3OW1A

Crystal structure of d-mannonate dehydratase from chromohalobacter salexigens complexed with mg
Total Genus 144
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
144
sequence length
403
structure length
384
Chain Sequence
b'LKIRDAYTIVTCPGRNFVTLKIVTESGTHGIGDATLNGREMAVAAYLDEHVVPALIGRDAGRIEDTWQYLYRGAYWRRGPVTMTAIAAVDMALWDIKAKAAGMPLYQLLGGKSRERVMTYAHCTGQTIEDCLGEVARHVELGYRAVRVQSGVPGSSLPAEHVWSTEKYLNHAPKLFAAVRERFGDDLHVLHDVHHRLTPIEAARLGKAVEPYHLFWLEDCVPAENQESLRLIREHTTTPLAIGEVFNSIHDCRELIQNQWIDYIRMPLTHGGGITAMRRVADLASLYHVRTGFHGPTDLSPVCLGAAIHFDTWVPNFGIQEHMPHTDETDAVFPHDYRFEDGHFLAGESPGHGVDIDEELAAKYPYERASLPVNRLEDGTLWHW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mandelate racemase/muconate lactonizing enzyme
publication title CRYSTAL STRUCTURE OF D-MANNONATE DEHYDRATASE FROM CHROMOHALOBACTER SALEXIGENS complexed with MG
rcsb
source organism Chromohalobacter salexigens
molecule tags Lyase
total genus 144
structure length 384
sequence length 403
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 4.2.1.39: Gluconate dehydratase.
pdb deposition date 2010-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02746 MR_MLE_N Mandelate racemase / muconate lactonizing enzyme, N-terminal domain
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 3ow1A02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 3ow1A01
2PTYA 1EC7A 3U4FA 3DIPA 3DDMA 2ZADA 4ENLA 3RITA 2PMQA 4DHGA 1EC9A 2AKZA 2OQYA 3VCNA 3ZVHB 3OPSA 3SN4A 3MY9A 3GC2A 3QN3A 4MGGA 3UXLA 1YEYA 2QJNA 4GGHA 1KKRA 4HPNA 2MNRA 2OO6A 1MDLA 2PU1A 2GGHA 1IYXA 4FI4A 1FHVA 3U9IA 3IK4A 5EU9A 3GD6A 1KCZA 2PODA 4GGBA 4H2HA 3TJ4A 3NZGA 3SSZA 2PP3A 3R0UA 2GDQA 2XSXA 1SJDA 2XH2A 1NU5A 4FP1A 3TW9A 4IP5A 3T9PA 4H83A 3RR1A 1PDYA 3RO6A 3RRAA 2XGZA 4MKSA 2GL5A 2OX4A 3DESA 1EC8A 1TZZA 3UGVA 2AL2A 4KWSA 1JPDX 1ELSA 3CT2A 2HNEA 3OTRA 1WUEA 3CXOA 1E9IA 2QDEA 3JZUA 3GO2A 2OG9A 3UCCA 3SQSA 1SJBA 3SJNA 5BOFA 2OQHA 2RDXA 1F9CA 2OZ3A 4HCDA 1MRAA 4HNCA 4DWDA 1PDZA 3DG7A 3OZYA 3FVDA 2QGYA 2PTXA 2PGWA 3N4EA 3DERA 4A6GA 3VFCA 2PSNA 3VDGA 2AL2B 2NQLA 4H1ZA 3N4FA 3Q45A 4IHCA 3OW1A 3TWBA 4HCLA 2GGGA 4G8TA 1P43A 3KUMA 3BSMA 2AL1A 3V4BA 4G7FA 3NO1A 3H70A 4GMEA 3V5CA 3Q4DA 3TCSA 4H19A 3FJ4A 4A3RA 4Z1YA 2OLAA 4JN8A 4ROPA 3SBFA 1JPMA 3UJFA 3H8AA 3PWIA 2FKPA 3S5SA 4M0XA 3PWGA 2PGEA 6ENLA 3IJQA 2QVHA 4E8GA 5IDZA 3DFYA 3ZLFA 5FJUA 2PPGA 3P93A 3I6EA 4GYPC 3I4KA 3UCDA 4IL0A 3N6HA 1XPYA 1R6WA 4A35A 3T8QA 3R10A 3VCCA 2CHRA 2QDDA 4IZGA 3T6CA 2ONEA 3THUA 1ECQA 1DTNA 3OP2A 5FJOA 5FJTA 3FCPA 3ENLA 2OZ8A 3T4WA 3V5FA 1SJAA 3EEZA 2PS2A 4EWJA 3SN1A 1KKOA 7ENLA 4HCHA 3NXLA 4K8GA 4MMWA 4ZA0A 3H12A 4JHMA 3UJEA 4ZCWA 3UXKA 3CAWA 1TE6A 2PTWA 3NFUA 1EBGA 3CB3A 4E4FA 3VC6A 2MUCA 2QQ6A 3PFRA 3MWCA 2OKTA 4DXKA 2GGIA 3ZLGA 5FJPA 3FXGA 1W6TA 3HPFA 1EBHA 4DYEA 1BKHA 3ZLHA 3OZMA 4DX3A 3RCYA 2P8CA 1ONEA 4F4RA 3K1GA 1SJCA 2FYMA 2GGJA 1WUFA 4IT1A 3R0KA 4E5TA 4KEMA 3TOYA 3I6TA 1MDRA 4YWSA 3DGBA 3MKCA 2AKMA 4GISA 3JW7A 2PTZA 3MUCA 4X2PA 2O56A 3TQPA 3S47A 3STPA 3JVAA 2POZA 2HZGA 3PK7A 3R11A 4KPLA 4K1WA 5BOEA 2DW6A 3ES8A 3QPEA 3IJLA 3DG6A 2GGEA 3UJRA 1JCTA 2QJJA 4IL2A 2P0IA 3UJSA 4DN1A 3D46A 4J3ZA 3MSYA 5ENLA 2HXTA 3FYYA 4J1OA 3MZNA 1XS2A 3TJIA 3CK5A 3R1ZA 3SN0A 1TKKA 3QLDA 2PA6A 1RVKA 2OPJA 2OZTA 3EKGA 2QJMA 3CYJA 4Z17A 2XH7A 2XH0A 2OVLA 2PU0A 3BOXA 1FHUA 3D47A 3TWAA 2OFJA 1P48A 3DG3A 4E4UA 2PP0A 4K2SA 5J04A 3V3WA 4JN7A 1JDFA 4IP4A 3R25A 4M6UA 3UJ2A 1MNSA 1R0MA 3H7VA 3N6JA 3ZVIA 3ZVHA 1L8PA 4E6MA 3VA8A 2P88A 3QKEA 5FJRA 3RGTA 2ZC8A 3ES7A 3TTEA 3P3BA 2P3ZA 3DEQA 2PP1A 3B97A 3GY1A 3VC5A 4HN8A 4GIRA 1BQGA 3FV9A 2I5QA 3QTPA 4KT2A 4GYPA 1KD0A 1NELA 1OEPA 3P0WA 2DW7A 4GFIA 4HYRA 3BJSA 2XH4A 4HNLA 2HXUA 3IJIA 2GSHA 2P8BA 3DFHA 2PCEA 3MQTA 1MUCA
chains in the Genus database with same CATH superfamily
2DZTA 3FSUA 5DY2A 4WJEA 3NM3A 3UXIA 3AWOA 1KRBC 4S39A 3WNKA 3FX4A 2GJXA 5IBXC 3WBAA 3VKAA 3KW3A 3QTGA 1UUQA 4MGGA 3B9DA 3LXCA 5AECA 5U4NA 4GO9A 1TB3A 4QDPA 2WB5A 4ERIA 2DVXA 2HVNA 4GRTA 2I16A 2C7FA 3WLKX 1JYVA 1UJQA 3M5ZA 2Z2AA 4AZ5A 4PTVA 3U9IA 1IEIA 2GOKA 3C0LA 5AZ1A 4IQDA 1EIXA 1UIOA 3P5YA 4H4YA 4H04A 3E2QA 4IGMA 2C6QA 3ZS4A 1EX1A 4J2MA 1P0KA 4FP1A 4NI8A 3AXHA 2Z00A 4Q8QA 5REQB 2O0TA 2IPFA 4PRRA 5CCZA 2QKFA 4LH8A 2J78A 2TSYA 1TX0A 1VAHA 3SCQA 4XIAA 4GXWA 1EDGA 1POKA 3PN8A 3HPZA 2OG9A 1LRNA 1QHOA 3MDWA 1R7OA 1HJWA 4ZTYA 1ZY8A 3I3DA 1JCJA 1R3TA 4O14A 3S9ZA 3TAOA 3UNDA 4INFA 4WD0A 4FXRA 2ADAA 2X8GA 3QYQA 4WK9A 5K2ZA 1VCGA 5JBDA 1GVFA 3UZWA 3LQLA 5GPRA 1AQ0A 2WHMA 4B92A 4RW3A 1KXQA 3VDGA 3LV6A 4LCSA 4BQ5A 3S4TA 1E4LA 1KNWA 1G0CA 1R3VA 1Q6CA 4QJ1A 3N19B 5DT7A 4RNHA 3TU9A 3BG3A 1GEUA 1BEUA 1NIUA 2O9OA 3GH5A 3TNBA 2J9XA 1P5BA 1E72M 2Z4GA 1QBAA 1F3EA 4B4FA 1KCLA 1SFLA 1B1YA 1OVDA 4NZFA 1BHGA 1BYCA 3W26A 1LQAA 1GERA 1STZA 1PWMA 4GQ0A 2O4QA 1JDAA 1EBDA 5FJUA 4PTWA 4REQA 3GBEA 4B3KA 1XPYA 2EBNA 3DK4A 2PDUA 2DEPA 3MV11 1GPWA 2WNNA 4GC3A 1SZNA 3MCOA 3NG3A 1D7KA 1UC5A 1M68A 1F8MA 4O17A 2ZC1A 3LK6A 4NQ1A 3BAXA 4H4PA 1ECEA 5HWMA 3KAOA 5EMYA 3DJGX 4K8DA 3W73A 4JL2A 3TYBA 3BGJA 1AH4A 3P2VA 4JTHA 4DQWA 2CW6A 3LMZA 3IJ7A 3WLMA 5DN1A 1PTDA 3PSWA 4UUIA 3DI0A 1TIMA 4ZA0A 1XLHA 4RX0A 1TCMA 3C56A 3GKFA 2BGNE 3NPUA 2V38A 2O4MA 4AMAA 1ITCA 1OIFA 3AN1A 4NU7A 4O0KA 5BMWA 4GYFA 2OELA 3VINA 3VZYA 1E6NA 3N2MA 2X8RA 5D9PA 1J8VA 5FJPA 3FXGA 3GDMA 3O6AA 4IQEA 3F5JA 1TPH1 3HPFA 3G5EA 1XM3A 3GIPA 4AVFA 1IWBA 4ZTXA 3M7WA 1RV8A 1MEWA 1KRMA 1T3QC 4FLRA 3UA4A 4DF1A 2WYSA 1TO3A 1TJPA 2NXIA 4H4QA 4JS3A 3NO5A 4YTUA 2DY3A 3FYPA 4JTTA 5FSDC 5DT5A 1XH1A 5ABFA 4C6EA 4Q8TA 2GJNA 2I1OA 3MV01 5CAHA 1XYAA 1XC6A 2WLYA 2CLHA 4OIFA 4WQ6A 5JU6A 4GJ1A 2Z6JA 3L7RA 1RPKA 5LYRA 1ZP3A 3M46A 4ACZB 4MNJA 3IC9A 2E67A 1GESA 3P61A 4LYKA 2Y8UA 1TWSA 2GGEA 3UZXA 3KOXA 4GABA 4LV4A 4IFKA 4PUJA 1JEHA 3OZOA 1JR1A 3LCIA 4K6AA 4O10A 4UQEA 1KR1A 3VIJA 3WJXA 1BGAA 3LTSA 4WDXA 1GSNA 1QI2A 4MNMA 1EKOA 1R3WA 4YCPA 1OFDA 1F2JA 3W01A 4DUOA 5BU9A 2V0TA 4OV4A 5M17A 1XL9A 1QUMA 3MUIA 2X2YA 1CBGA 4B3ZA 2EHHA 5JUVA 2DIKA 2PP0A 1GRBA 3AXKA 4JIIX 1A49A 1LM1A 1EJTC 4JFWA 4M56A 4FF7A 3UJ2A 5EGRA 2FZ9A 1E55A 2DZAA 4K68A 3CQJA 4BY3A 2G3FA 1XPGA 4JTAA 4A22A 4KIRA 2Y5SA 2I56A 1LJYA 1SO5A 3C2RA 4YWOA 4TTUA 1DJIA 4E38A 4E2OA 3GU1A 1E9ZB 3RX4A 4L6OA 3FG2P 3K4DA 1FFRA 1NELA 3G8EA 3QFWA 3ABSA 3PTKA 3T07A 3WELA 4HNLA 1MFUA 4EACA 4NXSA 1JZ7A 3OU8A 4IH3A 5JCIA 3W7CA 1XXXA 5HUOA 5HINA 4RL3A 3QV8A 2OYLA 1OX4B 4DHGA 2VNCA 2W62A 3W7JA 2ACQA 1GVIA 3GS6A 4WHBA 2J8FA 3GC2A 3FKRA 5D05A 3WF4A 4XO6A 5H1WA 4FNRA 3WNLA 3LLFA 2HJPA 5T8GA 2ZA1A 2ANUA 3WL0A 3A9BA 3TV8A 4LYRA 3SW6A 3PPGA 3QJAA 1NHSA 3HQNA 2QPUA 1CZ1A 2G4FA 4I7UA 3ITTA 1CXKA 2CZFA 4A3UA 3WNOA 1WDDA 1Q65A 3IK4A 1YXCA 1RP8A 4P2VA 3P8IA 2OODA 4PEKA 2YBTA 1QNPA 4GGBA 4AZIA 2OLHA 1XG4A 2R1LA 3R43A 3WQ8A 4FIQA 4MYAA 3IVSA 4R9XA 1GJUA 2IPWA 1PZ3A 4QBXA 2AAMA 2WVUA 4LAZA 3NDZA 4IOTA 4HBKA 2ALDA 2A3AA 2Y2WA 3G22A 3ZIZA 1WUEA 1GHSA 4A3QA 3G1FA 4NJJA 1OC5A 2IPJA 2REQB 2YCLB 1KTBA 1FCQA 4UTKA 4L6HA 2RAGA 4AY1A 1FWGC 3EA1A 2FJUB 2GQAA 3F03K 3UFYA 1P0DA 4QQ3A 4FOJA 3VABA 1F9CA 3OA3A 3ZWTA 3QGVA 1UR3M 4F0KA 3DFNA 4RCXA 2EF9A 5FS9A 4HNCA 2YGYA 2XGIA 2OYMA 4UWMA 3NPWA 3W74A 1ISZA 3TQ0A 1SM9A 1BRLA 3FVDA 2A7RA 5CZ0A 4Z08A 1ZY9A 2VX7A 2AMXA 3DERA 3W2JA 2UY2A 1EDQA 2R6OA 3VFCA 2PSNA 3GNDA 4H1ZA 4F48A 2O9RA 1GKPA 4JXCA 3NXFA 1TELA 2GGGA 3FW6A 4LUSA 1XG3A 3RJYA 1UR0A 1OHLA 5E0KA 4QITA 1OJTA 1H50A 1RHCA 3EOLA 4W7VA 2X09A 1H11A 4W9TA 4FPSA 4DBUA 4GKLA 5AFDA 1HGYA 3AZSA 4UFIA 3UY7A 2ZUVA 4FX7A 4GI9A 3LHVA 1DP0A 3NQ6A 2ZTKA 4KBXA 1DJQA 1JVNA 1ODZA 1S5MA 5BXPA 5GVJA 4V2XA 2EQ7A 4E3TA 2CZVA 2OEJA 3DFYA 4ZQOA 3QLLA 4L56A 5LA2A 5GJPA 4GNJA 1XQKA 3UCDA 2FZDA 2ZUSA 4X3ZA 2ON3A 4BQ4A 2PLJA 2J7BA 1EFZA 3GUGA 1ISVA 1VLIA 2ZFAA 4UTFA 3BCDA 5BXTA 3L4TA 4XISA 3B8WA 2D3LA 3CTTA 3GDKA 3NQ2A 3THAA 3JU2A 4DEFA 1ZAHA 4M6VA 4ZSTA 3VIMA 1EYWA 1M7OA 5F7UA 2PWVA 1XIFA 1AVAA 3MPGA 4KESA 3HM7A 1RJRA 1E15A 3DHFA 4Q8WA 3P0XA 4AQLA 3CM4A 5C8BB 4GJJA 4LS1A 1SW7A 3CQHA 3UWUA 3WUBA 4LPCA 4L7ZA 1FWBC 3MI6A 2NLYA 1BKSA 4IMFA 3W1TA 2ZRWA 2QT3A 2AOSA 1XLMA 4DJEA 3KTXA 1YDVA 3CB3A 4LALA 5DCEA 2MUCA 4S3CA 2OKTA 3A4AA 2GJPA 1R2RA 2RDUA 1XLEA 1MWOA 4XWUA 2E09A 1CIUA 1JOAA 4EMJA 3U7VA 3CYVA 3GNRA 4MAZA 2QVNA 3MVTA 4OZOA 4KEVA 4H4TA 1ODUA 3IPWA 2UY3A 4PMRA 3WFZA 2VRJA 1AL7A 2XVPA 5CPSA 5A8GA 3OYZA 3DBNA 4R34A 5A6MA 3WD2A 3BMWA 1I2OA 5E5CA 4TU1A 4XKYA 4IIBA 5AZ0A 4DO5A 3H6OA 1NJJA 3M47A 3N2OA 1TREA 4V27A 2AKMA 3NQGA 4FR1A 3AUOA 1O12A 3BO9A 1V3LA 3CPRA 3DHPA 3NTYA 2J13A 3IANA 1CECA 5MHBA 2HWGA 3DYOA 2ZXDA 4R7WA 3SRFA 3WBWA 2FPVA 2BMBA 4RUBA 1EWEA 2HZGA 1BF6A 2H90A 1IT0A 1UWSA 2QLYA 2HQAA 3UJRA 3L9CA 4C6OA 2CKSA 1THFD 1S5TA 3L65A 1A50A 1XIHA 2B7OA 1FWSA 4JQ9A 3EWYA 1EJXC 2V69A 1BYBA 1JG9A 1ZUAX 1H62A 3KVJA 4TIMA 1XF0A 1XLJA 2NXHA 3GTFA 1I2PA 3ARXA 4UMBA 1LRQA 4Z2LA 1LTDA 4QR6A 1M04A 3CMGA 1M6JA 2OZTA 3TJXA 3URQA 4Z17A 2HMCA 1HG3A 4QIUA 4YYFA 3KL0A 4HZMA 4D6DA 4M1BA 5B80A 1KV8A 2GRTA 1VIZA 4EQWA 1O5RA 2YPIA 2XTKA 1FCBA 3QBUA 1Z44A 2D0FA 2Y89A 5JCMA 4W8LA 3GR7A 1LORA 2G50A 4JN7A 2NQZA 3VKKA 3R25A 3MYPA 4X0NA 1KXVA 4B91A 3ZVHA 3M5YA 4YNGA 3R7MA 1KBBA 4HJFA 1EF2A 4PC8A 3TEVA 1AQHA 1V02E 4H9ZA 4POCA 3TROA 4WR3A 3CXBA 2WBGA 1UD6A 1YMYA 5DO8A 4H9VA 5CSYA 4PFMA 2JQXA 2Q8LA 4YHEA 4L1WA 2W3SA 3P0WA 1QPRA 1IWAA 1J0ZA 3WQWA 1F7BA 4M6PA 3PUDA 3CZLA 2ZKMX 3VILA 3MO7A 3OA5A 5HNNA 1BTCA 1NWSA 4Y9MA 3LM3A 1MUCA 5DF0A 2ACSA 4PTNA 4N9BA 1PL9A 3ZR6A 1FDZA 4RKAA 1KM0A 4LCQA 1W5NA 3EDJA 3RITA 4UOZA 2YA1A 3G0UA 4EXQA 5SWUA 1OD0A 2ZQ0A 5FI8A 3GZAA 4HK6A 3M0XA 4OHQA 4R7OA 1CXHA 4B16A 2L5HA 3NSMA 4C7GA 3GG7A 4GHRA 5EBUA 1ZMDA 2OSYA 4UFLA 3WO8A 2Q71A 3STEA 2DSKA 2ZYFA 5I6SA 3O07A 1ISWA 4LTSA 1TUFA 2PLMA 4JFVA 4Y8EA 1TCDA 1RH9A 3W82A 2WWDA 3LBOA 1S5NA 2C18A 3EPOA 2XIIA 1YNPA 2AMGA 3BLIA 4H7ZA 4FMVA 3QFEA 1YHTA 4NAFB 1Q6QA 4TMCA 2WZIA 2R24A 3GXFA 4NP7A 4GRSA 2HBXA 3RR1A 2X1UA 3WYZA 1J96A 3BUVA 5DLCA 2PC4A 3QHOA 3NGFA 3OTRA 4KCWA 1FWTA 3OZPA 4H9TA 3M44A 4JTSA 3ARUA 3WMCA 4CU6A 1PKYA 1TR1A 1W1PA 1S1RA 3L5MA 4I6VA 4G1NA 3TYAA 4K7ZA 4B9YA 2PD5A 4CEUC 1UUMA 1XD1A 1IT8A 1C8YA 1A5UA 2PD9A 1B2YA 4OUIA 3DECA 1AFSA 4EMWA 4G2DA 4DNMA 2BS9A 4TVYA 4ZQCA 4LC6A 1WV2A 2HK1A 4ZE4A 4NUWA 1HP4A 4MB3A 4DXXA 2AL2B 3OW1A 4AYGA 4G8TA 1MFVA 3KUMA 1TPFA 2I7GA 4BR1A 2VEPA 5DBUA 1A5LC 4GMEA 4OQVA 2DT1A 3SCTA 5H8MA 1ZZMA 1Q66A 2W3RA 2YJQA 1RUSA 1AW5A 4MJZA 3ARWA 1D8WA 2J24A 2VEGA 2XSAA 4XAYA 4WKHA 4DUWA 4ALDA 4GUFA 1G67A 3EX4A 1Z89A 4W93A 6ENLA 4YU1A 1G7VA 5F2MA 1I2RA 3O05A 1V97A 1E1CA 1ZX9A 2B7PA 3AIWA 3ITXA 2XISA 5MF5A 1GQNA 2ZDSA 1NH6A 4O8RA 5TR3A 5CPOA 3FSTA 3GXNA 2V2CA 3SB0A 4BEUA 3MMTA 1DWHM 2GWGA 1VJZA 5FJOA 5HULA 2E6FA 3QSTA 4XD6A 4PBFA 5HNRA 3EXSA 1XHCA 4EWJA 3DFPA 3FLUA 2Y88A 3W7PA 3JR2A 6PTDA 3QY7A 4GH3A 4I7VA 1AMYA 2GVEA 2DT2A 3M5XA 1FWDC 3S6DA 3DKJA 3Q2DA 3EOOA 3REQB 3PFRA 3MWCA 4HPXA 2C3DA 2TAAA 1EDTA 2Z26A 3O6DA 4XG1A 3PG6A 5CBJA 4PEEA 3VAVA 4DLMA 3LXDA 4TX8A 1BG4A 3U2OA 5CZJA 3ITYA 1EBHA 6ALDA 2QMKA 3F2BA 1UP2A 1TPWA 1E0UA 1VRXA 3VGFA 2JBMA 4D6HA 4M82A 4WKAA 2W67A 1PZ2A 2XYLA 3R0KA 4KEMA 4E5TA 4WSHA 4LJ3A 9CGTA 1S2VA 4GISA 1PX4A 3NWRA 5JIWA 4IICA 1A5NC 3RU8X 1UP0A 2ABAA 1TX2A 2BDQA 4MJ2A 4FXFA 3LSBA 4TQTA 4AD5A 3AICA 5D38A 1OGSA 1XDIA 3CAVA 3SQMA 5BOEA 1E0XA 4L64A 3UWVA 5HANA 2QIWA 4MB1A 3QOKA 2ZZBA 4ATWA 1YBQA 4B15A 4XAFA 2XUCA 4I9MA 4O57A 4DN1A 3D46A 3F2DA 3G1DA 3T0CA 3TA9A 2ZDRA 3NQMA 3CMJA 3FYYA 3C86A 3IJ8A 4JY9A 2FZNA 1OGGA 1AW2A 3N2XA 1CWYA 3AFBA 1P7TA 1U1JA 4UFKA 2PA6A 3ABRA 4LUIA 1DQUA 2FHBA 1ADSA 3GHRA 5A94A 4BZYA 4QE5A 4F40A 2DZWA 2GR1A 1LLZA 1RXOB 4F0RA 1SZFA 2WHLA 1V0NA 4QHRA 1DWIM 3E74A 2ZE3A 4L61A 2Y24A 1ZBVA 2DT0A 4FOUA 1DTUA 4QS6A 4Y2WA 5G1MA 4PUEA 1DPMA 4ZOCA 2XPKA 4GY1A 3K2GA 2OO0A 3ZVIA 4GACA 3SRHA 3KX6A 3GNOA 1R9YA 2C0AA 4HYWA 3BL3A 1WX0A 3BG9A 2X8HA 1EP1A 2A3CA 3RJXA 3R79A 1XD0A 4J4KA 4WXYA 2GYIA 5B7YA 3ETRB 4A21A 2VFFA 4KT2A 4LAUA 3TIMA 1Q63A 4D8LA 1J01A 2ATSA 1LQ0A 3LXAA 4MWAA 4DJEC 4S3EA 2QIIA 2VFGA 1WAUA 3QGAC 4PN2A 3WQGA 3GTXA 4IFRA 4KWWA 3BGAA 3BPWA 1W1ZA 5H6HA 2E3ZA 2XWEA 1YTDA 3I68A 3HOJA 1DJWA 1QWKA 3TZNA 4A8RA 2QS8A 4HPNA 8TIMA 1UC4A 4AHQA 3A13A 2C15A 3UBPC 4H2CA 2IQTA 1BLIA 1AJ0A 1M9HA 2VFHA 3EGJA 3NVDA 4Q22A 1Q2SA 4KCTA 2DORA 5G5HB 1LF1A 3NZGA 3SSZA 3EWUA 1GUVA 2GDQA 4HTBA 1K4QA 3T05A 4XD3A 3WEMA 2W5FA 4BF5A 3M0KA 1XJBA 3KVMA 3KBSA 2PDHA 4U3AA 1J18A 3KVLA 3ZOAA 4YTTA 2E28A 2J66A 4J2PA 1A4LA 5C54A 1XINA 2J9YA 1V6WA 3UCCA 3ZWSA 3W00A 4NJGA 2BLEA 5KZDA 4YTSA 2OTDA 2WP6A 1RQEA 4S3JA 2VTFA 2J77A 2VC7A 1CXFA 3GHUA 1MRAA 1VRDA 1X2HA 4QCFA 1XLGA 4YXGA 3WMLA 4HT3A 4X61A 3VGEA 2YB1A 1HF6A 4DWSC 1FH7A 3UPBA 1LVLA 3H2OA 2CBJA 3SIZA 2KAUC 1TZ7A 3KL5A 2DDXA 2J9ZA 1AL8A 3RFAA 3GBDA 1TPDA 2Z2BA 1W1TA 1IEVA 4O15A 1P43A 3O0FA 2J7DA 3WD0A 2J47A 1WDWA 4XZ9A 2BGSA 4BEQA 1D9EA 1KQZA 3W1UA 4E2BA 1EP3A 1G4TA 3EOUA 3UGRA 3RMEA 4HKPA 1SFTA 4BI5A 2BCPA 1XIDA 1EJ7L 2WPCA 3UJFA 4LWWA 1ZJBA 1LL7A 3F4VA 3S5SA 1GOWA 5LA0A 3JUGA 3SUVA 4K8HA 3W6YA 3CB8A 4HZ7A 1S2TA 2OKOA 1VEMA 1N2VA 3UVIA 3WQ5A 1I1WA 3KLJA 4D6FA 4I7WA 6XIAA 1MW2A 1GEQA 4FNSA 4NT0A 1GVYA 1HKMA 1A0EA 3ARYA 3THDA 1GRFA 3G24A 3HPSA 5JXQA 4UZSA 3NVWB 4PMZA 4M81A 2ZRYA 1KFCA 3LRMA 4LU0A 3VNDA 2ACRA 2PWDA 3T4WA 1H51A 4LY8A 5J5DA 9XIMA 5EBAA 1RA0A 1GGOA 1JPHA 3U2ZA 1J6OA 4F9JA 2X0SA 3U5YA 2CLIA 3WEZA 2X05A 4WY0B 4C6LA 3A22A 3SI9A 1TYGA 1OCNA 4XTIA 2B7QA 1TE6A 2D22A 1SZRA 3COTA 1LBLA 2DJXA 3S2LA 1AOGA 3AS2A 1JD7A 4HNNA 3DZ1A 3GR8A 3EOSA 5CQ1A 3UG5A 4AYSA 1UD4A 3XISA 3N18A 2ZOXA 3GVGA 2UWFA 4JYFA 1CPUA 7TIMA 4OECA 1SQ7A 3K13A 1XIIA 3LZ5A 3U2CA 5E09A 5HDRA 4GXMA 2QEZA 2BHYA 5E6YA 2UV8G 5JRBA 4MF4A 1QAPA 2DZXA 4G7EA 3B06A 4IGSA 3B9OA 3HPAA 3TN5A 1IZCA 2WCSA 3VUSA 5CEWA 4JIHA 1U1HA 1WUFA 3CWOX 4D71A 2HTMA 2F7FA 2Y85A 4YWSA 1S7MA 1PKLA 2ZBTA 3AIBA 4OTKA 4EOUA 1JGIA 4P8XA 1MZRA 3EDFA 3WQVA 2FVKA 3OVRA 3FEMA 1FXQA 5J5RA 4LXFA 2V6AA 3NOEA 5I5RA 1ICPA 1S1PA 2INZA 3C8NA 1IWPA 4K1WA 1OFOA 1O66A 1QNQA 1BG9A 3BAKA 1FWRA 3NL6A 1JF5A 4JIEA 1VBGA 1QI4A 2EQ8A 4IL2A 5HAOA 3M43A 1DJZA 3CWNA 3E0FA 3PZOA 4ACYA 1UROA 1FBAA 2CLMA 1LWJA 3R1ZA 3V7PA 3ERPA 1D7YA 1FVPA 1RVKA 5HNTA 3MTWA 3CZGA 3HGRA 2PDFA 1UCWA 3CHCA 2PU0A 4RJEA 3BGGA 4UNIA 4GPNA 4KEZA 4UB9A 1KLYA 5GQBA 1VENA 2TMDA 5CBBA 2RABA 1OG6A 1DJNA 1NP0A 3W02A 3T44A 2E7FA 1LWHA 4JFSA 4J3TA 1EUNA 1HTIA 2LLEA 4P7NA 1EEXA 3IGXA 4JR5A 1AQFA 1LZOA 3AMZA 1MNSA 3V16A 4IXHA 1Y65A 3F4WA 1FWHC 3TW6A 4F66A 3MS8A 2DUAA 4F2TA 3TTEA 3P3BA 2C1IA 2WM1A 3GX9A 2NQ9A 3GDBA 3VOHA 4GVIA 4LANA 3PZ9A 1WZMA 2OZ0A 4HN8A 1K4HA 1SO6A 1ZP4A 4FIRA 3W38A 3WZ0E 3W7KA 3PZNA 1EZWA 1NFBA 2WAGA 5CZTA 2WVVB 4HMNA 3B05A 3L5LA 2ZWZA 5FMHA 3BLOA 3WD3A 4HIBA 2F84A 3N3TA 2NUXA 4AIBA 3MMWA 4QP0A 2OT1A 4FNTA 4U4MA 3QV9A 3LRLA 2JGQA 3G1XA 2V6OA 4Q7IA 3HW2A 5E0FA 3WF3A 2OQYA 4ZVJA 5HBFA 1TV4A 5I79A 3AM9A 3SCWA 1V93A 2VURA 3GRIA 4XUGA 3UXLA 3S5ZA 2EQ9A 1XGEA 4HPGA 2IPGA 3HTWA 1IGWA 3S1UA 1ZFJA 3SEPA 4FI4A 2XWDA 3MSDA 1NF0A 4GI4A 4Z0JA 2V5LA 1OFPA 1WXYA 4WJ8A 5LNVA 5E9AA 4ZQRA 1JFHA 4H2HA 3TJ4A 3GXTA 3O7UA 1Z7AA 2PP3A 3DFTA 1QRQA 3DCPA 4DNAA 1CW2A 4C60A 3W7IA 3IIPA 1W1YA 2YXOA 3L23A 1EXBA 3C0QA 1KBJA 1BXNA 3TH6A 2GUYA 4TR9A 4UQCA 2CXEA 3NQCA 3EB2A 3CNYA 1ELSA 4B9ZA 4XV0A 2HNEA 4JX4A 3NO3A 2HPIA 1GREA 2QDEA 4JKLA 1V7AA 4QJ5B 4DBEA 4IIEA 4QLLA 3SQSA 3BMXA 2VDGA 1OK4A 1VFTA 5BWFA 5BOFA 2OQHA 5LNWA 4LVAA 1T41A 2Q3RA 4CQ9A 3WEOA 2QF7A 3GH4A 1GQJA 4BS0A 1VBJA 1S38A 1PDZA 1YADA 1RY0A 4KGJA 3LBMA 2DSZA 1YXYA 3P84A 4W8BA 3T2QA 1TV8A 1GQIA 5C9UA 3HO8A 3ICJA 2HS8A 1R8LA 1UD8A 2PTXA 2B81A 2BB0A 4A6GA 1XP3A 1J12A 2G0WA 4GX9A 2WANA 3M16A 1JNDA 3A23A 4IUGA 1A0DA 5D8ZA 4OT7A 4H6EA 2ZRXA 1I8JA 3WLRA 2WOQA 4EX4A 3NSXA 3R8GA 3IAPA 3NQ8A 4M29A 2NZLA 2WVTA 1E6ZA 3ZJ8A 2R94A 3M0JA 1XRVA 3ARTA 4Y9AA 4MZ1A 3BCJA 2Z7KA 5G2IA 1BXBA 3M0YA 2GR0A 3IJQA 3WF2A 3I65A 4L65A 3W7OA 1A5SA 3W27A 4O13A 3ARRA 1UASA 5HMFA 3R0DA 5I03A 1EB3A 4XBSA 1JDDA 1KN0A 1ITQA 2GQ8A 4MWAC 5HR6A 1RLCL 4DJDA 1Q6DA 3SO7A 1IIGA 4ZFCA 3P81A 1OCQA 1XBVA 1T5AA 2H9AB 1XBXA 3VNYA 4US5A 3PBUA 3W1QA 1H7WA 4WXZA 3UERA 3BJFA 2FZBA 5CPNA 1MQRA 2PS2A 5C6MA 4IM4A 4HHPA 5HK4A 5DBTA 1EJVC 3EDKA 4HTYA 4W7UA 4C1NB 1RCOB 5FF4A 3W85A 4M5PA 1HT6A 3C2FA 3UJEA 2V63A 3N6QA 2XFYA 1Q7QA 4ZCWA 1D3HA 1GVEA 4DYKA 5FEWA 1MOKA 3NFUA 3G6LA 3RM4A 2NVKX 2J75A 3QM3A 1D2KA 1V3IA 3K8MA 4C6BA 1AH3A 1TA3B 4LX4A 3H26A 2VUNA 3LHYA 4Q8PA 3L4VA 4N9EA 1OB0A 4MFEA 3CQKA 1CX9A 4P7OA 1I9CB 3OZMA 1LPFA 5A95A 1KW1A 3IVTA 3GLCA 1GV4A 4FB7A 3C2OA 4LW7A 1QJWA 1ZLPA 2PBOA 1ZENA 2ZVRA 3QR3A 3H2EA 3GG0A 5BOOA 1S2AA 1H49A 3EMCA 2F2HA 2VJXA 5BU6A 3TOYA 3E02A 4QCEA 2ZZ5A 1NDAA 1VEPA 3FAWA 2W0HA 1I45A 4HQVA 2NQHA 4CQ8A 3M7SA 5G4EA 3C2EA 2RUSA 5GNZA 3BAWA 2E9LA 3B03A 2GVLA 4N6EA 1Y5VA 5KETA 1F3TA 3A5VA 4IMDA 4Y9PA 3TN4A 3JVAA 1W31A 2ZA2A 1Z48A 2YZRA 4H8NA 5LIYX 4N0RA 1R47A 3WF0A 4AD4A 1JIBA 1JCTA 3EA3A 3AIQA 5MKGB 3W6MA 1MW1A 1A47A 3RN6A 3H2CA 3W1RA 4XAGA 3LNPA 3CBWA 1LP6A 4KS0A 4Y7EA 1TJRA 5D04C 1M7JA 3MZ2A 1K9EA 3GSMA 5BYWA 3PVFA 1QR7A 4QDMA 4YYCA 2ASHA 5A6BD 5CSSA 3M6DA 4ADUA 2OVLA 3NNTA 3GTIA 2X50A 1FHUA 5CGQA 3W9ZA 1FHDA 1XLKA 5CLWA 1XSJA 1H7OA 4ZO6A 1OD8A 1GG1A 3GK0A 3R13A 3SY1A 4EPKA 4HZ8A 3IWPA 5CJ5A 5LIKX 1JZ8A 5M2FX 5PTDA 1R0MA 3H7VA 1X1ZA 2NQ5A 2R91A 4ADWA 2HSAA 5ECUA 3PANA 4RZ5A 3TQVA 2VC9A 1V03A 1SSGA 2W79A 1Y5WA 2XINA 2CPUA 3T0TA 4GIRA 4HB7A 3BSHA 1N5WC 1UZHA 4GYPA 2XG9A 5IDIA 2DW7A 1PKNA 1AMKA 3CT7A 1E0TA 5EBKA 3DFHA 2PCEA 1LUCA 3Q37A 1FWNA 4MLJA 3RM8A 1KBLA 1PEZA 2GOUA 4UCFA 4XTDA 1RJPA 3DFOA 3ZXWA 2RGLA 3B8UA 3FAXA 3QN3A 3LUTA 1U5HA 1L0PA 1W2PA 4OBSA 5FS6A 2BVTA 3P14A 5FACA 1JZ5A 2JFEX 1OY0A 3QQWA 1UH2A 4RE2A 1KM5A 4CUCA 1C90A 3N25A 4WY0A 4AG0A 4DAIA 4ZE5A 1E6RA 4FSAA 5G1YA 4MY1A 2G5WA 3THQA 3GYCA 1VKFA 3S5YA 4PL1A 2NW0A 5T91A 4UTTA 2JALA 2X0YA 2X42A 1CEOA 4O4WA 5JBFA 3QQ0A 4WGXA 3R0UA 3F5LA 3GC5A 1PVNA 1SU5A 1XISA 2J7FA 2QUMA 4KRZA 4HK7A 1K03A 4YIWA 2GJXB 3LCGA 3GXIA 3VDHA 1QNSA 2XU2A 2WZEA 3LV5A 1JAEA 3BZGA 3QH2A 3UGVA 1JCNA 3Q67A 1IZJA 1PS9A 2ISSA 3VGDA 4JQ1A 2ZX5A 2WSQA 1W2VA 3KWXA 1DE6A 4IXXA 1L6YA 1UUOA 3CGEA 4P5UA 4LBSA 2WCAA 3JZEA 3P82A 4NZCA 4C91A 4I3GA 5JCNA 5I78A 3CL7A 2NV1A 1CLXA 3DYMA 2DQWA 3HQPA 4GR1A 2W27A 2WKLA 3V0UA 1NFGA 3QMSA 1WDPA 1ZBCA 1SMDA 3G8RA 3QY8A 1B4EA 1VD6A 4QJ3B 3KRZA 2ZXAA 2C1HA 4JX6A 1HVXA 3GDLA 2FFCA 5EPDA 3GNPA 1TV2A 3CHFA 2VR2A 4OOZA 1Y0EA 3TC3A 1LDCA 1MUWA 1E51A 2NQLA 4Q4KA 4HOXA 1HO4A 1HXJA 3F4NA 4HCLA 4ZR8A 2E9MA 2YQUA 5IM51 1TTPA 2D0HA 4HA0A 2DP3A 4NJHA 4UQ9A 5K9CA 3WLOA 1P1XA 3ALFA 4CD4A 3VIIA 3IEBA 3FGCA 4AZBA 4S3FA 1H7RA 1NQKA 3W7NA 1ZAJA 3PBWA 1TQJA 3OQ8A 3EMQA 4BF9A 4DO7A 3P93A 2BWGA 3IS4A 3I4KA 3ZR5A 1H60A 2FB2A 1J79A 1OFEA 3QXBA 1VC4A 4F3HA 3UCQA 3EX3A 4ZB0A 4YMZA 2VGFA 2WZTA 1TTJA 3AWNA 2PDKA 3THUA 3KS5A 1UKSA 3FCPA 2B4GA 2QPSA 1D7FA 3EEZA 1W9BM 1K1DA 4XBKA 4NF7A 1QI3A 3BG5A 4AEFA 1PYFA 1SUXA 1DE5A 4HOWA 1BWKA 3EXTA 3LD5A 5CC6A 5DQPA 3TN6A 5AYZA 1IR1A 4ATDA 1ADOA 1OFQA 3LCFA 1DORA 4C5ZA 1W1IE 1ONRA 3PBVA 2EJ1A 4REQB 3W2KA 4JY8A 1EBGA 3AUJA 3KRUA 2QW5A 4QJ4B 2VR4A 3L4YA 1VPYA 4QEEA 3W7HA 4YTQA 4LB3A 2YBVA 3UESA 4CD5A 1J0KA 2VUYA 4UOQA 3FDGA 4PMOA 3NSNA 5ABGA 3ZM8A 5TBOA 4O1EA 1FA2A 4DJFC 3DHUA 1VPQA 4DPPA 4F4RA 5BNKA 3GU2A 2YAUA 1LWIA 4UCGA 4XO7A 1POJA 2V3GA 2XVLA 1SJCA 4IIFA 3W7LA 5AY7A 4C90A 1O1HA 1JPIA 1JQXA 2WM0A 1DV7A 4C6PA 1ALDA 2A4AA 2QUVA 4URIA 3MC5A 1R86A 5BCAA 7REQA 1ZPTA 1QVBA 5HPOA 3ITOA 4PRWA 4H01A 4XK2A 2PFHA 1QO5A 3KCOA 3N14A 3ARZA 1QPKA 1ZGDA 2FHCA 5HMEA 3U5UA 2JEPA 2OX1A 3TFCA 3G2GA 3CEPA 1QO2A 4QG6A 1Q6FA 3RM9A 5ABTA 5A6AA 2YKKA 4W4QA 1LRTA 4AHOA 4KFOA 3WLHA 1EQPA 1BVZA 5IFTA 3BLDA 3RILA 2ZXQA 4LEFA 2V30A 2HXTA 3E96A 3EX6A 3WQ6A 3SR6B 1VB9A 1R2SA 3CH9A 2OGYA 1A80A 1EGZA 1PKMA 4PL2A 2ZX9A 3W37A 1TKKA 2ABBA 2YFNA 4KWOA 3WLNA 4CQAA 4JQ4A 3BE7A 2P5NA 2XH0A 5H91A 5JQ9A 2WMJA 2HE8A 1NHQA 5KINA 4L1XA 1ITUA 1Q7MA 5FJJA 3RYSA 1B9BA 5F2LA 1F5ZA 3H54A 3C3NA 1P48A 3SGZA 4K2SA 4LAKA 1B57A 2JKAA 4Y8FA 3G3MA 1RQBA 1QPOA 3DK9A 4IFKB 4KKXA 1BF2A 1UZDA 3QHNA 2VDIA 4WKFA 1KRAC 2X1TA 3VA8A 2R8WA 3UR7A 1CGWA 2ZC8A 4Q32A 4Q3MA 2P3ZA 1D8CA 1PO9A 2BX7A 4MSSA 4QISA 3AHYA 1MYRA 4J5NA 2ZX8A 2EPKX 3ZZ1A 4HHMA 1NPXA 4JOMA 4JTGA 3BQ6A 2CBIA 3EDDA 3RO8A 3WH6A 3UR5A 1OEPA 2I17A 3TC6A 3U2EA 1GT8A 3WNMA 4HYRA 1SZEA 3IJIA 4JNMA 2PGFA 4G1KA 1N60C 4PUKA 1V08A 3MQTA 3TVAA 4AH7A 2GDVA 1HN1A 2J62A 3R94A 1EO7A 1EP2A 3ZJ7A 5LZLA 5C2GA 2PDPA 1RJQA 3GXPA 3VCNA 3NDYA 1LLOA 4O28A 2QXWA 1T0OA 4UFHA 4ASTA 2W55A 1K77A 3AO0A 4LYQA 4GGHA 3E0IA 2W4XA 2PB1A 4EIVA 5IOBA 3T40A 2NT0A 3M64A 2X99A 1H4PA 3W28A 3F4DA 2VR5A 1S5VA 3OQEA 3UZZA 1FHVA 5AYYA 4C6JA 1WOBA 3AZTA 1KCZA 4OBTA 2ZIDA 2VENA 3LPPA 3K5XA 3WUFA 9RUBA 3PTMA 3G0XA 3L66A 2XSXA 4LC8A 1XYLA 3B9JB 2VFIA 1E5NA 5IRPA 3R89A 3T9PA 4GA8A 1KV5A 1FTXA 1FKXA 2XGZA 2GL5A 1ZSXA 3LRKA 3LPFA 3HPXA 1E3ZA 1JPDX 3VE9A 1TWZA 1OZQA 3W75A 1EIBA 2F8QA 1GQKA 4CVUA 3H4XA 4CKQA 4RDYA 4PMJA 4EP8C 4H4VA 1UKQA 3QZ6A 4H9YA 2NXGA 2VWSA 4AZ7A 1GW9A 2PBGA 1RCQA 2GUUA 1PCKA 3UR8A 4DWDA 2WJEA 2Z1SA 3TE9A 2DZBA 3OZYA 1C9DA 3IIZA 3RXZA 2Q8ZA 1UKPA 2PDMA 5BMXA 4GLEA 1ME7A 1RY8A 4JTDA 3WJYA 2BC0A 1XDLA 4S3BA 3VIGA 2CZDA 2VD9A 3S0CA 3CGCA 2WSKA 1H0IA 3TWBA 4KERA 1O95A 1KFWA 3QZEA 4LCRA 2VFDA 3N04A 1HNYA 2O92A 3KBWA 5DELA 4GC4A 4HSOA 4Z2IA 3H70A 5KMYA 1T8XA 1YTEA 1JRPA 4Z1YA 3W1AA 3DFQA 3E2RA 2QULA 3T55A 2V3FA 5GJNA 1VQZA 4LUJA 5CJMA 1FFVC 3J7HA 3EXRA 2J25A 5C7VA 5K9XA 3H2MA 1BRLB 3T08A 4QLJA 4LF2A 5AHMA 1OZMA 2X30A 3VKBA 2PPGA 4GYPC 2VZUA 3AOFA 1OGBA 1L6FA 2SFPA 2ZUMA 3IJ9A 3I10A 4LUSB 3R10A 1RAKA 1ZL1A 3PZVA 2EQDA 1ECQA 2WMIA 1YDNA 5FJTA 1UD2A 4PZVA 3V5FA 1V3MA 4RE4A 4R33A 4CCEA 4H8HA 1US2A 3PBYA 4FX6M 3DXIA 1V59A 3NQ7A 2V3BA 4TVUA 1TWWA 3GG1A 1W3HA 2E8YA 3TX9A 3W76A 2BY3A 3BLKA 2GZXA 3KTSA 1MXGA 3THCA 1HKWA 1A3XA 1R85A 3TSMA 1GZGA 4Z1AA 3AXIA 3KLKA 2FH8A 3B0VC 2QYGA 1LT7A 3GVRA 3KRBA 1DIDA 2H3BA 4UTTC 4O0QA 3GAKA 3QPZA 2GGIA 3M0LA 1RK6A 2Z1BA 3PAOA 4KETA 4I5RA 4GVFA 3SCPA 2Y7FA 3M5VA 1HFBA 2FQIA 1HO1A 4I5XA 4AX6A 1JXKA 1CXEA 3N4AA 5E70A 6XIMA 4DIAA 5AYXA 3ARSA 5A2BA 1G01A 3FNDA 4GVHA 3EEGA 2J3NA 4DJED 4JL1A 3C6CA 2OR2A 4PH6A 1UWUA 4JTQA 2E5BA 1FO4A 2PTDA 2QJIA 1O94A 1XDMA 4E4PA 1XW8A 3S1XA 4QTGA 3QW4B 2G97A 4EM4A 1RALA 3QEZA 4IUOA 1A0CA 4H3DA 2FPTA 4AZCA 2A79A 2HQMA 4NJKA 3LCWA 1MEIA 2DW6A 2GQ3A 3UR2A 4JN6A 3IJLA 2QMJA 3E2VA 2E3TA 5ABHA 1NHRA 1GW1A 4LBRA 2QJJA 2CLEA 2WSRA 1YLVA 1WKYA 3C0JA 1FWJC 4P8UA 4AD0A 4XKYB 3LZ3A 3P7YA 3XINA 3DUGA 3VFLA 4DBWA 1RPXA 1QU4A 1TV7A 3LHZA 4ZXLA 3VOFA 1WDSA 1NHPA 1MO0A 4FNPA 3SRKA 2OPJA 1KQYA 3BARA 3DAQA 1NTHA 3IIVA 1GOKA 4FLSA 3OC4A 1ZALA 1YW1A 1FRBA 1NOWA 1M6IA 2E5CA 4DY1A 2XFWA 3CZKA 1UWRA 2E1DA 4DRSA 3DX5A 4I9AA 3VKDA 2J7HA 1PAMA 3APYA 2GQ9A 2A6LA 2QCHA 4GOAA 3MCNA 4ICMA 4ES4A 4GH1A 2YL6A 3POHA 2BFGA 1KTCA 2JF7A 4CCDA 3CTLA 1EOKA 3MHGA 2VVSA 2BXZA 4IP4A 3NQEA 5FCZA 3W2NA 3TONA 3WG6A 3WDIA 1L8PA 1ZRQA 4LEQA 4NNBA 1P6WA 4UTMA 3NQFA 1VCFA 2IKIA 2EPNA 1SPQA 3TYZA 3B97A 3VC5A 3SUWA 3EB3A 2CFYA 3TQKA 2Q3OA 3GUWA 5CJNA 4W87A 4C6NA 1X1OA 2VQTA 4ERGA 3T2PA 4UTLA 1MSSA 4XKMA 4WDWA 2ICSA 1RA5A 1GKRA 3CMFA 3SURA 5D2TA 1MEHA 4BFAA 1YQ2A 1VBRA 3DDMA 1YPXA 4KWVA 3ZVHB 4J3SA 3MVIA 3DH7A 4DLFA 2PDGA 3HF3A 1KB3A 5AOUA 3TAKA 2VWTA 4RV3A 2WHJA 3S9YA 2WBAA 2MNRA 3RNMA 4O54A 4Q4MA 1OF6A 3LM7A 1SO4A 4GIYA 1OSEA 2AAQA 2WXDM 3FDKA 3CV7A 1F8IA 4IPPA 3CEUA 3FJNA 1JZ6A 1PIIA 2YDRA 5EU9A 2HNHA 1OYCA 3H55A 3D3AA 2GVGA 4FZIA 5IHSA 3WN6A 2E6DA 2C0HA 3WJSA 2PDBA 4V15A 4ZOAA 4GQRA 1TPC1 5CSUA 2ZZ2A 3BH4A 3IACA 2J7CA 3UPMA 3WUGA 4LY4A 3MO4A 3V0SA 5TIMA 3UZ5A 1HVQA 2FIQA 3MHUA 1U22A 1TZZA 1P1MA 2ZZ4A 2J8TA 3IRSA 1A5OC 1K4GA 3EKLA 3S2CA 3NIYA 5A6LA 4G56A 4QSFA 9XIAA 2J4GA 4IMGA 4JIPA 2YW3A 2RDXA 1FCUA 4ZQNA 1EUAA 3VNIA 2TRSA 1FP9A 4N6FA 4EK7A 4F0LA 2IW0A 3AHXA 4P7QA 1MXSA 3PY2A 4TMBA 2I14A 4J3WA 2CHNA 3ZSTA 1R9ZA 3ZT7A 3TFXA 1E4NA 2E40A 4G6CA 3TYEA 1IIHA 2BVYA 4B5XA 1EJRC 2E6AA 1KFBA 3N4FA 2E5AA 3SFWA 4XVDA 3CV1A 3OB8A 3QGKC 4PBEA 3A5FA 3QC0A 1I0BA 3V5CA 4NKCA 3Q4DA 1K7XA 1FIQB 3HN3A 5AYBA 2V8ZA 5BRBA 3VOIA 3BCFA 3BZJA 1VS1A 2I9UA 2DUXA 3TP4A 3BLFA 1G7UA 3WDHA 3H21A 5LXEA 3PWGA 1NY1A 3GIQA 3H7UA 2PGEA 2FHFA 1OFBA 3UU0A 2OU4A 1XKYA 4CCZA 3ZLFA 3DYPA 4E2DA 2BY2A 1DHPA 3M0ZA 1ZTVA 4AWUA 6TAAA 1O5XA 2XIMA 3HMJG 2FDSA 1O60A 4DBSA 5FF3A 1XLBA 4S2CA 3AHZA 4K38A 1EQCA 5B7ZA 3NZPA 4AIOA 3S1GA 3MWAA 1SJAA 1ZJAA 1JEZA 2QAEA 3A21A 4HU3A 4P8VA 4AXKA 3LDVA 3S42A 4JDBA 3MW7A 3SN1A 4GUGA 3ORWA 1RR2A 1W5PA 5JVLA 4K8GA 2A8XA 5CBIA 4U5KA 1J0JA 3NQBA 4GQQA 1REQA 4DPQA 4C7DA 4PUNA 1WKFA 2PTWA 4ZMGA 1E1CB 1K7FA 4R27A 4H8UA 4MVAA 3PB2A 2VZOA 3N1AA 3VC6A 3B0PA 1XLLA 4Q8VA 1J10A 3LBCA 1UA7A 4NVTA 2QPXA 4M51A 2D2OA 3NVYB 1HKVA 5CPTA 4AB4A 4JBRA 3CIWA 1H1ZA 3V18A 4HMEA 3STFA 3E12A 3W7EA 2IKJA 2A7NA 2GWNA 4IG2A 2HEJA 1V02A 3AMGA 4PGLA 1KFEA 3IV3A 4GY0A 3GXDA 3MKVA 3DFSA 1GPFA 1HL9A 1CT5A 5BWAA 1GORA 4JTCA 3S9IA 2I57A 1WNOA 1R38A 2YL9A 1XANA 1E4IA 1TV3A 2PTZA 4M52A 3VIFA 1KBKA 1JDCA 3PZGA 4L4PA 3DOPA 1JNEA 1HZYA 3GDRA 1OC7A 2XN0A 5GNXA 3SCVA 1UH3A 1VFSA 3S2NA 4DXVA 4HMCA 2XZ7A 2BY1A 4N7QA 3L4UA 1KGXA 5HQEA 2EG8A 3CJPA 3GC4A 4GK8A 4EF8A 2DZSA 2JE8A 4GFSA 1RBLA 3SCUA 1XFCA 4HNOA 5EKYA 3UJSA 3HBLA 2UY5A 3KOWA 3MHFA 1EF3A 2OSWA 4K37A 4RPQA 5EY5A 3U6WA 2UBPC 4EAMA 1QASA 3APGA 4DZAA 1E6QM 2GFTA 2C19A 2OOGA 5AC8A 2Y7EA 1HL8A 3ME3A 4OBRA 3A64A 1QNOA 2XH7A 3D47A 4MPKA 1R30A 3WJZA 1ESWA 4YS1A 1YYAA 1U30A 2Z2UA 1XIGA 3N11A 5AHFA 3IUDA 3K8LA 3AU2A 2OT0A 1CYGA 2FLIA 1L8NA 4IJRA 2CZ5A 3B0XA 1YBQB 2JKPA 3PJTA 1V6UA 3KL3A 4N9DA 2WWCA 3ARPA 3VKJA 3LHTA 4MTVA 2PDQA 5FJRA 3W84A 1P7TB 1M7PA 5C2CA 1GYLA 3L4XA 5K4ZA 2PP1A 2EKGA 4OE7A 2IKGA 3QC3A 1YNQA 1FY6A 3UQNA 4LYPA 4RDVA 3GY1A 4Y6GA 1EZ2A 5D09A 2X1SA 3G77A 1GRAA 3W83A 1JAKA 4AIUA 5FL1A 4GFIA 4Y96A 1A53A 3DENA 4IPIA 2P8BA 2VGBA 4K3ZA 3GH7A 4WSKA 2PDIA 2VFEA 3S5OA 1K8YA 1QW9A 3VMPA 2JEQA 2ZADA 4ENLA 2FTPA 1Y8BA 1D3GA 4DI8A 1W3KA 4QG8A 3I3BA 2WPEA 1K7EA 3V36A 3WD1A 1X7IA 2CLKA 2F38A 3R2GA 1U2YA 1QK2A 1Q8AA 3ID7A 3MSRA 2X40A 1JZ2A 1UIPA 5CG0A 4NZ5A 3WQFA 2WV8A 2NVCA 5LNSA 1GRHA 2D2GA 4MWAD 1IYXA 2VEKA 5HMSA 3DH9A 3VI2A 2E25A 4MWAB 5CZSA 4GJIA 5GNYA 4MG4A 1H5VA 1UWIA 3VIOA 2ZZ1A 4ZB5A 2HRWA 3O16A 1QWGA 3A3HA 3KVKA 5KTLA 3POCA 3SJ3A 1SJDA 4GZ7A 3TW9A 3STCA 4IP5A 3L0GA 4FHAA 3DGHA 3A7RA 1IR2A 4CD7A 1GQLA 3I4EA 1EHNA 2ISFA 4WF7A 4YL2A 4PBGA 4XB3A 1X1NA 3OBKA 3R58A 3UW6A 3B0UX 2J8GA 1J4EA 2W3ZA 1MVYA 1YPIA 1M1BA 3EUB3 3QVQA 4V33A 2EAWA 5HMDA 1W3LA 4I90A 4TV5A 1T40A 4W5ZA 2F61A 3LLXA 1YX1A 2XZ9A 4RXGA 4IIHA 5A6TC 3AS3A 1IXOA 1OCBA 2FPYA 3QHMA 2QGHA 1V6XA 1WA3A 3T7VA 2Z7GA 4QSHA 3BANA 2QGYA 1CLKA 2PGWA 3OO2A 5HWNA 1YIXA 3FVMA 3Q45A 4IHCA 4HNTA 3BTNA 1OT2A 3VIPA 4WOZA 1CI1A 4Q6XA 3P6LA 1WBJA 3P5ZA 3V4BA 5KZ6A 1E6XM 4XBJA 1KR0A 1V0LA 3II1A 5AHIA 4A3RA 4UMCA 1Q6OA 1DXFA 4J27A 4ROPA 4DF2A 2C79A 2B31A 5FSEC 3W1XA 3C61A 5D9OA 1US0A 1UOZA 3G1SA 4M0XA 1IGSA 4ZBCA 1GEHA 1PJ9A 2EPMX 1L9WA 3Q65A 3N17A 5AC7A 3GFZA 3AXMA 1Q6RA 4XZBA 3GB6A 1NF7A 3BLEA 3T42A 4K7YA 3LOTA 1XV8A 3ITVA 3EPMA 1HIZA 2WOVA 3BLLA 2YVFA 3P74A 1R6WA 4Q4SA 2PWFA 2D2HA 4XZMX 3GYEA 1DWJM 3GFYA 2MANA 1X7FA 4H7VA 3CH0A 3PNZA 2OZ8A 4WIWA 3C2YA 1VQTA 4W84A 5C0QA 3M0HA 1KKOA 3M9YA 3PNUA 4HNUA 4O4VA 1P4CA 4DWSA 7ENLA 4IJCA 4HCHA 6TIMA 5G4HC 3H12A 2DPEA 2DIJA 1TIWA 3VMOA 1KFLA 4LQ1A 5LNUA 1BAGA 3O8AA 1LLWA 4F0MA 2QCCA 5BRQA 4A8LA 3WIJA 1QT1A 2QCLA 3RRXA 4E4FA 3HGJA 4GD0A 3SFKA 5DMNA 4C1LA 5CLTA 2D23A 2VGGA 2ZTJA 2R9RA 3OGVA 3CQ0A 1CB7B 4OGZA 1KXHA 3LCLA 2B0MA 3GG8A 4JYDA 2BVWA 3S6TA 4LIIA 4H00A 1C8VA 4N42A 5CC3A 3KZSA 4DYEA 3U3HA 5I02A 3LPOA 5LIXX 4LGXA 3MMUA 2NWRA 4LUTA 4UNKA 1KWGA 2GUBA 2G3NA 4KCVA 3B04A 4HHHA 3IARA 4RPPA 1XYZA 4PR4A 4QS5A 5TD4A 1XBZA 3FYOA 4A3YA 1LL6A 1OK6A 1ONXA 3SAZA 1RD5A 3BICA 2WSPA 3W87A 2O56A 4IIDA 1O5QA 1E9LA 3HV9A 1JROA 1SYTA 2XFRA 4QGCA 2I5IA 4NXKA 1R3QA 3SUTA 3SCSA 2VMFA 1ZBWA 4EKJA 2QR6A 3LNMA 5JBEA 3APTA 3ES8A 3GHSA 1WYIA 3FS2A 4OWGA 3L4ZA 2VCBA 2PDWA 3URAA 4MUZA 1G4SA 2VL4A 5HQMA 1B3ZA 4G7EB 4KEUA 1MMFA 1LT8A 1XR2A 2VYOA 3LERA 2GJLA 4R9OA 1F76A 4HK5A 3W71A 3AZRA 1KFJA 1XS2A 1FUYA 1CGYA 3TJIA 3N9RA 5LNRA 4PRTA 3B8DA 5D2WA 3BK0A 3GWQA 2HBVA 4IP7A 1AH0A 4H6KA 2QJMA 4HYVA 4L4MA 5TF0A 1W9VA 3OBEA 1LROA 3MJMA 5JCLA 1DJGA 2YCJA 2G96A 4JCLA 3EX1A 3V0TA 4E4UA 2GJRA 3H7RA 3TSDA 3UNTA 4NNAA 1H3GA 3TN3A 1WAWA 4JIQA 5AKQA 3TXZA 3STGA 2A85A 4L1GA 1N62C 2P76A 3PZQA 4GO8A 1XLFA 4RNJA 3TZFA 3EMZA 5G1TA 2C8NA 2DVTA 2POTA 4ZEPA 2WNQA 3GW0A 4CQBA 3NGJA 3OVPA 1H1NA 6REQA 3AYTA 4APNA 2CWXA 4GUIA 4UNLA 2BY0A 1HP5A 1B3VA 1H2IA 3VDBA 4CNSA 3E0LA 5KVHA 2VP8A 4RZ6A 3PG8A 4LAMA 4DUXA 3GD4A 4DO6A 4X9SA 3FA5A 3URHA 1W1VA 3E3HA 2YLLA 2PTYA 4Q8UA 3CIVA 4IQJA 3VNMA 1RM6B 3T8LA 1C93A 1SMAA 4H9XA 4NEWA 3W7MA 1C91A 3MP3A 1JDEA 4C6DA 3OLDA 4WCJA 3N2TA 1RSCA 3W1LA 3SY8A 5C71A 4C6CA 1K02A 5C9XA 3B9NA 5I2UA 2VHLA 4AWTA 4MUPA 3UP8A 5RUBA 3O63A 2VRQA 3RIKA 2V5CA 2NLIA 3BSGA 1MNZA 2XFFA 5U25A 3VXGA 3D6NA 5M5DA 3TTOA 4EMIA 1W3NA 1L2QA 2QNEA 5I3HA 3CGTA 1XYMA 4AFYA 1GOMA 4M24A 2O7QA 3PZIA 1C7SA 1F6YA 1ZAIA 1V3HA 1AD1A 1NU5A 4B5WA 1M53A 4JHZA 1LBMA 3CO8A 1EX5A 1W56A 4B2DA 5BRPA 3WDJA 3F7JA 3MJYA 4EWND 2J7GA 4WDTA 2V68A 1TTIA 2NPXA 5EL1A 1EPXA 2JF6A 1N82A 4OV9A 4AXNA 2Z24A 2WNZA 3ABOA 2ZZ6A 3G6MA 3ZFHA 3ZSSA 3YPIA 3BXWA 2G3JA 1V77A 4JAWA 4O19A 3C0SA 3NVTA 3DN5A 3EZ4A 4O18A 2BNJA 3S8HA 3IGSA 1X8CA 1KFKA 2PAJA 3B8VA 1JXJA 3FIGA 3VOJA 3AJ7A 3CUHA 2PDYA 1FH9A 3PM6A 3LLDA 2D2JA 4Q8NA 2ZZCA 1TMLA 1SVDA 3ABXA 1GVSA 3PAJA 2ZZ3A 5L9FA 4GIAA 3UD6A 1PXGA 4WOQA 4O53A 5EB8A 1CCWB 4H4SA 4DM1A 2WMFA 1NWTA 4A2SA 5KSWA 1W54A 3LTYA 2YFOA 4H19A 5A6KA 3IJ6A 5ER0A 4ZODA 5K9DA 2OLAA 5A8OA 4NJIA 3SBFA 4JHOA 4KW2A 4UTIA 3H8AA 1WBHA 2RGMA 1GVQA 1LOLA 4IF2A 1BWCA 1XCWA 1DWGM 4S2BA 3INPA 2C91A 2QVHA 1ICQA 3HURA 1TPVA 1B9ZA 2VZTA 2A7PA 3EX2A 3VNZA 3HIJA 3AISA 4MOZA 2QDHA 3ZQ9A 2OQLA 2VRKA 3CUZA 1Z41A 2CIPA 3E6EA 2GH5A 5DX7A 3LB0A 4QG9A 1AW1A 3N29A 3W81A 1WKDA 1PHWA 2CHRA 5K4XA 1XFBA 4JKKA 1H2JA 2VO5A 4XD5A 1AZ2A 3T6CA 3WQEA 3QY6A 4TXEA 1OFRA 3W29A 3W7RA 1GK8A 1EHAA 4L9ZA 1W5QA 1DQXA 1YE6A 4RE3A 3GHTA 1FKWA 3AU6A 3SZ8A 1RD6A 3H53A 3VM5A 4DYJA 3LXBA 2RJHA 3VD3A 1GRGA 3W88A 3RK8A 4AZ6A 2V2DA 4CNUA 3KZPA 3OVGA 4QAWA 3LHUA 1JCMP 1PBGA 4DJDD 5CH9A 1JGMA 1X2GA 1W9XA 4U10A 3AS1A 2FZMA 1VYSX 4US5D 2IXUA 3ABQA 3UG8A 3RPDA 3BOLA 2NSOA 2Z6IA 4XZWA 2HE5A 3OLEA 3VDCA 2ZUNA 2W92A 4H4IA 4DUVA 4XAZA 3RCYA 3USBA 1Z3NA 1B90A 4TO8A 2CESA 4C5YA 1DL3A 1FP8A 2Y63A 4L6DA 2QCDA 3MMDA 2WKGA 4FLQA 3C5QA 3GTNA 3TKFA 1US3A 2D20A 2XIQA 4W89A 5LHFA 3UEQA 4F9DA 3VD7A 1PCWA 4V28A 1DJHA 1DHKA 1O4UA 4GUJA 3VOGA 1NDWA 3TNOA 3TQPA 1KM2A 1NAL1 2D73A 2ISDA 3WH9A 2V82A 5FF0A 2POZA 1UB3A 4LVBA 2CEQA 2HS6A 2D0GA 4K7VA 2CBVA 1TMHA 2Z1KA 4JDYA 2RJGA 1G69A 3AJXA 3I7SA 3QPEA 4PUWA 3WY1A 1F6PA 4PTDA 2P1FA 2YXXA 3UWQA 1A4MA 3NVZB 3B8TA 1Y7VA 3A4JA 1GZJA 2OWXA 4MAVA 1BFNA 2PZNA 3OVQA 5T26A 4F0HA 2G37A 3E0WA 4NYYA 5E1QA 3TCEA 2YBUA 4PTMA 2GK1A 3VMNA 1FCVA 5FAJA 4H9UA 4AY8A 2R1MA 2Q09A 4JPGA 1MQQA 5A8QA 3GFXA 1UR4A 4S23A 3CYJA 4AD1A 3F2CA 2TPRA 5A5WA 1CGVA 2E5DA 3BOXA 2DVUA 2IS7A 4X22A 1VBHA 1YDOA 4QRNA 1ENUA 4MDPA 2ISWA 3W70A 4AU0A 2PLCA 4MB5A 4LSBA 4JKMA 3VK5A 1VCVA 2DZPA 2ZRUA 4LNCA 3N9SA 2OJPA 2QHAA 1DQWA 3NQDA 3QKEA 1O7AA 1YDYA 2QCNA 3U57A 5I7GA 3P62A 1PSCA 3BW4A 3CZJA 1B30A 2R1KA 3O15A 4Q7NA 3WK3A 3WLQA 1FWWA 4UMAA 3IK2A 3NEVA 4C6MA 3HG3A 3KCJA 2AQVA 4PMYA 3NCOA 1G4EA 3KS6A 3QFBA 2CHOA 3OEXA 4YVXA 2GPTA 3EKZA 1JYXA 4NNCA 1JZ3A 2OWCA 1V5XA 2OGJA 1X39A 4AF0A 2ESCA 5HUPA 4W5UA 3MUXA 1AG1O 1DYSA 2W6RA 1BTMA 2AKZA 1M7XA 3W1NA 1R3SA 1XH0A 2ZUTA 3GVQA 2J7EA 1IEQA 3L68A 3N12A 4UR9A 3TC7A 5GRTA 2QUNA 5DCDA 2VKZG 4NHVA 4UQBA 1S46A 4LT9A 1W3JA 1E43A 1Z42A 1W32A 1F74A 1KWKA 3E2SA 5I77A 1KGWA 2XN2A 3QR0A 2P0OA 4KMQA 1V79A 5TNVA 4NRRA 1IXNA 5E93A 3GD6A 1GRTA 2EPOA 2GDUA 4UZUA 1XRFA 1LUCB 4PCSA 2TYSA 1PB0A 5EYWA 1Z32X 2X16A 4CVWA 4AMCA 1C92A 2ZZ0A 3UG4A 1PDYA 4MZYA 4UFMA 3DESA 3W22A 2JGYA 1QHZA 4I8DA 1SO3A 4LB4A 1AA1B 3UWWA 1W9PA 3QW3A 3U0HA 2YVJA 1UWQA 3QRHA 3U48A 2PZ0A 3FN9A 4ERAA 5EMLA 1EYEA 1Q4WA 2GSJA 4CNOA 5CC7A 1C7TA 2W91A 3MBDA 4D6EA 3SJNA 3IIOA 4KRTA 3WX7A 1XYFA 5FAGA 3TSBA 4GE8A 1M5WA 1DWFM 1W8GA 5BROA 1GYNA 4J7RA 4JNZA 2GR2A 1VIWA 2X0HA 3WQPA 4QFUA 1UOKA 2PWUA 2G8ZA 3W4RA 4P8WA 1PPIA 1PIFA 3MP4A 3L5AA 5I0DA 4I9TA 4BWLA 1A5KC 3KDOA 3ZYZA 1VR6A 4CNNA 5CGTA 2F6KA 3LSCA 2FTWA 3H23A 1RCXB 2DFAA 1RVGA 4M3PA 1BWVA 1GTEA 3NOYA 4A8IA 3IV8A 3AMDA 1WZKA 3C2VA 4XAPA 4PCFA 4JGDA 4EXBA 3VNKA 3VM7A 1HJSA 1F8WA 2ZZ7A 3WBYA 1BYAA 3EYPA 4US6A 3S1WA 3LN3A 1MUMA 3W2MA 4RZBA 1UZ4A 1I0DA 3NA8A 1N5XA 2CETA 1FEBA 2YYUA 3ANYA 5ABEA 3GRSA 1JF6A 2PDNA 1TR9A 5K7JA 3CO4A 4HMDA 4GI8A 2AAAA 3TXVA 2FZ8A 2PC8A 4BHYA 1QFEA 1XGDA 3CUFA 1Q6LA 1H7XA 4ZOHB 5I24A 1H41A 2ZE0A 3OP2A 2GQWA 3ENLA 3AHVA 1DXEA 3EA2A 1GXFA 2DZVA 4R85A 4H41A 4I9JA 1XICA 4JEJA 4PFHA 2XIJA 1WYGA 5FIPA 4ZQMA 5G2WA 4KH2A 1IQ8A 4AZGA 1GHRA 1BVNP 3MU7A 3FGCB 4FX8A 4PMUA 2CKRA 1E0VA 4HZ6A 4LBUA 3UXKA 4EPEC 3LMYA 4WEVX 1E6PA 2WC7A 7PTDA 4P7LA 3VZXA 4FO4A 4PSPA 4JTFA 1UR9A 3T4CA 2PF8A 3T2OA 3CGDA 1M01A 4NY2A 3D9XA 4QLKA 3UWYA 3K30A 3IGHX 4MB4A 3ZLGA 4ADTA 1OWQA 2BG5A 4MIMA 5M1TA 4AX7A 4B3LA 3URNA 4XZLX 1A3HA 4M7TA 1F3WA 3GR4A 3CV6A 5D30A 7CGTA 5AB3A 4H4WA 4PODA 3N15A 2DH3A 1TWDA 1X6NA 2W0UA 5H8UA 4MNKA 2P8CA 2ISVA 1QW7A 1ONEA 3K1GA 3QF0A 3UT0A 3FXYA 3BURA 3AMCA 5H8PA 3CLWA 3P80A 2Z0IA 2H8XA 4IT1A 3S1VA 4LVFA 3CV2A 4IPLA 4JCMA 4X63A 2A3EA 5HPCA 2YSWA 3KCLA 3E49A 2HVOA 4BK9A 2R14A 3H22A 5I23A 1W9UA 4ZQPA 2HISA 3CPGA 1Z69A 4BURA 2FVMA 5DXYA 2NQJA 4O52A 4UQAA 5A8MA 5CPLA 3GXMA 1XYBA 4JFTA 1BPLB 1W3TA 5A8PA 3T78A 3ITGA 3R11A 2R1PA 1BVWA 4B4HA 4RK8A 3T0BA 4Q6JA 3LB8A 3NQAA 2ZRVA 3CUJA 3RNDA 2VEIA 4N9CA 5T9CE 1TG7A 1UQZA 4K39A 4IGHA 3LCXA 2GLKA 3LYEA 3MSYA 4U5IA 3SY5A 1JQVA 4W7WA 4J1OA 1E0WA 3MZNA 3LGEA 5G2HA 3CK5A 1QDSA 4PYSA 3SN0A 2W9MA 1K8XA 4JD4A 3CUXA 3WNNA 3RR4A 3EKGA 1T8QA 7REQB 2NV2A 5C5YA 1HKJA 4PMQA 2XJ7A 1XHGA 3IJDA 3MDUA 3LA4A 5E6ZA 4RW5A 3TTQA 1FWFC 2ZWYA 4DJFA 4UOJA 3WBXA 4U2YA 1XKJA 2BP1A 2A3LA 4CD8A 1KXTA 3DG3A 3ZR4A 1AJ2A 1UD5A 4JYEA 3BOFA 3HV8A 2Q01A 3FHAA 3VD9A 1JDFA 4D6JA 4DAFA 3WUEA 1TE1A 1VHNA 5CAKA 1EOMA 1G9HA 2VD8A 4S3AA 1GETA 4E6MA 3TYUA 4WUIA 1F73A 3UA3A 1A5AA 1B3XA 1AQMA 3B3DA 2F9RA 3VOCA 5A69A 4QXIA 3HJZA 3OG3A 1MQPA 4AY7A 1Z6KA 1GOIA 4EPDC 3UF9A 3VIKA 2V3DA 4P7RA 4HU8A 2XDFA 5AHEA 1K8CA 3WDRA 3KTCA 5JH2A 1UKOA 2ODOA 3L8KA 2WJFA 5AVHA 3S83A 3A24A 4EPBC 2QZRA 3WCZA 3QV7A 5AHLA 1J0IA 5FD0A 1UR1A 2YDQA 1EA9C 1B0IA 1EC7A 1TSIA 3BLPX 1Q13A 1NARA 2YR1A 3K4WA 1ZXIC 1WXJA 4QQUA 5REQA 2NSXA 3SN4A 1KA9F 1KO0A 4Q4QA 3KOFA 4ZO9A 3W1MA 1R3YA 1TVLA 4LAOA 3CIXA 5KVIA 3OIHA 2XIOA 5ECVA 2KZHA 3RG6A 5HA7A 4FAMA 4ML4A 1WOAA 1VF8A 4M6QA 1B54A 1QNVA 2VXNA 4H50A 2YW4A 3PC0A 5I3FA 2WSYA 4YHGA 3SCOA 3S2MA 4NEVA 3AAMA 5JIPA 1I2QA 4FA3A 3RCNA 3CL8A 3CS2A 3VNLA 2R82A 3JRKA 2XH2A 4IQLA 2XVNA 4H83A 2VOTA 3A9IA 4XVEA 3V1HA 1LL4A 3A47A 3M0IA 2DUZA 3WH5A 2AGKA 4D1JA 3HQ1A 4LS2A 2VC5A 4WY0F 4RV8A 4EF9A 3CT2A 2V5DA 1MRQA 3QSRA 3TMQA 4AEEA 1F05A 4UBPC 2WPFA 1XIJA 3N3MA 2FJKA 1ZHAA 4HU0A 1Q7ZA 3FA3A 3EOEA 4M1RA 3BW3A 2EG6A 4W8AA 5D2VA 1I1XA 1HJUA 2ZCGA 1H09A 2NX3A 2YVGA 1OG0A 2CCRA 3DHDA 2WMGA 3BAIA 4C7FA 3WD4A 3C8FA 4XD4A 4E0CA 5KZEA 3WK2A 1DEDA 3V1PA 1H6VA 1JZ4A 1AK5A 1FQ0A 3KBNA 1X96A 3ONCA 1GVRA 1SR0A 5AHNA 2PWHA 4C6IA 5XIAA 6A3HA 1G5AA 3NO1A 2J74A 2J6VA 5CZKA 4Y90A 4J56A 4PSRA 4UQDA 4S3GA 4YN5A 3RDKA 1V3KA 7TAAA 1VH7A 3OLIA 1OIMA 2O9PA 3LY0A 3FY1A 2UY4A 2Z27A 3WQOA 3AALA 3ISIX 4X0VA 3O0KA 1ME9A 4HSNA 1E5JA 2JIEA 5LIUX 3I6EA 1FECA 4GWEA 4BV6A 1C9WA 1HKIA 3W2LA 3G1YA 2HV5A 5BXSA 1DWAM 2E77A 4V1YA 3RHGA 4QE1A 3M6YA 1N8WA 2VC6A 1ZJIA 2ONEA 4I6KA 2TPSA 3ATYA 2A3BA 4PUUA 2BHZA 2V81A 3UWZA 3AMLA 1TV5A 4R5EA 2PE4A 3L67A 2A6NA 4UR7A 1PV8A 5M03A 3PTDA 1F4HA 1N7KA 3BC9A 3K4AA 1A3WA 3AS0A 5C9ZA 2Y5EA 3PZMA 1J5TA 2NX9A 3PPFA 1C29A 2Q02A 3KBMA 1JUEA 1RK5A 1JJKA 2J27A 4D6CA 1ISYA 1BGGA 1ML1A 1NSJA 3SM0A 3R4IA 3NR0A 1FWIC 3M4HA 1IF2A 1F07A 4DNHA 4GQBA 3TMLA 3EWBX 3GDTA 3HQOA 3TLLA 3UG3A 1TTQA 4X60A 3TK7A 3LEPA 3KHDA 3T09A 2WMIB 2DIEA 3A7UA 4IMEA 4ACZA 1W6TA 5CC5A 4XQ6A 2ACUA 4WLCA 1UD3A 2C71A 5D03A 2FFIA 4ONVA 1R9XA 1CXLA 1V3JA 3VGBA 1LG1A 2VZVA 4HHLA 1U1UA 3LU2A 3EWDA 1KRCC 1QPNA 4Z2JA 2CLLA 3HFTA 2FVLA 2DJLA 3N73A 1T6MA 3DGZA 1PZ1A 1NDZA 3R6IA 2AQWA 5FKYA 3N2CA 3WDPP 4AIEA 4M19A 4NAEB 1F6KA 3ONBA 2JIWA 3VGGA 4KPLA 1B3WA 1XDJA 2B7NA 4MFDA 2HROA 3SRDA 2XHYA 3FA4A 4YVVA 1EGVA 4FS9A 4K36A 1FDYA 4DZIA 4BWLC 5GJMA 3CZ8A 4N2YA 4FX9A 1G4PA 3M07A 3SECA 1S2WA 1A5MC 5DMMA 1PTGA 2E8ZA 3SGGA 5CGMA 1DJYA 4NX5A 3PF3A 1W9DM 4E3VA 2NWSA 1IXQA 3GAYA 2YXGA 3BMVA 4IX2A 1ZCOA 2CZEA 3PR2A 5F4SA 1S3HA 4LV9A 1LBFA 3PWAA 5D9MA 4IMCA 3AIRA 3CQIA 1LG2A 4IX0A 4OOUA 5HNUA 2WO5A 3VTRA 3G1HA 4AZCB 1UW9A 3ANUA 4D8ZA 3JS3A 4AISA 2EPLX 4GUHA 3H4KA 1OADA 3CHVA 2WJZA 1ONFA 2V5JA 1L6SA 2XVGA 2VM8A 4AW7A 2BSLA 2BOGX 3V3WA 3R07C 4NIRA 2BODX 1GG0A 1V7YA 3RLGA 5I00A 4M6UA 1VFMA 1OX4A 1FWAC 3WQDA 2WLZA 1U33A 4IMAA 3PULA 2Y4SA 4EQRA 1XUUA 5LGZA 3II4A 1ZMCA 2X2GA 3WKZA 4KF1A 4GCXA 3DEQA 4IWWA 1V0MA 2WW5A 3N34A 4C6QA 2WC4A 2BXYA 2A3HA 2Y70A 4Z1BA 3Q6JA 2RFGA 3O3RA 4O0ZA 3ZT5A 3BDKA 1JFXA 2QJGA 2VX5A 7ODCA 4QEHA 2OXNA 1OCJA 4S1FA 2IXVA 4ZFMA 2BV9A 1OX5A 2XH4A 3A7AA 1A5CA 4TV6A 2X7WA 3WLPA 3AIUA 3NPVA 1KGUA 3ZO9A 3AIVA 1W17A 2PMQA 3C3UA 3OG2A 4Q7BA 3OPSA 3QZAA 4A4AA 1ICSA 1PX8A 1LOSA 1JD9A 1W5MA 1UA3A 2H6RA 1XQLA 2QJNA 4G5DA 3U4AA 3R5EA 1CLVA 3WNPA 3F1QA 2PI6A 1FHLA 2Y1HA 3GZ3A 4CU8A 1XUZA 2IKHA 3NL2A 3HZ3A 4YVPA 3V5OA 2OO6A 1I6NA 2G41A 2REQA 2V5KA 2Y5JA 2YCLA 4DVOA 3M1ZA 1BSLA 2X41A 3AROA 1CB2A 5LXXA 3KP0A 2PODA 1ZCCA 3WMBA 4BI7A 1IT7A 1ZDLA 1ZNNA 3DJJA 5A6JA 3URBA 5C9RA 4U28A 3M0VA 4ROQA 3HG5A 4K1GA 3WQCA 2F5ZA 4GQGA 4CN6A 3EB4A 3WLIA 2EO7A 4E8CA 1GNXA 4JICA 1EC8A 5FS8A 1HJQA 3PBGA 3SQPA 2PDCA 1ZB5A 2WKJA 5XIMA 3MUAA 1QXLA 3VCRA 4E2VA 5KITA 4LUYA 2ZX6A 3BVJA 3JZUA 1XRSA 3GO2A 4ZO7A 4Z2KA 4JIRA 1SJBA 2GVYA 2UZ9A 2YDAA 1EJUC 5BXRA 1Z9AA 2EGZA 2CFFA 4ZXOA 2HK0A 3O06A 2Z29A 2YCKX 1Q4NX 4MLRA 3S3GA 1RP9A 3F4CA 4H9MA 5KEZA 1KCXA 3E38A 4FK9A 2VELA 5JCKA 4CN1A 3UYIA 1R2TA 1XWYA 2OSXA 1S3TC 1QMLA 5BZAA 3WLJA 1EXPA 3BSMA 2AL1A 2Y8KA 2Y8VA 1N55A 3VKCA 4PCPA 3RPMA 3RLHA 4KPRA 1B3YA 3GNNA 5G5GB 4EVZA 4ADSA 1XIMA 3KHJA 1G6CA 1VYRA 2WC3A 4BKNA 1H0GA 4TTGA 1R5YA 2QCGA 2PWEA 3CHDA 3MANA 1NM9A 1EJSC 4EM3A 4GYKA 2XM1A 3WBEA 2C3ZA 1XLIA 2GSEA 4YTRA 2E6YA 3T8QA 1UQYA 2WMKA 3NUKA 1TRIA 3PS7A 3OGSA 4IZGA 1WPCA 4BA0A 4GXPA 3EAOA 3GU9A 4PMDA 1EL3A 3TTYA 3IUIA 2FB3A 3TR2A 3KRSA 1HJVA 4DELA 4C6KA 1NDYA 1W1A1 4UFJA 1E73M 4OKDA 2FTYA 2ZUWA 1I2NA 3RCMA 3S2JA 4HSHA 3WJWA 4Z1CA 3KOYA 5I3KA 1DIOA 4NZJA 3MA8A 3RF9A 4LA1A 3HU7A 3FHQA 2V3AA 2P3EA 2OEKA 4FF5A 2EPHA 3RLUA 1GONA 3PB0A 1XSIA 4HN4A 1HX0A 2A2IA 2AGTA 3FOKA 3IAQA 3B9AA 3OJGA 4ZSUA 4UTHA 1OABA 5JH1A 5I3JA 3IRDA 1XI3A 3NRZB 4KFNA 3OYXA 3K8KA 4JDRA 1TWIA 3MBFA 1BKHA 4YPJA 3NYDA 3FJ6A 4H6QA 4DX3A 1X6UA 2C14A 2VX6A 3TJLA 4RLIA 5AN7A 4W86A 1V0KA 4O1CA 5DXXA 4AAJA 4AEOA 2FYMA 5EA9A 1NFPA 1REQB 2BVDA 5D02A 4WGHA 2H8ZA 3DGBA 4CNTA 1X38A 2Q8XA 4S3KA 1GOXA 5FF2A 3MUCA 4H4XA 4MDOA 4X2PA 4L4OA 3USZA 2HDJA 4B5SA 3W72A 4S38A 3STPA 2PGRA 1DOSA 4BQ3A 5CPQA 3B4YA 4HD5A 4M80A 1C8QA 2X7VA 3PK7A 1B5TA 3LHWA 1VFFA 1ITXA 4GZIA 1PTAA 3DG6A 4IG2B 2WMHA 4EXAA 2QF8A 3CUGA 4D8AA 3O0HA 3KOZA 3AI0A 2P0IA 1N61C 4CQDA 1QTWA 1ME8A 1PYMA 5T9BG 1A5BA 1H1YA 2R1NA 1UG6A 1GJPA 2INFA 4TVDA 4EQSA 3MYOA 2A0NA 2FGBA 5CKSA 1KM1A 3Q58A 1I4NA 2Y6ZA 3GQYA 2QDGA 1W8SA 1H61A 3E5BA 1DIEA 2ZRZA 1OFAA 1K9DA 5HXMA 1E56A 4FXSA 4ZL1A 4N02A 1JL8A 5E9XA 1F3PA 4GBUA 1RBAA 4ZENA 4DBDA 1K9FA 1KCKA 4L9YA 4D9PA 3SCRA 2FGZA 4Z42C 4MY9A 4HPJA 5LHEA 1XRTA 2PDLA 1G94A 5HQLA 5J04A 2NV9A 4AUBA 4BF7A 1K3UA 4GNVA 2WZHA 4BI6A 1TPB1 3N6JA 3WH7A 1GOQA 4CLMA 4MPQA 4PA8A 5DFAA 3KM8A 1V8EA 4PB5A 3RGTA 5I06A 4M8UA 4EQXA 3KLLA 1H7PA 2ALRA 4DZHA 3FEQA 4V1XA 2J88A 4ZOEA 2I5QA 3CHEA 3LGDA 2W54A 3TR9A 4C65A 1UBPC 1KD0A 2I5GA 1I60A 3G18A 4KQNA 1TJ0A 2R9ZA 3BJSA 2PDXA 2GSHA 3HA1A 1IE7C 1UZ1A 1W3IA 5LSMA 3B9EA 3VIHA 5AC5A 2CNCA 3NPXA 2Q6ZA 1FOBA 1UBSA 1Q85A 3LS9A 4Y9NA 1O6IA 3U4FA 4PMXA 4NAFA 1DXLA 3CAKA 3OIXA 4HP5A 1EA0A 4GZJA 3VUPA 4J9JA 4DI9A 3GTHA 1KM4A 4N4QA 1KBIA 5DMYA 2IQ0A 1JRCA 1DNCA 2O55A 4RNIA 1QCWA 3FK4A 3NZRA 3DKLA 5DEZA 2YL8A 2XGBA 2F6UA 2YYTA 4JTLA 5I3GA 4JNYA 2WQDA 3CASA 3HJEA 1Q6EA 1TPEA 1QBBA 1P0EA 4GG9A 2CU0A 1TVPA 3GE7A 2C3CA 3T0AA 4CU7A 1AJZA 4BQ2A 2PF0A 1N8FA 3IUHA 3H4GA 4HA3A 2W61A 2YA2A 3LENA 1X98A 1XIEA 2DSVA 3BW2A 3RO6A 4KFPA 5EMJA 2ATMA 1ZKQA 3SCNA 1HL2A 2AL2A 3HB9A 3ANVA 4BCEA 3GIYA 2Z25A 5DCBA 4CN4A 1E9IA 4A8NA 4WVXA 1N8IA 4U33A 4RDWA 1QNRA 1M65A 1SFSA 5CG7A 1VEOA 3ZMRA 5C7HA 2W63A 3OHMB 1E70M 4EANA 1JYNA 4AC7C 4XX6A 3TA6A 1BWLA 1TUXA 1PZ0A 1ZK7A 3AYSA 5D2YA 1M3UA 4JEQA 1KM6A 3DG7A 3W7GA 5LA1A 4GINA 1Q3NA 1J2WA 3QQ1A 2V5BA 4NAEA 3KDNA 4HOZA 4TOQA 4PCTA 3MUZ1 2CLOA 1UHVA 4IPJA 3WK1A 1E40A 4MWAE 2CLFA 3LI0A 4MNLA 3MKKA 1J6PA 4R53A 1X6LA 4DZ5A 1K8ZA 4UTJA 1M03A 1VJIA 3DGRA 4WRHA 3TCSA 3Q94A 4WDUA 5D32A 4AWSA 4GCAA 1JPMA 2FDMA 3A3WA 3ITLA 5D8WA 3E1F1 2A21A 4J35A 1VGAA 2WHKA 2F6XA 2YOCA 1DIKA 4XSLA 1JI2A 1GZ1A 4HJWA 2OCZA 1NOFA 1C3FA 2E68A 3TDFA 3T0DA 3MT1A 3BQ5A 4E8GA 5IDZA 3O2LA 4E8DA 4NZ3A 3N13A 2E4TA 3CL6A 3WLLA 4A35A 3REQA 4HGXA 1DJXA 1WZLA 2ZUUA 3TW7A 2QDDA 5TQLA 1VYPX 4L5ZA 2DSWA 4KGLA 2YLAA 1WQ5A 1VFOA 4WJXA 5HR7A 1JCXA 1TVNA 2EXOA 2YX0A 8A3HA 3W23A 3QR1A 3UETA 3H2AA 4CD6A 3NXLA 3HGSA 3NURA 1E1FA 2QJHA 3LGGA 4JHMA 5D4YA 2PRLA 4F8XA 1Q1WA 1OYAA 2WNWA