3OW22

Crystal structure of enhanced macrolide bound to 50s ribosomal subunit
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
92
structure length
92
Chain Sequence
MQMPRRFNTYCPHCNEHQEHEVEKVRSGRQTGMKWIDRQRERNSGIGNDGKFSKVPGGDKPTKKTDLKYRCGECGKAHLREGWRAGRLEFQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 23S RIBOSOMAL RNA
total genus 17
structure length 92
sequence length 92
ec nomenclature
pdb deposition date 2010-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
2 PF00935 Ribosomal_L44 Ribosomal protein L44
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.80 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3ow2200
2QEX3 3G6E3 1K734 1VQ53 1QVG2 1M904 3CMA3 3CCQ3 1M1K4 3CC43 3CD63 3CME3 1VQO3 2QA43 1N8R4 1Q864 1Q814 1NJI4 1Q824 1VQN3 3CCU3 1VQM3 1VQK3 1S723 1QVF2 3CC73 1YJ93 2OTL3 1VQP3 1KD14 1VQ63 1JJ22 1YI23 3CCV3 3CCS3 1VQ73 1YIT3 1Q7Y4 3CCL3 1YIJ3 3G4S3 1KQS2 3I553 1YJN3 1K8A4 3OW22 3CCE3 1VQ83 1VQL3 3CCM3 1YJW3 1VQ93 2OTJ3 3CCR3 3CC23 3CCJ3 1YHQ3 3G713 3CPW2 1VQ43 1KC84 1W2B2 3CXC2 3I563 1K9M4
chains in the Genus database with same CATH superfamily
1OPYA 2GU3A 2WOHA 1BUQA 2CH9A 2XF3A 2AADA 2KF4A 4N6LA 1B2ZA 4OVMA 3FZWA 2MC8A 4HOHA 3SLUA 1BSCA 3IJEB 4GHOA 1W4NA 1I70A 4MJDA 3ROBA 3TDGA 1Q814 1NJI4 4N6NB 1DVCA 1JBTA 1W2ZA 2C4BA 3ECFA 5BIRA 3NM2A 3X3ZA 1VQQA 5IG3A 1DMMA 2BU4A 2ML5A 3DGOA 3EJVA 1IQ8A 5AYSC 5CK6A 2GBXB 3Q2PA 1M1XB 5AIGA 3DGLA 7GSPA 4MMXB 4N6MA 1BNIA 1IVXA 1VQ93 4XDVA 3FSDA 3KZTA 3PCRA 3E99A 4XM4A 2SBLA 4EW5A 3LT8A 1QJGA 1Q7HA 5STDA 1UUVB 1BOXA 1A67A 1GOYA 2FXTA 1BIRA 3VSYA 1BSBA 1JB5A 4J5KA 3STDA 3BIRA 3SYUA 2KF3A 3T8UA 3CCQ3 3DH2A 5IF6A 3CC43 2V1LA 1W7CA 2KRTA 4AKYA 4L8OA 3EBTA 3PGBA 1RSNA 3OV4A 4HYZA 1QVF2 4K61A 5IERA 1C54A 1LXEA 3FCSB 1EA2A 3I0YA 1JJ22 3ZG5A 3AMOB 1B2UA 1KSIA 2CX1A 3K5TA 3F7SA 1LOXA 1IK3A 3CCS3 4BL2A 2F86B 1VZZA 4MMYB 6STDA 3BB9A 4JF8A 1HKXA 1LVNA 2C11A 2YX9A 1CH0A 1WTHA 1QAKA 3PS8A 4CJNA 1WMNA 1TU5A 1RGHA 2YFJB 1JBRA 3MG3A 3MWZA 4DKIA 4I4KA 4I5QA 1RN1A 5CF1A 1G0TA 1B27A 3OWYA 4Q53A 5HGRA 3WODG 1EEJA 4XBYA 5AEUB 1UW1A 1RGGA 3CME3 3GZXB 3URPA 4FMDA 3OWSA 2IMJA 1RCLA 1IV9A 1N5HA 1DYUA 2CW9A 2E2UA 3AMOA 5M18A 1CYVA 1BSAA 1FYSA 1WMPA 1FGTA 1MOLA 2BMRB 2CFWA 3DGYA 1FW7A 3O8YA 3FH1A 5AIFA 2F99A 1IVWA 1UGIA 1YJN3 4XBTA 2R4IA 2HOHA 2QIYA 2XSHB 2RCDA 4LMIA 3GSPA 1VQ43 1W02A 1W2B2 2HMNB 1BNGA 1U8CB 3CXC2 3L0RA 1RDSA 1QVG2 2W56B 1BRSA 2LYXA 1AV4A 3B4PA 3T0UA 2UX0A 2F5WA 1AVLA 1IYYA 5KP4A 2GU1A 1Q824 2JQ5A 2GEXA 5G1KA 5IG0A 1C7HA 1HYFA 3MPHA 1E3VA 1N8QA 1JRQA 2CFGA 3MHEA 2XEPA 3CCL3 3EX9A 1RGKA 1YJW3 1G96A 1ASKA 1I2EA 1K8A4 3B7CA 4R1KA 3IMAB 3NBBA 4HM5B 2PNCA 2XH9A 1QALA 3MYTA 3EN8A 1JB4A 1W00A 2ZHXB 3GAXA 1IQXA 1TRQA 2Z76A 3I563 1MGRA 1VQ73 2XRXB 1K9M4 3GZYB 3KKGA 1YVSA 1SIHA 2WGQA 1TFOA 4XDWA 5DRVA 1JN5B 1LOYA 4MEIA 1T5YA 2CX0A 1OACA 2OOVA 4N6TA 1A2PA 2GEYA 3EBYA 1BRKA 1MWSA 2MF7A 2ZL8A 1V57A 1ULIB 4KFDA 2FGTA 1QAFA 1RTUA 1UDII 2F56A 4HVNA 3WHOA 2CHCA 5CXOA 3MKIA 5BVBA 1GSPA 1A2VA 1IVVA 2KAAA 4R9LA 3DGMA 1AR0A 2GXFA 3NBRA 4LZIA 1PFPA 5KP3A 3UJMA 2CG0A 3LXUX 3CC23 3G713 4RZMA 1QMAA 2R41A 1Q40A 1BRHA 1SARA 4BU4A 1FUWA 1TUHA 4ILFA 4K1UA 5GSPA 4R9KA 1IV7A 2OQEA 1VQ53 1N9EA 5EEOA 1KWIA 1UI8A 1ZS7A 2OCTA 4HAAA 3CC73 2FNQA 1RN4A 3V99A 1RJOA 1UCLA 1B2SA 3KE7A 2WO0A 3AGNA 2HMKB 1VQK3 1SPUA 1FA3A 2HMJB 3NXJA 3KSED 4JRFA 1CYUA 1ZX2A 3J7Yd 2OWPA 1ULJB 3SX1A 3NX0A 3VF1A 1GMQA 2YFIB 4R4KA 4AEQA 4BTWA 1FGRA 3D79A 1US1A 1B21A 1AQZA 1RGAA 1UCIA 4N6OB 4FCJA 4HM7B 2KXGA 2O9UX 3LYGA 4L8PA 1NB3I 1OF5A 3EF8A 2QEX3 2XGLA 3S29A 2XFTA 3CD63 1FZUA 1TRPA 1TTOA 1FUTA 3HIGA 4NHFA 1GD3A 1O7NB 2CIUA 3H3HA 3SXXA 5CLKA 3WOEB 4HBRA 1V58A 5ELJA 3H51A 3MSOA 3WA3A 1X1WA 1RGEA 2BMOB 2RGQA 3EN1B 1T2HA 2E2TA 4KFFA 3Q3FA 2P0MA 3UL6A 4EC6A 3N9HA 1B2XA 1NU3A 4O8SA 4EXRA 5IEOA 3S5CA 1WNHA 3FF2A 3ZFZA 2KCDA 4U13A 3CCE3 1DMQA 3CPOA 1MNLA 1Q42A 2GBWB 3JVCA 2CFDA 4L7KA 1JBSA 3LH4A 1TP6A 3CPW2 1O7GB 1JB2A 4XB5A 3F40A 1KC84 3ZG0A 2W9QA 4HKVB 1DVDA 2M7OA 3RDEA 1L5GB 5D82A 3MG2A 4HM2B 3WDGB 1T2IA 3EQQB 5JBSA 5TGNA 3X3YA 2HMOB 2ZDJA 1A90A 4STDA 2Z77A 3FG3A 1JZDA 2QGUA 2A15A 5A0OB 4K90B 1GYBA 3JUOA 1LNHA 1VQP3 3K7CA 3N54B 1JNQA 4HJLB 1YI23 2B24B 3D3LA 3CCV3 3DMCA 3GZBA 3SEDA 1SQWA 1LOWA 2D42A 2L4VA 1IDPA 3I553 4OK0A 3UNLA 1UUGB 1I3FA 3A5EA 1GOVA 3RGRA 4EYCA 2CK3H 3X42A 3G6E3 3D5GA 1RN7A 1AY7A 3CNMA 4MMZB 1EQKA 1RHLA 4HM4B 4H61A 3K0ZA 3KCHA 4FMAA 2Z6BA 3K63A 3PXMA 5EVHA 2B1XB 2CWVA 2RFRA 3JUPA 5DREA 2CKFB 2CWUA 1OCVA 1NDOB 2F4YA 1BVIA 2L1SA 4WYKA 1SJWA 1SIIA 3LTCA 1TJDA 2OQEC 4J8TA 1VQ63 2Z7AA 1DE3A 1O7PB 5IENA 2P0XA 1X1YA 4HM3B 1IU7A 4X2HA 4FMBA 1PYLA 5CF2A 3BNDA 4RNTA 2Q07A 3Q1CA 4HZ9B 1IQYA 3QRDA 4LYLB 6RNTA 1JKGB 2IUKA 1ZGXA 3FG1A 3CCJ3 3X3XA 1R4CA 3S67A 5D83A 2BT3A 1HZ1A 1X1XA 2J8XB 1EKMA 4KT3B 2W9PA 3F7XA 1UGHI 4J9AA 3WMDA 8RNTA 3NV0B 1TFKA 1JZOA 5IEPA 3OWUA 1M904 4G1MB 2HMLB 3DZLA 4R80A 1BNRA 1J2BA 2LQVA 2ML6A 3AGOA 4AKZA 3N8BA 1GOUA 1NB5I 1O7MB 3PZWA 1ROAA 3JUMA 5ELUA 1OHSA 3LZAA 1I0XA 3Q90A 2E2VA 3D4AA 3CU3A 1M9GA 3ALAA 3V98A 5M19A 1O7HB 3CNXA 3DY5A 5LC6A 1I8VA 2BIRA 2W2CA 2CFKA 2AAEA 5AEWB 8CHOA 3CCM3 4LGQA 1BUJA 4EV2A 2CWTA 1STFI 3SOAA 4N6V0 4CCVA 3GZRA 3S27A 1NO3A 1UUWB 2BO9B 1BRGA 1RLSA 2O3OA 3NV0A 1RCKA 4RNZA 5KP1A 4HM8B 3HOHA 5D81A 1BGSA 1Z1SA 2XGNA 2YFLB 3BNEA 1D6YA 2W56A 2BNGA 3WA2X 3GWRA 1Q864 3B4OA 5EQLA 2IUJA 3CCU3 1GY6A 2P09A 2UUGC 1FUSA 1N5PA 1VQM3 4J5GA 3BNCA 4BL3A 1KD14 1YNVX 4ZM8A 2PZVA 3FGYA 1PU4A 3NHXA 1YIJ3 1D6ZA 2ZA4A 5AI1A 1ZO2A 2IY2A 1LNIA 4FR9A 3X41A 3D9RA 4BIRA 1N9JA 3HIIA 1VQ83 1GY7A 3LTAA 3NM7A 5IW9A 1GD4A 1G02A 2OTJ3 3EHCA 4H3UA 4FCZA 4N3VA 1F8NA 2F5MA 5G2GA 1U5OA 5LC7A 3X40A 1BRIA 1MGWA 2H0IA 4O3VA 1BRNL 5JPUA 3DGNA 4ORLA 1K734 3SOYA 2CG1A 3V92A 1MWTA 1K41A 1LRAA 1UI7A 3EE1A 3D5IA 1B2MA 1OF5B 4RBNA 1B20A 2XSOB 3HK4A 1S723 4HM1B 1BNFA 3AHSA 5AYRB 1FGMA 3BLZA 2STDA 4RNYA 4WFOA 5FW5A 2P05A 4KFEA 3OW22 3NBJA 5AIIA 1TIJA 1FGQA 2BMQB 1BSDA 2Y73A 1RNTA 3UL5A 1YHQ3 1YVBI 1RGFA 2HMMB 2W03A 4FMCA 4PEJA 7STDA 1CQSA 2INXA 2WOFA 1K28A 1RMSA 3CMA3 2BHMA 1Q9EA 4GL6A 4KVHA 3NQZA 1BNEA 1IT7A 2RNTA 3KSPA 2W6JH 4QWTA 3KIIA 1LQGC 4IT7A 2GSPA 4WP5A 2JDIH 4IIAA 3S28A 5M1AA 3M8CA 3BU4A 3F9SA 4O2HA 1Q7Y4 1E3RA 1OHOA 3WOFB 2H0HA 3FLJA 1KQS2 1MWRA 4WHAA 2C10A 3KN4A 1GS3A 1B3SA 1O7WB 2W0QA 4HM6B 2XR8B 1FGOA 3WR2A 1YGEA 3U1WA 2IA7A 3ER7A 1RGLA 2Y74A 4EV5A 3LMLA 4XBXA 3QK9A 1RKYA 1HU9A 4KZ1A 3IPTA 3LOYA 1GY5A 1JN5A 3AHWA 3HZPA 1W6GA 1LQMB 3JUQA 3MG1A 1M1K4 1EUIC 1OGXA 1N8R4 4HZBB 3T8NA 4K1VA 4CDLA 2K54A 2SARA 2CFLA 3DM8A 2OTL3 6GSPA 1GMPA 3LTDA 7RNTA 2UGIA 5G1LA 1BRJA 1DETA 3LTBA 3VGNA 4OUQA 1MWUA 4FCMA 1OGZA 1RRHA 3U97A 1Y4KA 3FF0A 1OH0A 1BAOA 4GSPA 5AIHA 1GMRA 4BTXA 1T3BA 5BXQA 3CCR3 1A2KA 1OHPA 1BU4A 3A76A 2I9WA 2D1WA 4TX4A 3G8ZA 1YGWA 1JKGA 3EB8A 3JUNA 3FG4A 1W01A 1W6YA 3UB1A 2WGOA 1LOVA 3BNBA 3NUVA 3FKAA 4NREA 1VQN3 1IT8A 1NNVA 4LEHA 3OX9A 1OUNA 2K3DA 3KFQC 2KF5A 1I0VA 3HI7A 5BU4A 1YIT3 3NQYA 5IG5A 2RBIA 1RNBA 4HM0B 4X2OA 3RGAA 5HOHA 1VQL3 1S5AA 1PY3A 5I97A 3PYJA 3PCSA 3LT9A 1BNSA 4O02B 2P38A 3SVAA 1I2FA 1BNJA 1D6UA 1IVUA 2K0MA 3DXOA 3DUKA 4EBGA 3GRDA 5IG4A 2F98A 2H0GA 1VQO3 5RNTA 1BSEA 1I3IA 2QA43 3EC9A 1WMOA 1STDA 1WQLB 2CC3A 1E97A 1UCJA 4CPKA 3OXAA 1RRLA 4N6UA 1YJ93 2XFSA 1BANA 1R4YA 3B8LA 1ISKA 4WYKB 9RNTA 3F8HA 4LSOA 3G16A 3K9MC 5JPPA 3F14A 4NPBA 1DMNA 4BTYA 2IYJA 3G0KA 1NWWA 1Q40B 3RNTA 1UCKA 1X1UA 3G4S3 1W6CA 1W5ZA 1AVKA 4GB5A 4IPBA 2OOVC 1ROVA 1CEWI 1V74A 3F8XA 1RGCA 2W04A 3HX8A 2KF6A 2RSXA 1EG9B 5FGOA 1I2GA 4WWUC 1JV2B
chains in the Genus database with same CATH topology
1OPYA 2GU3A 2WOHA 1BUQA 2CH9A 2XF3A 4N6LA 2MC8A 4OVMA 3FZWA 3SLUA 3IJEB 4MJDA 1W4NA 3ROBA 3TDGA 1Q814 1NJI4 4N6NB 1DVCA 1W2ZA 3ECFA 3NM2A 3X3ZA 5IG3A 1DMMA 2ML5A 3DGOA 3EJVA 1IQ8A 5AYSC 5CK6A 2GBXB 3Q2PA 1M1XB 5AIGA 3DGLA 4MMXB 4N6MA 1IVXA 1VQ93 4XDVA 3FSDA 3KZTA 3PCRA 3E99A 4XM4A 2SBLA 3LT8A 1QJGA 5STDA 1UUVB 1A67A 2FXTA 3VSYA 1JB5A 3STDA 3CCQ3 3T8UA 5IF6A 3CC43 2V1LA 1W7CA 2KRTA 4AKYA 4L8OA 3EBTA 3PGBA 4HYZA 3OV4A 1QVF2 4K61A 5IERA 1LXEA 3FCSB 1EA2A 3I0YA 1JJ22 3AMOB 1IK3A 1KSIA 3CCS3 3K5TA 3F7SA 1LOXA 2F86B 1VZZA 4MMYB 6STDA 3BB9A 4JF8A 1HKXA 1LVNA 2C11A 2YX9A 1WTHA 1QAKA 3PS8A 1WMNA 1TU5A 2YFJB 3MG3A 3MWZA 4I4KA 5CF1A 3OWYA 4Q53A 5HGRA 3WODG 5AEUB 4XBYA 1UW1A 3CME3 3GZXB 4FMDA 3OWSA 2IMJA 1IV9A 1N5HA 1DYUA 2CW9A 2E2UA 3AMOA 1CYVA 2BMRB 1WMPA 1FGTA 1MOLA 2CFWA 3O8YA 3FH1A 5AIFA 2F99A 1IVWA 1YJN3 4XBTA 2R4IA 2QIYA 2XSHB 2RCDA 4LMIA 1VQ43 1W02A 1W2B2 2HMNB 1U8CB 3CXC2 3L0RA 1QVG2 2W56B 3T0UA 2LYXA 1AV4A 3B4PA 2UX0A 1AVLA 5KP4A 2GU1A 1Q824 2JQ5A 2GEXA 5IG0A 1C7HA 3MPHA 1E3VA 1N8QA 1JRQA 2CFGA 3MHEA 2XEPA 3CCL3 3EX9A 1G96A 1ASKA 1K8A4 3B7CA 4R1KA 3IMAB 3NBBA 4HM5B 2PNCA 2XH9A 1QALA 3MYTA 3EN8A 1JB4A 1W00A 3GAXA 1IQXA 2Z76A 3I563 1VQ73 1K9M4 2XRXB 3GZYB 3KKGA 1SIHA 2WGQA 1TFOA 4XDWA 5DRVA 1JN5B 4MEIA 1T5YA 1OACA 2OOVA 4N6TA 2GEYA 3EBYA 2MF7A 2ZL8A 1ULIB 4KFDA 2FGTA 1QAFA 4HVNA 2CHCA 5CXOA 3MKIA 5BVBA 1A2VA 1IVVA 4R9LA 3DGMA 1AR0A 2GXFA 3NBRA 4LZIA 1PFPA 5KP3A 3UJMA 2CG0A 3LXUX 3CC23 3G713 4RZMA 1QMAA 1Q40A 1FUWA 1TUHA 4K1UA 2OQEA 4R9KA 1IV7A 1VQ53 1N9EA 5EEOA 1KWIA 1UI8A 2OCTA 2FNQA 3V99A 1RJOA 3KE7A 2WO0A 2HMKB 1VQK3 1SPUA 1FA3A 2HMJB 3NXJA 3KSED 4JRFA 1CYUA 1ZX2A 3J7Yd 2OWPA 1ULJB 3SX1A 3NX0A 3VF1A 2YFIB 4R4KA 4AEQA 4BTWA 1FGRA 1US1A 4N6OB 4FCJA 4HM7B 2KXGA 2O9UX 3LYGA 4L8PA 1NB3I 1OF5A 3EF8A 2QEX3 2XGLA 3S29A 2XFTA 3CD63 4NHFA 3HIGA 1GD3A 1O7NB 2CIUA 3H3HA 3SXXA 5CLKA 3WOEB 4HBRA 5ELJA 3H51A 3MSOA 3WA3A 3EN1B 4KFFA 2BMOB 2RGQA 4EC6A 2E2TA 3CC73 3UL6A 2P0MA 3N9HA 1NU3A 4O8SA 4EXRA 5IEOA 3S5CA 1WNHA 3FF2A 2KCDA 4U13A 3CCE3 1DMQA 3CPOA 1MNLA 1Q42A 2GBWB 3JVCA 2CFDA 4L7KA 3LH4A 1TP6A 3CPW2 1O7GB 1JB2A 4XB5A 3F40A 1KC84 2W9QA 4HKVB 1DVDA 2M7OA 3RDEA 1L5GB 5D82A 3MG2A 4HM2B 3WDGB 3EQQB 5JBSA 5TGNA 3X3YA 2HMOB 2ZDJA 1A90A 4STDA 2Z77A 3FG3A 2QGUA 2A15A 5A0OB 4K90B 1GYBA 3JUOA 1LNHA 1VQP3 3K7CA 3N54B 1JNQA 4HJLB 1YI23 2B24B 3D3LA 3CCV3 3DMCA 3GZBA 3SEDA 1SQWA 2D42A 2L4VA 1IDPA 3I553 4OK0A 3UNLA 3RGRA 4EYCA 2CK3H 3X42A 3G6E3 1RN7A 3CNMA 4MMZB 1EQKA 4HM4B 4H61A 3K0ZA 4FMAA 2Z6BA 3K63A 3PXMA 5EVHA 2B1XB 2CWVA 2RFRA 3JUPA 5DREA 2CKFB 2CWUA 1OCVA 1NDOB 4WYKA 1SJWA 1SIIA 3LTCA 4J8TA 2OQEC 1VQ63 2Z7AA 1O7PB 5IENA 2P0XA 4HM3B 1IU7A 4X2HA 4FMBA 5CF2A 3BNDA 2Q07A 3Q1CA 4HZ9B 1IQYA 3QRDA 1JKGB 2IUKA 3FG1A 3CCJ3 3X3XA 1R4CA 3S67A 5D83A 2BT3A 1EKMA 2W9PA 3F7XA 4J9AA 3WMDA 3NV0B 1TFKA 1M904 5IEPA 3OWUA 4G1MB 2HMLB 3DZLA 4R80A 1J2BA 2LQVA 2ML6A 4AKZA 3N8BA 1NB5I 1O7MB 3PZWA 1ROAA 3JUMA 5ELUA 1OHSA 3LZAA 3Q90A 2E2VA 3CU3A 1M9GA 3ALAA 3V98A 1O7HB 3CNXA 3DY5A 5LC6A 2W2CA 2CFKA 8CHOA 5AEWB 3CCM3 4LGQA 4EV2A 2CWTA 1STFI 3SOAA 4N6V0 4CCVA 3GZRA 3S27A 1NO3A 1UUWB 2BO9B 2O3OA 3NV0A 4RNZA 5KP1A 4HM8B 5D81A 1Z1SA 2XGNA 2YFLB 3BNEA 1D6YA 2W56A 2BNGA 3WA2X 3GWRA 1Q864 3B4OA 5EQLA 2IUJA 3CCU3 1GY6A 2P09A 1VQM3 1N5PA 3BNCA 1KD14 4ZM8A 2PZVA 3FGYA 1PU4A 3NHXA 1YIJ3 1D6ZA 5AI1A 1ZO2A 4FR9A 3X41A 3D9RA 1N9JA 3HIIA 1VQ83 1GY7A 3LTAA 3NM7A 5IW9A 1GD4A 2OTJ3 3EHCA 4H3UA 4FCZA 4N3VA 1F8NA 5G2GA 5LC7A 1U5OA 3X40A 4O3VA 5JPUA 3DGNA 4ORLA 1K734 3SOYA 2CG1A 3V92A 1K41A 1UI7A 3EE1A 1OF5B 4RBNA 2XSOB 3HK4A 1S723 4HM1B 5AYRB 1FGMA 3BLZA 2STDA 4RNYA 4WFOA 5FW5A 2P05A 4KFEA 3OW22 3NBJA 5AIIA 1TIJA 1FGQA 2BMQB 2Y73A 3UL5A 1YHQ3 1YVBI 2W03A 2HMMB 4FMCA 4PEJA 7STDA 1CQSA 2INXA 2WOFA 1K28A 3CMA3 2BHMA 4GL6A 4KVHA 3NQZA 1IT7A 3KSPA 2W6JH 4QWTA 3KIIA 4IT7A 4WP5A 2JDIH 4IIAA 3S28A 3M8CA 3F9SA 4O2HA 1Q7Y4 1E3RA 1OHOA 3WOFB 3FLJA 1KQS2 4WHAA 2C10A 3KN4A 1GS3A 5JPPA 1O7WB 2W0QA 4HM6B 2XR8B 1FGOA 1YJW3 1YGEA 3U1WA 2IA7A 3ER7A 4EV5A 2Y74A 3LMLA 4XBXA 3QK9A 1RKYA 1HU9A 4KZ1A 3IPTA 3LOYA 1GY5A 1JN5A 3JUQA 3HZPA 1W6GA 3MG1A 1M1K4 1OGXA 1N8R4 4HZBB 3T8NA 4K1VA 4CDLA 2K54A 2CFLA 3DM8A 2OTL3 3LTDA 3LTBA 3VGNA 4OUQA 4FCMA 1OGZA 1RRHA 3U97A 1Y4KA 3FF0A 1OH0A 5AIHA 4BTXA 5BXQA 3CCR3 1A2KA 1OHPA 3A76A 2I9WA 2D1WA 4TX4A 3G8ZA 1JKGA 3EB8A 3JUNA 3FG4A 1W01A 1W6YA 3UB1A 3NUVA 3BNBA 3FKAA 4NREA 1VQN3 1IT8A 4LEHA 3OX9A 1OUNA 3KFQC 3HI7A 1YIT3 3NQYA 5IG5A 4HM0B 4X2OA 3RGAA 1VQL3 1S5AA 5I97A 3PYJA 3PCSA 3LT9A 4O02B 2P38A 3SVAA 1D6UA 1IVUA 2K0MA 3DXOA 3DUKA 4EBGA 3GRDA 5IG4A 2F98A 1VQO3 2QA43 3EC9A 1WMOA 1STDA 1WQLB 2CC3A 1E97A 3OXAA 1RRLA 4N6UA 1YJ93 2XFSA 3B8LA 1ISKA 4WYKB 3F8HA 4LSOA 3G16A 3K9MC 3F14A 4BTYA 1DMNA 3G0KA 1NWWA 1Q40B 3G4S3 1W6CA 1W5ZA 1AVKA 4GB5A 4IPBA 2OOVC 1ROVA 1CEWI 1V74A 3F8XA 2W04A 3HX8A 2RSXA 5FGOA 1EG9B 2WGOA 4WWUC 1JV2B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QEX 3;  3G6E 3;  1K73 4;  1VQ5 3;  1QVG 2;  1M90 4;  3CMA 3;  3CCQ 3;  1M1K 4;  3CC4 3;  3CD6 3;  3CME 3;  1VQO 3;  2QA4 3;  1N8R 4;  1Q86 4;  1Q81 4;  1NJI 4;  1Q82 4;  1VQN 3;  3CCU 3;  1VQM 3;  1VQK 3;  1S72 3;  1QVF 2;  3CC7 3;  1YJ9 3;  2OTL 3;  1VQP 3;  1KD1 4;  1VQ6 3;  1JJ2 2;  1YI2 3;  3CCV 3;  3CCS 3;  1VQ7 3;  1YIT 3;  1Q7Y 4;  3CCL 3;  1YIJ 3;  3G4S 3;  1KQS 2;  3I55 3;  1YJN 3;  1K8A 4;  3OW2 2;  3CCE 3;  1VQ8 3;  1VQL 3;  3CCM 3;  1YJW 3;  1VQ9 3;  2OTJ 3;  3CCR 3;  3CC2 3;  3CCJ 3;  1YHQ 3;  3G71 3;  3CPW 2;  1VQ4 3;  1KC8 4;  1W2B 2;  3CXC 2;  3I56 3;  1K9M 4; 
#chains in the Genus database with same CATH topology
 1OPY A;  2GU3 A;  2WOH A;  1BUQ A;  2CH9 A;  2XF3 A;  2AAD A;  2KF4 A;  4N6L A;  1B2Z A;  4OVM A;  3FZW A;  2MC8 A;  4HOH A;  3SLU A;  1BSC A;  3IJE B;  4GHO A;  1W4N A;  1I70 A;  4MJD A;  3ROB A;  3TDG A;  1Q81 4;  1NJI 4;  4N6N B;  1DVC A;  1JBT A;  1W2Z A;  2C4B A;  3ECF A;  5BIR A;  3NM2 A;  3X3Z A;  1VQQ A;  5IG3 A;  1DMM A;  2BU4 A;  2ML5 A;  3DGO A;  3EJV A;  1IQ8 A;  5AYS C;  5CK6 A;  2GBX B;  3Q2P A;  1M1X B;  5AIG A;  3DGL A;  7GSP A;  4MMX B;  4N6M A;  1BNI A;  1IVX A;  1VQ9 3;  4XDV A;  3FSD A;  3KZT A;  3PCR A;  3E99 A;  4XM4 A;  2SBL A;  4EW5 A;  3LT8 A;  1QJG A;  1Q7H A;  5STD A;  1UUV B;  1BOX A;  1A67 A;  1GOY A;  2FXT A;  1BIR A;  3VSY A;  1BSB A;  1JB5 A;  4J5K A;  3STD A;  3BIR A;  3SYU A;  2KF3 A;  3T8U A;  3CCQ 3;  3DH2 A;  5IF6 A;  3CC4 3;  2V1L A;  1W7C A;  2KRT A;  4AKY A;  4L8O A;  3EBT A;  3PGB A;  1RSN A;  3OV4 A;  4HYZ A;  1QVF 2;  4K61 A;  5IER A;  1C54 A;  1LXE A;  3FCS B;  1EA2 A;  3I0Y A;  1JJ2 2;  3ZG5 A;  3AMO B;  1B2U A;  1KSI A;  2CX1 A;  3K5T A;  3F7S A;  1LOX A;  1IK3 A;  3CCS 3;  4BL2 A;  2F86 B;  1VZZ A;  4MMY B;  6STD A;  3BB9 A;  4JF8 A;  1HKX A;  1LVN A;  2C11 A;  2YX9 A;  1CH0 A;  1WTH A;  1QAK A;  3PS8 A;  4CJN A;  1WMN A;  1TU5 A;  1RGH A;  2YFJ B;  1JBR A;  3MG3 A;  3MWZ A;  4DKI A;  4I4K A;  4I5Q A;  1RN1 A;  5CF1 A;  1G0T A;  1B27 A;  3OWY A;  4Q53 A;  5HGR A;  3WOD G;  1EEJ A;  4XBY A;  5AEU B;  1UW1 A;  1RGG A;  3CME 3;  3GZX B;  3URP A;  4FMD A;  3OWS A;  2IMJ A;  1RCL A;  1IV9 A;  1N5H A;  1DYU A;  2CW9 A;  2E2U A;  3AMO A;  5M18 A;  1CYV A;  1BSA A;  1FYS A;  1WMP A;  1FGT A;  1MOL A;  2BMR B;  2CFW A;  3DGY A;  1FW7 A;  3O8Y A;  3FH1 A;  5AIF A;  2F99 A;  1IVW A;  1UGI A;  1YJN 3;  4XBT A;  2R4I A;  2HOH A;  2QIY A;  2XSH B;  2RCD A;  4LMI A;  3GSP A;  1VQ4 3;  1W02 A;  1W2B 2;  2HMN B;  1BNG A;  1U8C B;  3CXC 2;  3L0R A;  1RDS A;  1QVG 2;  2W56 B;  1BRS A;  2LYX A;  1AV4 A;  3B4P A;  3T0U A;  2UX0 A;  2F5W A;  1AVL A;  1IYY A;  5KP4 A;  2GU1 A;  1Q82 4;  2JQ5 A;  2GEX A;  5G1K A;  5IG0 A;  1C7H A;  1HYF A;  3MPH A;  1E3V A;  1N8Q A;  1JRQ A;  2CFG A;  3MHE A;  2XEP A;  3CCL 3;  3EX9 A;  1RGK A;  1YJW 3;  1G96 A;  1ASK A;  1I2E A;  1K8A 4;  3B7C A;  4R1K A;  3IMA B;  3NBB A;  4HM5 B;  2PNC A;  2XH9 A;  1QAL A;  3MYT A;  3EN8 A;  1JB4 A;  1W00 A;  2ZHX B;  3GAX A;  1IQX A;  1TRQ A;  2Z76 A;  3I56 3;  1MGR A;  1VQ7 3;  2XRX B;  1K9M 4;  3GZY B;  3KKG A;  1YVS A;  1SIH A;  2WGQ A;  1TFO A;  4XDW A;  5DRV A;  1JN5 B;  1LOY A;  4MEI A;  1T5Y A;  2CX0 A;  1OAC A;  2OOV A;  4N6T A;  1A2P A;  2GEY A;  3EBY A;  1BRK A;  1MWS A;  2MF7 A;  2ZL8 A;  1V57 A;  1ULI B;  4KFD A;  2FGT A;  1QAF A;  1RTU A;  1UDI I;  2F56 A;  4HVN A;  3WHO A;  2CHC A;  5CXO A;  3MKI A;  5BVB A;  1GSP A;  1A2V A;  1IVV A;  2KAA A;  4R9L A;  3DGM A;  1AR0 A;  2GXF A;  3NBR A;  4LZI A;  1PFP A;  5KP3 A;  3UJM A;  2CG0 A;  3LXU X;  3CC2 3;  3G71 3;  4RZM A;  1QMA A;  2R41 A;  1Q40 A;  1BRH A;  1SAR A;  4BU4 A;  1FUW A;  1TUH A;  4ILF A;  4K1U A;  5GSP A;  4R9K A;  1IV7 A;  2OQE A;  1VQ5 3;  1N9E A;  5EEO A;  1KWI A;  1UI8 A;  1ZS7 A;  2OCT A;  4HAA A;  3CC7 3;  2FNQ A;  1RN4 A;  3V99 A;  1RJO A;  1UCL A;  1B2S A;  3KE7 A;  2WO0 A;  3AGN A;  2HMK B;  1VQK 3;  1SPU A;  1FA3 A;  2HMJ B;  3NXJ A;  3KSE D;  4JRF A;  1CYU A;  1ZX2 A;  3J7Y d;  2OWP A;  1ULJ B;  3SX1 A;  3NX0 A;  3VF1 A;  1GMQ A;  2YFI B;  4R4K A;  4AEQ A;  4BTW A;  1FGR A;  3D79 A;  1US1 A;  1B21 A;  1AQZ A;  1RGA A;  1UCI A;  4N6O B;  4FCJ A;  4HM7 B;  2KXG A;  2O9U X;  3LYG A;  4L8P A;  1NB3 I;  1OF5 A;  3EF8 A;  2QEX 3;  2XGL A;  3S29 A;  2XFT A;  3CD6 3;  1FZU A;  1TRP A;  1TTO A;  1FUT A;  3HIG A;  4NHF A;  1GD3 A;  1O7N B;  2CIU A;  3H3H A;  3SXX A;  5CLK A;  3WOE B;  4HBR A;  1V58 A;  5ELJ A;  3H51 A;  3MSO A;  3WA3 A;  1X1W A;  1RGE A;  2BMO B;  2RGQ A;  3EN1 B;  1T2H A;  2E2T A;  4KFF A;  3Q3F A;  2P0M A;  3UL6 A;  4EC6 A;  3N9H A;  1B2X A;  1NU3 A;  4O8S A;  4EXR A;  5IEO A;  3S5C A;  1WNH A;  3FF2 A;  3ZFZ A;  2KCD A;  4U13 A;  3CCE 3;  1DMQ A;  3CPO A;  1MNL A;  1Q42 A;  2GBW B;  3JVC A;  2CFD A;  4L7K A;  1JBS A;  3LH4 A;  1TP6 A;  3CPW 2;  1O7G B;  1JB2 A;  4XB5 A;  3F40 A;  1KC8 4;  3ZG0 A;  2W9Q A;  4HKV B;  1DVD A;  2M7O A;  3RDE A;  1L5G B;  5D82 A;  3MG2 A;  4HM2 B;  3WDG B;  1T2I A;  3EQQ B;  5JBS A;  5TGN A;  3X3Y A;  2HMO B;  2ZDJ A;  1A90 A;  4STD A;  2Z77 A;  3FG3 A;  1JZD A;  2QGU A;  2A15 A;  5A0O B;  4K90 B;  1GYB A;  3JUO A;  1LNH A;  1VQP 3;  3K7C A;  3N54 B;  1JNQ A;  4HJL B;  1YI2 3;  2B24 B;  3D3L A;  3CCV 3;  3DMC A;  3GZB A;  3SED A;  1SQW A;  1LOW A;  2D42 A;  2L4V A;  1IDP A;  3I55 3;  4OK0 A;  3UNL A;  1UUG B;  1I3F A;  3A5E A;  1GOV A;  3RGR A;  4EYC A;  2CK3 H;  3X42 A;  3G6E 3;  3D5G A;  1RN7 A;  1AY7 A;  3CNM A;  4MMZ B;  1EQK A;  1RHL A;  4HM4 B;  4H61 A;  3K0Z A;  3KCH A;  4FMA A;  2Z6B A;  3K63 A;  3PXM A;  5EVH A;  2B1X B;  2CWV A;  2RFR A;  3JUP A;  5DRE A;  2CKF B;  2CWU A;  1OCV A;  1NDO B;  2F4Y A;  1BVI A;  2L1S A;  4WYK A;  1SJW A;  1SII A;  3LTC A;  1TJD A;  2OQE C;  4J8T A;  1VQ6 3;  2Z7A A;  1DE3 A;  1O7P B;  5IEN A;  2P0X A;  1X1Y A;  4HM3 B;  1IU7 A;  4X2H A;  4FMB A;  1PYL A;  5CF2 A;  3BND A;  4RNT A;  2Q07 A;  3Q1C A;  4HZ9 B;  1IQY A;  3QRD A;  4LYL B;  6RNT A;  1JKG B;  2IUK A;  1ZGX A;  3FG1 A;  3CCJ 3;  3X3X A;  1R4C A;  3S67 A;  5D83 A;  2BT3 A;  1HZ1 A;  1X1X A;  2J8X B;  1EKM A;  4KT3 B;  2W9P A;  3F7X A;  1UGH I;  4J9A A;  3WMD A;  8RNT A;  3NV0 B;  1TFK A;  1JZO A;  5IEP A;  3OWU A;  1M90 4;  4G1M B;  2HML B;  3DZL A;  4R80 A;  1BNR A;  1J2B A;  2LQV A;  2ML6 A;  3AGO A;  4AKZ A;  3N8B A;  1GOU A;  1NB5 I;  1O7M B;  3PZW A;  1ROA A;  3JUM A;  5ELU A;  1OHS A;  3LZA A;  1I0X A;  3Q90 A;  2E2V A;  3D4A A;  3CU3 A;  1M9G A;  3ALA A;  3V98 A;  5M19 A;  1O7H B;  3CNX A;  3DY5 A;  5LC6 A;  1I8V A;  2BIR A;  2W2C A;  2CFK A;  2AAE A;  5AEW B;  8CHO A;  3CCM 3;  4LGQ A;  1BUJ A;  4EV2 A;  2CWT A;  1STF I;  3SOA A;  4N6V 0;  4CCV A;  3GZR A;  3S27 A;  1NO3 A;  1UUW B;  2BO9 B;  1BRG A;  1RLS A;  2O3O A;  3NV0 A;  1RCK A;  4RNZ A;  5KP1 A;  4HM8 B;  3HOH A;  5D81 A;  1BGS A;  1Z1S A;  2XGN A;  2YFL B;  3BNE A;  1D6Y A;  2W56 A;  2BNG A;  3WA2 X;  3GWR A;  1Q86 4;  3B4O A;  5EQL A;  2IUJ A;  3CCU 3;  1GY6 A;  2P09 A;  2UUG C;  1FUS A;  1N5P A;  1VQM 3;  4J5G A;  3BNC A;  4BL3 A;  1KD1 4;  1YNV X;  4ZM8 A;  2PZV A;  3FGY A;  1PU4 A;  3NHX A;  1YIJ 3;  1D6Z A;  2ZA4 A;  5AI1 A;  1ZO2 A;  2IY2 A;  1LNI A;  4FR9 A;  3X41 A;  3D9R A;  4BIR A;  1N9J A;  3HII A;  1VQ8 3;  1GY7 A;  3LTA A;  3NM7 A;  5IW9 A;  1GD4 A;  1G02 A;  2OTJ 3;  3EHC A;  4H3U A;  4FCZ A;  4N3V A;  1F8N A;  2F5M A;  5G2G A;  1U5O A;  5LC7 A;  3X40 A;  1BRI A;  1MGW A;  2H0I A;  4O3V A;  1BRN L;  5JPU A;  3DGN A;  4ORL A;  1K73 4;  3SOY A;  2CG1 A;  3V92 A;  1MWT A;  1K41 A;  1LRA A;  1UI7 A;  3EE1 A;  3D5I A;  1B2M A;  1OF5 B;  4RBN A;  1B20 A;  2XSO B;  3HK4 A;  1S72 3;  4HM1 B;  1BNF A;  3AHS A;  5AYR B;  1FGM A;  3BLZ A;  2STD A;  4RNY A;  4WFO A;  5FW5 A;  2P05 A;  4KFE A;  3OW2 2;  3NBJ A;  5AII A;  1TIJ A;  1FGQ A;  2BMQ B;  1BSD A;  2Y73 A;  1RNT A;  3UL5 A;  1YHQ 3;  1YVB I;  1RGF A;  2HMM B;  2W03 A;  4FMC A;  4PEJ A;  7STD A;  1CQS A;  2INX A;  2WOF A;  1K28 A;  1RMS A;  3CMA 3;  2BHM A;  1Q9E A;  4GL6 A;  4KVH A;  3NQZ A;  1BNE A;  1IT7 A;  2RNT A;  3KSP A;  2W6J H;  4QWT A;  3KII A;  1LQG C;  4IT7 A;  2GSP A;  4WP5 A;  2JDI H;  4IIA A;  3S28 A;  5M1A A;  3M8C A;  3BU4 A;  3F9S A;  4O2H A;  1Q7Y 4;  1E3R A;  1OHO A;  3WOF B;  2H0H A;  3FLJ A;  1KQS 2;  1MWR A;  4WHA A;  2C10 A;  3KN4 A;  1GS3 A;  1B3S A;  1O7W B;  2W0Q A;  4HM6 B;  2XR8 B;  1FGO A;  3WR2 A;  1YGE A;  3U1W A;  2IA7 A;  3ER7 A;  1RGL A;  2Y74 A;  4EV5 A;  3LML A;  4XBX A;  3QK9 A;  1RKY A;  1HU9 A;  4KZ1 A;  3IPT A;  3LOY A;  1GY5 A;  1JN5 A;  3AHW A;  3HZP A;  1W6G A;  1LQM B;  3JUQ A;  3MG1 A;  1M1K 4;  1EUI C;  1OGX A;  1N8R 4;  4HZB B;  3T8N A;  4K1V A;  4CDL A;  2K54 A;  2SAR A;  2CFL A;  3DM8 A;  2OTL 3;  6GSP A;  1GMP A;  3LTD A;  7RNT A;  2UGI A;  5G1L A;  1BRJ A;  1DET A;  3LTB A;  3VGN A;  4OUQ A;  1MWU A;  4FCM A;  1OGZ A;  1RRH A;  3U97 A;  1Y4K A;  3FF0 A;  1OH0 A;  1BAO A;  4GSP A;  5AIH A;  1GMR A;  4BTX A;  1T3B A;  5BXQ A;  3CCR 3;  1A2K A;  1OHP A;  1BU4 A;  3A76 A;  2I9W A;  2D1W A;  4TX4 A;  3G8Z A;  1YGW A;  1JKG A;  3EB8 A;  3JUN A;  3FG4 A;  1W01 A;  1W6Y A;  3UB1 A;  2WGO A;  1LOV A;  3BNB A;  3NUV A;  3FKA A;  4NRE A;  1VQN 3;  1IT8 A;  1NNV A;  4LEH A;  3OX9 A;  1OUN A;  2K3D A;  3KFQ C;  2KF5 A;  1I0V A;  3HI7 A;  5BU4 A;  1YIT 3;  3NQY A;  5IG5 A;  2RBI A;  1RNB A;  4HM0 B;  4X2O A;  3RGA A;  5HOH A;  1VQL 3;  1S5A A;  1PY3 A;  5I97 A;  3PYJ A;  3PCS A;  3LT9 A;  1BNS A;  4O02 B;  2P38 A;  3SVA A;  1I2F A;  1BNJ A;  1D6U A;  1IVU A;  2K0M A;  3DXO A;  3DUK A;  4EBG A;  3GRD A;  5IG4 A;  2F98 A;  2H0G A;  1VQO 3;  5RNT A;  1BSE A;  1I3I A;  2QA4 3;  3EC9 A;  1WMO A;  1STD A;  1WQL B;  2CC3 A;  1E97 A;  1UCJ A;  4CPK A;  3OXA A;  1RRL A;  4N6U A;  1YJ9 3;  2XFS A;  1BAN A;  1R4Y A;  3B8L A;  1ISK A;  4WYK B;  9RNT A;  3F8H A;  4LSO A;  3G16 A;  3K9M C;  5JPP A;  3F14 A;  4NPB A;  1DMN A;  4BTY A;  2IYJ A;  3G0K A;  1NWW A;  1Q40 B;  3RNT A;  1UCK A;  1X1U A;  3G4S 3;  1W6C A;  1W5Z A;  1AVK A;  4GB5 A;  4IPB A;  2OOV C;  1ROV A;  1CEW I;  1V74 A;  3F8X A;  1RGC A;  2W04 A;  3HX8 A;  2KF6 A;  2RSX A;  1EG9 B;  5FGO A;  1I2G A;  4WWU C;  1JV2 B; 
#chains in the Genus database with same CATH homology
 1OPY A;  2GU3 A;  2WOH A;  1BUQ A;  2CH9 A;  2XF3 A;  4N6L A;  2MC8 A;  4OVM A;  3FZW A;  3SLU A;  3IJE B;  4MJD A;  1W4N A;  3ROB A;  3TDG A;  1Q81 4;  1NJI 4;  4N6N B;  1DVC A;  1W2Z A;  3ECF A;  3NM2 A;  3X3Z A;  5IG3 A;  1DMM A;  2ML5 A;  3DGO A;  3EJV A;  1IQ8 A;  5AYS C;  5CK6 A;  2GBX B;  3Q2P A;  1M1X B;  5AIG A;  3DGL A;  4MMX B;  4N6M A;  1IVX A;  1VQ9 3;  4XDV A;  3FSD A;  3KZT A;  3PCR A;  3E99 A;  4XM4 A;  2SBL A;  3LT8 A;  1QJG A;  5STD A;  1UUV B;  1A67 A;  2FXT A;  3VSY A;  1JB5 A;  3STD A;  3CCQ 3;  3T8U A;  5IF6 A;  3CC4 3;  2V1L A;  1W7C A;  2KRT A;  4AKY A;  4L8O A;  3EBT A;  3PGB A;  4HYZ A;  3OV4 A;  1QVF 2;  4K61 A;  5IER A;  1LXE A;  3FCS B;  1EA2 A;  3I0Y A;  1JJ2 2;  3AMO B;  1IK3 A;  1KSI A;  3CCS 3;  3K5T A;  3F7S A;  1LOX A;  2F86 B;  1VZZ A;  4MMY B;  6STD A;  3BB9 A;  4JF8 A;  1HKX A;  1LVN A;  2C11 A;  2YX9 A;  1WTH A;  1QAK A;  3PS8 A;  1WMN A;  1TU5 A;  2YFJ B;  3MG3 A;  3MWZ A;  4I4K A;  5CF1 A;  3OWY A;  4Q53 A;  5HGR A;  3WOD G;  5AEU B;  4XBY A;  1UW1 A;  3CME 3;  3GZX B;  4FMD A;  3OWS A;  2IMJ A;  1IV9 A;  1N5H A;  1DYU A;  2CW9 A;  2E2U A;  3AMO A;  1CYV A;  2BMR B;  1WMP A;  1FGT A;  1MOL A;  2CFW A;  3O8Y A;  3FH1 A;  5AIF A;  2F99 A;  1IVW A;  1YJN 3;  4XBT A;  2R4I A;  2QIY A;  2XSH B;  2RCD A;  4LMI A;  1VQ4 3;  1W02 A;  1W2B 2;  2HMN B;  1U8C B;  3CXC 2;  3L0R A;  1QVG 2;  2W56 B;  3T0U A;  2LYX A;  1AV4 A;  3B4P A;  2UX0 A;  1AVL A;  5KP4 A;  2GU1 A;  1Q82 4;  2JQ5 A;  2GEX A;  5IG0 A;  1C7H A;  3MPH A;  1E3V A;  1N8Q A;  1JRQ A;  2CFG A;  3MHE A;  2XEP A;  3CCL 3;  3EX9 A;  1G96 A;  1ASK A;  1K8A 4;  3B7C A;  4R1K A;  3IMA B;  3NBB A;  4HM5 B;  2PNC A;  2XH9 A;  1QAL A;  3MYT A;  3EN8 A;  1JB4 A;  1W00 A;  3GAX A;  1IQX A;  2Z76 A;  3I56 3;  1VQ7 3;  1K9M 4;  2XRX B;  3GZY B;  3KKG A;  1SIH A;  2WGQ A;  1TFO A;  4XDW A;  5DRV A;  1JN5 B;  4MEI A;  1T5Y A;  1OAC A;  2OOV A;  4N6T A;  2GEY A;  3EBY A;  2MF7 A;  2ZL8 A;  1ULI B;  4KFD A;  2FGT A;  1QAF A;  4HVN A;  2CHC A;  5CXO A;  3MKI A;  5BVB A;  1A2V A;  1IVV A;  4R9L A;  3DGM A;  1AR0 A;  2GXF A;  3NBR A;  4LZI A;  1PFP A;  5KP3 A;  3UJM A;  2CG0 A;  3LXU X;  3CC2 3;  3G71 3;  4RZM A;  1QMA A;  1Q40 A;  1FUW A;  1TUH A;  4K1U A;  2OQE A;  4R9K A;  1IV7 A;  1VQ5 3;  1N9E A;  5EEO A;  1KWI A;  1UI8 A;  2OCT A;  2FNQ A;  3V99 A;  1RJO A;  3KE7 A;  2WO0 A;  2HMK B;  1VQK 3;  1SPU A;  1FA3 A;  2HMJ B;  3NXJ A;  3KSE D;  4JRF A;  1CYU A;  1ZX2 A;  3J7Y d;  2OWP A;  1ULJ B;  3SX1 A;  3NX0 A;  3VF1 A;  2YFI B;  4R4K A;  4AEQ A;  4BTW A;  1FGR A;  1US1 A;  4N6O B;  4FCJ A;  4HM7 B;  2KXG A;  2O9U X;  3LYG A;  4L8P A;  1NB3 I;  1OF5 A;  3EF8 A;  2QEX 3;  2XGL A;  3S29 A;  2XFT A;  3CD6 3;  4NHF A;  3HIG A;  1GD3 A;  1O7N B;  2CIU A;  3H3H A;  3SXX A;  5CLK A;  3WOE B;  4HBR A;  5ELJ A;  3H51 A;  3MSO A;  3WA3 A;  3EN1 B;  4KFF A;  2BMO B;  2RGQ A;  4EC6 A;  2E2T A;  3CC7 3;  3UL6 A;  2P0M A;  3N9H A;  1NU3 A;  4O8S A;  4EXR A;  5IEO A;  3S5C A;  1WNH A;  3FF2 A;  2KCD A;  4U13 A;  3CCE 3;  1DMQ A;  3CPO A;  1MNL A;  1Q42 A;  2GBW B;  3JVC A;  2CFD A;  4L7K A;  3LH4 A;  1TP6 A;  3CPW 2;  1O7G B;  1JB2 A;  4XB5 A;  3F40 A;  1KC8 4;  2W9Q A;  4HKV B;  1DVD A;  2M7O A;  3RDE A;  1L5G B;  5D82 A;  3MG2 A;  4HM2 B;  3WDG B;  3EQQ B;  5JBS A;  5TGN A;  3X3Y A;  2HMO B;  2ZDJ A;  1A90 A;  4STD A;  2Z77 A;  3FG3 A;  2QGU A;  2A15 A;  5A0O B;  4K90 B;  1GYB A;  3JUO A;  1LNH A;  1VQP 3;  3K7C A;  3N54 B;  1JNQ A;  4HJL B;  1YI2 3;  2B24 B;  3D3L A;  3CCV 3;  3DMC A;  3GZB A;  3SED A;  1SQW A;  2D42 A;  2L4V A;  1IDP A;  3I55 3;  4OK0 A;  3UNL A;  3RGR A;  4EYC A;  2CK3 H;  3X42 A;  3G6E 3;  1RN7 A;  3CNM A;  4MMZ B;  1EQK A;  4HM4 B;  4H61 A;  3K0Z A;  4FMA A;  2Z6B A;  3K63 A;  3PXM A;  5EVH A;  2B1X B;  2CWV A;  2RFR A;  3JUP A;  5DRE A;  2CKF B;  2CWU A;  1OCV A;  1NDO B;  4WYK A;  1SJW A;  1SII A;  3LTC A;  4J8T A;  2OQE C;  1VQ6 3;  2Z7A A;  1O7P B;  5IEN A;  2P0X A;  4HM3 B;  1IU7 A;  4X2H A;  4FMB A;  5CF2 A;  3BND A;  2Q07 A;  3Q1C A;  4HZ9 B;  1IQY A;  3QRD A;  1JKG B;  2IUK A;  3FG1 A;  3CCJ 3;  3X3X A;  1R4C A;  3S67 A;  5D83 A;  2BT3 A;  1EKM A;  2W9P A;  3F7X A;  4J9A A;  3WMD A;  3NV0 B;  1TFK A;  1M90 4;  5IEP A;  3OWU A;  4G1M B;  2HML B;  3DZL A;  4R80 A;  1J2B A;  2LQV A;  2ML6 A;  4AKZ A;  3N8B A;  1NB5 I;  1O7M B;  3PZW A;  1ROA A;  3JUM A;  5ELU A;  1OHS A;  3LZA A;  3Q90 A;  2E2V A;  3CU3 A;  1M9G A;  3ALA A;  3V98 A;  1O7H B;  3CNX A;  3DY5 A;  5LC6 A;  2W2C A;  2CFK A;  8CHO A;  5AEW B;  3CCM 3;  4LGQ A;  4EV2 A;  2CWT A;  1STF I;  3SOA A;  4N6V 0;  4CCV A;  3GZR A;  3S27 A;  1NO3 A;  1UUW B;  2BO9 B;  2O3O A;  3NV0 A;  4RNZ A;  5KP1 A;  4HM8 B;  5D81 A;  1Z1S A;  2XGN A;  2YFL B;  3BNE A;  1D6Y A;  2W56 A;  2BNG A;  3WA2 X;  3GWR A;  1Q86 4;  3B4O A;  5EQL A;  2IUJ A;  3CCU 3;  1GY6 A;  2P09 A;  1VQM 3;  1N5P A;  3BNC A;  1KD1 4;  4ZM8 A;  2PZV A;  3FGY A;  1PU4 A;  3NHX A;  1YIJ 3;  1D6Z A;  5AI1 A;  1ZO2 A;  4FR9 A;  3X41 A;  3D9R A;  1N9J A;  3HII A;  1VQ8 3;  1GY7 A;  3LTA A;  3NM7 A;  5IW9 A;  1GD4 A;  2OTJ 3;  3EHC A;  4H3U A;  4FCZ A;  4N3V A;  1F8N A;  5G2G A;  5LC7 A;  1U5O A;  3X40 A;  4O3V A;  5JPU A;  3DGN A;  4ORL A;  1K73 4;  3SOY A;  2CG1 A;  3V92 A;  1K41 A;  1UI7 A;  3EE1 A;  1OF5 B;  4RBN A;  2XSO B;  3HK4 A;  1S72 3;  4HM1 B;  5AYR B;  1FGM A;  3BLZ A;  2STD A;  4RNY A;  4WFO A;  5FW5 A;  2P05 A;  4KFE A;  3OW2 2;  3NBJ A;  5AII A;  1TIJ A;  1FGQ A;  2BMQ B;  2Y73 A;  3UL5 A;  1YHQ 3;  1YVB I;  2W03 A;  2HMM B;  4FMC A;  4PEJ A;  7STD A;  1CQS A;  2INX A;  2WOF A;  1K28 A;  3CMA 3;  2BHM A;  4GL6 A;  4KVH A;  3NQZ A;  1IT7 A;  3KSP A;  2W6J H;  4QWT A;  3KII A;  4IT7 A;  4WP5 A;  2JDI H;  4IIA A;  3S28 A;  3M8C A;  3F9S A;  4O2H A;  1Q7Y 4;  1E3R A;  1OHO A;  3WOF B;  3FLJ A;  1KQS 2;  4WHA A;  2C10 A;  3KN4 A;  1GS3 A;  5JPP A;  1O7W B;  2W0Q A;  4HM6 B;  2XR8 B;  1FGO A;  1YJW 3;  1YGE A;  3U1W A;  2IA7 A;  3ER7 A;  4EV5 A;  2Y74 A;  3LML A;  4XBX A;  3QK9 A;  1RKY A;  1HU9 A;  4KZ1 A;  3IPT A;  3LOY A;  1GY5 A;  1JN5 A;  3JUQ A;  3HZP A;  1W6G A;  3MG1 A;  1M1K 4;  1OGX A;  1N8R 4;  4HZB B;  3T8N A;  4K1V A;  4CDL A;  2K54 A;  2CFL A;  3DM8 A;  2OTL 3;  3LTD A;  3LTB A;  3VGN A;  4OUQ A;  4FCM A;  1OGZ A;  1RRH A;  3U97 A;  1Y4K A;  3FF0 A;  1OH0 A;  5AIH A;  4BTX A;  5BXQ A;  3CCR 3;  1A2K A;  1OHP A;  3A76 A;  2I9W A;  2D1W A;  4TX4 A;  3G8Z A;  1JKG A;  3EB8 A;  3JUN A;  3FG4 A;  1W01 A;  1W6Y A;  3UB1 A;  3NUV A;  3BNB A;  3FKA A;  4NRE A;  1VQN 3;  1IT8 A;  4LEH A;  3OX9 A;  1OUN A;  3KFQ C;  3HI7 A;  1YIT 3;  3NQY A;  5IG5 A;  4HM0 B;  4X2O A;  3RGA A;  1VQL 3;  1S5A A;  5I97 A;  3PYJ A;  3PCS A;  3LT9 A;  4O02 B;  2P38 A;  3SVA A;  1D6U A;  1IVU A;  2K0M A;  3DXO A;  3DUK A;  4EBG A;  3GRD A;  5IG4 A;  2F98 A;  1VQO 3;  2QA4 3;  3EC9 A;  1WMO A;  1STD A;  1WQL B;  2CC3 A;  1E97 A;  3OXA A;  1RRL A;  4N6U A;  1YJ9 3;  2XFS A;  3B8L A;  1ISK A;  4WYK B;  3F8H A;  4LSO A;  3G16 A;  3K9M C;  3F14 A;  4BTY A;  1DMN A;  3G0K A;  1NWW A;  1Q40 B;  3G4S 3;  1W6C A;  1W5Z A;  1AVK A;  4GB5 A;  4IPB A;  2OOV C;  1ROV A;  1CEW I;  1V74 A;  3F8X A;  2W04 A;  3HX8 A;  2RSX A;  5FGO A;  1EG9 B;  2WGO A;  4WWU C;  1JV2 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...