3OW1A

Crystal structure of d-mannonate dehydratase from chromohalobacter salexigens complexed with mg
Total Genus 144
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
144
sequence length
403
structure length
384
Chain Sequence
LKIRDAYTIVTCPGRNFVTLKIVTESGTHGIGDATLNGREMAVAAYLDEHVVPALIGRDAGRIEDTWQYLYRGAYWRRGPVTMTAIAAVDMALWDIKAKAAGMPLYQLLGGKSRERVMTYAHCTGQTIEDCLGEVARHVELGYRAVRVQSGVPGSSLPAEHVWSTEKYLNHAPKLFAAVRERFGDDLHVLHDVHHRLTPIEAARLGKAVEPYHLFWLEDCVPAENQESLRLIREHTTTPLAIGEVFNSIHDCRELIQNQWIDYIRMPLTHGGGITAMRRVADLASLYHVRTGFHGPTDLSPVCLGAAIHFDTWVPNFGIQEHMPHTDETDAVFPHDYRFEDGHFLAGESPGHGVDIDEELAAKYPYERASLPVNRLEDGTLWHW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title CRYSTAL STRUCTURE OF D-MANNONATE DEHYDRATASE FROM CHROMOHALOBACTER SALEXIGENS complexed with MG
rcsb
source organism Chromohalobacter salexigens
molecule tags Lyase
molecule keywords Mandelate racemase/muconate lactonizing enzyme
total genus 144
structure length 384
sequence length 403
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 4.2.1.39: Gluconate dehydratase.
pdb deposition date 2010-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02746 MR_MLE_N Mandelate racemase / muconate lactonizing enzyme, N-terminal domain
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 3ow1A02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 3ow1A01
2XH2A 1OEPA 4E6MA 2PS2A 3QLDA 3I6TA 2PA6A 3QN3A 2AL2A 1WUFA 2DW7A 2ONEA 2PU1A 4H1ZA 3RO6A 2PGWA 3VDGA 4GYPA 3N6JA 1ONEA 3H8AA 2PMQA 2GGIA 2CHRA 2MUCA 3S47A 3RRAA 1MRAA 3ES7A 2MNRA 4MKSA 2FYMA 5BOFA 4Z17A 5ENLA 5FJUA 3MUCA 3T6CA 3SBFA 3GY1A 1W6TA 2QJNA 5FJRA 1TE6A 3DEQA 4EWJA 2OQYA 4IHCA 3OTRA 3SN1A 3PFRA 3V4BA 3U9IA 6ENLA 3N6HA 3UJSA 2XH0A 2XSXA 3V5CA 3R10A 2OX4A 4J1OA 2PODA 4DYEA 4A35A 1SJAA 4HNCA 5IDZA 3I4KA 4KWSA 3DG6A 4KT2A 4IT1A 3P93A 1ECQA 3I6EA 1P48A 1KCZA 4HCLA 3RGTA 3SSZA 3JVAA 1EC9A 3FXGA 3UJEA 2OZ3A 1EBGA 4K8GA 7ENLA 4IZGA 3GO2A 4E5TA 4F4RA 2QDEA 3PWIA 3VCCA 4HNLA 1IYXA 2PTXA 2PPGA 4ZCWA 1XPYA 2OKTA 1MDLA 4JN7A 4GFIA 3RR1A 3JZUA 3P3BA 3UJ2A 4DN1A 3UXKA 3NO1A 3ES8A 1MDRA 1PDYA 1YEYA 2PCEA 3OPSA 2GGEA 3TW9A 4M6UA 1L8PA 2QQ6A 4YWSA 4MMWA 4K1WA 3IJLA 3V3WA 3CXOA 1E9IA 2ZC8A 4A6GA 2QJJA 3N4FA 2GL5A 4FP1A 5EU9A 3K1GA 3Q45A 4KEMA 2PSNA 1JPDX 3R25A 3DIPA 3ENLA 2GGGA 3UJRA 1JCTA 4JHMA 3H12A 3FJ4A 3BSMA 3DFHA 3QPEA 4GGHA 3PWGA 2PP3A 2AKZA 3B97A 3R1ZA 3CYJA 3T9PA 2GGHA 3D47A 2HNEA 4H83A 1BQGA 4HYRA 3MWCA 1SJBA 1JDFA 3OP2A 2XH7A 3IK4A 3OZYA 4JN8A 3H7VA 4ENLA 2OO6A 4H2HA 3R0UA 3VFCA 3S5SA 4KPLA 4GISA 2QDDA 3QKEA 2P3ZA 3EEZA 2QVHA 3TOYA 1XS2A 5FJPA 2OLAA 3DG7A 2GDQA 3EKGA 2PTWA 4H19A 3VA8A 4A3RA 3VC6A 3SN4A 1SJCA 4GIRA 3TWAA 2O56A 3ZVHA 4G8TA 4HCDA 3TWBA 3SN0A 3R0KA 4E4UA 1TKKA 2PP0A 4FI4A 3TJ4A 2OZTA 3P0WA 1EC7A 3IJIA 4HCHA 3FCPA 1NU5A 1NELA 2P8BA 4Z1YA 3RITA 3UCCA 1PDZA 3QTPA 1KKOA 1TZZA 4IP4A 2OPJA 3NZGA 3MSYA 1FHUA 3UXLA 1KD0A 3DG3A 2GSHA 3BJSA 3FV9A 4HN8A 5BOEA 3THUA 3SQSA 2OFJA 3DDMA 3NFUA 3DERA 1FHVA 1KKRA 3ZLFA 2POZA 4DXKA 1DTNA 3CT2A 4ZA0A 2OZ8A 1MNSA 3GC2A 1P43A 3MQTA 4X2PA 2OQHA 2HZGA 4J3ZA 3UGVA 3TJIA 2AKMA 3MKCA 4GMEA 2PP1A 1SJDA 2DW6A 4ROPA 3FYYA 3FVDA 2QJMA 2P8CA 3V5FA 3MY9A 2PTYA 3VCNA 3TQPA 2PTZA 4G7FA 3ZVIA 3H70A 3ZVHB 5FJOA 3CK5A 4E8GA 2FKPA 1RVKA 3Q4DA 2RDXA 1BKHA 2QGYA 3GD6A 4IL0A 3U4FA 3DGBA 4IP5A 3RCYA 1WUEA 4HPNA 2I5QA 2OG9A 2AL1A 3MZNA 2GGJA 4GYPC 3R11A 2OVLA 3TTEA 3CAWA 3OZMA 4MGGA 3UJFA 3BOXA 3PK7A 2NQLA 2ZADA 1R6WA 2P0IA 5FJTA 1EBHA 5J04A 4GGBA 2P88A 3ZLHA 3JW7A 3D46A 3SJNA 2AL2B 4DWDA 3UCDA 1MUCA 3VC5A 4DHGA 3DESA 3NXLA 3N4EA 1R0MA 3STPA 3T4WA 3TCSA 2PU0A 3DFYA 2HXTA 3T8QA 3ZLGA 4M0XA 1EC8A 4IL2A 4K2SA 1F9CA 3HPFA 3OW1A 2HXUA 4DX3A 4E4FA 3KUMA 2XH4A 1ELSA 2XGZA 3IJQA 2PGEA 1JPMA 3CB3A
chains in the Genus database with same CATH superfamily
5AC4A 1CGYA 2QCHA 1FWSA 2YL9A 3L0GA 1JZ5A 4TR9A 4HTBA 1CXKA 5GNYA 1ISYA 3LPOA 2C15A 4WGXA 3SQLA 3UW6A 2JKAA 3GM8A 5BW6A 3AIBA 4MLRA 1OVDA 1VYSX 4F0RA 2YL8A 4TV5A 5BOFA 7REQA 1EPXA 1TUFA 3PPFA 4WX2A 1TWZA 1CB2A 4CU8A 1JYWA 1G4SA 4AFYA 1PO9A 1NHSA 1XYZA 3N2OA 1BXCA 3GLCA 2Z2BA 2V2DA 1B5TA 2VO5A 2VJXA 2PDPA 1LQ2A 2BLEA 3EX3A 3ITLA 3L7RA 1ZK7A 4DYEA 3NYZA 4AEEA 2Z1SA 2ZTJA 3VX0A 5FMHA 2YBUA 4HNNA 1GEUA 4GH3A 3DG6A 2W3RA 4IQDA 2WANA 1WA3A 2UZ9A 1GESA 3N73A 1R3SA 1ME7A 1CTNA 4MPQA 1VJIA 1C8QA 3JVAA 1PYMA 3CMGA 4IX2A 3PR2A 1U1HA 1DV7A 4PN2A 2WBGA 5C9RA 1UZDA 2ZXQA 1EIBA 4A2RA 2NXGA 3PB0A 2A0NA 1NHPA 2GJRA 3H24A 4ZCWA 3UR2A 3TTYA 4A3QA 3MWAA 4XZHA 4FMVA 5D37A 5FD0A 1E9LA 3C61A 3GVGA 2DZUA 2QGHA 4BEUA 5BZAA 1HKWA 1YKWA 5FIPA 1JUKA 3EPOA 5LXXA 2IPGA 4IFKA 4FLSA 1JQXA 1MZRA 4NY2A 1Z44A 5DCDA 1KXQA 2W66A 5T9CE 3N18A 2JEPA 1MNZA 4GRSA 4DYKA 1KWKA 2NQJA 4UR7A 3W23A 1BKSA 2CLHA 2QJJA 2XWEA 3R89A 2EQDA 2BWGA 4FEZA 2BHUA 4LUJA 1Q7ZA 1HJQA 3VOCA 2VDGA 1V79A 2GGGA 4MNKA 1JCTA 2FZ8A 2ZYFA 4CNOA 4HNUA 3BGAA 1ZMDA 3L0NA 1VYPX 5C2GA 3IJ9A 3NQFA 3OVGA 4B9ZA 1VZWA 1AW5A 3NVDA 1K77A 3LBOA 3ITCA 1UJQA 4IIHA 4I8DA 3IGXA 5XIMA 4YIWA 3XINA 1FFQA 2CERA 3RJXA 1Q8AA 2VURA 6REQA 3P6LA 4X2RA 2ZX9A 4AZ7A 3AZRA 4IF2A 1PV8A 2VFDA 1DP0A 1V6TA 3NR0A 2Z6IA 4RW5A 2J74A 1VFFA 3QKEA 2G3IA 4ATWA 5K4XA 4WIWA 1H2JA 3DI0A 5CBIA 2PTDA 2ZZ1A 3TSBA 3L23A 1B54A 1DKWA 3W53A 4A8NA 3VOIA 3QYQA 2P53A 1TVPA 3JU2A 1T3QC 3LUTA 4E2OA 1V08A 4JPGA 4TMBA 4QLKA 5EB8A 3O7UA 6CGTA 5FS9A 4K37A 5I23A 2NWSA 2J7CA 1IE7C 1CX9A 1KTBA 5FESA 1BAGA 1ZLPA 1S5TA 2G96A 4B5TA 1GW1A 1EWEA 1RV8A 3MP3A 1GYNA 4GNKB 1FCQA 2VTFA 1HVXA 4BEQA 3ZYZA 3TKFA 5HJLA 4IMAA 1BZLA 1IR1A 1EP2A 1FHVA 1KKRA 1RLCL 4FF5A 4ZA0A 4JQ1A 1PX8A 3VINA 1UP3A 2GQAA 2ASHA 1V3JA 5A8OA 2CITA 4H3DA 2OSYA 1ONRA 4J3ZA 4W8AA 3QVQA 1QNOA 5J5RA 1WZLA 1HL8A 4NL1A 4RCXA 1F73A 3B4YA 1UH2A 4AZIA 5L9FA 4CD5A 1ADDA 5ER0A 2BNJA 4O18A 1CGWA 4UNIA 4BS0A 4I9MA 4MDPA 2ATSA 2EPOA 5U1OA 1JAEA 4UFMA 1QNPA 3LEPA 3EWCA 1J4EA 1HJVA 2Y89A 1BXNA 1H0IA 1TZ9A 4FNSA 5TIMA 2X8CA 1XLGA 4IIEA 1V6UA 2AMXA 3CLMA 4L6HA 4Q8UA 2RDXA 5D2XA 3F2CA 3MCNA 2DJLA 2WVTA 2QVNA 2OO0A 2WVSA 5HAOA 4OFCA 2DZTA 2YFNA 3EA1A 3N34A 9RUBA 1HJWA 3U8GA 1VBRA 2D1ZA 2ZADA 1QI5A 3ARVA 3B8IA 2FQIA 1GOQA 2KX9A 4KETA 2CZVA 2PDKA 3AIRA 3W7PA 1GVFA 1GQLA 1YW1A 2YA2A 3GDLA 3JS3A 1O60A 1VCVA 2ACQA 4LANA 3CM4A 3STPA 4LIIA 3AALA 3HB9A 3DFYA 1YBQA 1R7AA 4D9PA 1SO6A 4LUSB 1NQ6A 2UY4A 5BXPA 4S3GA 4IL2A 1ZQ5A 3FIGA 2Z29A 2I57A 4O54A 4WY0B 2J8GA 3LBCA 4OJYA 3G1SA 1IZKA 1KB3A 4OBSA 3VAVA 4E4FA 1GCYA 5A1AA 3BLLA 3CHVA 1CXIA 1V0NA 3UR8A 4H7ZA 1OK4A 3PHAA 2PGRA 3PUGA 3FAWA 5LNSA 3NDOA 1XIJA 1AW1A 4ERGA 2GQWA 2AL2A 3D6NA 3S1XA 3W75A 4J3SA 3BLKA 1XH1A 2VGFA 4B5NA 2PU1A 3JUGA 3DK8A 5SWUA 1E6SM 4DBDA 1XBYA 2IPWA 4W9TA 5CSSA 3N6JA 2E28A 3N19B 1B3WA 4YHGA 3LV6A 2GGIA 4INFA 2OT0A 5EMMA 5CJMA 5MKGB 5TD4A 3CV2A 4YMZA 1KBIA 2XZ9A 5ECUA 5XIAA 2ZRXA 2CW6A 1XF0A 3CGTA 1R38A 4PL2A 1UMLA 1I2PA 2A79A 4HNVA 4UWMA 5DCEA 4MVAA 2V5KA 1VYRA 3ECQA 3EPMA 1T6MA 1BTCA 3FAXA 4FX9A 4LYKA 1TB3A 3G8RA 1ZUAX 3BDKA 1OF8A 4PEKA 4Y9OA 3T08A 4XUYA 5LNUA 1YDOA 3I6EA 1P48A 3CZKA 4NQ1A 1TWIA 3SGGA 2WJDA 1Z9AA 3QQ1A 5F1UA 2A5HA 3F03K 4DNMA 4E5TA 1QCWA 2Q3RA 5D4YA 3MHFA 2Y7DA 3C5QA 1FWRA 1UQYA 3LM7A 2J9ZA 4J5NA 1MDLA 1V6XA 2IPJA 3ALFA 2PEVA 4KH2A 4V1XA 1F3WA 5C55A 5LIKX 3E49A 3CH9A 2X09A 3DX5A 7PTDA 3HG2A 4H4IA 4A4AA 5A6LA 3TYCA 1EX5A 4IIGA 4RNFA 3HV8A 1SUXA 1H4PA 1GKQA 1N63C 4KS0A 4AW7A 4D6CA 4EIVA 5DT5A 1K03A 4I5RA 5CJNA 1XRVA 3EXRA 1YPXA 1BG4A 4PRRA 5JXQA 2WCAA 2E8ZA 3ARYA 1P6WA 4Y9NA 1UZ1A 1X2GA 2W27A 4FXSA 4UZSA 2IKHA 1VEOA 1SZRA 1VFHA 3B0UX 1FBAA 1G7UA 5HPOA 1A5NC 1K02A 1PS9A 4UQAA 4UIOA 3FJ4A 2ZXAA 5A6KA 3MT1A 4TXEA 1RH9A 4AMCA 2WOIA 4JTKA 3S5SA 1EL3A 1DPMA 1OYCA 2QAPA 3MP5A 2GVEA 1C90A 3GB6A 4J35A 3WL1A 2O9TA 4XBSA 4LF1A 2YCEA 3L65A 1GJWA 4H7VA 4XZBA 1Q63A 3W72A 3AHXA 3I4EA 5GNXA 4BCEA 2YB1A 1FWTA 3SN4A 1AFSA 3B8VA 4DPQA 4PSRA 3BGJA 3F4CA 3LLXA 1CW2A 4QNEA 3G3DA 5G2IA 3INPA 2Y0FA 3QGKC 5EY5A 5TF0A 1R3WA 3QHNA 1HQTA 3UCQA 4GY1A 4HCHA 4CUCA 3TC7A 4CGTA 3VIKA 3UA4A 2WZHA 3O6YX 1W9XA 3CZGA 3CLWA 5FF3A 4UCGA 4DNHA 2VDIA 3QOMA 4OZOA 5EMKA 3QF0A 1FHUA 3UXLA 4PB5A 5HBFA 4WF7A 4LUTB 4PRTA 4HPGA 4KCTA 1XYFA 2W5FA 1T8QA 3SCNA 4K7ZA 1E0UA 1Q6CA 2GVJA 5AFDA 1TPEA 1TIMA 1ZAJA 2G50A 1U5HA 5DBTA 1JRBA 3LTSA 3TC3A 1MEHA 1EKOA 2PWEA 3GC2A 1P43A 4FOJA 4AC7C 4X2PA 4GJIA 1F2JA 2HZGA 3KZSA 4P2VA 3USZA 2J24A 4NG3A 3LSCA 4NF7A 3D3AA 1I0BA 5D9MA 4EVZA 2X8GA 4LVFA 4ROPA 3BMVA 4ZQCA 3RFAA 4GCAA 3SR7A 1XLJA 4QAIA 3LK6A 1DQWA 4QAWA 5LYRA 1NWSA 4L1GA 2Y61A 3O0KA 3LTPA 3FSTA 4RLIA 4QG9A 1W9DM 4B2DD 1A5UA 5CEWA 4Z0JA 3ZVIA 3H70A 1GERA 3CK5A 4EF8A 1GQNA 4HNTA 3IVUA 1W91A 3EF6A 3DGBA 1NOUA 3NOYA 1SVDA 2YVJA 4CD7A 4H50A 1XLKA 1R7OA 1CZ1A 2DSZA 4KPRA 4GYPC 1EWDA 1R9XA 3SY5A 4HD5A 4B91A 1CXHA 2BTMA 1HJSA 4LUIA 4O15A 4C6CA 5REQB 3NVTA 3P14A 3KBWA 4DUOA 1GK8A 1UOZA 4US5D 4C60A 1PKYA 2OZ0A 3BUVA 1P1MA 3K4DA 4LW7A 5ABFA 3NM1A 4HA3A 3TCSA 1ESWA 1GRBA 3S2CA 4ZOCA 3FA5A 2FVLA 2RDTA 3CAKA 3SCUA 4OE7A 1E1EA 3N2TA 2AMGA 3WQOA 2BDQA 3RLGA 1UMYA 1P6CA 2NV1A 2ACSA 2ZZ5A 5IFPA 4LX4A 3OVQA 4QM1A 2EEXA 4MY8A 4Q32A 3FGCA 2AOSA 1ELSA 5T91A 3B0PA 1OADA 3AMZA 3P7YA 3WO8A 1K8XA 2OTDA 3IAPA 4PUNA 3FNDA 1CNVA 2YXGA 3WLRA 4XZ9A 2O55A 3NZ1A 3QN3A 2ZZCA 4GYJA 1GZJA 2VEIA 1V4YA 1LRNA 2I7GA 3GR8A 2WSKA 3OODA 3BXWA 3BLIA 4XZIA 2QLYA 4QS5A 1ZXIC 4QR6A 2B31A 2OGJA 4DUXA 4HNOA 3B3DA 1RY8A 3ABOA 2UY2A 3DK9A 3A13A 1ML1A 2GJXB 4IJRA 3Q65A 4E8CA 1XLHA 3WN6A 1JAKA 3PJWA 3M07A 4LWWA 1W6TA 2YX0A 3L4VA 1IV8A 1OFEA 3ITOA 1VQTA 1XYBA 3UP8A 2GVGA 4HZ8A 1Z32X 3CHCA 5DQPA 3IJ6A 1UC5A 3H2NA 2ZUNA 5G1MA 3DXIA 2O4QA 5F7UA 4WQ6A 4TV6A 2CCRA 2HSAA 3QSTA 4RK8A 4EM4A 2Y8KA 2WC7A 2DUAA 2XIIA 3IJ8A 4GA8A 4MYAA 1KCZA 1F6YA 1EQCA 1UD3A 2R94A 3SSZA 3Q6JA 4YVVA 3NIYA 3TN3A 1ONFA 3A7RA 7ENLA 1ZRQA 2C71A 4IPPA 2YFOA 4K38A 3GTHA 1HTIA 4UOQA 1F5ZA 5BNKA 5FS6A 1L6FA 2YB4A 1F05A 1MW1A 5C2XA 3TYZA 3EAOA 3W02A 1OK6A 4JIEA 1B3YA 3VFLA 2Z4GA 3JZUA 3WD1A 4AB4A 4UTWC 2F7FA 4KWVA 1KFEA 4Y8FA 3S1UA 4JTHA 1E4NA 2ZRUA 3LBMA 1SZNA 2AAAA 2ESCA 2FTYA 5FF0A 3LZ3A 1JCNA 2AAMA 4G2DA 4HT3A 4ZO6A 4PCNA 1TYPA 4M6PA 1JVNA 1JD9A 1HW6A 4I5UA 1E9IA 2ZC8A 1EF2A 2CZ5A 3D0CA 3P84A 4MTVA 2QCMA 4FP1A 1OCNA 2GUBA 1LLOA 3HOJA 3WDIA 5D2YA 3WENA 3YPIA 4HN4A 4PUKA 4WXZA 3GZAA 3PPHA 4W4QA 2VQTA 1ISXA 4DO4A 1MRQA 2QEZA 1UWAA 4JHMA 4C6NA 2FGLA 3H12A 4GFSA 1WV2A 2I1OA 1E6PA 2OX1A 4P7RA 3DBPA 5C7HA 1YBQB 5DXXA 4DJDA 1XH2A 4H9ZA 1QATA 1ZBCA 1DJGA 3IK4A 3GU2A 3C2FA 4WRHA 3VFCA 1BWKA 2ZVIA 3BW2A 7ODCA 2OXNA 3EXTA 3GX9A 2FFCA 2W0HA 1CIUA 4JGDA 3GXPA 1YIXA 3HBLA 1O7AA 1B3XA 4EX4A 4HMCA 1LYXA 1ICQA 4TTGA 3UXDA 3T40A 3WQCA 2OELA 3EEZA 5C9ZA 4ZQRA 3SCOA 5LNRA 4QFUA 2X16A 4LSBA 4W84A 4ZZ9A 5LIWX 3VC6A 4QCFA 2PWDA 4PMZA 3BAYA 1J5TA 5CZTA 4GVIA 3TSMA 4ADWA 2OWXA 1P0BA 1Z6KA 4HCDA 3G8EA 1IXNA 1JZ8A 4H01A 3NPWA 3ARUA 3FN9A 4TO8A 3KX6A 2ALRA 1TPFA 1X6NA 3O63A 1FHLA 3AIVA 1IHIA 3IRDA 3CMJA 2W6RA 2FPVA 1DJIA 3VDCA 4XAZA 4FXRA 3IC9A 1WOBA 1H60A 2GSHA 1XR2A 3F5JA 2QS8A 1JDAA 1RPKA 2V5DA 1SFTA 5LNVA 2PC8A 4WSHA 2PFHA 4RDZA 2YAUA 5C70A 3W7NA 3WNOA 5BCAA 5BROA 1IXOA 4Z1DA 3CT2A 4V33A 3ZIZA 1A3WA 1MNSA 3TFCA 4TQTA 5I0DA 1ZHAA 1K8CA 3MQTA 1TRDA 1OD0A 1DQXA 3WLLA 3MSRA 1EJRC 5EMJA 3UGVA 3MKCA 1JUEA 3R94A 1BF6A 2PP1A 4H7CA 1SJDA 4K68A 3R6IA 3VTRA 1F3XA 3UZZA 1NJJA 4PTVA 4M81A 3WJXA 1F61A 4UNKA 4XSLA 2XSAA 4NYUA 2ZRZA 3MY9A 3NM3A 3RLVA 1SR9A 4H4XA 1XLMA 4HPHA 2TPRA 2DY3A 4PMXA 5EPDA 5BWAA 5MF5A 1YDYA 4H8HA 2FKPA 4E0CA 3BK0A 3CWOX 2ZUVA 2F6KA 2WV8A 2BXYA 4GZJA 1GETA 4Q4KA 3UFYA 3B8DA 4IPIA 4LQ1A 3SADA 1SSGA 4FALA 2OG9A 2AL1A 4Q4MA 2V0TA 3KOXA 4JX4A 4AMAA 1ICSA 2EPHA 2A85A 1AK5A 4J9JA 1GPWA 3CQIA 1O1HA 3Q58A 1GORA 2IW0A 3JW7A 3MUAA 1B3VA 2PDBA 1HN1A 2DIEA 3PTMA 2DSWA 4Q4RA 1J01A 2VGIA 1EJWC 4EQWA 3TP4A 1G4EA 1GRGA 4L65A 4NNAA 5HR6A 3AXXA 2INZA 1LDCA 1C7TA 4NZJA 4N2YA 4YTUA 1LLZA 2PRMA 2VVSA 5LGXA 4C6OA 3R13A 1E6QM 3IAQA 1UR1A 4HTYA 1HZYA 4U3CA 1FWWA 3LRLA 1CGXA 5F2LA 4NZ5A 2O92A 1XSJA 3REQA 2H3DA 4FSAA 4JTLA 1IGSA 3ZT7A 3U48A 4J27A 1S2CA 3MS8A 3W29A 4ZB0A 1R5YA 3BH4A 3KAOA 4MB5A 4ZOEA 3MW7A 3ARRA 4PB4A 4WHBA 1VBGA 4ML4A 4RW3A 1M5WA 4A3YA 2HROA 4QQUA 1YDNA 5CJ5A 4BQ3A 3P81A 4H6EA 4PR4A 2Q02A 1EHAA 1M6IA 3FX4A 1JGMA 1X2HA 4H4VA 5IHSA 3O07A 3DFTA 3SZ8A 5D2TA 2QJNA 3A12A 1EYEA 3VK5A 3KWXA 3OTRA 3PFRA 2D2GA 2R1NA 1NAL1 4ZEPA 4Q7BA 3U5UA 2G97A 3C3NA 3E0VA 1K8ZA 1A0EA 3MC5A 5K9CA 3QFBA 3V5CA 1BQCA 1SZGA 3R10A 5KZEA 4W87A 4WKFA 2YDRA 1EBDA 3W01A 4WZHA 3VOGA 4Z42C 4W5UA 1NWUA 1PKLA 1V6VA 2Y62A 4S2BA 2P10A 3DHUA 3IUHA 2GK1A 4KGLA 2ISWA 3QMSA 4RZBA 3LU2A 3M41A 4LNCA 3T07A 3B04A 1TX2A 3S9IA 4D8LA 3H7RA 4M8UA 4O0ZA 5XINA 4YYCA 3UWUA 5C7VA 2NW0A 3IIVA 1OQFA 4AUBA 1TWDA 1W1PA 1V3MA 2BC0A 2D0FA 3LMZA 3PWIA 4ZOAA 3HM7A 3SRKA 2ZFAA 3BLDA 4MWAA 1O95A 1XPYA 5HUPA 4S3KA 1TPVA 1B0IA 1F74A 4QDMA 1F8MA 3PZIA 1REQB 1M41A 4HVXA 1XH0A 1HJUA 1LL7A 2HRWA 3W2UA 4YLWA 4L9XA 3CT7A 4AVNA 4EMWA 3EWDA 4UFJA 1YEYA 4W7WA 2XVKA 4WDTA 3PG6A 3SQPA 1XIBA 4K36A 1FWGC 1FWHC 1GYLA 3W3OA 2E5DA 2SFPA 3NQVA 4QSFA 3UYIA 2WP5A 1XSKA 3CC1A 2GL5A 4H04A 5EU9A 4KRUA 3W1TA 4UNLA 3HV9A 3BJTA 2D0HA 4A8RA 1W0MA 3PUEA 1XSIA 1JFXA 2PSNA 3E0WA 4JTAA 4REQB 1WXZA 5DANA 4GVHA 3GXMA 3ENLA 1QNRA 3OOQA 4GQRA 5FS7A 1AL7A 4EM3A 5DXYA 1MFUA 3LQLA 4GXPA 3VD3A 1THFD 5I78A 2DFAA 2QW5A 1O5KA 2OSXA 4D6EA 4NKCA 2OYKA 1RP8A 1LL4A 2XIJA 1JD7A 3CZEA 4CQDA 1QK0A 1WPCA 3QHMA 2EO7A 4FOKA 3BCDA 2MANA 2WBKA 4CNSA 5BRBA 3T0DA 3S5YA 5D9PA 2HMCA 2QDDA 1KM4A 2EG8A 1YXYA 1KXTA 2Z28A 3AIWA 3PZVA 3TFXA 1SW3A 4H41A 2G5WA 1GUVA 2W79A 4DUWA 3O8AA 3TOYA 1AMKA 1VBHA 2AGTA 3OHIA 3WQ8A 4PTMA 4D1JA 3QR0A 2C18A 2FMOA 2BVDA 4ICNA 2ISDA 2A6LA 1XIDA 1OB0A 2BHZA 1OWQA 3GBEA 3NEHA 4Y7EA 1TKKA 5DMLA 3PG9A 1L6YA 3LB8A 1KO0A 3N14A 4TVDA 4JTEA 1H09A 2OOGA 1C9DA 4Z1YA 3MO7A 5D32A 3T7VA 4MKNA 3UCCA 4BF9A 3BLFA 1KKOA 3L21A 1T8XA 1Q65A 5C9UA 2J9XA 1TA3A 2NVDA 3A22A 1RJQA 3WX7A 1K4GA 2PDQA 1KM5A 3ATYA 8TIMA 3DG3A 4PE8A 5J8LA 3JR2A 1A50A 3OIXA 1KM6A 5C9WA 3AXIA 4HN8A 3OA3A 1NDVA 2NVCA 1IT7A 1LQAA 2GJPA 3NFUA 5G4HC 4DELA 3B9EA 4W89A 2VEKA 5IHRA 2PD5A 2B7PA 2VKZG 2E6YA 3BG9A 4I6KA 1TJPA 1CGUA 1U1JA 2Y1HA 5DCBA 1J6PA 1WKFA 1T0OA 2OQHA 4D6DA 4I9AA 1S2AA 4QX4A 2A1YA 3R8RA 1V03A 4UQCA 1WKEA 4IXHA 4QROA 1J0IA 2HV5A 4R9OA 4U10A 2AQOA 2RABA 4R27A 2CBJA 3FYYA 3FEQA 3MDUA 3FVDA 2G8ZA 5DLCA 1EDGA 4AAJA 3GC4A 3MB9A 1NIUA 1W2PA 5FF2A 1E6RA 1VQZA 4P7OA 4ZB5A 3OGRA 1ITCA 4MZ1A 3ZVHB 1ZSXA 1X96A 4LTSA 3HN3A 1XC6A 5FS8A 4ALDA 4F2TA 3GW0A 1A53A 4D72A 3C8FA 1TRIA 1DORA 1Q5MA 2GLKA 3OLEA 1O94A 2XIBA 3NRZB 2Y88A 3GR4A 3MZNA 3R11A 3EXSA 3E9AA 2E67A 2HK1A 4GQBA 3UGRA 1ENUA 1ADOA 4L1XA 4G7EB 3KBVA 4LCSA 4LT9A 2CLMA 3MV01 1NQKA 3OG2A 4DWDA 5CC5A 1OCQA 3SQMA 4EP8C 1K1DA 4KQNA 4XD3A 3C3UA 1YXDA 4JDBA 3GTXA 1K7EA 3W1AA 3NL2A 2XPKA 1XX1A 1QK2A 5D03A 1GVIA 3UWQA 2QUVA 1FH8A 4M0XA 3OIHA 4NNCA 3GXNA 1GTHA 2QCCA 3V18A 3VIIA 1VH7A 4W88A 1IWPA 4Q4OA 3OZPA 3VDBA 3KFTA 2CLEA 3DECA 4BURA 5D05A 4G6CA 1ONWA 1F76A 3W1LA 1LWIA 5HXMA 4E6MA 3FJNA 1TVLA 3QLDA 4IPLA 3I6TA 4QNWA 4TVWA 4H9MA 3BMWA 5C0QA 3OU8A 3E1F1 1G67A 1LWJA 2VOMA 4DJDD 5FEPA 4KCUA 2FGBA 3E74A 1J0KA 1BRLB 4G9PA 2VI0A 2WHKA 1XIEA 4R33A 1MRAA 1GONA 4UR8A 4IG2A 3G2GA 5ENLA 4BI5A 3RCNA 1XDIA 3MUCA 4GX9A 2W91A 3A4JA 1TZ7A 3KCOA 1UIOA 4I6VA 1XIHA 4ZMGA 3SFWA 4Z2LA 2CEQA 3DEQA 3WDRA 4IHCA 1ZTVA 5HQLA 1RD5A 2ZIDA 1X6UA 2O9PA 2VCCA 4HIBA 5H6HA 2XH0A 3AIUA 1RBAA 5A6BD 4QITA 2BOEX 3AMLA 1OY0A 1QR7A 1RBLA 3GRTA 4H4RA 5JH1A 1AQHA 2EG6A 3W1XA 1D3GA 3I4KA 1HP5A 4JTTA 3G1XA 1NSJA 4IT1A 3C8NA 5BMXA 1EYWA 1UR3M 2V5CA 1ZCOA 4W7UA 1YLVA 3TQ0A 1BF2A 3VMNA 1FUYA 1GQIA 4Z1AA 4OKDA 1UKSA 3RMEA 1MEWA 4XKYB 4CQ9A 4K8GA 1CGVA 2V9DA 3NVWB 5HMFA 1B57A 4URIA 2HBVA 3AMKA 3STEA 1IF2A 1VIZA 2IQTA 3ZJ7A 2J7GA 5EBAA 4HSOA 4B3KA 2FTPA 3BJFA 5G5IA 3DFOA 1YADA 5LIXX 2ZUTA 3TVAA 4M7TA 2I9EA 4AZ5A 1F6KA 1TPC1 3ABXA 1WXYA 5LZLA 3A5FA 1Q6OA 1SU5A 5A3HA 2VD8A 4HZ6A 5CGTA 2XM1A 1XLEA 2CIPA 1GEQA 1HT6A 3AZSA 4E8DA 1RY0A 2D24A 4K8EA 2HPIA 2XM2A 2G41A 2WC3A 3NQMA 1A80A 1FQ0A 3EMZA 3TAOA 2NQ9A 5KVIA 4XBKA 3RCMA 2WAGA 2XGBA 4GI9A 1MEIA 1DJNA 2PDNA 1UWRA 1N82A 4IGMA 3NSMA 3AC0A 4AD0A 4GUHA 4DWSA 1FDZA 2DT1A 5GVJA 3M4HA 2VRQA 3SI9A 1B9ZA 4L4PA 2E5BA 1ADSA 3GG1A 5GJPA 3ZJ8A 4E2DA 4J57A 3THDA 4LBUA 4BQ5A 4V27A 2CFFA 1H5VA 3RPMA 6TAAA 4HYRA 2Z2UA 3EKZA 3N6QA 3E2RA 4U2YA 1H5YA 4X63A 2VELA 5BU9A 1UD2A 2F8QA 3VD7A 2R9ZA 1Y0EA 4GNJA 3W2JA 4M29A 4JNMA 2V63A 1TYTA 3R4IA 4NRRA 3GYCA 1MQQA 2OLAA 3BWWA 3HPXA 3HQPA 1IEVA 5CC3A 3NDZA 1HJXA 3SSJA 1TYGA 3WH6A 2WSRA 1A5KC 1YPFA 3W37A 4FAMA 3TWBA 2E4TA 1ZBWA 1V5XA 1OIFA 1LLWA 4NZ4A 1WO2A 1UIPA 3PULA 4O1FA 5I6SA 3CAQA 2VR4A 2E7FA 2ZDRA 5CZSA 1TTQA 3VUPA 1EO5A 3NZGA 4C7FA 1QFEA 1SO4A 2Y70A 2GH5A 2V2CA 4MSSA 1UASA 2A21A 1DHKA 1R3QA 4ORMA 5TQLA 4M7SA 1RCXB 3LXAA 2H3BA 4OECA 1H11A 2WWCA 1FIQB 3C2VA 3WLOA 4Q8PA 4D1IA 1W1VA 1UKOA 2NX1A 3IANA 2TMDA 2WB5A 3UWZA 2FZMA 4JFTA 1QMLA 3ARXA 3H2AA 1DTNA 2X1RA 2WW5A 4QE5A 1QOXA 2OYLA 1UZ4A 2BMBA 3UZJA 2QAFA 4N02A 4CCEA 4JX6A 2J7DA 3LQGA 3BV7A 2ATMA 4RV8A 4Y9PA 5M1TA 2E9BA 4G1KA 3LYEA 2Q8ZA 4LJ3A 4H4YA 3WLIA 3URHA 1D3CA 1MWOA 3L4YA 1RALA 3GNPA 4F48A 1MXDA 5M5DA 3AROA 2HTMA 1EUAA 4UOZA 1TQXA 1VPQA 2EPMX 4JYFA 4AX7A 2BY2A 1GGOA 4MG4A 1UWQA 3TONA 4HPNA 3S6OA 3L5OA 2ISSA 5D09A 3B9OA 3KVKA 4S1FA 3RG6A 1JULA 2XZ7A 4Y8EA 3L4ZA 4JD4A 2NQLA 4G7EA 3CV7A 1UWSA 2QT3A 4Y96A 4KKXA 2P88A 1VCGA 4GH1A 3ONCA 4HSHA 3HF3A 6XIAA 1XIFA 2FHCA 3EDDA 1JZ7A 5JUVA 3FJLA 1H2IA 1TMQA 1XLDA 4ACYA 5DY3A 4ZVJA 4H8UA 3MZ2A 1KQZA 3DESA 4C7GA 3OG3A 1H7WA 4XBJA 2D20A 1L9WA 1U5VA 1IWBA 2VOTA 2X05A 2O9RA 4K2SA 4H9VA 1A4LA 2ZOXA 2HXUA 1R9YA 2DGAA 2QCNA 3KVMA 1SR0A 3HQNA 4EANA 1GTEA 3KOWA 1J2WA 4GLEA 1RD6A 3E0FA 3S1GA 1IIHA 4NVTA 3VYLA 4DM2A 4F9DA 3SIMA 3L5AA 4NZ1A 1E70M 3TK7A 5KITA 6PTDA 4NI8A 2KAUC 2XINA 3T78A 1X1ZA 4IMEA 3ZOAA 1H7PA 3GWQA 4L7ZA 4WY0F 3HIJA 4UMBA 1OSEA 1FTXA 1OCJA 3FDGA 1ONEA 3H8AA 2XTKA 3NZQA 2XU2A 4MKSA 1ZU8A 2FYMA 1UD8A 2FMNA 3BAWA 4LUSA 1DWAM 4O52A 3CUXA 4QP0A 4G1NA 1GOOA 3EUB3 2HWGA 4AZCB 1KM0A 4XD4A 4JKMA 1PWMA 3UD6A 4Y2WA 2JKEA 3ZR5A 4HB7A 4PZVA 2OQYA 4JIPA 2V3EA 4YJ5A 3BLOA 1GWJA 2C0HA 4MNMA 3CGEA 1OINA 4BWLA 1JZ6A 4EWND 5JCMA 1E51A 2PRHA 2VFEA 2OX4A 3GK0A 2J78A 2F84A 3M0LA 3M46A 1M1BA 2NZLA 3W1PA 1Q7QA 5F4SA 3TYAA 3PJUA 4WSKA 5AYYA 4BY3A 2Y4SA 1TPH1 4FB7A 1AH3A 1BXBA 2B7QA 3USBA 2GWGA 2BHYA 1JEZA 3WFZA 3G1VA 1IT0A 4L9ZA 2CNCA 4IZGA 3GU1A 3ZFHA 1IYXA 3CZ8A 2NSOA 2V5LA 3H54A 3URNA 3KTCA 1YXCA 2NV9A 2R1LA 4JN7A 1QPQA 2PZ0A 2TSYA 1BVWA 3GTFA 3NNTA 4NJHA 4U31A 3VOHA 1FH7A 3DYMA 4P7LA 4I9TA 1CCWB 3V75A 3IEBA 4QS6A 4Q8NA 1HG3A 3VXGA 1PEZA 3LDVA 4CN6A 3WJSA 2CWXA 1OZQA 3OPSA 1XANA 1VP5A 1EJ7L 5EBKA 3BO9A 2O0TA 1KFJA 2V30A 5BU6A 2QIWA 4MMWA 3M0HA 4ECLA 4WR3A 3UWVA 3MPGA 2YOCA 3ABZA 3AUJA 3CXOA 3CB8A 2B7OA 3FYPA 2C3ZA 1AG1O 2DPEA 1L6GA 5CPLA 2PURA 5A2AA 4HHHA 5HK4A 4RPQA 2W3ZA 3M43A 3AYSA 1HP4A 1Z8AA 3GW3A 3KCLA 4Q8VA 4CCDA 3NL5A 1ZDLA 4MB4A 2DZAA 2WP6A 3QV9A 3PWGA 1W1ZA 2W63A 5DEZA 4E4PA 1H1ZA 3VIJA 2WYSA 2Y5JA 2QV5A 2POTA 3BMXA 4LY8A 3TW6A 4APNA 3RO8A 3UVAA 5GJMA 1WDPA 3QOKA 2V6AA 1H7XA 1FCBA 4JCMA 1A5CA 1N55A 2V68A 2R8WA 3ARZA 3H22A 3REQB 4IQEA 1J2BA 2IQDA 2AQWA 4C7DA 5JQ9A 3E96A 2VWTA 2PLJA 2CHNA 4YTQA 1XKYA 5LNWA 2PBOA 1EJVC 3LPGA 4FDCB 3BPWA 2IPFA 1OM0A 3EAUA 3NO3A 4GJ1A 1LWHA 3TMLA 1DJXA 1JIBA 3VGGA 3SN0A 1UBSA 3DENA 4E4UA 3W6MA 2A7NA 1F3TA 4AD1A 3WD2A 3GE7A 1FWFC 1W9VA 3MDWA 3GC5A 3H23A 3TLLA 3KLKA 3MYOA 1E0VA 1XUUA 1Q6RA 3LM3A 1BLIA 3CEUA 2Y8UA 1TELA 3K4WA 5HWJA 2OSWA 1Q6LA 4MOZA 1VCFA 4S3AA 4EQSA 1N5WC 3W87A 1KTNA 5BXSA 1R86A 1N8FA 3MI6A 5HQMA 2VP8A 1ZJBA 4FR6A 1NWRA 2FPYA 3W2NA 3VX1A 2QIIA 4QEHA 5E6ZA 2J3NA 2VL4A 1LVLA 3E2SA 3CASA 1YYAA 3KRUA 5GNZA 5CBBA 1YTEA 4UQDA 3W38A 1QO2A 1V3HA 2Z27A 3VCRA 1B4KA 3QV8A 1RUSA 4WY0A 3M0ZA 3A23A 4JFUA 5A6TC 5JU6A 1JF5A 3QFWA 2EJ1A 3QGAC 3F4WA 3V5FA 3M6YA 2TODA 1E9ZB 1ZCCA 4XD5A 1OX5A 3LXCA 3S3GA 3UG3A 2VZSA 1H61A 1GG1A 4D71A 3KBMA 2PWFA 2EQ8A 2VCBA 3GXIA 2ISFA 2BODX 4JTRA 4E8GA 1RVKA 1U30A 4LV9A 2VX4A 4LS1A 4HPXA 1PIGA 1C8YA 4NJKA 2ZE3A 4QLJA 3GG8A 3S6TA 1P5BA 3F4DA 4PA8A 5K3VA 4QJ5B 1WUEA 1S5NA 3UT0A 4GXMA 4V2XA 5LKYA 1I60A 5FEZA 1SSDA 3CUZA 1UP0A 5E0FA 1U22A 5CSRA 2OLHA 2OMAA 5JCIA 2VYOA 4IUOA 4Z0SA 4DJEC 4GE8A 4S3DA 3L5MA 1RCQA 3TYUA 3SO7A 2D0GA 4Y6GA 3MCMA 5AVNA 4EXBA 4N6FA 3S46A 4JKLA 4M6QA 2WQDA 5F4XA 1SPQA 1QPOA 1ZBVA 2FFIA 1CXLA 2EQ6A 2HXTA 1GKRA 1E4LA 4EAYA 3UEQA 3AIQA 3NPXA 5HJXA 4DI9A 2G4JA 1W8GA 4LFYA 2R82A 2JBMA 5AYBA 3B0YA 3HPFA 1W3JA 2OJPA 1UG6A 2OYMA 3BAJA 3VOJA 3EDKA 1KV5A 1NM9A 3CGBA 3U2CA 2DVUA 3N2XA 1TV7A 5A2CA 3AZTA 1PZ2A 4TU1A 1Z89A 2WJFA 5DRCA 3WUEA 2X7WA 2F2KA 1GPFA 4OQVA 2DSUA 4JNZA 5I3FA 1M7OA 4H4PA 4IPJA 3A3HA 1QI3A 3QR3A 3VDGA 5JIPA 3LNMA 1M7JA 3VZYA 3ZR4A 1ZENA 3SUTA 5LSMA 1XDJA 1YPIA 2V3FA 4FX6M 3M44A 3LS9A 4D6GA 1V02A 5EA9A 2G37A 3WLQA 2QCLA 1XM3A 2PDJA 4TTUA 2WMJA 4HHPA 1OFAA 2J7FA 1JF6A 4WLCA 4RNJA 2FTWA 3GHSA 3BV4A 1LROA 1PJ9A 4NJJA 2BSLA 4YU1A 4L4MA 3QKZA 3UJSA 2ZX6A 5A6MA 2YDQA 3U3HA 4NNBA 1I4NA 7TIMA 2Z2AA 4M1BA 1JYXA 3QM3A 1A47A 3VZZA 1TTIA 1GHRA 4V1YA 4JIHA 2NWRA 2HBXA 5AYXA 5CC7A 4J3WA 4LAKA 3P93A 1KC7A 1AQFA 2PWHA 2FPTA 5H1WA 4UZUA 1EC9A 3NVYB 3N2MA 5A8NA 4JR5A 2XYLA 3I7RA 2QJHA 5EGRA 3CL6A 3S2NA 5IXEA 4LVDA 2YZ5A 2YDAA 3S83A 3M5YA 3IWPA 3DCPA 2V8ZA 3G18A 4Q3MA 1RK6A 1V3KA 2YXXA 5KTLA 3AICA 2VZVA 2PPGA 3CAVA 3TJLA 1CLXA 2J7HA 3TIMA 3KW3A 2BXVA 5TBOA 4LEQA 4LOCA 2L5HA 4U28A 3WK3A 1W9UA 2VZUA 3ZQ9A 3MSDA 1E40A 1UA3A 3ZS4A 4H4TA 1UH4A 2R6OA 2YCLA 3LG3A 2YCLB 3FJ6A 3II1A 1DE5A 3CU2A 1QVBA 4O1DA 4FPSA 1B9BA 1WDDA 4YCPA 5HINA 1X38A 4ADSA 1N61C 3BQ5A 3CTLA 3W07A 2XVPA 1WXJA 5C5YA 5MHBA 3FKRA 1Y8BA 1Q1RA 3QPEA 1FDYA 1EO7A 4UOJA 1FH9A 4B5XA 4ZOHB 2DVTA 4IFKB 2V67A 3D47A 1R2SA 3RK8A 3WF0A 2V3BA 4A21A 1TTJA 4JHZA 4Y90A 4PMUA 5HANA 5IM51 1N8WA 2X50A 3CL8A 1E73M 5C54A 4JTUA 4EMJA 3GHRA 5C8BB 4H2HA 4CCCA 4AC1X 5A6JA 1TPDA 1P0EA 3WK2A 5I3GA 4PBFA 1L6WA 4FHAA 5C2CA 5CPMA 2F6UA 2E9MA 3PZGA 1OCBA 5FJPA 3GHUA 2RDUA 3AN1A 3CUGA 2CBIA 5KZ6A 3NYDA 3W7LA 4A3RA 1XWYA 4LYRA 1E0WA 2RGMA 4MZ8A 4EQRA 1VFUA 1ZP3A 3EWWA 3L9CA 1JZ2A 2PE4A 3VKCA 2Q71A 4ACZA 2JK6A 2DT0A 3PAOA 3WD0A 2C1IA 1QNQA 1P7TA 3SCRA 3KOYA 3ORWA 2C16A 3RLHA 4B15A 3OLIA 3LXDA 1PIIA 5D2WA 1U2YA 5KEZA 1X98A 4FK9A 4GKTA 2FJKA 4GQQA 2PF0A 3MUXA 3O9NA 5DBUA 2FJUB 4OU1A 3SJ3A 3TLQA 3G6MA 4AHPA 4JTFA 2XN2A 4FXFA 3GNXA 2WVVB 1AZ1A 5DMMA 1B90A 4DY1A 3WLTA 3ZLFA 1BSLA 1CI1A 1LOLA 1MOKA 1Z69A 3THCA 1VBJA 4S2CA 3ABQA 1XRTA 4BI7A 1MZHA 2A3EA 4AWEA 1DIEA 3KS5A 2V69A 1XKJA 2EPNA 3W71A 1JCLA 1P0NA 4KIRA 1CEOA 3L8KA 2NUWA 3EX4A 3DHFA 4H4QA 4ZSTA 3U7VA 2P8CA 4O12A 1SW0A 1UC4A 3U2ZA 1D8WA 1I2QA 4GZEA 2A3BA 1SMDA 4HYVA 1AJZA 1JI2A 1TPB1 4RNIA 5DN1A 1OFPA 1WCGA 1YRRA 1E4MM 3TR2A 3I7QA 4MJ4A 1W5OA 3CS2A 3GNNA 1XBZA 2G3MA 1OABA 4N9BA 1HGWA 1J0ZA 1VENA 3H2CA 3M5VA 5MKGA 1JNEA 2W3SA 2O9OA 4GHRA 3RCYA 5T9BG 3DUGA 3UYCA 3KTSA 4MWAE 1KRCC 1UCWA 2O7SA 4XKYA 4C1KA 3TTEA 4A29A 4PMRA 3UZ5A 3CHDA 1TA3B 5G2HA 3GDMA 4V15A 1NVMA 5K4ZA 1TO3A 4FR1A 2F6XA 2F38A 1POKA 1TMHA 4MWAB 2PDCA 4RZ5A 3KHJA 4XTDA 4O16A 4O1BA 1OGGA 3EOUA 4JZ5A 5M17A 2ZZ0A 3GYEA 4ICMA 2WPEA 3V0UA 1QI0A 2WLZA 3N4EA 1J0JA 4RZ4A 2QCFA 4UXDA 3OVRA 4GUIA 1VIWA 5HNTA 4GNVA 2CETA 1GRAA 1RJPA 2B0MA 4C5ZA 3H4WA 4H8VA 4JAWA 4TOQA 3O05A 1WDRA 4B9YA 1GVEA 3UNDA 4LVAA 1VKFA 1QPKA 4IQJA 1I45A 3LOTA 4YL2A 4AEFA 4WCJA 2BB0A 4WDUA 4JN6A 3WMSA 3CUJA 1IEQA 2WLYA 3LPFA 5I00A 3MANA 2QUUA 2PGWA 1QWKA 3MP4A 3OQ8A 1J8VA 1W5MA 1GT8A 2OT1A 4N7QA 1S3HA 2PMQA 1JDEA 4M56A 3RRAA 1Z7AA 2ZZ3A 2ZUWA 3KCJA 1EJSC 3ZXWA 5FJUA 1T7LA 3SBFA 3SR6B 2XDFA 2C1HA 1DQUA 1EXPA 4NU7A 1DWIM 1RAKA 2HE8A 1E5NA 5AYIA 1ZY8A 2QYGA 4PFMA 3NQGA 3C0QA 3TNBA 2A3HA 3GDTA 4M1RA 1MXGA 5G1YA 1MW2A 2PODA 3U6WA 2GWNA 1LRQA 3A3XA 5M2FX 4JTDA 4F0HA 3NVVB 1QJWA 4KWSA 2GR1A 4CU7A 2QNEA 4JX5A 1VBUA 2FDMA 2VD9A 3WLSA 4A2SA 5JIWA 1D8CA 3WFAA 4C1LA 2JQXA 1E6ZA 3RGTA 4DWSC 4AD3A 4JCLA 2D23A 1IXQA 5JCNA 3RYSA 2I5GA 2OZ3A 2OEJA 4GCXA 4PH6A 4UUIA 3MA8A 2VEPA 4IJCA 5I07A 3NL6A 3BANA 1WKDA 3CNYA 1Q2SA 2OKTA 1PPIA 1M7XA 2BGQA 1S39A 5HNRA 3CJPA 1MW0A 4N4QA 3T8LA 2GDVA 3SRDA 2PAJA 3P3BA 4DBSA 4ZQOA 3UJ2A 3SUUA 3GFYA 1S3TC 4W85A 1N5XA 2R1PA 5E0CA 2OCZA 3P82A 3GRIA 4FOUA 3NQAA 4EPDC 1QDSA 2DZXA 2Z25A 4LAOA 3P0XA 3TXVA 4IOTA 3VGHA 3SUVA 3NQCA 3W76A 1XLBA 3PJXA 4PMOA 3I6RA 3FXYA 4IGHA 1FP9A 2VCAA 3CZJA 3NQ6A 2WPBA 1IT8A 2JGQA 3WLKX 2PLKA 4GINA 2Y85A 5K7JA 5M03A 4GGHA 4LC6A 1F8WA 2KZHA 3R1ZA 5AHFA 1RXOB 3W86A 1DVJA 1EJXC 4LA1A 2PDWA 2EJAA 3LLDA 2HNEA 3QY7A 4IPNB 2ZXBA 2V6OA 1TWWA 2Y5EA 3ARTA 2VC6A 2PLCA 1EGVA 1S1RA 5FL0A 3T2QA 3HQOA 1KR0A 2PRLA 3R12A 1N62C 2OGYA 3W74A 3GAKA 2IKGA 3IV8A 2P3ZA 3VMPA 3MUY1 3M5ZA 1GRTA 5FCZA 4J7RA 3R8HA 3PNZA 5HWMA 3EKGA 2BX7A 3JRKA 3I7SA 5D02A 3CWNA 4UQ9A 5HJYA 1W9BM 4QE1A 4L80A 2E68A 2X7VA 4NI3A 2FLIA 2ZUUA 1UWUA 4R53A 4ZQPA 2ABBA 2NX9A 1VEPA 5A6AA 3K30A 3PZNA 1V51A 4M5PA 4K6AA 1ZY9A 3KRBA 1RLDA 3EB2A 4DBUA 1JPHA 4DBEA 3H2EA 4LYQA 1TFVA 3PZMA 1UUOA 3T1GA 3DGRA 4R85A 4GG9A 1FO4A 2C14A 5I7GA 3VD5A 4P8UA 2TPSA 4BF5A 1QHZA 3PSWA 4M6VA 5LA2A 3MMUA 3LMYA 3TE9A 3UERA 1GQKA 4OV9A 1OZMA 4EQXA 4QGCA 2CZDA 3F2BA 1SQ7A 2OFJA 2QDHA 1OD8A 1KBKA 1YDVA 2X30A 3QY6A 1GJUA 2PDUA 3LHUA 4BHYA 4DZHA 2YLAA 4DXKA 1LG2A 2WHMA 3NPVA 5AHMA 3G0XA 5E9AA 4TVYA 2W9MA 2WPGA 1EH9A 3BZJA 5AC8A 1FHDA 3URBA 1KGXA 1HGYA 5FSDC 1JYVA 5DELA 1W32A 4JTJA 1IIGA 4NZFA 3W1QA 1Q2RA 2WPFA 3C4UA 3LGGA 3WQ6A 4HHLA 1S1PA 1Q85A 3FW6A 3EDJA 4WXYA 5BXTA 1GVYA 1NPXA 2QXWA 2GPTA 2X1IA 5AYZA 5AC6A 4CD6A 1OG0A 5JBEA 3E0IA 2GOKA 4AF0A 4PUMA 3PZQA 1GOIA 1X1OA 3TH6A 3D9XA 5M3WA 4NXSA 1UH3A 3EDFA 3LRKA 2CXEA 5JCLA 3MMTA 4U3AA 3U4FA 2EPKX 1WYIA 4KEZA 5CZ0A 4DJEA 4HMDA 1WE5A 4GABA 2JEQA 1BD0A 1DIKA 2GR2A 2YCKX 2J79A 1VLIA 4OWGA 2YIHA 2PZNA 1EZ2A 5AHNA 3P8IA 3MO4A 3O2LA 4CNUA 5J04A 3VNJA 2E77A 4CN1A 1HL2A 5HUOA 4P8XA 3B40A 3LB0A 2NVAA 3VD9A 1UYQA 3A9BA 1KTCA 1V6YA 2DP3A 5HATA 5A95A 1VGAA 3VGBA 3O16A 2FHBA 1FXQA 3AMCA 2D3NA 3RUBL 3T4WA 1ZS2A 1F7BA 1XRSA 4O19A 1GEHA 5HMSA 4WDXA 4CQ8A 1JCXA 3EB3A 1MW3A 4QJ4B 3GKAA 4IQLA 3A64A 3W6LA 1WZMA 3DFSA 1JCJA 1CXFA 1AUSL 1QBBA 4S3JA 1XV8A 2GRTA 2PGFA 2DZSA 3A3WA 4I9JA 4JHOA 4XUGA 2UBPC 3RM8A 1WZKA 3GAYA 5CLTA 5EL1A 3M0KA 1OEPA 4D6IA 5KZMA 4PRWA 4GVFA 3AYTA 4F40A 4LC8A 3RHGA 1UA7A 2YXOA 4B4FA 4DWSB 1DJQA 2DW7A 2PDLA 3WIJA 4CEUC 2ONEA 1MI3A 4Z08A 3PC0A 4DJFC 2Z7KA 3O6AA 3LHTA 3SRHA 3M0VA 4CU6A 5CC6A 1V3IA 4RNHA 4DBWA 3S47A 2ZZ2A 4UQEA 2WSYA 1OX4B 2WMHA 5E6YA 1S38A 1P7TB 4Z1CA 3KZPA 1NDYA 1UR2A 3RR4A 4YPJA 2DT3A 2UV8G 3TN4A 1VDVA 3BARA 5CPNA 2FH6A 4JQAA 1DYSA 1LUCA 3GXFA 2Y24A 4H6KA 2Q3OA 2Z0IA 3N15A 1EOMA 4DF1A 4OHQA 3DH9A 7XIMA 9CGTA 2INFA 1DE6A 1XJBA 3WMLA 1SFLA 3RILA 2XSXA 2F5ZA 4AF0B 1AVAA 4PCFA 6XIMA 3U0HA 2DZVA 1XC4A 3ARQA 1G6CA 3NZPA 1GZ1A 2J75A 4UFKA 4KT2A 3NDYA 2WKGA 3RIKA 3TJXA 3CQJA 2J47A 3WJYA 1PKMA 1TUXA 1HX0A 4RDYA 3FXGA 3K8MA 3R2GA 3V7PA 2JIEA 1EBGA 2DIKA 5A94A 2WHJA 3EWBX 2A7RA 3WYZA 4GX8A 2FVMA 4JIIX 3PG8A 1EEXA 1FEBA 4AH7A 1GSNA 3MU7A 2NQZA 3VKDA 2D69A 4NEVA 1U1UA 3WBEA 1M7PA 3ARSA 3H4KA 2GSJA 4EKJA 4LUTA 1VAHA 4Q8TA 3F7JA 2WOVA 3S4TA 4WJ8A 1VC4A 1R87A 4OBRA 3S9YA 1AODA 3WY1A 3WNPA 1XG4A 1RA5A 2VFIA 3W7QA 5IFTA 1QHPA 1MQRA 3ES8A 3O3RA 2PCEA 2GGEA 4Z2IA 2XWDA 3ARWA 5A8GA 4YWSA 1MO0A 1ZAIA 4GIEA 1ZGDA 3IIXA 1RJRA 2VQUA 3CYVA 3I3EA 4OVXA 1NH6A 1JRPA 4FS9A 2XIMA 3DH7A 4ICCX 1TV2A 3SCSA 3W22A 3P62A 4ONVA 3UU0A 2PP3A 1QASA 2BVYA 4UTWA 4F0MA 4XVEA 4C6IA 3W7KA 3CHEA 1I6NA 1QTWA 1VPYA 3MV11 1QU4A 1S2TA 4PB3A 3AMGA 3GUWA 1J79A 3GU9A 4JN8A 3RX3A 3FDKA 1PTGA 1CBGA 3BE7A 1LBMA 1LG1A 4I7UA 4KPLA 4QBXA 4ATLA 1J93A 3AFBA 3OEXA 3WF4A 5AHIA 3GH7A 1MVYA 3MUIA 2OU4A 4B4HA 3RU6A 1VF8A 2ZUMA 3IK2A 2GJLA 4XISA 3HPSA 2XN0A 1TV8A 2J62A 2GDQA 4JIQA 4DM1A 5I5RA 3WQWA 3AAMA 4ZE5A 1Y5XA 1M01A 1P4CA 1B31A 1LBLA 2ZCGA 5I02A 4PYSA 3B9NA 3VNDA 2Y7FA 4QDPA 4MUPA 3WF2A 1FX6A 4J3VA 3PVFA 3SCVA 1N7KA 3EEGA 1XFCA 2R1KA 3ITYA 3W83A 1FWAC 1WBJA 5HDRA 3RX4A 4L1WA 1J96A 3ELFA 3S1WA 1TR9A 2P8BA 2IKJA 6REQB 4GKLA 3FG2P 2QHAA 4D8AA 3PNUA 4LAUA 4WD0A 3CO4A 1GVOA 1YX1A 4X61A 3MVIA 3IVTA 5FI8A 1KQYA 9XIMA 2BY1A 4AYGA 4PTXA 1A5LC 3APGA 4PFHA 4D2JA 3EBVA 2YSWA 3G22A 2VZTA 3W73A 1VFLA 1BRLA 1K9EA 3PB2A 2BGNE 1PAMA 1Q4NX 2HS6A 2QULA 5KETA 1RK5A 2VFHA 5G1TA 3HPZA 4MLJA 4DXVA 5CAKA 4GR1A 4B5VA 3W2MA 5HPCA 4GMEA 1XLFA 2RAGA 4IMFA 2DW6A 3GKFA 4BV6A 4JBRA 1K7FA 3UPBA 3KVJA 2Z24A 5FF4A 2QUMA 4KRTA 4OGZA 4O50A 2RKXA 3IUDA 6TIMA 4JKKA 1TG7A 1H7RA 5A69A 1V7AA 4IGNA 2Y7EA 4CVWA 1AZ2A 2X1SA 3K8KA 3TX9A 2Z1XA 1VHNA 5AY7A 1VJZA 4UTUA 4YTTA 1SFSA 1BWLA 3SCTA 3CH0A 5G4WA 3M0YA 5ABHA 4UTMA 3BCJA 1OT2A 1WYGA 3IUIA 1UHVA 3BL3A 2ZZ4A 3RM4A 5D8ZA 4NYYA 4CD4A 4MKVA 2A7PA 2JK2A 5GPRA 2OWCA 4AIBA 5T26A 3OYZA 2BVTA 1IEIA 2V3DA 1R6WA 2P0IA 1EBHA 4DRSA 4IIDA 2DORA 2BP1A 4R9XA 1SZFA 1NARA 3KM8A 3HQ1A 1JFHA 1Y5VA 3BICA 2AL2B 4YYFA 1GHSA 1F4HA 4HBKA 2GQ8A 3TV8A 4AD5A 2DUXA 2X40A 3HJZA 3KBJA 1W17A 1R0MA 3L67A 3ISIX 3PFMA 4EK7A 2WMIA 1VHCA 2PDXA 5FAJA 4AD4A 2PCQA 3ZLGA 2GZXA 2BOFX 3IIZA 3KUMA 2QKFA 4J3XA 1FA2A 2XH4A 1UROA 4MYXA 3FHQA 1Y7VA 2ZA1A 3B06A 3O6DA 3COTA 3AU2A 4L9YA 1LF1A 2EPLX 3U7BA 5CGQA 1FCVA 4Q4QA 4LCRA 4NEWA 2WOQA 4GYFA 1POJA 2VHLA 1J0HA 2WNNA 1VD6A 1BHGA 1UD5A 3SIZA 4PULA 3AM9A 1VS1A 1H63A 1Z3NA 1NP2A 1RBOB 2F9RA 2PC4A 4JTCA 1ZPTA 3WBXA 1K7XA 4DZAA 1E0TA 3RDKA 1E1CA 4H00A 2E9LA 1E1CB 4UMCA 4EAMA 2IS7A 3BCFA 4U33A 3W7OA 4MNJA 1TPWA 3WLMA 1JRCA 3AWNA 1EA0A 2YW3A 4KGJA 1H7NA 3A47A 1Q13A 6ENLA 3ZMRA 4J40A 3UZYA 1JNDA 3GNOA 2YL6A 4JFWA 5D2VA 3PBVA 4JQ4A 1SJAA 5CG0A 4WDWA 3FHAA 2GVLA 3KVLA 4BWLC 3LNPA 5LA1A 5CSUA 3W1NA 1CXEA 4U2ZA 5H91A 3M0MA 1Q1WA 3WQGA 3N04A 1QNSA 2XVNA 3KBNA 4CD8A 3DFNA 5EFFA 4F2UA 3BAKA 4R5EA 1H50A 3EA3A 5F2GA 1G94A 4MHBA 4WK9A 2X41A 2J8TA 4MAVA 4UMAA 1B3ZA 4GPNA 4FNRA 1DWJM 1SYTA 5JBFA 1HUVA 2DV0A 3S2MA 4AY8A 3IGUA 3CMFA 3MMWA 4ZOBA 1E71M 2BOGX 1EXBA 1CWYA 4RV3A 2BV9A 2RDWA 2XGIA 5I77A 3W27A 1I9CB 1XI3A 1WNOA 4IX0A 4PMDA 1KM2A 1ZB5A 3OBEA 1DJYA 2X99A 5T8GA 1GOMA 1HF6A 3NCOA 3AXKA 4EPKA 1L8PA 4LCQA 4AYSA 5EMUA 1Q3NA 4K1WA 5A5WA 3L66A 2BC1A 1V0MA 1B1YA 1T40A 1Z41A 3M7WA 4PSPA 2CLFA 5AC5A 2BGSA 1T5AA 2WMFA 1L8NA 3KLLA 4DLMA 3TYBA 4J56A 1KRAC 4AD2A 3QC0A 3R25A 3DIPA 2NUXA 4JFVA 2E6DA 2CLKA 1PZ3A 3PZUA 4N42A 4JTQA 4AY7A 4AVOA 3DJGX 2BVWA 2IXVA 1MMFA 3GTNA 1RVGA 3RXZA 2VX7A 3SCPA 3LZ5A 3W7JA 2PWUA 1GOWA 3O0FA 3RN6A 3OP2A 3EX2A 4GBUA 1E5JA 3OZYA 4O8AA 1FCUA 2YKKA 4X22A 4UTTC 3QTGA 4DVOA 2WKJA 1W1TA 3TYDA 4PMNA 2G3FA 3OBKA 1DWFM 2OWWA 1E6XM 5FAGA 3MBFA 2W62A 3W2LA 2P1FA 3ZJ6A 2Z7GA 2XN1A 1NDZA 1H6VA 4L4OA 1AD1A 4H19A 4A8LA 2NSXA 3NZRA 3T0AA 4RE3A 1XHCA 3WEMA 3T09A 5KSWA 1Q6FA 1HVQA 1W5QA 1A5BA 1VFMA 1XBXA 3AQUA 1FWJC 4J3TA 3G5EA 1TWSA 3RITA 2CPUA 3HG3A 4XK2A 5JH2A 4CNTA 1M6JA 3QV7A 4PCPA 1NFPA 4AWSA 3MSYA 4HOZA 1RSCA 3GIYA 4IGSA 3CUIA 3MHUA 3WH5A 1I0DA 3GIPA 2OEMA 5BOEA 3UXIA 2ZDSA 1W1IE 3DDMA 1JDCA 3OQEA 1XRFA 1US2A 1OT1A 2POZA 3CXBA 3SW6A 2BASA 2OODA 1MO9A 1PTDA 2WZTA 3QFEA 1NFGA 2PUZA 3TA6A 1KRMA 4DWSD 3VE7A 3KL3A 1PXGA 5CSYA 4AZCA 4PMJA 5HWNA 2NXHA 2O4MA 4A22A 3MYPA 3RNMA 1AJ0A 2ZX7A 3PZTA 3TJIA 2X0YA 3IVSA 1DOSA 1XGDA 4KEVA 1TSIA 2HJPA 1I2RA 1J0YA 3BW3A 3TQKA 3FS2A 2QJMA 4H2CA 4AG0A 1W8SA 5E0KA 4F79A 5CAHA 1FEAA 1DL3A 1WBHA 4JQ3A 3P80A 3TQPA 1AOGA 4DB7A 4XO6A 5A2BA 3HMCA 1WDSA 2EQ9A 2YLLA 4R3UA 5FJIA 2DQWA 2FGZA 2G3NA 3H4XA 4GIAA 4IP7A 4LV4A 3AXHA 3UWWA 1O68A 2WWDA 5FKYA 4KW2A 4GY0A 2HNHA 3WBWA 4Q4PA 1H49A 3BW4A 4YTSA 4CCZA 1XISA 2PDHA 3AS1A 4PCSA 3VGDA 1OHLA 1F07A 1PX4A 3WMBA 2V2HA 2VR5A 4IMGA 1RHCA 3WD3A 3VNKA 2VFFA 1IQ8A 4S39A 1US3A 4M51A 3MVTA 5BOOA 1K6WA 3BOXA 3TTOA 4ILSA 1AQMA 3M1ZA 1SB3B 1E1FA 4BQ4A 3KP0A 1JYNA 4ES4A 4UFLA 1W5PA 4ORIA 1RQBA 3MI2A 3K2GA 4L61A 1MUCA 2W67A 3V36A 3G6LA 2XFWA 1UR8A 4OBTA 3KDNA 3PS7A 4Q6XA 1J5SA 1EC8A 2CC0A 4LVBA 4AVFA 4LEFA 1OBAA 3OW1A 3B9DA 4NAEA 3DBNA 1B4EA 1LRTA 4QRNA 1KV8A 3AYRA 5G4EA 5AN7A 4IFOA 4QTGA 4HK6A 4AISA 1MDRA 3CB3A 4O57A 3N9KA 1HIZA 4P61A 2H8ZA 1R2RA 2PS2A 2QMKA 4ADUA 4BZYA 3TW7A 4ZQMA 4N4PA 2XJ7A 2EHHA 4J2PA 4W8LA 2ZWYA 1TV5A 2J88A 3TSDA 3OJGA 4PUJA 3BOLA 3S6DA 2GK1B 2CHRA 3ANYA 1OFBA 1FVPA 3WDQA 2WMIB 3ZSSA 4FA3A 1W54A 4Z17A 4DQWA 3UA3A 2BBFA 4PUWA 1PB0A 4AZBA 2FB3A 4XAFA 5E70A 2W61A 1KLZA 3HPAA 1M03A 3DU0A 3T0TA 4O1CA 1UUQA 1PCWA 3FGCB 2VNCA 3FEMA 1JJKA 4OUIA 3WLNA 3WEOA 1EIXA 2X8HA 3VDAA 4RXGA 3N6HA 1V93A 4S38A 1R9ZA 3SGUA 4LAMA 2FDSA 3T4CA 4ZE4A 5IBXC 4IICA 3KEHA 1XIMA 3HZ3A 2RH9A 3F5KA 2Y6ZA 3FVMA 4ZL1A 1VEMA 2QPUA 2CYGA 1UJPA 1REQA 1KM3A 4AZ6A 3VOFA 4U5KA 4MM1A 3DOPA 3SUWA 1G01A 2JALA 4WOZA 1FWIC 1S5VA 2XFYA 3HFYA 3LENA 4HU3A 1TJ1A 1QI2A 4ASTA 5KINA 2ZWZA 1EQPA 5HMDA 3II4A 4DO6A 4ML9A 3L2MA 3B03A 1G7VA 1NP0A 1RM6B 5D33A 1EFZA 3U57A 2I14A 5LXEA 2QDEA 1G4TA 1CECA 4QCEA 1C29A 3VCCA 3WQFA 3AHTA 2WJEA 2JFEX 1RCOB 4RX0A 1K6AA 1RQEA 2WVVA 4KBXA 5DRIA 5CXPA 2G3JA 4RJEA 3WBYA 2QJGA 5K9XA 1V59A 4TIMA 4LVGA 3HFTA 5B80A 5ABFB 5AHEA 1TCMA 3UXKA 4N9CA 3NO1A 1H1NA 3I3DA 1UB3A 4DLFA 1K8YA 1UWIA 3KL5A 1EF3A 4HA4A 3ZWTA 3TUUA 4YNGA 4P7NA 3SGZA 4GK8A 3OGSA 4MADA 1AD4A 2V81A 4JXCA 4HZMA 1S2WA 4AZHA 3DKLA 2RJGA 5E1QA 1LJYA 3K1GA 2R24A 5FL1A 4K1GA 1EGZA 2Q8XA 1PKNA 2J27A 3A6OA 3AISA 3OYXA 3VI2A 3P2VA 2HPMA 3HGRA 1GNXA 3P67A 1DXIA 1KFCA 3VNYA 3SB0A 1I75A 2VMFA 5F2IA 3GSMA 3RNDA 4QXIA 2BG5A 3T9PA 3TA9A 3L4TA 1GQJA 3FKKA 2DH3A 4BKNA 1FP8A 3EWZA 2XIQA 3EX6A 1NHRA 1GRFA 1SJBA 1A3XA 3N29A 3SEPA 3H7VA 3R0UA 5RUBA 2EGZA 2W54A 2C1GA 3NQ2A 8RUCA 3DKJA 1GREA 4ZR8A 1CLVA 3ANVA 3DK4A 2GSEA 3KHDA 4YWOA 3G1AA 3H26A 3VIPA 1QHOA 2BCPA 3GVVA 1KA9F 4GIRA 3HURA 4QIUA 2WZMA 4OIFA 4BFAA 3PN8A 4B3LA 3UG4A 4O0QA 1J9YA 4HHMA 2PP0A 4M3PA 3SCWA 3ZO9A 2PB1A 2VZOA 2GR0A 4W93A 2WHLA 4FZIA 2Q8LA 1A5MC 3VKJA 4MFEA 1YMYA 2EQ7A 1E9YB 4KFOA 3MKKA 4KWUA 1U83A 1V0LA 3JZEA 4FX7A 4MAZA 1ONXA 2ZVRA 3A9IA 4REQA 4LBSA 1IR2A 3BJSA 1DIDA 3C86A 2G0WA 2E5AA 3FV9A 3VPLA 3AO0A 4H4SA 4N6EA 4C6BA 3VILA 3CPUA 4C6KA 2C6QA 3GH5A 1ODUA 5DMNA 3DGZA 2DQXA 3U2EA 8CGTA 2VEFA 3CHFA 4JDYA 1AL8A 2EXOA 4GD0A 3W82A 4IIBA 1ZX9A 1B30A 2HE5A 3E02A 2ZZBA 4YTRA 3CL7A 3DI1A 4RL3A 1DNCA 4GI4A 4UTHA 1TX0A 2QUTA 1B2YA 3MHGA 4L6DA 1MUMA 2A3AA 4CVUA 3W00A 2A3LA 3AJXA 3VCNA 3DYOA 3GD3A 2PDGA 4G7FA 1T41A 4TX6A 5FJOA 3VDHA 1HKKA 5HA7A 3WQEA 3LERA 4AHQA 2TYSA 3GXDA 3H53A 3MSGA 3NTYA 3VKKA 3VIOA 4IUGA 1J11A 4WVXA 3CQ0A 4M19A 1XDLA 1KWGA 3EDEA 1LM1A 3B8UA 1P0DA 1QWGA 2QDGA 3VU2A 1LCOA 5G2WA 2WJZA 2J8FA 1TTPA 3S9ZA 4RXFA 4MGGA 3LLFA 3UJFA 3G3MA 1ALDA 1XYCA 1ZFJA 1PX3A 3PWAA 3HG5A 3ITXA 5CH9A 2J6VA 1G69A 3TZNA 1W3LA 3WNLA 1B3OA 3NUKA 3G1HA 3PTKA 2QV4A 4DHGA 4L4LA 3NXLA 3STGA 5F4WA 2CBVA 2REQA 1IZJA 3A5VA 2YR1A 1CLKA 1S2VA 3B0VC 1F9CA 1UD6A 1BYBA 3AU6A 3QZAA 1W37A 4JDRA 2OEKA 1S5MA 5I3IA 2JGYA 2DEPA 3PP7A 4KERA 1T96A 3NWRA 1JPMA 5K2ZA 2XH2A 1XGEA 4GQGA 3R0DA 2IMRA 4MFDA 4RE2A 4C5YA 3W9ZA 2ZX5A 4GUJA 4UCFA 1HFBA 3OVPA 2WK2A 1TV4A 4DXXA 1M68A 2P5NA 4KWOA 4H1ZA 2X2YA 5EYWA 2C3CA 5CKSA 4X0NA 4YWIA 5A8MA 3S5ZA 3AYVA 3SRFA 3UWYA 2I17A 5BWFA 2VXNA 2A4AA 4Y9MA 1K3UA 5HQEA 2GVYA 1JCYA 3E2QA 4OTKA 5LHEA 3M6DA 4A3HA 1RPXA 4MIMA 4JTIA 5FJRA 1LOSA 3LTYA 4A05A 1XLCA 3M0JA 4EWJA 3R7MA 3W81A 3QEZA 3ZT5A 2X0HA 2UY5A 3THQA 3POHA 5G5GB 1JCMP 1M9HA 3LX9A 1XCXA 3CGDA 1SGJA 1A5SA 4B3ZA 3VNZA 1CDGA 2ANUA 3APTA 1X6LA 1H3GA 5CGMA 4GI6A 3K5XA 4XKMA 3PF3A 4DJFD 2GR3A 2OOFA 3EWXA 3HGJA 3L2IA 3NQDA 1FDJA 1C8VA 3LCHA 2ACRA 3LCFA 3T2OA 1J18A 1YNQA 1GKPA 2QF7A 4OOUA 3UJEA 1C7SA 4WOQA 4C91A 1NY1A 1L0PA 4BF7A 4XAYA 3GO2A 2YPIA 3WZ0E 4V28A 3WQ4A 2BFGA 4Z1BA 3OGVA 2BXZA 1SM9A 4KRZA 2YL5A 2R14A 3TR9A 4CEXC 3V1PA 4X3ZA 3QRHA 3W26A 1YE6A 2WSQA 1G0CA 4U4MA 3WL0A 4Q8OA 4FNUA 3QMRA 4GBDA 1UZHA 2ADAA 5J5DA 4GQ0A 4IG2B 3FFSA 2GUYA 3O06A 3T05A 1D7YA 1JI1A 2QQ6A 4LB3A 3WF1A 1C9WA 5DFAA 4JTSA 3IJLA 3V3WA 4GI8A 4XAGA 4DF2A 3L12A 3W88A 2D2OA 4A6GA 4AIOA 2NXIA 3H2FA 1GVQA 3M7SA 1FWDC 3Q37A 4Q6JA 1AA1B 4S3CA 2H9AB 4S23A 1R47A 1JPDX 4F66A 2TRSA 1Y65A 4JYEA 2B7NA 3F5LA 3W0KA 1VRXA 2WNQA 1A0CA 1KW1A 2HVMA 1CGTA 2CBUA 4J4KA 4JEQA 1LP6A 3WK1A 5A6SA 3BTNA 1BQGA 1UR0A 3HU7A 3OA5A 3LHWA 3VKAA 3NPUA 4O53A 4DEFA 2Q6ZA 4JY9A 4O1AA 2WCSA 1BGAA 3G0SA 1PZ1A 2C13A 2C0AA 4MJMA 3EYPA 1G4PA 2FIQA 2QCEA 3J7HA 3IARA 3E0LA 1BVNP 4P5UA 1K9DA 1YHTA 4QJ1A 3TAKA 1D7KA 5DY2A 1JG9A 1XQKA 2QVHA 4XG1A 4GJJA 2EBNA 3ITGA 3KE0A 1H7OA 4EXQA 3AMDA 2DIJA 4H6QA 2PTWA 3VZXA 1GG0A 4LBRA 2I5IA 2JKPA 4FNQA 3VABA 3VA8A 1A49A 2HQMA 2J4GA 4KMQA 3W6YA 3ZVHA 2CLOA 2CDUA 5FSEC 3EMCA 3P5ZA 4G56A 4PTWA 4H4UA 1BEUA 3BSGA 4D6HA 3TJ4A 3VNMA 7REQB 3P61A 1JEHA 4QDWA 1I8JA 3ZSTA 4X0VA 5DX7A 1FXPA 1NU5A 3VMOA 4PUUA 4O0KA 1PDZA 4ZO8A 2I56A 1EX1A 3PBUA 4BA0A 4W5ZA 1EPVA 4O28A 1V3LA 1KM1A 3QQ0A 3LY0A 4H9XA 3NGJA 3C2OA 1E3ZA 2I9UA 3A24A 2PDYA 1TR1A 4US5A 4MJ2A 4B5WA 1CENA 3KTXA 3DERA 3EOSA 3RPDA 1YTKA 3EKLA 4LALA 3RM9A 4ERIA 3WFLA 1QI4A 2BY3A 6ALDA 2WO5A 2OZ8A 1F6PA 3GHTA 5L6UA 3GG7A 3BAIA 1LOQA 3BZGA 4O1EA 3QHOA 1TJ2A 2CXGA 1IEXA 1D3HA 1O5XA 3SFKA 2OKOA 2ZA3A 2VEGA 1IWAA 4R7OA 1VFTA 2JF6A 1GVRA 2ZC1A 1JROA 2CLIA 1KXHA 4JICA 3F2DA 2VVNA 5A8QA 3M0IA 2HQAA 3F4NA 1LORA 4C6MA 4UTTA 1Q6GA 4UTFA 2FVKA 1BGGA 2C91A 4FIQA 4UFIA 1GV4A 3K46A 3W7CA 3DZ1A 2QZRA 4MY9A 1FFRA 4OV4A 4JL2A 4ZGYA 1XPGA 4JYDA 3LHVA 1VFOA 2CZFA 3FA3A 5A6BA 1UWTA 5H2ZA 1UUMA 1PIFA 3WNMA 4UTIA 5FEWA 1JGIA 4FO4A 1BKHA 3GD6A 3QQWA 2B81A 3EWUA 3TN5A 3UG5A 2QCDA 3VM5A 4LH8A 1OFRA 2GGJA 2OVLA 3OB8A 3VIMA 2PDMA 1GYMA 4ZB2A 2Z1BA 5FJTA 4QLLA 4LS0A 5HMEA 4EACA 4PBEA 4TVUA 5JCKA 4UBPC 5IBXA 1PE1A 1PTAA 1X8CA 1WDWA 1W31A 1AMYA 4NILA 2W92A 3SJNA 3EMQA 2FZBA 2HVOA 1UPPA 3N3MA 1XQLA 1WX0A 3W7GA 1W5NA 4KIEA 1NF0A 1DWGM 3VC5A 3M16A 3LPPA 1E55A 4HMNA 1KR1A 3UY8A 3Q94A 4IM4A 2REQB 4IXXA 2WVUA 1PSCA 5CPSA 1XD0A 4US6A 3MUZ1 4WSJA 3WQDA 4BQ2A 4IH3A 2OR2A 2G4FA 4DO7A 1JXKA 3S42A 2YA0A 4EMIA 3BQ6A 3W28A 3APYA 5KZDA 2D73A 2XGZA 3IJQA 3WLPA 1LPFA 3KOFA 1X7FA 4O13A 2NQ5A 4I5XA 2PA6A 2WCGA 4XWUA 3FYOA 5FJJA 3E5PA 3EX1A 4GZ7A 4FLRA 3I68A 4P8VA 4F3HA 2FHFA 2WC4A 3S5OA 2CLPA 1ISZA 2VEMA 3W2KA 1G9HA 1HNYA 4DYJA 1SMAA 5KVHA 3OZOA 3BG5A 4K7YA 3BC9A 3UY7A 1QNVA 4GY7A 2V38A 3WLHA 2ZQ0A 1FRBA 1E3XA 2ZKMX 5AVHA 5C9XA 3NSXA 2Z1WA 3OLGA 1R3RA 2RFGA 3DC8A 3NSNA 3U9IA 4FNTA 3UR5A 3QPYA 4H4ZA 4IJBA 1XICA 1C91A 3BSHA 3ME3A 1BYCA 1GW9A 2CKSA 4NX5A 2XVGA 1KCKA 4HQVA 3W1RA 2V5BA 5I2UA 4Q22A 1BG9A 3NJ3A 2H6RA 4FLQA 3N2BA 1EDTA 4WEVX 2J77A 3R79A 2P50A 1KBBA 2W0UA 5JMUA 4WUIA 2ZRVA 1OX6A 1Q6EA 4XTIA 1TREA 4HCLA 2VRKA 1RR2A 3D3FA 3GH4A 4WJXA 4DZ5A 5CPTA 4MY1A 2ZUSA 1EGMA 3PUDA 2ICSA 4Q8MA 4HA0A 1NDWA 4ADTA 3GDRA 2ZRYA 4U5IA 3FLUA 3L4WA 1E43A 1Q45A 2ABAA 5AZ1A 4FIRA 4RZ6A 3SY8A 3KP1A 1R46A 1XLIA 4JQ2A 1Q7MA 2BZNA 1K9TA 3IACA 1XUZA 1Y5WA 4PUDA 1NWTA 2DZBA 1AQ0A 4JEJA 4XSMA 4JFSA 2HVNA 3CV6A 3NGFA 3P74A 3W7IA 2XG9A 3HTWA 4HK7A 3AHZA 1V6WA 2WNWA 3N4FA 4NHVA 5HNUA 3VGEA 3IIOA 3PUOA 3EOOA 3NG3A 1OYBA 1H1YA 3PPGA 3MMDA 1EJUC 1UPMB 3L4XA 1FFUC 1FWCC 3HW2A 4LNYA 1W3KA 3T42A 2A6NA 1EB3A 4I90A 3B97A 2GGHA 1QW9A 3E2VA 3EANA 1O66A 3U4AA 4XZMX 4XZNX 2ZZ7A 4H8NA 4WJEA 4ATDA 3GR7A 1WQ5A 4J2MA 4NIRA 3URAA 1KCLA 4AHOA 1OJTA 3U2OA 4LAZA 5E09A 2ZE0A 3N9RA 2VT0A 2VUYA 4XIAA 5CG7A 3ABRA 3HJEA 4KCVA 4NJGA 3PTDA 1GOKA 1XS2A 3SAZA 4F0KA 1ZKQA 5CZKA 1V8EA 2H9AA 1R3VA 1W3IA 2RUSA 3EWYA 4W8BA 1SJCA 2DU2A 3QH2A 4NRSA 4GC4A 4LF2A 1EEPA 3TWAA 2WKLA 2O56A 3DHPA 2JF7A 1DJZA 1WDQA 4CQAA 2D3LA 3M0XA 2WOWA 2OZTA 4C6EA 4DJED 4B92A 1FY6A 3EB4A 4JY8A 2YBTA 3DFQA 4CNPA 2RJHA 4BJHA 3N13A 1YQ2A 5D9OA 4NAFB 3A21A 1LUCB 5CQ1A 3A4WA 3W25A 2P76A 3WH9A 1LQ0A 4F2BA 1EP3A 2C3DA 3MJYA 3BG3A 4UTJA 1M04A 2QAEA 2GFTA 4YVPA 1MQPA 4DPPA 3NXFA 1GXFA 1U33A 3NQ7A 4E2BA 4F0LA 5GRTA 2JIWA 4X9SA 4GYKA 2C79A 3TC6A 3S0CA 5EMYA 2WMGA 3LD5A 1NHQA 1P6BA 1RA0A 2PBGA 4PUEA 3ERPA 3GTIA 1DBTA 2X8RA 3SY1A 1X97A 3I65A 2HISA 2AQVA 3UWEA 2NLIA 4X60A 5AECA 3AHYA 1QXLA 2A3CA 2NUYA 3V0TA 1V77A 4LXFA 3TNOA 4TX8A 2FB2A 5D8WA 4PMQA 3AHVA 2XIOA 2PTZA 2EG7A 1YNPA 3E3HA 3LGDA 4FF7A 4MUZA 3A4AA 4MNLA 3Q4DA 2F61A 3L2LA 4ACZB 1E56A 1H51A 3EOLA 3OC4A 3UZWA 2C7FA 2E8YA 2VENA 1UKQA 3WLJA 3VIGA 4Y9AA 3AXMA 1OC5A 3ANUA 3NA8A 1BYDA 2OLSA 1JR1A 3R58A 3CAWA 4TMCA 2NV2A 4HJFA 3T0CA 3PK7A 3W7RA 4HOXA 1QW7A 1WP6A 4NP7A 1PUDA 3GG0A 3WH7A 3NOEA 1JZ3A 2R91A 1FECA 2YDSA 1V97A 4AX6A 4C6JA 3MCOA 3K8LA 1XP3A 3WSUA 3B8TA 3H7UA 3VIHA 4UTLA 1KFBA 4HU8A 3PZOA 2Y7GA 1ZJAA 3B8WA 3FA4A 4C6PA 1OJXA 1DXLA 3G1FA 1NDAA 5DMYA 1Z42A 4X9YA 2DH2A 3TTQA 3AWOA 1BTMA 3GXTA 2GQ3A 3M64A 3V0SA 4MZYA 4PMVA 2YBVA 3WCZA 4HU4A 1NF7A 3CO8A 1WAWA 2ON3A 1EDQA 2XFRA 4BK9A 1XYLA 4ZO9A 2VFGA 1WZAA 4ZFCA 3CWHA 1O5QA 3WQVA 3VE9A 4PC8A 1RQHA 3TEVA 2QCGA 3POCA 3ZT6A 1KGWA 2ZTKA 4D6FA 3W85A 2QUNA 3WK0A 3ES7A 2MNRA 7CGTA 1ZMCA 3GFXA 4HP5A 3CPRA 2GDUA 4KF1A 1ZP4A 1JQVA 5I3KA 4RE4A 2NT0A 3GY1A 4R7WA 2J9YA 3BAXA 1TE6A 3GVQA 1N8IA 3C2EA 3PM6A 3V4BA 2E1DA 3MKVA 4XX6A 3R07C 1ECEA 4K39A 2VGBA 3NAVA 4O11A 4DAIA 4LRSA 4HZ7A 4PL1A 1CB7B 1QAPA 4J1OA 2P0OA 2P3EA 1LBFA 3QZEA 4GIYA 5IDZA 1TCDA 3NQ8A 3RX2A 1EA9C 3BOFA 1YQZA 1E15A 3O0HA 3B4UA 3CIXA 5GJNA 2IUZA 4POCA 1WB0A 2ZRWA 4IISA 1HL9A 3CQKA 1ITQA 1OC7A 4XO7A 4FXJA 3SCQA 1BPLB 3TXZA 2J7EA 2E1WA 2JE8A 3G77A 3WKZA 3N9SA 3T81A 4ZENA 2ZXDA 1ISWA 2PWGA 4KFNA 1CT5A 2W4XA 5FA5A 2GYIA 4ZTXA 1A5OC 4I3GA 4IWWA 5ABTA 4GRTA 3LADA 2Z26A 1ZBKA 1WKYA 4AXKA 3QZ6A 3GVRA 1R3TA 1LT8A 1I2OA 3B9JB 3IV3A 4GFIA 2Q01A 4O8RA 1QUMA 1E0XA 1PDYA 2YZRA 4GVGA 4M6UA 1W3NA 4EPEC 1R30A 4Z2GA 1ODZA 3N1AA 5CLWA 1V7YA 2WBAA 1DXFA 2NPXA 3RMJA 4A8IA 5D38A 1AW2A 4IIFA 4GXWA 3IGHX 2QCDB 1IZCA 1ITXA 2E6AA 3VNIA 1JDDA 5TR3A 5IRPA 4GUGA 2GQ9A 2C19A 3Q45A 8XIMA 2Z1KA 1A5AA 3IPWA