N5SA 3ZT1A 4AHVA 1MU2A 4EZ6A 4B9MA 3ZSOA 2PYJA 1CXUA 1C0TA 3O3FA 3NE6A 1RTDA 3PO5A 4Z4HA 4FJGA 4CGGA 2F8SA 1U45A 4JRPA 3L2QA 2OYQA 3UIQA 1JXEA 1JLFA 4ID5A 2ITGA 1YTAA 1NK4A 4Z4FA 4OGCA 2IS3A 3RMDA 1ITGA 3DLGA 3NF8A 3O3GA 3TI0A 1L3VA 5CZ1A 2HHVA 3OYCA 3HPGA 3NF6A 4CJFA 4O44A 3OYNA 3M8PA 5HLFA 1LW0A 1CXQA 3KJVA 3L3UA 1Q9XA 2DTUA 4W5OA 4IKFA 4B8AB 1BGXT 1TKDA 4FVMA 1FK9A 1G15A 5SWMA 3KK2A 3AO4A 1U48A 2XHBA 3RMCA 4FXDA 4CHPA 5D3GA 1BIZA 4DLEA 4DTSA 1HMVA 3CM6A 4J2AA 3E01A 4QAGA 1RBUA 4Y1DA 4M41A 3DLHA 2QKBA 4DTOA 3TAMA 4W5RA 1Q9YA 4CF9A 2XY6A 3RR7A 3VQAA 4AHSA 3TR8A 4DG1A 1U49A 1XWLA 1KCFA 3KIOA 4O5BA 3QEPA 3SQ1A 1L3TA 4FK0A 3F73A 2G8VA 4DU4A 3OY9A 1D9FA 3P83D 2RF2A 1T8EA 3QEWA 1GOCA 4CEAA 4JLHA 1RT5A 4W5TA 4DTMA 1LV5A 4FZYA 5FRNA 1F21A 3PX4A 1VSEA 3C94A 4CE9A 1EKEA 3HT3A 4FM0A 3SUNA 2GUIA 5E41A 3HL8A 1XI1A 1NJYA 1TL3A 4CFBA 1ASWA 5HROA 4Z4CA 3CFPA 4FJLA 3M8RA 2D0BA 3QETA 2OZSA 3PUFA 3B6OA 4LY7A 4N47A 3M8QA 3ZCMA 4J2BA 1IH7A 4UQGA 3D0PA 4DTPA 3VQ9A 1NK9A 3T1AA 2F96A 5KTQA 4FJ9A 4JS4A 4HCCA 4OKJA 3S3OA 1LAWA 3P5JA 4CK3A 3SPZA 1TK8A 3QEIA 4FLXA 1QSYA 4F8RA 1C0MA 1S5JA 5J2PA 4KHSA 2HHSA 4XIUA 1GOBA 1BIUA 2Z1IA 1W9HA 5J2QA 2IC3A 2X74A 3BGRA 2O4GA 4I2QA 5HRPA 1EP4A 4GW6A 3RRGA 3PX6A 2B4JA 3C6TA 3HP9A 3IG1A 4IFYA 3U3GA 4E1NA 4AILC 2Y1IA 1WSIA 4FM2A 4KHYA 4CJLA 2OPPA 3TANA 5I3UA 3MEGA 1W0HA 4GVMA 3NH2A 2Z1JA 3VQBA 3U6FA 1VSMA 1BHLA 3HP6A 1IKWA 1JXBA 2HNYA 4DQSA 4QOZB 4KAZA 4B9VA 1WSGA 1YT3A 4BE0A 3HJFA 4DMNA 3SYZA 3SCXA 3KK1A 1D8YA 4ELVA 2HNZA 4CECA 4Z4EA 1VRUA 1JKHA 2KZMA 3OYAA 4C8LA 2HMIA 3ULDA 3SV3A 3HK2A 3AV9A 1RTHA 2NUBA 2G8HA 1IKXA 4QCLA 1UWBA 1I39A 3KLIA 4CJEA 3JYTA 4KFBA 2P5GA 4CHOA 4CIEA 3LDSA 4CJQA 4B9UA 3NBPA 3DLBA 4CHNA 3DOKA 3HPOA 1T03A 3T19A 3PY8A 3MXMA 2P1JA 4C8MA 4Z4GA 4JS5A 4FJKA 2X78A 1NJXA 4K8XA 4I2PA 4LH4A 1YTUA 3C95A 4Y1CA 4DF8A 3LAMA 4FJ7A 1RNHA 1C1AA 1A5WA 3SI6A 1KRPA 5C25A 5J2NA 1RTJA 1ZBIA 4CJVA 4L8RB 3L3VA 4CEZA 3OJSA 3RRHA 2XY5A 3MECA 3VN5A 3KLHA 5KRTA 4CK2A 2HVIA 3QLHA 5CY4A 4KRFA 1YVUA 3QEVA 1NK0A 3I0SA 5C42A 4M45A
chains in the Genus database with same CATH superfamily
4EFHA 1B9FA 4X64K 3JSMA 2QWOA 1ASUA 4O4GA 4WE1A 4DTJA 2G8FA 2A1RA 3ZT0A 4RW4A 2KLAA 2GWKA 5KQDA 3QFPA 4A59A 2ZJQL 1N33K 4W5NA 1JL2A 1OH5A 1U04A 3OYKA 2PBDA 1BDGA 5I9EB 1NGJA 1LWFA 1EWRA 4M3UA 3HSTB 4BR0A 4FOEA 3B8AX 4FK4A 4Z94A 1ZBFA 4H0OA 4YDUC 3VQQA 3UKRB 1WN7A 1T7PA 2A1SA 4HUEA 4DR3K 3NGIA 4FWPA 2HHHK 2AA4A 2QXFA 2FSNA 1NGAA 4CJRA 3BP8A 3KHYA 3VGKA 3ZT3A 1S1WA 2P9LA 4A57A 1YITN 3OYLA 4KTZA 1HJRA 4HHTA 3JS6A 2GELA 3MCAB 1JLGA 1C0UA 4CF2A 4BRIA 3SPYA 4FZXC 1N32K 4N41A 3T3FA 2P9PA 4IFVA 5KQ8A 3MEEA 1NGEA 5LJVA 4DF4A 1SUQA 1LOTB 1NOYA 3LPUA 1X9MA 2HBMA 3V9UA 4CGJA 4JKGA 3HOTA 1RGIA 3E9LA 3DYAA 5M1KA 2XY7A 3I0RA 5JVGL 3SZ2A 4FJXA 3MK6A 3CJCA 1QZ5A 3OBWA 4BRDA 4RG8A 3IRXA 2HVHA 1VSHA 2WTUA 3K5MA 1NKCA 1W97L 4Q0BA 5AQSA 2IVPA 2W40A 1LAVA 4CEDA 1NGFA 2FLOA 4O0JA 1SL2A 3WXLA 3IS9A 2G8UA 4B1WB 4RW9A 3O1WA 4DLGA 1WBBA 3OYJA 4F3TA 1GLEG 3IKMA 3V4IA 4FLYA 4AHTA 2E6MA 4M63C 1A5XA 5HOOA 1B9DA 2E2OA 1NMNA 4YOXA 1U6ZA 4H4OA 3MWTA 2ASMA 3HXMA 5FPDA 1QVGM 3AO2A 1ZBUA 3G10A 2FF3B 2YNFA 3LDOA 1BI4B 2HOEA 3RWUA 4OLAA 1RBSA 1S1TA 3C0BA 2Q3SA 3OBYA 3DAWA 5AQHA 3VQ5A 3EE8A 3K5NA 5AQRA 2BGGA 4WQ4A 4DU3A 4B9SA 3DLLL 4KB0A 4FJIA 4CJSA 3V9SA 1HQEA 1T6CA 5CYMA 3LM9A 4NLBA 1HX1A 3WNHA 3V6DA 4JI3K 1VQNN 1VQ4N 2QTDA 4KHNA 1N36K 3QERA 3FZHA 5TKWA 4U67L 2QKKA 4RWTA 2O8EB 4M3YA 1TKXA 3C7NB 1HRHA 4JKAA 4FWLA 3S41A 3C65A 4B3RK 2P9KA 3CJ9A 3ENOA 3DRRA 2ITMA 1D5AA 3ENHA 3QDKA 1BCMA 3T1YK 1MWKA 1GLCG 4O5FA 5C2DA 1IBKK 4DTNA 3VESA 1RT1A 5EU7A 3VQDA 1QQMA 3NH1A 3OYDA 3PX0A 4OPKA 3ZX2A 1HNZK 1BL3A 2QA4N 3M5RA 3E66A 1GLAG 4E7HA 4FJ8A 4AHRA 1WSHA 3RR8A 3QBXA 2Z1GA 4FL9A 4ICLA 4OPAA 1NBWA 5DK5A 4WQ5A 3OS1A 4FWOA 1NK5A 4E0DA 3EZ5A 3HYFA 1Q86O 3FFKB 4RTFD 2A5XA 4YFUA 2DFHA 1Q18A 3ZSZA 3CCLN 1BQNA 4KV8A 4X66K 4JI8K 3HO1A 4EHUA 3KK3A 4DQ8A 3QESA 3K9JA 2CH6A 3BF3A 2ETJA 2FSJA 5LMUK 2YKNA 4NYFA 3WNFA 4M3XA 2VG5A 3T7ZA 3AVJA 3IDHA 2O8DB 4BGBA 3T1HK 2O8BB 1LCUA 4YDUA 5M1NA 3AAQA 3EE9A 3K57A 3MAQA 3V1OA 1RBRA 2P9SA 4BACA 3SJJA 1JLEA 2YHXA 1S9EA 3AA5X 1BOTO 4DV0K 4JNEA 1EXQA 2YHBA 4FWQA 1J9AA 4EP4A 4JN4A 5AZIA 4DFKA 4QS8A 3VPZA 2VYPA 4MO4A 4ILGB 4RCHA 1YJNN 2FF6A 4HWIA 2Z1HA 4JHDA 4H5RA 3CF5L 3QNNA 1KAZA 4HTUA 3SQ2A 1JCEA 1SKWA 1VQLN 2O8FB 4CGHA 1J53A 5HBMA 1JL1A 3O6WA 4DR6K 2QWMA 4CJ5A 1ATRA 3R3LA 4OVLA 4CZIA 5FPMA 2YNHA 3SBTA 2JWKA 3THYB 3ULEB 3LWLA 3B6PA 4BE1A 3CCEN 4GV3A 2DFEA 1S3XA 4W5QA 1ESVA 3E1YA 3O1BA 1ZYQA 3D2FA 3HM9A 4KREA 1WLJA 1HNIA 3C6UA 4CGGA 3LDPA 2Q31A 3LP3A 5HRSA 4GKKK 1DGKN 1DLOA 2HNDA 4JI2K 4C8OA 3MX5A 4H4MA 3CCUN 1Q81O 3VQPA 2GV9A 4N5SA 5BREA 4B9MA 2PYJA 4LC9B 4FJGA 2NRTA 3L2QA 2CGJA 1EWQA 3OTOK 4OGCA 3NF8A 5BR8K 5AQYA 3NF6A 2ZJRL 2NNWA 4CJFA 5GAHP 3EN9A 2E88A 3KJVA 1Q9XA 2DTUA 4W5OA 3CQXA 3ZEUA 5EX5A 4FVMA 4JI6K 1TKDA 3CCVN 3WQUA 4FXDA 1V4SA 5GAGP 4GV9A 4JKFA 4AM6A 4Y1DA 3TAMA 4W5RA 4CF9A 3RR7A 3VEXA 1L3TA 1NWKA 2P9NB 2Q97A 4K0KK 3TSUA 2UYTA 4I6MA 3FGUA 3OY9A 2W6LA 3QEWA 1GOCA 4FZYA 4JLHA 3PX4A 1VSEA 3C94A 1S22A 4CE9A 4BG8A 5C12A 5JMVA 3MCPA 2QWRA 3QETA 3MMVA 1T6DA 3CETA 4N47A 4CBWA 1KQSM 1IH7A 1VQ7N 1DEJA 4J2BA 4FJ9A 2Q36A 3ZETB 1X3MA 4DUYK 4CK3A 1QSYA 3QEIA 1XQSC 2OCEA 1BIUA 2Z1IA 3K0SA 5M1PA 1EP4A 4GW6A 3RRGA 1M90O 3WQTA 4WF9L 4AILC 4CJLA 2Z1JA 3U6FA 5AQNA 2HNYA 4BRCA 4X65K 4KAZA 3QMLA 4B9VA 1HLUA 1YT3A 4DMNA 1JKHA 2KZMA 4C8LA 1JCGA 4JI0K 4QCLA 3JYTA 3PY8A 1T03A 2J4RA 3T19A 3MXMA 5DM7L 4K8XA 1NJXA 3WXMB 1VHXA 3SI6A 1BWFO 3D2EB 1ZBIA 3UKUB 4CJVA 4L8RB 3L3VA 1QQOA 3KLHA 5KRTA 2HVIA 3QLHA 1YVUA 4M45A 1VSFA 4CERA 1R0AA 4B1ZA 4N76A 1RDDA 2FC0A 1HNVA 1QVFM 3A5OC 1BO5O 5AQTA 3LALA 3RVCA 3OW2M 3HVTA 4IDKA 4CZEA 3O4QA 1ZBHA 2P51A 4FWNA 1WBDA 3AVFA 4DQIA 3FR0A 1CZ9A 3ZT4A 3OYIA 1NK7A 1HYSA 1NU0A 4FLUA 2V51B 1QSLA 4OJRA 2Q2RA 4OGEA 3TTFA 4LD0A 3WEEA 4BRGA 2JGUA 3GBTA 3PSFA 4DFJA 4CJWA 5EY4A 3OA9A 3V9ZA 1EO1A 1OH6A 3LL3A 2YHWA 5DMRA 2IDOA 4IJNA 5AQJA 1L5UA 1JLBA 1ZBLA 3V9WA 4DR5K 3VQCA 4DV5K 1U2VB 4B3OA 2WBNA 4E7JA 4CW7B 2EHGA 4FW2A 4NYNA 4IO9L 4R79A 4B3SK 2KQ2A 1NOZA 3CMEN 1RDUA 1LWEA 3MXIA 3MWPA 1IV0A 4IJAA 4IFEA 4PQUA 2W6KA 4JI4K 2NRVA 3HBTA 1G99A 3AA3A 5BN8A 1YXQA 4BRAA 4A2AA 2FXUA 3VGMA 3IUCA 5KPRA 1MA9B 3K5OA 3H1VX 1NM1A 3FZLA 4N56A 1Z25A 4BROA 1DTTA 3LZJA 5BRDA 4JD2A 5ADXH 4RW8A 2BTFA 2Q1NA 3F5TA 2OPSA 1A5VA 2UUBK 1VSKA 3E9PA 1BCOA 4J2EA 2IVOA 1WAJA 4IOCL 4Z0UA 4K42A 3HVRA 2F7TA 4R5PA 3AVNA 4E7IA 1OH8A 1QHAA 2DPNA 3LPTA 1J5EK 1Q8IA 3VGLA 2P9LB 1E3MA 1SV5A 3ZSXA 2QK9A 4CHYA 4M7XA 3CIPA 4CEEA 3H08A 3DM2A 1B92A 1HYVA 5T7BA 3KLGA 3WUHA 3NVKA 2P9PB 4FK2A 4BRFA 4LSLA 3RMBA 1J5OA 3NVMA 1KSPA 3CMAN 3S3NA 2OTJN 4DU1A 1S1XA 2NLXA 4LH5A 1S6PA 1IKVA 3O9SA 3TTCA 3K2PA 3CD6N 4MLEA 4JKGB 2VCPA 4C1NI 1VRTA 4NXMK 2VWJA 1LW2A 3CERA 1FKPA 3GE1A 4KTWA 4L3QA 1SS6A 5FDLA 1UA0A 2VWBA 2BE2A 2WONA 1REVA 1UA1A 3O3HA 3F9KA 3BDPA 4BG9A 4M3TA 1FXXA 2G8KA 3P31A 4O0IA 2HSTA 1TYQA 1W7AA 3MX2A 4IDHA 4CJTA 3CPWM 2VG7A 4NLCA 4JK7A 4BVOA 1J6ZA 4NB4A 4BWJA 2R7YA 2P9IA 4H0XB 3FZKA 3AVLA 2JLEA 4IG0A 4F2SA 3VEYA 4Q5VA 4Z4IA 5MLCQ 4JKBA 3NHGA 4BDPA 4ISEA 1K73O 4PA1A 4CZKA 4KHUA 1DTQA 3G71N 5AQWA 2P9UA 3AVIA 2XRIA 5EVZA 4OPHA 1P90A 5CR4A 3U4LA 1W2BM 4F2RA 3V1RA 3ZSRA 1QSSA 3Q7CA 3EY1A 4B3TK 1HNXK 2G8IA 4CI6A 4GKJK 3CPEA 4I9LA 4E1MA 3QO9A 3SAHA 3J7AP 1Z05A 2A40A 2RKIA 3LAKA 4FW1A 3VA0A 4H5WA 3SK3A 3ZLJA 2P9KB 2AJQA 2ATQA 1OVYA 3EYZA 3KK7A 1L3UA 3OYEA 1VSLA 2ZD1A 1WSJA 2QWNA 4A62A 1HKCA 3DLKA 4GVEA 2E5LK 4ZTJA 1HQUA 2HW3A 3HZ6A 2HHTA 3PV8A 4DS5A 4YOVA 3DXMA 4J8FA 3A2FA 4DSJA 3ATUA 1TUYA 2A42A 3AA2A 3KTQA 5HRRA 1HPZA 4BR7A 1X1PA 4YOWA 1NGHA 1TGOA 3KD1E 2DY4A 3CJ7A 4KHWA 5AQFA 4BRKA 1RDBA 3O8MA 3QFUA 2EX3A 4B8CA 2QM1A 5HRNA 1LWCA 4CK1A 2KTQA 3WT0A 4B1XB 3IFRA 3AAPA 1RDWX 2FBTA 1WSEA 3AARA 5FROA 4CF1A 4FOIA 4YOYA 3NCIA 2O8CA 1XMQK 4LF5K 1RT6A 5LL6Z 1QQNA 2YJEA 4CJKA 3KD5E 4YY3K 5CZ2A 3SJHA 4JI5K 3HPHA 1C0FA 1KVAA 1NJZA 2HHQA 2YNGA 3VQEA 2FBVA 2D5RA 5ELZA 1KC8O 4F4KA 3CQYA 1YF5L 4YORA 5AQZA 3ZT1A 2E1YA 1MU2A 4CZMA 1RTDA 2ASOA 4Z4HA 2P9SB 1P8ZA 4ID5A 4PKIA 2IS3A 1HR0K 3BZKA 3TI0A 2AP1A 4O44A 5AZIB 1CXQA 4WYBA 4IKFA 1BGXT 5SWMA 2Q0UA 4JHDB 2XHBA 3QB0A 1U48A 4BREA 5JLHA 5D3GA 1BIZA 2QXLA 5EXWA 4DLEA 4DTSA 3CM6A 2V7YA 1YI2N 1BG3A 4M41A 2OANA 4CVNE 4DTOA 2CGLA 4FK0A 4DU4A 1D9FA 2RF2A 4YHHK 1LV5A 1RT5A 5FRNA 4DV2K 4DR2K 4DV4K 1Z6RA 3SUNA 3GOIA 2NRHA 3HL8A 1XI1A 1NJYA 3VERA 1ASWA 5HROA 4Z4CA 3M8RA 3PUFA 2GEMA 3D2FB 4UQGA 3VQ9A 1NK9A 2F96A 4ILHA 1JCFA 4F9OA 1M1KO 3UB5A 2GX9A 4HCCA 3SPZA 1C0MA 1BUPA 2HHSA 4XIUA 1GOBA 1BA1A 1VQ5N 3BGRA 4B9QA 5HRPA 5CHIA 3PX6A 2B4JA 3C6TA 3HP9A 3IG1A 4IFYA 1O13A 5ADXA 4FM2A 3TANA 2D0PA 3K9KA 2BUPA 5IWAK 4BQZA 5M1QA 4BE0A 3ZEUB 3KK1A 4Z4EA 1VRUA 2HMIA 3I55N 3SV3A 3AV9A 2G8HA 3L6QA 3LDSA 4CJQA 5KPTA 3DLBA 3HPOA 5BN9A 1XMOK 2E20A 3HSCA 4FJKA 4I6MB 3P38A 3ID6A 3EZWA 1DKGD 1X9JA 4DF8A 3LAMA 1IBLK 3OHRA 1KRPA 5J2NA 4PHTX 4CEZA 3OJSA 3VN5A 5F2RA 2D0OA 4KRFA 2ZJPL 3I0SA 5C42A 1C1CA 4PKHA 3VA3A 1S1VA 3G6EN 1NG9A 4FSVA 4O8KA 4A2BA 1IG9A 2HBKA 3EKSA 3THWA 4IOXA 3N4PA 3CM5A 1VSJA 3KKSA 3CG7A 3P39A 4DQRA 1KFDA 1V4TA 2HMPA 3THVA 3LDLA 5FLXO 4KH4A 3M3ZA 1JLQA 5BPLA 4X62K 4MDAA 1XNQK 3KWGA 5KPZA 1TKTA 3CFRA 1K8KA 2QWLA 5AZJA 5GIOA 4FLWA 4DQQA 4BDZA 1I94K 5F0XA 2YKMA 3WNGA 4K8ZA 2B5JA 4LF6K 2ZQBA 2I7PA 4MDBA 5DM6L 3I33A 2CGKA 4H8KA 4PWDA 2ZWHA 4CFAA 4DR4K 4CGDA 3LDQA 4ISFA 1HJOA 5AQKA 4FLZA 4HVJA 2UU9K 3LP1A 3H45C 2G8WA 3S9HA 2OPQA 4PUOA 4DQPA 4K25A 4BQLA 1FJGK 4KPYA 4KBOA 5H1SQ 3HOSA 1C6VA 1KAXA 4H5VA 1D9DA 4CIFA 2F8TA 1WSFA 2OA8A 4CHZA 5SZTA 3ITHA 3BY5A 2GWJA 4WFAL 2OPRA 4FJNA 3PO4A 3AVGA 3N4QA 3ASMA 4JI7K 2F4VK 1DT9A 1RDCA 4MQ3A 2IAJA 4BRHA 3SAGA 2IIRA 4CFCA 1TUUA 3J81O 4DTUA 4I7FA 3WEEB 1HNWK 5M1OA 5BPMA 2E2PA 3A5NC 1ZBSA 1JLAA 4AQYK 4CCHA 3TABA 4IOAL 3QEXA 2KFNA 3CCJN 3L4QA 3A5MC 4B08A 1VK0A 3H3NO 3W0LA 3LANA 4QS7A 1S6QA 4BGAA 3AVHA 4KHQA 2RN2A 2HB5A 1T3VA 4H0VB 2JWLA 1XC9A 2PYLA 4KTQA 4XH4A 1MWMA 1VQKN 4B9TA 4LF4K 3U8XA 1TAUA 4FWMA 3NFAA 3AY9A 5FPNA 3TU5A 2E6LA 3K59A 4C8KA 2KW4A 4XEIA 3DLRA 5C10A 4JEPA 5AQVA 3VQ8A 4FM1A 2ASPA 2XO7A 3VMFB 3QIPA 4CGIA 3ZX3A 3J7YP 5I42A 4JD2B 3OS2A 4DUZK 2KZZA 5GIPA 1VQ9N 3AO5A 2O4IA 4AH9A 1TK0A 2QW9A 2IOCA 1N6QA 1CLQA 3TAEA 4AHCA 1IKYA 3AVBA 4BDYA 3J80O 3KLFA 4DSLA 4KKOA 1NNEA 4BR4A 4AF1A 3RSEA 3R9PA 5M1FA 3VQ7A 3WXKA 4M42A 1RBTA 3P4IA 3GG4A 5HP1A 4CHQA 5LJWA 4NCBA 3BZCA 5E26A 4LF8K 1KVCA 4ELUA 2UUCK 3LDNA 3MN5A 1QTMA 4JK9A 1T05A 4M3RA 2IGIA 1K9MO 3SQ0A 5JLFA 2ZGYA 2UXBK 3I8DA 1E4FT 1MDUB 1BU6O 2E2NA 3VTIA 1RT2A 3VEOA 1QHTA 2D4WA 1U4BA 4LFCK 5AQPA 2I5JA 1QQCA 4E7KA 2DFFA 4CGFA 4B3MK 3KVGA 2YV0X 3VEVA 2I7NA 4DCHA 3VOVA 2GTDA 4DR7K 3LZIA 1TYQB 1KXPA 3M6GA 3D45A 3TAPA 3C6AA 3C6HA 4RW7A 4TSXA 3IAYA 2BANA 1JLCA 2P9IB 4BC3A 3HM8A 5AQGA 4LFAK 2BDPA 4GMJB 4EHTA 4I9QA 1SQKA 4C8NA 1KLNA 5KRSA 2X6NA 4EAHD 3O5BA 4KHPK 4O8UA 3T69A 2HHWA 4KH6A 5GINA 3ENBA 3AVCA 2F9TA 2VG6A 3AVAA 3CXCM 3QINA 2PZSA 2F9WA 2P9UB 1TK5A 1X9WA 4A61A 3FE1A 1RCHA 2VWKA 3TAFA 2PY5A 4UY8O 3D6RA 5AQMA 4KI4A 2P5OA 3M1FA 2YCHA 1NJIO 3O9RA 3WXJA 1SAZA 2FBXA 5JS2A 4CEOA 3G4SN 3ZSWA 3CI5A 1L3SA 1TV6A 5KGWA 2YNIA 3LWMA 4ID1A 1TAQA 3LP0A 4FJMA 1ATNA 4B1VA 3GDQA 2RPIA 4BC2A 3DI6A 4G1QA 1QS4A 1YUWA 3O80A 3MXJA 3ZSYA 4FJHA 5IT9O 1ZC6A 1NKBA 4JRQA 3EKUA 4CEFA 3CC2N 4EZ6A 1CXUA 1VQ8N 1YJWN 2F8SA 3THXA 2OYQA 1JLFA 1GLBG 2ITGA 1NK4A 1L3VA 3SBGA 3DLGA 3O3GA 5CZ1A 4DB3A 3I8BA 1IBMK 4JYAK 3DXMB 4LF7K 5BRHA 3ID8A 3M8PA 5HLFA 1LW0A 3CJBA 4IZ9A 3VF4A 1GLDG 4B8AB 1GLFO 4WCEL 3KK2A 3AO4A 1IG8A 3FLCO 4CHPA 3O9QA 1HMVA 4MO5A 3E01A 3A5LC 2QKBA 1HKGA 1Q9YA 1GLLO 3VQAA 3TR8A 1IJJA 4DG1A 3H46O 4FWSA 1XWLA 3KIOA 5BR9A 1U49A 4O5BA 3SQ1A 4CEAA 4B1UB 4W5TA 1F21A 4JKEA 1EKEA 4QS9A 3HT3A 2GUIA 4BC5A 2O8CB 1TL3A 1YVNA 2ZF5O 2QWPA 4LF9K 2D0BA 1NLVA 5AQLA 3DWLA 4LY7A 3M8QA 3DXKB 3ZCMA 3SLCA 3D0PA 4XH5A 3T1AA 2HF3A 3TSPA 1CZAN 1EQYA 4OKJA 1OH7A 1TK8A 4CZJA 4F8RA 3CC4N 4FLXA 2RHKA 1GLJO 1S5JA 5E84A 5J2PA 3J8AA 4CBXA 3W3DA 1OKJA 5J2QA 3IMXA 4I2QA 2V7ZA 4KHYA 1WSIA 5EOYA 5I3UA 3MEGA 1FW6A 3KZBA 1VSMA 3TSQA 1IKWA 1JXBA 1WSGA 3UKRA 3SYZA 1D8YA 1VQ6N 2QI2A 4BY9C 4JKHA 2HBLA 4JK8A 3OYAA 1RTHA 1I39A 4AM7A 5C0YA 4B9UA 2PFUA 3CCMN 4Z4GA 4JS5A 4NO7A 3FZFA 4LH4A 1WOQA 3QICA 4Y1CA 4FJ7A 1C1AA 1A5WA 1RTJA 3RRHA 5AFUH 4H03B 5HL7L 3J7ZO 4CK2A 3DXKA 5CY4A 1NK0A 5GAEP 5J1EA 4FCYA 2BH1A 3VF2A 1SKRA 3RTVA 3L8BA 4OX9K 1S72N 1QZ6A 3HRGA 5B8HA 3TTDA 4NCGA 1J54A 2KFZA 3PSIA 4DFPA 1VSIA 4BR9A 4CEBA 3M8SA 3G0ZA 3TAGA 4MFBA 3DOLA 5AQXA 3O08A 4B9NA 1Q82O 4DSIA 1FKOA 3NGZA 1JJ2M 1TL1A 3OYBA 1XHZA 2GBZA 3TWHA 3VQ6A 1ASVA 2YJFA 5AQQA 4C1NK 3OYMA 3V1QA 3K58A 4H0PA 3TPQA 4JI1K 1RT3A 4DFMA 3KWIA 2W42A 3ALYA 4HTLA 4IEIA 2VQEK 4E3SA 3QNOA 3DRPA 4O55A 2E2QA 4YOUA 4A5BA 3TAQA 4DSKA 1NGBA 4MLHA 4BRNA 3CFOA 1BI4A 3WXIA 3L0QA 3L4IA 4WFNL 1RILA 2YI1A 1RFQA 4M3ZA 1YAGA 3AGKA 2A41A 3ZSVA 4CJ4A 3SUOA 3SNNA 3NMUA 4CJ7A 2NRWA 4HUGA 3HTVA 4JKCA 3LM2A 2X6SA 3H6EA 4OKKA 3CC7N 5AJ3K 4CF8A 1HYZA 3THWB 1NK6A 1X9SA 3WNEA 4FJJA 4OLBA 3OYHA 3QBWA 3DMJA 1VAZA 5KI6A 3S3MA 4CZHA 4NXNK 2FBYA 2IVNA 4BE2A 2O8EA 1WUAA 1ZXOA 3C7NA 3BEXA 4CZFA 4LSNA 1UAXA 4K41A 4IWVA 2KKZA 3VEZA 3R6MA 4J2DA 1VQON 1K8KB 4E89A 1RDAA 5AZJB 4KO0A 4F3OA 2KHOA 4CBUA 2GUPA 4H5NA 2QEXN 2YHAA 1Y97A 4KB1A 4E19A 4GV6A 4DV7K 3AA4A 3HI0A 4KH5A 1SL1A 1XNRK 1WAFA 3AVMA 2ZE2A 3NGYA 1QE1A 4M3WA 4CJ3A 5TKYA 2YHYA 4U7BA 4V19S 4CEQA 4CESA 4BVPA 1E4GT 5LY3A 4OPJA 2HHXA 3AGRA 2ZGZA 1D4XA 4DSEA 3MDQA 3CCRN 3A0IX 3O9TA 4HCBA 3CJ1A 4DSFA 3G25A 2UXCK 1EETA 4IBNA 4GY2B 1HUXA 3F9MA 3R1XA 4E7LA 3VQ4A 1XC3A 3RMAA 3MN6A 3VF6A 1WNSA 4EZ9A 1KTQA 1N34K 4Y0WA 2E4LA 4DS4A 2PAVA 3AO1A 4CFDA 4BR5A 3PLAA 2EWSA 4CJUA 3SMPA 4K43A 3TARA 3VTHA 1XHXA 3DLEA 1BQMA 4E1JA 1WB9A 4FYDA 2O8DA 2D1KA 2O8BA 3O4NA 3L2VA 3K5LA 3F2KA 2NRRA 1R59O 4B9LA 4EP5A 3NAEA 3OVNA 1C1BA 3SV4A 1T44A 1VSDA 5J2MA 5C24A 1TKZA 4DTXA 2A3ZA 3LP2A 4NCAA 5JICA 3GL1A 4ZHRA 4FZZA 3EL2A 3JXUA 1NJWA 3ATVA 1K8AO 2OZMA 4PKGA 4FJ5A 3E9OA 3L2RA 1KVBA 3UE5A 4IG3A 5BPNA 4AHUA 1I3AA 4CD1A 3V9XA 3AO3A 4CJPA 2O8FA 3U3YA 2LSNA 1O1WA 1TVRA 1NMDA 3OYFA 4BC4A 3NDKA 1U47A 1CZBA 5AR0A 1RT7A 4FLVA 3THYA 3ULEA 3CQ8A 5AQOA 3KKRA 1UOCA 1K6YA 3DRSA 3OS0A 4YNQA 3BUZB 5AQUA 4CZGA 5FRMA 4G9ZA 4FO0A 2D0CA 4BWMA 2NRXA 4IXCA 1YIJN 3CYMA 3ISNC 3QIOA 5JVHL 2D0AA 4OKEA 2W41A 2B6AA 5KGXA 3FFIA 1GOAA 3L2WA 3BF1A 3NF9A 4ILJA 4CIGA 1S9GA 3SAFA 3AVKA 4ELTA 4YOTA 4OO1J 4XH1A 4FWRA 1N5YA 4DTRA 3CCSN 4PL7A 1S1UA 5CE3A 3SUPA 3NH0A 3RSEB 2NZTA 2WC9A 4PY5A 4DR1K 3R8EA 5CYQA 2Q0RA 1SL0A 1KFSA 3OJUA 4HUFA 3D7EO 2HHUA 1KLMA 4H0TB 4BR2A 3V81A 4DV3K 4DV1K 5GADP 4DV6K 3ZSQA 3VEWA 4CF0A 2Y1JA 1IO2A 2E8AA 5JS1A 2HBJA 3H3OB 1Z26A 2WOMA 3P1GA 4KI6A 1EX4A 2P9NA 3SMSA 4FWKA 5C15A 4FLTA 4C23A 1SKSA 3SQ4A 3ZT2A 5AFUA 1NKEA 4FPAA 3PIOL 1RTIA 3L2UA 5K14A 2XY8A 3ZX0A 4BRMA 1RBVA 4ZTFA 4LFBK 4ISGA 3NF7A 5FPEA 4WFBL 4DWIA 1RT4A 2CH5A 2OTLN 4JKDA 3ZETA 3MEDA 3CCQN 3SUQA 4EIAA 1BISA 2VQFK 3KLEA 4RW6A 3OYGA 2RE2A 4JV5K 4A5AA 1NK8A 4IO8A 4AHVA 3ZSOA 3PO5A 3VETA 1C0TA 3O3FA 3NE6A 1KD1O 1U45A 4JRPA 3UIQA 1JXEA 1YTAA 4Z4FA 3RMDA 1ITGA 2HHVA 3OYCA 3HPGA 3OYNA 1SZ2A 2VGNA 3EEQA 1X3NA 3L3UA 2FSKA 4BRPA 3CHWA 1VQMN 1YHQN 1FK9A 1G15A 3RMCA 3U9ZA 3A8YA 1ATSA 1Y64A 1NGDA 4CZLA 3PIPL 4J2AA 1HPMA 3FZMA 3H1QA 4QAGA 1RBUA 2VGMA 3DLHA 3I56N 2XY6A 1NGGA 4AHSA 4BRLA 1KCFA 3VENA 3QEPA 3F73A 2G8VA 3O9UA 2H3GX 3P83D 4DKWA 4FPBA 1T8EA 1Q7YO 4DTMA 3O4WA 4IEEA 4FM0A 5E41A 3MN7A 3D2EA 1C0GA 2E1ZA 4H0YB 3UKUA 4JAXA 2V52B 4CFBA 3CFPA 4FJLA 2QWQA 4WQ4C 2OZSA 3B6OA 3U9DA 1NGCA 4DTPA 2ZM6K 2UUAK 2HF4A 5KTQA 4JS4A 3EO3A 1N8RO 2NRZA 3S3OA 1LAWA 3P5JA 3CJAA 3JAMO 5LMNK 4KHSA 2WUSA 1YJ9N 1ILYA 1W9HA 5F1XA 2IC3A 2X74A 3ZYYX 2O4GA 4GNIA 3THXB 4E1NA 2Y1IA 3U3GA 2WFBA 1HKBA 2OPPA 1W0HA 5AQIA 4GVMA 3NH2A 3VQBA 1BHLA 3HP6A 4QOZB 4DQSA 1OVQA 1XUPO 3HJFA 3SCXA 5BRFA 4ELVA 2HNZA 2A6AA 4CECA 3ULDA 3HK2A 3DJCA 1H1VA 2NUBA 1IKXA 1NGIA 1UWBA 3KLIA 4CJEA 2UXDK 3Q7BA 4KFBA 5C2FA 3MN9A 4CHOA 4CIEA 2P5GA 4B1YB 3NBPA 4CHNA 3DOKA 2P1JA 4C8MA 5A2QO 1BA0A 1VQPN 2X78A 4I2PA 1YTUA 3C95A 4FVUA 1KAYA 1RNHA 1U2VA 4H5TA 5C25A 2YX6A 2XY5A 3MECA 4M7YA 4BRQA 4CD3A 3QEVA 4DHYA 4WQ5C 4PL8A
chains in the Genus database with same CATH topology
1VSFA 1C1CA 5J1EA 3VA3A 4FCYA 1B9FA 1S1VA 4CERA 3JSMA 1R0AA 4N76A 1SKRA 1ASUA 4O4GA 1RDDA 2FC0A 4WE1A 4DTJA 1HNVA 3RTVA 1IG9A 2G8FA 3L8BA 2A1RA 3ZT0A 4RW4A 3LALA 3CM5A 1VSJA 3KKSA 3HVTA 4IDKA 3CG7A 3O4QA 2P51A 1ZBHA 4DQRA 1JL2A 1KFDA 4W5NA 4NCGA 3AVFA 3THVA 1J54A 2KFZA 1U04A 3OYKA 4DQIA 4DFPA 1VSIA 4CEBA 1LWFA 3M8SA 1CZ9A 1JLQA 3G0ZA 4MFBA 3ZT4A 3OYIA 3DOLA 3HSTB 3TAGA 4M3UA 1NK7A 4B9NA 1HYSA 4FLUA 4FK4A 1TKTA 3CFRA 1QSLA 1ZBFA 4OJRA 4DSIA 1FKOA 3NGZA 4OGEA 1TL1A 3OYBA 3VQQA 4FLWA 4LD0A 1WN7A 4DQQA 1T7PA 2A1SA 4BDZA 1XHZA 2JGUA 2YKMA 2GBZA 4HUEA 3TWHA 3WNGA 3VQ6A 4K8ZA 1ASVA 3NGIA 3OYMA 3V1QA 3K58A 4DFJA 2QXFA 2B5JA 4CJWA 2ZQBA 4CJRA 3V9ZA 1RT3A 3ZT3A 1S1WA 4DFMA 2W42A 3ALYA 4H8KA 5DMRA 3OYLA 4KTZA 1HJRA 2IDOA 4HHTA 4PWDA 4E3SA 3QNOA 1L5UA 3DRPA 4O55A 3TAQA 1JLGA 1C0UA 1JLBA 4CFAA 1ZBLA 4DSKA 4CGDA 4CF2A 3V9WA 3SPYA 4FZXC 3CFOA 3VQCA 4FLZA 4HVJA 4B3OA 3LP1A 1BI4A 3T3FA 4N41A 4E7JA 2G8WA 3S9HA 4IFVA 2OPQA 4PUOA 4DQPA 3MEEA 1RILA 2EHGA 4FW2A 4NYNA 4DF4A 4M3ZA 1SUQA 2KQ2A 1NOZA 3ZSVA 4KPYA 1NOYA 3LPUA 4CJ4A 1LWEA 3SUOA 3SNNA 3MXIA 4HUGA 1X9MA 1C6VA 3V9UA 1D9DA 2X6SA 4PQUA 4CIFA 4OKKA 4CGJA 2F8TA 3AA3A 1WSFA 4CF8A 2OA8A 3DYAA 4CHZA 5SZTA 1HYZA 3I0RA 3ITHA 2XY7A 1NK6A 1X9SA 3WNEA 3SZ2A 4FJXA 3K5OA 4FJJA 4OLBA 3OYHA 3DMJA 4RG8A 5KI6A 3S3MA 3IRXA 4N56A 2FBYA 1VSHA 2OPRA 3AVGA 4BE2A 3PO4A 4FJNA 3ASMA 2HVHA 1Z25A 3K5MA 1DTTA 3LZJA 1NKCA 4Q0BA 1RDCA 4MQ3A 2IAJA 4RW8A 4LSNA 1LAVA 1UAXA 4CEDA 4CFCA 4O0JA 2OPSA 1A5VA 4J2DA 1SL2A 4E89A 1RDAA 1VSKA 3IS9A 1BCOA 4KO0A 4F3OA 4J2EA 4DTUA 4I7FA 2G8UA 1WAJA 4RW9A 2YHAA 4Z0UA 1Y97A 4DLGA 4KB1A 4E19A 3OYJA 3AA4A 4F3TA 3HVRA 4R5PA 3AVNA 4E7IA 3LPTA 1JLAA 3V4IA 1Q8IA 1SL1A 2KFNA 4CCHA 4FLYA 1SV5A 3ZSXA 4AHTA 3QEXA 3TABA 1WAFA 3AVMA 2E6MA 2ZE2A 4CHYA 4B08A 2QK9A 1A5XA 1VK0A 1B9DA 4CEEA 3LANA 3NGYA 3H08A 1QE1A 4H4OA 4M3WA 3HXMA 4CJ3A 3DM2A 1B92A 1HYVA 1S6QA 3AO2A 5T7BA 3KLGA 1ZBUA 3G10A 2YNFA 3AVHA 1BI4B 4CEQA 3RWUA 4FK2A 4CESA 4KHQA 4OLAA 1RBSA 2RN2A 2HB5A 4LSLA 4OPJA 1S1TA 2Q3SA 3RMBA 1J5OA 2HHXA 1KSPA 4DSEA 1XC9A 3VQ5A 3S3NA 2PYLA 4KTQA 3K5NA 2BGGA 4DU1A 4B9TA 1S1XA 1TAUA 3NFAA 4LH5A 4DSFA 1S6PA 4DU3A 1IKVA 4HCBA 4B9SA 4KB0A 4FJIA 4CJSA 3V9SA 1HQEA 3K2PA 2E6LA 3K59A 4C8KA 1EETA 4IBNA 5CYMA 1VRTA 2KW4A 3WNHA 3V6DA 2VWJA 3DLRA 1LW2A 1FKPA 3VQ4A 3VQ8A 4E7LA 4FM1A 4KHNA 3RMAA 4KTWA 1UA0A 5FDLA 1WNSA 4EZ9A 2XO7A 3QERA 1KTQA 2QKKA 2BE2A 2E4LA 4DS4A 2WONA 1REVA 3QIPA 4M3YA 1UA1A 4CGIA 3O3HA 1TKXA 3AO1A 3F9KA 4CFDA 5I42A 3BDPA 4M3TA 1HRHA 1FXXA 3OS2A 4CJUA 2G8KA 2KZZA 3TARA 4O0IA 3AO5A 2O4IA 4AH9A 4CJTA 1TK0A 2IOCA 1XHXA 2VG7A 1BQMA 3DLEA 1N6QA 4FYDA 3TAEA 1CLQA 4AHCA 3DRRA 1IKYA 3O4NA 3L2VA 3K5LA 1D5AA 3AVBA 4BWJA 4BDYA 1BCMA 4B9LA 4EP5A 2R7YA 3NAEA 3AVLA 3OVNA 1C1BA 2JLEA 4IG0A 3KLFA 3SV4A 4DSLA 1VSDA 5J2MA 4F2SA 5C24A 1TKZA 4KKOA 4DTXA 4DTNA 4Q5VA 1RT1A 5EU7A 3LP2A 4NCAA 3VQDA 4Z4IA 4ZHRA 4FZZA 1NJWA 3NHGA 4BDPA 3VQ7A 2OZMA 4FJ5A 4PA1A 3L2RA 3NH1A 1KVBA 3OYDA 3PX0A 4M42A 1RBTA 4IG3A 4OPKA 4KHUA 1DTQA 4AHUA 1I3AA 3V9XA 4CHQA 5HP1A 4NCBA 3AO3A 1BL3A 1KVCA 3AVIA 2XRIA 4CJPA 4E7HA 4ELUA 4FJ8A 3U3YA 2LSNA 4AHRA 1O1WA 1TVRA 3OYFA 1WSHA 1QTMA 3RR8A 2Z1GA 4ICLA 5DK5A 3NDKA 1T05A 4M3RA 1U47A 1CZBA 2IGIA 3OS1A 3SQ0A 3V1RA 1NK5A 4F2RA 4E0DA 3EZ5A 1RT7A 3HYFA 3ZSRA 4FLVA 4YFUA 1QSSA 3I8DA 3EY1A 2DFHA 3ZSZA 1RT2A 1BQNA 3CQ8A 1QHTA 2G8IA 1U4BA 4KV8A 2I5JA 1QQCA 1UOCA 1K6YA 3DRSA 3KKRA 4E7KA 4I9LA 2DFFA 4YNQA 3OS0A 3HO1A 3KK3A 4CGFA 4E1MA 3QESA 3QO9A 5FRMA 2YV0X 2ETJA 2D0CA 4BWMA 2RKIA 3LAKA 3LZIA 4FW1A 2YKNA 4NYFA 3WNFA 3VA0A 3CYMA 3D45A 2VG5A 3ISNC 3TAPA 4M3XA 3QIOA 3AVJA 2D0AA 4OKEA 2AJQA 4RW7A 2B6AA 5KGXA 2ATQA 3FFIA 3EYZA 1GOAA 4TSXA 1L3UA 3IAYA 3L2WA 2BANA 3NF9A 1VSLA 4CIGA 3OYEA 1JLCA 1S9GA 2ZD1A 3K57A 3MAQA 3V1OA 3AVKA 1RBRA 4ELTA 1WSJA 4BACA 3SJJA 1JLEA 1S9EA 3DLKA 2BDPA 4GMJB 4ZTJA 4I9QA 1N5YA 1HQUA 4C8NA 4DTRA 2HW3A 3AA5X 1S1UA 1KLNA 5KRSA 3SUPA 2X6NA 3NH0A 1EXQA 2YHBA 2HHTA 1J9AA 3PV8A 4DS5A 4EP4A 4DFKA 3A2FA 4DSJA 4PY5A 3AA2A 3KTQA 5CYQA 2HHWA 5HRRA 1SL0A 1KFSA 2Z1HA 1HPZA 3AVCA 3OJUA 1X1PA 3QNNA 4HUFA 2VG6A 4HTUA 3AVAA 1TGOA 3SQ2A 3KD1E 2DY4A 2HHUA 1KLMA 3QINA 2PZSA 4KHWA 3V81A 1RDBA 1TK5A 1X9WA 3ZSQA 2EX3A 4CF0A 2Y1JA 1SKWA 1IO2A 1RCHA 4B8CA 2VWKA 5HRNA 3TAFA 5JS1A 2PY5A 4CGHA 1J53A 1Z26A 2WOMA 3P1GA 5HBMA 4KI6A 1JL1A 1EX4A 1LWCA 4KI4A 4CK1A 4CJ5A 2KTQA 4FLTA 4OVLA 2P5OA 1SKSA 2YNHA 3SQ4A 2FBTA 1WSEA 5FROA 3ZT2A 4CF1A 2FBXA 3LWLA 3B6PA 3NCIA 5JS2A 4BE1A 1NKEA 1RT6A 4CJKA 1RTIA 3L2UA 3KD5E 5CZ2A 2XY8A 5K14A 2DFEA 4CEOA 1L3SA 3ZSWA 4W5QA 1TV6A 1RBVA 3HPHA 5KGWA 1KVAA 2YNIA 3LWMA 4ID1A 4ZTFA 1NJZA 2HHQA 1ZYQA 3NF7A 1TAQA 3LP0A 4DWIA 1RT4A 4FJMA 3HM9A 2YNGA 4KREA 1WLJA 3VQEA 2RPIA 1HNIA 3DI6A 2FBVA 1QS4A 3C6UA 3MEDA 3MXJA 2D5RA 3LP3A 4G1QA 3ZSYA 1BISA 5HRSA 3KLEA 3SUQA 4FJHA 1DLOA 2HNDA 4C8OA 4F4KA 4RW6A 4H4MA 3OYGA 1NKBA 4JRQA 4CEFA 3VQPA 2GV9A 1NK8A 4N5SA 3ZT1A 4AHVA 1MU2A 4EZ6A 4B9MA 3ZSOA 2PYJA 1CXUA 1C0TA 3O3FA 3NE6A 1RTDA 3PO5A 4Z4HA 4FJGA 4CGGA 2F8SA 1U45A 4JRPA 3L2QA 2OYQA 3UIQA 1JXEA 1JLFA 4ID5A 2ITGA 1YTAA 1NK4A 4Z4FA 4OGCA 2IS3A 3RMDA 1ITGA 3DLGA 3NF8A 3O3GA 3TI0A 1L3VA 5CZ1A 2HHVA 3OYCA 3HPGA 3NF6A 4CJFA 4O44A 3OYNA 3M8PA 5HLFA 1LW0A 1CXQA 3KJVA 3L3UA 1Q9XA 2DTUA 4W5OA 4IKFA 4B8AB 1BGXT 1TKDA 4FVMA 1FK9A 1G15A 5SWMA 3KK2A 3AO4A 1U48A 2XHBA 3RMCA 4FXDA 4CHPA 5D3GA 1BIZA 4DLEA 4DTSA 1HMVA 3CM6A 4J2AA 3E01A 4QAGA 1RBUA 4Y1DA 4M41A 3DLHA 2QKBA 4DTOA 3TAMA 4W5RA 1Q9YA 4CF9A 2XY6A 3RR7A 3VQAA 4AHSA 3TR8A 4DG1A 1U49A 1XWLA 1KCFA 3KIOA 4O5BA 3QEPA 3SQ1A 1L3TA 4FK0A 3F73A 2G8VA 4DU4A 3OY9A 1D9FA 3P83D 2RF2A 1T8EA 3QEWA 1GOCA 4CEAA 4JLHA 1RT5A 4W5TA 4DTMA 1LV5A 4FZYA 5FRNA 1F21A 3PX4A 1VSEA 3C94A 4CE9A 1EKEA 3HT3A 4FM0A 3SUNA 2GUIA 5E41A 3HL8A 1XI1A 1NJYA 1TL3A 4CFBA 1ASWA 5HROA 4Z4CA 3CFPA 4FJLA 3M8RA 2D0BA 3QETA 2OZSA 3PUFA 3B6OA 4LY7A 4N47A 3M8QA 3ZCMA 4J2BA 1IH7A 4UQGA 3D0PA 4DTPA 3VQ9A 1NK9A 3T1AA 2F96A 5KTQA 4FJ9A 4JS4A 4HCCA 4OKJA 3S3OA 1LAWA 3P5JA 4CK3A 3SPZA 1TK8A 3QEIA 4FLXA 1QSYA 4F8RA 1C0MA 1S5JA 5J2PA 4KHSA 2HHSA 4XIUA 1GOBA 1BIUA 2Z1IA 1W9HA 5J2QA 2IC3A 2X74A 3BGRA 2O4GA 4I2QA 5HRPA 1EP4A 4GW6A 3RRGA 3PX6A 2B4JA 3C6TA 3HP9A 3IG1A 4IFYA 3U3GA 4E1NA 4AILC 2Y1IA 1WSIA 4FM2A 4KHYA 4CJLA 2OPPA 3TANA 5I3UA 3MEGA 1W0HA 4GVMA 3NH2A 2Z1JA 3VQBA 3U6FA 1VSMA 1BHLA 3HP6A 1IKWA 1JXBA 2HNYA 4DQSA 4QOZB 4KAZA 4B9VA 1WSGA 1YT3A 4BE0A 3HJFA 4DMNA 3SYZA 3SCXA 3KK1A 1D8YA 4ELVA 2HNZA 4CECA 4Z4EA 1VRUA 1JKHA 2KZMA 3OYAA 4C8LA 2HMIA 3ULDA 3SV3A 3HK2A 3AV9A 1RTHA 2NUBA 2G8HA 1IKXA 4QCLA 1UWBA 1I39A 3KLIA 4CJEA 3JYTA 4KFBA 2P5GA 4CHOA 4CIEA 3LDSA 4CJQA 4B9UA 3NBPA 3DLBA 4CHNA 3DOKA 3HPOA 1T03A 3T19A 3PY8A 3MXMA 2P1JA 4C8MA 4Z4GA 4JS5A 4FJKA 2X78A 1NJXA 4K8XA 4I2PA 4LH4A 1YTUA 3C95A 4Y1CA 4DF8A 3LAMA 4FJ7A 1RNHA 1C1AA 1A5WA 3SI6A 1KRPA 5C25A 5J2NA 1RTJA 1ZBIA 4CJVA 4L8RB 3L3VA 4CEZA 3OJSA 3RRHA 2XY5A 3MECA 3VN5A 3KLHA 5KRTA 4CK2A 2HVIA 3QLHA 5CY4A 4KRFA 1YVUA 3QEVA 1NK0A 3I0SA 5C42A 4M45A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VSF A;  1C1C A;  5J1E A;  3VA3 A;  4FCY A;  1B9F A;  1S1V A;  4CER A;  3JSM A;  1R0A A;  4N76 A;  1SKR A;  1ASU A;  4O4G A;  1RDD A;  2FC0 A;  4WE1 A;  4DTJ A;  1HNV A;  3RTV A;  1IG9 A;  2G8F A;  3L8B A;  2A1R A;  3ZT0 A;  4RW4 A;  3LAL A;  3CM5 A;  1VSJ A;  3KKS A;  3HVT A;  4IDK A;  3CG7 A;  3O4Q A;  2P51 A;  1ZBH A;  4DQR A;  1JL2 A;  1KFD A;  4W5N A;  4NCG A;  3AVF A;  3THV A;  1J54 A;  2KFZ A;  1U04 A;  3OYK A;  4DQI A;  4DFP A;  1VSI A;  4CEB A;  1LWF A;  3M8S A;  1CZ9 A;  1JLQ A;  3G0Z A;  4MFB A;  3ZT4 A;  3OYI A;  3DOL A;  3HST B;  3TAG A;  4M3U A;  1NK7 A;  4B9N A;  1HYS A;  4FLU A;  4FK4 A;  1TKT A;  3CFR A;  1QSL A;  1ZBF A;  4OJR A;  4DSI A;  1FKO A;  3NGZ A;  4OGE A;  1TL1 A;  3OYB A;  3VQQ A;  4FLW A;  4LD0 A;  1WN7 A;  4DQQ A;  1T7P A;  2A1S A;  4BDZ A;  1XHZ A;  2JGU A;  2YKM A;  2GBZ A;  4HUE A;  3TWH A;  3WNG A;  3VQ6 A;  4K8Z A;  1ASV A;  3NGI A;  3OYM A;  3V1Q A;  3K58 A;  4DFJ A;  2QXF A;  2B5J A;  4CJW A;  2ZQB A;  4CJR A;  3V9Z A;  1RT3 A;  3ZT3 A;  1S1W A;  4DFM A;  2W42 A;  3ALY A;  4H8K A;  5DMR A;  3OYL A;  4KTZ A;  1HJR A;  2IDO A;  4HHT A;  4PWD A;  4E3S A;  3QNO A;  1L5U A;  3DRP A;  4O55 A;  3TAQ A;  1JLG A;  1C0U A;  1JLB A;  4CFA A;  1ZBL A;  4DSK A;  4CGD A;  4CF2 A;  3V9W A;  3SPY A;  4FZX C;  3CFO A;  3VQC A;  4FLZ A;  4HVJ A;  4B3O A;  3LP1 A;  1BI4 A;  3T3F A;  4N41 A;  4E7J A;  2G8W A;  3S9H A;  4IFV A;  2OPQ A;  4PUO A;  4DQP A;  3MEE A;  1RIL A;  2EHG A;  4FW2 A;  4NYN A;  4DF4 A;  4M3Z A;  1SUQ A;  2KQ2 A;  1NOZ A;  3ZSV A;  4KPY A;  1NOY A;  3LPU A;  4CJ4 A;  1LWE A;  3SUO A;  3SNN A;  3MXI A;  4HUG A;  1X9M A;  1C6V A;  3V9U A;  1D9D A;  2X6S A;  4PQU A;  4CIF A;  4OKK A;  4CGJ A;  2F8T A;  3AA3 A;  1WSF A;  4CF8 A;  2OA8 A;  3DYA A;  4CHZ A;  5SZT A;  1HYZ A;  3I0R A;  3ITH A;  2XY7 A;  1NK6 A;  1X9S A;  3WNE A;  3SZ2 A;  4FJX A;  3K5O A;  4FJJ A;  4OLB A;  3OYH A;  3DMJ A;  4RG8 A;  5KI6 A;  3S3M A;  3IRX A;  4N56 A;  2FBY A;  1VSH A;  2OPR A;  3AVG A;  4BE2 A;  3PO4 A;  4FJN A;  3ASM A;  2HVH A;  1Z25 A;  3K5M A;  1DTT A;  3LZJ A;  1NKC A;  4Q0B A;  1RDC A;  4MQ3 A;  2IAJ A;  4RW8 A;  4LSN A;  1LAV A;  1UAX A;  4CED A;  4CFC A;  4O0J A;  2OPS A;  1A5V A;  4J2D A;  1SL2 A;  4E89 A;  1RDA A;  1VSK A;  3IS9 A;  1BCO A;  4KO0 A;  4F3O A;  4J2E A;  4DTU A;  4I7F A;  2G8U A;  1WAJ A;  4RW9 A;  2YHA A;  4Z0U A;  1Y97 A;  4DLG A;  4KB1 A;  4E19 A;  3OYJ A;  3AA4 A;  4F3T A;  3HVR A;  4R5P A;  3AVN A;  4E7I A;  3LPT A;  1JLA A;  3V4I A;  1Q8I A;  1SL1 A;  2KFN A;  4CCH A;  4FLY A;  1SV5 A;  3ZSX A;  4AHT A;  3QEX A;  3TAB A;  1WAF A;  3AVM A;  2E6M A;  2ZE2 A;  4CHY A;  4B08 A;  2QK9 A;  1A5X A;  1VK0 A;  1B9D A;  4CEE A;  3LAN A;  3NGY A;  3H08 A;  1QE1 A;  4H4O A;  4M3W A;  3HXM A;  4CJ3 A;  3DM2 A;  1B92 A;  1HYV A;  1S6Q A;  3AO2 A;  5T7B A;  3KLG A;  1ZBU A;  3G10 A;  2YNF A;  3AVH A;  1BI4 B;  4CEQ A;  3RWU A;  4FK2 A;  4CES A;  4KHQ A;  4OLA A;  1RBS A;  2RN2 A;  2HB5 A;  4LSL A;  4OPJ A;  1S1T A;  2Q3S A;  3RMB A;  1J5O A;  2HHX A;  1KSP A;  4DSE A;  1XC9 A;  3VQ5 A;  3S3N A;  2PYL A;  4KTQ A;  3K5N A;  2BGG A;  4DU1 A;  4B9T A;  1S1X A;  1TAU A;  3NFA A;  4LH5 A;  4DSF A;  1S6P A;  4DU3 A;  1IKV A;  4HCB A;  4B9S A;  4KB0 A;  4FJI A;  4CJS A;  3V9S A;  1HQE A;  3K2P A;  2E6L A;  3K59 A;  4C8K A;  1EET A;  4IBN A;  5CYM A;  1VRT A;  2KW4 A;  3WNH A;  3V6D A;  2VWJ A;  3DLR A;  1LW2 A;  1FKP A;  3VQ4 A;  3VQ8 A;  4E7L A;  4FM1 A;  4KHN A;  3RMA A;  4KTW A;  1UA0 A;  5FDL A;  1WNS A;  4EZ9 A;  2XO7 A;  3QER A;  1KTQ A;  2QKK A;  2BE2 A;  2E4L A;  4DS4 A;  2WON A;  1REV A;  3QIP A;  4M3Y A;  1UA1 A;  4CGI A;  3O3H A;  1TKX A;  3AO1 A;  3F9K A;  4CFD A;  5I42 A;  3BDP A;  4M3T A;  1HRH A;  1FXX A;  3OS2 A;  4CJU A;  2G8K A;  2KZZ A;  3TAR A;  4O0I A;  3AO5 A;  2O4I A;  4AH9 A;  4CJT A;  1TK0 A;  2IOC A;  1XHX A;  2VG7 A;  1BQM A;  3DLE A;  1N6Q A;  4FYD A;  3TAE A;  1CLQ A;  4AHC A;  3DRR A;  1IKY A;  3O4N A;  3L2V A;  3K5L A;  1D5A A;  3AVB A;  4BWJ A;  4BDY A;  1BCM A;  4B9L A;  4EP5 A;  2R7Y A;  3NAE A;  3AVL A;  3OVN A;  1C1B A;  2JLE A;  4IG0 A;  3KLF A;  3SV4 A;  4DSL A;  1VSD A;  5J2M A;  4F2S A;  5C24 A;  1TKZ A;  4KKO A;  4DTX A;  4DTN A;  4Q5V A;  1RT1 A;  5EU7 A;  3LP2 A;  4NCA A;  3VQD A;  4Z4I A;  4ZHR A;  4FZZ A;  1NJW A;  3NHG A;  4BDP A;  3VQ7 A;  2OZM A;  4FJ5 A;  4PA1 A;  3L2R A;  3NH1 A;  1KVB A;  3OYD A;  3PX0 A;  4M42 A;  1RBT A;  4IG3 A;  4OPK A;  4KHU A;  1DTQ A;  4AHU A;  1I3A A;  3V9X A;  4CHQ A;  5HP1 A;  4NCB A;  3AO3 A;  1BL3 A;  1KVC A;  3AVI A;  2XRI A;  4CJP A;  4E7H A;  4ELU A;  4FJ8 A;  3U3Y A;  2LSN A;  4AHR A;  1O1W A;  1TVR A;  3OYF A;  1WSH A;  1QTM A;  3RR8 A;  2Z1G A;  4ICL A;  5DK5 A;  3NDK A;  1T05 A;  4M3R A;  1U47 A;  1CZB A;  2IGI A;  3OS1 A;  3SQ0 A;  3V1R A;  1NK5 A;  4F2R A;  4E0D A;  3EZ5 A;  1RT7 A;  3HYF A;  3ZSR A;  4FLV A;  4YFU A;  1QSS A;  3I8D A;  3EY1 A;  2DFH A;  3ZSZ A;  1RT2 A;  1BQN A;  3CQ8 A;  1QHT A;  2G8I A;  1U4B A;  4KV8 A;  2I5J A;  1QQC A;  1UOC A;  1K6Y A;  3DRS A;  3KKR A;  4E7K A;  4I9L A;  2DFF A;  4YNQ A;  3OS0 A;  3HO1 A;  3KK3 A;  4CGF A;  4E1M A;  3QES A;  3QO9 A;  5FRM A;  2YV0 X;  2ETJ A;  2D0C A;  4BWM A;  2RKI A;  3LAK A;  3LZI A;  4FW1 A;  2YKN A;  4NYF A;  3WNF A;  3VA0 A;  3CYM A;  3D45 A;  2VG5 A;  3ISN C;  3TAP A;  4M3X A;  3QIO A;  3AVJ A;  2D0A A;  4OKE A;  2AJQ A;  4RW7 A;  2B6A A;  5KGX A;  2ATQ A;  3FFI A;  3EYZ A;  1GOA A;  4TSX A;  1L3U A;  3IAY A;  3L2W A;  2BAN A;  3NF9 A;  1VSL A;  4CIG A;  3OYE A;  1JLC A;  1S9G A;  2ZD1 A;  3K57 A;  3MAQ A;  3V1O A;  3AVK A;  1RBR A;  4ELT A;  1WSJ A;  4BAC A;  3SJJ A;  1JLE A;  1S9E A;  3DLK A;  2BDP A;  4GMJ B;  4ZTJ A;  4I9Q A;  1N5Y A;  1HQU A;  4C8N A;  4DTR A;  2HW3 A;  3AA5 X;  1S1U A;  1KLN A;  5KRS A;  3SUP A;  2X6N A;  3NH0 A;  1EXQ A;  2YHB A;  2HHT A;  1J9A A;  3PV8 A;  4DS5 A;  4EP4 A;  4DFK A;  3A2F A;  4DSJ A;  4PY5 A;  3AA2 A;  3KTQ A;  5CYQ A;  2HHW A;  5HRR A;  1SL0 A;  1KFS A;  2Z1H A;  1HPZ A;  3AVC A;  3OJU A;  1X1P A;  3QNN A;  4HUF A;  2VG6 A;  4HTU A;  3AVA A;  1TGO A;  3SQ2 A;  3KD1 E;  2DY4 A;  2HHU A;  1KLM A;  3QIN A;  2PZS A;  4KHW A;  3V81 A;  1RDB A;  1TK5 A;  1X9W A;  3ZSQ A;  2EX3 A;  4CF0 A;  2Y1J A;  1SKW A;  1IO2 A;  1RCH A;  4B8C A;  2VWK A;  5HRN A;  3TAF A;  5JS1 A;  2PY5 A;  4CGH A;  1J53 A;  1Z26 A;  2WOM A;  3P1G A;  5HBM A;  4KI6 A;  1JL1 A;  1EX4 A;  1LWC A;  4KI4 A;  4CK1 A;  4CJ5 A;  2KTQ A;  4FLT A;  4OVL A;  2P5O A;  1SKS A;  2YNH A;  3SQ4 A;  2FBT A;  1WSE A;  5FRO A;  3ZT2 A;  4CF1 A;  2FBX A;  3LWL A;  3B6P A;  3NCI A;  5JS2 A;  4BE1 A;  1NKE A;  1RT6 A;  4CJK A;  1RTI A;  3L2U A;  3KD5 E;  5CZ2 A;  2XY8 A;  5K14 A;  2DFE A;  4CEO A;  1L3S A;  3ZSW A;  4W5Q A;  1TV6 A;  1RBV A;  3HPH A;  5KGW A;  1KVA A;  2YNI A;  3LWM A;  4ID1 A;  4ZTF A;  1NJZ A;  2HHQ A;  1ZYQ A;  3NF7 A;  1TAQ A;  3LP0 A;  4DWI A;  1RT4 A;  4FJM A;  3HM9 A;  2YNG A;  4KRE A;  1WLJ A;  3VQE A;  2RPI A;  1HNI A;  3DI6 A;  2FBV A;  1QS4 A;  3C6U A;  3MED A;  3MXJ A;  2D5R A;  3LP3 A;  4G1Q A;  3ZSY A;  1BIS A;  5HRS A;  3KLE A;  3SUQ A;  4FJH A;  1DLO A;  2HND A;  4C8O A;  4F4K A;  4RW6 A;  4H4M A;  3OYG A;  1NKB A;  4JRQ A;  4CEF A;  3VQP A;  2GV9 A;  1NK8 A;  4N5S A;  3ZT1 A;  4AHV A;  1MU2 A;  4EZ6 A;  4B9M A;  3ZSO A;  2PYJ A;  1CXU A;  1C0T A;  3O3F A;  3NE6 A;  1RTD A;  3PO5 A;  4Z4H A;  4FJG A;  4CGG A;  2F8S A;  1U45 A;  4JRP A;  3L2Q A;  2OYQ A;  3UIQ A;  1JXE A;  1JLF A;  4ID5 A;  2ITG A;  1YTA A;  1NK4 A;  4Z4F A;  4OGC A;  2IS3 A;  3RMD A;  1ITG A;  3DLG A;  3NF8 A;  3O3G A;  3TI0 A;  1L3V A;  5CZ1 A;  2HHV A;  3OYC A;  3HPG A;  3NF6 A;  4CJF A;  4O44 A;  3OYN A;  3M8P A;  5HLF A;  1LW0 A;  1CXQ A;  3KJV A;  3L3U A;  1Q9X A;  2DTU A;  4W5O A;  4IKF A;  4B8A B;  1BGX T;  1TKD A;  4FVM A;  1FK9 A;  1G15 A;  5SWM A;  3KK2 A;  3AO4 A;  1U48 A;  2XHB A;  3RMC A;  4FXD A;  4CHP A;  5D3G A;  1BIZ A;  4DLE A;  4DTS A;  1HMV A;  3CM6 A;  4J2A A;  3E01 A;  4QAG A;  1RBU A;  4Y1D A;  4M41 A;  3DLH A;  2QKB A;  4DTO A;  3TAM A;  4W5R A;  1Q9Y A;  4CF9 A;  2XY6 A;  3RR7 A;  3VQA A;  4AHS A;  3TR8 A;  4DG1 A;  1U49 A;  1XWL A;  1KCF A;  3KIO A;  4O5B A;  3QEP A;  3SQ1 A;  1L3T A;  4FK0 A;  3F73 A;  2G8V A;  4DU4 A;  3OY9 A;  1D9F A;  3P83 D;  2RF2 A;  1T8E A;  3QEW A;  1GOC A;  4CEA A;  4JLH A;  1RT5 A;  4W5T A;  4DTM A;  1LV5 A;  4FZY A;  5FRN A;  1F21 A;  3PX4 A;  1VSE A;  3C94 A;  4CE9 A;  1EKE A;  3HT3 A;  4FM0 A;  3SUN A;  2GUI A;  5E41 A;  3HL8 A;  1XI1 A;  1NJY A;  1TL3 A;  4CFB A;  1ASW A;  5HRO A;  4Z4C A;  3CFP A;  4FJL A;  3M8R A;  2D0B A;  3QET A;  2OZS A;  3PUF A;  3B6O A;  4LY7 A;  4N47 A;  3M8Q A;  3ZCM A;  4J2B A;  1IH7 A;  4UQG A;  3D0P A;  4DTP A;  3VQ9 A;  1NK9 A;  3T1A A;  2F96 A;  5KTQ A;  4FJ9 A;  4JS4 A;  4HCC A;  4OKJ A;  3S3O A;  1LAW A;  3P5J A;  4CK3 A;  3SPZ A;  1TK8 A;  3QEI A;  4FLX A;  1QSY A;  4F8R A;  1C0M A;  1S5J A;  5J2P A;  4KHS A;  2HHS A;  4XIU A;  1GOB A;  1BIU A;  2Z1I A;  1W9H A;  5J2Q A;  2IC3 A;  2X74 A;  3BGR A;  2O4G A;  4I2Q A;  5HRP A;  1EP4 A;  4GW6 A;  3RRG A;  3PX6 A;  2B4J A;  3C6T A;  3HP9 A;  3IG1 A;  4IFY A;  3U3G A;  4E1N A;  4AIL C;  2Y1I A;  1WSI A;  4FM2 A;  4KHY A;  4CJL A;  2OPP A;  3TAN A;  5I3U A;  3MEG A;  1W0H A;  4GVM A;  3NH2 A;  2Z1J A;  3VQB A;  3U6F A;  1VSM A;  1BHL A;  3HP6 A;  1IKW A;  1JXB A;  2HNY A;  4DQS A;  4QOZ B;  4KAZ A;  4B9V A;  1WSG A;  1YT3 A;  4BE0 A;  3HJF A;  4DMN A;  3SYZ A;  3SCX A;  3KK1 A;  1D8Y A;  4ELV A;  2HNZ A;  4CEC A;  4Z4E A;  1VRU A;  1JKH A;  2KZM A;  3OYA A;  4C8L A;  2HMI A;  3ULD A;  3SV3 A;  3HK2 A;  3AV9 A;  1RTH A;  2NUB A;  2G8H A;  1IKX A;  4QCL A;  1UWB A;  1I39 A;  3KLI A;  4CJE A;  3JYT A;  4KFB A;  2P5G A;  4CHO A;  4CIE A;  3LDS A;  4CJQ A;  4B9U A;  3NBP A;  3DLB A;  4CHN A;  3DOK A;  3HPO A;  1T03 A;  3T19 A;  3PY8 A;  3MXM A;  2P1J A;  4C8M A;  4Z4G A;  4JS5 A;  4FJK A;  2X78 A;  1NJX A;  4K8X A;  4I2P A;  4LH4 A;  1YTU A;  3C95 A;  4Y1C A;  4DF8 A;  3LAM A;  4FJ7 A;  1RNH A;  1C1A A;  1A5W A;  3SI6 A;  1KRP A;  5C25 A;  5J2N A;  1RTJ A;  1ZBI A;  4CJV A;  4L8R B;  3L3V A;  4CEZ A;  3OJS A;  3RRH A;  2XY5 A;  3MEC A;  3VN5 A;  3KLH A;  5KRT A;  4CK2 A;  2HVI A;  3QLH A;  5CY4 A;  4KRF A;  1YVU A;  3QEV A;  1NK0 A;  3I0S A;  5C42 A;  4M45 A; 
#chains in the Genus database with same CATH topology
 4EFH A;  1B9F A;  4X64 K;  3JSM A;  2QWO A;  1ASU A;  4O4G A;  4WE1 A;  4DTJ A;  2G8F A;  2A1R A;  3ZT0 A;  4RW4 A;  2KLA A;  2GWK A;  5KQD A;  3QFP A;  4A59 A;  2ZJQ L;  1N33 K;  4W5N A;  1JL2 A;  1OH5 A;  1U04 A;  3OYK A;  2PBD A;  1BDG A;  5I9E B;  1NGJ A;  1LWF A;  1EWR A;  4M3U A;  3HST B;  4BR0 A;  4FOE A;  3B8A X;  4FK4 A;  4Z94 A;  1ZBF A;  4H0O A;  4YDU C;  3VQQ A;  3UKR B;  1WN7 A;  1T7P A;  2A1S A;  4HUE A;  4DR3 K;  3NGI A;  4FWP A;  2HHH K;  2AA4 A;  2QXF A;  2FSN A;  1NGA A;  4CJR A;  3BP8 A;  3KHY A;  3VGK A;  3ZT3 A;  1S1W A;  2P9L A;  4A57 A;  1YIT N;  3OYL A;  4KTZ A;  1HJR A;  4HHT A;  3JS6 A;  2GEL A;  3MCA B;  1JLG A;  1C0U A;  4CF2 A;  4BRI A;  3SPY A;  4FZX C;  1N32 K;  4N41 A;  3T3F A;  2P9P A;  4IFV A;  5KQ8 A;  3MEE A;  1NGE A;  5LJV A;  4DF4 A;  1SUQ A;  1LOT B;  1NOY A;  3LPU A;  1X9M A;  2HBM A;  3V9U A;  4CGJ A;  4JKG A;  3HOT A;  1RGI A;  3E9L A;  3DYA A;  5M1K A;  2XY7 A;  3I0R A;  5JVG L;  3SZ2 A;  4FJX A;  3MK6 A;  3CJC A;  1QZ5 A;  3OBW A;  4BRD A;  4RG8 A;  3IRX A;  2HVH A;  1VSH A;  2WTU A;  3K5M A;  1NKC A;  1W97 L;  4Q0B A;  5AQS A;  2IVP A;  2W40 A;  1LAV A;  4CED A;  1NGF A;  2FLO A;  4O0J A;  1SL2 A;  3WXL A;  3IS9 A;  2G8U A;  4B1W B;  4RW9 A;  3O1W A;  4DLG A;  1WBB A;  3OYJ A;  4F3T A;  1GLE G;  3IKM A;  3V4I A;  4FLY A;  4AHT A;  2E6M A;  4M63 C;  1A5X A;  5HOO A;  1B9D A;  2E2O A;  1NMN A;  4YOX A;  1U6Z A;  4H4O A;  3MWT A;  2ASM A;  3HXM A;  5FPD A;  1QVG M;  3AO2 A;  1ZBU A;  3G10 A;  2FF3 B;  2YNF A;  3LDO A;  1BI4 B;  2HOE A;  3RWU A;  4OLA A;  1RBS A;  1S1T A;  3C0B A;  2Q3S A;  3OBY A;  3DAW A;  5AQH A;  3VQ5 A;  3EE8 A;  3K5N A;  5AQR A;  2BGG A;  4WQ4 A;  4DU3 A;  4B9S A;  3DLL L;  4KB0 A;  4FJI A;  4CJS A;  3V9S A;  1HQE A;  1T6C A;  5CYM A;  3LM9 A;  4NLB A;  1HX1 A;  3WNH A;  3V6D A;  4JI3 K;  1VQN N;  1VQ4 N;  2QTD A;  4KHN A;  1N36 K;  3QER A;  3FZH A;  5TKW A;  4U67 L;  2QKK A;  4RWT A;  2O8E B;  4M3Y A;  1TKX A;  3C7N B;  1HRH A;  4JKA A;  4FWL A;  3S41 A;  3C65 A;  4B3R K;  2P9K A;  3CJ9 A;  3ENO A;  3DRR A;  2ITM A;  1D5A A;  3ENH A;  3QDK A;  1BCM A;  3T1Y K;  1MWK A;  1GLC G;  4O5F A;  5C2D A;  1IBK K;  4DTN A;  3VES A;  1RT1 A;  5EU7 A;  3VQD A;  1QQM A;  3NH1 A;  3OYD A;  3PX0 A;  4OPK A;  3ZX2 A;  1HNZ K;  1BL3 A;  2QA4 N;  3M5R A;  3E66 A;  1GLA G;  4E7H A;  4FJ8 A;  4AHR A;  1WSH A;  3RR8 A;  3QBX A;  2Z1G A;  4FL9 A;  4ICL A;  4OPA A;  1NBW A;  5DK5 A;  4WQ5 A;  3OS1 A;  4FWO A;  1NK5 A;  4E0D A;  3EZ5 A;  3HYF A;  1Q86 O;  3FFK B;  4RTF D;  2A5X A;  4YFU A;  2DFH A;  1Q18 A;  3ZSZ A;  3CCL N;  1BQN A;  4KV8 A;  4X66 K;  4JI8 K;  3HO1 A;  4EHU A;  3KK3 A;  4DQ8 A;  3QES A;  3K9J A;  2CH6 A;  3BF3 A;  2ETJ A;  2FSJ A;  5LMU K;  2YKN A;  4NYF A;  3WNF A;  4M3X A;  2VG5 A;  3T7Z A;  3AVJ A;  3IDH A;  2O8D B;  4BGB A;  3T1H K;  2O8B B;  1LCU A;  4YDU A;  5M1N A;  3AAQ A;  3EE9 A;  3K57 A;  3MAQ A;  3V1O A;  1RBR A;  2P9S A;  4BAC A;  3SJJ A;  1JLE A;  2YHX A;  1S9E A;  3AA5 X;  1BOT O;  4DV0 K;  4JNE A;  1EXQ A;  2YHB A;  4FWQ A;  1J9A A;  4EP4 A;  4JN4 A;  5AZI A;  4DFK A;  4QS8 A;  3VPZ A;  2VYP A;  4MO4 A;  4ILG B;  4RCH A;  1YJN N;  2FF6 A;  4HWI A;  2Z1H A;  4JHD A;  4H5R A;  3CF5 L;  3QNN A;  1KAZ A;  4HTU A;  3SQ2 A;  1JCE A;  1SKW A;  1VQL N;  2O8F B;  4CGH A;  1J53 A;  5HBM A;  1JL1 A;  3O6W A;  4DR6 K;  2QWM A;  4CJ5 A;  1ATR A;  3R3L A;  4OVL A;  4CZI A;  5FPM A;  2YNH A;  3SBT A;  2JWK A;  3THY B;  3ULE B;  3LWL A;  3B6P A;  4BE1 A;  3CCE N;  4GV3 A;  2DFE A;  1S3X A;  4W5Q A;  1ESV A;  3E1Y A;  3O1B A;  1ZYQ A;  3D2F A;  3HM9 A;  4KRE A;  1WLJ A;  1HNI A;  3C6U A;  4CGG A;  3LDP A;  2Q31 A;  3LP3 A;  5HRS A;  4GKK K;  1DGK N;  1DLO A;  2HND A;  4JI2 K;  4C8O A;  3MX5 A;  4H4M A;  3CCU N;  1Q81 O;  3VQP A;  2GV9 A;  4N5S A;  5BRE A;  4B9M A;  2PYJ A;  4LC9 B;  4FJG A;  2NRT A;  3L2Q A;  2CGJ A;  1EWQ A;  3OTO K;  4OGC A;  3NF8 A;  5BR8 K;  5AQY A;  3NF6 A;  2ZJR L;  2NNW A;  4CJF A;  5GAH P;  3EN9 A;  2E88 A;  3KJV A;  1Q9X A;  2DTU A;  4W5O A;  3CQX A;  3ZEU A;  5EX5 A;  4FVM A;  4JI6 K;  1TKD A;  3CCV N;  3WQU A;  4FXD A;  1V4S A;  5GAG P;  4GV9 A;  4JKF A;  4AM6 A;  4Y1D A;  3TAM A;  4W5R A;  4CF9 A;  3RR7 A;  3VEX A;  1L3T A;  1NWK A;  2P9N B;  2Q97 A;  4K0K K;  3TSU A;  2UYT A;  4I6M A;  3FGU A;  3OY9 A;  2W6L A;  3QEW A;  1GOC A;  4FZY A;  4JLH A;  3PX4 A;  1VSE A;  3C94 A;  1S22 A;  4CE9 A;  4BG8 A;  5C12 A;  5JMV A;  3MCP A;  2QWR A;  3QET A;  3MMV A;  1T6D A;  3CET A;  4N47 A;  4CBW A;  1KQS M;  1IH7 A;  1VQ7 N;  1DEJ A;  4J2B A;  4FJ9 A;  2Q36 A;  3ZET B;  1X3M A;  4DUY K;  4CK3 A;  1QSY A;  3QEI A;  1XQS C;  2OCE A;  1BIU A;  2Z1I A;  3K0S A;  5M1P A;  1EP4 A;  4GW6 A;  3RRG A;  1M90 O;  3WQT A;  4WF9 L;  4AIL C;  4CJL A;  2Z1J A;  3U6F A;  5AQN A;  2HNY A;  4BRC A;  4X65 K;  4KAZ A;  3QML A;  4B9V A;  1HLU A;  1YT3 A;  4DMN A;  1JKH A;  2KZM A;  4C8L A;  1JCG A;  4JI0 K;  4QCL A;  3JYT A;  3PY8 A;  1T03 A;  2J4R A;  3T19 A;  3MXM A;  5DM7 L;  4K8X A;  1NJX A;  3WXM B;  1VHX A;  3SI6 A;  1BWF O;  3D2E B;  1ZBI A;  3UKU B;  4CJV A;  4L8R B;  3L3V A;  1QQO A;  3KLH A;  5KRT A;  2HVI A;  3QLH A;  1YVU A;  4M45 A;  1VSF A;  4CER A;  1R0A A;  4B1Z A;  4N76 A;  1RDD A;  2FC0 A;  1HNV A;  1QVF M;  3A5O C;  1BO5 O;  5AQT A;  3LAL A;  3RVC A;  3OW2 M;  3HVT A;  4IDK A;  4CZE A;  3O4Q A;  1ZBH A;  2P51 A;  4FWN A;  1WBD A;  3AVF A;  4DQI A;  3FR0 A;  1CZ9 A;  3ZT4 A;  3OYI A;  1NK7 A;  1HYS A;  1NU0 A;  4FLU A;  2V51 B;  1QSL A;  4OJR A;  2Q2R A;  4OGE A;  3TTF A;  4LD0 A;  3WEE A;  4BRG A;  2JGU A;  3GBT A;  3PSF A;  4DFJ A;  4CJW A;  5EY4 A;  3OA9 A;  3V9Z A;  1EO1 A;  1OH6 A;  3LL3 A;  2YHW A;  5DMR A;  2IDO A;  4IJN A;  5AQJ A;  1L5U A;  1JLB A;  1ZBL A;  3V9W A;  4DR5 K;  3VQC A;  4DV5 K;  1U2V B;  4B3O A;  2WBN A;  4E7J A;  4CW7 B;  2EHG A;  4FW2 A;  4NYN A;  4IO9 L;  4R79 A;  4B3S K;  2KQ2 A;  1NOZ A;  3CME N;  1RDU A;  1LWE A;  3MXI A;  3MWP A;  1IV0 A;  4IJA A;  4IFE A;  4PQU A;  2W6K A;  4JI4 K;  2NRV A;  3HBT A;  1G99 A;  3AA3 A;  5BN8 A;  1YXQ A;  4BRA A;  4A2A A;  2FXU A;  3VGM A;  3IUC A;  5KPR A;  1MA9 B;  3K5O A;  3H1V X;  1NM1 A;  3FZL A;  4N56 A;  1Z25 A;  4BRO A;  1DTT A;  3LZJ A;  5BRD A;  4JD2 A;  5ADX H;  4RW8 A;  2BTF A;  2Q1N A;  3F5T A;  2OPS A;  1A5V A;  2UUB K;  1VSK A;  3E9P A;  1BCO A;  4J2E A;  2IVO A;  1WAJ A;  4IOC L;  4Z0U A;  4K42 A;  3HVR A;  2F7T A;  4R5P A;  3AVN A;  4E7I A;  1OH8 A;  1QHA A;  2DPN A;  3LPT A;  1J5E K;  1Q8I A;  3VGL A;  2P9L B;  1E3M A;  1SV5 A;  3ZSX A;  2QK9 A;  4CHY A;  4M7X A;  3CIP A;  4CEE A;  3H08 A;  3DM2 A;  1B92 A;  1HYV A;  5T7B A;  3KLG A;  3WUH A;  3NVK A;  2P9P B;  4FK2 A;  4BRF A;  4LSL A;  3RMB A;  1J5O A;  3NVM A;  1KSP A;  3CMA N;  3S3N A;  2OTJ N;  4DU1 A;  1S1X A;  2NLX A;  4LH5 A;  1S6P A;  1IKV A;  3O9S A;  3TTC A;  3K2P A;  3CD6 N;  4MLE A;  4JKG B;  2VCP A;  4C1N I;  1VRT A;  4NXM K;  2VWJ A;  1LW2 A;  3CER A;  1FKP A;  3GE1 A;  4KTW A;  4L3Q A;  1SS6 A;  5FDL A;  1UA0 A;  2VWB A;  2BE2 A;  2WON A;  1REV A;  1UA1 A;  3O3H A;  3F9K A;  3BDP A;  4BG9 A;  4M3T A;  1FXX A;  2G8K A;  3P31 A;  4O0I A;  2HST A;  1TYQ A;  1W7A A;  3MX2 A;  4IDH A;  4CJT A;  3CPW M;  2VG7 A;  4NLC A;  4JK7 A;  4BVO A;  1J6Z A;  4NB4 A;  4BWJ A;  2R7Y A;  2P9I A;  4H0X B;  3FZK A;  3AVL A;  2JLE A;  4IG0 A;  4F2S A;  3VEY A;  4Q5V A;  4Z4I A;  5MLC Q;  4JKB A;  3NHG A;  4BDP A;  4ISE A;  1K73 O;  4PA1 A;  4CZK A;  4KHU A;  1DTQ A;  3G71 N;  5AQW A;  2P9U A;  3AVI A;  2XRI A;  5EVZ A;  4OPH A;  1P90 A;  5CR4 A;  3U4L A;  1W2B M;  4F2R A;  3V1R A;  3ZSR A;  1QSS A;  3Q7C A;  3EY1 A;  4B3T K;  1HNX K;  2G8I A;  4CI6 A;  4GKJ K;  3CPE A;  4I9L A;  4E1M A;  3QO9 A;  3SAH A;  3J7A P;  1Z05 A;  2A40 A;  2RKI A;  3LAK A;  4FW1 A;  3VA0 A;  4H5W A;  3SK3 A;  3ZLJ A;  2P9K B;  2AJQ A;  2ATQ A;  1OVY A;  3EYZ A;  3KK7 A;  1L3U A;  3OYE A;  1VSL A;  2ZD1 A;  1WSJ A;  2QWN A;  4A62 A;  1HKC A;  3DLK A;  4GVE A;  2E5L K;  4ZTJ A;  1HQU A;  2HW3 A;  3HZ6 A;  2HHT A;  3PV8 A;  4DS5 A;  4YOV A;  3DXM A;  4J8F A;  3A2F A;  4DSJ A;  3ATU A;  1TUY A;  2A42 A;  3AA2 A;  3KTQ A;  5HRR A;  1HPZ A;  4BR7 A;  1X1P A;  4YOW A;  1NGH A;  1TGO A;  3KD1 E;  2DY4 A;  3CJ7 A;  4KHW A;  5AQF A;  4BRK A;  1RDB A;  3O8M A;  3QFU A;  2EX3 A;  4B8C A;  2QM1 A;  5HRN A;  1LWC A;  4CK1 A;  2KTQ A;  3WT0 A;  4B1X B;  3IFR A;  3AAP A;  1RDW X;  2FBT A;  1WSE A;  3AAR A;  5FRO A;  4CF1 A;  4FOI A;  4YOY A;  3NCI A;  2O8C A;  1XMQ K;  4LF5 K;  1RT6 A;  5LL6 Z;  1QQN A;  2YJE A;  4CJK A;  3KD5 E;  4YY3 K;  5CZ2 A;  3SJH A;  4JI5 K;  3HPH A;  1C0F A;  1KVA A;  1NJZ A;  2HHQ A;  2YNG A;  3VQE A;  2FBV A;  2D5R A;  5ELZ A;  1KC8 O;  4F4K A;  3CQY A;  1YF5 L;  4YOR A;  5AQZ A;  3ZT1 A;  2E1Y A;  1MU2 A;  4CZM A;  1RTD A;  2ASO A;  4Z4H A;  2P9S B;  1P8Z A;  4ID5 A;  4PKI A;  2IS3 A;  1HR0 K;  3BZK A;  3TI0 A;  2AP1 A;  4O44 A;  5AZI B;  1CXQ A;  4WYB A;  4IKF A;  1BGX T;  5SWM A;  2Q0U A;  4JHD B;  2XHB A;  3QB0 A;  1U48 A;  4BRE A;  5JLH A;  5D3G A;  1BIZ A;  2QXL A;  5EXW A;  4DLE A;  4DTS A;  3CM6 A;  2V7Y A;  1YI2 N;  1BG3 A;  4M41 A;  2OAN A;  4CVN E;  4DTO A;  2CGL A;  4FK0 A;  4DU4 A;  1D9F A;  2RF2 A;  4YHH K;  1LV5 A;  1RT5 A;  5FRN A;  4DV2 K;  4DR2 K;  4DV4 K;  1Z6R A;  3SUN A;  3GOI A;  2NRH A;  3HL8 A;  1XI1 A;  1NJY A;  3VER A;  1ASW A;  5HRO A;  4Z4C A;  3M8R A;  3PUF A;  2GEM A;  3D2F B;  4UQG A;  3VQ9 A;  1NK9 A;  2F96 A;  4ILH A;  1JCF A;  4F9O A;  1M1K O;  3UB5 A;  2GX9 A;  4HCC A;  3SPZ A;  1C0M A;  1BUP A;  2HHS A;  4XIU A;  1GOB A;  1BA1 A;  1VQ5 N;  3BGR A;  4B9Q A;  5HRP A;  5CHI A;  3PX6 A;  2B4J A;  3C6T A;  3HP9 A;  3IG1 A;  4IFY A;  1O13 A;  5ADX A;  4FM2 A;  3TAN A;  2D0P A;  3K9K A;  2BUP A;  5IWA K;  4BQZ A;  5M1Q A;  4BE0 A;  3ZEU B;  3KK1 A;  4Z4E A;  1VRU A;  2HMI A;  3I55 N;  3SV3 A;  3AV9 A;  2G8H A;  3L6Q A;  3LDS A;  4CJQ A;  5KPT A;  3DLB A;  3HPO A;  5BN9 A;  1XMO K;  2E20 A;  3HSC A;  4FJK A;  4I6M B;  3P38 A;  3ID6 A;  3EZW A;  1DKG D;  1X9J A;  4DF8 A;  3LAM A;  1IBL K;  3OHR A;  1KRP A;  5J2N A;  4PHT X;  4CEZ A;  3OJS A;  3VN5 A;  5F2R A;  2D0O A;  4KRF A;  2ZJP L;  3I0S A;  5C42 A;  1C1C A;  4PKH A;  3VA3 A;  1S1V A;  3G6E N;  1NG9 A;  4FSV A;  4O8K A;  4A2B A;  1IG9 A;  2HBK A;  3EKS A;  3THW A;  4IOX A;  3N4P A;  3CM5 A;  1VSJ A;  3KKS A;  3CG7 A;  3P39 A;  4DQR A;  1KFD A;  1V4T A;  2HMP A;  3THV A;  3LDL A;  5FLX O;  4KH4 A;  3M3Z A;  1JLQ A;  5BPL A;  4X62 K;  4MDA A;  1XNQ K;  3KWG A;  5KPZ A;  1TKT A;  3CFR A;  1K8K A;  2QWL A;  5AZJ A;  5GIO A;  4FLW A;  4DQQ A;  4BDZ A;  1I94 K;  5F0X A;  2YKM A;  3WNG A;  4K8Z A;  2B5J A;  4LF6 K;  2ZQB A;  2I7P A;  4MDB A;  5DM6 L;  3I33 A;  2CGK A;  4H8K A;  4PWD A;  2ZWH A;  4CFA A;  4DR4 K;  4CGD A;  3LDQ A;  4ISF A;  1HJO A;  5AQK A;  4FLZ A;  4HVJ A;  2UU9 K;  3LP1 A;  3H45 C;  2G8W A;  3S9H A;  2OPQ A;  4PUO A;  4DQP A;  4K25 A;  4BQL A;  1FJG K;  4KPY A;  4KBO A;  5H1S Q;  3HOS A;  1C6V A;  1KAX A;  4H5V A;  1D9D A;  4CIF A;  2F8T A;  1WSF A;  2OA8 A;  4CHZ A;  5SZT A;  3ITH A;  3BY5 A;  2GWJ A;  4WFA L;  2OPR A;  4FJN A;  3PO4 A;  3AVG A;  3N4Q A;  3ASM A;  4JI7 K;  2F4V K;  1DT9 A;  1RDC A;  4MQ3 A;  2IAJ A;  4BRH A;  3SAG A;  2IIR A;  4CFC A;  1TUU A;  3J81 O;  4DTU A;  4I7F A;  3WEE B;  1HNW K;  5M1O A;  5BPM A;  2E2P A;  3A5N C;  1ZBS A;  1JLA A;  4AQY K;  4CCH A;  3TAB A;  4IOA L;  3QEX A;  2KFN A;  3CCJ N;  3L4Q A;  3A5M C;  4B08 A;  1VK0 A;  3H3N O;  3W0L A;  3LAN A;  4QS7 A;  1S6Q A;  4BGA A;  3AVH A;  4KHQ A;  2RN2 A;  2HB5 A;  1T3V A;  4H0V B;  2JWL A;  1XC9 A;  2PYL A;  4KTQ A;  4XH4 A;  1MWM A;  1VQK N;  4B9T A;  4LF4 K;  3U8X A;  1TAU A;  4FWM A;  3NFA A;  3AY9 A;  5FPN A;  3TU5 A;  2E6L A;  3K59 A;  4C8K A;  2KW4 A;  4XEI A;  3DLR A;  5C10 A;  4JEP A;  5AQV A;  3VQ8 A;  4FM1 A;  2ASP A;  2XO7 A;  3VMF B;  3QIP A;  4CGI A;  3ZX3 A;  3J7Y P;  5I42 A;  4JD2 B;  3OS2 A;  4DUZ K;  2KZZ A;  5GIP A;  1VQ9 N;  3AO5 A;  2O4I A;  4AH9 A;  1TK0 A;  2QW9 A;  2IOC A;  1N6Q A;  1CLQ A;  3TAE A;  4AHC A;  1IKY A;  3AVB A;  4BDY A;  3J80 O;  3KLF A;  4DSL A;  4KKO A;  1NNE A;  4BR4 A;  4AF1 A;  3RSE A;  3R9P A;  5M1F A;  3VQ7 A;  3WXK A;  4M42 A;  1RBT A;  3P4I A;  3GG4 A;  5HP1 A;  4CHQ A;  5LJW A;  4NCB A;  3BZC A;  5E26 A;  4LF8 K;  1KVC A;  4ELU A;  2UUC K;  3LDN A;  3MN5 A;  1QTM A;  4JK9 A;  1T05 A;  4M3R A;  2IGI A;  1K9M O;  3SQ0 A;  5JLF A;  2ZGY A;  2UXB K;  3I8D A;  1E4F T;  1MDU B;  1BU6 O;  2E2N A;  3VTI A;  1RT2 A;  3VEO A;  1QHT A;  2D4W A;  1U4B A;  4LFC K;  5AQP A;  2I5J A;  1QQC A;  4E7K A;  2DFF A;  4CGF A;  4B3M K;  3KVG A;  2YV0 X;  3VEV A;  2I7N A;  4DCH A;  3VOV A;  2GTD A;  4DR7 K;  3LZI A;  1TYQ B;  1KXP A;  3M6G A;  3D45 A;  3TAP A;  3C6A A;  3C6H A;  4RW7 A;  4TSX A;  3IAY A;  2BAN A;  1JLC A;  2P9I B;  4BC3 A;  3HM8 A;  5AQG A;  4LFA K;  2BDP A;  4GMJ B;  4EHT A;  4I9Q A;  1SQK A;  4C8N A;  1KLN A;  5KRS A;  2X6N A;  4EAH D;  3O5B A;  4KHP K;  4O8U A;  3T69 A;  2HHW A;  4KH6 A;  5GIN A;  3ENB A;  3AVC A;  2F9T A;  2VG6 A;  3AVA A;  3CXC M;  3QIN A;  2PZS A;  2F9W A;  2P9U B;  1TK5 A;  1X9W A;  4A61 A;  3FE1 A;  1RCH A;  2VWK A;  3TAF A;  2PY5 A;  4UY8 O;  3D6R A;  5AQM A;  4KI4 A;  2P5O A;  3M1F A;  2YCH A;  1NJI O;  3O9R A;  3WXJ A;  1SAZ A;  2FBX A;  5JS2 A;  4CEO A;  3G4S N;  3ZSW A;  3CI5 A;  1L3S A;  1TV6 A;  5KGW A;  2YNI A;  3LWM A;  4ID1 A;  1TAQ A;  3LP0 A;  4FJM A;  1ATN A;  4B1V A;  3GDQ A;  2RPI A;  4BC2 A;  3DI6 A;  4G1Q A;  1QS4 A;  1YUW A;  3O80 A;  3MXJ A;  3ZSY A;  4FJH A;  5IT9 O;  1ZC6 A;  1NKB A;  4JRQ A;  3EKU A;  4CEF A;  3CC2 N;  4EZ6 A;  1CXU A;  1VQ8 N;  1YJW N;  2F8S A;  3THX A;  2OYQ A;  1JLF A;  1GLB G;  2ITG A;  1NK4 A;  1L3V A;  3SBG A;  3DLG A;  3O3G A;  5CZ1 A;  4DB3 A;  3I8B A;  1IBM K;  4JYA K;  3DXM B;  4LF7 K;  5BRH A;  3ID8 A;  3M8P A;  5HLF A;  1LW0 A;  3CJB A;  4IZ9 A;  3VF4 A;  1GLD G;  4B8A B;  1GLF O;  4WCE L;  3KK2 A;  3AO4 A;  1IG8 A;  3FLC O;  4CHP A;  3O9Q A;  1HMV A;  4MO5 A;  3E01 A;  3A5L C;  2QKB A;  1HKG A;  1Q9Y A;  1GLL O;  3VQA A;  3TR8 A;  1IJJ A;  4DG1 A;  3H46 O;  4FWS A;  1XWL A;  3KIO A;  5BR9 A;  1U49 A;  4O5B A;  3SQ1 A;  4CEA A;  4B1U B;  4W5T A;  1F21 A;  4JKE A;  1EKE A;  4QS9 A;  3HT3 A;  2GUI A;  4BC5 A;  2O8C B;  1TL3 A;  1YVN A;  2ZF5 O;  2QWP A;  4LF9 K;  2D0B A;  1NLV A;  5AQL A;  3DWL A;  4LY7 A;  3M8Q A;  3DXK B;  3ZCM A;  3SLC A;  3D0P A;  4XH5 A;  3T1A A;  2HF3 A;  3TSP A;  1CZA N;  1EQY A;  4OKJ A;  1OH7 A;  1TK8 A;  4CZJ A;  4F8R A;  3CC4 N;  4FLX A;  2RHK A;  1GLJ O;  1S5J A;  5E84 A;  5J2P A;  3J8A A;  4CBX A;  3W3D A;  1OKJ A;  5J2Q A;  3IMX A;  4I2Q A;  2V7Z A;  4KHY A;  1WSI A;  5EOY A;  5I3U A;  3MEG A;  1FW6 A;  3KZB A;  1VSM A;  3TSQ A;  1IKW A;  1JXB A;  1WSG A;  3UKR A;  3SYZ A;  1D8Y A;  1VQ6 N;  2QI2 A;  4BY9 C;  4JKH A;  2HBL A;  4JK8 A;  3OYA A;  1RTH A;  1I39 A;  4AM7 A;  5C0Y A;  4B9U A;  2PFU A;  3CCM N;  4Z4G A;  4JS5 A;  4NO7 A;  3FZF A;  4LH4 A;  1WOQ A;  3QIC A;  4Y1C A;  4FJ7 A;  1C1A A;  1A5W A;  1RTJ A;  3RRH A;  5AFU H;  4H03 B;  5HL7 L;  3J7Z O;  4CK2 A;  3DXK A;  5CY4 A;  1NK0 A;  5GAE P;  5J1E A;  4FCY A;  2BH1 A;  3VF2 A;  1SKR A;  3RTV A;  3L8B A;  4OX9 K;  1S72 N;  1QZ6 A;  3HRG A;  5B8H A;  3TTD A;  4NCG A;  1J54 A;  2KFZ A;  3PSI A;  4DFP A;  1VSI A;  4BR9 A;  4CEB A;  3M8S A;  3G0Z A;  3TAG A;  4MFB A;  3DOL A;  5AQX A;  3O08 A;  4B9N A;  1Q82 O;  4DSI A;  1FKO A;  3NGZ A;  1JJ2 M;  1TL1 A;  3OYB A;  1XHZ A;  2GBZ A;  3TWH A;  3VQ6 A;  1ASV A;  2YJF A;  5AQQ A;  4C1N K;  3OYM A;  3V1Q A;  3K58 A;  4H0P A;  3TPQ A;  4JI1 K;  1RT3 A;  4DFM A;  3KWI A;  2W42 A;  3ALY A;  4HTL A;  4IEI A;  2VQE K;  4E3S A;  3QNO A;  3DRP A;  4O55 A;  2E2Q A;  4YOU A;  4A5B A;  3TAQ A;  4DSK A;  1NGB A;  4MLH A;  4BRN A;  3CFO A;  1BI4 A;  3WXI A;  3L0Q A;  3L4I A;  4WFN L;  1RIL A;  2YI1 A;  1RFQ A;  4M3Z A;  1YAG A;  3AGK A;  2A41 A;  3ZSV A;  4CJ4 A;  3SUO A;  3SNN A;  3NMU A;  4CJ7 A;  2NRW A;  4HUG A;  3HTV A;  4JKC A;  3LM2 A;  2X6S A;  3H6E A;  4OKK A;  3CC7 N;  5AJ3 K;  4CF8 A;  1HYZ A;  3THW B;  1NK6 A;  1X9S A;  3WNE A;  4FJJ A;  4OLB A;  3OYH A;  3QBW A;  3DMJ A;  1VAZ A;  5KI6 A;  3S3M A;  4CZH A;  4NXN K;  2FBY A;  2IVN A;  4BE2 A;  2O8E A;  1WUA A;  1ZXO A;  3C7N A;  3BEX A;  4CZF A;  4LSN A;  1UAX A;  4K41 A;  4IWV A;  2KKZ A;  3VEZ A;  3R6M A;  4J2D A;  1VQO N;  1K8K B;  4E89 A;  1RDA A;  5AZJ B;  4KO0 A;  4F3O A;  2KHO A;  4CBU A;  2GUP A;  4H5N A;  2QEX N;  2YHA A;  1Y97 A;  4KB1 A;  4E19 A;  4GV6 A;  4DV7 K;  3AA4 A;  3HI0 A;  4KH5 A;  1SL1 A;  1XNR K;  1WAF A;  3AVM A;  2ZE2 A;  3NGY A;  1QE1 A;  4M3W A;  4CJ3 A;  5TKY A;  2YHY A;  4U7B A;  4V19 S;  4CEQ A;  4CES A;  4BVP A;  1E4G T;  5LY3 A;  4OPJ A;  2HHX A;  3AGR A;  2ZGZ A;  1D4X A;  4DSE A;  3MDQ A;  3CCR N;  3A0I X;  3O9T A;  4HCB A;  3CJ1 A;  4DSF A;  3G25 A;  2UXC K;  1EET A;  4IBN A;  4GY2 B;  1HUX A;  3F9M A;  3R1X A;  4E7L A;  3VQ4 A;  1XC3 A;  3RMA A;  3MN6 A;  3VF6 A;  1WNS A;  4EZ9 A;  1KTQ A;  1N34 K;  4Y0W A;  2E4L A;  4DS4 A;  2PAV A;  3AO1 A;  4CFD A;  4BR5 A;  3PLA A;  2EWS A;  4CJU A;  3SMP A;  4K43 A;  3TAR A;  3VTH A;  1XHX A;  3DLE A;  1BQM A;  4E1J A;  1WB9 A;  4FYD A;  2O8D A;  2D1K A;  2O8B A;  3O4N A;  3L2V A;  3K5L A;  3F2K A;  2NRR A;  1R59 O;  4B9L A;  4EP5 A;  3NAE A;  3OVN A;  1C1B A;  3SV4 A;  1T44 A;  1VSD A;  5J2M A;  5C24 A;  1TKZ A;  4DTX A;  2A3Z A;  3LP2 A;  4NCA A;  5JIC A;  3GL1 A;  4ZHR A;  4FZZ A;  3EL2 A;  3JXU A;  1NJW A;  3ATV A;  1K8A O;  2OZM A;  4PKG A;  4FJ5 A;  3E9O A;  3L2R A;  1KVB A;  3UE5 A;  4IG3 A;  5BPN A;  4AHU A;  1I3A A;  4CD1 A;  3V9X A;  3AO3 A;  4CJP A;  2O8F A;  3U3Y A;  2LSN A;  1O1W A;  1TVR A;  1NMD A;  3OYF A;  4BC4 A;  3NDK A;  1U47 A;  1CZB A;  5AR0 A;  1RT7 A;  4FLV A;  3THY A;  3ULE A;  3CQ8 A;  5AQO A;  3KKR A;  1UOC A;  1K6Y A;  3DRS A;  3OS0 A;  4YNQ A;  3BUZ B;  5AQU A;  4CZG A;  5FRM A;  4G9Z A;  4FO0 A;  2D0C A;  4BWM A;  2NRX A;  4IXC A;  1YIJ N;  3CYM A;  3ISN C;  3QIO A;  5JVH L;  2D0A A;  4OKE A;  2W41 A;  2B6A A;  5KGX A;  3FFI A;  1GOA A;  3L2W A;  3BF1 A;  3NF9 A;  4ILJ A;  4CIG A;  1S9G A;  3SAF A;  3AVK A;  4ELT A;  4YOT A;  4OO1 J;  4XH1 A;  4FWR A;  1N5Y A;  4DTR A;  3CCS N;  4PL7 A;  1S1U A;  5CE3 A;  3SUP A;  3NH0 A;  3RSE B;  2NZT A;  2WC9 A;  4PY5 A;  4DR1 K;  3R8E A;  5CYQ A;  2Q0R A;  1SL0 A;  1KFS A;  3OJU A;  4HUF A;  3D7E O;  2HHU A;  1KLM A;  4H0T B;  4BR2 A;  3V81 A;  4DV3 K;  4DV1 K;  5GAD P;  4DV6 K;  3ZSQ A;  3VEW A;  4CF0 A;  2Y1J A;  1IO2 A;  2E8A A;  5JS1 A;  2HBJ A;  3H3O B;  1Z26 A;  2WOM A;  3P1G A;  4KI6 A;  1EX4 A;  2P9N A;  3SMS A;  4FWK A;  5C15 A;  4FLT A;  4C23 A;  1SKS A;  3SQ4 A;  3ZT2 A;  5AFU A;  1NKE A;  4FPA A;  3PIO L;  1RTI A;  3L2U A;  5K14 A;  2XY8 A;  3ZX0 A;  4BRM A;  1RBV A;  4ZTF A;  4LFB K;  4ISG A;  3NF7 A;  5FPE A;  4WFB L;  4DWI A;  1RT4 A;  2CH5 A;  2OTL N;  4JKD A;  3ZET A;  3MED A;  3CCQ N;  3SUQ A;  4EIA A;  1BIS A;  2VQF K;  3KLE A;  4RW6 A;  3OYG A;  2RE2 A;  4JV5 K;  4A5A A;  1NK8 A;  4IO8 A;  4AHV A;  3ZSO A;  3PO5 A;  3VET A;  1C0T A;  3O3F A;  3NE6 A;  1KD1 O;  1U45 A;  4JRP A;  3UIQ A;  1JXE A;  1YTA A;  4Z4F A;  3RMD A;  1ITG A;  2HHV A;  3OYC A;  3HPG A;  3OYN A;  1SZ2 A;  2VGN A;  3EEQ A;  1X3N A;  3L3U A;  2FSK A;  4BRP A;  3CHW A;  1VQM N;  1YHQ N;  1FK9 A;  1G15 A;  3RMC A;  3U9Z A;  3A8Y A;  1ATS A;  1Y64 A;  1NGD A;  4CZL A;  3PIP L;  4J2A A;  1HPM A;  3FZM A;  3H1Q A;  4QAG A;  1RBU A;  2VGM A;  3DLH A;  3I56 N;  2XY6 A;  1NGG A;  4AHS A;  4BRL A;  1KCF A;  3VEN A;  3QEP A;  3F73 A;  2G8V A;  3O9U A;  2H3G X;  3P83 D;  4DKW A;  4FPB A;  1T8E A;  1Q7Y O;  4DTM A;  3O4W A;  4IEE A;  4FM0 A;  5E41 A;  3MN7 A;  3D2E A;  1C0G A;  2E1Z A;  4H0Y B;  3UKU A;  4JAX A;  2V52 B;  4CFB A;  3CFP A;  4FJL A;  2QWQ A;  4WQ4 C;  2OZS A;  3B6O A;  3U9D A;  1NGC A;  4DTP A;  2ZM6 K;  2UUA K;  2HF4 A;  5KTQ A;  4JS4 A;  3EO3 A;  1N8R O;  2NRZ A;  3S3O A;  1LAW A;  3P5J A;  3CJA A;  3JAM O;  5LMN K;  4KHS A;  2WUS A;  1YJ9 N;  1ILY A;  1W9H A;  5F1X A;  2IC3 A;  2X74 A;  3ZYY X;  2O4G A;  4GNI A;  3THX B;  4E1N A;  2Y1I A;  3U3G A;  2WFB A;  1HKB A;  2OPP A;  1W0H A;  5AQI A;  4GVM A;  3NH2 A;  3VQB A;  1BHL A;  3HP6 A;  4QOZ B;  4DQS A;  1OVQ A;  1XUP O;  3HJF A;  3SCX A;  5BRF A;  4ELV A;  2HNZ A;  2A6A A;  4CEC A;  3ULD A;  3HK2 A;  3DJC A;  1H1V A;  2NUB A;  1IKX A;  1NGI A;  1UWB A;  3KLI A;  4CJE A;  2UXD K;  3Q7B A;  4KFB A;  5C2F A;  3MN9 A;  4CHO A;  4CIE A;  2P5G A;  4B1Y B;  3NBP A;  4CHN A;  3DOK A;  2P1J A;  4C8M A;  5A2Q O;  1BA0 A;  1VQP N;  2X78 A;  4I2P A;  1YTU A;  3C95 A;  4FVU A;  1KAY A;  1RNH A;  1U2V A;  4H5T A;  5C25 A;  2YX6 A;  2XY5 A;  3MEC A;  4M7Y A;  4BRQ A;  4CD3 A;  3QEV A;  4DHY A;  4WQ5 C;  4PL8 A; 
#chains in the Genus database with same CATH homology
 1VSF A;  1C1C A;  5J1E A;  3VA3 A;  4FCY A;  1B9F A;  1S1V A;  4CER A;  3JSM A;  1R0A A;  4N76 A;  1SKR A;  1ASU A;  4O4G A;  1RDD A;  2FC0 A;  4WE1 A;  4DTJ A;  1HNV A;  3RTV A;  1IG9 A;  2G8F A;  3L8B A;  2A1R A;  3ZT0 A;  4RW4 A;  3LAL A;  3CM5 A;  1VSJ A;  3KKS A;  3HVT A;  4IDK A;  3CG7 A;  3O4Q A;  2P51 A;  1ZBH A;  4DQR A;  1JL2 A;  1KFD A;  4W5N A;  4NCG A;  3AVF A;  3THV A;  1J54 A;  2KFZ A;  1U04 A;  3OYK A;  4DQI A;  4DFP A;  1VSI A;  4CEB A;  1LWF A;  3M8S A;  1CZ9 A;  1JLQ A;  3G0Z A;  4MFB A;  3ZT4 A;  3OYI A;  3DOL A;  3HST B;  3TAG A;  4M3U A;  1NK7 A;  4B9N A;  1HYS A;  4FLU A;  4FK4 A;  1TKT A;  3CFR A;  1QSL A;  1ZBF A;  4OJR A;  4DSI A;  1FKO A;  3NGZ A;  4OGE A;  1TL1 A;  3OYB A;  3VQQ A;  4FLW A;  4LD0 A;  1WN7 A;  4DQQ A;  1T7P A;  2A1S A;  4BDZ A;  1XHZ A;  2JGU A;  2YKM A;  2GBZ A;  4HUE A;  3TWH A;  3WNG A;  3VQ6 A;  4K8Z A;  1ASV A;  3NGI A;  3OYM A;  3V1Q A;  3K58 A;  4DFJ A;  2QXF A;  2B5J A;  4CJW A;  2ZQB A;  4CJR A;  3V9Z A;  1RT3 A;  3ZT3 A;  1S1W A;  4DFM A;  2W42 A;  3ALY A;  4H8K A;  5DMR A;  3OYL A;  4KTZ A;  1HJR A;  2IDO A;  4HHT A;  4PWD A;  4E3S A;  3QNO A;  1L5U A;  3DRP A;  4O55 A;  3TAQ A;  1JLG A;  1C0U A;  1JLB A;  4CFA A;  1ZBL A;  4DSK A;  4CGD A;  4CF2 A;  3V9W A;  3SPY A;  4FZX C;  3CFO A;  3VQC A;  4FLZ A;  4HVJ A;  4B3O A;  3LP1 A;  1BI4 A;  3T3F A;  4N41 A;  4E7J A;  2G8W A;  3S9H A;  4IFV A;  2OPQ A;  4PUO A;  4DQP A;  3MEE A;  1RIL A;  2EHG A;  4FW2 A;  4NYN A;  4DF4 A;  4M3Z A;  1SUQ A;  2KQ2 A;  1NOZ A;  3ZSV A;  4KPY A;  1NOY A;  3LPU A;  4CJ4 A;  1LWE A;  3SUO A;  3SNN A;  3MXI A;  4HUG A;  1X9M A;  1C6V A;  3V9U A;  1D9D A;  2X6S A;  4PQU A;  4CIF A;  4OKK A;  4CGJ A;  2F8T A;  3AA3 A;  1WSF A;  4CF8 A;  2OA8 A;  3DYA A;  4CHZ A;  5SZT A;  1HYZ A;  3I0R A;  3ITH A;  2XY7 A;  1NK6 A;  1X9S A;  3WNE A;  3SZ2 A;  4FJX A;  3K5O A;  4FJJ A;  4OLB A;  3OYH A;  3DMJ A;  4RG8 A;  5KI6 A;  3S3M A;  3IRX A;  4N56 A;  2FBY A;  1VSH A;  2OPR A;  3AVG A;  4BE2 A;  3PO4 A;  4FJN A;  3ASM A;  2HVH A;  1Z25 A;  3K5M A;  1DTT A;  3LZJ A;  1NKC A;  4Q0B A;  1RDC A;  4MQ3 A;  2IAJ A;  4RW8 A;  4LSN A;  1LAV A;  1UAX A;  4CED A;  4CFC A;  4O0J A;  2OPS A;  1A5V A;  4J2D A;  1SL2 A;  4E89 A;  1RDA A;  1VSK A;  3IS9 A;  1BCO A;  4KO0 A;  4F3O A;  4J2E A;  4DTU A;  4I7F A;  2G8U A;  1WAJ A;  4RW9 A;  2YHA A;  4Z0U A;  1Y97 A;  4DLG A;  4KB1 A;  4E19 A;  3OYJ A;  3AA4 A;  4F3T A;  3HVR A;  4R5P A;  3AVN A;  4E7I A;  3LPT A;  1JLA A;  3V4I A;  1Q8I A;  1SL1 A;  2KFN A;  4CCH A;  4FLY A;  1SV5 A;  3ZSX A;  4AHT A;  3QEX A;  3TAB A;  1WAF A;  3AVM A;  2E6M A;  2ZE2 A;  4CHY A;  4B08 A;  2QK9 A;  1A5X A;  1VK0 A;  1B9D A;  4CEE A;  3LAN A;  3NGY A;  3H08 A;  1QE1 A;  4H4O A;  4M3W A;  3HXM A;  4CJ3 A;  3DM2 A;  1B92 A;  1HYV A;  1S6Q A;  3AO2 A;  5T7B A;  3KLG A;  1ZBU A;  3G10 A;  2YNF A;  3AVH A;  1BI4 B;  4CEQ A;  3RWU A;  4FK2 A;  4CES A;  4KHQ A;  4OLA A;  1RBS A;  2RN2 A;  2HB5 A;  4LSL A;  4OPJ A;  1S1T A;  2Q3S A;  3RMB A;  1J5O A;  2HHX A;  1KSP A;  4DSE A;  1XC9 A;  3VQ5 A;  3S3N A;  2PYL A;  4KTQ A;  3K5N A;  2BGG A;  4DU1 A;  4B9T A;  1S1X A;  1TAU A;  3NFA A;  4LH5 A;  4DSF A;  1S6P A;  4DU3 A;  1IKV A;  4HCB A;  4B9S A;  4KB0 A;  4FJI A;  4CJS A;  3V9S A;  1HQE A;  3K2P A;  2E6L A;  3K59 A;  4C8K A;  1EET A;  4IBN A;  5CYM A;  1VRT A;  2KW4 A;  3WNH A;  3V6D A;  2VWJ A;  3DLR A;  1LW2 A;  1FKP A;  3VQ4 A;  3VQ8 A;  4E7L A;  4FM1 A;  4KHN A;  3RMA A;  4KTW A;  1UA0 A;  5FDL A;  1WNS A;  4EZ9 A;  2XO7 A;  3QER A;  1KTQ A;  2QKK A;  2BE2 A;  2E4L A;  4DS4 A;  2WON A;  1REV A;  3QIP A;  4M3Y A;  1UA1 A;  4CGI A;  3O3H A;  1TKX A;  3AO1 A;  3F9K A;  4CFD A;  5I42 A;  3BDP A;  4M3T A;  1HRH A;  1FXX A;  3OS2 A;  4CJU A;  2G8K A;  2KZZ A;  3TAR A;  4O0I A;  3AO5 A;  2O4I A;  4AH9 A;  4CJT A;  1TK0 A;  2IOC A;  1XHX A;  2VG7 A;  1BQM A;  3DLE A;  1N6Q A;  4FYD A;  3TAE A;  1CLQ A;  4AHC A;  3DRR A;  1IKY A;  3O4N A;  3L2V A;  3K5L A;  1D5A A;  3AVB A;  4BWJ A;  4BDY A;  1BCM A;  4B9L A;  4EP5 A;  2R7Y A;  3NAE A;  3AVL A;  3OVN A;  1C1B A;  2JLE A;  4IG0 A;  3KLF A;  3SV4 A;  4DSL A;  1VSD A;  5J2M A;  4F2S A;  5C24 A;  1TKZ A;  4KKO A;  4DTX A;  4DTN A;  4Q5V A;  1RT1 A;  5EU7 A;  3LP2 A;  4NCA A;  3VQD A;  4Z4I A;  4ZHR A;  4FZZ A;  1NJW A;  3NHG A;  4BDP A;  3VQ7 A;  2OZM A;  4FJ5 A;  4PA1 A;  3L2R A;  3NH1 A;  1KVB A;  3OYD A;  3PX0 A;  4M42 A;  1RBT A;  4IG3 A;  4OPK A;  4KHU A;  1DTQ A;  4AHU A;  1I3A A;  3V9X A;  4CHQ A;  5HP1 A;  4NCB A;  3AO3 A;  1BL3 A;  1KVC A;  3AVI A;  2XRI A;  4CJP A;  4E7H A;  4ELU A;  4FJ8 A;  3U3Y A;  2LSN A;  4AHR A;  1O1W A;  1TVR A;  3OYF A;  1WSH A;  1QTM A;  3RR8 A;  2Z1G A;  4ICL A;  5DK5 A;  3NDK A;  1T05 A;  4M3R A;  1U47 A;  1CZB A;  2IGI A;  3OS1 A;  3SQ0 A;  3V1R A;  1NK5 A;  4F2R A;  4E0D A;  3EZ5 A;  1RT7 A;  3HYF A;  3ZSR A;  4FLV A;  4YFU A;  1QSS A;  3I8D A;  3EY1 A;  2DFH A;  3ZSZ A;  1RT2 A;  1BQN A;  3CQ8 A;  1QHT A;  2G8I A;  1U4B A;  4KV8 A;  2I5J A;  1QQC A;  1UOC A;  1K6Y A;  3DRS A;  3KKR A;  4E7K A;  4I9L A;  2DFF A;  4YNQ A;  3OS0 A;  3HO1 A;  3KK3 A;  4CGF A;  4E1M A;  3QES A;  3QO9 A;  5FRM A;  2YV0 X;  2ETJ A;  2D0C A;  4BWM A;  2RKI A;  3LAK A;  3LZI A;  4FW1 A;  2YKN A;  4NYF A;  3WNF A;  3VA0 A;  3CYM A;  3D45 A;  2VG5 A;  3ISN C;  3TAP A;  4M3X A;  3QIO A;  3AVJ A;  2D0A A;  4OKE A;  2AJQ A;  4RW7 A;  2B6A A;  5KGX A;  2ATQ A;  3FFI A;  3EYZ A;  1GOA A;  4TSX A;  1L3U A;  3IAY A;  3L2W A;  2BAN A;  3NF9 A;  1VSL A;  4CIG A;  3OYE A;  1JLC A;  1S9G A;  2ZD1 A;  3K57 A;  3MAQ A;  3V1O A;  3AVK A;  1RBR A;  4ELT A;  1WSJ A;  4BAC A;  3SJJ A;  1JLE A;  1S9E A;  3DLK A;  2BDP A;  4GMJ B;  4ZTJ A;  4I9Q A;  1N5Y A;  1HQU A;  4C8N A;  4DTR A;  2HW3 A;  3AA5 X;  1S1U A;  1KLN A;  5KRS A;  3SUP A;  2X6N A;  3NH0 A;  1EXQ A;  2YHB A;  2HHT A;  1J9A A;  3PV8 A;  4DS5 A;  4EP4 A;  4DFK A;  3A2F A;  4DSJ A;  4PY5 A;  3AA2 A;  3KTQ A;  5CYQ A;  2HHW A;  5HRR A;  1SL0 A;  1KFS A;  2Z1H A;  1HPZ A;  3AVC A;  3OJU A;  1X1P A;  3QNN A;  4HUF A;  2VG6 A;  4HTU A;  3AVA A;  1TGO A;  3SQ2 A;  3KD1 E;  2DY4 A;  2HHU A;  1KLM A;  3QIN A;  2PZS A;  4KHW A;  3V81 A;  1RDB A;  1TK5 A;  1X9W A;  3ZSQ A;  2EX3 A;  4CF0 A;  2Y1J A;  1SKW A;  1IO2 A;  1RCH A;  4B8C A;  2VWK A;  5HRN A;  3TAF A;  5JS1 A;  2PY5 A;  4CGH A;  1J53 A;  1Z26 A;  2WOM A;  3P1G A;  5HBM A;  4KI6 A;  1JL1 A;  1EX4 A;  1LWC A;  4KI4 A;  4CK1 A;  4CJ5 A;  2KTQ A;  4FLT A;  4OVL A;  2P5O A;  1SKS A;  2YNH A;  3SQ4 A;  2FBT A;  1WSE A;  5FRO A;  3ZT2 A;  4CF1 A;  2FBX A;  3LWL A;  3B6P A;  3NCI A;  5JS2 A;  4BE1 A;  1NKE A;  1RT6 A;  4CJK A;  1RTI A;  3L2U A;  3KD5 E;  5CZ2 A;  2XY8 A;  5K14 A;  2DFE A;  4CEO A;  1L3S A;  3ZSW A;  4W5Q A;  1TV6 A;  1RBV A;  3HPH A;  5KGW A;  1KVA A;  2YNI A;  3LWM A;  4ID1 A;  4ZTF A;  1NJZ A;  2HHQ A;  1ZYQ A;  3NF7 A;  1TAQ A;  3LP0 A;  4DWI A;  1RT4 A;  4FJM A;  3HM9 A;  2YNG A;  4KRE A;  1WLJ A;  3VQE A;  2RPI A;  1HNI A;  3DI6 A;  2FBV A;  1QS4 A;  3C6U A;  3MED A;  3MXJ A;  2D5R A;  3LP3 A;  4G1Q A;  3ZSY A;  1BIS A;  5HRS A;  3KLE A;  3SUQ A;  4FJH A;  1DLO A;  2HND A;  4C8O A;  4F4K A;  4RW6 A;  4H4M A;  3OYG A;  1NKB A;  4JRQ A;  4CEF A;  3VQP A;  2GV9 A;  1NK8 A;  4N5S A;  3ZT1 A;  4AHV A;  1MU2 A;  4EZ6 A;  4B9M A;  3ZSO A;  2PYJ A;  1CXU A;  1C0T A;  3O3F A;  3NE6 A;  1RTD A;  3PO5 A;  4Z4H A;  4FJG A;  4CGG A;  2F8S A;  1U45 A;  4JRP A;  3L2Q A;  2OYQ A;  3UIQ A;  1JXE A;  1JLF A;  4ID5 A;  2ITG A;  1YTA A;  1NK4 A;  4Z4F A;  4OGC A;  2IS3 A;  3RMD A;  1ITG A;  3DLG A;  3NF8 A;  3O3G A;  3TI0 A;  1L3V A;  5CZ1 A;  2HHV A;  3OYC A;  3HPG A;  3NF6 A;  4CJF A;  4O44 A;  3OYN A;  3M8P A;  5HLF A;  1LW0 A;  1CXQ A;  3KJV A;  3L3U A;  1Q9X A;  2DTU A;  4W5O A;  4IKF A;  4B8A B;  1BGX T;  1TKD A;  4FVM A;  1FK9 A;  1G15 A;  5SWM A;  3KK2 A;  3AO4 A;  1U48 A;  2XHB A;  3RMC A;  4FXD A;  4CHP A;  5D3G A;  1BIZ A;  4DLE A;  4DTS A;  1HMV A;  3CM6 A;  4J2A A;  3E01 A;  4QAG A;  1RBU A;  4Y1D A;  4M41 A;  3DLH A;  2QKB A;  4DTO A;  3TAM A;  4W5R A;  1Q9Y A;  4CF9 A;  2XY6 A;  3RR7 A;  3VQA A;  4AHS A;  3TR8 A;  4DG1 A;  1U49 A;  1XWL A;  1KCF A;  3KIO A;  4O5B A;  3QEP A;  3SQ1 A;  1L3T A;  4FK0 A;  3F73 A;  2G8V A;  4DU4 A;  3OY9 A;  1D9F A;  3P83 D;  2RF2 A;  1T8E A;  3QEW A;  1GOC A;  4CEA A;  4JLH A;  1RT5 A;  4W5T A;  4DTM A;  1LV5 A;  4FZY A;  5FRN A;  1F21 A;  3PX4 A;  1VSE A;  3C94 A;  4CE9 A;  1EKE A;  3HT3 A;  4FM0 A;  3SUN A;  2GUI A;  5E41 A;  3HL8 A;  1XI1 A;  1NJY A;  1TL3 A;  4CFB A;  1ASW A;  5HRO A;  4Z4C A;  3CFP A;  4FJL A;  3M8R A;  2D0B A;  3QET A;  2OZS A;  3PUF A;  3B6O A;  4LY7 A;  4N47 A;  3M8Q A;  3ZCM A;  4J2B A;  1IH7 A;  4UQG A;  3D0P A;  4DTP A;  3VQ9 A;  1NK9 A;  3T1A A;  2F96 A;  5KTQ A;  4FJ9 A;  4JS4 A;  4HCC A;  4OKJ A;  3S3O A;  1LAW A;  3P5J A;  4CK3 A;  3SPZ A;  1TK8 A;  3QEI A;  4FLX A;  1QSY A;  4F8R A;  1C0M A;  1S5J A;  5J2P A;  4KHS A;  2HHS A;  4XIU A;  1GOB A;  1BIU A;  2Z1I A;  1W9H A;  5J2Q A;  2IC3 A;  2X74 A;  3BGR A;  2O4G A;  4I2Q A;  5HRP A;  1EP4 A;  4GW6 A;  3RRG A;  3PX6 A;  2B4J A;  3C6T A;  3HP9 A;  3IG1 A;  4IFY A;  3U3G A;  4E1N A;  4AIL C;  2Y1I A;  1WSI A;  4FM2 A;  4KHY A;  4CJL A;  2OPP A;  3TAN A;  5I3U A;  3MEG A;  1W0H A;  4GVM A;  3NH2 A;  2Z1J A;  3VQB A;  3U6F A;  1VSM A;  1BHL A;  3HP6 A;  1IKW A;  1JXB A;  2HNY A;  4DQS A;  4QOZ B;  4KAZ A;  4B9V A;  1WSG A;  1YT3 A;  4BE0 A;  3HJF A;  4DMN A;  3SYZ A;  3SCX A;  3KK1 A;  1D8Y A;  4ELV A;  2HNZ A;  4CEC A;  4Z4E A;  1VRU A;  1JKH A;  2KZM A;  3OYA A;  4C8L A;  2HMI A;  3ULD A;  3SV3 A;  3HK2 A;  3AV9 A;  1RTH A;  2NUB A;  2G8H A;  1IKX A;  4QCL A;  1UWB A;  1I39 A;  3KLI A;  4CJE A;  3JYT A;  4KFB A;  2P5G A;  4CHO A;  4CIE A;  3LDS A;  4CJQ A;  4B9U A;  3NBP A;  3DLB A;  4CHN A;  3DOK A;  3HPO A;  1T03 A;  3T19 A;  3PY8 A;  3MXM A;  2P1J A;  4C8M A;  4Z4G A;  4JS5 A;  4FJK A;  2X78 A;  1NJX A;  4K8X A;  4I2P A;  4LH4 A;  1YTU A;  3C95 A;  4Y1C A;  4DF8 A;  3LAM A;  4FJ7 A;  1RNH A;  1C1A A;  1A5W A;  3SI6 A;  1KRP A;  5C25 A;  5J2N A;  1RTJ A;  1ZBI A;  4CJV A;  4L8R B;  3L3V A;  4CEZ A;  3OJS A;  3RRH A;  2XY5 A;  3MEC A;  3VN5 A;  3KLH A;  5KRT A;  4CK2 A;  2HVI A;  3QLH A;  5CY4 A;  4KRF A;  1YVU A;  3QEV A;  1NK0 A;  3I0S A;  5C42 A;  4M45 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...