3OW22

Crystal structure of enhanced macrolide bound to 50s ribosomal subunit
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
92
structure length
92
Chain Sequence
MQMPRRFNTYCPHCNEHQEHEVEKVRSGRQTGMKWIDRQRERNSGIGNDGKFSKVPGGDKPTKKTDLKYRCGECGKAHLREGWRAGRLEFQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S RIBOSOMAL RNA
molecule tags Ribosome
total genus 17
structure length 92
sequence length 92
ec nomenclature
pdb deposition date 2010-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
2 PF00935 Ribosomal_L44 Ribosomal protein L44
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.80 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3ow2200
1VQ43 1Q824 1N8R4 3CPW2 1YJ93 1S723 1KC84 1K734 1K8A4 3CME3 1VQ93 1VQO3 3CD63 1KQS2 2OTL3 3CCS3 1YJW3 2OTJ3 1YI23 3G4S3 1VQK3 1QVF2 1VQ53 3CXC2 1VQP3 1YIT3 1M904 1VQN3 3CC43 3CCE3 3G6E3 1Q814 1KD14 3CCJ3 1QVG2 1W2B2 1VQ73 1VQL3 3I563 2QA43 3CCV3 1Q864 3CCM3 3CMA3 3I553 2QEX3 1YJN3 1YHQ3 3CC73 1NJI4 1K9M4 1M1K4 1VQ83 1VQ63 1YIJ3 3CCR3 1JJ22 1Q7Y4 3CCQ3 3CCU3 1VQM3 3CCL3 3CC23 3G713 3OW22
chains in the Genus database with same CATH superfamily
1OF5A 4CCVA 1Q824 3LTDA 1S723 1EA2A 4QWTA 1FUWA 3WDGB 3U97A 5JPUA 1RRLA 2FGTA 2XH9A 1RKYA 1PY3A 1PU4A 1Z1SA 1I0VA 2P38A 2H0HA 1L5GB 1IV7A 2BT3A 1FGTA 1K28A 3Q90A 1FUTA 1O7GB 2CH9A 1G96A 2XSHB 3GWRA 3ZG5A 2ZDJA 1JB4A 1RGAA 3MYTA 1MGRA 1YJN3 1RNBA 1X1YA 4GSPA 2HMLB 1STDA 4MJDA 1NNVA 3NUVA 4EW5A 5JBSA 3EX9A 4MMXB 2Q07A 3D5GA 1TJDA 2RFRA 2FXTA 4HJLB 3G713 1B2XA 8RNTA 2IY2A 2W0QA 5BIRA 1UI8A 1BRJA 1Q40B 1VQO3 3X41A 5D81A 1U8CB 4O8SA 2OTL3 1MWTA 1ZO2A 2BMRB 5G1LA 5IEPA 2PNCA 2W9PA 3JUNA 4R80A 1D6UA 2CKFB 1DVCA 3G6E3 1Q814 4AKZA 2WOFA 2UUGC 2QA43 2IA7A 1IQ8A 1UW1A 1VZZA 1ROAA 2XFTA 4LEHA 3RNTA 1BSDA 3O8YA 4HBRA 3DGNA 2R4IA 2CFDA 3FGYA 1ASKA 1BNIA 3B7CA 3JUOA 5G2GA 1M1K4 2RCDA 1VQ63 1JJ22 3CNXA 1EQKA 1IVUA 4WHAA 1RN4A 1BNRA 3NBBA 3KSPA 1RN7A 1I3IA 1BOXA 4N6TA 3D3LA 4HOHA 1I2GA 1VQQA 3K5TA 4STDA 4BTYA 4MMZB 2HMJB 2KXGA 5ELJA 1I3FA 1M904 2P05A 5AEUB 2XR8B 3NM7A 1RGCA 1W2B2 1AV4A 2C10A 2W04A 4TX4A 3TDGA 1OACA 4OUQA 5CF1A 4HM6B 1IT7A 1A2PA 1C7HA 1O7WB 1UUGB 2UX0A 1MWSA 1VQ83 3UL5A 1RRHA 1QJGA 4EBGA 4PEJA 5AYSC 1AVKA 1BRIA 1W01A 2MF7A 3CCU3 4L8PA 2IYJA 4FMAA 4K1VA 3MKIA 2HMKB 1N8R4 3SOAA 1B2ZA 3DY5A 5D83A 3NBJA 4BIRA 5M18A 1KC84 3VF1A 6STDA 1G0TA 4ILFA 5FGOA 4GB5A 4LGQA 1DMQA 3ROBA 3WHOA 1JB2A 2FNQA 1RGGA 1BGSA 1B2UA 2YFJB 2XFSA 4IIAA 9RNTA 1BSAA 2BHMA 1LOXA 1WTHA 2BMOB 3F7SA 1UCLA 4OVMA 1KWIA 2A15A 1R4YA 1RGLA 2HMMB 3HIGA 3N9HA 3LTBA 2F5MA 4HAAA 2Z7AA 2HMOB 3EBTA 3F9SA 3JUMA 4JRFA 3X3XA 1E97A 3T8NA 4HM7B 4BU4A 3AHSA 4AEQA 4U13A 2CWVA 2BU4A 4RNZA 4XDWA 1RJOA 3NV0A 1BANA 3WMDA 1ULJB 3T8UA 1I70A 1OHOA 4K1UA 1RGHA 2F5WA 3F40A 5LC7A 1GD3A 3VGNA 6RNTA 1CQSA 2CHCA 1AY7A 3IJEB 4FR9A 2OOVA 3WOEB 5IF6A 1Q42A 1FW7A 3WR2A 2CFLA 1S5AA 1UI7A 2GBXB 2K0MA 5DRVA 3FG4A 1YGEA 1VQ73 3I0YA 4FMBA 1PFPA 2ZL8A 3URPA 1QAFA 4MEIA 1ULIB 2MC8A 2AAEA 3RGRA 4WYKB 3UL6A 5G1KA 3X40A 2R41A 1TU5A 4HM5B 2Z77A 3F8XA 1IVWA 4R9LA 3SYUA 3OX9A 3I553 1NJI4 3CCR3 2K54A 1SPUA 3FG3A 3B4PA 1K41A 1RDSA 3RGAA 2LQVA 3NHXA 3OW22 3FF2A 1IVVA 1RTUA 3EN8A 1RMSA 3K9MC 1GMQA 3EHCA 4WWUC 4R1KA 3KKGA 4O02B 4HZ9B 5IEOA 1VQN3 1X1XA 2H0IA 3AMOA 4XM4A 2W9QA 2GSPA 1QVG2 1X1WA 3QRDA 1VQL3 2INXA 1A2KA 4HYZA 4K61A 3OWUA 1DYUA 1TP6A 2KF5A 1YGWA 2XEPA 4J5KA 3NBRA 3V99A 1YIJ3 1KSIA 1SIIA 3GZRA 1LXEA 1E3VA 2OOVC 1DMMA 1A67A 1HKXA 1B27A 1M9GA 1GD4A 2F98A 2I9WA 1SJWA 3PGBA 3V92A 3NX0A 3X3YA 1QMAA 3WA3A 3WODG 3ZFZA 1W5ZA 2L4VA 3LT9A 4HZBB 1KQS2 5STDA 3CCS3 3A76A 2ZHXB 3PCRA 1OPYA 2LYXA 1BNSA 5GSPA 5IW9A 2PZVA 3GZXB 2E2UA 2YX9A 3PXMA 4NHFA 3Q2PA 1IQYA 2H0GA 3DGYA 3MSOA 4EV5A 2C4BA 5IG5A 1FUSA 2RGQA 5BVBA 3BIRA 1GS3A 2RSXA 3KFQC 2WO0A 2O3OA 3K0ZA 5AI1A 3DMCA 1GYBA 3HX8A 3HZPA 4GHOA 3MPHA 3CC73 2STDA 1N9EA 3CU3A 3KE7A 3CNMA 3H3HA 1EEJA 1PYLA 1MWUA 2HMNB 2XRXB 3ECFA 3F14A 3LZAA 3PCSA 2KF3A 4FCMA 1TIJA 1O7MB 3CPOA 2IUKA 1NU3A 3NQYA 3NV0B 2Z6BA 2K3DA 2CX1A 4XDVA 1EUIC 2SBLA 1WMOA 1LOWA 5IG3A 3NM2A 4ZM8A 4J8TA 5KP4A 1NDOB 1UGHI 1ZX2A 3MWZA 3CCE3 4CPKA 3LH4A 2P0MA 2E2VA 1Q7HA 1W6CA 5AEWB 3FSDA 1CYVA 1JN5A 3SXXA 3FKAA 2W56A 2CG1A 2W2CA 3STDA 3FG1A 1JRQA 4L7KA 3CCM3 4DKIA 3DXOA 4BL3A 4OK0A 4BL2A 4HKVB 1RGEA 1WMNA 3DGOA 3DZLA 5A0OB 1RN1A 1D6ZA 2CFGA 3DUKA 3PS8A 5KP3A 2KCDA 2XF3A 3BNBA 3S29A 1DVDA 5AIFA 3AGOA 5D82A 1MGWA 4RNYA 4N6MA 3RDEA 1OHPA 3N8BA 3Q3FA 3IMAB 4KZ1A 1V57A 1I8VA 3S28A 3MG3A 4HM1B 5AIHA 2BO9B 1WMPA 3G0KA 2GEXA 3IPTA 2OTJ3 1GMRA 2V1LA 4EV2A 1OF5B 2CK3H 1IDPA 2W6JH 1GOYA 1T3BA 1W7CA 4HM2B 1WNHA 4O2HA 5I97A 3GAXA 2F4YA 1STFI 2B1XB 3UJMA 1FGMA 3VSYA 2CC3A 2OWPA 1SARA 3EJVA 5CLKA 1SQWA 3D79A 2ML5A 5ELUA 3D9RA 7RNTA 3FLJA 1BIRA 7GSPA 1Q40A 2BMQB 1BVIA 3FCSB 3JVCA 2RBIA 1YVBI 1OCVA 1CEWI 4G1MB 5IG0A 3CD63 1RCLA 2ZA4A 3G16A 3B8LA 3G8ZA 5HOHA 1IU7A 1R4CA 3MG1A 1UGIA 3EQQB 1QVF2 4HVNA 1YIT3 5IG4A 1UDII 1BAOA 2C11A 2D1WA 4H61A 4Q53A 4EYCA 3AHWA 1IK3A 3CCJ3 1AVLA 1J2BA 1IYYA 1JZDA 1B2SA 3GZBA 4JF8A 1W00A 1WQLB 1B2MA 2GBWB 3KSED 3PYJA 1O7HB 1JB5A 4WP5A 1CYUA 3HK4A 5JPPA 2Y74A 1E3RA 1JKGA 3BNDA 4HM0B 2WGOA 5AYRB 3CCQ3 1A90A 1GOUA 4HM4B 1BNJA 3F7XA 3H51A 3NXJA 2F86B 1O7NB 2O9UX 1FGQA 4RBNA 3S67A 3CPW2 1BRGA 1YVSA 4K90B 8CHOA 1LOVA 1FGRA 4CJNA 2M7OA 1LOYA 2W03A 3SEDA 3V98A 2XGLA 3FH1A 4N6NB 7STDA 3OWYA 3CC43 2XSOB 3MHEA 1NB3I 3SVAA 1KD14 3I563 1A2VA 4L8OA 1GSPA 1GY6A 2QIYA 3B4OA 1YHQ3 4WFOA 1W2ZA 1UCKA 1W6YA 3BU4A 3K63A 2OQEA 3HIIA 1EG9B 1JNQA 3LOYA 1TTOA 2RNTA 1BUJA 1SIHA 1B20A 3QK9A 1YNVX 4FCZA 4RNTA 1B21A 1I2EA 1OGZA 3N54B 5CXOA 1VQ43 1FA3A 4HM8B 1T2HA 1UUVB 1GMPA 1TRPA 3SLUA 1V74A 5BXQA 2BNGA 1YJW3 4RZMA 3L0RA 4N6UA 5EVHA 3CXC2 2F56A 2GXFA 1W4NA 1BSCA 1DETA 1N5HA 3BNCA 3M8CA 3OV4A 3FF0A 3BNEA 1RCKA 2YFLB 3X3ZA 3S27A 3LTAA 1JBSA 1LVNA 3KZTA 4FMCA 3X42A 1Q9EA 1U5OA 1M1XB 2QEX3 1BUQA 2CWTA 1I2FA 1QAKA 5IENA 1N8QA 4N6OB 3LYGA 2CG0A 4N6LA 1OGXA 1V58A 4LYLB 1Y4KA 3HI7A 5DREA 4GL6A 1BSBA 1FZUA 4J5GA 1ZS7A 2XGNA 4BTXA 3DGLA 3CME3 3UNLA 4KT3B 4LZIA 3D4AA 1OHSA 1ROVA 1QALA 4I4KA 1VQP3 1AR0A 5CF2A 1FYSA 5AIIA 4EC6A 1O7PB 1CH0A 1RHLA 2CX0A 2GU1A 4WYKA 1MWRA 5FW5A 1NO3A 2GU3A 3BLZA 4H3UA 1US1A 1TFKA 2OQEC 1D6YA 3DM8A 1N9JA 3EC9A 3F8HA 3GRDA 4I5QA 3WA2X 3ZG0A 2J8XB 1UCJA 2UGIA 4X2OA 3LXUX 4KVHA 4J9AA 2IUJA 3CMA3 5KP1A 1W6GA 1GOVA 1HYFA 2D42A 4XBYA 4NREA 1LRAA 1NB5I 1MNLA 2P09A 1JKGB 5M1AA 1VQM3 3ALAA 2CWUA 1VQ93 3KCHA 3NQZA 1BRNL 1IQXA 3T0UA 1YJ93 2SARA 3K7CA 2KF4A 2CW9A 1RGFA 3U1WA 1TRQA 3EE1A 1VQK3 1I0XA 4KFDA 1BRHA 2CFWA 3HOHA 3JUQA 2B24B 3ER7A 1C54A 3WOFB 1RGKA 1EKMA 4O3VA 4X2HA 3EBYA 4LSOA 5RNTA 1OUNA 3EB8A 4FCJA 2L1SA 2JQ5A 1MOLA 1FGOA 1OH0A 1GY7A 3AMOB 4IT7A 4EXRA 1JV2B 2HOHA 4FMDA 4MMYB 4CDLA 3BB9A 1Q7Y4 4AKYA 1NWWA 2KF6A 2QGUA 3LMLA 1ZGXA 3CCL3 3CC23 1BSEA 1BRKA 5HGRA 3D5IA 1K8A4 2YFIB 1IV9A 4IPBA 3MG2A 1X1UA 2Z76A 4ORLA 4R4KA 3FZWA 3G4S3 3DH2A 1BNFA 2OCTA 3S5CA 2IMJA 4NPBA 3UB1A 1T2IA 1JBRA 2F99A 5CK6A 4BTWA 3CCV3 3E99A 1DMNA 5IERA 1Q864 2CFKA 6GSPA 1TFOA 4N6V0 3PZWA 1HZ1A 1K9M4 3GZYB 5BU4A 3EN1B 4R9KA 1JZOA 1G02A 1TUHA 2JDIH 1RNTA 1T5YA 2WOHA 1BRSA 2Y73A 3LTCA 5TGNA 1F8NA 1N5PA 1K734 1IVXA 1HU9A 2P0XA 3JUPA 3KN4A 3SOYA 1RLSA 1GY5A 5AIGA 3SX1A 2CIUA 3KIIA 3OXAA 1YI23 1JBTA 1VQ53 4LMIA 2KRTA 1B3SA 1LNIA 1LQMB 2AADA 4KFEA 1LNHA 5M19A 2KAAA 1UCIA 1RSNA 1UUWB 4XBXA 1DE3A 3LT8A 4KFFA 4XBTA 2ML6A 1BU4A 3Q1CA 4N3VA 5LC6A 4HM3B 2WGQA 5EQLA 3EF8A 1W02A 3OWSA 1BNGA 3AGNA 3DGMA 1JN5B 2E2TA 2BIRA 1AQZA 1IT8A 3GSPA 1BNEA 2W56B 4XB5A 2GEYA 1LQGC 1ISKA 5EEOA 3J7Yd 3A5EA
chains in the Genus database with same CATH topology
1OF5A 4CCVA 1Q824 3LTDA 1S723 1EA2A 4QWTA 1FUWA 3WDGB 3U97A 5JPUA 1RRLA 2FGTA 2XH9A 1RKYA 1PU4A 1Z1SA 2P38A 1L5GB 1IV7A 2BT3A 1FGTA 1K28A 3Q90A 1O7GB 2CH9A 1G96A 2XSHB 3GWRA 2ZDJA 1JB4A 3MYTA 1YJN3 2HMLB 1STDA 4MJDA 3NUVA 5JBSA 3EX9A 4MMXB 2Q07A 2RFRA 2FXTA 4HJLB 3G713 2W0QA 1UI8A 1VQO3 1Q40B 3X41A 5D81A 1U8CB 4O8SA 2OTL3 1ZO2A 2BMRB 5IEPA 2PNCA 2W9PA 3JUNA 4R80A 1D6UA 2CKFB 1DVCA 3G6E3 1Q814 4AKZA 2WOFA 2QA43 2IA7A 1IQ8A 1UW1A 1VZZA 1ROAA 2XFTA 4LEHA 3O8YA 4HBRA 3DGNA 2R4IA 2CFDA 3FGYA 1ASKA 3JUOA 3B7CA 5G2GA 1M1K4 1VQ63 2RCDA 1JJ22 3CNXA 1EQKA 1IVUA 4WHAA 3NBBA 3KSPA 1RN7A 4N6TA 3D3LA 3K5TA 4STDA 4BTYA 4MMZB 2HMJB 2KXGA 5ELJA 1M904 2P05A 5AEUB 2XR8B 3NM7A 1W2B2 1AV4A 2C10A 2W04A 4TX4A 3TDGA 1OACA 4OUQA 5CF1A 4HM6B 1IT7A 1C7HA 1O7WB 2UX0A 1VQ83 3UL5A 1RRHA 1QJGA 4EBGA 4PEJA 5AYSC 1AVKA 1W01A 2MF7A 3CCU3 4L8PA 4FMAA 4K1VA 3MKIA 2HMKB 1N8R4 3SOAA 3DY5A 5D83A 3NBJA 1KC84 3VF1A 6STDA 5FGOA 4GB5A 4LGQA 1DMQA 3ROBA 1JB2A 2FNQA 2YFJB 4IIAA 2XFSA 2BHMA 1LOXA 1WTHA 2BMOB 3F7SA 4OVMA 1KWIA 2A15A 2HMMB 3HIGA 3N9HA 3LTBA 4JRFA 2Z7AA 2HMOB 3EBTA 3F9SA 3JUMA 3X3XA 1E97A 3T8NA 4HM7B 4AEQA 4U13A 2CWVA 4RNZA 4XDWA 1RJOA 3NV0A 3WMDA 1ULJB 3T8UA 1OHOA 4K1UA 3F40A 5LC7A 1GD3A 3VGNA 1CQSA 2CHCA 2OOVA 3IJEB 4FR9A 3WOEB 5IF6A 1Q42A 2CFLA 1S5AA 1UI7A 2GBXB 2K0MA 5DRVA 3FG4A 1YGEA 1VQ73 3I0YA 4FMBA 1PFPA 2ZL8A 1QAFA 4MEIA 1ULIB 2MC8A 3RGRA 4WYKB 3UL6A 3X40A 1TU5A 4HM5B 2Z77A 3F8XA 1IVWA 4R9LA 3I553 3OX9A 1NJI4 3CCR3 2K54A 1SPUA 3FG3A 3B4PA 1K41A 3RGAA 3OW22 2LQVA 3NHXA 3FF2A 1IVVA 3EN8A 3K9MC 3EHCA 4WWUC 4R1KA 3KKGA 4O02B 4HZ9B 5IEOA 1VQN3 3AMOA 4XM4A 1VQL3 2W9QA 1QVG2 3QRDA 2INXA 1A2KA 4HYZA 4K61A 3OWUA 1DYUA 1TP6A 2XEPA 3NBRA 3V99A 1YIJ3 1KSIA 1SIIA 3GZRA 1LXEA 1E3VA 2OOVC 1DMMA 1A67A 1HKXA 3V92A 1M9GA 1GD4A 2F98A 2I9WA 1SJWA 3PGBA 3X3YA 3NX0A 5A0OB 1QMAA 3WA3A 3WODG 1W5ZA 2L4VA 3LT9A 4HZBB 1KQS2 5STDA 3CCS3 3A76A 3PCRA 1OPYA 2LYXA 5IW9A 2PZVA 3GZXB 2E2UA 2YX9A 3PXMA 4NHFA 3Q2PA 1IQYA 4EV5A 3MSOA 5IG5A 2RGQA 5BVBA 1GS3A 2RSXA 3KFQC 2WO0A 2O3OA 3K0ZA 5AI1A 3DMCA 1GYBA 3HX8A 3HZPA 3CC73 3MPHA 2STDA 1N9EA 3CU3A 3KE7A 3CNMA 3H3HA 2XRXB 3ECFA 3F14A 2HMNB 3LZAA 3PCSA 4FCMA 1TIJA 1O7MB 3CPOA 2IUKA 1NU3A 3NQYA 3NV0B 2Z6BA 4XDVA 2SBLA 1WMOA 5IG3A 3NM2A 4ZM8A 4J8TA 5KP4A 1NDOB 1ZX2A 3MWZA 3CCE3 3LH4A 2P0MA 2E2VA 5AEWB 1W6CA 3FSDA 1CYVA 1JN5A 3SXXA 3FKAA 2W56A 2CG1A 2W2CA 3STDA 3FG1A 1JRQA 4L7KA 3CCM3 3DXOA 4OK0A 4HKVB 3DGOA 1WMNA 3DZLA 1D6ZA 2CFGA 3DUKA 3PS8A 5KP3A 2KCDA 2XF3A 3BNBA 3S29A 1DVDA 5AIFA 5D82A 4RNYA 4N6MA 3RDEA 1OHPA 3N8BA 3IMAB 4KZ1A 3S28A 3MG3A 4HM1B 5AIHA 2BO9B 1WMPA 3G0KA 2GEXA 3IPTA 2OTJ3 2V1LA 4EV2A 1OF5B 2CK3H 1IDPA 2W6JH 4HM2B 1W7CA 1WNHA 4O2HA 5I97A 3GAXA 1STFI 2B1XB 3UJMA 1FGMA 3VSYA 2CC3A 2OWPA 3EJVA 5CLKA 1SQWA 5ELUA 2ML5A 3D9RA 3FLJA 1Q40A 2BMQB 3FCSB 3JVCA 1YVBI 1OCVA 1CEWI 4G1MB 5IG0A 3CD63 3G16A 3B8LA 3G8ZA 1IU7A 1R4CA 3MG1A 3EQQB 1QVF2 4HVNA 1YIT3 5IG4A 2D1WA 2C11A 4H61A 4Q53A 1IK3A 4EYCA 3CCJ3 1AVLA 1J2BA 3GZBA 4JF8A 1W00A 1WQLB 2GBWB 3KSED 3PYJA 1O7HB 1JB5A 4WP5A 1CYUA 3HK4A 5JPPA 2Y74A 1E3RA 1JKGA 3BNDA 4HM0B 2WGOA 5AYRB 3CCQ3 1A90A 4HM4B 3F7XA 3H51A 3NXJA 2F86B 1O7NB 2O9UX 1FGQA 4RBNA 3S67A 3CPW2 4K90B 8CHOA 1FGRA 2M7OA 2W03A 3SEDA 3V98A 2XGLA 3FH1A 4N6NB 7STDA 3OWYA 3CC43 2XSOB 3MHEA 1NB3I 3SVAA 1KD14 3I563 1A2VA 4L8OA 1GY6A 2QIYA 3B4OA 1YHQ3 4WFOA 1W2ZA 1W6YA 3K63A 2OQEA 3HIIA 1EG9B 1JNQA 3LOYA 1SIHA 3QK9A 4FCZA 1OGZA 3N54B 5CXOA 1VQ43 1FA3A 4HM8B 1UUVB 3SLUA 1V74A 5BXQA 2BNGA 1YJW3 4RZMA 3L0RA 4N6UA 5EVHA 3CXC2 2GXFA 3M8CA 1W4NA 3OV4A 1N5HA 3BNCA 3FF0A 3BNEA 3X3ZA 2YFLB 3S27A 3LTAA 1LVNA 3KZTA 4FMCA 3X42A 1U5OA 1M1XB 2QEX3 1BUQA 2CWTA 1QAKA 5IENA 1N8QA 4N6OB 3LYGA 2CG0A 4N6LA 1OGXA 1Y4KA 3HI7A 5DREA 4GL6A 2XGNA 4BTXA 3DGLA 3CME3 3UNLA 4LZIA 1OHSA 1ROVA 1QALA 4I4KA 1VQP3 1AR0A 5CF2A 4EC6A 5AIIA 1O7PB 2GU1A 4WYKA 5FW5A 1NO3A 2GU3A 3BLZA 4H3UA 1US1A 1TFKA 2OQEC 1D6YA 3DM8A 1N9JA 3EC9A 3F8HA 3GRDA 3WA2X 4X2OA 3LXUX 4KVHA 4J9AA 2IUJA 3CMA3 5KP1A 1W6GA 2D42A 4XBYA 4NREA 1NB5I 1MNLA 2P09A 1JKGB 1VQM3 3ALAA 2CWUA 1VQ93 3NQZA 1IQXA 3T0UA 1YJ93 3K7CA 2CW9A 3U1WA 3EE1A 1VQK3 4KFDA 2CFWA 3JUQA 2B24B 3ER7A 3WOFB 1EKMA 4O3VA 4X2HA 3EBYA 4LSOA 1OUNA 3EB8A 4FCJA 2JQ5A 1MOLA 1FGOA 1OH0A 1GY7A 3AMOB 4IT7A 4EXRA 1JV2B 4FMDA 4MMYB 4CDLA 3BB9A 1Q7Y4 4AKYA 1NWWA 2QGUA 3LMLA 3CCL3 3CC23 5HGRA 1K8A4 2YFIB 1IV9A 4IPBA 3MG2A 2Z76A 4ORLA 3G4S3 4R4KA 3FZWA 2OCTA 3S5CA 2IMJA 3UB1A 2F99A 5CK6A 4BTWA 3CCV3 3E99A 1DMNA 5IERA 1Q864 2CFKA 1TFOA 4N6V0 3PZWA 1K9M4 3GZYB 3EN1B 4R9KA 1TUHA 2JDIH 1T5YA 2WOHA 2Y73A 3LTCA 5TGNA 1F8NA 1N5PA 1K734 1IVXA 1HU9A 2P0XA 3JUPA 3KN4A 3SOYA 5AIGA 1GY5A 3SX1A 2CIUA 3KIIA 3OXAA 1YI23 1VQ53 4LMIA 2KRTA 4KFEA 1LNHA 1UUWB 4XBXA 3LT8A 4KFFA 4XBTA 2ML6A 3Q1CA 4N3VA 5LC6A 4HM3B 2WGQA 5EQLA 3EF8A 1W02A 3OWSA 3DGMA 1JN5B 2E2TA 1IT8A 2W56B 4XB5A 2GEYA 1ISKA 5EEOA 3J7Yd
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQ4 3;  1Q82 4;  1N8R 4;  3CPW 2;  1YJ9 3;  1S72 3;  1KC8 4;  1K73 4;  1K8A 4;  3CME 3;  1VQ9 3;  1VQO 3;  3CD6 3;  1KQS 2;  2OTL 3;  3CCS 3;  1YJW 3;  2OTJ 3;  1YI2 3;  3G4S 3;  1VQK 3;  1QVF 2;  1VQ5 3;  3CXC 2;  1VQP 3;  1YIT 3;  1M90 4;  1VQN 3;  3CC4 3;  3CCE 3;  3G6E 3;  1Q81 4;  1KD1 4;  3CCJ 3;  1QVG 2;  1W2B 2;  1VQ7 3;  1VQL 3;  3I56 3;  2QA4 3;  3CCV 3;  1Q86 4;  3CCM 3;  3CMA 3;  3I55 3;  2QEX 3;  1YJN 3;  1YHQ 3;  3CC7 3;  1NJI 4;  1K9M 4;  1M1K 4;  1VQ8 3;  1VQ6 3;  1YIJ 3;  3CCR 3;  1JJ2 2;  1Q7Y 4;  3CCQ 3;  3CCU 3;  1VQM 3;  3CCL 3;  3CC2 3;  3G71 3;  3OW2 2; 
#chains in the Genus database with same CATH topology
 1OF5 A;  4CCV A;  1Q82 4;  3LTD A;  1S72 3;  1EA2 A;  4QWT A;  1FUW A;  3WDG B;  3U97 A;  5JPU A;  1RRL A;  2FGT A;  2XH9 A;  1RKY A;  1PY3 A;  1PU4 A;  1Z1S A;  1I0V A;  2P38 A;  2H0H A;  1L5G B;  1IV7 A;  2BT3 A;  1FGT A;  1K28 A;  3Q90 A;  1FUT A;  1O7G B;  2CH9 A;  1G96 A;  2XSH B;  3GWR A;  3ZG5 A;  2ZDJ A;  1JB4 A;  1RGA A;  3MYT A;  1MGR A;  1YJN 3;  1RNB A;  1X1Y A;  4GSP A;  2HML B;  1STD A;  4MJD A;  1NNV A;  3NUV A;  4EW5 A;  5JBS A;  3EX9 A;  4MMX B;  2Q07 A;  3D5G A;  1TJD A;  2RFR A;  2FXT A;  4HJL B;  3G71 3;  1B2X A;  8RNT A;  2IY2 A;  2W0Q A;  5BIR A;  1UI8 A;  1BRJ A;  1Q40 B;  1VQO 3;  3X41 A;  5D81 A;  1U8C B;  4O8S A;  2OTL 3;  1MWT A;  1ZO2 A;  2BMR B;  5G1L A;  5IEP A;  2PNC A;  2W9P A;  3JUN A;  4R80 A;  1D6U A;  2CKF B;  1DVC A;  3G6E 3;  1Q81 4;  4AKZ A;  2WOF A;  2UUG C;  2QA4 3;  2IA7 A;  1IQ8 A;  1UW1 A;  1VZZ A;  1ROA A;  2XFT A;  4LEH A;  3RNT A;  1BSD A;  3O8Y A;  4HBR A;  3DGN A;  2R4I A;  2CFD A;  3FGY A;  1ASK A;  1BNI A;  3B7C A;  3JUO A;  5G2G A;  1M1K 4;  2RCD A;  1VQ6 3;  1JJ2 2;  3CNX A;  1EQK A;  1IVU A;  4WHA A;  1RN4 A;  1BNR A;  3NBB A;  3KSP A;  1RN7 A;  1I3I A;  1BOX A;  4N6T A;  3D3L A;  4HOH A;  1I2G A;  1VQQ A;  3K5T A;  4STD A;  4BTY A;  4MMZ B;  2HMJ B;  2KXG A;  5ELJ A;  1I3F A;  1M90 4;  2P05 A;  5AEU B;  2XR8 B;  3NM7 A;  1RGC A;  1W2B 2;  1AV4 A;  2C10 A;  2W04 A;  4TX4 A;  3TDG A;  1OAC A;  4OUQ A;  5CF1 A;  4HM6 B;  1IT7 A;  1A2P A;  1C7H A;  1O7W B;  1UUG B;  2UX0 A;  1MWS A;  1VQ8 3;  3UL5 A;  1RRH A;  1QJG A;  4EBG A;  4PEJ A;  5AYS C;  1AVK A;  1BRI A;  1W01 A;  2MF7 A;  3CCU 3;  4L8P A;  2IYJ A;  4FMA A;  4K1V A;  3MKI A;  2HMK B;  1N8R 4;  3SOA A;  1B2Z A;  3DY5 A;  5D83 A;  3NBJ A;  4BIR A;  5M18 A;  1KC8 4;  3VF1 A;  6STD A;  1G0T A;  4ILF A;  5FGO A;  4GB5 A;  4LGQ A;  1DMQ A;  3ROB A;  3WHO A;  1JB2 A;  2FNQ A;  1RGG A;  1BGS A;  1B2U A;  2YFJ B;  2XFS A;  4IIA A;  9RNT A;  1BSA A;  2BHM A;  1LOX A;  1WTH A;  2BMO B;  3F7S A;  1UCL A;  4OVM A;  1KWI A;  2A15 A;  1R4Y A;  1RGL A;  2HMM B;  3HIG A;  3N9H A;  3LTB A;  2F5M A;  4HAA A;  2Z7A A;  2HMO B;  3EBT A;  3F9S A;  3JUM A;  4JRF A;  3X3X A;  1E97 A;  3T8N A;  4HM7 B;  4BU4 A;  3AHS A;  4AEQ A;  4U13 A;  2CWV A;  2BU4 A;  4RNZ A;  4XDW A;  1RJO A;  3NV0 A;  1BAN A;  3WMD A;  1ULJ B;  3T8U A;  1I70 A;  1OHO A;  4K1U A;  1RGH A;  2F5W A;  3F40 A;  5LC7 A;  1GD3 A;  3VGN A;  6RNT A;  1CQS A;  2CHC A;  1AY7 A;  3IJE B;  4FR9 A;  2OOV A;  3WOE B;  5IF6 A;  1Q42 A;  1FW7 A;  3WR2 A;  2CFL A;  1S5A A;  1UI7 A;  2GBX B;  2K0M A;  5DRV A;  3FG4 A;  1YGE A;  1VQ7 3;  3I0Y A;  4FMB A;  1PFP A;  2ZL8 A;  3URP A;  1QAF A;  4MEI A;  1ULI B;  2MC8 A;  2AAE A;  3RGR A;  4WYK B;  3UL6 A;  5G1K A;  3X40 A;  2R41 A;  1TU5 A;  4HM5 B;  2Z77 A;  3F8X A;  1IVW A;  4R9L A;  3SYU A;  3OX9 A;  3I55 3;  1NJI 4;  3CCR 3;  2K54 A;  1SPU A;  3FG3 A;  3B4P A;  1K41 A;  1RDS A;  3RGA A;  2LQV A;  3NHX A;  3OW2 2;  3FF2 A;  1IVV A;  1RTU A;  3EN8 A;  1RMS A;  3K9M C;  1GMQ A;  3EHC A;  4WWU C;  4R1K A;  3KKG A;  4O02 B;  4HZ9 B;  5IEO A;  1VQN 3;  1X1X A;  2H0I A;  3AMO A;  4XM4 A;  2W9Q A;  2GSP A;  1QVG 2;  1X1W A;  3QRD A;  1VQL 3;  2INX A;  1A2K A;  4HYZ A;  4K61 A;  3OWU A;  1DYU A;  1TP6 A;  2KF5 A;  1YGW A;  2XEP A;  4J5K A;  3NBR A;  3V99 A;  1YIJ 3;  1KSI A;  1SII A;  3GZR A;  1LXE A;  1E3V A;  2OOV C;  1DMM A;  1A67 A;  1HKX A;  1B27 A;  1M9G A;  1GD4 A;  2F98 A;  2I9W A;  1SJW A;  3PGB A;  3V92 A;  3NX0 A;  3X3Y A;  1QMA A;  3WA3 A;  3WOD G;  3ZFZ A;  1W5Z A;  2L4V A;  3LT9 A;  4HZB B;  1KQS 2;  5STD A;  3CCS 3;  3A76 A;  2ZHX B;  3PCR A;  1OPY A;  2LYX A;  1BNS A;  5GSP A;  5IW9 A;  2PZV A;  3GZX B;  2E2U A;  2YX9 A;  3PXM A;  4NHF A;  3Q2P A;  1IQY A;  2H0G A;  3DGY A;  3MSO A;  4EV5 A;  2C4B A;  5IG5 A;  1FUS A;  2RGQ A;  5BVB A;  3BIR A;  1GS3 A;  2RSX A;  3KFQ C;  2WO0 A;  2O3O A;  3K0Z A;  5AI1 A;  3DMC A;  1GYB A;  3HX8 A;  3HZP A;  4GHO A;  3MPH A;  3CC7 3;  2STD A;  1N9E A;  3CU3 A;  3KE7 A;  3CNM A;  3H3H A;  1EEJ A;  1PYL A;  1MWU A;  2HMN B;  2XRX B;  3ECF A;  3F14 A;  3LZA A;  3PCS A;  2KF3 A;  4FCM A;  1TIJ A;  1O7M B;  3CPO A;  2IUK A;  1NU3 A;  3NQY A;  3NV0 B;  2Z6B A;  2K3D A;  2CX1 A;  4XDV A;  1EUI C;  2SBL A;  1WMO A;  1LOW A;  5IG3 A;  3NM2 A;  4ZM8 A;  4J8T A;  5KP4 A;  1NDO B;  1UGH I;  1ZX2 A;  3MWZ A;  3CCE 3;  4CPK A;  3LH4 A;  2P0M A;  2E2V A;  1Q7H A;  1W6C A;  5AEW B;  3FSD A;  1CYV A;  1JN5 A;  3SXX A;  3FKA A;  2W56 A;  2CG1 A;  2W2C A;  3STD A;  3FG1 A;  1JRQ A;  4L7K A;  3CCM 3;  4DKI A;  3DXO A;  4BL3 A;  4OK0 A;  4BL2 A;  4HKV B;  1RGE A;  1WMN A;  3DGO A;  3DZL A;  5A0O B;  1RN1 A;  1D6Z A;  2CFG A;  3DUK A;  3PS8 A;  5KP3 A;  2KCD A;  2XF3 A;  3BNB A;  3S29 A;  1DVD A;  5AIF A;  3AGO A;  5D82 A;  1MGW A;  4RNY A;  4N6M A;  3RDE A;  1OHP A;  3N8B A;  3Q3F A;  3IMA B;  4KZ1 A;  1V57 A;  1I8V A;  3S28 A;  3MG3 A;  4HM1 B;  5AIH A;  2BO9 B;  1WMP A;  3G0K A;  2GEX A;  3IPT A;  2OTJ 3;  1GMR A;  2V1L A;  4EV2 A;  1OF5 B;  2CK3 H;  1IDP A;  2W6J H;  1GOY A;  1T3B A;  1W7C A;  4HM2 B;  1WNH A;  4O2H A;  5I97 A;  3GAX A;  2F4Y A;  1STF I;  2B1X B;  3UJM A;  1FGM A;  3VSY A;  2CC3 A;  2OWP A;  1SAR A;  3EJV A;  5CLK A;  1SQW A;  3D79 A;  2ML5 A;  5ELU A;  3D9R A;  7RNT A;  3FLJ A;  1BIR A;  7GSP A;  1Q40 A;  2BMQ B;  1BVI A;  3FCS B;  3JVC A;  2RBI A;  1YVB I;  1OCV A;  1CEW I;  4G1M B;  5IG0 A;  3CD6 3;  1RCL A;  2ZA4 A;  3G16 A;  3B8L A;  3G8Z A;  5HOH A;  1IU7 A;  1R4C A;  3MG1 A;  1UGI A;  3EQQ B;  1QVF 2;  4HVN A;  1YIT 3;  5IG4 A;  1UDI I;  1BAO A;  2C11 A;  2D1W A;  4H61 A;  4Q53 A;  4EYC A;  3AHW A;  1IK3 A;  3CCJ 3;  1AVL A;  1J2B A;  1IYY A;  1JZD A;  1B2S A;  3GZB A;  4JF8 A;  1W00 A;  1WQL B;  1B2M A;  2GBW B;  3KSE D;  3PYJ A;  1O7H B;  1JB5 A;  4WP5 A;  1CYU A;  3HK4 A;  5JPP A;  2Y74 A;  1E3R A;  1JKG A;  3BND A;  4HM0 B;  2WGO A;  5AYR B;  3CCQ 3;  1A90 A;  1GOU A;  4HM4 B;  1BNJ A;  3F7X A;  3H51 A;  3NXJ A;  2F86 B;  1O7N B;  2O9U X;  1FGQ A;  4RBN A;  3S67 A;  3CPW 2;  1BRG A;  1YVS A;  4K90 B;  8CHO A;  1LOV A;  1FGR A;  4CJN A;  2M7O A;  1LOY A;  2W03 A;  3SED A;  3V98 A;  2XGL A;  3FH1 A;  4N6N B;  7STD A;  3OWY A;  3CC4 3;  2XSO B;  3MHE A;  1NB3 I;  3SVA A;  1KD1 4;  3I56 3;  1A2V A;  4L8O A;  1GSP A;  1GY6 A;  2QIY A;  3B4O A;  1YHQ 3;  4WFO A;  1W2Z A;  1UCK A;  1W6Y A;  3BU4 A;  3K63 A;  2OQE A;  3HII A;  1EG9 B;  1JNQ A;  3LOY A;  1TTO A;  2RNT A;  1BUJ A;  1SIH A;  1B20 A;  3QK9 A;  1YNV X;  4FCZ A;  4RNT A;  1B21 A;  1I2E A;  1OGZ A;  3N54 B;  5CXO A;  1VQ4 3;  1FA3 A;  4HM8 B;  1T2H A;  1UUV B;  1GMP A;  1TRP A;  3SLU A;  1V74 A;  5BXQ A;  2BNG A;  1YJW 3;  4RZM A;  3L0R A;  4N6U A;  5EVH A;  3CXC 2;  2F56 A;  2GXF A;  1W4N A;  1BSC A;  1DET A;  1N5H A;  3BNC A;  3M8C A;  3OV4 A;  3FF0 A;  3BNE A;  1RCK A;  2YFL B;  3X3Z A;  3S27 A;  3LTA A;  1JBS A;  1LVN A;  3KZT A;  4FMC A;  3X42 A;  1Q9E A;  1U5O A;  1M1X B;  2QEX 3;  1BUQ A;  2CWT A;  1I2F A;  1QAK A;  5IEN A;  1N8Q A;  4N6O B;  3LYG A;  2CG0 A;  4N6L A;  1OGX A;  1V58 A;  4LYL B;  1Y4K A;  3HI7 A;  5DRE A;  4GL6 A;  1BSB A;  1FZU A;  4J5G A;  1ZS7 A;  2XGN A;  4BTX A;  3DGL A;  3CME 3;  3UNL A;  4KT3 B;  4LZI A;  3D4A A;  1OHS A;  1ROV A;  1QAL A;  4I4K A;  1VQP 3;  1AR0 A;  5CF2 A;  1FYS A;  5AII A;  4EC6 A;  1O7P B;  1CH0 A;  1RHL A;  2CX0 A;  2GU1 A;  4WYK A;  1MWR A;  5FW5 A;  1NO3 A;  2GU3 A;  3BLZ A;  4H3U A;  1US1 A;  1TFK A;  2OQE C;  1D6Y A;  3DM8 A;  1N9J A;  3EC9 A;  3F8H A;  3GRD A;  4I5Q A;  3WA2 X;  3ZG0 A;  2J8X B;  1UCJ A;  2UGI A;  4X2O A;  3LXU X;  4KVH A;  4J9A A;  2IUJ A;  3CMA 3;  5KP1 A;  1W6G A;  1GOV A;  1HYF A;  2D42 A;  4XBY A;  4NRE A;  1LRA A;  1NB5 I;  1MNL A;  2P09 A;  1JKG B;  5M1A A;  1VQM 3;  3ALA A;  2CWU A;  1VQ9 3;  3KCH A;  3NQZ A;  1BRN L;  1IQX A;  3T0U A;  1YJ9 3;  2SAR A;  3K7C A;  2KF4 A;  2CW9 A;  1RGF A;  3U1W A;  1TRQ A;  3EE1 A;  1VQK 3;  1I0X A;  4KFD A;  1BRH A;  2CFW A;  3HOH A;  3JUQ A;  2B24 B;  3ER7 A;  1C54 A;  3WOF B;  1RGK A;  1EKM A;  4O3V A;  4X2H A;  3EBY A;  4LSO A;  5RNT A;  1OUN A;  3EB8 A;  4FCJ A;  2L1S A;  2JQ5 A;  1MOL A;  1FGO A;  1OH0 A;  1GY7 A;  3AMO B;  4IT7 A;  4EXR A;  1JV2 B;  2HOH A;  4FMD A;  4MMY B;  4CDL A;  3BB9 A;  1Q7Y 4;  4AKY A;  1NWW A;  2KF6 A;  2QGU A;  3LML A;  1ZGX A;  3CCL 3;  3CC2 3;  1BSE A;  1BRK A;  5HGR A;  3D5I A;  1K8A 4;  2YFI B;  1IV9 A;  4IPB A;  3MG2 A;  1X1U A;  2Z76 A;  4ORL A;  4R4K A;  3FZW A;  3G4S 3;  3DH2 A;  1BNF A;  2OCT A;  3S5C A;  2IMJ A;  4NPB A;  3UB1 A;  1T2I A;  1JBR A;  2F99 A;  5CK6 A;  4BTW A;  3CCV 3;  3E99 A;  1DMN A;  5IER A;  1Q86 4;  2CFK A;  6GSP A;  1TFO A;  4N6V 0;  3PZW A;  1HZ1 A;  1K9M 4;  3GZY B;  5BU4 A;  3EN1 B;  4R9K A;  1JZO A;  1G02 A;  1TUH A;  2JDI H;  1RNT A;  1T5Y A;  2WOH A;  1BRS A;  2Y73 A;  3LTC A;  5TGN A;  1F8N A;  1N5P A;  1K73 4;  1IVX A;  1HU9 A;  2P0X A;  3JUP A;  3KN4 A;  3SOY A;  1RLS A;  1GY5 A;  5AIG A;  3SX1 A;  2CIU A;  3KII A;  3OXA A;  1YI2 3;  1JBT A;  1VQ5 3;  4LMI A;  2KRT A;  1B3S A;  1LNI A;  1LQM B;  2AAD A;  4KFE A;  1LNH A;  5M19 A;  2KAA A;  1UCI A;  1RSN A;  1UUW B;  4XBX A;  1DE3 A;  3LT8 A;  4KFF A;  4XBT A;  2ML6 A;  1BU4 A;  3Q1C A;  4N3V A;  5LC6 A;  4HM3 B;  2WGQ A;  5EQL A;  3EF8 A;  1W02 A;  3OWS A;  1BNG A;  3AGN A;  3DGM A;  1JN5 B;  2E2T A;  2BIR A;  1AQZ A;  1IT8 A;  3GSP A;  1BNE A;  2W56 B;  4XB5 A;  2GEY A;  1LQG C;  1ISK A;  5EEO A;  3J7Y d;  3A5E A; 
#chains in the Genus database with same CATH homology
 1OF5 A;  4CCV A;  1Q82 4;  3LTD A;  1S72 3;  1EA2 A;  4QWT A;  1FUW A;  3WDG B;  3U97 A;  5JPU A;  1RRL A;  2FGT A;  2XH9 A;  1RKY A;  1PU4 A;  1Z1S A;  2P38 A;  1L5G B;  1IV7 A;  2BT3 A;  1FGT A;  1K28 A;  3Q90 A;  1O7G B;  2CH9 A;  1G96 A;  2XSH B;  3GWR A;  2ZDJ A;  1JB4 A;  3MYT A;  1YJN 3;  2HML B;  1STD A;  4MJD A;  3NUV A;  5JBS A;  3EX9 A;  4MMX B;  2Q07 A;  2RFR A;  2FXT A;  4HJL B;  3G71 3;  2W0Q A;  1UI8 A;  1VQO 3;  1Q40 B;  3X41 A;  5D81 A;  1U8C B;  4O8S A;  2OTL 3;  1ZO2 A;  2BMR B;  5IEP A;  2PNC A;  2W9P A;  3JUN A;  4R80 A;  1D6U A;  2CKF B;  1DVC A;  3G6E 3;  1Q81 4;  4AKZ A;  2WOF A;  2QA4 3;  2IA7 A;  1IQ8 A;  1UW1 A;  1VZZ A;  1ROA A;  2XFT A;  4LEH A;  3O8Y A;  4HBR A;  3DGN A;  2R4I A;  2CFD A;  3FGY A;  1ASK A;  3JUO A;  3B7C A;  5G2G A;  1M1K 4;  1VQ6 3;  2RCD A;  1JJ2 2;  3CNX A;  1EQK A;  1IVU A;  4WHA A;  3NBB A;  3KSP A;  1RN7 A;  4N6T A;  3D3L A;  3K5T A;  4STD A;  4BTY A;  4MMZ B;  2HMJ B;  2KXG A;  5ELJ A;  1M90 4;  2P05 A;  5AEU B;  2XR8 B;  3NM7 A;  1W2B 2;  1AV4 A;  2C10 A;  2W04 A;  4TX4 A;  3TDG A;  1OAC A;  4OUQ A;  5CF1 A;  4HM6 B;  1IT7 A;  1C7H A;  1O7W B;  2UX0 A;  1VQ8 3;  3UL5 A;  1RRH A;  1QJG A;  4EBG A;  4PEJ A;  5AYS C;  1AVK A;  1W01 A;  2MF7 A;  3CCU 3;  4L8P A;  4FMA A;  4K1V A;  3MKI A;  2HMK B;  1N8R 4;  3SOA A;  3DY5 A;  5D83 A;  3NBJ A;  1KC8 4;  3VF1 A;  6STD A;  5FGO A;  4GB5 A;  4LGQ A;  1DMQ A;  3ROB A;  1JB2 A;  2FNQ A;  2YFJ B;  4IIA A;  2XFS A;  2BHM A;  1LOX A;  1WTH A;  2BMO B;  3F7S A;  4OVM A;  1KWI A;  2A15 A;  2HMM B;  3HIG A;  3N9H A;  3LTB A;  4JRF A;  2Z7A A;  2HMO B;  3EBT A;  3F9S A;  3JUM A;  3X3X A;  1E97 A;  3T8N A;  4HM7 B;  4AEQ A;  4U13 A;  2CWV A;  4RNZ A;  4XDW A;  1RJO A;  3NV0 A;  3WMD A;  1ULJ B;  3T8U A;  1OHO A;  4K1U A;  3F40 A;  5LC7 A;  1GD3 A;  3VGN A;  1CQS A;  2CHC A;  2OOV A;  3IJE B;  4FR9 A;  3WOE B;  5IF6 A;  1Q42 A;  2CFL A;  1S5A A;  1UI7 A;  2GBX B;  2K0M A;  5DRV A;  3FG4 A;  1YGE A;  1VQ7 3;  3I0Y A;  4FMB A;  1PFP A;  2ZL8 A;  1QAF A;  4MEI A;  1ULI B;  2MC8 A;  3RGR A;  4WYK B;  3UL6 A;  3X40 A;  1TU5 A;  4HM5 B;  2Z77 A;  3F8X A;  1IVW A;  4R9L A;  3I55 3;  3OX9 A;  1NJI 4;  3CCR 3;  2K54 A;  1SPU A;  3FG3 A;  3B4P A;  1K41 A;  3RGA A;  3OW2 2;  2LQV A;  3NHX A;  3FF2 A;  1IVV A;  3EN8 A;  3K9M C;  3EHC A;  4WWU C;  4R1K A;  3KKG A;  4O02 B;  4HZ9 B;  5IEO A;  1VQN 3;  3AMO A;  4XM4 A;  1VQL 3;  2W9Q A;  1QVG 2;  3QRD A;  2INX A;  1A2K A;  4HYZ A;  4K61 A;  3OWU A;  1DYU A;  1TP6 A;  2XEP A;  3NBR A;  3V99 A;  1YIJ 3;  1KSI A;  1SII A;  3GZR A;  1LXE A;  1E3V A;  2OOV C;  1DMM A;  1A67 A;  1HKX A;  3V92 A;  1M9G A;  1GD4 A;  2F98 A;  2I9W A;  1SJW A;  3PGB A;  3X3Y A;  3NX0 A;  5A0O B;  1QMA A;  3WA3 A;  3WOD G;  1W5Z A;  2L4V A;  3LT9 A;  4HZB B;  1KQS 2;  5STD A;  3CCS 3;  3A76 A;  3PCR A;  1OPY A;  2LYX A;  5IW9 A;  2PZV A;  3GZX B;  2E2U A;  2YX9 A;  3PXM A;  4NHF A;  3Q2P A;  1IQY A;  4EV5 A;  3MSO A;  5IG5 A;  2RGQ A;  5BVB A;  1GS3 A;  2RSX A;  3KFQ C;  2WO0 A;  2O3O A;  3K0Z A;  5AI1 A;  3DMC A;  1GYB A;  3HX8 A;  3HZP A;  3CC7 3;  3MPH A;  2STD A;  1N9E A;  3CU3 A;  3KE7 A;  3CNM A;  3H3H A;  2XRX B;  3ECF A;  3F14 A;  2HMN B;  3LZA A;  3PCS A;  4FCM A;  1TIJ A;  1O7M B;  3CPO A;  2IUK A;  1NU3 A;  3NQY A;  3NV0 B;  2Z6B A;  4XDV A;  2SBL A;  1WMO A;  5IG3 A;  3NM2 A;  4ZM8 A;  4J8T A;  5KP4 A;  1NDO B;  1ZX2 A;  3MWZ A;  3CCE 3;  3LH4 A;  2P0M A;  2E2V A;  5AEW B;  1W6C A;  3FSD A;  1CYV A;  1JN5 A;  3SXX A;  3FKA A;  2W56 A;  2CG1 A;  2W2C A;  3STD A;  3FG1 A;  1JRQ A;  4L7K A;  3CCM 3;  3DXO A;  4OK0 A;  4HKV B;  3DGO A;  1WMN A;  3DZL A;  1D6Z A;  2CFG A;  3DUK A;  3PS8 A;  5KP3 A;  2KCD A;  2XF3 A;  3BNB A;  3S29 A;  1DVD A;  5AIF A;  5D82 A;  4RNY A;  4N6M A;  3RDE A;  1OHP A;  3N8B A;  3IMA B;  4KZ1 A;  3S28 A;  3MG3 A;  4HM1 B;  5AIH A;  2BO9 B;  1WMP A;  3G0K A;  2GEX A;  3IPT A;  2OTJ 3;  2V1L A;  4EV2 A;  1OF5 B;  2CK3 H;  1IDP A;  2W6J H;  4HM2 B;  1W7C A;  1WNH A;  4O2H A;  5I97 A;  3GAX A;  1STF I;  2B1X B;  3UJM A;  1FGM A;  3VSY A;  2CC3 A;  2OWP A;  3EJV A;  5CLK A;  1SQW A;  5ELU A;  2ML5 A;  3D9R A;  3FLJ A;  1Q40 A;  2BMQ B;  3FCS B;  3JVC A;  1YVB I;  1OCV A;  1CEW I;  4G1M B;  5IG0 A;  3CD6 3;  3G16 A;  3B8L A;  3G8Z A;  1IU7 A;  1R4C A;  3MG1 A;  3EQQ B;  1QVF 2;  4HVN A;  1YIT 3;  5IG4 A;  2D1W A;  2C11 A;  4H61 A;  4Q53 A;  1IK3 A;  4EYC A;  3CCJ 3;  1AVL A;  1J2B A;  3GZB A;  4JF8 A;  1W00 A;  1WQL B;  2GBW B;  3KSE D;  3PYJ A;  1O7H B;  1JB5 A;  4WP5 A;  1CYU A;  3HK4 A;  5JPP A;  2Y74 A;  1E3R A;  1JKG A;  3BND A;  4HM0 B;  2WGO A;  5AYR B;  3CCQ 3;  1A90 A;  4HM4 B;  3F7X A;  3H51 A;  3NXJ A;  2F86 B;  1O7N B;  2O9U X;  1FGQ A;  4RBN A;  3S67 A;  3CPW 2;  4K90 B;  8CHO A;  1FGR A;  2M7O A;  2W03 A;  3SED A;  3V98 A;  2XGL A;  3FH1 A;  4N6N B;  7STD A;  3OWY A;  3CC4 3;  2XSO B;  3MHE A;  1NB3 I;  3SVA A;  1KD1 4;  3I56 3;  1A2V A;  4L8O A;  1GY6 A;  2QIY A;  3B4O A;  1YHQ 3;  4WFO A;  1W2Z A;  1W6Y A;  3K63 A;  2OQE A;  3HII A;  1EG9 B;  1JNQ A;  3LOY A;  1SIH A;  3QK9 A;  4FCZ A;  1OGZ A;  3N54 B;  5CXO A;  1VQ4 3;  1FA3 A;  4HM8 B;  1UUV B;  3SLU A;  1V74 A;  5BXQ A;  2BNG A;  1YJW 3;  4RZM A;  3L0R A;  4N6U A;  5EVH A;  3CXC 2;  2GXF A;  3M8C A;  1W4N A;  3OV4 A;  1N5H A;  3BNC A;  3FF0 A;  3BNE A;  3X3Z A;  2YFL B;  3S27 A;  3LTA A;  1LVN A;  3KZT A;  4FMC A;  3X42 A;  1U5O A;  1M1X B;  2QEX 3;  1BUQ A;  2CWT A;  1QAK A;  5IEN A;  1N8Q A;  4N6O B;  3LYG A;  2CG0 A;  4N6L A;  1OGX A;  1Y4K A;  3HI7 A;  5DRE A;  4GL6 A;  2XGN A;  4BTX A;  3DGL A;  3CME 3;  3UNL A;  4LZI A;  1OHS A;  1ROV A;  1QAL A;  4I4K A;  1VQP 3;  1AR0 A;  5CF2 A;  4EC6 A;  5AII A;  1O7P B;  2GU1 A;  4WYK A;  5FW5 A;  1NO3 A;  2GU3 A;  3BLZ A;  4H3U A;  1US1 A;  1TFK A;  2OQE C;  1D6Y A;  3DM8 A;  1N9J A;  3EC9 A;  3F8H A;  3GRD A;  3WA2 X;  4X2O A;  3LXU X;  4KVH A;  4J9A A;  2IUJ A;  3CMA 3;  5KP1 A;  1W6G A;  2D42 A;  4XBY A;  4NRE A;  1NB5 I;  1MNL A;  2P09 A;  1JKG B;  1VQM 3;  3ALA A;  2CWU A;  1VQ9 3;  3NQZ A;  1IQX A;  3T0U A;  1YJ9 3;  3K7C A;  2CW9 A;  3U1W A;  3EE1 A;  1VQK 3;  4KFD A;  2CFW A;  3JUQ A;  2B24 B;  3ER7 A;  3WOF B;  1EKM A;  4O3V A;  4X2H A;  3EBY A;  4LSO A;  1OUN A;  3EB8 A;  4FCJ A;  2JQ5 A;  1MOL A;  1FGO A;  1OH0 A;  1GY7 A;  3AMO B;  4IT7 A;  4EXR A;  1JV2 B;  4FMD A;  4MMY B;  4CDL A;  3BB9 A;  1Q7Y 4;  4AKY A;  1NWW A;  2QGU A;  3LML A;  3CCL 3;  3CC2 3;  5HGR A;  1K8A 4;  2YFI B;  1IV9 A;  4IPB A;  3MG2 A;  2Z76 A;  4ORL A;  3G4S 3;  4R4K A;  3FZW A;  2OCT A;  3S5C A;  2IMJ A;  3UB1 A;  2F99 A;  5CK6 A;  4BTW A;  3CCV 3;  3E99 A;  1DMN A;  5IER A;  1Q86 4;  2CFK A;  1TFO A;  4N6V 0;  3PZW A;  1K9M 4;  3GZY B;  3EN1 B;  4R9K A;  1TUH A;  2JDI H;  1T5Y A;  2WOH A;  2Y73 A;  3LTC A;  5TGN A;  1F8N A;  1N5P A;  1K73 4;  1IVX A;  1HU9 A;  2P0X A;  3JUP A;  3KN4 A;  3SOY A;  5AIG A;  1GY5 A;  3SX1 A;  2CIU A;  3KII A;  3OXA A;  1YI2 3;  1VQ5 3;  4LMI A;  2KRT A;  4KFE A;  1LNH A;  1UUW B;  4XBX A;  3LT8 A;  4KFF A;  4XBT A;  2ML6 A;  3Q1C A;  4N3V A;  5LC6 A;  4HM3 B;  2WGQ A;  5EQL A;  3EF8 A;  1W02 A;  3OWS A;  3DGM A;  1JN5 B;  2E2T A;  1IT8 A;  2W56 B;  4XB5 A;  2GEY A;  1ISK A;  5EEO A;  3J7Y d; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...