3OW1A

Crystal structure of d-mannonate dehydratase from chromohalobacter salexigens complexed with mg
Total Genus 144
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
144
sequence length
403
structure length
384
Chain Sequence
LKIRDAYTIVTCPGRNFVTLKIVTESGTHGIGDATLNGREMAVAAYLDEHVVPALIGRDAGRIEDTWQYLYRGAYWRRGPVTMTAIAAVDMALWDIKAKAAGMPLYQLLGGKSRERVMTYAHCTGQTIEDCLGEVARHVELGYRAVRVQSGVPGSSLPAEHVWSTEKYLNHAPKLFAAVRERFGDDLHVLHDVHHRLTPIEAARLGKAVEPYHLFWLEDCVPAENQESLRLIREHTTTPLAIGEVFNSIHDCRELIQNQWIDYIRMPLTHGGGITAMRRVADLASLYHVRTGFHGPTDLSPVCLGAAIHFDTWVPNFGIQEHMPHTDETDAVFPHDYRFEDGHFLAGESPGHGVDIDEELAAKYPYERASLPVNRLEDGTLWHW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title CRYSTAL STRUCTURE OF D-MANNONATE DEHYDRATASE FROM CHROMOHALOBACTER SALEXIGENS complexed with MG
rcsb
source organism Chromohalobacter salexigens
molecule tags Lyase
molecule keywords Mandelate racemase/muconate lactonizing enzyme
total genus 144
structure length 384
sequence length 403
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 4.2.1.39: Gluconate dehydratase.
pdb deposition date 2010-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02746 MR_MLE_N Mandelate racemase / muconate lactonizing enzyme, N-terminal domain
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 3ow1A02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 3ow1A01
3QTPA 4HCDA 1JPMA 3DERA 3U9IA 1ECQA 2OZ8A 3R0KA 3OZYA 3T6CA 2OVLA 2O56A 3NFUA 2GSHA 3P93A 2AL2B 5FJUA 1R0MA 4E6MA 1MRAA 3I6EA 2GGIA 2QGYA 3FJ4A 4K8GA 1DTNA 2ONEA 3UCCA 3VFCA 2FKPA 2PSNA 3S5SA 2PP3A 2PMQA 2HZGA 3TJIA 3TTEA 3HPFA 3GO2A 4HN8A 2PTWA 3GD6A 2GGJA 3H70A 2GGGA 4H1ZA 3ZLGA 2AL2A 3TWAA 3ZLHA 3DFYA 1FHVA 5EU9A 3V5FA 4DN1A 2AKZA 3NO1A 3OZMA 4YWSA 4E5TA 3VA8A 5J04A 3CT2A 1MUCA 3PWIA 2PU1A 4DYEA 3QKEA 1NELA 1MDRA 3ENLA 4K2SA 4GISA 3FXGA 5FJPA 2P0IA 2XH7A 4GMEA 3ES8A 3U4FA 3VC6A 1EBHA 4DWDA 4IZGA 3UCDA 3OP2A 1EC9A 3T8QA 2MNRA 3TJ4A 4IL0A 3CK5A 2CHRA 2OZTA 4F4RA 3MZNA 3S47A 3P3BA 4FI4A 3H12A 1MNSA 1TZZA 1EC7A 2QJJA 4M6UA 3KUMA 1SJBA 1BQGA 3R25A 2OKTA 3DG7A 3SBFA 4ZA0A 3OPSA 3TW9A 4MMWA 1SJDA 2P3ZA 3TCSA 2GL5A 2PP0A 3MQTA 3ZVHB 1KD0A 3TQPA 3MKCA 4KWSA 3ZVIA 3ZVHA 3IJQA 2QVHA 3I6TA 3D46A 4IP5A 3ZLFA 2PGWA 1JDFA 3JW7A 3DG6A 2PPGA 3STPA 1RVKA 3UJ2A 3RRAA 2XH0A 4Z17A 4X2PA 2HXUA 1YEYA 3K1GA 2QDEA 2AKMA 3DGBA 4DXKA 3V5CA 4E4UA 4KT2A 3OTRA 4HPNA 3GC2A 4A6GA 1WUFA 1WUEA 3IJLA 4ZCWA 2DW7A 2QQ6A 4HCHA 3BJSA 2AL1A 2ZADA 1P43A 3MUCA 1XS2A 3N4FA 3R11A 3FVDA 2XSXA 1FHUA 3ES7A 2XGZA 4KEMA 3RCYA 3NXLA 1W6TA 2DW6A 2GDQA 3PFRA 4MKSA 3R0UA 2I5QA 3TWBA 3DG3A 4JHMA 1OEPA 2PTYA 2XH2A 2OPJA 3QN3A 3SN1A 2PCEA 3TOYA 7ENLA 3H7VA 1JCTA 3DESA 3UJSA 1BKHA 1XPYA 3H8AA 4H2HA 3Q45A 4IT1A 1P48A 2QJNA 3VDGA 3QLDA 1R6WA 4A35A 2OQHA 1ELSA 4A3RA 1ONEA 3VCNA 3SN4A 2GGHA 2PP1A 4J3ZA 3CYJA 4GIRA 2XH4A 3Q4DA 3NZGA 2GGEA 2PGEA 4HNCA 3IK4A 4JN7A 3P0WA 3GY1A 6ENLA 3VC5A 3CXOA 4HYRA 3SN0A 3THUA 3SJNA 2PS2A 1TE6A 2P8BA 5BOFA 2OQYA 2HXTA 3EEZA 1EC8A 2PA6A 3VCCA 3T4WA 3R10A 4ENLA 4H83A 3RR1A 4ROPA 3QPEA 3T9PA 3DEQA 4G7FA 3JZUA 3DFHA 3RITA 1JPDX 3PWGA 3RO6A 1NU5A 2MUCA 3FV9A 3SSZA 2OLAA 2OZ3A 3N6JA 5FJOA 4JN8A 4IP4A 3N4EA 3UJEA 3FCPA 1L8PA 1SJAA 2PTXA 2QDDA 2P88A 1PDZA 3R1ZA 4Z1YA 3JVAA 1E9IA 1MDLA 3UGVA 3EKGA 2QJMA 3IJIA 1KKRA 2RDXA 4GGHA 4IHCA 4H19A 2OG9A 2ZC8A 3MWCA 1KCZA 2OO6A 4M0XA 4FP1A 1PDYA 3V4BA 3D47A 3PK7A 2POZA 3UXLA 5FJRA 3FYYA 4MGGA 2NQLA 4GGBA 3RGTA 4GFIA 5IDZA 1EBGA 4GYPA 5FJTA 3N6HA 1IYXA 2HNEA 3SQSA 5ENLA 4HNLA 4G8TA 3B97A 4EWJA 3UJFA 3CB3A 1TKKA 3MSYA 4E4FA 3UXKA 2OX4A 3I4KA 3V3WA 2P8CA 2OFJA 3DDMA 1SJCA 3CAWA 4DX3A 5BOEA 4KPLA 2PODA 3OW1A 4J1OA 4E8GA 4DHGA 2PU0A 3BSMA 4GYPC 3MY9A 3DIPA 1KKOA 2FYMA 3UJRA 3BOXA 2PTZA 4IL2A 4K1WA 4HCLA 1F9CA
chains in the Genus database with same CATH superfamily
3EF6A 5TF0A 1D7KA 2OLHA 1TG7A 2E6FA 4RNFA 3T05A 3BPWA 3WD1A 3WKZA 5EPDA 3T0DA 3HJEA 1B9BA 4MJ2A 2J79A 4H9MA 3B0PA 3EX2A 4Q8OA 1ZNNA 3EXRA 2O7QA 5I23A 5I24A 2HE8A 2BHYA 1UZHA 4IPNB 1OX4A 1H7XA 4QLKA 3VOIA 3BJFA 2BP1A 4D71A 3ZT5A 1RVGA 4FXFA 3URQA 3DI1A 2C0HA 3NQ8A 2B7NA 2GGJA 4JR5A 5ECUA 4A8NA 4GQGA 3E9AA 5DCDA 4JTAA 1FTXA 1LQ2A 2QYGA 2AQVA 3PBGA 3O0HA 3UW6A 3JS3A 1AW5A 4ZQMA 1F3PA 1G94A 2I57A 1T3QC 1XIGA 3RLGA 5D04C 3AIRA 1Z32X 2V0TA 4UC5A 1MUCA 3M44A 3NOYA 4RZ5A 3CEUA 3O1NA 4UNIA 2F61A 3RUBL 4C60A 1T96A 4Q32A 1OC7A 1R5YA 5L9FA 3HA1A 2D24A 1KM6A 1K8XA 1JXKA 1LG2A 2GDUA 5D9PA 3EWWA 1YYAA 3OLIA 4O1BA 4KEUA 1VPQA 2ZFAA 4HA4A 2CWXA 3SECA 2XHYA 1A4MA 5AVNA 3WMCA 3G18A 3VKAA 3GAYA 4RE2A 2X8HA 5AOUA 3IK2A 3VZYA 1VJIA 1L2UA 1TIMA 1O12A 4EMWA 4WD0A 4LJ3A 4F0SA 4QR6A 2YFOA 1XRFA 3O9NA 4S1FA 7A3HA 2AAAA 1S1PA 1XD1A 4C91A 3UZWA 3G6LA 5FF2A 2DZSA 3IGXA 2VZOA 2GL5A 3CM4A 4B5SA 4F0LA 4MADA 1XLBA 1AL8A 1P4CA 1WKFA 5D4YA 2C15A 2OKOA 3NQCA 3LQLA 3VABA 2PDQA 2R14A 3W9ZA 3UR2A 3O6YX 4F8XA 3S1WA 2YCEA 4TTUA 3WQ4A 1RVKA 4WOZA 1SO5A 2DUAA 2NX1A 4BEQA 4CN6A 2DT2A 4JX6A 2V3AA 4JL1A 2Q09A 4JHZA 4H8UA 1ZP4A 2W3RA 3C6CA 3OTRA 4HPNA 3G1AA 4FLSA 1WUEA 4B5XA 4H9UA 1MZRA 3KLJA 1K4QA 4JOMA 1P7TA 1VLIA 2GLKA 4H50A 3EZ4A 2ZX6A 3POCA 2VEMA 1JDAA 1J2BA 2PRLA 3KP1A 4MFDA 2NVAA 4JHMA 5MHBA 5E93A 5JUVA 1HNYA 3MUY1 4JFWA 4QE4A 3W7RA 2F8QA 4BURA 3F7JA 3QN3A 1K8YA 3IPWA 1UWSA 4IJCA 4HNOA 4J3UA 1JPHA 4GIAA 3A13A 1JG9A 5JQ9A 4H2HA 4DAIA 5SWUA 1GKQA 1LT7A 3SURA 3S1UA 2V68A 3PG6A 1ZZMA 4AD2A 1HIZA 1X1ZA 4C6PA 1XSJA 3W7JA 3CHFA 4RE3A 4MUZA 4IGSA 5TQLA 5K9DA 1N5WC 3LGGA 2WMIB 4GY1A 3TDFA 1CGUA 2D1ZA 3UZZA 2CLEA 2XVLA 3KLLA 3FAXA 5AYYA 4WUIA 1XICA 1LOSA 3F2DA 5DO8A 2C79A 1TA3B 2CZEA 2VL4A 3QHOA 3O6DA 2QCDB 4H9XA 3UYIA 4PA8A 2PA6A 3FA4A 1HTIA 3N1AA 1GRGA 1L6GA 2B81A 4O19A 3EB4A 1LQAA 1ZJAA 3IIZA 2VKZG 1HJVA 2ZZ4A 1SW3A 1X6LA 2WNQA 4DM1A 3H21A 4Q4RA 3PBMA 4D8AA 3WDPP 1FKXA 1SO4A 3RO6A 5M1TA 4N9DA 4OIFA 3FV9A 3W1PA 3O0KA 2E1DA 1CXKA 3KFTA 2NW0A 4EPBC 1DHPA 1V5XA 5TIMA 3VNKA 1XLMA 4QJ5B 2D2HA 1SSGA 2YVJA 1C3FA 2CLKA 2XN2A 4L61A 2VZTA 3AIWA 1ESWA 3AYTA 4D6GA 1PUDA 3OBEA 5F2MA 2YGYA 1QBAA 5HJXA 4GC4A 5DEZA 3G8EA 4L9XA 4Z2LA 1E71M 3EOOA 3W7MA 2TODA 4FP1A 1Z48A 1KM3A 4KEVA 4HHMA 4KGLA 2VVNA 3MWAA 4FNUA 1UASA 3RGTA 2XVGA 3NS1B 1T99A 2FZNA 4CN1A 2VJXA 4DZHA 2X50A 4AXKA 1F6YA 1I4NA 1UR4A 1O95A 4XTIA 4RUBA 1PKNA 4ZR8A 4FLQA 3A3HA 3DZ1A 3T1GA 4HK6A 2VFHA 3FAWA 2J88A 4K7YA 4XZWA 4AD1A 2A4AA 3SGUA 4NAFA 3MV01 3LRKA 3ZJ7A 1A0DA 3ANYA 3L5LA 5H8PA 2WQPA 3AHZA 3ZR5A 4Y8FA 1N5XA 3FLUA 4U2ZA 4JS3A 3UD6A 4P8WA 3KOXA 4E8GA 1E1FA 1J6OA 3U2EA 3BVJA 5BOOA 1XSKA 4A29A 1KXQA 3MKKA 1XYFA 1H61A 1LDCA 3MY9A 1JCMP 1V3HA 1DQXA 2JIEA 4E2VA 3PTMA 3A7UA 4ZSUA 1NHPA 4Y96A 3W7HA 1E1CA 4DVOA 1U30A 2ANUA 2QAFA 5D05A 3NOEA 1JIBA 2GJPA 3T81A 1A53A 1JPMA 1OGGA 1WQ5A 4GVHA 3UG3A 1IT0A 1F3TA 4GZJA 5IHRA 1LLZA 4XWUA 3KS6A 3TC6A 1DPMA 3UG4A 3QC0A 3VKBA 1L6WA 3HTWA 3H2OA 4D6DA 1OM0A 5FSDC 1UBPC 1MFVA 1VCFA 3LOTA 1JD7A 1VFLA 3LZ3A 3FVMA 3QEZA 1MRAA 3WCZA 4WSKA 3QVQA 4FEZA 3MZ2A 4TX8A 5K9XA 3KVJA 1ZAHA 3MHGA 3W2NA 1KFBA 3EKZA 3PZ9A 2PE4A 4OTKA 1W3TA 3FXYA 3SO7A 3WQOA 1DWHM 5A8QA 4EP8C 5BXSA 4PFHA 5C8BB 3GH7A 3S9YA 4J40A 4Y9PA 1QNRA 4LALA 1E3XA 4XVDA 1BRLA 3CUHA 5C6MA 2YZRA 4J4KA 2ZX5A 5A5WA 1V6UA 3OVRA 3NO1A 2FTWA 1UKTA 2QGHA 2J74A 3KOYA 3LQGA 4U10A 2NT0A 3AYRA 3TSMA 3LZ5A 4Q7IA 4IH3A 4G2DA 3T4CA 3V75A 1RQBA 2X42A 1XC4A 4Z2JA 2C18A 3QKEA 1LJYA 3T2PA 1Q6EA 3VKKA 2GH5A 1G4EA 2H3DA 2J47A 1SB3B 1GKPA 3G1YA 3T7VA 1RK5A 2UY3A 1R3RA 3VD5A 1TPWA 2O9OA 2DJLA 1E4IA 1CGTA 1E40A 3OP2A 4K8EA 4MZ1A 4AG0A 3WNNA 2WZEA 2F2KA 5HNNA 4Q8QA 3CK5A 3TFXA 1IQ8A 4OUIA 4K36A 5A6LA 3FA5A 1Y5VA 1TMLA 2Y62A 3PM6A 2EPHA 3N25A 1Q3NA 1G0CA 1Q85A 5A6AA 3ARUA 3G6MA 1KXVA 3MT1A 4I90A 6TAAA 2C3CA 4XV0A 3VNZA 3N73A 1XUUA 6XIAA 4JTQA 4KCTA 4IG2B 1S5WA 2GSJA 3KRUA 2BZNA 5HATA 2WCGA 2VNCA 1W9DM 3EKLA 4BCEA 4MNLA 3BAKA 4H6EA 3SCPA 1POKA 3B0YA 1V3KA 1EJVC 3C56A 2NUXA 3R89A 2WVVB 1FOBA 2CBUA 4YYFA 1ADDA 5DT5A 7XIMA 4H7ZA 1B30A 3JW7A 3A47A 3STPA 1W3KA 3AC0A 3HW2A 3CZKA 2ZRVA 3OHIA 4Q33A 1MW2A 4MDPA 1JQVA 3RXZA 2QUUA 1XI3A 4A6GA 3TIMA 1WUFA 1P7TB 1YADA 4H7VA 3CZJA 3IJLA 1GRFA 3TQVA 3CV6A 4M80A 1JDEA 1Q7ZA 3E0VA 3C5QA 5AYXA 4XZIA 1PL9A 2W61A 2Z2BA 3KL3A 4H04A 2VEFA 3ISIX 2BDQA 4GYKA 1W5NA 5AZ0A 4V28A 2I16A 2E6DA 3I7RA 3SRDA 4MKSA 4M29A 3GR7A 5AC5A 4QS6A 2BGSA 2E28A 5T26A 1M6JA 3NZPA 3H2FA 4Q7NA 2X0HA 1W54A 4FXJA 1EJUC 5MF5A 3S9IA 3TEVA 4HSNA 4ADWA 3EX1A 5B80A 1BKHA 5A69A 2QUVA 3NQFA 3HV9A 3N04A 1BG4A 5T9BG 3QLDA 2Y7GA 5F4WA 2VDIA 3HF3A 1X8CA 4A3RA 2V6OA 4KCVA 5T8GA 1AQMA 2BVYA 1W1A1 2WVVA 5D32A 4DO6A 5ABTA 2GGEA 3IK4A 5DXYA 2OWWA 4B4HA 1W31A 4HD5A 2UWFA 1YBQA 2C3DA 2OYLA 1OC5A 2E6AA 2QHAA 4R9OA 1EYEA 3WLMA 1SW7A 3SN0A 1H5YA 1T0OA 2CBIA 2G3IA 3B9EA 3AXHA 4OBRA 2OU4A 5CZ0A 2ZA1A 5D8ZA 3CUGA 2WZMA 1OFEA 1GOXA 1DE6A 1V8EA 2A79A 4I9JA 3TLLA 1KV8A 2VZVA 3FKRA 2GQWA 5DMYA 3WMSA 1BF6A 1PEZA 3W7EA 3PS7A 4J2PA 1RM6B 1P0KA 1YE4A 5JXQA 3NL3A 3GVVA 2YL8A 3NQEA 1R86A 1VBRA 2QF8A 5GJMA 1WE5A 2Z26A 2VMFA 1B9ZA 5XINA 2CLOA 1D8CA 5XIAA 4GXMA 3NVZB 1B4EA 1V6YA 5I3GA 1LF1A 4NNCA 3ATZA 4JIIX 1DWFM 2HBXA 1UWUA 1PDYA 1OCBA 3DYPA 5FOOA 4XD4A 1GRBA 2XISA 3SCTA 4GUGA 1IWBA 1WXYA 3ZM8A 1GVFA 5C2CA 3CV2A 3E6EA 4O52A 2D69A 3M07A 1KXTA 2R91A 2HNEA 4O13A 2DEPA 5HQMA 3DCPA 1PKLA 4PCTA 4R3UA 1ZBCA 4LV4A 2AMXA 3QGAC 5AHIA 3C8FA 2GJLA 3GHRA 4E4FA 3ALFA 1H5VA 5KEZA 2OX4A 4PTWA 2BTMA 5JBFA 3V3WA 3N34A 1S5NA 1AH3A 1R8LA 3PY2A 4C6KA 2G0WA 2PC8A 1VZWA 3KVLA 1EEPA 4HB7A 2JKEA 4ZE4A 1D3GA 1TWWA 1ECEA 2C8NA 4JYFA 1KTCA 2OB3A 4BA0A 5BCAA 4TQTA 5AY7A 3PZUA 1NP2A 5J5DA 2PTZA 4GY0A 2FZDA 3E0WA 4R9XA 2OO0A 1CGXA 3S42A 3WEOA 4AVFA 4ROQA 3W82A 1R30A 4WDUA 3ID7A 1MQQA 2DU2A 4CQ9A 2R1PA 3AMLA 3W76A 3GUWA 1BYAA 1W3JA 2OXNA 2FIQA 3WNMA 3QYSA 1AJ0A 2O56A 4EAYA 2GSHA 3B8WA 1XX1A 1I1XA 3W81A 3KP0A 2C6QA 3TROA 1AUSL 2CBJA 4Z08A 2DIJA 4BQ2A 4EVZA 4MB3A 3VTRA 3UY8A 5CZSA 4KCUA 3MDWA 2ONEA 3VFCA 2X1RA 4CQAA 4ZOEA 2FZ8A 3USZA 2EJ1A 3N11A 2ALDA 1NAL1 2TMDA 3VIOA 4GRSA 3V0UA 2PTWA 3TA9A 4DUWA 1KTBA 3F4DA 1OIFA 2OWCA 2I7GA 3ZT7A 4TOQA 2JGQA 3YPIA 5AKQA 2H8XA 2Z1SA 1J01A 1EKOA 1EJRC 3VZZA 1AODA 2DIKA 1IEIA 4RK8A 2X7VA 3AZTA 3A4AA 1UPPA 5A8NA 4OBTA 1N55A 4HJFA 2FGLA 4V15A 3OA3A 3PWIA 2JE8A 1ZXIC 4DYEA 3C2VA 1KGWA 2WSYA 1XYLA 1HL2A 1OY0A 2BBFA 3F2BA 1YDOA 4V1XA 4UZUA 1B2YA 3QR0A 5FJPA 4F9DA 2YQUA 3L4UA 1K7EA 1NVMA 1WA3A 1JNDA 3R13A 4QXIA 1ZBVA 1Q45A 4JQ4A 4DWDA 2BXVA 2KZHA 3TJ4A 3BARA 3RCMA 3FNDA 4M82A 4S3AA 1AA1B 1ZBKA 1R9ZA 2BOGX 3WQ5A 1FDJA 1I45A 3LM7A 4GR1A 4RV8A 2J9YA 1FP9A 1HJQA 3R8RA 2GVGA 3WLTA 1A4LA 1QNPA 3VKCA 2V2DA 1J2WA 5AC6A 3K46A 1UCWA 3B3DA 1UR8A 4XTDA 4G1KA 3CMFA 4PMOA 2QJHA 3PR2A 4MM1A 3VE7A 3RCNA 2V3EA 1CGWA 4KWSA 2ODOA 3N29A 3MSDA 4UTHA 1VC4A 4HPGA 1XLFA 2QVHA 5ABFB 1NFBA 3W1RA 2CDUA 4EQSA 2E4TA 3GYEA 4Z2HA 3QFAA 4QDPA 1O7AA 1JDFA 3ATYA 3ZQ9A 3OG3A 2NQJA 3DKLA 3UCQA 1M41A 4ZBCA 3RRAA 4PBFA 4IIHA 4LV9A 4C6DA 4PSRA 3AMDA 1YXCA 4Q8TA 1OINA 3H2AA 4Q4OA 3TXVA 2PD9A 3W00A 1E6NA 1XH2A 3AIUA 3LLDA 3OZPA 3CC1A 5I0DA 2ZDRA 4KH2A 1P43A 3BSGA 2WPCA 1TE1A 4BEUA 5G1MA 3BQ6A 1V3IA 4HGXA 2O92A 2CEQA 2XVNA 4PUUA 2WLZA 3ARRA 1OFRA 2HISA 3LBCA 1TRDA 1D3CA 3J7HA 1W5QA 2PDIA 5DELA 3KBVA 3GBDA 1DJHA 1EH9A 4G9PA 3PUGA 1O68A 1E6ZA 2WCSA 3NQDA 1VCVA 3HQNA 1Z8AA 4JFVA 1Y7VA 1Y65A 3OOQA 1AW1A 4GKLA 4P7NA 3P5ZA 4YPJA 2WP5A 1P6WA 4J3ZA 4ORIA 3L7RA 4PULA 4QBXA 3RU8X 1CXLA 1ITUA 3WF4A 4YVXA 4J28A 2PDHA 1SFLA 3KTXA 3TJXA 4K37A 1TCDA 3GRSA 1MEWA 3P0WA 4B5NA 1OF6A 3GY1A 5HXMA 2ZX9A 3PPFA 1QI4A 1EDGA 2DIEA 4KKXA 4H4PA 1QHZA 3ZIZA 5HNUA 5HR6A 1UZDA 1KCKA 3EWZA 3CGCA 5IM51 3XINA 5G2IA 1DP0A 4I7WA 1XYZA 4QG9A 4UCGA 1W1YA 3T9PA 3VXGA 4UFIA 4OECA 1HJXA 1A5LC 6A3HA 2XFFA 3HB9A 1TVNA 1K6AA 1XLDA 5C9ZA 3VIIA 1WOAA 3CWOX 3KM8A 1E6XM 2HVMA 2MUCA 3U5YA 3GTFA 3M0ZA 4CQDA 4HU8A 1XLHA 1R2SA 2OZ3A 3IJ7A 4U31A 2RGMA 4C6BA 2Q6ZA 2IPFA 3KZPA 3TMQA 5LKYA 1L6SA 4C1NB 2XTKA 4E8CA 1NIUA 1LORA 1SFJA 2Z6IA 5GJNA 2FJKA 4Z1YA 1Z44A 4HSOA 3LCLA 3IUHA 2VEIA 1H41A 3CO4A 4GJ1A 1HXJA 3W72A 3IGSA 4JTEA 4HNTA 5C9XA 4NEWA 4I7VA 4MPQA 3UA4A 4CEXC 5CZTA 5CSYA 2X1IA 1AMYA 3GTHA 1FCQA 4Q8MA 1K9TA 4GC3A 2Y5JA 3EDEA 4L64A 5PTDA 4GFIA 1WXZA 1ITQA 1R38A 4AVNA 2PDBA 5IDZA 1V6TA 3VGHA 5ENLA 2YCIX 4LEQA 3C2OA 4G8TA 4YLWA 3B8DA 3V7PA 4LY4A 3SCSA 4AD4A 1E70M 2BX7A 3I4KA 4AH7A 1H0IA 1KXHA 3RM4A 1FFRA 1B3WA 4WKAA 3AFBA 1H2JA 4DX3A 4J1OA 1TV8A 2WBGA 4AZ5A 1KM2A 1FWDC 1JUKA 3LRLA 3FN9A 2H8ZA 1W1IE 2BV9A 5HANA 3R0DA 2XN0A 4QIUA 1WBJA 1ZU8A 1HKKA 3DIPA 2D3NA 4R7WA 3BOXA 1LLWA 3T42A 1C92A 2D2JA 3CPUA 4WZHA 1FFUC 3LMYA 3WSUA 1JRBA 1AH0A 3CLWA 3B9JB 2YBUA 2DP3A 4JTSA 4GI6A 1QOPA 4DPPA 3RM8A 3KTSA 5HOSA 1QO5A 2ZZCA 4MWAB 4AZHA 4DO5A 5FESA 3RM9A 3GDBA 4PTMA 4HIBA 2P50A 1ODZA 1YTDA 2NLIA 2Y5EA 2NVCA 2E5AA 1EGVA 4DJEC 1XKYA 4DBDA 3ORWA 4HTBA 4RNHA 3KVMA 1JYXA 2EQ9A 2ACSA 4K8GA 1NWTA 3LCGA 4HT3A 1VIZA 3RLVA 2VENA 1AJ2A 4UTIA 2B0MA 4FIRA 3MMTA 1TJ2A 1ME7A 3N2TA 7REQB 1LRTA 4LAOA 2PDNA 5HR7A 4C6JA 4DN1A 4W7WA 4IMGA 2V38A 3CH9A 4IPJA 2ZUUA 4YWSA 3BUVA 5I03A 1BSIA 1TMHA 4GZIA 3N3MA 4QM1A 3SB0A 3MUAA 3KL5A 2E3TA 3BMXA 2XU2A 2O9PA 3DK8A 4XZHA 2FGBA 2NVKX 3K8KA 1GYLA 4MUPA 4WY0A 2ISWA 3G3DA 5CJNA 1FH9A 2PLCA 3EEGA 1B31A 5HK4A 4LCQA 1PXGA 4TUFA 4JL2A 4JY8A 1FWGC 4WKHA 3AQUA 4APNA 5BNKA 4AY7A 4LQ1A 4HNVA 1GVIA 2W3ZA 5HWNA 1XM3A 2BY3A 2W67A 2RHGA 4GKTA 4UFLA 1HO4A 1E0WA 1SGJA 1PHQA 4B9ZA 1LUCA 2OZTA 4LGXA 5GRTA 5AB3A 3UZXA 3UXIA 4PEKA 1TZZA 1EC7A 3TZFA 1D3HA 1Y5WA 3SR6B 4MB1A 1V08A 4EM3A 2IPJA 4RPQA 2OSXA 3LUTA 1EWDA 3TW9A 3FYPA 1IEWA 4A2SA 2R82A 1IZCA 5GNZA 3UF9A 3ZR4A 2NV2A 2PF8A 1E4LA 1ENUA 5ER0A 4AWSA 2VRKA 1V6XA 4HOZA 1UG6A 2DVUA 4FA3A 7TIMA 3AZSA 3MB9A 4H2CA 4K38A 3EWBX 2Q8LA 3H7UA 5CXPA 3NQAA 1TV3A 4Z2IA 2PPGA 3G24A 3OU8A 4IJRA 3W29A 4H6RA 4GX8A 2W0UA 4BWLC 2KAUC 1V03A 1SZRA 2YL5A 4ZOBA 3ABXA 3L68A 2O4MA 4DLMA 3S8HA 1F6KA 2VEGA 3QFBA 1V51A 2ZVRA 3I7QA 3BJSA 2AL1A 2HS6A 3VK5A 1WCGA 3WLHA 3KOFA 3L0GA 3R11A 5AYZA 1M7JA 1U2YA 3IIXA 3DX5A 1Q1WA 3B9DA 3BWWA 1PCWA 4ZO8A 3B8UA 3CUJA 2WMJA 3D3AA 3IARA 3IV8A 3BCFA 3GZ3A 3NEHA 3V16A 1CNVA 2INEA 1KQZA 3R0UA 1K3UA 4RE4A 4B91A 1US0A 1K4GA 1OEPA 3V36A 3HQPA 3EX3A 5KZEA 4CCDA 2YA0A 3GH4A 2R9RA 7ENLA 4LFYA 3ONBA 1FVPA 4REQA 4QAWA 3TYBA 1EBDA 4J3TA 3URNA 3SCVA 3VIJA 2JIWA 4BF9A 1KA9F 4UFHA 4IPPA 1IHIA 3RPDA 3KRSA 2X09A 3RR4A 4A2RA 3Q4DA 3NZGA 2DPEA 4ZODA 1AQHA 2IQ0A 2G96A 1PX3A 3S1GA 2RUSA 5A3HA 3QOMA 3CGEA 1XG4A 4OWGA 4NUWA 4S39A 5CJMA 3EOEA 1ONXA 4MKVA 1P0NA 2ZXAA 3W22A 5HNRA 3WLRA 3M5ZA 4HOWA 2BASA 2WPBA 4D6JA 3V1PA 2VEPA 3SRFA 5B7ZA 5I3IA 2IQTA 4S2CA 1GEQA 5CG0A 4O50A 1BD0A 1FH8A 3R8HA 1BVWA 3SQMA 2GSEA 2GFTA 2VT0A 2YJQA 4ZGYA 5I3JA 2Z1KA 1TIWA 4R85A 2DZBA 9XIMA 1CB2A 1ZS2A 4TIMA 1UWIA 3BLPX 3TMLA 4QG6A 3PC0A 2ZA2A 5LIUX 4BKNA 1UR0A 3I3DA 4ATLA 4WY0B 3UZ5A 2RDXA 1WZKA 3STGA 3DAQA 1QVBA 3O6CA 4IQLA 4Y9AA 2ZC8A 3UWQA 4FX7A 5F2IA 1KLZA 1PB0A 2HVNA 1EEXA 1YNQA 4FOKA 2W62A 4ACZA 3CBWA 4Y90A 3WK0A 1HP5A 3UXLA 1S7MA 3FYYA 3L5AA 3GW0A 5JU6A 2D0GA 4NAEB 4U28A 1GRHA 1X2HA 1JAEA 2TYSA 1YTKA 4J7RA 4UQEA 3U6WA 4FLRA 5HDRA 4GBUA 5F4SA 2QPSA 3T0TA 1T5AA 1DXLA 2YYUA 4U5KA 3CWNA 3O8AA 1Q7QA 4JQ3A 1KCXA 1JF5A 1P0EA 3HIJA 2PODA 2FDMA 1AQ0A 5GPRA 4D8ZA 3LCXA 4CVUA 3HMJG 1S3TC 2X41A 4D6CA 3TSBA 5EKYA 1QFEA 2X8CA 2W54A 1VCGA 1JJKA 4US5D 5BRPA 3WH5A 4E4PA 4C6MA 4AMAA 5MKGB 4GD0A 3PULA 1POJA 4HCDA 3CEPA 3GXPA 2Q02A 3NDZA 1TYTA 1FFVC 4GI4A 4JDRA 4R53A 1ML1A 1PYFA 2D2GA 4E2OA 1XIJA 2VVSA 3M5VA 4O1EA 1DWAM 4B4FA 4BHYA 1KQYA 3QXBA 3UU0A 4AZ6A 2Z1BA 3U4AA 1UBSA 4LCRA 1XYMA 1R0MA 4E6MA 4G56A 1RCOB 3UR5A 2ZUNA 3DHUA 1DTNA 4E3TA 9RUBA 5FACA 2PDUA 4HP5A 4M8UA 2OSYA 2PRHA 3AWOA 4RZBA 1TTQA 2DSWA 2CIPA 2ON3A 2V5JA 1PZ0A 3HPFA 1JCJA 1PZ2A 2A3HA 1J0YA 1JD9A 4NXSA 4O1FA 3VOGA 4H1ZA 2WO5A 4ALDA 3OG2A 3GG1A 3VO0A 4GQ0A 2ACQA 4R7JA 3NGJA 4L4OA 4DBEA 1OHLA 3CT2A 5LIYX 4FK9A 2XVKA 5A8PA 1R9XA 4HVXA 5AHEA 4O4WA 1UP3A 3I65A 1UB3A 4LUSB 6CGTA 4C5ZA 3E2SA 3IUIA 1LZOA 2EQDA 3QV6A 1A5BA 1GOIA 4KBXA 3OZOA 2Q8XA 4Z1DA 3FW6A 1WO2A 2BWGA 4EE9A 4HSHA 4IZGA 3CGTA 5LYRA 4AZBA 3NQBA 3VOHA 3WJWA 2J75A 1M65A 1V93A 1XFBA 4L9ZA 2QPXA 2DZVA 4R33A 1W1VA 3LMZA 3H12A 5G5GB 4PMDA 4ACZB 4NI8A 1B90A 1N82A 3WF1A 3W7IA 3BAJA 4NZ4A 2JEPA 1ZSXA 3M0VA 2C13A 2ZIDA 3B4YA 3ITLA 3LB0A 4QRNA 2AMGA 2ICSA 3MUZ1 1UR9A 2PP0A 2V5CA 4XAYA 1PYMA 2WC3A 1WDWA 4UZSA 1X6UA 1Q65A 1QW9A 2X8GA 4X0VA 1M7PA 1BYDA 3I6TA 1HKJA 1CGYA 2ZRYA 1C9DA 1O1ZA 3RIKA 2F7FA 1NHQA 3P6LA 3OJGA 4Q4KA 4DBWA 3V18A 3FHQA 3GG0A 4GNJA 4H4ZA 3DYMA 2QT3A 5D03A 4EPKA 3FK4A 1MWOA 3VGBA 5HPCA 4IM4A 4IP7A 3K4DA 2G4FA 4WKFA 4LX4A 4PCSA 1EIXA 1TJ1A 2XFRA 3RNDA 3UWUA 1N60C 4PUDA 4MZYA 3QQ0A 5H8UA 3S83A 2PTYA 5U25A 2VTFA 5CPLA 4L1GA 4RX0A 3O2LA 4KW2A 2CU0A 3GKFA 3SN1A 3PTKA 8XIMA 3GDRA 4LOCA 3VFLA 4KMQA 4J3VA 1GVYA 1R7AA 2CCRA 5DANA 1QNSA 1E4MM 3FX4A 4PMUA 3CAQA 1C29A 3MCMA 1OD0A 1XKJA 4DZ5A 4A35A 3WL1A 1F07A 2DSVA 1K6WA 1ZBWA 4QAIA 2A5HA 4I8DA 4GIRA 3U8GA 3JU2A 4OV4A 2PDYA 2XN1A 4LH8A 1Q63A 3Q67A 4IQJA 4ZENA 1E5NA 2BCPA 2WYSA 5A8MA 1TPUA 1SFTA 4K8HA 2DZXA 3KX6A 3WIJA 3VD4A 1FKWA 2WC7A 1VYSX 1KM5A 1WDDA 4NZ3A 4DJDC 5FEPA 3B05A 2WANA 4DI8A 4OGZA 1TPC1 1EC8A 5I2UA 3WJXA 2ZXBA 1J9YA 4M6QA 4B15A 5CQ1A 1VHNA 4G7FA 2EHHA 5E6YA 3A7AA 1V7YA 4UQDA 1LPFA 3HRDC 3EA2A 2A3AA 3RFAA 1ZLPA 4N4PA 4ADSA 2YVGA 2OYKA 1EO5A 3N4EA 4YTSA 4R7OA 3FCPA 1L8PA 4UQCA 2GVYA 1EDQA 2GVLA 3OIXA 3R1ZA 3AS2A 3SADA 1BGAA 2BHUA 2WKGA 4XD3A 3WH8A 1OABA 1BRLB 4ZFCA 2PAJA 1KFLA 2WWCA 4JDBA 1I2OA 3OIHA 3WQ8A 2D2OA 3L5MA 1I75A 4RXFA 1JEZA 4IOTA 3HO8A 1M5WA 3A9BA 3DC0A 2C19A 1MQRA 5F7UA 3KHJA 3VVGA 3SFKA 2QJGA 5FA5A 4B2DA 1QJWA 3LY0A 2FMNA 1DNCA 3W1AA 3I4EA 1WPCA 5DY3A 3TC3A 1TVPA 5JCMA 1A3HA 2ZZ3A 5JVLA 4ZMGA 1P6BA 3HZ3A 2VO5A 1RQHA 3HFTA 3EX6A 4P7OA 3VNJA 3BGJA 1T6MA 4S3BA 5H2ZA 4XAGA 4B5VA 1FWJC 3EWXA 1JVNA 3LERA 3CB8A 2WMIA 4H00A 5FEWA 5HMSA 1UOKA 1OBAA 3IANA 3W37A 2D0HA 1IEXA 3DHFA 5D2VA 3U2OA 3F2CA 4Y9MA 3W7CA 2JK6A 4MG4A 1C91A 1QRQA 4TVWA 3LN3A 1XCWA 3PZNA 2E67A 4GXWA 1M68A 2VDHA 3THCA 2F5ZA 5BWAA 1UH4A 1EPVA 2Z27A 1NDAA 1XANA 2BODX 5XIMA 1P1XA 8A3HA 3NNTA 4LSBA 3SEPA 4NAFB 2VEKA 5LIXX 3UQNA 1EO7A 4LS1A 4NZ5A 1LBMA 2J66A 5LA0A 5T9CE 2QCHA 1DTUA 4CVWA 4CU6A 1VAHA 4HYVA 4NNAA 5IXEA 1RBAA 4NZ1A 4CNTA 3W3OA 5D33A 5KZMA 1DJGA 3ABSA 5REQB 3BGAA 3TN6A 3TYEA 5HQLA 1RZMA 2IKJA 2GJXA 3SCRA 4HHLA 2VR2A 3OO2A 1DXIA 1W1ZA 4LAZA 5CSUA 4JNMA 1H63A 2VM8A 4XVEA 5EU9A 1F8MA 3AIEA 4WHBA 4LYPA 2QIIA 5LNSA 1RY0A 3VA8A 4V1YA 1HW6A 1EUAA 1OC6A 3EXTA 2J27A 1RA5A 2NWRA 1HX0A 1Z6KA 1RP8A 1SUXA 3GHTA 4GISA 3TC7A 4NL1A 4MJ4A 4GABA 3LSCA 1F3WA 3VPLA 1P0BA 4BY3A 4JIQA 1JEHA 5L6UA 3IIOA 1Z89A 1PPIA 1QNOA 2J78A 2DSKA 2J24A 4ZB0A 4NIRA 4RPPA 3R2GA 1DWJM 2OGYA 3S47A 2XIOA 1NOUA 3GWQA 2XIIA 1VQTA 3GDLA 1V59A 1CCWB 2BGNE 3L4TA 5HMEA 2ZZ1A 3HJZA 2TRSA 2REQA 2CZVA 3PZIA 2PTDA 1SJBA 4WF7A 1UD6A 4MB5A 4W5ZA 4JTGA 1UROA 1FXQA 1E9LA 4O10A 2R6OA 2X0YA 4LBSA 3WBXA 3ABOA 1OJTA 3RO8A 2Z1VA 3TTYA 3ZVHA 5A2BA 1PIFA 4FNRA 4JNYA 3W1UA 2NXGA 4HZ6A 1NOFA 3AMGA 3TONA 3ZLFA 3T0AA 2A2IA 1J93A 1JNEA 2ZTKA 3O16A 1ZB5A 2BS9A 4YYCA 4X2PA 1QI3A 2EPMX 4E0CA 3K1GA 3DGBA 2WNWA 3O63A 3UESA 1P6CA 1J6PA 1ME9A 5AHLA 1X8FA 1TWIA 2W91A 1KO0A 1ZDLA 1H7RA 3LS9A 2CYGA 3WEMA 4CNNA 2ZADA 4HZ7A 1V3LA 2CBVA 3ZYZA 1NHSA 1E43A 3ES7A 4KEMA 3UNTA 3RCYA 2FVLA 3NXLA 4FOUA 2GUUA 4ZSTA 1XJBA 4JYEA 1S2AA 3LNPA 1SQ7A 4W7UA 3DFPA 1WAWA 1BTCA 4TVCA 1HN1A 4ADTA 3AS3A 1PHWA 1DL3A 2Y2WA 2PI6A 1YXYA 1BWKA 3NQMA 4V2XA 2PGRA 1UJPA 5D30A 1EUNA 3R6IA 1W2PA 3DESA 2WVSA 1FWEC 3V5OA 4GOAA 3H8AA 1IF2A 3W25A 1UWRA 3Q45A 1HF6A 2O55A 3HM7A 2FHCA 4L80A 4OHQA 2QCGA 4AFYA 2ZUTA 1XP3A 4NY2A 4Z1CA 1FIQB 2GGHA 4AYGA 1F7BA 5AN7A 4AIUA 3LLFA 1A5CA 3B9OA 3K4AA 3OBAA 1E9ZB 3BG9A 3LYEA 1XWYA 2F9RA 1NF0A 4MVAA 5C70A 3C3NA 3LPFA 3CXOA 2ZRZA 2XDFA 3DU0A 3GUGA 3LTYA 2PS2A 3L4ZA 1F05A 2NZLA 2Z6JA 1VS1A 5A6JA 2V69A 2YXOA 2VX4A 1QNQA 1N62C 1I0BA 1HVXA 4GA8A 4AZCA 3VCRA 2E68A 3NTYA 3KHDA 3N9SA 4UOZA 2QMKA 2VOMA 3VUSA 1LWIA 3W2LA 1EP2A 2F6UA 3M0IA 5K7JA 2G3FA 1AOGA 1GYNA 2Y70A 1AK5A 1OCNA 1TUXA 3ERPA 1A80A 3GDKA 1TCMA 5H91A 1TB3A 1YDNA 1XH1A 1BAGA 3LI1A 2H90A 2V81A 5IBXA 4AUBA 3AYSA 4IXXA 5TNVA 4FR1A 1JCXA 3GLCA 3SGZA 3MMDA 5FF4A 2PRMA 3PG9A 4RW3A 3V35A 2X1TA 3VDHA 1Q6FA 1L2QA 3PUEA 4MYXA 4LUYA 1JCNA 4QNWA 1BXBA 1CGVA 1TV4A 3M41A 2Y63A 4NQ1A 3TQ0A 5LA2A 2NUWA 3L21A 1H60A 4G1NA 3GNNA 3SQSA 1LVLA 3NRZB 4BQ4A 2VX5A 5BXRA 2CLPA 2YXXA 3STEA 1NHRA 1QCWA 3B0UX 2WZHA 1X2GA 4S3GA 5FF0A 3DJGX 1K9FA 3T55A 2KX9A 4K7ZA 1DJNA 3N6QA 4AB4A 2Q3OA 3W1QA 4H4TA 3H54A 4YJ5A 1WDPA 5CGMA 4UQBA 1VBUA 4IFRA 5CH9A 1JROA 3CS2A 5EBAA 1RD6A 3MYOA 4AC7C 3FDGA 1RJQA 4Z42C 1MEHA 2QCFA 4XKMA 3RLHA 3ZXWA 5ABEA 3G3MA 4HZMA 3KW3A 2PUZA 2DV0A 1F9CA 2NXHA 3ELFA 4RZ6A 4YNGA 1K02A 4LAMA 2G50A 4UR9A 2WW5A 3DI0A 2SFPA 1ZALA 5BXTA 2FB3A 2R8WA 3CUXA 4YN5A 3W2JA 1YRRA 4E2BA 3EOUA 4ADUA 1PO9A 1XV8A 4GACA 2VWSA 4AHQA 4HNUA 3LXCA 5F4XA 4CGTA 2XYLA 3QV8A 2Z00A 1WB0A 4AWTA 4F2TA 4UCFA 4F40A 1XLJA 5AC8A 3VIMA 3JR2A 2QGYA 2GVEA 3IVTA 2VR4A 5G5IA 4H4SA 2WOVA 4OU1A 3C0LA 3B8SA 4NAEA 3VMNA 3WF0A 2ACRA 2V5BA 3MUIA 3CV1A 4KQNA 1JUBA 3PB0A 4F9JA 4N02A 3L65A 3P74A 3WLQA 2A1YA 4HN8A 2QVNA 3GD6A 5U4NA 3IEBA 1VJSA 4EPDC 1GZGA 4DJFA 2VYOA 3DFYA 2ZC1A 4B16A 4FOJA 1VH7A 3QW3A 4DELA 2YBVA 4PMVA 3KRZA 3W1LA 1J18A 5ABGA 1XRSA 1H0GA 1OG6A 1BFNA 3QHNA 3O07A 1TV5A 4P7RA 5CAKA 3C86A 1KBIA 1ICPA 2Y61A 1T8QA 2PU1A 1NELA 3BTNA 3PB2A 2A7PA 3TX9A 4HMCA 4IMEA 4NZCA 3R4IA 3A12A 3VMOA 1QMLA 2AAMA 2NSOA 1ZCCA 2WSPA 3KAOA 4GK8A 2IMRA 1RR2A 3AMCA 3PVFA 2C1GA 1HJWA 2YPIA 4P2VA 4CU8A 1HUVA 2C1HA 1Q6OA 3MW7A 3OHMB 4OFCA 1Q2SA 1CECA 1C8QA 4Y2WA 2F84A 1LT8A 3O6AA 4AX6A 4H9YA 4EIVA 4YMZA 4GQRA 1F5ZA 1GG0A 7TAAA 1VEMA 1MUWA 3N18A 4AWEA 1T7LA 1OD8A 2BGQA 2VC6A 3KUMA 2HMCA 5LNRA 1F8WA 2ZA3A 4WY0F 1DIOA 1TYGA 2P3ZA 3IWPA 3P61A 4W87A 4XISA 1FCUA 3GC5A 1WAUA 4FX6M 2GPTA 3A21A 1TR1A 4JNZA 3DFOA 1XFCA 1TSIA 3D46A 4WGHA 3BW2A 2EO7A 3UVAA 3CHCA 1G67A 3NIYA 4IGMA 3VMPA 4ERGA 3FSUA 5E0CA 3V5CA 2G8ZA 2Z7KA 4H8HA 1SO6A 4IIFA 2X8RA 3EWYA 2C7FA 4KRZA 1XLKA 3E12A 3I6RA 1CWYA 3P5YA 1MQPA 4G7EB 4HCHA 4XIAA 3N19B 3W1NA 3FDKA 4LVGA 4WIWA 3CYVA 4F0MA 5JCIA 1UZ4A 1LQ0A 5I77A 4LB3A 3H2MA 4JIEA 2GDQA 4HHPA 3W4RA 4LU0A 2I9UA 1W9BM 4ONVA 3AAMA 5D09A 5A6BA 4A3HA 3CU2A 5DRCA 2VGIA 1OK4A 2WM1A 3E74A 4XO6A 3PBWA 4UR7A 3W27A 2FMOA 2PWVA 3G1RA 4LS0A 1XYBA 3ZWTA 3TYDA 2QMJA 4LUTA 4WEVX 1OCJA 1PIIA 1YKWA 5BRBA 1VRXA 4R34A 1ELSA 3WFAA 1TO3A 2PP1A 4H9ZA 1V0LA 4FNQA 3A4JA 3SDOA 1B5TA 3MCNA 5I3DA 5EFFA 3BMWA 3S3GA 2OZ0A 1J11A 4JYDA 3BLLA 5TR3A 5HJLA 1E55A 4JN7A 1QOXA 1JULA 3BLDA 1TFVA 3WNLA 3WNKA 5REQA 3NQGA 3RX2A 2J8TA 2JK2A 2VCAA 5EMLA 3NPVA 1MFUA 3AXXA 3WY1A 1X96A 2WJZA 1TE6A 3IJ8A 4N4QA 1GXFA 2QUMA 4JAWA 4CNSA 1NPXA 4JQAA 1J8VA 5CPTA 1ITCA 3ZSTA 2VGGA 1HGYA 3ABRA 1JZ8A 3DEQA 1N8WA 4S3EA 3ALGA 3AUJA 4ICCX 4ECLA 6PTDA 1QO2A 4IMCA 1X7IA 3M0MA 2YZ5A 3WLOA 1I2NA 1UR3M 4JTKA 1VQZA 1UWQA 3UBPC 4BR1A 1Q6CA 1GYMA 1LTDA 3L66A 5G1TA 1YMYA 4IG2A 3PWAA 1XDJA 1IEVA 4JKKA 4HBKA 4C6FA 1QU4A 3SUWA 4M24A 5JH2A 3GIPA 4PZVA 4H19A 2DVXA 1DWIM 2ACUA 3W7DA 3GTIA 1F74A 1J96A 2NXIA 2YFNA 2DZAA 3V4BA 3CIXA 5CSSA 1VFTA 3MTWA 1ZAJA 4DNMA 5M03A 2YDAA 4LAUA 4BV6A 3PZOA 2YCJA 4E3VA 1M3UA 3QF0A 2YLLA 4H3DA 4H9VA 5A1AA 3SJ3A 2EQ8A 3OLDA 2IW0A 3CB3A 1A3XA 2ZRWA 1O94A 3KXQA 1JUEA 3MJYA 1E9YB 3OBKA 3E0FA 1VBHA 4A3UA 1BZLA 3K8LA 4LRTA 4O57A 2OFJA 3S0CA 4MWAD 1W9XA 3FS2A 5DMLA 3MVTA 1FHDA 2AAQA 4B92A 3TZNA 2QAEA 3AOFA 4DUXA 4BI7A 3TQKA 1U33A 4QQ3A 3W86A 4MY8A 3MP3A 2XFWA 4LTSA 1FRBA 2A8XA 1M53A 1JYVA 1EX5A 1PSCA 1UA7A 1G4SA 4CD8A 3CQ0A 3DGHA 3NCOA 2DUXA 2EJAA 1KFEA 4EOUA 5IRPA 3S2NA 4O53A 4BFAA 2Q71A 4GUFA 2XGBA 1UJQA 1RY8A 4HJWA 1ECQA 5DCEA 3XISA 1ZJIA 5CC3A 4D72A 2HBVA 1BYBA 2I5IA 1GOMA 3G1SA 1N8FA 1PE1A 3H4XA 1X38A 4H6QA 3WLNA 5T91A 3VM7A 1S5TA 1VRDA 2D23A 4PUWA 1EOMA 3DKJA 5CAHA 3AIQA 3CPRA 4A22A 3DN5A 2P76A 3DHPA 5U7SA 3NM3A 4NF7A 3W0KA 1JRPA 3EDFA 4UFKA 3BSHA 2NQ9A 2JBMA 5A95A 3QKZA 3OYZA 4JX4A 4WOQA 1UKPA 2CZDA 4A8IA 2GGGA 3WL0A 3ZSSA 4HPHA 5KINA 2BVTA 1JDDA 4DJEA 2QPUA 1WX0A 4ZB2A 3KBNA 1FWNA 2XM1A 3N2BA 3B03A 1U22A 2RFGA 5D2WA 3B04A 3KBMA 4GI9A 2W0HA 1X1OA 5BXPA 4Z1AA 2HRWA 3DK9A 4BQ5A 3BW4A 2VHLA 3APTA 4WSHA 3UXAA 1VBJA 1BWVA 2ZRXA 2A3BA 3G1XA 2YVFA 4Q3MA 1E51A 1LWHA 3TNBA 1VIWA 2J7HA 2CESA 2W55A 4Y6GA 2EPOA 4L6DA 3KBWA 3P14A 5BU9A 1DIEA 1GVSA 1TREA 2XH7A 3A5FA 1VB9A 4IMFA 2IUZA 4JTDA 4IISA 1Y8BA 3TV8A 1I60A 1QPKA 1UC4A 2I17A 1PKYA 4FS9A 1EIBA 1NJJA 1H3GA 5FL0A 4ORMA 1G5AA 4E38A 3P7YA 4M6PA 3NXFA 1Q1RA 2OJPA 2PCQA 1OX4B 2CHRA 1HFBA 1G7VA 1SMAA 1FUYA 4PUJA 1AVAA 3WK1A 3U2ZA 1G01A 1UH3A 3BLFA 3QSTA 3LHZA 1PV8A 2JEQA 3B0XA 2I14A 2E09A 4Q8PA 3W6YA 3LCIA 5EFDA 4PSPA 3GG7A 3C0SA 1UD8A 1DJIA 3BOFA 4J27A 3R8GA 4MMWA 1W8GA 1U1UA 1W0MA 1ADSA 2W79A 2WHLA 2DZUA 1H7NA 1YLVA 2NX9A 4WXYA 1AJZA 2GDVA 1CT5A 2YLAA 1DJQA 3TXZA 1W3NA 4LUTB 5C7HA 3P60A 3W70A 5LNVA 4UBPC 1HQTA 3ZVIA 3G1DA 5F2LA 4R5EA 4LAKA 1FFQA 1V6WA 4IX0A 4B9YA 4IFKA 3GW3A 3U7VA 1JCLA 5CBBA 4YWOA 3ARYA 3W6LA 2OT0A 4A21A 1QUMA 3SIZA 3WQGA 2PC4A 3OA5A 2X30A 2BOFX 2OR2A 2XJ7A 4KFOA 3NL5A 1VDVA 4X9YA 3W26A 1R3SA 2PZ0A 2R9ZA 3W87A 3EPOA 3MBDA 4TVDA 3D0CA 3WENA 3L0KA 1H50A 4C5YA 2E5BA 4C6IA 4XAFA 3GD4A 5CGQA 3IACA 4PTXA 1V97A 5D2XA 4QITA 5GNYA 1KM0A 1X97A 2AGKA 2L5HA 4Z2GA 3N2MA 2VGBA 1FECA 2XWDA 4GXPA 1TX0A 1ITXA 1AFSA 1LCOA 3T2QA 4DI9A 4J3SA 1ZMDA 1S2TA 3PBVA 1DXEA 3NYZA 2GWGA 2ZICA 2WHKA 4L6HA 4DF2A 1S2WA 4MF4A 3H7VA 1JCTA 1QR7A 3EMQA 1VGAA 2Y5SA 3WDRA 3VKDA 2QJNA 3MI6A 4NJHA 3UWEA 5JIPA 4MLJA 3QRHA 1MYRA 2O9RA 3KRBA 3VCNA 1R7OA 3UETA 3UWYA 1UD4A 4JPGA 2XWEA 4D6IA 1KFWA 3BAIA 4HMDA 2HEJA 5C5YA 3PSWA 1NQKA 1DXFA 4YTRA 3D6NA 3HPXA 4RKAA 3HG5A 1YX1A 3VGDA 1T40A 3EMZA 1FX6A 4OT7A 5FJJA 2PDJA 1TR9A 2QLYA 3K5XA 3VZXA 3MANA 1XSIA 4RCXA 2JF7A 4IQEA 1GOWA 3PSVA 4OJYA 2GK1B 3OLGA 3OGRA 2DORA 2HXTA 5TD4A 3EEZA 3E5BA 4H8NA 5DLCA 1FWAC 3VAVA 3NQ2A 5A6TC 4XX6A 5A8OA 3M4HA 2E9LA 4H83A 4IMDA 3RR1A 4DEFA 4I5XA 3R7MA 1HZYA 4ZB5A 1ONFA 1BWCA 3ZWSA 1XBVA 4H4QA 2CZ5A 4B5WA 1HKVA 2VCCA 1NWRA 5DBUA 1ZY9A 4JIRA 3DK4A 1XLCA 3CASA 3BG5A 3QV7A 3MSRA 1MDLA 3APGA 3GZAA 4AIEA 2RDWA 1B3YA 3NQ6A 3UWWA 1KCZA 4NT0A 1RCQA 3LNMA 4M0XA 2WBKA 4IMAA 3D47A 3QMTA 3R58A 1XIMA 3LXAA 1W1TA 2VP8A 1D7FA 3EWCA 1DBTA 2CKSA 3TKFA 2ZWYA 1IYXA 4UR8A 3TYCA 3L23A 1GOKA 3BAWA 1LLOA 1TKKA 3NO5A 5G4WA 4X9SA 3WJZA 1MXGA 3C52A 2E5DA 3GNOA 2P8CA 3SCUA 3Q37A 1QHOA 1SJCA 1OYBA 1K1DA 3QTGA 2A7NA 3BAXA 3QZEA 1QPOA 3U5UA 1XDLA 3GTNA 3INPA 3GHUA 1GVQA 1VD6A 3ITYA 3WJYA 3GQYA 2Z7GA 3VI2A 2DT3A 3W24A 4P61A 2FZ9A 1H62A 4KWVA 2Y7DA 4H4WA 3QFWA 4MOZA 4XD5A 4WX2A 3TJLA 3XIMA 1F4HA 2JKPA 2C14A 1WV2A 2PGFA 3LV6A 4XSLA 3UT0A 1GRAA 2P1FA 1K8ZA 4XIMA 4IIDA 1PTAA 4UB9A 4TO8A 1S46A 1J5SA 3C2EA 3EWDA 2OMAA 3A5VA 4FNPA 4ZO7A 2ZZ7A 4AWUA 2YAUA 4PUMA 2NWSA 4LBUA 5JMUA 3TCEA 1BEUA 4AHPA 5LZLA 3W6MA 2YCKX 2W63A 2XZ9A 3I68A 4C1KA 1B1YA 2Z28A 7ODCA 3KE0A 3NL6A 3KWXA 2IKHA 1W9UA 1SU5A 3WLJA 3ARVA 2BXZA 4L4PA 3H70A 1R47A 6ALDA 1TJ0A 3AYVA 3E49A 3TWAA 2HROA 3MHUA 1SO3A 1TYPA 5I78A 1EHAA 3GFZA 1TZ7A 2Y88A 4M7TA 4FX9A 3TTOA 2AKZA 7CGTA 2FTYA 2Y89A 2FZMA 2R1NA 4QEHA 2GWNA 3WLIA 2CLLA 1W1PA 1H09A 3CO8A 1SZGA 5J04A 1JGIA 3SQLA 3UPWA 1PJ9A 5D9NA 5A6BD 4C90A 4U33A 2X2GA 4AVOA 1FQ0A 2YDSA 2RH9A 3CHDA 4JZ5A 1OT1A 3PBYA 3JZEA 2ZKMX 4H4VA 3PFMA 1O66A 3H2CA 3AXMA 2FVMA 2Y7EA 4RXGA 3H55A 3EDJA 1UMYA 1EC9A 3T8QA 4JTUA 2MNRA 3SRKA 5CGTA 1GWJA 4IIGA 2FB2A 1W5PA 2HJPA 2ATSA 3DFNA 1E15A 4FI4A 2VQUA 3W1XA 2QEZA 4FO4A 2GRTA 1JZ6A 1DOSA 4ICMA 1GQJA 2EEXA 1GQKA 1HP4A 2WOWA 4KFNA 5IFPA 3DG7A 4DNAA 4ZA0A 4QFUA 2PDLA 3BICA 4JTRA 3TN5A 1EXPA 2F38A 4JX5A 2GJRA 2HCVA 3TW6A 3H4GA 4J35A 1UWTA 3G8RA 2WQDA 2FPYA 1KWKA 1W1B1 5LXEA 1DJWA 5I00A 1V3MA 3SI9A 1IR1A 2OWXA 4PCFA 2ZWZA 1JQXA 5LGXA 1E0VA 4DYJA 3QY8A 2AQOA 4UTLA 3AHVA 2YYTA 4HYWA 4Z0SA 3IC9A 3COTA 3C2RA 3BURA 2WZTA 4Z17A 3RX4A 1FWTA 1PS9A 2ASHA 3W07A 3ME3A 2FTPA 1DQUA 4KT2A 2X99A 3AZRA 3H53A 4N2YA 2QV5A 4GRTA 4IPIA 1LROA 4ZCWA 4GG9A 1K9EA 3AJXA 1CLVA 1MO9A 2CZFA 3M43A 1V0KA 3E02A 3NVWB 2E9BA 3FVDA 5LNUA 1E6RA 1DIDA 4PR4A 3P84A 4H4UA 3CUFA 2NUYA 3PZVA 1J0JA 2MANA 4P7QA 1NDYA 4AEEA 4N0RA 3RLUA 3TWBA 4MHBA 3SR7A 1Q6RA 4P8UA 1XIEA 4GZ7A 2OPJA 5BRQA 5FSEC 3QFEA 1YHTA 1E56A 3H2EA 2G3MA 2ZUMA 2GOUA 3DENA 4IT1A 1EGMA 3VDGA 4I7UA 5FS7A 1E1CB 1EJWC 1P5BA 1QI2A 4S38A 3NG3A 1FA2A 3PZTA 2A0NA 2DDXA 1PWLA 2W5FA 2OODA 5KETA 3KOZA 1OX6A 2DGAA 4HNCA 4QROA 3QQ1A 4YVPA 1OJXA 1ZMCA 2WXDM 3WLPA 4U3AA 3CGBA 3PNUA 3F5KA 3UWVA 2WCAA 1B3ZA 2PBGA 3AU2A 2EPNA 3VNIA 2FZBA 1W17A 2P8BA 5BOFA 4KWWA 4NJIA 1FWIC 3MYPA 2WBAA 3AS1A 1H51A 1CXIA 2WNZA 3EBVA 1XBYA 1CTNA 4ZQOA 4FAMA 4GIEA 3URBA 5AC4A 3WH7A 3SSZA 2OLAA 2XIMA 2EPLX 4JFUA 4IP4A 1THFD 1MNZA 1Z7AA 4MTVA 4UMBA 3UJEA 4S2BA 2DZTA 1N8IA 4K39A 1E9IA 1QK0A 2YDQA 2VC5A 1GREA 3PHAA 3CQKA 4QQUA 2PDCA 4EANA 4WK9A 3MA8A 1RH9A 2POZA 2ALRA 5BZAA 2RJHA 5EMUA 3M0LA 4DAFA 5D2TA 2J7FA 3SSJA 4XB3A 3KEHA 3WD0A 4PGLA 3E0IA 1OB0A 3DOPA 3T0BA 4XG1A 5D38A 4HU0A 4D6FA 1BYCA 4HNLA 1W3LA 2JKAA 3VOCA 3LRMA 3H7RA 1Q4NX 5CZKA 2PDXA 1M1BA 2ZE3A 1CBGA 2Y8UA 4X22A 3F5JA 1TTIA 1I1WA 3ITOA 3WMBA 2E77A 1Q6LA 1KW1A 4U4MA 4QJ4B 2PWEA 3CPGA 3W84A 3GVWA 1PTGA 1VFHA 1YPIA 3GH5A 4MKNA 3WX7A 1ZL1A 4FNTA 4ILSA 2O9TA 5GNXA 3CHEA 2UBPC 4AQLA 4A05A 1KRAC 1RQEA 3CAKA 4ZO6A 3BDKA 3GD3A 2WM0A 4A4AA 3OQ8A 1HT6A 3O15A 3USBA 3S4TA 2GVJA 3QTPA 4TV5A 2VELA 1MVYA 1GGOA 3PAOA 3SCQA 4O54A 4GI8A 2OZ8A 2ZXDA 2YBTA 3L2MA 1PWMA 4KETA 3AIVA 2WLYA 2VUYA 4NHVA 3W23A 2XG9A 3BH4A 1UIOA 3THDA 3ABQA 4D8LA 3NURA 4TR9A 2WK2A 3H23A 3I3BA 2OQLA 2PDPA 1KFCA 1WZAA 4HA1A 1S1RA 2G5WA 1AL7A 4G5DA 3LPOA 2PP3A 5BYWA 3GKAA 5TBOA 4YTQA 4DUOA 1IV8A 1T8XA 3WLLA 4N9EA 2WP6A 3VOJA 3BCJA 4DO4A 3FHAA 5KVIA 3WH6A 1UKQA 3W83A 1A5SA 1OCQA 4H8VA 3S1XA 1XDIA 2BVDA 4M5PA 2V82A 5ABHA 5CC6A 1VKFA 3UZYA 1BQCA 1BGGA 3RAOA 2RDUA 1EA0A 3ABZA 1QI5A 3POHA 3GNDA 2OGJA 3OVQA 1YE6A 4JXCA 4AF0B 4LB4A 1A5KC 1EWEA 2UY2A 1J0ZA 4K2SA 3WQVA 2PFHA 4U2YA 4L1XA 4GH1A 1S3HA 3DECA 3FXGA 1GETA 1US2A 2ZE0A 2C3ZA 4K68A 4LVBA 3VC6A 2NT1A 1GTEA 3S6DA 4PL1A 3UA3A 1EL3A 3TNOA 2VOTA 3PUDA 4NRRA 4IX2A 3VX0A 3FJLA 3WFLA 2B7QA 3OVPA 1KBLA 3NAVA 3WQEA 2OEKA 3BG3A 1MNSA 1FWFC 2INZA 2W6RA 3QMSA 2A3EA 2Z2UA 1IXQA 2YIHA 1IWPA 4TVYA 5CJ5A 1BQGA 1RALA 2XIQA 3E2RA 2YL6A 2DVTA 4H4IA 4PB3A 1E3ZA 4LNCA 3SBFA 3TLQA 2X0SA 3P8IA 2PF0A 2D0FA 4U3CA 3IIPA 2HTMA 2Y7FA 3ITGA 1XPGA 1EHNA 4D2JA 4DNHA 1Z9AA 1DYSA 4V27A 5CC5A 3GK0A 3Q58A 3MJMA 3AISA 3QW4B 4IXHA 3S2JA 4FHAA 3VINA 2QAPA 1AD1A 2R24A 1NQ6A 2NVDA 3IJQA 3EUB3 3GIYA 2X1UA 3VDCA 3II4A 3MI3A 3VGGA 3LK6A 5EMMA 2PGWA 3RRXA 2ISFA 3NPUA 4ML4A 1D2KA 4KPRA 2Y0FA 4C6QA 3C61A 1SFSA 2HXUA 4GYFA 3KZSA 3CAVA 4I6KA 1MXSA 2H9AA 1VFUA 3BLOA 4DJFD 1T41A 3GC2A 3M7SA 1OT2A 1GVEA 2GR0A 2A3LA 4LF2A 1PVNA 2VXNA 2CLIA 2BC1A 3AHYA 5FS8A 1EDTA 2PEVA 1XLGA 2QQ6A 3ITVA 4Q6XA 1RD5A 3PANA 3LPPA 2UV8G 3A3WA 4DJFC 2XGZA 2DUZA 4EM4A 1F61A 1Q4WA 1CI1A 2PWGA 1EP1A 4LANA 1GK8A 2UY4A 3EB3A 4AZ7A 1ZRQA 3GXNA 1C7TA 2I5QA 4N9CA 1JXJA 2Q8ZA 4XQ6A 4DIAA 3CL7A 5IFTA 2CLHA 4ZOHB 5GQBA 4B2DD 2P3EA 4W8LA 2V9DA 4H4RA 2P5NA 4HHHA 2B31A 1Y5XA 1H7OA 3ANUA 4WXZA 3VM5A 4HMNA 1P48A 2GZXA 4GYJA 3TYAA 5HPOA 2AQWA 3SN4A 1IIHA 1GZJA 1IR2A 1M9HA 4LS2A 1EQPA 2XH4A 3F4CA 2FFIA 4TX9A 1KB3A 4S3KA 5E1QA 2GOKA 2PGEA 3KS5A 1J12A 1FXPA 1EB3A 3AN1A 3DHDA 4NG3A 1JZ3A 4S3FA 3WMLA 1PBGA 1Z69A 5CCZA 3DGZA 3O7UA 1Z41A 5HUPA 1XLIA 3WDJA 1KR0A 3QH2A 1STZA 4WGXA 4S3JA 1CZ1A 1MMFA 1F3XA 2XIJA 1GTHA 1ZUAX 4ENLA 1DQWA 2J4GA 3HBLA 1PX4A 2V5DA 3LCHA 5I6SA 1S5VA 1JPDX 2VUNA 2JQXA 5LHEA 1NU5A 3WF2A 2J62A 4PC8A 4JBRA 1GW9A 3EXSA 4NXKA 2F6KA 3S6OA 2G41A 1JOAA 2WB5A 2BY1A 3THAA 5LGZA 2WHJA 4PMNA 3EAOA 3C2YA 5CG7A 1OFBA 2QULA 4GQQA 3BE7A 1L9WA 1BHGA 1SYTA 2WAGA 4NJKA 3BGGA 4C6LA 1H7WA 1HKMA 3M46A 2DZWA 3ARWA 3HOJA 3SUVA 4LW7A 3VOFA 2J7DA 4MNMA 1DJXA 4D1IA 4FLOA 3RMEA 3LV5A 3U2CA 4CCEA 2NQZA 3MBFA 4F66A 4YWIA 4GUHA 3N15A 1CIUA 1D9EA 5AVHA 3BV4A 4XZBA 3HMCA 3IUDA 2G3NA 3N6HA 4M1RA 2D3LA 1A47A 4PMQA 4L65A 1KGUA 3TTQA 2I5GA 3NQVA 1W5MA 3UNDA 1REQA 2J7EA 3A22A 1ZFJA 4H6KA 1A3WA 1NWSA 3GXIA 4XSMA 1EA9C 2V8ZA 1YW1A 3OW1A 1U1JA 3M0YA 1RA0A 4FXSA 1O4UA 4PRRA 3TVAA 2QCLA 2PU0A 1P1MA 2BY2A 4UOQA 1VP5A 3FY1A 3AHXA 1QXLA 5M3WA 2G37A 1KKOA 1IXPA 1XLEA 3MU7A 3QZAA 4C7GA 2HQMA 3UR7A 9XIAA 1I0DA 1S2UA 1V77A 2OT1A 1ONWA 5A2CA 4NILA 3KDOA 5I09A 3DERA 1IGSA 3KL0A 2BSLA 1J79A 1MRQA 2QDGA 2AOSA 3IJDA 2WPFA 4KIRA 2Y4SA 3WBYA 3SZ8A 1CB7B 3NFUA 4WDXA 1XGZA 2AL2B 4HU4A 1KM1A 1GEUA 2POTA 1GHSA 1TZ9A 4E2DA 1JFXA 2CW6A 1YPXA 3SUSA 1TVLA 5AECA 3DUGA 3NVYB 2FKPA 3C4UA 5AZ1A 1I2PA 4ATWA 4XBKA 1G4PA 2PDMA 3S5YA 1G9HA 3CMGA 3QBUA 1I2RA 2WSKA 4KRUA 2RJGA 4WQ6A 5D9MA 1VFSA 3CH0A 4F79A 4NJGA 2CXEA 2GR2A 4F0RA 1AH4A 3G0UA 1XC6A 4KS0A 2VC7A 3GYCA 1ZHAA 8TIMA 4CEUC 4MWAA 2DH3A 1C8VA 4E5TA 3LG3A 1B0IA 4S23A 3QZ6A 2A7RA 2HSAA 3WLKX 4DWSD 4PTDA 4Q4SA 5IOBA 4GUIA 4HK5A 3PN8A 4INFA 2VR5A 3H22A 1N7KA 1EJ7L 2B7PA 3FJNA 5FJIA 1X6NA 3QPZA 4EXQA 5EMKA 4US5A 1IZJA 3CZ8A 4Y7EA 2PDWA 4JEJA 4LC6A 3M0JA 4GY7A 4EQWA 2WMKA 3GNRA 3HPSA 4EF9A 3MDUA 3W7NA 1VYRA 2RGLA 1UKSA 4NYYA 4NKCA 2DH2A 4IL0A 4N6EA 4QSFA 3MZNA 4FIQA 4BS0A 1JYNA 4UOJA 1OIMA 1WXJA 1H49A 1LG1A 2YW4A 2VFEA 3NVDA 2OOFA 4PCPA 2TPRA 2ZDSA 2D22A 1TV7A 4GE8A 3HGJA 5MKGA 7PTDA 3GU1A 4EAMA 3OPSA 1BVNP 3U7BA 3S1VA 4I6VA 5CZJA 2V2HA 1ZQ5A 1MSSA 3MQTA 3ZVHB 4YTUA 4UQAA 5FEZA 1XIDA 2PWUA 1TX2A 3N2OA 3I3EA 1HJUA 3OLEA 3K30A 2VGFA 1NF7A 2YW3A 3MVIA 3UJ2A 3BLEA 1JI2A 1YEYA 1KCLA 5C0QA 4CD6A 2BXYA 2ISSA 3CIWA 1UKOA 4PMJA 3PPCA 3VNDA 4GZEA 4W93A 4EMJA 1Z42A 2IXUA 4RDZA 4LA1A 3PJTA 2JFEX 5TAOA 2DW7A 1EF2A 4NZFA 4B5UA 2CHNA 3QC3A 1RUSA 1KLYA 2QS8A 1FHUA 2BY0A 1K77A 1W6TA 3WF3A 4LUIA 3ZMRA 1GESA 5EMYA 3M0HA 3U0HA 2Q01A 1SW0A 5DCBA 2RABA 2XH2A 3GNPA 3UWZA 4QSHA 3G0SA 3R5EA 2NLYA 1NEYA 3WBEA 3MUXA 4QEEA 2C71A 4M51A 1V0MA 4HN4A 1JYWA 3WNOA 4Q7BA 3LENA 1YQZA 4O14A 3BC9A 1NDZA 3K1DA 5DBTA 3CWHA 1ONEA 4F0KA 3ZR6A 5C71A 1PIGA 4PBGA 4GVFA 3LB8A 3G2GA 4J56A 2IKIA 3G77A 3LHUA 5A6SA 1QPRA 1DVJA 2VI0A 1F2JA 4AZGA 2HK1A 3MPGA 2J7BA 4POCA 4AHOA 3NZRA 3L67A 3T07A 1YIXA 3CIVA 3H24A 1ZCOA 1FBAA 1UW9A 1FWCC 4GUJA 3T09A 3IGUA 2FPVA 4K1GA 3H4WA 1K9DA 4F2BA 1AZ2A 2QCMA 4MY9A 3W85A 1E72M 1U1HA 1UQYA 2FHBA 4O16A 1RPKA 4F0HA 3TSDA 4CQCA 3LI0A 2R94A 1GORA 1DE5A 1KBKA 3AICA 2XIBA 1KRCC 3MS8A 3GC4A 3NVVB 3CUIA 4J3WA 5A6MA 4OBSA 1EGZA 4ZQRA 3KLKA 1ICQA 2QV4A 3GVQA 1US3A 1OFDA 3BMVA 1PDZA 1L8NA 2VFFA 4LUSA 1F4AA 4IJBA 1FHLA 5FCZA 5LXXA 2OCZA 1XYCA 5HWJA 3A6OA 3IJIA 5I3HA 1KV5A 1NFGA 2Z25A 2H6RA 3MWCA 3B8TA 2XSAA 4XK2A 2Y1HA 2YB4A 2ZUWA 5KSWA 1MXDA 3PK7A 4JTJA 4L1WA 3V0TA 2Y8VA 1V4YA 2FGZA 4GGBA 1MW0A 2GR3A 3VD7A 3CL6A 1JF6A 3N17A 2QDHA 3B97A 3S2CA 2AGTA 2J6VA 2ESCA 1ZX9A 3C0JA 3NYDA 4AMCA 4NYUA 4B3LA 2YB1A 4YL2A 1RXOB 1XHGA 1XQKA 3L4VA 1K4HA 5H1WA 3HPZA 4EMIA 2OYMA 3HGRA 4AISA 2DJXA 2ZQ0A 4Q22A 5BOEA 4PBEA 3AJ7A 5DT7A 1XXXA 3M0XA 3M5XA 3AO0A 1H2IA 2QXWA 2EQ7A 5HAOA 4FR6A 4O12A 3NJ3A 5C2XA 4AX7A 4CQBA 4QTGA 2F6XA 5M17A 5LIWX 4PEEA 2Z1WA 4O0ZA 3BANA 4S3DA 1EX1A 1ZPTA 3GFXA 2VD9A 3PNZA 2V30A 4GFSA 4HZ8A 4JTFA 4LPCA 4NZJA 1RV8A 2OTDA 2DSZA 4WDWA 3PBUA 1TPDA 2BVWA 1U83A 3GRIA 3B9AA 5EGRA 3MV11 2OVLA 4Q8UA 4GO9A 1UUMA 1VLWA 2XSBA 2EG8A 1BG9A 3WEZA 3STFA 1BLIA 3NA8A 4O0KA 4UTUA 1GEHA 3G1HA 2LLEA 2J9XA 3I6EA 5K9CA 3II1A 5FI8A 4UFMA 4AC1X 2GQAA 3GDMA 4XBJA 2PSNA 3ZZ1A 3S5SA 1SR9A 1FH7A 1GERA 1G7UA 3CHVA 3IJ6A 3F4VA 3CQHA 4CCCA 3GXMA 4ZOCA 1OG0A 2PD5A 3T0CA 4GHRA 1ME8A 1CXFA 5BW6A 3ZLHA 1Y0EA 3LCWA 1ISZA 4ZE5A 3T78A 3D9XA 2QW5A 4UMAA 4C1NA 3CZLA 3EOLA 4RR4A 3W02A 1CLXA 1UA3A 4OOZA 4CN4A 3OGVA 2BMBA 4ZQCA 4D6HA 4JHOA 4Y9OA 4M56A 1MDRA 1UQZA 1P0DA 3MMUA 1ZJHA 5JBDA 3AWNA 1DV7A 3WLSA 6REQA 2VX7A 3NPXA 3TOPA 5KTLA 3WJSA 3LHWA 1PTDA 3N2CA 4UTKA 2WC4A 1HL8A 4QE1A 4FF7A 5LHFA 1OYCA 3DGRA 2OSWA 3GBEA 1IXOA 1FP8A 4WJ8A 5A8GA 1JAKA 3OGSA 1HVQA 3Q94A 2RKXA 2J7CA 2CLFA 1UMLA 4L6OA 1J0IA 5C55A 4X0NA 3AXKA 3H6OA 3WZ0E 2VRJA 1AG1O 1W5OA 2QJJA 4O4VA 4M6UA 2WPEA 3CTTA 3NZ1A 1WDRA 1RAKA 4Z2KA 3F1QA 2R1MA 3TCSA 3EANA 5CBIA 1GQNA 2EQ6A 2YOCA 4O28A 1UZ1A 1OZMA 2YX0A 1JI1A 3L5OA 4O17A 3QM3A 1IE7C 2ZZ6A 5K3VA 3TK7A 2WHMA 4ES4A 3UG8A 1XIHA 2E8YA 1OWQA 3PJWA 2EAWA 3TFCA 3VUPA 2XH0A 2DSUA 3LGEA 3QHMA 3UPMA 1L6FA 3M5YA 1N63C 1EQCA 3RYSA 1B3OA 4DXKA 4E4UA 5GJPA 1WKEA 1A5OC 1GQIA 5KZDA 1GPFA 2CWNA 5CPNA 1ZP3A 4F3HA 2ZZ5A 3TP4A 2XFYA 4FDCB 2X7WA 4EKJA 5H8MA 3N4FA 4GJIA 3PJXA 4PB4A 2Z29A 1GJPA 4MDOA 1FEBA 3DH7A 1WDQA 1XIFA 2IPWA 2E9MA 3P0XA 2DW6A 4LF1A 5LIKX 2ABBA 3AXIA 3MCOA 2ADAA 3UP8A 4EXBA 3R07C 4FXRA 5DN1A 1KFKA 2CFFA 1B57A 1GW1A 3DG3A 5CKSA 4P8XA 6TIMA 1KN0A 1XUZA 1WZMA 1GSNA 3Q6JA 5AHMA 1UYQA 1XGEA 4J2MA 2WV8A 4HA0A 1QI0A 1Q7MA 3URHA 1IT8A 3ZJ8A 2PLJA 3CMJA 3W7LA 4HQVA 1F76A 1ADOA 4FALA 2EBNA 2OQHA 6XIMA 3BOLA 2J25A 3KOWA 3WQCA 3PUOA 5E70A 2NV1A 5D2YA 1X39A 3CYJA 2P53A 4EX4A 3VIPA 1TQJA 4EWND 1C8YA 4OOUA 2IQDA 4O0QA 3E3HA 4JN6A 2QR6A 1BTMA 2J77A 1WDSA 3DC8A 4Y8EA 3VIHA 1M04A 3E0LA 2FH8A 3THUA 1WZLA 4QJ3B 3HPAA 5CLTA 4WR3A 3SJNA 1JL8A 4DZIA 2FDSA 2ZXQA 1H4PA 1RSCA 3VE9A 3VCCA 2WVTA 4FNSA 3ARTA 2GYIA 1RLCL 4JTTA 1VFFA 2A6NA 3IV3A 3HG4A 1UR2A 3I7SA 2V2CA 5HBFA 3UFYA 4GH3A 3UVIA 5D9OA 3FOKA 3EA3A 1V3JA 1U5JA 1DEDA 4FX8A 4BJHA 1JDCA 1GNXA 3IIVA 3GX9A 2EG7A 4BWLA 4HKPA 4IGNA 2P88A 4LRSA 4ASTA 1HO1A 4BQ3A 3LM3A 1CEOA 1O1HA 3QQWA 1VPXA 2OOGA 4PL2A 3WD2A 1J0HA 2OG9A 1S2CA 2BHZA 2BFGA 2TAAA 3E1F1 1RCXB 4Q8NA 1QT1A 3A4WA 3NUKA 5C2GA 3LGDA 3W7QA 3DYOA 4IGHA 1F3EA 4GX9A 1UOZA 4Q4PA 4WVXA 1RJPA 3PP7A 3QGVA 3GE7A 4DJED 4W9TA 1GPWA 7REQA 3IRDA 5FF7A 2BC0A 3VNYA 3AMKA 3NVTA 2YXGA 3NQ7A 3GVGA 1LOLA 2CFYA 1SM9A 2PDFA 1WP6A 5FAJA 5EB8A 5G4HC 4IIEA 3CAWA 4TVUA 2ATMA 4OVXA 5J8LA 1NP0A 2E7FA 1QDSA 1YBQB 1EFZA 4XBSA 1KFJA 4JQ9A 1E0XA 3AS0A 1SZEA 5K2ZA 1E1EA 3O06A 1E5JA 3GDTA 4GVIA 3NR0A 3UG5A 2HV5A 2ABAA 1VJZA 2FYMA 1R3WA 1LRQA 3TTSA 1AQFA 2C0AA 1FDYA 3N14A 5K4ZA 3WFZA 1W37A 2YR1A 2HK0A 4R88A 4K1WA 1TELA 3A64A 4R27A 5AHFA 4CNUA 3E5PA 4JQ2A 1QOQA 4KERA 4PMXA 1FWWA 2FLIA 3SIMA 1Z3NA 5FF3A 4S3CA 2V3BA 4IPLA 4GINA 4KEZA 3W38A 3KWSA 1EXBA 3RJXA 3RMJA 3S9ZA 1FWSA 4OE7A 3GIQA 3R12A 2WKJA 2J3NA 5CPSA 3NZQA 2EPKX 4GWEA 1D8WA 2YKKA 3GXDA 2QIWA 3FJ4A 1AZ1A 1FCVA 2CPUA 3UGRA 3L2IA 4NX5A 5J5RA 4HTYA 5HWMA 1FO4A 3GO2A 4CNPA 3NL2A 2ZX8A 1XBXA 2WMGA 5DRIA 2H9AB 4YTTA 1DORA 3NSMA 1DHKA 2J8GA 1BSLA 1R2RA 2WPGA 2E6YA 4QP0A 3V5FA 6REQB 3NM1A 4DRSA 2VC9A 1R46A 2DFAA 2BB0A 1E4NA 4GPNA 4D1JA 2ZUSA 2DT1A 5I79A 5HJYA 4WJXA 2VFDA 2PB1A 2CLMA 1W9VA 4BF5A 5EL1A 2P0IA 4PMRA 2HE5A 4GMEA 3WK3A 3S5OA 1BF2A 1UUOA 3ES8A 2WOIA 1WYIA 4PUNA 4UNLA 1OF8A 1K8CA 2RAGA 3P80A 1YNYA 3QR1A 4LT9A 3DJJA 1V79A 1FWRA 2V67A 4CD7A 4Q8WA 2XGIA 4LBRA 3BXWA 1E0UA 4F4RA 1A50A 4I3GA 5M5DA 5C54A 2E8ZA 3P3BA 4H01A 1OADA 3S46A 5HMDA 4MSSA 2ZUVA 3W74A 1XIBA 1HJSA 3AU6A 4LC8A 3EWUA 4QDMA 2BOEX 2ZZBA 2PURA 2ZVIA 3VNLA 3G0XA 4JFTA 4AIBA 3BLIA 4GBDA 4ICNA 4X61A 3V0SA 2YA1A 5I02A 1KD0A 1BKSA 2BG5A 2WNNA 1OSEA 3K8MA 4JFSA 3RPMA 1QPNA 2E40A 3C8NA 3W01A 3WYZA 3F5LA 3VIFA 2C91A 4H41A 4W7VA 4XKYA 2WVUA 3MO7A 1GVRA 4P8VA 2OELA 5DY2A 3H26A 2QUTA 3HGOA 5C7VA 4Y9NA 3FGCA 2QDEA 4NASA 1Q2RA 1UHVA 4DB7A 5A2AA 2GK1A 4CD5A 3RK8A 1LUCB 3WO8A 1R3TA 3HN3A 5KVHA 4O8RA 3QOKA 1X7FA 1XS2A 4HOXA 3WD3A 5I3FA 1ISYA 4QNEA 1JFHA 3BQ5A 2GQ3A 5D02A 3P81A 1KRBC 3ZOAA 4YCOA 3W71A 4LUJA 3LU2A 1I8JA 3PFRA 4WCJA 3URAA 4WRHA 3VGEA 1OFOA 2DQXA 1CPUA 4WSJA 2CHOA 3M1ZA 3QLLA 3VX1A 4FF5A 1NSJA 2VD8A 4NP7A 1A0CA 1WNOA 1O5XA 4XZNX 1UD2A 3UJSA 1O5RA 3G1VA 4L5ZA 3CZGA 1R6WA 3SY1A 2B7OA 2V6AA 3W75A 4GNVA 4EQRA 3BZGA 3WQ6A 4YHGA 4YS1A 5JRBA 4XUGA 2REQB 5KITA 4J5NA 1IT7A 1QK2A 5FS6A 2GQ9A 1VEOA 5HINA 1QATA 4ZQNA 1OX5A 5FAGA 4Q6JA 1DWGM 4C6OA 5CPQA 3SY8A 1S2VA 3VILA 4HYRA 3O0FA 3OODA 3TR2A 3TAKA 5CC7A 3RNMA 4W5UA 4LYKA 1GOOA 5AYBA 3GHSA 5JCKA 3KCJA 3B8IA 4MNKA 4O1DA 4FPSA 4PTVA 1OFQA 2I9EA 2J6XA 1OGSA 4ROPA 3QPEA 4U5IA 5BU6A 4RW5A 3IVUA 1LM1A 4ZL1A 3DFHA 4FMVA 2FJUB 4HK7A 1PZ3A 2FPTA 3RILA 3PWGA 3ZJ6A 3FEMA 5AHNA 4CLMA 4YIWA 4IUGA 4AF0A 3N6JA 1QHPA 4CQ8A 2ZZ0A 4JN8A 1MZHA 2YA2A 3ARSA 4GLEA 3JRKA 1SJAA 5G5HB 2G95A 2VX6A 3FA3A 5IHSA 5G4EA 4QLJA 3OQEA 5I7GA 3H4KA 1KKRA 3BZJA 4Q4QA 1VEPA 3B8VA 4MAVA 5FS9A 3EGJA 1L0PA 1YQ2A 2O4QA 1HG3A 1IGWA 4W4QA 2UY5A 3T40A 1PZ1A 1V02E 2W66A 3LSBA 4UQ9A 4M81A 1G69A 3WQFA 4JTLA 1YDYA 2PBOA 1XBZA 4LY8A 3FFSA 1V7AA 4EWJA 3MSYA 3P82A 1MOKA 3D3FA 1QPQA 2YDRA 5E0FA 3CJPA 1TPVA 4I9MA 2ISDA 1WBHA 4BK9A 2J7GA 3VIGA 3TW7A 4DPQA 5D37A 2PLKA 3ARQA 4KCWA 4LYQA 4O11A 2CC0A 1KRMA 1UPMB 2V5KA 1NWUA 3L4YA 2QKFA 4DWSA 2VQTA 5I3KA 5E09A 2HVOA 4PCNA 4W88A 3CZEA 5DXXA 3QY7A 3HG2A 5EYWA 3C3UA 5DX7A 3W2UA 1DJZA 3EPNA 4I9TA 3R79A 3EAUA 3OC4A 4H4YA 1GT8A 2PWFA 1GJUA 1J10A 4AY1A 1M6IA 3GSMA 3G5EA 1GHRA 3APYA 1XCFA 1B54A 4TX6A 3LADA 1BXCA 4UNKA 5AFDA 5FD0A 1JZ4A 2ZBTA 3E96A 1M7XA 1CENA 2VURA 3UR8A 4TV6A 1E0TA 4UXDA 4JDYA 2PDKA 3E38A 3HURA 1VFMA 3P93A 1O60A 3LHVA 2IPGA 2Z0IA 4FZIA 4JD4A 3N12A 5FJUA 1LL7A 3KVKA 4L7ZA 3N4AA 4XD6A 3ZJKA 3C2FA 1UP2A 3ETRB 2D73A 3VD3A 1GQLA 2WSQA 3S5ZA 1JR1A 1TJPA 1UH2A 3IS4A 4UIOA 4LNYA 2V3DA 1Q6DA 1UWAA 2Y85A 1JGMA 5F2GA 4DJDD 3SAZA 5CPMA 3ZLGA 1IIGA 8CGTA 2GUYA 2C16A 3M7WA 4LXFA 3OZMA 3PPGA 3EPMA 1TRIA 3AM9A 3KCLA 2X16A 3RG6A 3R43A 2V3GA 5EMJA 4JIPA 4B90A 3SRHA 5HMFA 2GJXB 4EXAA 1H11A 3FIGA 2FVKA 1SR0A 3M6YA 4L9YA 1V6VA 3W2MA 3LDVA 5EY5A 3W1TA 2OEMA 4BI5A 4YXGA 4ZTXA 1ICSA 2WJFA 3FG2P 4AD3A 2OX1A 3A23A 2BNJA 3HU7A 5A94A 4DXXA 4A8LA 1A5UA 5KZ6A 4QJ1A 2Y6ZA 5BWFA 3MP4A 3NSXA 1I9CB 3DBNA 3HGSA 3ONCA 1TTPA 3IGHX 1OYAA 3VIKA 4UTMA 4YCPA 1TPB1 3OYXA 1DJYA 3EOSA 3K13A 1ALDA 2OEJA