3OW2F

Crystal structure of enhanced macrolide bound to 50s ribosomal subunit
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
119
structure length
119
Chain Sequence
PVYVDFDVPADLEDDALEALEVARDTGAVKKGTNETTKSIERGSAELVFVAEDVQPEEIVMHIPELADEKGVPFIFVEQQDDLGHAAGLEVGSAAAAVTDAGAAATVLEEIADKVEELR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S RIBOSOMAL RNA
molecule tags Ribosome
total genus 30
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2010-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 3ow2F00
1K8AH 3PAFA 1YHQF 5GIPC 3CCMF 1YJWF 1E7KA 3NMUC 3N4ZA 1W2BF 2QEXF 4C4WC 1KD1H 2BO1A 3CCEF 5FJ4C 3LWPC 1Q82H 2JNBA 3CMAF 2WALA 1Q7YH 3V7QA 2QA4F 3CXCF 3N4YA 4NUTA 1S72F 3CCVF 1VQOF 4X3MA 3NVIB 1VQLF 3CMEF 3E1YA 1VQMF 1YI2F 1VQ4F 1Q86H 3SIUA 5GANK 3I56F 3CPQA 1QVGF 1VQ9F 3NVKE 1VQ6F 1NJIH 1KQSF 3OW2F 2I6DA 3LWVC 3VI6A 2KTUA 1W42A 4TZZA 3G6EF 1VQKF 1VQ8F 3LWQC 3G71F 2OTJF 3IR9A 3WXMB 3CCQF 2FC3A 3GYQA 1GO1A 1ZWZA 1W40A 3JCMM 1JJ2F 3OBWA 1GO0A 1RA4A 3CPWF 1H7MA 2AIFA 2OZBA 3MCAB 1GZ0A 3RA5A 1M1KH 2OTLF 3CC7F 2KG4A 2ALEA 1XBIA 3CCUF 3JAMM 1YITF 3RA6A 1X52A 1YIJF 3HAXD 3HJWC 1W41A 3CC4F 1CK2A 2VGNA 1NMUB 1VQPF 3FFMA 5G4VC 3PLAC 2LBWA 3ON1A 1Q81H 5IT9M 3V7EA 4LCKA 5EO3A 3NK7A 3CCLF 3J81M 3AGKA 3CC2F 3OBYA 3VMFB 3O85A 5EWRA 5A2QM 1VQ5F 1K73H 3CCSF 2VGMA 3CD6F 3I55F 1PXWA 1RLGA 3SIVA 1CN7A 5DCVA 3G4SF 1M90H 3LWOC 3J80M 2CZWA 1X7OA 2QI2A 2HVYD 3LWRC 1DT9A 1SDSA 1VQNF 1N8RH 2OHWA 3NK6A 3CG6A 1KC8H 4X3LA 1K9MH 1VQ7F 2KTVA 1W3EX 1T0KB 4BW0B 1QVFF 5FLXM 3J7AR 1YJ9F 2LBXA 5GIOC 1X7PA 5GINC 5G4UC 3CCRF 1YJNF 3E20B 4BY9D 3LFOA 3CCJF 1IPAA 5GAPK
chains in the Genus database with same CATH superfamily
3UT5B 3HKDB 1YJWF 3C9TA 3N4ZA 4O2BA 4XCQA 5JCOA 5LOVA 3CCEF 4BVTA 3WGLA 1TVKA 5J2TA 3JALA 1VK3A 3S0HA 3S03A 3CYPB 3FPIA 5LXTA 1CLIA 5EZYA 5HP8A 1UFYA 2HS0A 4I50B 4NUTA 2AIZP 1S72F 3QUWA 1FNJA 3VCZA 3R0PA 4X3MA 1GX1A 5HY4A 3RYCA 1FNKA 5CA1A 1VH8A 1U43A 1VHAA 3F0DA 3JAKB 2H8CA 1QVGF 3NVKE 1RQ7A 2HS4A 4ZOLB 1COMA 2ZODA 3IKFA 2HRYA 3LYBA 3FD6A 4U39A 2I6DA 3LWVC 3G6EF 4B46A 1OFUA 3LWQC 3HWUA 3V4DA 1SA0A 5JCOC 5CA0A 5C8YB 1GO1A 3ZP7A 5KX5A 3ESJA 4NQ3A 2OZBA 3JASA 3D54A 3HTNA 5CB4A 2OTLF 2KG4A 2UYPA 3EORA 3JAMM 3RA6A 5GONA 5B8FA 3HJWC 3CC4F 4YJ2A 5HWEA 1NMUB 2UYJA 3IEWA 5IT9M 4LNUA 4BT3A 4LCKA 5LA6A 2HP3A 4FFBA 1JD1A 3CB2A 4BVSA 1FFXB 1K73H 4C8GA 5IYZB 3HKBA 3L7QA 3I55F 3C9UA 2DT4A 3ELCA 3SIVA 5DCVA 3S02A 2CHSA 2PHNA 3J80M 5JH7A 4TV9B 1QU9A 2YXZA 1YGYA 2QI2A 5LP6B 3OONA 2RHOA 3S06A 2IAFA 4EI9A 2GLZA 4X3LA 1H47A 2GZLA 4IIJA 1W3EX 1T0KB 4G4YA 2HS3A 4O4HA 4BW0B 3TD3A 5FNVB 5IJ9A 4X1IB 4EB6A 1X7PA 2HP0B 3RYHB 5HY1A 5G4UC 4BY9D 3U0OA 3LFOA 3K12A 3K2XA 4O4IB 1K8AH 1YHQF 5J2UA 4YJ3B 2PMPA 1W2BF 3JVHA 2ZOVA 1KD1H 2BO1A 4B62A 5FJ4C 3BYQA 2JNBA 1Q82H 4TV8B 3F0FA 1XV2A 3CXCF 3VO8A 1IV1A 2FGYA 2RHLA 3IKEA 5EIBD 5MN4A 4F6RB 5JQGB 3HKCB 3UT5A 4X1KB 3HKDA 2GVIA 3WPWA 1W5AA 3E1YA 3P10A 1JN1A 1VQ4F 3VYUC 1J7HA 2BTOA 1NJIH 3I7TA 4C8IA 2Z1TA 5EB1B 5MN5A 4I50A 1VQVA 1VQ8F 1KNJA 5EAZA 2OTJF 3CCQF 4ZHQB 2FC3A 1JY8A 4TUYB 3GYQA 3TD5A 3VIUA 1W40A 2UZHA 4ZHWA 3JAWB 4NWOB 3JAKA 3CPWF 3E22B 2DYYA 4C8EA 4ZOLA 2BTQB 4G4ZA 3V3TA 4O2AB 1GZ0A 3GTZA 3RA5A 3CC7F 2VAMA 1XBIA 3C8LA 3JATB 3P0ZA 1CK2A 5C8YA 2VGNA 4ZI7B 4BT2A 4C81A 4IHJB 2KGWA 5HXUA 4G4XA 3KE1A 3OBYA 3VMFB 1Z5WA 1VQ5F 2NMUA 2VGMA 3CD6F 5AVMA 4WBNB 1JFFB 1X25A 2UYKA 4RHAA 3LMEA 4BVRA 1ONIA 1W55A 1SDSA 3VYTC 1FFXA 1W5BA 5IYZA 3KJJA 4RQOA 1R1MA 2R751 5GAPK 2Z01A 3C9RA 3MQWA 3P4EA 2Q1YA 4TV9A 2LBXA 5EYPB 5LP6A 3CCRF 1XRGA 3E20B 2ZVZA 3RYFB 3CCJF 5BMVB 3M4SA 1QAHA 3VOBA 5GIPC 3CCMF 1UI9A 3F6MA 2QEXF 5FNVA 1IV3A 2VAPA 5MN6A 3LWPC 3ERNA 4X1IA 3WGNA 5KMGB 1XHOA 1W581 3FD5A 1W59A 4M8IA 2HP0A 3RYHA 4EI7A 2QA4F 1ODEA 1DBFA 4X20B 4G4VA 4O4IA 4I55B 4O4JB 4YJ3A 4G4WA 5HXZA 3CCVF 3IEQA 3NVIB 5ITZB 1VQLF 4DXDA 4B5CA 1YI2F 2Z1EA 2EWCA 3ZP4A 4ZK7A 1Q86H 3SIUA 4TV8A 5GANK 3QHDA 4I4TB 2F9ZC 1NQ3A 5HY2A 3JARB 1VQ9F 1VQ6F 5LP6C 2IQQA 3RYIB 4EI8A 3VI6A 3HKEB 4F6RA 5JQGA 2K1SA 3HKCA 4X1KA 4TZZA 1TUBB 5HP7A 3G71F 3K0TA 3M84A 4ERHA 1ZWZA 3OBWA 4U3JB 3S0WA 1RQ2A 3DDNA 1H7MA 4BT5A 5HY0A 2AMTA 3MCAB 5EB0A 2RHJA 3N2GB 5JVDB 1QD9A 3N2KB 3F0EA 2ALEA 3CCUF 1PF5A 1FSZA 4X1YB 3MBMA 1X52A 1YIJF 4BT6A 1Z5VA 1W41A 3VTIC 4ZHQA 1VQPF 4DRXB 3FFMA 5G4VC 4TUYA 3ON1A 4E6EA 3QTYA 3WGJA 4HNAB 3JAWA 3KJKA 5EO3A 2QTPA 2UYNB 3AGKA 1U3PA 3CYQA 3E22A 3O85A 3J81M 4C82A 5EWRA 5A2QM 2VXYA 3CCSF 4O2AA 3Q8HA 3VOAA 3D00A 1PXWA 1RLGA 2OTMA 5EIBC 3G4SF 3JATA 5LYJB 3LWOC 4ZI7A 1X7OA 2HVYD 2Q1XA 1DT9A 2RHHA 2ZAUA 4IHJA 3B6NA 4O4LA 1SZQA 2W8BC 3NK6A 5IJ0B 2CWJA 3CG6A 4O2BB 4KWEA 5LOVB 1QVFF 5FLXM 4O4LB 1OAPA 4WBNA 3IMPA 3M1XA 1JFFA 3J7AR 3VYSC 4R40B 1TVKB 5J2TB 3JALB 2Z1UA 5GINC 3WGKA 5GIOC 5LXTB 2H6LA 1T0AA 4BT4A 1YJNF 5EZYB 2N48A 2VAWA 3PAFA 1E7KA 3NMUC 3LDTA 5IJ0A 4C4WC 2BTUA 3RYCB 3ZO8A 3WGMA 5CA1B 3WJRA 2V9YA 2G9IA 3CMAF 2B33A 1H48A 2CW4A 2WALA 1Q7YH 5EYPA 3V7QA 3GHZA 3RYFA 5BMVA 3N4YA 3D01A 1VQOF 2HRUA 1SA0B 4ZHYB 3CMEF 5CA0B 1VQMF 3FBAA 3KIZA 4B45A 5KMGA 1KNKA 5KX5B 2CVLA 3WJQA 3I56F 3CPQA 2HQSC 3T80A 1W57A 1KQSF 4X20A 3JASB 3OW2F 2KTUA 1W42A 3WPXA 4I55A 5CB4B 1VQKF 4O4JA 3RE3A 5GONB 3IR9A 3WXMB 5ITZA 4YJ2B 1W5EA 2LCAA 4LNUB 2Z1FA 3JCMM 2P6YA 3K14A 5LA6B 4FFBB 4I4TA 1JJ2F 1GO0A 1RA4A 3DC2A 3JARA 1YQNA 2AIFA 3RYIA 2RB9A 1W5FA 3HKBB 3HKEA 1M1KH 1YITF 1TUBA 3HAXD 2H8EA 4PWTA 2R6R1 1U3LA 2CHTA 3C9SA 5JH7B 3PLAC 2LBWA 1IV2A 3I3FA 3MCQA 1Q81H 3V7EA 3MDOA 4U3JA 1RLUA 3NK7A 3S0YA 3CCLF 3CC2F 4IIJB 1IV4A 4O4HB 4BVQA 2MQEA 3N2GA 5IJ9B 5JVDA 2I6RA 3N2KA 4ZHVA 2CSLA 1CN7A 2ZVYA 4X1YA 1M90H 2CZWA 4DRXA 4EB6B 2HX0A 3LWRC 1VQNF 1Q8RA 4G88A 1N8RH 4HNAA 2OHWA 1KC8H 1U40A 2ZF8A 2UYNA 4BT7A 1K9MH 5J2UB 3WJPA 1VQ7F 2KTVA 2YYEA 3F0GA 3KHNA 2IG8A 5LYJA 2LBTA 1YJ9F 3ZOPA 2L26A 1IPAA 3TD4A
chains in the Genus database with same CATH topology
1K8AH 3PAFA 1YHQF 5GIPC 3CCMF 1YJWF 1E7KA 3NMUC 3N4ZA 1W2BF 4XCQA 2QEXF 4C4WC 1KD1H 2BO1A 3CCEF 5FJ4C 3LWPC 1Q82H 2JNBA 4BVTA 3CMAF 2WALA 1Q7YH 4EI7A 3V7QA 2QA4F 3CXCF 2FGYA 3N4YA 4NUTA 1S72F 5HXZA 3CCVF 1VQOF 4X3MA 3NVIB 1VQLF 5HY4A 3E1YA 3CMEF 1VQMF 1YI2F 1VQ4F 1Q86H 3SIUA 5GANK 3I56F 2F9ZC 3CPQA 5HY2A 1QVGF 1VQ9F 3NVKE 1VQ6F 1NJIH 1KQSF 3OW2F 2I6DA 3LWVC 4EI8A 3VI6A 2KTUA 1W42A 4TZZA 3G6EF 1VQKF 1VQ8F 3LWQC 3G71F 2OTJF 3IR9A 3WXMB 3CCQF 2FC3A 3GYQA 1GO1A 1ZWZA 1W40A 3JCMM 1JJ2F 3OBWA 1GO0A 1RA4A 3CPWF 1H7MA 2AIFA 4NQ3A 5HY0A 2OZBA 3MCAB 3V3TA 1GZ0A 3RA5A 1M1KH 2OTLF 3CC7F 2KG4A 2ALEA 1XBIA 3CCUF 3JAMM 1YITF 3RA6A 1X52A 1YIJF 3HAXD 3HJWC 1W41A 3CC4F 1CK2A 2VGNA 5HWEA 1NMUB 1VQPF 3FFMA 5G4VC 3PLAC 2LBWA 3ON1A 1Q81H 5IT9M 3V7EA 5HXUA 4LCKA 5EO3A 3NK7A 3CCLF 3J81M 3AGKA 3CC2F 3OBYA 3VMFB 3O85A 4BVSA 5EWRA 5A2QM 1VQ5F 1K73H 4BVQA 3CCSF 2VGMA 3CD6F 3D00A 3I55F 1PXWA 1RLGA 3SIVA 1CN7A 5DCVA 3G4SF 1M90H 3LWOC 3J80M 2CZWA 1X7OA 2QI2A 4BVRA 2HVYD 3LWRC 1DT9A 1SDSA 1VQNF 1N8RH 2OHWA 3NK6A 3CG6A 4EI9A 1KC8H 2GLZA 4X3LA 1K9MH 1VQ7F 2KTVA 1W3EX 1T0KB 4BW0B 1QVFF 5FLXM 3J7AR 1YJ9F 2LBXA 5GIOC 1X7PA 5GINC 5HY1A 5G4UC 3CCRF 1YJNF 3E20B 4BY9D 3LFOA 3CCJF 1IPAA 5GAPK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K8A H;  3PAF A;  1YHQ F;  5GIP C;  3CCM F;  1YJW F;  1E7K A;  3NMU C;  3N4Z A;  1W2B F;  2QEX F;  4C4W C;  1KD1 H;  2BO1 A;  3CCE F;  5FJ4 C;  3LWP C;  1Q82 H;  2JNB A;  3CMA F;  2WAL A;  1Q7Y H;  3V7Q A;  2QA4 F;  3CXC F;  3N4Y A;  4NUT A;  1S72 F;  3CCV F;  1VQO F;  4X3M A;  3NVI B;  1VQL F;  3CME F;  3E1Y A;  1VQM F;  1YI2 F;  1VQ4 F;  1Q86 H;  3SIU A;  5GAN K;  3I56 F;  3CPQ A;  1QVG F;  1VQ9 F;  3NVK E;  1VQ6 F;  1NJI H;  1KQS F;  3OW2 F;  2I6D A;  3LWV C;  3VI6 A;  2KTU A;  1W42 A;  4TZZ A;  3G6E F;  1VQK F;  1VQ8 F;  3LWQ C;  3G71 F;  2OTJ F;  3IR9 A;  3WXM B;  3CCQ F;  2FC3 A;  3GYQ A;  1GO1 A;  1ZWZ A;  1W40 A;  3JCM M;  1JJ2 F;  3OBW A;  1GO0 A;  1RA4 A;  3CPW F;  1H7M A;  2AIF A;  2OZB A;  3MCA B;  1GZ0 A;  3RA5 A;  1M1K H;  2OTL F;  3CC7 F;  2KG4 A;  2ALE A;  1XBI A;  3CCU F;  3JAM M;  1YIT F;  3RA6 A;  1X52 A;  1YIJ F;  3HAX D;  3HJW C;  1W41 A;  3CC4 F;  1CK2 A;  2VGN A;  1NMU B;  1VQP F;  3FFM A;  5G4V C;  3PLA C;  2LBW A;  3ON1 A;  1Q81 H;  5IT9 M;  3V7E A;  4LCK A;  5EO3 A;  3NK7 A;  3CCL F;  3J81 M;  3AGK A;  3CC2 F;  3OBY A;  3VMF B;  3O85 A;  5EWR A;  5A2Q M;  1VQ5 F;  1K73 H;  3CCS F;  2VGM A;  3CD6 F;  3I55 F;  1PXW A;  1RLG A;  3SIV A;  1CN7 A;  5DCV A;  3G4S F;  1M90 H;  3LWO C;  3J80 M;  2CZW A;  1X7O A;  2QI2 A;  2HVY D;  3LWR C;  1DT9 A;  1SDS A;  1VQN F;  1N8R H;  2OHW A;  3NK6 A;  3CG6 A;  1KC8 H;  4X3L A;  1K9M H;  1VQ7 F;  2KTV A;  1W3E X;  1T0K B;  4BW0 B;  1QVF F;  5FLX M;  3J7A R;  1YJ9 F;  2LBX A;  5GIO C;  1X7P A;  5GIN C;  5G4U C;  3CCR F;  1YJN F;  3E20 B;  4BY9 D;  3LFO A;  3CCJ F;  1IPA A;  5GAP K; 
#chains in the Genus database with same CATH topology
 3UT5 B;  3HKD B;  1YJW F;  3C9T A;  3N4Z A;  4O2B A;  4XCQ A;  5JCO A;  5LOV A;  3CCE F;  4BVT A;  3WGL A;  1TVK A;  5J2T A;  3JAL A;  1VK3 A;  3S0H A;  3S03 A;  3CYP B;  3FPI A;  5LXT A;  1CLI A;  5EZY A;  5HP8 A;  1UFY A;  2HS0 A;  4I50 B;  4NUT A;  2AIZ P;  1S72 F;  3QUW A;  1FNJ A;  3VCZ A;  3R0P A;  4X3M A;  1GX1 A;  5HY4 A;  3RYC A;  1FNK A;  5CA1 A;  1VH8 A;  1U43 A;  1VHA A;  3F0D A;  3JAK B;  2H8C A;  1QVG F;  3NVK E;  1RQ7 A;  2HS4 A;  4ZOL B;  1COM A;  2ZOD A;  3IKF A;  2HRY A;  3LYB A;  3FD6 A;  4U39 A;  2I6D A;  3LWV C;  3G6E F;  4B46 A;  1OFU A;  3LWQ C;  3HWU A;  3V4D A;  1SA0 A;  5JCO C;  5CA0 A;  5C8Y B;  1GO1 A;  3ZP7 A;  5KX5 A;  3ESJ A;  4NQ3 A;  2OZB A;  3JAS A;  3D54 A;  3HTN A;  5CB4 A;  2OTL F;  2KG4 A;  2UYP A;  3EOR A;  3JAM M;  3RA6 A;  5GON A;  5B8F A;  3HJW C;  3CC4 F;  4YJ2 A;  5HWE A;  1NMU B;  2UYJ A;  3IEW A;  5IT9 M;  4LNU A;  4BT3 A;  4LCK A;  5LA6 A;  2HP3 A;  4FFB A;  1JD1 A;  3CB2 A;  4BVS A;  1FFX B;  1K73 H;  4C8G A;  5IYZ B;  3HKB A;  3L7Q A;  3I55 F;  3C9U A;  2DT4 A;  3ELC A;  3SIV A;  5DCV A;  3S02 A;  2CHS A;  2PHN A;  3J80 M;  5JH7 A;  4TV9 B;  1QU9 A;  2YXZ A;  1YGY A;  2QI2 A;  5LP6 B;  3OON A;  2RHO A;  3S06 A;  2IAF A;  4EI9 A;  2GLZ A;  4X3L A;  1H47 A;  2GZL A;  4IIJ A;  1W3E X;  1T0K B;  4G4Y A;  2HS3 A;  4O4H A;  4BW0 B;  3TD3 A;  5FNV B;  5IJ9 A;  4X1I B;  4EB6 A;  1X7P A;  2HP0 B;  3RYH B;  5HY1 A;  5G4U C;  4BY9 D;  3U0O A;  3LFO A;  3K12 A;  3K2X A;  4O4I B;  1K8A H;  1YHQ F;  5J2U A;  4YJ3 B;  2PMP A;  1W2B F;  3JVH A;  2ZOV A;  1KD1 H;  2BO1 A;  4B62 A;  5FJ4 C;  3BYQ A;  2JNB A;  1Q82 H;  4TV8 B;  3F0F A;  1XV2 A;  3CXC F;  3VO8 A;  1IV1 A;  2FGY A;  2RHL A;  3IKE A;  5EIB D;  5MN4 A;  4F6R B;  5JQG B;  3HKC B;  3UT5 A;  4X1K B;  3HKD A;  2GVI A;  3WPW A;  1W5A A;  3E1Y A;  3P10 A;  1JN1 A;  1VQ4 F;  3VYU C;  1J7H A;  2BTO A;  1NJI H;  3I7T A;  4C8I A;  2Z1T A;  5EB1 B;  5MN5 A;  4I50 A;  1VQV A;  1VQ8 F;  1KNJ A;  5EAZ A;  2OTJ F;  3CCQ F;  4ZHQ B;  2FC3 A;  1JY8 A;  4TUY B;  3GYQ A;  3TD5 A;  3VIU A;  1W40 A;  2UZH A;  4ZHW A;  3JAW B;  4NWO B;  3JAK A;  3CPW F;  3E22 B;  2DYY A;  4C8E A;  4ZOL A;  2BTQ B;  4G4Z A;  3V3T A;  4O2A B;  1GZ0 A;  3GTZ A;  3RA5 A;  3CC7 F;  2VAM A;  1XBI A;  3C8L A;  3JAT B;  3P0Z A;  1CK2 A;  5C8Y A;  2VGN A;  4ZI7 B;  4BT2 A;  4C81 A;  4IHJ B;  2KGW A;  5HXU A;  4G4X A;  3KE1 A;  3OBY A;  3VMF B;  1Z5W A;  1VQ5 F;  2NMU A;  2VGM A;  3CD6 F;  5AVM A;  4WBN B;  1JFF B;  1X25 A;  2UYK A;  4RHA A;  3LME A;  4BVR A;  1ONI A;  1W55 A;  1SDS A;  3VYT C;  1FFX A;  1W5B A;  5IYZ A;  3KJJ A;  4RQO A;  1R1M A;  2R75 1;  5GAP K;  2Z01 A;  3C9R A;  3MQW A;  3P4E A;  2Q1Y A;  4TV9 A;  2LBX A;  5EYP B;  5LP6 A;  3CCR F;  1XRG A;  3E20 B;  2ZVZ A;  3RYF B;  3CCJ F;  5BMV B;  3M4S A;  1QAH A;  3VOB A;  5GIP C;  3CCM F;  1UI9 A;  3F6M A;  2QEX F;  5FNV A;  1IV3 A;  2VAP A;  5MN6 A;  3LWP C;  3ERN A;  4X1I A;  3WGN A;  5KMG B;  1XHO A;  1W58 1;  3FD5 A;  1W59 A;  4M8I A;  2HP0 A;  3RYH A;  4EI7 A;  2QA4 F;  1ODE A;  1DBF A;  4X20 B;  4G4V A;  4O4I A;  4I55 B;  4O4J B;  4YJ3 A;  4G4W A;  5HXZ A;  3CCV F;  3IEQ A;  3NVI B;  5ITZ B;  1VQL F;  4DXD A;  4B5C A;  1YI2 F;  2Z1E A;  2EWC A;  3ZP4 A;  4ZK7 A;  1Q86 H;  3SIU A;  4TV8 A;  5GAN K;  3QHD A;  4I4T B;  2F9Z C;  1NQ3 A;  5HY2 A;  3JAR B;  1VQ9 F;  1VQ6 F;  5LP6 C;  2IQQ A;  3RYI B;  4EI8 A;  3VI6 A;  3HKE B;  4F6R A;  5JQG A;  2K1S A;  3HKC A;  4X1K A;  4TZZ A;  1TUB B;  5HP7 A;  3G71 F;  3K0T A;  3M84 A;  4ERH A;  1ZWZ A;  3OBW A;  4U3J B;  3S0W A;  1RQ2 A;  3DDN A;  1H7M A;  4BT5 A;  5HY0 A;  2AMT A;  3MCA B;  5EB0 A;  2RHJ A;  3N2G B;  5JVD B;  1QD9 A;  3N2K B;  3F0E A;  2ALE A;  3CCU F;  1PF5 A;  1FSZ A;  4X1Y B;  3MBM A;  1X52 A;  1YIJ F;  4BT6 A;  1Z5V A;  1W41 A;  3VTI C;  4ZHQ A;  1VQP F;  4DRX B;  3FFM A;  5G4V C;  4TUY A;  3ON1 A;  4E6E A;  3QTY A;  3WGJ A;  4HNA B;  3JAW A;  3KJK A;  5EO3 A;  2QTP A;  2UYN B;  3AGK A;  1U3P A;  3CYQ A;  3E22 A;  3O85 A;  3J81 M;  4C82 A;  5EWR A;  5A2Q M;  2VXY A;  3CCS F;  4O2A A;  3Q8H A;  3VOA A;  3D00 A;  1PXW A;  1RLG A;  2OTM A;  5EIB C;  3G4S F;  3JAT A;  5LYJ B;  3LWO C;  4ZI7 A;  1X7O A;  2HVY D;  2Q1X A;  1DT9 A;  2RHH A;  2ZAU A;  4IHJ A;  3B6N A;  4O4L A;  1SZQ A;  2W8B C;  3NK6 A;  5IJ0 B;  2CWJ A;  3CG6 A;  4O2B B;  4KWE A;  5LOV B;  1QVF F;  5FLX M;  4O4L B;  1OAP A;  4WBN A;  3IMP A;  3M1X A;  1JFF A;  3J7A R;  3VYS C;  4R40 B;  1TVK B;  5J2T B;  3JAL B;  2Z1U A;  5GIN C;  3WGK A;  5GIO C;  5LXT B;  2H6L A;  1T0A A;  4BT4 A;  1YJN F;  5EZY B;  2N48 A;  2VAW A;  3PAF A;  1E7K A;  3NMU C;  3LDT A;  5IJ0 A;  4C4W C;  2BTU A;  3RYC B;  3ZO8 A;  3WGM A;  5CA1 B;  3WJR A;  2V9Y A;  2G9I A;  3CMA F;  2B33 A;  1H48 A;  2CW4 A;  2WAL A;  1Q7Y H;  5EYP A;  3V7Q A;  3GHZ A;  3RYF A;  5BMV A;  3N4Y A;  3D01 A;  1VQO F;  2HRU A;  1SA0 B;  4ZHY B;  3CME F;  5CA0 B;  1VQM F;  3FBA A;  3KIZ A;  4B45 A;  5KMG A;  1KNK A;  5KX5 B;  2CVL A;  3WJQ A;  3I56 F;  3CPQ A;  2HQS C;  3T80 A;  1W57 A;  1KQS F;  4X20 A;  3JAS B;  3OW2 F;  2KTU A;  1W42 A;  3WPX A;  4I55 A;  5CB4 B;  1VQK F;  4O4J A;  3RE3 A;  5GON B;  3IR9 A;  3WXM B;  5ITZ A;  4YJ2 B;  1W5E A;  2LCA A;  4LNU B;  2Z1F A;  3JCM M;  2P6Y A;  3K14 A;  5LA6 B;  4FFB B;  4I4T A;  1JJ2 F;  1GO0 A;  1RA4 A;  3DC2 A;  3JAR A;  1YQN A;  2AIF A;  3RYI A;  2RB9 A;  1W5F A;  3HKB B;  3HKE A;  1M1K H;  1YIT F;  1TUB A;  3HAX D;  2H8E A;  4PWT A;  2R6R 1;  1U3L A;  2CHT A;  3C9S A;  5JH7 B;  3PLA C;  2LBW A;  1IV2 A;  3I3F A;  3MCQ A;  1Q81 H;  3V7E A;  3MDO A;  4U3J A;  1RLU A;  3NK7 A;  3S0Y A;  3CCL F;  3CC2 F;  4IIJ B;  1IV4 A;  4O4H B;  4BVQ A;  2MQE A;  3N2G A;  5IJ9 B;  5JVD A;  2I6R A;  3N2K A;  4ZHV A;  2CSL A;  1CN7 A;  2ZVY A;  4X1Y A;  1M90 H;  2CZW A;  4DRX A;  4EB6 B;  2HX0 A;  3LWR C;  1VQN F;  1Q8R A;  4G88 A;  1N8R H;  4HNA A;  2OHW A;  1KC8 H;  1U40 A;  2ZF8 A;  2UYN A;  4BT7 A;  1K9M H;  5J2U B;  3WJP A;  1VQ7 F;  2KTV A;  2YYE A;  3F0G A;  3KHN A;  2IG8 A;  5LYJ A;  2LBT A;  1YJ9 F;  3ZOP A;  2L26 A;  1IPA A;  3TD4 A; 
#chains in the Genus database with same CATH homology
 1K8A H;  3PAF A;  1YHQ F;  5GIP C;  3CCM F;  1YJW F;  1E7K A;  3NMU C;  3N4Z A;  1W2B F;  4XCQ A;  2QEX F;  4C4W C;  1KD1 H;  2BO1 A;  3CCE F;  5FJ4 C;  3LWP C;  1Q82 H;  2JNB A;  4BVT A;  3CMA F;  2WAL A;  1Q7Y H;  4EI7 A;  3V7Q A;  2QA4 F;  3CXC F;  2FGY A;  3N4Y A;  4NUT A;  1S72 F;  5HXZ A;  3CCV F;  1VQO F;  4X3M A;  3NVI B;  1VQL F;  5HY4 A;  3E1Y A;  3CME F;  1VQM F;  1YI2 F;  1VQ4 F;  1Q86 H;  3SIU A;  5GAN K;  3I56 F;  2F9Z C;  3CPQ A;  5HY2 A;  1QVG F;  1VQ9 F;  3NVK E;  1VQ6 F;  1NJI H;  1KQS F;  3OW2 F;  2I6D A;  3LWV C;  4EI8 A;  3VI6 A;  2KTU A;  1W42 A;  4TZZ A;  3G6E F;  1VQK F;  1VQ8 F;  3LWQ C;  3G71 F;  2OTJ F;  3IR9 A;  3WXM B;  3CCQ F;  2FC3 A;  3GYQ A;  1GO1 A;  1ZWZ A;  1W40 A;  3JCM M;  1JJ2 F;  3OBW A;  1GO0 A;  1RA4 A;  3CPW F;  1H7M A;  2AIF A;  4NQ3 A;  5HY0 A;  2OZB A;  3MCA B;  3V3T A;  1GZ0 A;  3RA5 A;  1M1K H;  2OTL F;  3CC7 F;  2KG4 A;  2ALE A;  1XBI A;  3CCU F;  3JAM M;  1YIT F;  3RA6 A;  1X52 A;  1YIJ F;  3HAX D;  3HJW C;  1W41 A;  3CC4 F;  1CK2 A;  2VGN A;  5HWE A;  1NMU B;  1VQP F;  3FFM A;  5G4V C;  3PLA C;  2LBW A;  3ON1 A;  1Q81 H;  5IT9 M;  3V7E A;  5HXU A;  4LCK A;  5EO3 A;  3NK7 A;  3CCL F;  3J81 M;  3AGK A;  3CC2 F;  3OBY A;  3VMF B;  3O85 A;  4BVS A;  5EWR A;  5A2Q M;  1VQ5 F;  1K73 H;  4BVQ A;  3CCS F;  2VGM A;  3CD6 F;  3D00 A;  3I55 F;  1PXW A;  1RLG A;  3SIV A;  1CN7 A;  5DCV A;  3G4S F;  1M90 H;  3LWO C;  3J80 M;  2CZW A;  1X7O A;  2QI2 A;  4BVR A;  2HVY D;  3LWR C;  1DT9 A;  1SDS A;  1VQN F;  1N8R H;  2OHW A;  3NK6 A;  3CG6 A;  4EI9 A;  1KC8 H;  2GLZ A;  4X3L A;  1K9M H;  1VQ7 F;  2KTV A;  1W3E X;  1T0K B;  4BW0 B;  1QVF F;  5FLX M;  3J7A R;  1YJ9 F;  2LBX A;  5GIO C;  1X7P A;  5GIN C;  5HY1 A;  5G4U C;  3CCR F;  1YJN F;  3E20 B;  4BY9 D;  3LFO A;  3CCJ F;  1IPA A;  5GAP K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...