3OW2F

Crystal structure of enhanced macrolide bound to 50s ribosomal subunit
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
119
structure length
119
Chain Sequence
b'PVYVDFDVPADLEDDALEALEVARDTGAVKKGTNETTKSIERGSAELVFVAEDVQPEEIVMHIPELADEKGVPFIFVEQQDDLGHAAGLEVGSAAAAVTDAGAAATVLEEIADKVEELR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S RIBOSOMAL RNA
molecule tags Ribosome
total genus 30
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2010-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 3ow2F00
3HJWC 3VI6A 1K8AH 3CPQA 1K73H 3CCJF 1H7MA 3CD6F 1Q81H 3NMUC 3CCQF 2KTUA 4X3MA 3NK6A 1T0KB 1X52A 4NUTA 3LWPC 1YI2F 1W3EX 2OTLF 1E7KA 5GINC 1VQPF 3GYQA 3FFMA 3LFOA 2OZBA 1VQ8F 1SDSA 3E20B 3V7QA 1VQMF 1NJIH 2OTJF 3JCMM 5EWRA 5G4VC 3MCAB 1Q86H 1JJ2F 1QVFF 5G4UC 3NVKE 1YJ9F 2HVYD 1VQ9F 1GZ0A 3NK7A 1VQ5F 3CC4F 1Q7YH 1RLGA 3CCMF 2KTVA 1VQNF 1VQ6F 1VQ7F 3N4YA 3N4ZA 4BY9D 3E1YA 1XBIA 3LWRC 1CK2A 3LWVC 3CCUF 1VQKF 5GANK 1VQOF 1S72F 1X7OA 3CCVF 5GIOC 5FJ4C 1ZWZA 3SIUA 3LWQC 3CMEF 1Q82H 2VGMA 3PLAC 3RA6A 4C4WC 2VGNA 2OHWA 2QI2A 1KD1H 2AIFA 1GO1A 3CCRF 2CZWA 3CMAF 2BO1A 3LWOC 5A2QM 3G71F 5GAPK 2LBWA 1M1KH 3CC2F 1W42A 1YJWF 3CCLF 2JNBA 1KC8H 4BW0B 5DCVA 1W2BF 5EO3A 3OBYA 1M90H 3SIVA 2I6DA 3PAFA 1VQLF 3CCEF 3CPWF 2ALEA 3CG6A 1VQ4F 3G4SF 1YIJF 2FC3A 1X7PA 3IR9A 1PXWA 3OW2F 4X3LA 3OBWA 2QA4F 3I56F 1GO0A 1N8RH 2WALA 5FLXM 3NVIB 3J7AR 4LCKA 1YJNF 3ON1A 3J80M 2QEXF 2KG4A 3WXMB 5GIPC 3CXCF 1NMUB 2LBXA 3I55F 1CN7A 1W40A 1W41A 1KQSF 3VMFB 3CCSF 1YHQF 3G6EF 1IPAA 3J81M 3HAXD 1YITF 1QVGF 3CC7F 3O85A 3JAMM 3AGKA 4TZZA 1K9MH 1DT9A 1RA4A 3V7EA 5IT9M 3RA5A
chains in the Genus database with same CATH superfamily
4O2AB 1K8AH 3CPQA 5KX5A 3D01A 5J2UB 3ZO8A 3D00A 1Q81H 4O4LB 4NWOB 3JARB 2HP0B 2HP3A 5HY1A 1TUBA 3LFOA 4X20B 3V7QA 1X25A 2OTJF 3WJRA 4O4JA 3MCAB 5EZYA 4IIJA 5G4VC 1Q86H 1JJ2F 2N48A 1Z5WA 3JATA 3WPXA 3NVKE 3RYFB 3NK7A 4O2BA 2ZF8A 1TVKA 2HRYA 3LMEA 1U43A 4U3JA 5J2TA 3M84A 1NQ3A 3IEWA 1XBIA 1IV1A 1W5AA 1TVKB 2ZOVA 2CVLA 1CK2A 2IAFA 4C82A 3F0GA 5GANK 2Z1TA 1S72F 3E22A 1RLUA 5GIOC 2UYJA 3S0HA 1OFUA 5JVDA 2VGMA 3RA6A 5CA1A 4HNAB 2GZLA 2P6YA 2Z1EA 2OHWA 5IYZA 1W57A 2G9IA 2Z01A 2Q1YA 2ZAUA 5A2QM 2LBWA 1M1KH 4B62A 4HNAA 2BTOA 3N2GA 3HTNA 1KC8H 4DXDA 3SIVA 4G4YA 2V9YA 3HKBA 2HP0A 2I6DA 3PAFA 2HS4A 2VXYA 3ERNA 4O4IB 1W5BA 1X7PA 5GONB 2CW4A 3V4DA 1COMA 5KX5B 4IHJB 3MDOA 2BTUA 1RQ2A 4X3LA 4F6RA 1SA0A 2VAWA 3BYQA 3RYIB 5EB1B 3V3TA 3JARA 2UYPA 2UYKA 4BT7A 1XRGA 5GIPC 2R751 4TV9B 5LYJA 1NMUB 3CXCF 2OTMA 3I55F 2GVIA 3FBAA 3FPIA 3L7QA 3B6NA 5LOVB 3G6EF 3J81M 3HKDA 2CSLA 2QTPA 1YITF 1JD1A 2NMUA 3JAMM 1VHAA 3KE1A 1IV3A 1RA4A 4C8GA 3JALB 4ZHQB 3HJWC 1CLIA 5HY0A 3CCJF 3VIUA 3CD6F 2EWCA 3WGJA 2HRUA 4X1KB 3VYUC 4ZHWA 3VOBA 3TD5A 3RYCA 3N2GB 1VQPF 5IJ0A 1DBFA 3FFMA 5AVMA 4XCQA 3TD4A 3GHZA 1VQMF 1U3LA 4RHAA 1NJIH 5CB4B 3P4EA 4BVRA 2HQSC 5HY2A 3QTYA 1QVFF 1JY8A 2AMTA 3HKEA 5G4UC 1YJ9F 2HVYD 1VQ9F 1ONIA 3N2KA 3F0DA 4NQ3A 1VQ5F 4I50A 2ZODA 4TV8B 1RLGA 3CCMF 1VQNF 1FNKA 3C9SA 4I50B 3P0ZA 3WPWA 5JQGA 3CCUF 5ITZA 1VQKF 3RE3A 1VQVA 3KJKA 4TUYA 3ZOPA 5JCOC 5LXTB 3S0WA 3CCVF 4ZI7A 1SA0B 4X20A 3HWUA 4YJ3B 1Q82H 5MN5A 3PLAC 4KWEA 5LP6A 1KD1H 2FGYA 1QU9A 3CCRF 4I55B 2CZWA 1Q8RA 3LWOC 1R1MA 5J2UA 1H48A 4IIJB 3CMAF 4O4HA 4ZOLA 5BMVA 2RHHA 5DCVA 1W2BF 1XHOA 4WBNA 4X1KA 1J7HA 3CYPB 1IV4A 1ODEA 3CCEF 5IYZB 3CPWF 4WBNB 1W5EA 1VQ4F 3G4SF 2FC3A 5HY4A 1PXWA 3FD6A 1UFYA 1YQNA 1T0AA 5LA6B 3S0YA 3J7AR 3K2XA 2KGWA 2QEXF 3Q8HA 3WXMB 4ZK7A 4FFBB 4ZHVA 2PHNA 3JAWB 1W41A 5EB0A 1UI9A 3CCSF 1IV2A 5HP8A 3VOAA 3CYQA 4X1IA 5HWEA 1W5FA 5JVDB 4BT3A 1VK3A 3DDNA 5CA0A 3AGKA 3HKCA 5IJ9A 5C8YA 1K9MH 5CA1B 2CHTA 4U39A 1VH8A 4TV8A 5MN4A 1XV2A 3LYBA 5EYPA 3IKFA 3K12A 3QUWA 4IHJA 3S02A 1W581 1H7MA 3KJJA 1TUBB 3VYTC 5LP6B 2HS3A 5JH7B 4EI7A 3CCQF 4X3MA 3VTIC 3M1XA 1X52A 2HX0A 4NUTA 4X1YB 2VAMA 3LWPC 4M8IA 4C8IA 5HXZA 1W3EX 1E7KA 5GINC 1FSZA 3GYQA 2ZVZA 2OZBA 2HS0A 2CWJA 1SDSA 3FD5A 3M4SA 2B33A 5GONA 2H8EA 5HXUA 3JASA 3KHNA 4BT5A 4F6RB 3JCMM 3C9TA 5BMVB 5EWRA 2PMPA 5J2TB 4YJ2B 5FNVA 3JALA 4EI9A 5KMGB 4ERHA 1GX1A 4BVQA 1VQ6F 3E22B 3GTZA 3UT5B 5CB4A 1YGYA 4BY9D 4FFBA 2Z1FA 3RYFA 5EIBC 3LWRC 1FFXB 4O2BB 3C8LA 3JAKB 1VQOF 2I6RA 3HKEB 2LBTA 1X7OA 4C8EA 3C9UA 2K1SA 3MQWA 4U3JB 3IMPA 3D54A 3SIUA 3F0FA 3QHDA 3JATB 1RQ7A 4C81A 2QI2A 2AIFA 3VO8A 3G71F 5GAPK 3CC2F 2R6R1 3CCLF 4X1IB 1SZQA 4O4LA 4BW0B 5EO3A 4YJ3A 5CA0B 1VQLF 3I3FA 2Q1XA 4BVTA 3HKDB 3R0PA 3CG6A 4G4WA 5JQGB 1YIJF 3IR9A 4EB6A 2UYNA 4O4HB 3S03A 4E6EA 1Z5VA 4ZI7B 1OAPA 3HKBB 5EIBD 4B45A 3OBWA 2QA4F 3I56F 2F9ZC 1N8RH 5FLXM 4ZHYB 4EB6B 3ON1A 3J80M 2MQEA 4I4TA 5FNVB 2KG4A 2AIZP 3RYHA 3IKEA 1W40A 1KQSF 4TUYB 5LXTA 2W8BC 1IPAA 4G4ZA 3ELCA 4YJ2A 5EZYB 4DRXB 4BT6A 4TZZA 1DT9A 4G4VA 5KMGA 3TD3A 4B5CA 3K14A 4RQOA 4EI8A 3VI6A 3WJQA 4DRXA 1K73H 1U3PA 5IJ0B 3KIZA 4TV9A 5LYJB 1JFFB 3LDTA 3NMUC 2KTUA 3NK6A 3K0TA 2IQQA 2VAPA 1YI2F 2OTLF 2RB9A 1H47A 5C8YB 1JFFA 3ZP4A 3CB2A 3P10A 5EYPB 3WGKA 1VQ8F 2LCAA 3JVHA 3E20B 4G4XA 4O4IA 5LA6A 3C9RA 4BVSA 4BT4A 1PF5A 1QAHA 1FNJA 5MN6A 3S06A 1GZ0A 4B46A 3WGMA 3CC4F 5ITZB 1Q7YH 2KTVA 1VQ7F 2GLZA 3N4YA 3T80A 3N4ZA 5B8FA 2H6LA 3JASB 3E1YA 3RYHB 1KNJA 2IG8A 3LWVC 5LOVA 3WGNA 3VCZA 1ZWZA 5FJ4C 2YXZA 3LWQC 3MCQA 3EORA 4O2AA 3VYSC 3CMEF 1T0KB 4I4TB 4C4WC 2VGNA 1GO1A 1JN1A 3F6MA 2BO1A 5JH7A 4O4JB 1W42A 1YJWF 3IEQA 4X1YA 2JNBA 3MBMA 3OBYA 3RYIA 1M90H 2L26A 3WGLA 3F0EA 3RYCB 4ZOLB 4G88A 2RHOA 2ALEA 2RHJA 4ZHQA 3OONA 2ZVYA 3WJPA 3U0OA 3OW2F 3HKCB 5IJ9B 3DC2A 3JAWA 5HP7A 4I55A 2RHLA 1QD9A 2WALA 3NVIB 1GO0A 4LCKA 1YJNF 2BTQB 1W55A 3ZP7A 3N2KB 3UT5A 2YYEA 3ESJA 1W59A 2DYYA 5LP6C 1U40A 2H8CA 2LBXA 4LNUB 1CN7A 2UYNB 3VMFB 1FFXA 1YHQF 3JAKA 4PWTA 1KNKA 2DT4A 2UZHA 3HAXD 4LNUA 5EAZA 1QVGF 4BT2A 3CC7F 3O85A 2Z1UA 3V7EA 3I7TA 5IT9M 4R40B 3RA5A 5JCOA 2CHSA
chains in the Genus database with same CATH topology
3HJWC 3VI6A 1K8AH 3CPQA 1K73H 5HY0A 3CCJF 1H7MA 3CD6F 1Q81H 3D00A 3NMUC 4EI7A 2KTUA 3CCQF 4X3MA 3NK6A 1T0KB 1X52A 4NUTA 3LWPC 5HXZA 1YI2F 1W3EX 2OTLF 1E7KA 5GINC 1VQPF 5HY1A 3GYQA 3FFMA 3LFOA 2OZBA 1VQ8F 1SDSA 4XCQA 3E20B 3V7QA 1VQMF 1NJIH 5HXUA 2OTJF 4BVRA 3JCMM 4BVSA 5HY2A 5EWRA 3MCAB 5G4VC 1Q86H 1JJ2F 1QVFF 5G4UC 3NVKE 1YJ9F 2HVYD 1VQ9F 1GZ0A 3NK7A 4NQ3A 1VQ5F 3CC4F 4EI9A 1Q7YH 1RLGA 3CCMF 2KTVA 4BVQA 1VQNF 1VQ6F 1VQ7F 2GLZA 3N4YA 3N4ZA 4BY9D 3E1YA 1XBIA 3LWRC 1CK2A 3LWVC 3CCUF 1VQKF 5GANK 1VQOF 1S72F 1X7OA 3CCVF 5GIOC 5FJ4C 1ZWZA 3SIUA 3LWQC 3CMEF 1Q82H 2VGMA 3PLAC 3RA6A 4C4WC 2VGNA 2OHWA 2QI2A 1KD1H 2AIFA 2FGYA 1GO1A 3CCRF 2CZWA 3CMAF 2BO1A 3LWOC 5A2QM 3G71F 5GAPK 2LBWA 1M1KH 3CC2F 1W42A 1YJWF 3CCLF 2JNBA 1KC8H 4BW0B 5DCVA 1W2BF 5EO3A 3OBYA 1M90H 3SIVA 2I6DA 3PAFA 1VQLF 3CCEF 3CPWF 4BVTA 2ALEA 3CG6A 1VQ4F 3G4SF 1YIJF 2FC3A 1X7PA 3IR9A 5HY4A 1PXWA 3OW2F 4X3LA 3OBWA 2QA4F 3I56F 1GO0A 2F9ZC 2WALA 5FLXM 1N8RH 3NVIB 3J7AR 4LCKA 3V3TA 1YJNF 3ON1A 3J80M 2QEXF 2KG4A 3WXMB 5GIPC 3CXCF 1NMUB 2LBXA 3I55F 1CN7A 1W40A 1W41A 1KQSF 3VMFB 3CCSF 1YHQF 3G6EF 1IPAA 3J81M 3HAXD 5HWEA 1YITF 1QVGF 3CC7F 3O85A 3JAMM 3AGKA 4TZZA 1K9MH 1DT9A 1RA4A 3V7EA 5IT9M 3RA5A 4EI8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HJW C;  3VI6 A;  1K8A H;  3CPQ A;  1K73 H;  3CCJ F;  1H7M A;  3CD6 F;  1Q81 H;  3NMU C;  3CCQ F;  2KTU A;  4X3M A;  3NK6 A;  1T0K B;  1X52 A;  4NUT A;  3LWP C;  1YI2 F;  1W3E X;  2OTL F;  1E7K A;  5GIN C;  1VQP F;  3GYQ A;  3FFM A;  3LFO A;  2OZB A;  1VQ8 F;  1SDS A;  3E20 B;  3V7Q A;  1VQM F;  1NJI H;  2OTJ F;  3JCM M;  5EWR A;  5G4V C;  3MCA B;  1Q86 H;  1JJ2 F;  1QVF F;  5G4U C;  3NVK E;  1YJ9 F;  2HVY D;  1VQ9 F;  1GZ0 A;  3NK7 A;  1VQ5 F;  3CC4 F;  1Q7Y H;  1RLG A;  3CCM F;  2KTV A;  1VQN F;  1VQ6 F;  1VQ7 F;  3N4Y A;  3N4Z A;  4BY9 D;  3E1Y A;  1XBI A;  3LWR C;  1CK2 A;  3LWV C;  3CCU F;  1VQK F;  5GAN K;  1VQO F;  1S72 F;  1X7O A;  3CCV F;  5GIO C;  5FJ4 C;  1ZWZ A;  3SIU A;  3LWQ C;  3CME F;  1Q82 H;  2VGM A;  3PLA C;  3RA6 A;  4C4W C;  2VGN A;  2OHW A;  2QI2 A;  1KD1 H;  2AIF A;  1GO1 A;  3CCR F;  2CZW A;  3CMA F;  2BO1 A;  3LWO C;  5A2Q M;  3G71 F;  5GAP K;  2LBW A;  1M1K H;  3CC2 F;  1W42 A;  1YJW F;  3CCL F;  2JNB A;  1KC8 H;  4BW0 B;  5DCV A;  1W2B F;  5EO3 A;  3OBY A;  1M90 H;  3SIV A;  2I6D A;  3PAF A;  1VQL F;  3CCE F;  3CPW F;  2ALE A;  3CG6 A;  1VQ4 F;  3G4S F;  1YIJ F;  2FC3 A;  1X7P A;  3IR9 A;  1PXW A;  3OW2 F;  4X3L A;  3OBW A;  2QA4 F;  3I56 F;  1GO0 A;  1N8R H;  2WAL A;  5FLX M;  3NVI B;  3J7A R;  4LCK A;  1YJN F;  3ON1 A;  3J80 M;  2QEX F;  2KG4 A;  3WXM B;  5GIP C;  3CXC F;  1NMU B;  2LBX A;  3I55 F;  1CN7 A;  1W40 A;  1W41 A;  1KQS F;  3VMF B;  3CCS F;  1YHQ F;  3G6E F;  1IPA A;  3J81 M;  3HAX D;  1YIT F;  1QVG F;  3CC7 F;  3O85 A;  3JAM M;  3AGK A;  4TZZ A;  1K9M H;  1DT9 A;  1RA4 A;  3V7E A;  5IT9 M;  3RA5 A; 
#chains in the Genus database with same CATH topology
 4O2A B;  1K8A H;  3CPQ A;  5KX5 A;  3D01 A;  5J2U B;  3ZO8 A;  3D00 A;  1Q81 H;  4O4L B;  4NWO B;  3JAR B;  2HP0 B;  2HP3 A;  5HY1 A;  1TUB A;  3LFO A;  4X20 B;  3V7Q A;  1X25 A;  2OTJ F;  3WJR A;  4O4J A;  3MCA B;  5EZY A;  4IIJ A;  5G4V C;  1Q86 H;  1JJ2 F;  2N48 A;  1Z5W A;  3JAT A;  3WPX A;  3NVK E;  3RYF B;  3NK7 A;  4O2B A;  2ZF8 A;  1TVK A;  2HRY A;  3LME A;  1U43 A;  4U3J A;  5J2T A;  3M84 A;  1NQ3 A;  3IEW A;  1XBI A;  1IV1 A;  1W5A A;  1TVK B;  2ZOV A;  2CVL A;  1CK2 A;  2IAF A;  4C82 A;  3F0G A;  5GAN K;  2Z1T A;  1S72 F;  3E22 A;  1RLU A;  5GIO C;  2UYJ A;  3S0H A;  1OFU A;  5JVD A;  2VGM A;  3RA6 A;  5CA1 A;  4HNA B;  2GZL A;  2P6Y A;  2Z1E A;  2OHW A;  5IYZ A;  1W57 A;  2G9I A;  2Z01 A;  2Q1Y A;  2ZAU A;  5A2Q M;  2LBW A;  1M1K H;  4B62 A;  4HNA A;  2BTO A;  3N2G A;  3HTN A;  1KC8 H;  4DXD A;  3SIV A;  4G4Y A;  2V9Y A;  3HKB A;  2HP0 A;  2I6D A;  3PAF A;  2HS4 A;  2VXY A;  3ERN A;  4O4I B;  1W5B A;  1X7P A;  5GON B;  2CW4 A;  3V4D A;  1COM A;  5KX5 B;  4IHJ B;  3MDO A;  2BTU A;  1RQ2 A;  4X3L A;  4F6R A;  1SA0 A;  2VAW A;  3BYQ A;  3RYI B;  5EB1 B;  3V3T A;  3JAR A;  2UYP A;  2UYK A;  4BT7 A;  1XRG A;  5GIP C;  2R75 1;  4TV9 B;  5LYJ A;  1NMU B;  3CXC F;  2OTM A;  3I55 F;  2GVI A;  3FBA A;  3FPI A;  3L7Q A;  3B6N A;  5LOV B;  3G6E F;  3J81 M;  3HKD A;  2CSL A;  2QTP A;  1YIT F;  1JD1 A;  2NMU A;  3JAM M;  1VHA A;  3KE1 A;  1IV3 A;  1RA4 A;  4C8G A;  3JAL B;  4ZHQ B;  3HJW C;  1CLI A;  5HY0 A;  3CCJ F;  3VIU A;  3CD6 F;  2EWC A;  3WGJ A;  2HRU A;  4X1K B;  3VYU C;  4ZHW A;  3VOB A;  3TD5 A;  3RYC A;  3N2G B;  1VQP F;  5IJ0 A;  1DBF A;  3FFM A;  5AVM A;  4XCQ A;  3TD4 A;  3GHZ A;  1VQM F;  1U3L A;  4RHA A;  1NJI H;  5CB4 B;  3P4E A;  4BVR A;  2HQS C;  5HY2 A;  3QTY A;  1QVF F;  1JY8 A;  2AMT A;  3HKE A;  5G4U C;  1YJ9 F;  2HVY D;  1VQ9 F;  1ONI A;  3N2K A;  3F0D A;  4NQ3 A;  1VQ5 F;  4I50 A;  2ZOD A;  4TV8 B;  1RLG A;  3CCM F;  1VQN F;  1FNK A;  3C9S A;  4I50 B;  3P0Z A;  3WPW A;  5JQG A;  3CCU F;  5ITZ A;  1VQK F;  3RE3 A;  1VQV A;  3KJK A;  4TUY A;  3ZOP A;  5JCO C;  5LXT B;  3S0W A;  3CCV F;  4ZI7 A;  1SA0 B;  4X20 A;  3HWU A;  4YJ3 B;  1Q82 H;  5MN5 A;  3PLA C;  4KWE A;  5LP6 A;  1KD1 H;  2FGY A;  1QU9 A;  3CCR F;  4I55 B;  2CZW A;  1Q8R A;  3LWO C;  1R1M A;  5J2U A;  1H48 A;  4IIJ B;  3CMA F;  4O4H A;  4ZOL A;  5BMV A;  2RHH A;  5DCV A;  1W2B F;  1XHO A;  4WBN A;  4X1K A;  1J7H A;  3CYP B;  1IV4 A;  1ODE A;  3CCE F;  5IYZ B;  3CPW F;  4WBN B;  1W5E A;  1VQ4 F;  3G4S F;  2FC3 A;  5HY4 A;  1PXW A;  3FD6 A;  1UFY A;  1YQN A;  1T0A A;  5LA6 B;  3S0Y A;  3J7A R;  3K2X A;  2KGW A;  2QEX F;  3Q8H A;  3WXM B;  4ZK7 A;  4FFB B;  4ZHV A;  2PHN A;  3JAW B;  1W41 A;  5EB0 A;  1UI9 A;  3CCS F;  1IV2 A;  5HP8 A;  3VOA A;  3CYQ A;  4X1I A;  5HWE A;  1W5F A;  5JVD B;  4BT3 A;  1VK3 A;  3DDN A;  5CA0 A;  3AGK A;  3HKC A;  5IJ9 A;  5C8Y A;  1K9M H;  5CA1 B;  2CHT A;  4U39 A;  1VH8 A;  4TV8 A;  5MN4 A;  1XV2 A;  3LYB A;  5EYP A;  3IKF A;  3K12 A;  3QUW A;  4IHJ A;  3S02 A;  1W58 1;  1H7M A;  3KJJ A;  1TUB B;  3VYT C;  5LP6 B;  2HS3 A;  5JH7 B;  4EI7 A;  3CCQ F;  4X3M A;  3VTI C;  3M1X A;  1X52 A;  2HX0 A;  4NUT A;  4X1Y B;  2VAM A;  3LWP C;  4M8I A;  4C8I A;  5HXZ A;  1W3E X;  1E7K A;  5GIN C;  1FSZ A;  3GYQ A;  2ZVZ A;  2OZB A;  2HS0 A;  2CWJ A;  1SDS A;  3FD5 A;  3M4S A;  2B33 A;  5GON A;  2H8E A;  5HXU A;  3JAS A;  3KHN A;  4BT5 A;  4F6R B;  3JCM M;  3C9T A;  5BMV B;  5EWR A;  2PMP A;  5J2T B;  4YJ2 B;  5FNV A;  3JAL A;  4EI9 A;  5KMG B;  4ERH A;  1GX1 A;  4BVQ A;  1VQ6 F;  3E22 B;  3GTZ A;  3UT5 B;  5CB4 A;  1YGY A;  4BY9 D;  4FFB A;  2Z1F A;  3RYF A;  5EIB C;  3LWR C;  1FFX B;  4O2B B;  3C8L A;  3JAK B;  1VQO F;  2I6R A;  3HKE B;  2LBT A;  1X7O A;  4C8E A;  3C9U A;  2K1S A;  3MQW A;  4U3J B;  3IMP A;  3D54 A;  3SIU A;  3F0F A;  3QHD A;  3JAT B;  1RQ7 A;  4C81 A;  2QI2 A;  2AIF A;  3VO8 A;  3G71 F;  5GAP K;  3CC2 F;  2R6R 1;  3CCL F;  4X1I B;  1SZQ A;  4O4L A;  4BW0 B;  5EO3 A;  4YJ3 A;  5CA0 B;  1VQL F;  3I3F A;  2Q1X A;  4BVT A;  3HKD B;  3R0P A;  3CG6 A;  4G4W A;  5JQG B;  1YIJ F;  3IR9 A;  4EB6 A;  2UYN A;  4O4H B;  3S03 A;  4E6E A;  1Z5V A;  4ZI7 B;  1OAP A;  3HKB B;  5EIB D;  4B45 A;  3OBW A;  2QA4 F;  3I56 F;  2F9Z C;  1N8R H;  5FLX M;  4ZHY B;  4EB6 B;  3ON1 A;  3J80 M;  2MQE A;  4I4T A;  5FNV B;  2KG4 A;  2AIZ P;  3RYH A;  3IKE A;  1W40 A;  1KQS F;  4TUY B;  5LXT A;  2W8B C;  1IPA A;  4G4Z A;  3ELC A;  4YJ2 A;  5EZY B;  4DRX B;  4BT6 A;  4TZZ A;  1DT9 A;  4G4V A;  5KMG A;  3TD3 A;  4B5C A;  3K14 A;  4RQO A;  4EI8 A;  3VI6 A;  3WJQ A;  4DRX A;  1K73 H;  1U3P A;  5IJ0 B;  3KIZ A;  4TV9 A;  5LYJ B;  1JFF B;  3LDT A;  3NMU C;  2KTU A;  3NK6 A;  3K0T A;  2IQQ A;  2VAP A;  1YI2 F;  2OTL F;  2RB9 A;  1H47 A;  5C8Y B;  1JFF A;  3ZP4 A;  3CB2 A;  3P10 A;  5EYP B;  3WGK A;  1VQ8 F;  2LCA A;  3JVH A;  3E20 B;  4G4X A;  4O4I A;  5LA6 A;  3C9R A;  4BVS A;  4BT4 A;  1PF5 A;  1QAH A;  1FNJ A;  5MN6 A;  3S06 A;  1GZ0 A;  4B46 A;  3WGM A;  3CC4 F;  5ITZ B;  1Q7Y H;  2KTV A;  1VQ7 F;  2GLZ A;  3N4Y A;  3T80 A;  3N4Z A;  5B8F A;  2H6L A;  3JAS B;  3E1Y A;  3RYH B;  1KNJ A;  2IG8 A;  3LWV C;  5LOV A;  3WGN A;  3VCZ A;  1ZWZ A;  5FJ4 C;  2YXZ A;  3LWQ C;  3MCQ A;  3EOR A;  4O2A A;  3VYS C;  3CME F;  1T0K B;  4I4T B;  4C4W C;  2VGN A;  1GO1 A;  1JN1 A;  3F6M A;  2BO1 A;  5JH7 A;  4O4J B;  1W42 A;  1YJW F;  3IEQ A;  4X1Y A;  2JNB A;  3MBM A;  3OBY A;  3RYI A;  1M90 H;  2L26 A;  3WGL A;  3F0E A;  3RYC B;  4ZOL B;  4G88 A;  2RHO A;  2ALE A;  2RHJ A;  4ZHQ A;  3OON A;  2ZVY A;  3WJP A;  3U0O A;  3OW2 F;  3HKC B;  5IJ9 B;  3DC2 A;  3JAW A;  5HP7 A;  4I55 A;  2RHL A;  1QD9 A;  2WAL A;  3NVI B;  1GO0 A;  4LCK A;  1YJN F;  2BTQ B;  1W55 A;  3ZP7 A;  3N2K B;  3UT5 A;  2YYE A;  3ESJ A;  1W59 A;  2DYY A;  5LP6 C;  1U40 A;  2H8C A;  2LBX A;  4LNU B;  1CN7 A;  2UYN B;  3VMF B;  1FFX A;  1YHQ F;  3JAK A;  4PWT A;  1KNK A;  2DT4 A;  2UZH A;  3HAX D;  4LNU A;  5EAZ A;  1QVG F;  4BT2 A;  3CC7 F;  3O85 A;  2Z1U A;  3V7E A;  3I7T A;  5IT9 M;  4R40 B;  3RA5 A;  5JCO A;  2CHS A; 
#chains in the Genus database with same CATH homology
 3HJW C;  3VI6 A;  1K8A H;  3CPQ A;  1K73 H;  5HY0 A;  3CCJ F;  1H7M A;  3CD6 F;  1Q81 H;  3D00 A;  3NMU C;  4EI7 A;  2KTU A;  3CCQ F;  4X3M A;  3NK6 A;  1T0K B;  1X52 A;  4NUT A;  3LWP C;  5HXZ A;  1YI2 F;  1W3E X;  2OTL F;  1E7K A;  5GIN C;  1VQP F;  5HY1 A;  3GYQ A;  3FFM A;  3LFO A;  2OZB A;  1VQ8 F;  1SDS A;  4XCQ A;  3E20 B;  3V7Q A;  1VQM F;  1NJI H;  5HXU A;  2OTJ F;  4BVR A;  3JCM M;  4BVS A;  5HY2 A;  5EWR A;  3MCA B;  5G4V C;  1Q86 H;  1JJ2 F;  1QVF F;  5G4U C;  3NVK E;  1YJ9 F;  2HVY D;  1VQ9 F;  1GZ0 A;  3NK7 A;  4NQ3 A;  1VQ5 F;  3CC4 F;  4EI9 A;  1Q7Y H;  1RLG A;  3CCM F;  2KTV A;  4BVQ A;  1VQN F;  1VQ6 F;  1VQ7 F;  2GLZ A;  3N4Y A;  3N4Z A;  4BY9 D;  3E1Y A;  1XBI A;  3LWR C;  1CK2 A;  3LWV C;  3CCU F;  1VQK F;  5GAN K;  1VQO F;  1S72 F;  1X7O A;  3CCV F;  5GIO C;  5FJ4 C;  1ZWZ A;  3SIU A;  3LWQ C;  3CME F;  1Q82 H;  2VGM A;  3PLA C;  3RA6 A;  4C4W C;  2VGN A;  2OHW A;  2QI2 A;  1KD1 H;  2AIF A;  2FGY A;  1GO1 A;  3CCR F;  2CZW A;  3CMA F;  2BO1 A;  3LWO C;  5A2Q M;  3G71 F;  5GAP K;  2LBW A;  1M1K H;  3CC2 F;  1W42 A;  1YJW F;  3CCL F;  2JNB A;  1KC8 H;  4BW0 B;  5DCV A;  1W2B F;  5EO3 A;  3OBY A;  1M90 H;  3SIV A;  2I6D A;  3PAF A;  1VQL F;  3CCE F;  3CPW F;  4BVT A;  2ALE A;  3CG6 A;  1VQ4 F;  3G4S F;  1YIJ F;  2FC3 A;  1X7P A;  3IR9 A;  5HY4 A;  1PXW A;  3OW2 F;  4X3L A;  3OBW A;  2QA4 F;  3I56 F;  1GO0 A;  2F9Z C;  2WAL A;  5FLX M;  1N8R H;  3NVI B;  3J7A R;  4LCK A;  3V3T A;  1YJN F;  3ON1 A;  3J80 M;  2QEX F;  2KG4 A;  3WXM B;  5GIP C;  3CXC F;  1NMU B;  2LBX A;  3I55 F;  1CN7 A;  1W40 A;  1W41 A;  1KQS F;  3VMF B;  3CCS F;  1YHQ F;  3G6E F;  1IPA A;  3J81 M;  3HAX D;  5HWE A;  1YIT F;  1QVG F;  3CC7 F;  3O85 A;  3JAM M;  3AGK A;  4TZZ A;  1K9M H;  1DT9 A;  1RA4 A;  3V7E A;  5IT9 M;  3RA5 A;  4EI8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...