3OW1A

Crystal structure of d-mannonate dehydratase from chromohalobacter salexigens complexed with mg
Total Genus 144
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
144
sequence length
403
structure length
384
Chain Sequence
LKIRDAYTIVTCPGRNFVTLKIVTESGTHGIGDATLNGREMAVAAYLDEHVVPALIGRDAGRIEDTWQYLYRGAYWRRGPVTMTAIAAVDMALWDIKAKAAGMPLYQLLGGKSRERVMTYAHCTGQTIEDCLGEVARHVELGYRAVRVQSGVPGSSLPAEHVWSTEKYLNHAPKLFAAVRERFGDDLHVLHDVHHRLTPIEAARLGKAVEPYHLFWLEDCVPAENQESLRLIREHTTTPLAIGEVFNSIHDCRELIQNQWIDYIRMPLTHGGGITAMRRVADLASLYHVRTGFHGPTDLSPVCLGAAIHFDTWVPNFGIQEHMPHTDETDAVFPHDYRFEDGHFLAGESPGHGVDIDEELAAKYPYERASLPVNRLEDGTLWHW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mandelate racemase/muconate lactonizing enzyme
publication title CRYSTAL STRUCTURE OF D-MANNONATE DEHYDRATASE FROM CHROMOHALOBACTER SALEXIGENS complexed with MG
rcsb
source organism Chromohalobacter salexigens
molecule tags Lyase
total genus 144
structure length 384
sequence length 403
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 4.2.1.39: Gluconate dehydratase.
pdb deposition date 2010-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02746 MR_MLE_N Mandelate racemase / muconate lactonizing enzyme, N-terminal domain
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 3ow1A02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 3ow1A01
2XH0A 3JVAA 4GMEA 1EBGA 1KKOA 4HNLA 2POZA 2GGGA 2OG9A 3IJIA 3I6TA 3VFCA 3P0WA 3R10A 4G7FA 4EWJA 4GYPC 3STPA 2P8BA 3QPEA 2GGEA 3HPFA 4ZA0A 3I6EA 3ENLA 3H7VA 3IK4A 2QJMA 3MY9A 5J04A 3VC5A 3T6CA 1SJBA 3UCCA 3VDGA 2PTYA 3GD6A 4ENLA 3V5CA 3H70A 1YEYA 4IP5A 3FYYA 2OZ8A 3FV9A 5FJPA 4KEMA 3GO2A 1IYXA 3SN0A 5BOFA 1MRAA 2XGZA 3U9IA 3ES8A 3B97A 1TE6A 3DG6A 3SJNA 4GGBA 4A6GA 3T8QA 3V4BA 3QN3A 4M0XA 4KWSA 1P43A 2QVHA 3KUMA 1L8PA 2PTWA 1WUFA 2PP3A 3TJ4A 3D47A 3UJSA 3VC6A 1BQGA 3RITA 1EC7A 4IHCA 4HCLA 2P0IA 3ZLGA 2XSXA 3RCYA 2ZC8A 2RDXA 2QJJA 2XH4A 4J3ZA 2OVLA 3DEQA 2AKZA 2XH7A 1XS2A 1KKRA 1ECQA 1R0MA 4DHGA 4J1OA 2DW6A 2PSNA 3UGVA 3NFUA 1KD0A 4H2HA 3FVDA 4GFIA 2PP1A 3BOXA 5BOEA 3TJIA 3NXLA 2QGYA 2FYMA 1FHUA 3SN1A 3EKGA 3P93A 3TTEA 1MUCA 2DW7A 3UCDA 3P3BA 2OQYA 4H1ZA 3SN4A 3TCSA 4H19A 4M6UA 1XPYA 2P88A 1NU5A 3V3WA 3THUA 2OX4A 1RVKA 3DESA 1W6TA 3OTRA 4G8TA 4FP1A 3MZNA 6ENLA 1OEPA 3SQSA 3N6JA 3PK7A 3CXOA 3MWCA 5ENLA 2NQLA 3N4EA 3DDMA 2AL1A 1PDZA 3GY1A 2ONEA 3ZVHB 2AKMA 2PGEA 3RRAA 3MUCA 2OZ3A 2PTXA 4E8GA 5FJRA 3V5FA 3DGBA 3UJRA 3SBFA 3N6HA 2AL2B 3NO1A 4JN8A 2PMQA 4KPLA 1PDYA 3DG3A 3ES7A 3RO6A 4DXKA 2PU0A 3OZMA 3R0UA 4HNCA 4HYRA 2GSHA 2OLAA 2QDDA 3TQPA 2PP0A 1JDFA 3TW9A 2ZADA 3CB3A 3NZGA 3Q4DA 3S47A 4DWDA 1FHVA 3U4FA 3DFYA 3UXLA 5IDZA 2HNEA 3TOYA 3PWGA 2QQ6A 4GIRA 4ZCWA 4MKSA 2GL5A 3R1ZA 3UXKA 3R0KA 2I5QA 3VA8A 3QKEA 1SJCA 4ROPA 2FKPA 4HCHA 2PS2A 3R11A 3DIPA 1JCTA 4JN7A 4DX3A 3FCPA 2CHRA 5FJTA 1ELSA 3UJFA 4FI4A 5FJUA 3EEZA 3ZLHA 7ENLA 3CAWA 4HCDA 2OPJA 3H12A 3K1GA 4E4FA 4F4RA 1TZZA 4IL2A 2GGJA 3OP2A 3QLDA 4MMWA 3JW7A 1TKKA 1NELA 4IT1A 3S5SA 2MNRA 2HXUA 3DFHA 1P48A 2P8CA 4MGGA 3I4KA 2PTZA 4K1WA 3T9PA 2MUCA 3BJSA 3RR1A 4KT2A 2P3ZA 1SJAA 2PA6A 3N4FA 3H8AA 3CT2A 4YWSA 4IZGA 5FJOA 2OO6A 3MSYA 3JZUA 2GGHA 2PODA 3UJ2A 2OZTA 2PPGA 4K2SA 4K8GA 3CYJA 4A3RA 3BSMA 3TWAA 2PCEA 2QDEA 4E4UA 1DTNA 1EBHA 4DN1A 1WUEA 1JPMA 4JHMA 1F9CA 1EC9A 3PWIA 3GC2A 2QJNA 1ONEA 3DERA 3VCCA 3PFRA 1R6WA 3FXGA 3R25A 2HXTA 3QTPA 3IJQA 3MKCA 3TWBA 1EC8A 4HN8A 2O56A 3IJLA 3ZVIA 4GYPA 3OW1A 4GGHA 4E5TA 3ZVHA 2PU1A 3MQTA 3RGTA 1MDLA 3OZYA 2AL2A 4Z1YA 4H83A 1E9IA 1MNSA 3DG7A 4GISA 4IP4A 3OPSA 2GDQA 1MDRA 1KCZA 2HZGA 5EU9A 3Q45A 1SJDA 2XH2A 3ZLFA 2PGWA 2OFJA 4E6MA 2OQHA 3CK5A 4DYEA 4IL0A 2OKTA 4HPNA 4Z17A 3UJEA 3T4WA 1JPDX 3FJ4A 4X2PA 1BKHA 4A35A 3SSZA 2GGIA 3VCNA 3D46A
chains in the Genus database with same CATH superfamily
5CC6A 3GR7A 2OSWA 1HKMA 5A2CA 1U1JA 1W3TA 3TDFA 3QPZA 3GR4A 1QTWA 3AJXA 2OG9A 3NZPA 3BUVA 5LHEA 3G5EA 4QJ3B 1XC6A 3DC8A 3FYPA 4HNTA 2EQDA 3DHPA 3QMTA 3H2AA 1KFLA 2Z27A 1DWFM 1L2QA 5CXPA 2ZUNA 4ERGA 1FCQA 2WNQA 4JTUA 4DF1A 5IRPA 1W0MA 2F6XA 2PRLA 1UR9A 3AXMA 2WKLA 3QFEA 2E8YA 2CETA 5REQA 3CJPA 3MTWA 1RBOB 1R3QA 1E55A 3ZR6A 4H9MA 3VDGA 4BQ3A 3TYAA 1PTGA 3W4RA 2WPEA 2G41A 4NI3A 3NQ7A 1IQ8A 1CT5A 1W91A 4R7JA 2PDQA 4I7VA 5CAKA 1DWGM 2WWDA 4MWAE 1IYXA 2QCEA 6REQA 4IUGA 3W2MA 1TUXA 2GJRA 5AECA 1CEOA 1WNOA 3GU1A 3N04A 3A24A 1LL6A 4WJEA 4ECLA 5AC8A 3OGVA 3ZJKA 2X1SA 3N73A 2BX7A 3BG5A 1JFXA 1PX4A 4XO7A 1GZJA 4FMVA 4C6DA 1XYCA 3CZEA 5LNWA 2QV5A 2VEPA 1U22A 1JXJA 1Z9AA 2PTDA 3MPGA 2XINA 5F4XA 3NRZB 3I7QA 2VUNA 3CZKA 4Q32A 3RILA 1HTIA 3TZFA 3WDHA 3ZWSA 2DVXA 4GZJA 2FPVA 1XLGA 4QSFA 1KM2A 3VNZA 4NAFA 4H4XA 5AYYA 5BXPA 1OCBA 4J1OA 3FS2A 3N18A 2YLAA 3OHIA 5AHIA 1JDDA 4JQ2A 4LC6A 1KD0A 4OE7A 1SO6A 2BVTA 2OGYA 3GBDA 1M7JA 2C14A 3V0UA 1F5ZA 4QM1A 1I0DA 1OINA 1B54A 3GHRA 3V75A 3EKGA 1D2KA 4FX8A 3FN9A 3ZT7A 3VKDA 2A1YA 2AMGA 3C2VA 2J47A 4DWSA 3THUA 1YE4A 2OX4A 4I8YA 4MJMA 3O6YX 4AYGA 1K8ZA 2RUSA 2XVKA 2O9TA 1QPOA 1M68A 4G8TA 4U31A 3IIPA 2WKGA 4IMFA 2J79A 2CLMA 1M53A 5JU6A 2ASHA 1NWSA 8TIMA 1O5RA 1E6SM 2HSAA 4IM4A 2W55A 3REQA 3N4EA 3SRHA 4NAEB 5LIUX 4MWAD 1JUBA 3EANA 1Z48A 4FS9A 2PGEA 2OSXA 3TFCA 4HMCA 2JF7A 2WVVB 1KNWA 3V35A 4GNJA 3CIVA 1UHVA 1GOOA 4DXKA 1P1XA 5E93A 4LCRA 3WQ5A 2W54A 2DSWA 3N2OA 4PCSA 1KRMA 2X05A 2LLEA 4H4IA 5G1MA 4W93A 1Z8AA 5ABGA 2IQDA 3LDVA 1HO1A 2ZX9A 3LHVA 4IX0A 1RY8A 1NTHA 3G24A 2VX4A 2ZTKA 3S46A 1WBJA 2B4GA 5G2HA 4XZLX 4MY1A 1EYWA 4TX9A 3CHDA 1GTHA 3VI2A 1DWAM 1T0OA 3ITLA 3QM3A 3NVWB 2PS2A 5JQ9A 4CEXC 1T8QA 4ZQNA 3T07A 1FX6A 4XKYA 3CAQA 2GWNA 2ZTJA 3MJYA 5AFDA 2VX5A 3CQIA 2VOMA 3PJUA 3WLMA 4BF7A 1UQZA 2C3DA 1JAEA 1QAPA 4O52A 3A21A 3AMLA 4F8XA 1QO5A 3TXZA 4LEQA 1ZPTA 3S0CA 4TUFA 1BG9A 5HK4A 3L7RA 3VOGA 1FHDA 1XGZA 3ZJ7A 4O11A 5AC6A 1KV5A 2W3SA 1KR1A 4IQLA 3NOEA 4ILSA 4GO9A 3OO2A 6TIMA 2E4TA 3CMJA 4H9ZA 2QJIA 4JX6A 3SSJA 4M6VA 1BWCA 2C19A 3NVDA 1V97A 3PBMA 2WSKA 4ZSUA 1PL9A 1RJQA 1V3JA 1EUNA 1QWGA 3ZMRA 5ABEA 2Y6ZA 3BSMA 1SO4A 4HMNA 3ZQ9A 3V5OA 3LCXA 1EJUC 3CHCA 2FHBA 2XWEA 5EL1A 3E1F1 1ZL1A 3ORWA 2QZRA 5CGMA 3A4AA 3GC2A 3NEHA 3GE7A 4Q22A 2VR4A 1S1RA 2YCEA 1R6WA 4S1FA 3DCPA 2PDLA 1G9HA 4CCZA 5EMKA 3OZOA 4W7WA 3S1UA 5F2LA 3W74A 3MDWA 4OU1A 4W9TA 4HTYA 4WY0F 4QCFA 4GXPA 4ML4A 1GW1A 4S3AA 4HN8A 4WLCA 1UW9A 3E2QA 4GYPA 4EVZA 1OX4B 5DY2A 2O7SA 4S3FA 4UTTA 4UCGA 2XISA 2ZX5A 5EMYA 1GESA 2DQWA 4A21A 3SJ3A 1IT7A 3VIHA 4H4PA 1K8YA 3HGOA 1H7XA 5E1QA 3HJEA 3M0HA 1ZLPA 3UD6A 4FF5A 1VFUA 4H9UA 1US2A 4CD5A 3W29A 1AL7A 4N6EA 3J7HA 1GW9A 1KCZA 1ICQA 1Q4WA 3L4ZA 2V5JA 1SSDA 3SCWA 4UZUA 1Y5WA 5MKGA 2FZNA 3NEVA 3L4TA 1UKOA 1O7AA 5DXYA 4ICMA 3M47A 2J13A 4UTHA 4Y7EA 2Y5EA 4HP5A 3TSMA 3U48A 1XISA 2REQB 3GW0A 3STFA 1QVBA 2G3MA 4FAMA 5BYWA 1BKHA 4DUWA 5FF7A 1THFD 4UWMA 2ZVRA 2ICSA 4RNJA 4K8HA 3A7UA 2YSWA 3W1UA 2FPYA 5EA9A 3MKVA 1Q5MA 2WCAA 4CCEA 1OFQA 1KM0A 4EACA 3BV4A 3I6TA 3UZZA 3FYOA 3VDCA 3WF3A 1OG0A 5G5IA 1TFVA 1FWDC 5I3KA 3WK3A 5EBAA 1VEMA 1G1YA 2W6RA 3APTA 1SZNA 2DZPA 1OSEA 1RP8A 2PD5A 2GJNA 3G8RA 3I6EA 3RYSA 1Q6LA 4D6CA 2QCDB 1EEXA 1RCOB 2ZZCA 3CAKA 3A9IA 5G5HB 4WXYA 4Z1AA 1NP2A 2Z1BA 3T6CA 2JIEA 3NPUA 4EQXA 3HV9A 4K3ZA 1TYPA 1FFVC 5AYBA 3WQCA 3MA8A 3AMDA 1DEDA 4PEKA 3EPMA 4Y8FA 5BRQA 4PUJA 4QLKA 3WLTA 4H9YA 4R53A 1W9XA 3O16A 4JDRA 3AMZA 3KUMA 4Q7NA 4IPNB 1TPC1 3MHFA 5I23A 2EHHA 2NLYA 3RM8A 1P0EA 2WVSA 1IIGA 3VE9A 3RIKA 5A6BA 2RDXA 1RXOB 2WP5A 1VGAA 5A95A 4C90A 4ZOEA 1O5XA 1C93A 2XH7A 1M03A 4EM3A 2WHLA 1M41A 3CTLA 1JOAA 3RLHA 4DBSA 2WPCA 2DW6A 1FP8A 3ITOA 1V93A 2DY3A 1XSIA 3ZS4A 1W1PA 3GVRA 3GAYA 4GWEA 2POTA 3U57A 4CD8A 1C7TA 5G2WA 2BY3A 5I0DA 4MHBA 3PSWA 4J2MA 4MM1A 3P93A 1AODA 3VNDA 5ABHA 4XZNX 1TV8A 2CBUA 3TR9A 1HJVA 4BY3A 1GHSA 5LIXX 5CPNA 3PY2A 4A4AA 5EPDA 3CWHA 1S1PA 4WSJA 3SFKA 3GDKA 2NW0A 3LK6A 1RLCL 3S1WA 1KXHA 2PLJA 6ENLA 3H2MA 2X7WA 4RV8A 2WB5A 1UZ4A 4MUZA 2X0HA 3FA5A 3TQ0A 4BR1A 3MANA 4ASTA 1J8VA 4AD3A 1CDGA 4AQLA 2XVNA 1Y8BA 4GNKB 4Y9PA 1YKWA 1B31A 4N42A 5CZJA 1IR1A 1KW1A 1Q45A 3FJNA 4QDPA 2ALRA 4X60A 2WC7A 1L6WA 5A8PA 1IEIA 2CHOA 5D37A 3KP1A 3RFAA 1JCYA 3C0LA 1U1HA 3KLLA 2UY3A 2WVUA 1L2UA 3WDRA 1ZAIA 3ARWA 3CLWA 3CGTA 1TPWA 1A5CA 1NOFA 4XUGA 1K8CA 1J18A 2ZICA 4K7ZA 1D8CA 1H1NA 4UFIA 4GXWA 3QGVA 4H8UA 5E5CA 3ZFHA 4IMGA 3TOYA 4PMVA 4I9AA 1ICPA 4NHVA 1TELA 1GTEA 3LU2A 3THCA 4BF5A 2XFWA 3QPYA 2DZUA 3W26A 4HA3A 2W5FA 1SJCA 1GETA 4US5D 4BCEA 1HJUA 1E43A 2BOGX 1LQ2A 2YZRA 3OOQA 4F3HA 1V6XA 4H8NA 4C65A 3EMZA 2DIKA 2Q02A 3MC5A 3HQOA 2EPMX 1RHCA 2WV8A 3L4VA 3B8DA 5HMDA 2V3AA 1YIXA 3SQMA 4P8VA 2E68A 4MSSA 2WMGA 1DWHM 3V0TA 4EIVA 1AD4A 1YPXA 3BH4A 3DFHA 1T6MA 2OELA 1GVFA 2PWDA 2NX1A 2QJGA 4W4QA 2A3CA 3K30A 1SJAA 3EUB3 2VFDA 1EB3A 3QGKC 3RN6A 4X9YA 1RD5A 2V2DA 4JQ1A 4QROA 4MNJA 2Y24A 3M16A 4C6BA 1VQTA 5FS6A 2C15A 2F7FA 4GKLA 1C92A 1GVEA 3GD3A 4ZFCA 3GFYA 2HS6A 1GERA 1G7VA 3MP3A 2C16A 1SZFA 3TWAA 1MW3A 1DXFA 1XG4A 4GZIA 2X30A 5D8WA 4IQEA 1HJSA 1PVNA 1B3XA 1E4IA 4O1CA 4WGHA 4L4MA 5I2UA 1VEOA 3U0HA 1F9CA 4JTAA 2A7PA 4O10A 2QJNA 3SR7A 3DJGX 1RQEA 4HGXA 3XISA 1ZRQA 2A21A 3WEZA 3AROA 4GI9A 3GHSA 3ZVIA 4QQUA 1XRVA 5LA0A 3VNJA 6PTDA 2I9UA 1MO0A 3RGTA 3HG5A 3K8KA 4WSKA 4IF2A 2XIMA 4H83A 4H00A 1FECA 3W70A 9CGTA 1LRNA 3UWWA 3ANYA 4HZ6A 1BVZA 1IEQA 5K9XA 3SUVA 3COTA 2JEQA 2WMKA 4LV9A 2IQ0A 5FEPA 2V30A 2PGWA 2NV9A 1W54A 2CZEA 4QIUA 1DVJA 1XLMA 4O50A 4XZWA 4MWAA 1EWEA 2GGIA 3WUEA 4NSBA 2VRJA 1GKPA 4ICCX 2WWCA 4TV6A 3C52A 4Y96A 1JEHA 3H4XA 3DC0A 1FH9A 3V1PA 2PDYA 2V6AA 4OECA 4UOQA 2FIQA 3JRKA 4PSPA 1U30A 1XLDA 1AQHA 1K8XA 2PWGA 2ZUTA 4ZOAA 4RLIA 1KBKA 2P10A 2G3IA 5C2XA 3KZPA 3AIQA 3U2CA 1E0VA 4WQ6A 2YB1A 1OZMA 2PE4A 4LCQA 1ZFJA 2B7QA 4TQTA 2QAFA 4NJHA 2VFFA 1IT8A 5D8ZA 1C91A 1QW9A 4DF2A 2ZA1A 3UCCA 4CGTA 5IHSA 2WOVA 1CGTA 3GD6A 1TR9A 4ENLA 1ITXA 4GVHA 1QK0A 1OCQA 3V5CA 1ADSA 3VGDA 1HUVA 1FWIC 4R7OA 3EWDA 2Y70A 1NJJA 4F2BA 3PF3A 4ONVA 1SVDA 4KEMA 4QHRA 5CSUA 3GO2A 4ML9A 4DI8A 1MWOA 3U9IA 3O06A 3SJNA 4A6GA 4GZ7A 2G97A 1OYBA 1X38A 3DGRA 4GHRA 2DH3A 2CZ5A 1OY0A 4NEWA 3GG1A 2FZBA 2W4XA 4NJKA 1P0DA 3VC6A 2ZZ5A 2PBGA 5C71A 3HOJA 1TV5A 4HPGA 4QX4A 3LQLA 4YU1A 1TPFA 4GVIA 4K1GA 3AHZA 3I3EA 7TIMA 3K4WA 5FEZA 2FJKA 1XYMA 4FHAA 4HT3A 3WLRA 8RUCA 2VEKA 1XM3A 4I5XA 4QR6A 5F7UA 1AW1A 4JFSA 5KZ6A 4EMWA 4RPPA 1VZWA 3O63A 3EA2A 4OT7A 3BXWA 4H2HA 5LNVA 3E0IA 2DZXA 5BOEA 2HROA 3IS4A 5C9WA 1U5VA 1ZBKA 3NQCA 2A3BA 1W9DM 1A5AA 5T26A 1WOAA 4DXVA 2WMHA 2HISA 1UR0A 1L0PA 1LT8A 2P88A 5AHNA 5C9ZA 1DIEA 1BF6A 3OTRA 4PTWA 4V28A 1JULA 3UBPC 1QXLA 2VUYA 3W1PA 1NEYA 1DYSA 1A50A 2EPKX 5FEWA 3NO3A 4KESA 4Z1DA 1Q6GA 1N5WC 1GNXA 1DV7A 1MI3A 1VFHA 3LX9A 1QI0A 3BW3A 1WQ5A 3FVMA 4LVAA 3FKKA 2X0YA 1VAHA 3JU2A 3R0UA 5AYXA 4TU1A 4HNCA 2HWGA 2GSHA 2DIEA 2OLAA 3TSDA 3EZ4A 5I00A 3BK0A 4LBRA 3KBJA 1SUXA 5C9XA 1HVXA 4EXQA 3Q4DA 1UZHA 4J4KA 3QVQA 3AO0A 2TODA 2E6FA 1HZYA 3SY1A 1ADOA 3U4FA 3VKAA 3BLIA 4NZFA 1B2YA 1GVQA 4W85A 4IICA 3G6MA 2PWEA 4P7QA 4WDTA 4XSMA 3Q6JA 2J88A 1GGOA 2CFYA 3VFLA 1AL8A 4D8LA 3R0KA 5AC5A 3VA8A 3TSBA 1I2QA 4KWVA 4XD4A 3WMLA 3E3HA 2OU4A 1ECEA 1SPQA 3BGGA 4QE4A 1GOWA 3GTXA 3BURA 4B5NA 3KTXA 4PB5A 4RDZA 4CEUC 1P6CA 2V3DA 3ARQA 3ARTA 1X7IA 3U7VA 3EAOA 1V0MA 3VIOA 4GBDA 4FNPA 4HNOA 3BPWA 4R9XA 5T9CE 2P5NA 3S5SA 1MMFA 4LVFA 3GB6A 3VX0A 3LTYA 3ME3A 5EMUA 1DXLA 3O2LA 1I6NA 1ZAHA 2IKHA 1BYAA 4C6JA 3ZOAA 3T9PA 1H60A 2MUCA 1SR9A 3UR5A 1OIMA 3B9EA 3W27A 2JF6A 4IZGA 3BV7A 2GZXA 2QNEA 3MSYA 5LGXA 4NJGA 2E77A 3UJ2A 5LZLA 4QG6A 4W5ZA 3F2DA 4PUDA 2NVKX 5GQBA 4HVXA 2X09A 2R8WA 5DBUA 4IJBA 3KBWA 1C8VA 2E7FA 1WUEA 1S39A 1FBAA 1XDLA 4TVYA 3FX4A 4PTXA 1HJQA 4UNKA 1AUSL 3NXFA 4NQ1A 2PWHA 1PZ1A 5GJPA 5I3GA 3MKCA 1V6VA 3CUJA 4QLLA 4GUJA 3AUOA 1LJYA 3IANA 3GDMA 5A6SA 3IJLA 5CPLA 4EQWA 1IWBA 4IG2B 1VIZA 3PUGA 1FKWA 3FJLA 3G1FA 3IWPA 1R3RA 2AL2A 3FKRA 1X1NA 1A49A 2QUNA 1E9IA 3O1NA 1A0EA 1EZWA 2H3DA 7ODCA 3DG7A 3HU7A 1NARA 5H8UA 1T7LA 1HVQA 3SGZA 3M0VA 3EWBX 3T2OA 4E4PA 1YTEA 3BW4A 3TW6A 4QEEA 1SJDA 2DQXA 5F4WA 3EAUA 4EXBA 2NXHA 5D4YA 1BVWA 1QT1A 1GT8A 2CXGA 1XYBA 5HATA 4IMEA 1J93A 1GQKA 1N5XA 3OG2A 5ABFB 3JVAA 3NTYA 2ZCGA 2QUUA 1UPMB 3WD4A 4LOCA 3IIVA 3WJZA 2H9AB 4U4MA 2PDPA 3EX6A 2OYLA 2DJLA 4J3VA 4JIQA 1UIPA 2BGNE 3ABQA 3TUUA 2EG6A 1GRTA 3GNNA 2GGEA 4ZA0A 3AU6A 2X1TA 4WHBA 4UTFA 5LNUA 3T55A 3LHYA 4O28A 1H0IA 5A5WA 3BSHA 1XQKA 4KH2A 1KM1A 2J7CA 4GVFA 2EQ6A 3H2FA 3KLKA 2QV4A 3FYYA 3LCGA 1H41A 2WCSA 3N14A 1ZY8A 3NQFA 5BOFA 1H50A 3QY7A 2VTFA 1N2VA 1QNOA 2YXXA 3VZXA 1H5VA 1FH7A 1OADA 1RM6B 1QATA 3EPOA 3UWEA 1MZRA 1XBXA 2B7NA 2I5IA 7REQB 2PTWA 4LB3A 3KXQA 2Y62A 3D47A 3W53A 1JZ4A 1E73M 1EX5A 1JNEA 4HCLA 3W1NA 2YFOA 1JZ6A 2GJLA 4AU0A 4JL2A 1SFTA 2QAEA 3TCEA 1WDQA 1D3CA 4FNUA 3F03K 1XS2A 3GUGA 2V5LA 3SQLA 1G4PA 3ITCA 1BLIA 2QLYA 3H2NA 5IFTA 3W6MA 5CZTA 5AC4A 3LV6A 1FWJC 1E9YB 1DOSA 3R94A 3UGVA 1YDOA 3EWZA 2C71A 2AGKA 3HFYA 4A3HA 2OT1A 1EBDA 4HU0A 4A8LA 2ZFAA 5F4SA 3UZJA 3HGRA 3VMOA 3IK2A 3OLGA 3H55A 1OFRA 1V4YA 4X2RA 4F0RA 4UQCA 1XIEA 4R88A 1S5WA 2IS7A 1J10A 3MZNA 4US6A 3NGJA 4A3YA 3VOFA 5CJNA 1CXEA 1S46A 5JUVA 3DN5A 1UP3A 3PR2A 5B80A 2ONEA 5HANA 1R87A 5E09A 3ZVHB 4C6PA 1GEHA 3I68A 4QEHA 1YPFA 3BAYA 4LWWA 3N6HA 2F6KA 2PAJA 1SO5A 1G7UA 1XD1A 3DOPA 3I7RA 2CHNA 3BVJA 3DFTA 2NV1A 1VCVA 4KMQA 4J35A 4BQ2A 2XIBA 4I7WA 2C7FA 3EB4A 1FFUC 3WL1A 4N2YA 2FZDA 3L0GA 1FKXA 2EXOA 3ARXA 3A4XA 3AYSA 3EMQA 3KCJA 1XSJA 2J62A 1LBFA 1Q63A 3D3AA 2RFGA 1BXNA 3SUUA 4C6IA 1DHPA 3S2LA 4DVOA 2MANA 5CAHA 2ACSA 3W7RA 1R9XA 3VX1A 4L61A 1NDVA 1PS9A 2XTKA 1CXIA 4PH6A 4XIMA 3W76A 1B4KA 3DHDA 3B0YA 4ATWA 4LBUA 4INFA 5KETA 1XUZA 2QMKA 3BJTA 4C1NB 2CZDA 4D8ZA 5I3JA 3NS1B 3VM7A 1GSNA 3W9ZA 4AWSA 4JTLA 1NIUA 2Y2WA 3WZ0E 4F2TA 3NWRA 3VIPA 3T0BA 5CZSA 4QBXA 3N9SA 3RK8A 1RAKA 3JS3A 2GDVA 1U5JA 3AHVA 2PLKA 3CYVA 3FDKA 2O9PA 3VZZA 3LB0A 3SGGA 1SZRA 1WZKA 2INEA 3AXKA 3HO8A 3T8LA 3THAA 3H4KA 3O05A 4YTQA 2XIQA 2F38A 4XSLA 1FDJA 1MW2A 2Y85A 1KBIA 4AZBA 3A13A 4LVDA 1XYLA 4LYRA 4PC8A 1JDCA 2P3ZA 2A79A 2W0UA 2RABA 1F3PA 3H8AA 4AZ6A 5JVLA 3KDNA 4DJFC 3GVWA 1QHPA 5FS8A 3QHOA 4KGJA 3CUHA 1E70M 1F3XA 2WC4A 1OM0A 1LVLA 2J9XA 4APNA 2CBVA 3BICA 3CPRA 5BXRA 1JZ5A 3P5ZA 3EXSA 3G77A 3UY8A 5HNTA 4DN1A 4JTIA 3PTQA 3M0XA 3FGCA 5B7ZA 3G0XA 3PM6A 2XIIA 4DJEA 2C3ZA 3N25A 1AQ0A 3NQ6A 3FXGA 2VXNA 3GTFA 3IJQA 3B40A 1D7FA 5DCDA 5C2GA 2OR2A 3W38A 3PBYA 4IQDA 4AZCA 2GJXB 3WMSA 2PU1A 1S38A 5HA7A 1NSJA 1XRTA 3BOFA 1YPIA 3UZWA 4CD6A 3KRSA 4IPIA 3CZ8A 1OX5A 4W87A 1W1YA 3QC3A 2AAAA 3T1GA 4B5XA 1VYSX 1QMLA 4U33A 1ME7A 4EAYA 5D05A 3TYUA 3KCLA 1VBHA 4GLEA 3DFPA 2YXGA 3HBLA 1UCWA 1XLHA 4HYVA 1YADA 3VGFA 3KOYA 1NHSA 2V5BA 2NQ5A 4GUHA 1PSCA 4REQB 4EMIA 1VJZA 3BLOA 1AOGA 1R47A 3DUGA 1NQKA 3NUKA 4BI5A 1VCGA 4NX0A 3SIZA 5CBBA 2VCAA 2GK1B 1RSCA 4PB4A 3QSTA 2VT0A 4ERIA 1RQHA 1E4LA 3FW6A 3IJ8A 2POZA 1BRLB 1WOBA 4ZOHB 2CLKA 3MKKA 1KTNA 1H49A 3AMKA 2XSAA 3EXRA 1D7KA 4MY8A 1SW7A 4Z42C 1JCLA 2V63A 3YPIA 3W7LA 4AX6A 4AF0B 1QNQA 4LUSB 3UEQA 3E0VA 1VQZA 3WLKX 3LI1A 1VLIA 3W25A 4FEZA 4QG9A 4CQ9A 2ZC1A 4F9DA 1W31A 3NQ2A 5J5DA 3VOJA 2ODOA 3APGA 2VVNA 5CH9A 3OGSA 5TAOA 2HE5A 1EGVA 2BB0A 2J7DA 2XVPA 3FA3A 1EHNA 1XV8A 1RA5A 5FEXA 1OGGA 2OWCA 3W7GA 3KW3A 3T08A 4HOWA 1N61C 1LOQA 3W7DA 2GQ9A 2WZEA 2Z1XA 1XRFA 4HK7A 2XGBA 1CPUA 1MRAA 3K4AA 3KS6A 4XBSA 3W7HA 4CN1A 5TIMA 2QDGA 3MSGA 5T9BG 3TAKA 3KBMA 2FFCA 2CKRA 3VOCA 3FK4A 1FXPA 4AWUA 1KM4A 1JYXA 1A80A 1AK5A 3AOFA 4QCEA 1BQGA 2B7PA 3IIZA 4AEFA 2ZX6A 1NDAA 3IV8A 3SCVA 3TN3A 3OBEA 3LEPA 5C55A 1SGJA 4GCXA 4FLQA 1V0NA 3G3DA 4O4WA 1OFBA 3W1XA 1JFHA 1LBMA 4O17A 4J3ZA 4N9CA 3VKBA 5G1YA 3PSVA 8A3HA 3DEQA 4PL2A 1IT0A 5TQLA 1QHOA 4QNWA 5JBEA 2WMFA 4BQ5A 1BEUA 2O7QA 3N2BA 1J0IA 4MJ2A 1IWAA 3IJDA 3LS9A 4JL1A 3M5XA 3NXLA 4XZBA 3W1AA 3R6IA 3XIMA 3UZXA 3VKCA 2QCGA 4AHPA 1XWYA 2PGRA 1FQ0A 3FJ6A 5LHFA 3S1VA 5IHRA 3BLPX 5T8GA 2BMBA 3P81A 4IPPA 1Q7MA 2O55A 4WKAA 5B7YA 4PN2A 4RDYA 4HZMA 2YCLA 4A2SA 3BAWA 4KPRA 1FA2A 1QDSA 6TAAA 3WN6A 2HK1A 2QCFA 3K5XA 3RO8A 2VC6A 4K7VA 1PDZA 2PDHA 1GHRA 1TE1A 3MUZ1 3Q2DA 3RRAA 2PDIA 2PTXA 3AJ7A 4E8GA 1SMAA 2QW5A 1JJKA 1NM9A 4C7FA 2VFHA 2B81A 3NQBA 1XGDA 1K9DA 3EEGA 2JK2A 1H2IA 3WG6A 5F2IA 2PU0A 3W81A 3EDJA 3CGBA 4ZQRA 3TW9A 3H21A 1NDZA 2Y5SA 3SCNA 1EJXC 5CJMA 4M81A 1IWPA 3KVMA 3GFZA 4MNLA 2CU0A 3N2XA 1ODUA 1YXYA 2WYSA 3PZUA 3A5VA 3DXIA 3TH6A 1VDVA 3TAOA 4F0KA 3WLOA 1DQXA 3PTDA 2WBKA 1UWRA 1TRIA 4L64A 3WLHA 4O14A 5CSSA 3OEXA 4ZXOA 1HQTA 3B9JB 1LBLA 4HA0A 1TJ1A 3AZTA 1WAWA 1H7OA 1NPXA 3LRKA 4NZJA 4WEVX 1E5JA 3OC4A 3W7OA 3T0TA 2DU2A 1FO4A 1KBBA 4I9TA 1TWDA 3LB8A 3A3WA 4CQCA 4ZGYA 2PD9A 1TWWA 3W1MA 3NAVA 1BSIA 4H4ZA 1EHAA 4AZHA 5JCIA 1A3XA 4DBEA 4HIBA 4TV5A 4L65A 3GVGA 2AAMA 5CBIA 3TNOA 1E1FA 1RZMA 4K36A 4H4SA 4ADWA 4K39A 3USBA 2G3JA 1RA0A 1GQIA 1PXGA 4LBSA 2HXUA 2Q6ZA 1P48A 4PL1A 5AOUA 5DRCA 4RV3A 4DUXA 4DO6A 5U1OA 1Y7VA 4GCAA 2PTZA 1FCUA 2D69A 3F7JA 1M01A 2WP6A 1R3VA 2GH5A 1VFMA 1OFDA 1EQPA 4YNGA 3EBVA 3EOSA 4YWSA 4QAWA 2HPIA 3TP4A 2VR2A 3C2RA 5HWMA 1W5PA 3WUFA 5A6TC 3T09A 2NVDA 3K13A 1AD1A 1B1YA 4A29A 4MNKA 1DIKA 2R94A 1K1DA 3N17A 2PDGA 1D3HA 4M56A 5FAGA 1OBAA 1JPIA 1TPH1 2E1DA 4RZ5A 4NZ4A 4S2CA 1MUMA 1YNQA 3NO5A 3STEA 3GU2A 1KQZA 1HGYA 5F2MA 1ISXA 4CNSA 3R25A 4AEOA 1KO0A 4PRWA 3U8GA 4OZOA 3EA1A 1EC8A 3BAKA 4OHQA 4L1XA 4WF7A 3GTIA 2W9MA 5I3IA 2YYUA 1ZHAA 4QDWA 3EPNA 1XR2A 2VX7A 1XINA 2EPHA 4IFKA 1ZBWA 3G0SA 3R5EA 3WCZA 1DJNA 5LA1A 3QGAC 5DMYA 2HVOA 5D2TA 3WLJA 3N4AA 4ZZ9A 2Y4SA 5AB3A 1F73A 3E02A 1C8QA 1KTCA 1B3ZA 3DGZA 3RX3A 1EUAA 5CZKA 3R89A 1XCFA 3VIFA 1HIZA 3CK5A 4JQAA 5M03A 4NYUA 4AX7A 3WD3A 4PMQA 5T91A 2QPSA 3M64A 3ITGA 4OBRA 1JPDX 2AGTA 1JCNA 3W7QA 1KGWA 2WCGA 4KFPA 3AXIA 3ABSA 4RE2A 3PJTA 2DV0A 1CLXA 2PWFA 4BKNA 1Z44A 3PC0A 3CL7A 5BCAA 3C86A 1H6VA 1TJPA 3QV8A 4JAWA 2L5HA 1A3HA 1EQCA 4UFMA 1MW1A 1Z32X 2H90A 5DEZA 4DZ5A 4MLRA 3HQNA 3RM9A 3G1DA 1J6OA 5FJJA 2VZSA 3WH5A 3R10A 4WKFA 3OA5A 1FTXA 3RNDA 2CDUA 2Y8VA 2DT2A 4AVOA 3S2CA 4RZBA 3DENA 1H7WA 2QMJA 3L23A 3FLUA 4LUYA 2PURA 3F1QA 1OHLA 2UY2A 5CQ1A 2A5HA 2SFPA 4XZMX 4J9JA 4B5VA 2PDFA 3AHXA 4MB4A 3KRZA 3KS5A 2GR3A 3C61A 2ZXDA 3P14A 1NHPA 2AQOA 2YA2A 1JXKA 2G8ZA 1JGMA 2E1WA 2GRTA 3GR8A 4LX4A 4QS5A 2X41A 3EX2A 5CGTA 1KRBC 4JIPA 4R9OA 4BK9A 3H2EA 3V4BA 3GYEA 3CZGA 2A4AA 3TONA 4IIFA 3RU6A 3L0NA 1L8PA 4J28A 4WGXA 5LIKX 1ZX9A 4HA1A 4N4QA 2VR5A 3RPDA 4C6LA 4HU4A 3UWZA 2ISVA 2VHLA 4PE8A 4BJHA 2VCCA 3MMWA 2ZZ4A 2CXEA 4MY9A 4XO6A 3PPCA 4AH7A 4BQ4A 1QFEA 5CG7A 3HMCA 1DIOA 1FFQA 2OVLA 4GINA 3AWOA 3C8FA 1J4EA 2VNCA 3N9RA 2A3AA 5KITA 2WLZA 4GQBA 3QOKA 4J3UA 2C18A 1V7AA 1JUEA 1VFFA 2V3FA 3E6EA 2YL5A 5HBFA 4EKJA 1TV2A 4DUVA 1EIBA 3MCMA 3T05A 5GNYA 3RHGA 3SN1A 3E0FA 4G7EB 1O95A 3KVLA 1K9FA 1JUKA 1AW5A 2DW7A 4BA0A 2VDGA 3UCDA 2IPGA 1B5TA 2XN0A 4B4HA 1Z6KA 5XIMA 3L4WA 1XPYA 1WDPA 2J66A 2BXVA 2EKGA 1OK4A 1OFEA 7CGTA 4DY1A 1YNYA 2J6VA 4GJIA 2ABAA 5TBOA 1OEPA 4C7GA 3PK7A 3TA6A 3BCJA 1UP0A 3B8SA 2NQLA 5M3WA 2E8ZA 3FG2P 3QY8A 4WDWA 1JROA 4YHGA 3HG4A 4KIRA 3VK5A 4I3GA 3N15A 5FJRA 4ZO7A 3EXTA 3CZJA 4JN8A 5C7HA 5U25A 4XD6A 1JPKA 1NHRA 3DG3A 1X96A 3TXVA 3UZYA 4KWOA 1HX0A 1PB0A 4U5KA 3RO6A 3A4WA 4GY7A 4Z2LA 3GRTA 3SQPA 3POCA 3ISIX 3PFMA 2Y88A 4B92A 1SSGA 1BGGA 3GVVA 2CYGA 3I3DA 3IVUA 2CLOA 2HDJA 1G5AA 3LPPA 1UD5A 1A3WA 2R91A 3MU7A 3GIQA 1W3NA 1O5KA 2R14A 1RPKA 4Q8UA 1H51A 2E0PA 5CKSA 3UA4A 1G67A 2GWGA 5HXMA 2YCKX 4UTIA 5KINA 4KFOA 2R1KA 3UXKA 3CL6A 3QFWA 3WQGA 4AW7A 4JQ3A 5ECUA 3TJXA 2YBTA 3AS2A 3M07A 3FCPA 4ZOBA 2CHRA 3LSBA 4XTDA 1W3KA 1DBTA 5C7VA 3PJXA 1HKJA 3P0XA 1R3WA 2J7HA 4DYKA 3IUHA 1QBBA 4H4VA 3ZLHA 1TYGA 1JNDA 4AIEA 4QAIA 4DF0A 4F4RA 1TQJA 1UMYA 5M17A 1A5SA 1TKKA 4PTNA 4D6DA 1CX9A 1ONFA 5RUBA 4U10A 1W32A 4MGGA 1E9LA 1GQJA 3WFLA 4BFAA 1R3SA 5JBDA 4LU0A 3URNA 1W3HA 1R30A 2J8TA 1TWIA 5E6YA 4B5TA 3GD4A 3ZR5A 1E56A 4JKMA 2PF8A 1Q3NA 5LGZA 2P53A 4C5YA 1MFVA 1XC4A 4YTTA 4UFKA 3UXDA 1JZ7A 4ERAA 2WJDA 1Y5VA 2JEPA 2XYLA 4JX5A 2EF9A 4AIUA 5DMLA 3SURA 1RJRA 2X1RA 3LM3A 1WCGA 3BOLA 1YRRA 2HCVA 4IJRA 4J5NA 1DJZA 1TG7A 5U4NA 1V02A 1N8WA 2QS8A 3M5YA 2WPFA 1GOMA 3IARA 4U28A 2BCPA 3L4UA 3NYZA 1REQB 4X9SA 2YJQA 1P0BA 3G22A 2HBVA 1A47A 1XHGA 1IEWA 4MKNA 1LPFA 2CBJA 3NVZB 4FDCB 1F74A 4UTWC 4FO4A 3CS2A 4DAFA 4NNBA 4F66A 3TYEA 4WJXA 4GD0A 2ON3A 4Q6JA 1MDLA 2FVKA 4HJFA 1PWLA 3AI0A 3ECQA 1TR1A 4ZODA 3HGJA 5EMLA 4CQAA 4WY0A 1XFCA 3HTWA 2Z4GA 4IXHA 2X8CA 3OPSA 4X0VA 1TCDA 5HJXA 3LRLA 4JN6A 4HZ8A 5EU9A 3UWYA 1DJXA 2WAGA 5DLCA 3VTRA 1PIFA 7TAAA 2EBNA 1F7BA 4H4TA 2KAUC 2ZRYA 1VYPX 3UJEA 2FVLA 2KX9A 3UFYA 3PZTA 4AD4A 3FJ4A 1V3KA 4D6EA 1A5OC 1EGMA 2H3BA 3VCNA 2W3RA 2VQTA 2W61A 1E1EA 4MYXA 4R7WA 3NQEA 1E0WA 2O0TA 3QR0A 1CLVA 5JBFA 4MOZA 3IAPA 3W6LA 4WSHA 4TTGA 4XZHA 2E9BA 1N60C 3GAKA 2GUUA 3II4A 3SM0A 5CPQA 2WHMA 1ZUAX 1JYWA 1XYZA 2YLLA 4UMAA 3RLGA 3VIIA 4J56A 1JGIA 2PZ0A 3VNMA 1MQPA 1EGZA 3WUGA 3WFZA 1TIMA 4FALA 4HZ7A 2A2IA 2WOIA 6A3HA 3A3HA 3EF6A 3BQ6A 3FAWA 3TLQA 3WBXA 1LDCA 4UZSA 3AHTA 2GUYA 4LS2A 4AY8A 2QUTA 1S2CA 2VDHA 2ZXQA 1VP5A 3SCSA 3H22A 1TPUA 4GUIA 1W8GA 4FK9A 4HYWA 4MB5A 2NQ9A 2ZZ7A 4GYKA 4AY7A 1VS1A 2WVTA 1E1CA 3QEZA 3AMCA 4DJDC 5HR7A 5IM51 2CKSA 3WENA 2WM0A 3GC5A 2YVGA 4BZYA 4DNHA 2XZ7A 2DUAA 3TJLA 3O6AA 2XSXA 3RCYA 2ZC8A 4LAZA 4ALDA 5LXEA 3HRDC 1F6KA 3SCPA 3KCOA 3W7CA 4JICA 4JPGA 4W5UA 4PUWA 3ZXWA 1ITQA 2QDHA 3ZT5A 2QPXA 3VNIA 4ZQPA 4HA4A 1OC5A 4LANA 5A2BA 2Y89A 2C1GA 1ZALA 3KEHA 3UXAA 3RXZA 3WLNA 4UC5A 3EYPA 3TTQA 4S3JA 1BPLB 3ITXA 7XIMA 3TA9A 4FLOA 4C6MA 3WMCA 1P7TB 5TNVA 3ABXA 3TCSA 4XAFA 2OOGA 3W75A 1QASA 2ZE0A 1N8FA 1F8WA 1FWWA 1RR2A 4ZR8A 5MHBA 3NCOA 3M6DA 2F8QA 1A5MC 1UH2A 2NLIA 3R43A 1EP1A 3LPFA 1BTCA 2CWXA 4WJ8A 1E6ZA 5FS7A 4GG9A 2TAAA 5HWJA 3PBWA 1Y0EA 1RBAA 3HA1A 4YWOA 1JL8A 1FVPA 1G01A 3WLSA 4DNAA 3PBUA 3S6TA 5HAOA 2HPMA 3KDOA 4LVBA 2XPKA 1ZMDA 1TA3A 1UJPA 1Z3NA 2XUCA 4CNUA 4AD1A 5D38A 3RDKA 1CIUA 2WK2A 5C8BB 2X8RA 4DBUA 3EB3A 3CHEA 3N6QA 4JYDA 2P1FA 1B9BA 5AY7A 4JNMA 3HIJA 4DWDA 4DJFA 1WP6A 4FA3A 1ZBCA 2OYKA 3DFYA 2WZTA 4DM1A 3PZNA 7A3HA 2ZZ6A 5D03A 3DKLA 3S2JA 1GZ1A 1UA7A 1BF2A 1AW2A 3W02A 3PG9A 1R85A 3T40A 1XHCA 1V51A 2I56A 3LV5A 4PMOA 3WEMA 5BROA 1YE6A 3A22A 3IIOA 1RALA 4C60A 1A4MA 3RLUA 1L6YA 3GG7A 4JY8A 2B7OA 4IIEA 4H9XA 3G1AA 3IJ7A 1ITUA 2V2CA 3UY7A 1P4CA 4ADTA 3GXMA 3HJZA 2V3BA 4P7OA 3EDKA 3WNLA 3B8WA 3M0JA 3VIMA 5FJUA 3CGDA 4DXXA 4GACA 4RR4A 2GVYA 2J75A 1EJVC 7ENLA 3GRSA 4JIHA 2ZBTA 4BI7A 2OPJA 1BZLA 4H6EA 2DZAA 1MYRA 4KEVA 3WO8A 1BHGA 3TN6A 4IGMA 4GUGA 3OYZA 3AQUA 5CC5A 4PBGA 2GPTA 4NRRA 3ZJ8A 1GCYA 4YTUA 2VKZG 5DMMA 4PBFA 4KCVA 4IGNA 3HPZA 4JQ4A 1ZENA 5C70A 4XD5A 3O6CA 4W7UA 2R9ZA 2DT1A 5K9CA 4K7YA 5D2WA 1ZU8A 2BNJA 2WOQA 2A6NA 2XVGA 1NAL1 5FESA 3VAVA 4A3UA 2GGHA 1XP3A 4JTRA 4CLMA 1F76A 3PPHA 1QNSA 3AISA 3AU2A 4UFHA 4HB7A 1GUVA 1X6NA 3SI9A 2PCEA 1VR6A 4QGCA 4MPKA 4LS1A 4W8AA 3AM9A 1JPMA 4CVWA 4O16A 3S6OA 4JTTA 1OWQA 3BW2A 3N13A 1YBQA 1JYVA 2VFEA 4JDYA 3VZYA 3DYMA 1HKVA 2W67A 5HUOA 4JD4A 3L2MA 4JNZA 1D8WA 3TWBA 1CGXA 3TC7A 2QULA 4LXFA 4LUTB 3T2PA 4P7LA 4OOZA 2E28A 2P76A 3KX6A 3LXBA 2VEMA 4ZO8A 2QT3A 1UOKA 4TVDA 1NOWA 3QMSA 1V3HA 3GKFA 2I57A 4MB1A 1Q6DA 3M9YA 3CGEA 2H8ZA 2OT0A 2VVSA 1JRBA 3QLLA 4ZO6A 3KOWA 2VFGA 1HJXA 1XLFA 1LWHA 3A47A 2Y7GA 4ZBCA 3M7SA 3V36A 1NWTA 4O0QA 3P67A 1BWLA 2XH2A 4LIIA 2OEJA 4E6MA 4PODA 4YS1A 1ISVA 2ZXAA 4EPKA 3O6DA 2XN1A 4W7VA 5EBKA 1D7YA 5C9RA 2FZ9A 5A6KA 4UNLA 4QE5A 4S23A 3QKZA 1IGWA 3CU2A 1E0XA 2OCZA 2I16A 5HWNA 1KKOA 4IMDA 4HNLA 2YDQA 2J24A 3V18A 3IJIA 3OIXA 5EKYA 1JR1A 3UETA 3R07C 3W00A 1TZ9A 1L6FA 1KBLA 4IQJA 5BOOA 4XG1A 3DFQA 1J6PA 1J5TA 2P8BA 9RUBA 2E25A 1UQYA 4RK8A 4LAOA 1T41A 1J2WA 1NH6A 4CN4A 2BY1A 4KRZA 1MNZA 1O66A 4FR6A 4JQ9A 1J0ZA 1GJUA 4MAZA 1JCJA 3E5BA 4IP5A 3O0HA 5F2GA 2WJEA 1FOBA 4HHMA 4XAPA 3S1GA 2Y7EA 4K68A 1PO9A 3BLLA 1DPMA 4V1XA 3DG6A 2I1OA 1IXNA 1Q6QA 2FGZA 3B8IA 2A7NA 4HD5A 2C0AA 4KWSA 3TNBA 1UWIA 3VKKA 3URHA 1V59A 2FFIA 3UJSA 3BE7A 1Q1WA 1YXDA 5JXQA 3BG9A 5LNRA 4OTKA 3L4XA 3GH7A 3RU8X 4NKCA 5L6UA 3CASA 3NQVA 1TWZA 3LMYA 3NL5A 1KKRA 1V77A 4LCSA 1YDVA 2VZVA 1FCVA 1HO4A 1TMHA 2IPFA 1H5YA 4JKKA 2F61A 4BWLC 3THQA 3C56A 4HMDA 4B2DD 4M6PA 2XHYA 4JYFA 1J9YA 2VDIA 3O9NA 1XICA 5CSYA 3TTEA 1OD0A 1E15A 3TC3A 2TSYA 5CBJA 4YWIA 3GXIA 2VC5A 2QJHA 3TROA 3ICJA 4A8IA 4L9ZA 2NT1A 3TX9A 4L80A 1CW2A 1R5YA 1WXZA 4NZ5A 4DJDD 2E3TA 1ZK7A 3CQ0A 2D2JA 5D9OA 3AYRA 4KEUA 2VI0A 5KZDA 4GRSA 4RE4A 1XGEA 3WQ4A 3A5FA 4JTKA 3V5FA 3VNKA 4ORMA 3UJRA 4ACZB 1XLJA 3M46A 2VWTA 3GVQA 2ESCA 2VM8A 3TLLA 1V3LA 5EY5A 3OZMA 2Z26A 1JCMP 1AVAA 2QDDA 3ABZA 4P8UA 5CCZA 4P5UA 2WZMA 1HL2A 1LLZA 3NPVA 3NZGA 3M0ZA 1LQAA 3VIJA 3CTTA 4F79A 3KZSA 3WQEA 3UCQA 3KBNA 3W7IA 2ACRA 3GNPA 5FCZA 1E6QM 2RHGA 1JI1A 3L65A 5A6AA 3N12A 4KETA 3JR2A 3I3BA 2DZVA 4DZHA 3KAOA 4GIRA 1QR7A 2GL5A 1Q6CA 4HK6A 2NXGA 2ZA2A 3EWXA 1YDNA 1UWSA 3CBWA 3L5LA 4PMNA 1FY6A 3WQOA 4Q7BA 3LI0A 1VPYA 4OBTA 2CNCA 3KRBA 5EFFA 3TKFA 4PUKA 4WIWA 5H8MA 3CM4A 3AIRA 1WYIA 3C6CA 3PHAA 2V38A 2DGAA 4M3PA 4FIQA 1VBRA 3QQ0A 3K1GA 1TZZA 1ZP4A 2HTMA 1QU4A 5REQB 4YYFA 2GGJA 3T7VA 3QLDA 4MMWA 2PLCA 1K9EA 2I17A 3F2CA 4IWWA 4BEQA 1VKFA 5AHEA 2J7FA 4PTDA 2P8CA 4C91A 3A9BA 2C1IA 4WK9A 1CTNA 1W1A1 1UKTA 1JZ2A 1Q8AA 1SO3A 5IDIA 2Q8LA 4OWGA 6REQB 4I6VA 3E12A 2EO7A 1SZGA 5FJOA 5HR6A 2OO6A 1TREA 1X1OA 4IUOA 1POKA 1E5NA 4FNQA 2GVGA 1TO3A 1TTJA 4KWWA 4LUJA 3G1SA 2WMIA 4X0NA 3NM1A 4URIA 3BLFA 4KRUA 4KQNA 4IISA 1I8JA 1T5AA 4Z0JA 1V3MA 3NR0A 4HHPA 4CU6A 3HMJG 5FS9A 4PCFA 2DJXA 5CC7A 5K4ZA 4AMCA 4NAFB 1ONEA 3IVSA 5G1TA 4XBKA 3R8HA 4UQEA 2E5DA 2Y7DA 4M80A 3WBYA 3MP5A 3QFAA 3SIMA 1MSSA 2YB4A 3PTKA 1LUCA 4S3CA 2ZQ0A 1S3HA 3RAOA 4EM4A 4HNNA 3NL6A 5CZ0A 4M82A 1KXQA 8CGTA 3NNTA 1I2RA 1X8CA 2YCJA 4YCPA 3H6OA 4A05A 4DLFA 2IKIA 4DWSB 1YXCA 3RR4A 3EDEA 3GXDA 1M1BA 3QBUA 4QE1A 4GISA 1OT2A 1OG6A 3ZIZA 5ABTA 4POCA 1C9DA 1VBUA 4DB7A 4YJ5A 1W17A 3REQB 2OFJA 3MT1A 3GXFA 4H7VA 4AZ7A 3CPGA 4S39A 3GRIA 3WLQA 1WBHA 1CYGA 2DSVA 1LLOA 3B8VA 5A3HA 3VD5A 3AFBA 3ANVA 3L66A 2JKEA 3PBVA 4WRHA 3U3HA 8XIMA 4GA8A 1F05A 3THDA 4GOAA 4NP7A 1GJWA 3EX1A 3IRSA 2QUVA 4GQGA 1WZLA 4XX6A 2NT0A 4IP7A 4BURA 3UA3A 2WBGA 3IACA 2YIHA 1CXHA 1MZHA 4Y9MA 5DMNA 2J9ZA 3LPGA 2UY4A 3GZAA 5FAJA 1XYFA 3W72A 1UMLA 4AMAA 1X1ZA 3CXBA 3U4AA 3GFXA 1RBLA 3WLIA 4GY1A 4NYYA 5BZAA 2YVJA 3F4WA 3EKZA 1EO7A 1WDSA 4WX2A 3BAXA 2JFEX 4QFUA 4XKYB 4XVEA 2IPWA 2C0HA 3H2OA 3LXCA 1WZMA 1EJ7L 1UA3A 2QHAA 3LCWA 2WZHA 1PKLA 2GVEA 2Z6JA 4FX6M 1XPGA 2NUXA 4Q4RA 4XAYA 3SN0A 3OLEA 4LYPA 4OIFA 3ES8A 3RCMA 4LQ1A 4GGBA 3C3NA 2RH9A 3S83A 5HQLA 2FMOA 2NUWA 4MTVA 2OZ0A 1P6BA 1P43A 1K77A 2J74A 1XLEA 1G0CA 5HNNA 3S5NA 1PYMA 3RITA 1EC7A 2EGZA 3PNZA 1VEPA 3NURA 4EQSA 3NL2A 3WH6A 3ZLGA 1Q7ZA 4JEJA 3DI0A 3UNTA 4YCOA 4WVXA 5AVHA 5CJ5A 2EPOA 3N2CA 3IV3A 2BHZA 3AIWA 3WFAA 3DHUA 3W7PA 3NSNA 3U5YA 1Q6EA 1S2AA 4H8VA 4K38A 1ITCA 1X6LA 1RCXB 3K8LA 1QI2A 3E0LA 2TMDA 2OSYA 3WH8A 1M7XA 3CWNA 2DVTA 2WQDA 3GBEA 4PFMA 1MUCA 4HPHA 1W3JA 1GEQA 1DNCA 2E9MA 3AHYA 1I2OA 3AIUA 3NDYA 3HG2A 4RKAA 3AN1A 3DESA 2ZRZA 1FH8A 4WXZA 4HKPA 5DT5A 5EFDA 1UH3A 1IEVA 1J0YA 3NQMA 4NL1A 2F2HA 2ZX8A 1K7EA 2WSPA 1XH0A 3DZ1A 2BGSA 3GH5A 3OBAA 2ADAA 9XIMA 1VJIA 4KERA 3TYCA 3VGBA 3URAA 3FY1A 4Z1BA 5I06A 3ITTA 3QW3A 5EB8A 3NO1A 4FLRA 4UTKA 2PMQA 3EOOA 4JIEA 4P2VA 3VDBA 4EMJA 1Z7AA 3O07A 3MMDA 3ES7A 1ZAJA 4B3ZA 3D6NA 5CPOA 4UR8A 3W28A 3QQWA 4O1EA 3O0KA 4WUIA 4FSAA 1LRQA 5MKGB 5KZEA 1FXQA 1OB0A 1KRAC 2ZADA 3WDQA 4R27A 3S47A 2PDNA 1AQFA 5D30A 2VEGA 2CLPA 1K9TA 4FXSA 3W2LA 4EAMA 1NQ6A 5A6JA 2G95A 3B4UA 1PV8A 4GJ1A 2ZZ1A 1E0UA 1Q13A 1AJZA 2OO0A 3W3OA 4MJZA 1F07A 3R1ZA 3IGUA 3F4NA 3W01A 5LYRA 3BAJA 3WL0A 3SW6A 3L8KA 4G1NA 4LF1A 1P0NA 5BXTA 4F40A 1B9ZA 3PG8A 1SFLA 4EE9A 5HQMA 2G4JA 1US3A 1JG9A 4MG4A 3EEZA 1R9YA 1V3IA 1C3FA 3A23A 5A8MA 2CBIA 4N9DA 3CGCA 2BHUA 4UTWA 5HMEA 3TEVA 3M7WA 4RNIA 3M0YA 2PDWA 1YDYA 1WYGA 4CVUA 5JIPA 2OLHA 1FFRA 1T99A 4IMCA 4MVAA 2VEIA 3LCLA 4FOKA 4JHOA 1WXYA 3ABRA 3BJSA 1GORA 2EPNA 3PVFA 3GZ3A 3GNOA 2Z1VA 1KLZA 3I7SA 1J12A 3MCOA 4ICNA 4RW5A 4EPBC 3BMXA 3S5OA 5JCLA 4LF2A 1YTDA 4ZQMA 3RM4A 1EYEA 1P0KA 4HMEA 1CGWA 3W2UA 1XIDA 1PIIA 1XSKA 4IXXA 2YGYA 3CYJA 3MMUA 3W1TA 1S5NA 4AG0A 3B4YA 4XZIA 1F6YA 3OJGA 2WHKA 5KVHA 4MFDA 1NWUA 2YR1A 3VD7A 2ZOXA 1HL8A 3GH4A 4AHQA 4O12A 3G1VA 1O68A 3TVAA 1JZ3A 3IIXA 4N7QA 2QCCA 3GDTA 3ZO9A 3S5YA 1EP3A 2DVUA 2INFA 3KOFA 2ANUA 4NAEA 2D24A 1POJA 4TIMA 1R2SA 1ZJIA 2OWWA 5HDRA 4PFHA 2HK0A 4H50A 3ARUA 4B2DA 2WVVA 1TYTA 4XBJA 3B05A 4TVWA 4PMUA 2PC4A 5FL0A 4P61A 4KFNA 2YQUA 3DYOA 3HZ3A 5C5YA 4XZ9A 4G9PA 2TYSA 1EWDA 3GNXA 3KWXA 4X61A 2J7BA 4AUBA 2EQ8A 1E6RA 2HZGA 1W37A 3FIGA 3PP7A 2OLSA 1EDTA 4PMJA 4ZFMA 2AQWA 2Y61A 4QXIA 3ZLFA 4RXFA 4K6AA 2RKXA 2CZVA 4DJDA 3IUIA 4HPNA 4JGDA 3HB9A 2DEPA 1VRXA 4U2ZA 3T4WA 4FB7A 5A6MA 3WDIA 5I09A 1BXBA 3D46A 1XJBA 1XIGA 2V0TA 1W1VA 4ZXLA 3LD5A 4KEZA 3WD2A 1AZ2A 1QNPA 1TTPA 4E2OA 4Q4OA 1KLYA 1ZNNA 3ZSSA 3V7PA 3CHVA 4L6DA 1XDMA 4IIBA 2X40A 3L2LA 3H7RA 1UPPA 5C2CA 2OQLA 3U2EA 2X8GA 3PPFA 4Z1CA 3CV1A 3W7EA 5PTDA 2X2YA 1SW0A 3QPEA 3AZSA 2VD8A 1FWEC 3MHUA 3R4IA 5CPMA 1JF5A 4QTGA 5CLWA 3WBWA 3MP4A 3S5ZA 4XV0A 3MBFA 2XSBA 4ORIA 2IW0A 4Q4PA 3KE0A 2ZWZA 1RH9A 4JY9A 1QPRA 2V69A 3G1XA 5J5RA 3BDKA 2PDKA 2BZNA 5FF3A 1US0A 5H91A 1SW3A 5BNKA 4QG8A 4D1IA 2IXUA 5DN1A 2E6AA 2VEFA 4QITA 3BZJA 4MZ1A 3GG0A 3NZQA 1GYMA 1PIGA 2W79A 2YA0A 1EJWC 4YXGA 3AS3A 4FOUA 3TQVA 2GR0A 2P0IA 3ARVA 4DZIA 4C5ZA 5I5RA 1R46A 1W9UA 1V0KA 4TTUA 2ZZ3A 2WJFA 4LRSA 4D8AA 2PGFA 4LVGA 3WJYA 4ZE5A 1BYCA 3LOTA 3VVGA 4P8XA 2TPRA 4GR1A 3F4VA 1IEXA 3RPMA 1WXJA 1IZKA 1OX4A 3C2FA 1VB9A 3AUJA 3AIVA 1CNVA 3KOZA 2CWNA 1BTMA 3WUBA 1PKMA 1MXGA 2C1HA 3AS0A 4PR4A 2DZTA 1Q6OA 1UD3A 5GRTA 3CH0A 1JF6A 4C6FA 3BCFA 1GK8A 4KF1A 4DQWA 1XIHA 2V68A 4GC3A 1NFBA 5LXXA 4NI8A 4OOUA 4UTMA 1KRCC 1KV8A 3NZRA 3V1HA 1R38A 4PRRA 4AWTA 1T96A 3SAZA 2AMXA 1S5MA 4FNRA 3SB0A 3VGHA 4GK8A 1GOIA 5G4EA 1D9EA 2V2HA 1R3TA 2REQA 1MFUA 2Q3RA 5BXSA 1W2VA 4B5SA 1BG4A 4JNYA 2GVJA 3CUIA 3KL0A 3NZ1A 2CEQA 3LTPA 4GQ0A 2XU2A 2V6OA 2GQ3A 2VGIA 1KCKA 3BAIA 4PZVA 3MDUA 1OX6A 4XIAA 4JTGA 4GRTA 3TQPA 3FDGA 2F5ZA 1ZDLA 1XQLA 3FAXA 1HJWA 3UVIA 3RUBL 1PWMA 3WK0A 2OJPA 3P82A 2ZRUA 2PRMA 2X8HA 4P7RA 3EOEA 2XM1A 1Q6RA 3UXLA 1XF0A 1QBAA 4LC8A 1CB7B 3WQVA 3TR2A 1JD7A 1XLAA 2HNEA 4HPXA 4MWAB 2Q3OA 1GG1A 2QQ6A 1BD0A 4FNSA 2QCDA 2FVMA 5AHFA 5E0FA 3S8HA 3QZ6A 4EPDC 4LYQA 1H0GA 4LUIA 1NF7A 2Y8UA 1DE6A 4HCHA 1XCWA 4UOJA 1SM9A 4KCWA 4GIEA 2DUXA 1HF6A 4HHLA 3INPA 2BC0A 4ADSA 4ZO9A 1VFSA 3ZWTA 5TD4A 3UW6A 3HM7A 1ONWA 3IC9A 4GX8A 5CPTA 4Q4MA 5HUPA 4O1AA 5CEWA 5CPSA 4Q8VA 4BS0A 2H8XA 1LG2A 3OP2A 5A69A 1XIJA 5E0KA 4J3TA 4FX7A 3WJSA 4KKXA 4CCCA 1EKOA 3TMLA 3C8NA 3B0UX 4QJ1A 1OFPA 3WK2A 5DF0A 4RX0A 1V5XA 4KT2A 3LNMA 4O8RA 3UPWA 4JX4A 1WKDA 3N29A 4CU8A 1W9BM 1V03A 3GQYA 1OJTA 1W56A 1XI3A 3WH7A 4G5DA 2YXOA 2BV9A 4B5UA 1B3YA 4E8DA 4RJEA 4Q8OA 4K8GA 2EPLX 1BWVA 4W8LA 6ALDA 2IUZA 3G6LA 2F6UA 5I3DA 2NUYA 3IAQA 4KGLA 3POHA 3VCCA 3KHJA 1Q65A 2BASA 4RNFA 4US5A 1OD8A 4YPJA 4CNTA 3HN3A 3WY1A 3UPMA 1EJSC 5HULA 4A22A 2R6OA 3GNDA 2ZRWA 4IIHA 2JALA 3DFSA 1EO5A 1VF8A 1TRDA 4ZSTA 3WSUA 1E4NA 1KFJA 1IV8A 3W1QA 3CEUA 1I1WA 5GJNA 4K8EA 1S2UA 2V67A 2YFNA 2W62A 5FIPA 2XGIA 1PX8A 4GNVA 4J2PA 1UC5A 1MVYA 3SECA 4L1WA 2Z2BA 3WLLA 5DQPA 4LSBA 2XFRA 4UTJA 4MNMA 1EIXA 2A7RA 5DRIA 2FLIA 3QZAA 2YVFA 4JZ5A 4AHOA 2VZUA 4M19A 1O1ZA 1N82A 5EBUA 2OKTA 3U7BA 1UYQA 1GQLA 2W27A 1GVSA 2HQAA 3Q67A 1AG1O 4JYEA 3U5UA 1FWHC 1J79A 1ZTVA 3DH9A 3GDBA 1Q1RA 4GMEA 3W7KA 4UMCA 2NWSA 2V81A 3TMQA 1CLKA 1B4EA 4JXCA 1E3XA 2NX9A 2J7GA 2D1ZA 2NQZA 5H8PA 1DJWA 2WNNA 3T44A 3DKJA 3NG3A 1M04A 1GJPA 4RE0A 3LCIA 4LAUA 2CLEA 4LJ3A 5DY3A 2BODX 5CLTA 3LADA 5FMHA 2OKOA 4S3DA 1V08A 5FL1A 1G69A 4BWLA 1KM6A 4UQ9A 1W1IE 4BI6A 1GKQA 3H7VA 5GPRA 3IK4A 3MUIA 2P0OA 1QWKA 1A5KC 3TTSA 2XN2A 1UR4A 4C1LA 4IPLA 4LGXA 1KWKA 4JHZA 4MDOA 4DRSA 4FXJA 3FSTA 4R85A 1I4NA 1WKFA 5AZ0A 1KA9F 3GXPA 3UWVA 1TWSA 2P50A 3SUSA 3GX9A 2VGBA 3R0DA 6XIMA 3E2RA 3LY0A 2PZNA 4TR9A 3FV9A 4JDBA 3P62A 3P2VA 1CGYA 4GJJA 4JCLA 2NVAA 4HK5A 4C1KA 3LENA 3MZ2A 1XLBA 4F0MA 4Q33A 4GIYA 4Y2WA 4LS0A 1R2TA 1TPDA 4M0XA 5XIAA 4B4FA 2JQXA 1DORA 1XLCA 3MI6A 1FWAC 4Q8QA 4Q6XA 2D0FA 2PP3A 4LEFA 1WX0A 4IIDA 2WSYA 3W73A 2OGJA 5LIYX 3C0SA 1UKPA 2ZZBA 2RDUA 3UQNA 1DQWA 3IPWA 4OV9A 4KCUA 3BL3A 4N4PA 4MIMA 2D2HA 1FWNA 5U7SA 2V5KA 3OHMB 3TYZA 1GWJA 3OQEA 4Q4QA 3CAVA 1FRBA 1P1MA 1PZ2A 3BQ5A 4BEUA 2CPUA 5D9NA 4B91A 2GR1A 4AC7C 1HL9A 3PUDA 4E8CA 2WNZA 1YQ2A 1XBZA 4DELA 1TMLA 5C54A 2QGYA 1MRQA 1K4GA 1KFCA 3AWNA 1CBGA 3CMFA 2ZUUA 2ZA3A 1AJ0A 3W83A 4DJEC 4LALA 2OB3A 5XINA 2GQWA 1U1UA 3AC0A 3PZIA 4JTFA 3S1XA 2CC0A 1MW0A 1HGWA 3OYXA 3CQHA 1H1ZA 1CCWB 1VFTA 2DUZA 4D6HA 4TMBA 1ZGDA 3OG3A 3M5VA 5I6SA 4J3SA 4PULA 2YBVA 4L6HA 4IX2A 1UOZA 3FFSA 2AL2B 2YDAA 4ZQOA 3GTHA 2Z7GA 4MKVA 3HW2A 4C6QA 2D20A 3LGDA 3L68A 3M5ZA 3P5YA 4HSNA 2ZUVA 4H4UA 2UWFA 4MDPA 1R7OA 4Q4SA 1AA1B 3ONBA 3QC0A 4O53A 1Q66A 4Z08A 2VRQA 3PS7A 1HXJA 2XIJA 1PPIA 3GDRA 4Y9AA 4A3QA 2AOSA 3CB3A 4AIOA 4DLMA 1F8IA 1UG6A 1DXEA 2QUMA 1A5NC 1PE1A 5A1AA 3QTGA 4C6OA 3QOMA 1FHVA 1DWIM 2HBXA 4WDXA 4WKHA 5AKQA 3B8UA 1M7PA 3MVIA 2ATSA 1GRAA 2XWDA 1VJSA 2CESA 3GXNA 1YYAA 1W5MA 1H7NA 3ITYA 3P80A 3S3GA 4ROPA 3BG3A 1OF8A 2Y5JA 2QEZA 1JCTA 2PF0A 1RY0A 3HGSA 4KBXA 1K6WA 3WLPA 4HHHA 3UR2A 2EJAA 1R3YA 3W84A 4JTEA 2F9RA 2QKFA 4FI4A 2D2GA 4FXFA 4O13A 2G0WA 3WQFA 2J7EA 4LB4A 1E3ZA 4D1JA 1W5NA 3IGHX 3L4YA 2DSZA 2YOCA 3JW7A 4ZB5A 3OODA 3W87A 3SFWA 4IGSA 4GQRA 3P61A 4DIAA 1ISYA 2E5AA 2CZFA 4H7CA 3EKLA 4JIIX 4XTIA 1GQNA 3UF9A 2PA6A 3N4FA 1RUSA 1A0CA 4AD5A 4IMAA 4PCTA 2BXZA 4HOXA 3PWAA 2O4QA 4E3TA 1H63A 1KFWA 4K2SA 1UD2A 4GQQA 4C6KA 5DCEA 1UJQA 3BMVA 2PLMA 1XKYA 3LZ3A 4JFUA 1DTNA 1MEIA 4WOQA 1X98A 1TQXA 1VHCA 1FWFC 3PWIA 1KGUA 3DERA 4NVTA 1IIHA 2PEVA 1J0JA 2FQIA 4YHEA 4B3KA 2HXTA 3CQJA 1QPQA 1KCLA 1DJIA 1ESWA 4UR9A 2XVLA 2VCBA 4EP8C 3CL8A 4GGHA 1X39A 2W0HA 1DWJM 4YVPA 1W2PA 1FWGC 2G3NA 3S2MA 3O8AA 1E9ZB 1I2PA 4ADUA 2JK6A 4NU7A 3F5JA 1KBJA 2WKJA 3BZGA 2R9RA 3QW4B 4H7ZA 1JRCA 1OYCA 4H9TA 4OJYA 4WD0A 1W1B1 1ISZA 3WNNA 2Q8XA 2GDQA 1QNRA 1B3OA 1PYFA 4H4RA 2CLLA 5IBXC 3PB0A 3EWYA 4PMZA 3CHFA 3CZLA 4CQ8A 4DYEA 2VZOA 4JTSA 1GYLA 3CQKA 2H6RA 3OLIA 1T3QC 2I5GA 3N34A 3PG6A 1H11A 1ME9A 5GNXA 4X2PA 3NVYB 3IGSA 2TRSA 3MSRA 2XH0A 3BLEA 3GC4A 5MF5A 3NVVB 5LA2A 3B0XA 1LWIA 2PC8A 1EBGA 3KTCA 1DQUA 3AYTA 4UB9A 4HU3A 3DJJA 3MYPA 2WOWA 1LTDA 1ONRA 2CW6A 5EMJA 1JIBA 1UD8A 3CWOX 1GYNA 4V27A 3WH9A 1S7MA 1VD6A 5G2IA 3SCRA 4TVCA 2CLIA 3ALFA 2J9YA 3N19B 4MF4A 5D2VA 2ZRXA 2F2KA 2DZWA 3OU8A 1DJGA 4NZCA 4QJ5B 3C2EA 4ZE4A 1B3WA 1R7AA 1R8LA 1NY1A 3IEBA 3OVQA 1XBYA 4AC1X 1WDRA 1ZJBA 2PTYA 4C6EA 1Q6FA 1IZCA 2WHJA 4V15A 4F0SA 1L8NA 1RP9A 5KEZA 3CLMA 4XAGA 1LOLA 2ISWA 1XRSA 5FJPA 4W86A 1B90A 3VABA 1XIIA 4XWUA 4OUEA 4NG3A 3OBKA 3T8QA 3TTYA 4XQ6A 3NQAA 4IFRA 2QIIA 3ATZA 1S5TA 4Y9OA 4RZ6A 2PI6A 3CIXA 1H7RA 2BSLA 4Y9NA 1W1ZA 1TTQA 1GOKA 4ACYA 3H24A 2WBAA 4PBEA 4XUYA 3B0PA 3LYEA 2D0HA 1JZ8A 3PB2A 4UNIA 2IKGA 4AEEA 2BFGA 2KZHA 3SCOA 2E5CA 3HPSA 2DORA 1MEWA 1YHTA 1TIWA 1LRTA 1OC6A 4HJWA 1WAUA 2R1MA 3OB8A 3ARRA 2OYMA 3UXIA 4H2CA 5DT7A 4DBWA 4Q8MA 2OEMA 1Q85A 2C13A 1RJPA 3NFUA 4FNTA 3U2ZA 3DAQA 4UTUA 1VENA 2QGHA 4L5ZA 4IG2A 1WV2A 1K7FA 3A7RA 3TJIA 2X1UA 2NXIA 1N7KA 5K9DA 1UBSA 1XLLA 3UPBA 1N63C 3SN4A 4L1GA 3WK1A 4H6KA 4YL2A 3VGEA 3FGCB 1NU5A 3V3WA 4NASA 3D3FA 1OGSA 3ZJ6A 5A8OA 1TVNA 3LCHA 2FJUB 4RDWA 4PUEA 4B5WA 4UOZA 4EF8A 1TSIA 1XG3A 2D73A 4IOTA 2NVCA 1Z42A 2VFIA 3WELA 2HQMA 3B3DA 1WDWA 4AZCB 4UTLA 3VD4A 4UFJA 2PDBA 1PCWA 4LY4A 3WNPA 1F2JA 1E0TA 5I7GA 3T0DA 3MWAA 4U3AA 3W07A 1HKWA 4BHYA 2FTWA 1WA3A 4S3EA 4KPLA 5ABFA 1KN0A 4X3ZA 3RJYA 4W88A 5BMXA 2I14A 5F1VA 2H9AA 1NFGA 3DYPA 1TX0A 4PYSA 5DXXA 3M0MA 4OVXA 4AD0A 3TC6A 3LRMA 2JGYA 1F3TA 1AH3A 4PMYA 1TX2A 3M4HA 3PUOA 5BWAA 3W71A 1CGVA 3PAJA 2GYIA 3UWUA 1GONA 2Z6IA 2VMFA 1UWAA 4PCPA 5I03A 2BXYA 5DANA 1AJ2A 4DJED 3R8RA 2V5DA 3UZ5A 3GHUA 3CV6A 2I5QA 2BS9A 3E0WA 1XH2A 3R11A 1IXPA 4KCTA 3VE7A 2BTMA 3BSGA 3CUGA 4EANA 4S3GA 5KMYA 3BTNA 2Z2AA 4N6FA 2Y63A 3KOXA 4N9EA 3PZVA 2YAUA 1ZMCA 3ONCA 3EMCA 3M43A 5FJTA 4JIRA 3VILA 3RX4A 3O15A 1ELSA 4PSRA 3HPAA 3LHTA 1GPFA 3V0SA 3S9IA 1C29A 3HQPA 4Z2IA 1TMQA 4M1RA 3FHQA 3Q58A 4QJ4B 7REQA 5JIWA 3ARYA 4O0ZA 4IL2A 3GNRA 2Z1SA 2ZDSA 1I75A 4IT1A 1VBGA 3G18A 4GIAA 1LM1A 3K46A 1E6PA 5D2YA 3S9YA 4AZGA 2BHYA 1K6AA 3ITVA 2WSRA 2VJXA 3E38A 1BQCA 3KBSA 1XLIA 4AIBA 3NSXA 1T8XA 4HTBA 1YTKA 4W89A 1ZXIC 2B31A 2JKPA 4GYJA 3Q37A 1JDEA 4MLJA 1RD6A 1RLDA 3K8MA 1LORA 3W2JA 4OKDA 4L9YA 4GABA 1DJQA 3OVPA 1ICSA 3CC1A 2ACQA 3ID7A 1BYBA 3H4WA 3NYDA 3ZM8A 2BWGA 1E72M 2YDSA 3FXYA 5CGQA 2D0GA 2E9LA 1AH0A 3PFRA 5HPCA 6XIAA 1C90A 1MXSA 2ZWYA 4S38A 2WANA 3CT7A 3HQ1A 1MEHA 5KSWA 4NX5A 3RMJA 4DO4A 1HP5A 3ATYA 3WNMA 1DXIA 4H3DA 4L4OA 1XIBA 4GVGA 2WXDM 3ZVHA 2WZIA 3SRFA 4UQAA 2V8ZA 3D9XA 1IR2A 5I07A 4AISA 2QCNA 4B15A 4DEFA 1XUUA 3MUY1 1FP9A 1TZ7A 1G94A 1M9HA 1MNSA 1E71M 2QAPA 2RAGA 2G96A 1QNVA 2ZUWA 3VCRA 4HN4A 4FLSA 3NIYA 3T0CA 2QF7A 2YCLB 1MDRA 2J78A 2O4MA 5ER0A 1H3GA 2UV8G 4NEVA 4EF9A 5FI8A 4GBUA 2OQHA 4MZYA 4IL0A 2Q8ZA 5JMUA 3NQGA 5G5GB 2VOTA 5HMSA 5I78A 2DZBA 2WMJA 2X7VA 1KFKA 3PN8A 2PDUA 3CUXA 3IUDA 1KC7A 2D3LA 2XG9A 1PJ9A 4A35A 4CKQA 3M0IA 3FEQA 2JGQA 3GU9A 2PRHA 4UQDA 4A8RA 3OGRA 1F3EA 4PCNA 1M65A 2NQJA 1QPKA 4LAKA 4DAIA 2GGGA 2FGBA 3OZPA 4JFVA 3C2YA 3CO4A 4GX9A 3VFCA 1YQZA 4C1NA 2GR2A 5ECVA 1GPWA 4G7FA 4EWJA 2Y0FA 2XFFA 4FF7A 3TOPA 3QMRA 3GM8A 2VRKA 1EPXA 4Y8EA 3VNLA 3NSMA 3ENLA 4E0CA 2EQ9A 4H8HA 4H9VA 4LRTA 4R33A 1QUMA 4HQVA 3W37A 2D23A 2GVLA 4HBKA 1EFZA 5IFPA 2I9EA 2BOFX 2WC3A 4V2XA 1IE7C 1XFBA 4CN6A 2GSEA 3GTNA 4Q8TA 3W7JA 3F4CA 5K4XA 3RX2A 2FHCA 3GXTA 3PJWA 1CZ1A 1PKYA 1MOKA 4F48A 4EK7A 3GW3A 4NNCA 2GOUA 2IPJA 2OTDA 1KWGA 3WBEA 4I9MA 2A6LA 4WCJA 4DO7A 2A3EA 4QP0A 3ABOA 1HNYA 1Y5XA 3PTMA 5M1TA 1IXQA 4ZMGA 3AIBA 4GYFA 1HN1A 3SZ8A 4ZQCA 3WQWA 3NOYA 3DI1A 4PTMA 3ZT6A 4GXMA 2FH8A 4TO8A 3G1RA 2FMNA 1ZP3A 4PB3A 3TU9A 1HKIA 2NPXA 4ZTXA 2XJ7A 2ZRVA 3PAOA 3QZEA 3MS8A 3GK0A 2DP3A 4IPJA 2QCHA 2CCRA 2QF8A 1QK2A 1Z69A 1OJXA 2D3NA 3LLDA 1OCJA 2A85A 4DHGA 5A6LA 5A8GA 1UR2A 2XFYA 2PSNA 3W6YA 2RGLA 5A8NA 4EX4A 1OIFA 1HKKA 3E49A 3P8JA 2FB3A 4M6QA 2DSKA 2GJXA 3IJ6A 2ZKMX 1LROA 4N02A 2ZUMA 2WPGA 3FA4A 5H6HA 2VGGA 1VCFA 1IXOA 2PDCA 2ZX7A 1QO2A 3H2CA 1PCKA 1ZZMA 1LP6A 1HFBA 4H19A 5FOOA 3R13A 3NQDA 2VD9A 3WYZA 4JFTA 2OMAA 1W5OA 3UYIA 4D72A 2HE8A 5BRPA 1W1TA 3EGJA 4DBDA 2V82A 1W6TA 1MO9A 2G3FA 2QCMA 3SQSA 1TVLA 4QNEA 3N6JA 1KM5A 3CUFA 3AALA 4A2RA 1K03A 1R9ZA 5ENLA 3S6DA 4MADA 4REQA 2AL1A 1UP2A 2E09A 4RL3A 3UYCA 2VYOA 3W24A 3D5HA 2AKMA 1VPXA 3SR6B 4LH8A 4CNNA 3VIKA 3SBFA 6CGTA 3WNOA 3S9ZA 2JIWA 4NRSA 1BAGA 1EA0A 4IFKB 1JPHA 2XM2A 1UUQA 2GK1A 1JI2A 3SCQA 3BWWA 1TCMA 4GFSA 4Z2KA 2WQPA 5HPOA 2DH2A 1BRLA 2YL9A 4HYRA 1A5LC 4QS6A 2WJZA 2YKKA 1SYTA 2C3CA 7PTDA 2QYGA 2BLEA 4GI8A 1F4HA 4LW7A 1O6IA 4XK2A 2E67A 4AF0A 1O12A 2QXWA 2OODA 4LUSA 3P8IA 4Q8NA 1GVOA 1UH4A 4HOZA 4TVUA 3ZSTA 3PWGA 4YIWA 2NSXA 2ZIDA 4XB3A 3L2IA 1K7XA 5E70A 4V1YA 1OVDA 3LA4A 4YVXA 3TFXA 8XIAA 3RNMA 1XIFA 3DECA 3MMTA 1J5SA 5C9UA 3KWSA 3QKEA 1A5UA 2FZ8A 2PUZA 3RG6A 1EZ2A 4NXSA 4JTHA 4OBSA 4JN7A 4X22A 1SB3B 2EQ7A 3WJXA 1SZEA 1LG1A 4MYAA 1YW1A 1ZCOA 5FF2A 1X97A 4OUIA 5E9AA 1QHZA 3QQ1A 2NQHA 5DCBA 4YYCA 1U2YA 5HMFA 3PBGA 3WEOA 1SU5A 3C2OA 3TZNA 3WQPA 4DM2A 5BMWA 1V6WA 2Z25A 4NUWA 3UERA 2VO5A 3MO4A 4HPJA 5K7JA 4O19A 3HF3A 5JCKA 4FXRA 1KQYA 2ZZ2A 1FWRA 2J77A 2CIPA 3ANUA 2EEXA 2IQTA 3W2NA 4U2YA 4DYJA 3ZYZA 4H01A 1J0HA 4PMDA 1XH1A 2FPTA 1PKNA 3CT2A 2WPBA 4OFCA 4M29A 3C0QA 1NDYA 3STCA 1I45A 1TV7A 3JZUA 1E51A 4ZTYA 3SEPA 2ATMA 2PPGA 2UY5A 1I9CB 3F5LA 1V79A 3H4GA 1OYAA 1L9WA 4E4UA 1OT1A 1A5BA 3VXGA 1EBHA 3P60A 3MI3A 2FHFA 1GOQA 1W9PA 2IXVA 2QR6A 2RGMA 4I8DA 2BVDA 3GSMA 1JQXA 2FB2A 3QJAA 1CB2A 5TR3A 3GYCA 2VC7A 4LT9A 2YW4A 3QTPA 4JCMA 2D22A 5F1UA 3QRHA 3QSRA 3DK9A 3KRUA 2RJGA 1KGXA 2UZ9A 3LPOA 2C91A 2O56A 3VU2A 1TPEA 1SR0A 3OW1A 1WB0A 2ABBA 1H4PA 3M1ZA 1R86A 4LY8A 1B57A 4Z1YA 2X0SA 1PZ0A 2BGQA 1ZSXA 3CV7A 5HJYA 1UWTA 1NP0A 2X50A 4RUBA 4UMBA 5E6ZA 1O94A 4S3KA 1PTDA 2BP1A 3I65A 3Q45A 4P7NA 5CG0A 4D71A 2D2OA 1Z41A 4WZHA 4Q8PA 3VMNA 2Z24A 1GOXA 4O8AA 2Q71A 4M24A 1UUMA 4CD4A 3EDFA 4ZB2A 3GIPA 5HNRA 1QW8A 3W82A 1GRFA 1X6UA 1EDGA 3JUGA 2Z0IA 4AXKA 4R3UA 2C6QA 1UUOA 4FX9A 1UZDA 1M3UA 1U83A 4AWEA 3EA3A 4JR5A 5D02A 5FF0A 4UQBA 2EJ1A 4OGZA 2E5BA 1NVMA 4L4PA 4NXKA 3TN5A 2HS8A 3H53A 4J7RA 1GZGA 4DPQA 2I7GA 5BW6A 3SRDA 4GO8A 2HEJA 4F2UA 4F0LA 1TV3A 1XLKA 5FJIA 3QH2A 5BU9A 3FSUA 4LAMA 2FTPA 2NX3A 1ISWA 4IH3A 1JVNA 1BXCA 4ROQA 1UD6A 3RJXA 1RK6A 2ZYFA 3VUPA 4GH1A 4AZ5A 4NNAA 5DX7A 2J4GA 1FEAA 1FWBC 3W1RA 3LHWA 1VH7A 5J04A 2CERA 1I60A 3GIYA 4B90A 4C6CA 2DDXA 2X16A 1I1XA 4D6FA 1GVIA 4PGLA 5I79A 1G4SA 3EWCA 2V3GA 3LTSA 1QPNA 2ZE3A 3ETRB 1EXBA 3G1HA 1FWTA 3IVTA 3B97A 4NZ3A 1HG3A 4ZVJA 4M8UA 5AHLA 3CV2A 4M1BA 3EWWA 4H04A 3EDDA 3N3TA 4MZ8A 3BCDA 1FWCC 2QVHA 1NFPA 4CUCA 1GRGA 4CNPA 4EWND 5GVJA 1D3GA 4XVDA 3AZRA 1UWUA 1LF1A 4IHCA 1TJRA 3JZEA 4BF9A 2J8FA 2XH4A 2ALDA 4Q8WA 4PUNA 1AZ1A 3K2GA 2FTYA 5AZ1A 1ECQA 4L7ZA 2PCQA 1R0MA 3LM7A 1CECA 2HJPA 2WO5A 2EAWA 3I10A 2GQ8A 1XXXA 1RVGA 5K3VA 2WNWA 1UKQA 1J0KA 1V02E 3KM8A 1EH9A 4JKLA 5LKYA 3UP8A 2HVMA 1N55A 1TUFA 2FYMA 1QJWA 5AVNA 3VPLA 1EL3A 1OC7A 3DK4A 3P3BA 4H1ZA 3SRKA 5D09A 1FIQB 5M2FX 2ZDRA 4M6UA 1TTIA 2F84A 1VYRA 4WR3A 2GOKA 4FP1A 3N1AA 1KR0A 3WF1A 4X63A 1QI3A 1BKSA 3GS6A 4MB3A 3R7MA 4YVVA 4WOZA 3UG5A 1AQMA 1HP4A 3W0KA 3U2OA 3MUCA 2YCIX 2DZSA 1GREA 1UD4A 4NILA 4S2BA 2PFHA 1V6TA 4FPSA 4PUUA 1PDYA 1N62C 3R79A 5I02A 4WY0B 2AAQA 2ISFA 4TXEA 3CIWA 4RXGA 1LQ0A 3SY5A 4HSHA 1JDFA 3DFOA 4W8BA 3O3RA 1HW6A 4NZ1A 5D9MA 3L67A 2O9RA 4WDUA 3H54A 4DO5A 1IGSA 4TOQA 2HRWA 3UWQA 4ZL1A