3OW2F

Crystal structure of enhanced macrolide bound to 50s ribosomal subunit
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
119
structure length
119
Chain Sequence
PVYVDFDVPADLEDDALEALEVARDTGAVKKGTNETTKSIERGSAELVFVAEDVQPEEIVMHIPELADEKGVPFIFVEQQDDLGHAAGLEVGSAAAAVTDAGAAATVLEEIADKVEELR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S RIBOSOMAL RNA
molecule tags Ribosome
total genus 30
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2010-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 3ow2F00
5FLXM 1KC8H 1Q7YH 5EO3A 3JAMM 3SIVA 2VGMA 5FJ4C 1RLGA 3LWOC 5GINC 2I6DA 3IR9A 5EWRA 5A2QM 1K8AH 3O85A 3OBYA 3VI6A 3V7QA 1YHQF 2OTJF 1YJWF 1X52A 2OTLF 1N8RH 3JCMM 2OZBA 3CPWF 3CMAF 3LWRC 1CN7A 5GAPK 1KQSF 1W40A 5GIOC 1GO0A 1GO1A 3J81M 2QI2A 1PXWA 1W41A 1VQ9F 4NUTA 5G4UC 3I55F 1W2BF 2HVYD 3LWVC 1X7PA 3ON1A 1CK2A 1ZWZA 3J7AR 1SDSA 3CCSF 2AIFA 2QA4F 2BO1A 1Q82H 1DT9A 1QVFF 3CD6F 4X3MA 2KTUA 1T0KB 3WXMB 2QEXF 1NMUB 1GZ0A 4C4WC 3VMFB 1RA4A 3CCRF 3CCLF 3GYQA 3CMEF 3E1YA 3LFOA 3G71F 3I56F 3NVIB 3LWPC 3SIUA 1M90H 2LBXA 3CC4F 2WALA 3OW2F 3J80M 4TZZA 4LCKA 3RA5A 3LWQC 3OBWA 1YJNF 1VQ8F 3NVKE 1VQOF 3PLAC 3CCUF 1S72F 3CG6A 3N4YA 3V7EA 1K9MH 3HAXD 1VQ4F 3RA6A 2JNBA 3CCEF 1VQLF 3E20B 3CCJF 1YIJF 3G6EF 3NMUC 3MCAB 1X7OA 1VQPF 1Q86H 1VQNF 2KG4A 1Q81H 4BW0B 5IT9M 1M1KH 3G4SF 5GIPC 1NJIH 2OHWA 1VQ7F 1VQMF 3CXCF 2LBWA 3HJWC 2ALEA 1XBIA 1VQ5F 1K73H 3FFMA 3CPQA 1E7KA 1KD1H 2VGNA 3CCQF 1YI2F 1H7MA 3AGKA 1W42A 1JJ2F 1QVGF 3CC2F 3NK6A 3CCVF 1IPAA 2FC3A 2KTVA 5GANK 3NK7A 3CCMF 5DCVA 3CC7F 2CZWA 4X3LA 1VQKF 1VQ6F 1YITF 3PAFA 5G4VC 1W3EX 4BY9D 3N4ZA 1YJ9F
chains in the Genus database with same CATH superfamily
5FLXM 1KC8H 4O2BB 4O4IB 3IEQA 5EO3A 3JAMM 3IKFA 3LWOC 5B8FA 3TD4A 3MDOA 2I6DA 3IR9A 1YGYA 2VXYA 1K8AH 4WBNB 3JASB 2MQEA 2ZAUA 5ITZB 2OTJF 2CW4A 4X20B 1RQ7A 1X52A 4I50B 3JAKA 2OTLF 5CB4B 1N8RH 2OZBA 3CMAF 3LWRC 3MBMA 1XRGA 2ZVZA 3U0OA 3E22A 1PXWA 2QI2A 1VQ9F 1NQ3A 3P0ZA 4I4TA 5HP8A 2OTMA 4YJ2A 3I55F 3KHNA 4O4LB 3LWVC 5C8YA 1QAHA 5JQGA 1X7PA 4TV8B 2Z1FA 2UYNB 3CCSF 4DRXB 2ZVYA 2BO1A 3R0PA 1DT9A 4NWOB 3S0WA 2KTUA 3D00A 3WXMB 2QEXF 4BT5A 2NMUA 3HTNA 3M84A 1GZ0A 1FNJA 4TV9B 2BTOA 2ZODA 1IV4A 3I7TA 2HS4A 3CMEF 3F6MA 2ZOVA 3G71F 3BYQA 1T0AA 4M8IA 2HRUA 2HP3A 5EYPB 3ZO8A 1H47A 3RA5A 3GHZA 1SA0A 3HKDA 4G88A 4ZHYB 3VCZA 1YJNF 5LP6B 1S72F 3JARA 2JNBA 3CCEF 4BT7A 5IJ9B 3CCJF 4ERHA 3JVHA 2DYYA 3NMUC 1UFYA 3WGJA 1Z5VA 1VQPF 5J2UA 4ZI7B 1VQNF 3JAWB 4X1YB 3IEWA 1VQMF 2HP0B 4ZK7A 5EIBC 3K12A 4IIJB 3RYFB 1VQ5F 1TVKA 3FFMA 1E7KA 4BT3A 5HY2A 1KD1H 5AVMA 5LYJA 3HKCA 3CCQF 1FFXA 3AGKA 5IJ0A 5EZYA 1Z5WA 3NK6A 1IPAA 2FC3A 5DCVA 1JY8A 2CZWA 3HKBA 1YITF 1QU9A 5MN6A 5CA1A 3WPXA 1YJ9F 1UI9A 1RLUA 3WGLA 3ERNA 3ZOPA 2HS3A 4FFBA 3FBAA 2VGMA 4G4ZA 2F9ZC 4BT6A 4X1IB 1W59A 2GLZA 3VTIC 2R751 3FPIA 5BMVB 5IYZB 1JFFA 3O85A 3RYHA 3N2KA 3V7QA 1YJWF 5EB1B 2VAWA 2RHOA 5LA6A 4TUYA 5JH7A 3GTZA 2YYEA 1X25A 3T80A 5GAPK 1PF5A 1KQSF 4O2BA 1GO1A 3HKEA 3RYCA 3S03A 3F0FA 1W41A 1W57A 5LXTB 3F0EA 1W2BF 1W55A 1FNKA 3JATA 2IQQA 1OAPA 3EORA 3ON1A 4ZHQB 3QHDA 5ITZA 2AIFA 1Q82H 4X1KB 3N2GB 1QVFF 5CB4A 2CWJA 1NMUB 4EB6B 2AMTA 2V9YA 3S02A 3CCRF 3CCLF 3GYQA 3LFOA 3Q8HA 4I55B 3I56F 4F6RA 2N48A 3NVIB 5FNVB 1KNJA 2KGWA 3SIUA 3CC4F 1JD1A 2I6RA 3S06A 2H8EA 1TUBA 5J2TB 3LWQC 3I3FA 1IV2A 3OBWA 3FD5A 3V7EA 3DDNA 1K9MH 3K0TA 4R40B 1VQLF 1OFUA 5KX5A 4C8IA 2G9IA 3LMEA 3G6EF 1DBFA 4U3JA 3JAKB 5KMGA 1U40A 4RQOA 1ONIA 3VYTC 5IT9M 2CVLA 5GIPC 1XV2A 2OHWA 3E22B 1VK3A 5EYPA 4I4TB 3K2XA 2H6LA 4YJ2B 4G4XA 5LOVA 1XHOA 5C8YB 1K73H 3V3TA 2VGNA 3M1XA 4YJ3A 1VHAA 1H7MA 2AIZP 2IAFA 1YI2F 1W42A 1JJ2F 2BTQB 3CC2F 1W5EA 4B5CA 3CCVF 3F0DA 3RYIA 2KTVA 4C81A 3CCMF 2PMPA 3JAWA 3NK7A 3ELCA 2HRYA 2FGYA 3PAFA 2IG8A 4X1YA 4XCQA 5HY1A 4BY9D 2HP0A 3QUWA 4NQ3A 2Z1TA 2CSLA 2W8BC 4O4JB 1RLGA 5GINC 2VAPA 3JALA 2RHLA 3OONA 2BTUA 3P10A 5EWRA 3V4DA 4C8GA 4C8EA 3OBYA 1KNKA 1H48A 1SA0B 2PHNA 3HKDB 5GONB 4B62A 4O2AA 1W5FA 2HQSC 3JCMM 3F0GA 3CPWF 1CN7A 4O4HA 2LBTA 1YQNA 3UT5A 5GIOC 3DC2A 3C9TA 5J2UB 2DT4A 4NUTA 3C9RA 2EWCA 3FD6A 5JVDA 2Z1EA 5G4UC 4ZHWA 1COMA 5BMVA 2HVYD 2UZHA 3ZP7A 1CK2A 1ZWZA 3C9UA 3J7AR 1SDSA 4IHJA 5HWEA 1W581 1TVKB 2RHJA 3S0YA 4HNAA 4X3MA 3CD6F 4LNUA 3B6NA 3HKCB 1FFXB 5IJ0B 1W5AA 5EZYB 2GZLA 1RA4A 4O4IA 3LYBA 2R6R1 2UYKA 4ZOLB 2Q1YA 5CA0B 5CA1B 1RQ2A 3LWPC 1M90H 2LBXA 2WALA 4G4YA 3OW2F 4FFBB 5HXZA 4WBNA 3JASA 3WJPA 2B33A 1R1MA 1VQ8F 3NVKE 1VQOF 4X20A 3PLAC 1ODEA 3CG6A 1JFFB 2CHTA 4I50A 3TD3A 1Q8RA 3N2KB 3RA6A 4BT2A 5HP7A 1YIJF 3MCAB 3WPWA 3M4SA 4TUYB 4BVQA 1X7OA 5JH7B 5JCOA 4BW0B 3VOBA 3L7QA 1IV3A 3G4SF 3HKEB 4O4LA 3RYCB 2UYPA 5J2TA 3P4EA 2LBWA 4TV8A 1J7HA 5EAZA 2ALEA 3HWUA 2UYNA 4DRXA 3JATB 3CPQA 4PWTA 2H8CA 2L26A 4BVSA 3VYSC 1QVGF 4TV9A 4U39A 3ZP4A 5MN5A 5GANK 3CC7F 1VQ6F 2CHSA 2ZF8A 4B46A 1FSZA 2Q1XA 1Q7YH 3KJKA 3SIVA 3C8LA 4F6RB 4BT4A 5FJ4C 3KJJA 2LCAA 5LP6A 4ZHVA 3S0HA 1JN1A 5HXUA 1QD9A 5A2QM 1TUBB 3WGMA 5JQGB 3MQWA 2K1SA 3CYQA 3VI6A 1YHQF 5IJ9A 5HY0A 5JCOC 2HS0A 4ZI7A 5KX5B 4EI8A 2GVIA 3D01A 2RHHA 1W40A 4U3JB 1GO0A 2Z1UA 5KMGB 3J81M 4O4JA 3WJQA 2QTPA 4IIJA 3RYFA 2P6YA 5EB0A 3TD5A 4EI7A 5GONA 3RE3A 5LOVB 2QA4F 3K14A 4RHAA 1U3LA 1T0KB 4E6EA 4YJ3B 3WGNA 3CYPB 3JARB 3MCQA 3RYIB 4C4WC 3VMFB 3VIUA 3E1YA 3QTYA 3WJRA 5LP6C 4X1IA 1CLIA 1SZQA 1U3PA 2VAMA 3KIZA 5IYZA 3J80M 4TZZA 4LCKA 3VO8A 4DXDA 3JALB 3CCUF 3D54A 3N4YA 4KWEA 3HAXD 1VQ4F 1VH8A 3WGKA 2UYJA 3E20B 5EIBD 5LYJB 4O2AB 3IMPA 4G4WA 3CB2A 1W5BA 4BVTA 1Q86H 4ZOLA 5CA0A 3LDTA 4C82A 2KG4A 4O4HB 5LXTA 1Q81H 1M1KH 3HKBB 3UT5B 1U43A 1NJIH 1VQ7F 3CXCF 4BVRA 5JVDB 4ZHQA 3HJWC 3KE1A 2YXZA 1XBIA 5HY4A 3VOAA 4X1KA 3N2GA 5MN4A 3ESJA 2Z01A 4B45A 2HX0A 4IHJB 3IKEA 3RYHB 1IV1A 4HNAB 4EB6A 4EI9A 1VQVA 4LNUB 4X3LA 4G4VA 1VQKF 3VYUC 2RB9A 5LA6B 5G4VC 1W3EX 3N4ZA 4I55A 3C9SA 5FNVA 1GX1A
chains in the Genus database with same CATH topology
5FLXM 1KC8H 4NQ3A 1Q7YH 5EO3A 3JAMM 3SIVA 2VGMA 2F9ZC 1RLGA 3LWOC 5FJ4C 5GINC 2I6DA 3IR9A 5EWRA 2GLZA 5HXUA 5A2QM 1K8AH 3O85A 3OBYA 3VI6A 3V7QA 1YHQF 2OTJF 1YJWF 5HY0A 1X52A 2OTLF 1N8RH 3JCMM 2OZBA 3CPWF 3CMAF 3LWRC 4EI8A 5GAPK 1CN7A 1KQSF 1W40A 5GIOC 1GO0A 1GO1A 3J81M 2QI2A 1PXWA 1W41A 1VQ9F 4NUTA 5G4UC 3I55F 1W2BF 2HVYD 3LWVC 1X7PA 3ON1A 4EI7A 1CK2A 1ZWZA 3J7AR 1SDSA 3CCSF 5HWEA 2AIFA 2QA4F 2BO1A 1Q82H 1DT9A 1QVFF 3CD6F 4X3MA 2KTUA 1T0KB 3D00A 3WXMB 2QEXF 1NMUB 1GZ0A 4C4WC 3VMFB 1RA4A 3CCRF 3CCLF 3GYQA 3CMEF 3E1YA 3LFOA 3G71F 3I56F 3NVIB 3LWPC 3SIUA 1M90H 2LBXA 3CC4F 2WALA 3OW2F 5HXZA 3J80M 4TZZA 3RA5A 4LCKA 3LWQC 3OBWA 1YJNF 1VQ8F 3NVKE 1VQOF 3PLAC 3CCUF 1S72F 3CG6A 3N4YA 3V7EA 1K9MH 3HAXD 1VQ4F 3RA6A 2JNBA 3CCEF 1VQLF 3E20B 3CCJF 1YIJF 3G6EF 3NMUC 3MCAB 4BVQA 1X7OA 4BVTA 1VQPF 1Q86H 1VQNF 2KG4A 1Q81H 4BW0B 5IT9M 1M1KH 3G4SF 5GIPC 1NJIH 2OHWA 1VQ7F 1VQMF 3CXCF 4BVRA 2LBWA 3HJWC 2ALEA 1XBIA 1VQ5F 5HY4A 3FFMA 3CPQA 1K73H 1E7KA 3V3TA 5HY2A 1KD1H 2VGNA 3CCQF 1YI2F 1H7MA 3AGKA 4BVSA 1W42A 1JJ2F 1QVGF 3CC2F 3NK6A 3CCVF 4EI9A 1IPAA 2FC3A 2KTVA 5GANK 3NK7A 3CCMF 5DCVA 3CC7F 2CZWA 4X3LA 1VQKF 1VQ6F 2FGYA 1YITF 3PAFA 4XCQA 5G4VC 1W3EX 5HY1A 4BY9D 3N4ZA 1YJ9F
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FLX M;  1KC8 H;  1Q7Y H;  5EO3 A;  3JAM M;  3SIV A;  2VGM A;  5FJ4 C;  1RLG A;  3LWO C;  5GIN C;  2I6D A;  3IR9 A;  5EWR A;  5A2Q M;  1K8A H;  3O85 A;  3OBY A;  3VI6 A;  3V7Q A;  1YHQ F;  2OTJ F;  1YJW F;  1X52 A;  2OTL F;  1N8R H;  3JCM M;  2OZB A;  3CPW F;  3CMA F;  3LWR C;  1CN7 A;  5GAP K;  1KQS F;  1W40 A;  5GIO C;  1GO0 A;  1GO1 A;  3J81 M;  2QI2 A;  1PXW A;  1W41 A;  1VQ9 F;  4NUT A;  5G4U C;  3I55 F;  1W2B F;  2HVY D;  3LWV C;  1X7P A;  3ON1 A;  1CK2 A;  1ZWZ A;  3J7A R;  1SDS A;  3CCS F;  2AIF A;  2QA4 F;  2BO1 A;  1Q82 H;  1DT9 A;  1QVF F;  3CD6 F;  4X3M A;  2KTU A;  1T0K B;  3WXM B;  2QEX F;  1NMU B;  1GZ0 A;  4C4W C;  3VMF B;  1RA4 A;  3CCR F;  3CCL F;  3GYQ A;  3CME F;  3E1Y A;  3LFO A;  3G71 F;  3I56 F;  3NVI B;  3LWP C;  3SIU A;  1M90 H;  2LBX A;  3CC4 F;  2WAL A;  3OW2 F;  3J80 M;  4TZZ A;  4LCK A;  3RA5 A;  3LWQ C;  3OBW A;  1YJN F;  1VQ8 F;  3NVK E;  1VQO F;  3PLA C;  3CCU F;  1S72 F;  3CG6 A;  3N4Y A;  3V7E A;  1K9M H;  3HAX D;  1VQ4 F;  3RA6 A;  2JNB A;  3CCE F;  1VQL F;  3E20 B;  3CCJ F;  1YIJ F;  3G6E F;  3NMU C;  3MCA B;  1X7O A;  1VQP F;  1Q86 H;  1VQN F;  2KG4 A;  1Q81 H;  4BW0 B;  5IT9 M;  1M1K H;  3G4S F;  5GIP C;  1NJI H;  2OHW A;  1VQ7 F;  1VQM F;  3CXC F;  2LBW A;  3HJW C;  2ALE A;  1XBI A;  1VQ5 F;  1K73 H;  3FFM A;  3CPQ A;  1E7K A;  1KD1 H;  2VGN A;  3CCQ F;  1YI2 F;  1H7M A;  3AGK A;  1W42 A;  1JJ2 F;  1QVG F;  3CC2 F;  3NK6 A;  3CCV F;  1IPA A;  2FC3 A;  2KTV A;  5GAN K;  3NK7 A;  3CCM F;  5DCV A;  3CC7 F;  2CZW A;  4X3L A;  1VQK F;  1VQ6 F;  1YIT F;  3PAF A;  5G4V C;  1W3E X;  4BY9 D;  3N4Z A;  1YJ9 F; 
#chains in the Genus database with same CATH topology
 5FLX M;  1KC8 H;  4O2B B;  4O4I B;  3IEQ A;  5EO3 A;  3JAM M;  3IKF A;  3LWO C;  5B8F A;  3TD4 A;  3MDO A;  2I6D A;  3IR9 A;  1YGY A;  2VXY A;  1K8A H;  4WBN B;  3JAS B;  2MQE A;  2ZAU A;  5ITZ B;  2OTJ F;  2CW4 A;  4X20 B;  1RQ7 A;  1X52 A;  4I50 B;  3JAK A;  2OTL F;  5CB4 B;  1N8R H;  2OZB A;  3CMA F;  3LWR C;  3MBM A;  1XRG A;  2ZVZ A;  3U0O A;  3E22 A;  1PXW A;  2QI2 A;  1VQ9 F;  1NQ3 A;  3P0Z A;  4I4T A;  5HP8 A;  2OTM A;  4YJ2 A;  3I55 F;  3KHN A;  4O4L B;  3LWV C;  5C8Y A;  1QAH A;  5JQG A;  1X7P A;  4TV8 B;  2Z1F A;  2UYN B;  3CCS F;  4DRX B;  2ZVY A;  2BO1 A;  3R0P A;  1DT9 A;  4NWO B;  3S0W A;  2KTU A;  3D00 A;  3WXM B;  2QEX F;  4BT5 A;  2NMU A;  3HTN A;  3M84 A;  1GZ0 A;  1FNJ A;  4TV9 B;  2BTO A;  2ZOD A;  1IV4 A;  3I7T A;  2HS4 A;  3CME F;  3F6M A;  2ZOV A;  3G71 F;  3BYQ A;  1T0A A;  4M8I A;  2HRU A;  2HP3 A;  5EYP B;  3ZO8 A;  1H47 A;  3RA5 A;  3GHZ A;  1SA0 A;  3HKD A;  4G88 A;  4ZHY B;  3VCZ A;  1YJN F;  5LP6 B;  1S72 F;  3JAR A;  2JNB A;  3CCE F;  4BT7 A;  5IJ9 B;  3CCJ F;  4ERH A;  3JVH A;  2DYY A;  3NMU C;  1UFY A;  3WGJ A;  1Z5V A;  1VQP F;  5J2U A;  4ZI7 B;  1VQN F;  3JAW B;  4X1Y B;  3IEW A;  1VQM F;  2HP0 B;  4ZK7 A;  5EIB C;  3K12 A;  4IIJ B;  3RYF B;  1VQ5 F;  1TVK A;  3FFM A;  1E7K A;  4BT3 A;  5HY2 A;  1KD1 H;  5AVM A;  5LYJ A;  3HKC A;  3CCQ F;  1FFX A;  3AGK A;  5IJ0 A;  5EZY A;  1Z5W A;  3NK6 A;  1IPA A;  2FC3 A;  5DCV A;  1JY8 A;  2CZW A;  3HKB A;  1YIT F;  1QU9 A;  5MN6 A;  5CA1 A;  3WPX A;  1YJ9 F;  1UI9 A;  1RLU A;  3WGL A;  3ERN A;  3ZOP A;  2HS3 A;  4FFB A;  3FBA A;  2VGM A;  4G4Z A;  2F9Z C;  4BT6 A;  4X1I B;  1W59 A;  2GLZ A;  3VTI C;  2R75 1;  3FPI A;  5BMV B;  5IYZ B;  1JFF A;  3O85 A;  3RYH A;  3N2K A;  3V7Q A;  1YJW F;  5EB1 B;  2VAW A;  2RHO A;  5LA6 A;  4TUY A;  5JH7 A;  3GTZ A;  2YYE A;  1X25 A;  3T80 A;  5GAP K;  1PF5 A;  1KQS F;  4O2B A;  1GO1 A;  3HKE A;  3RYC A;  3S03 A;  3F0F A;  1W41 A;  1W57 A;  5LXT B;  3F0E A;  1W2B F;  1W55 A;  1FNK A;  3JAT A;  2IQQ A;  1OAP A;  3EOR A;  3ON1 A;  4ZHQ B;  3QHD A;  5ITZ A;  2AIF A;  1Q82 H;  4X1K B;  3N2G B;  1QVF F;  5CB4 A;  2CWJ A;  1NMU B;  4EB6 B;  2AMT A;  2V9Y A;  3S02 A;  3CCR F;  3CCL F;  3GYQ A;  3LFO A;  3Q8H A;  4I55 B;  3I56 F;  4F6R A;  2N48 A;  3NVI B;  5FNV B;  1KNJ A;  2KGW A;  3SIU A;  3CC4 F;  1JD1 A;  2I6R A;  3S06 A;  2H8E A;  1TUB A;  5J2T B;  3LWQ C;  3I3F A;  1IV2 A;  3OBW A;  3FD5 A;  3V7E A;  3DDN A;  1K9M H;  3K0T A;  4R40 B;  1VQL F;  1OFU A;  5KX5 A;  4C8I A;  2G9I A;  3LME A;  3G6E F;  1DBF A;  4U3J A;  3JAK B;  5KMG A;  1U40 A;  4RQO A;  1ONI A;  3VYT C;  5IT9 M;  2CVL A;  5GIP C;  1XV2 A;  2OHW A;  3E22 B;  1VK3 A;  5EYP A;  4I4T B;  3K2X A;  2H6L A;  4YJ2 B;  4G4X A;  5LOV A;  1XHO A;  5C8Y B;  1K73 H;  3V3T A;  2VGN A;  3M1X A;  4YJ3 A;  1VHA A;  1H7M A;  2AIZ P;  2IAF A;  1YI2 F;  1W42 A;  1JJ2 F;  2BTQ B;  3CC2 F;  1W5E A;  4B5C A;  3CCV F;  3F0D A;  3RYI A;  2KTV A;  4C81 A;  3CCM F;  2PMP A;  3JAW A;  3NK7 A;  3ELC A;  2HRY A;  2FGY A;  3PAF A;  2IG8 A;  4X1Y A;  4XCQ A;  5HY1 A;  4BY9 D;  2HP0 A;  3QUW A;  4NQ3 A;  2Z1T A;  2CSL A;  2W8B C;  4O4J B;  1RLG A;  5GIN C;  2VAP A;  3JAL A;  2RHL A;  3OON A;  2BTU A;  3P10 A;  5EWR A;  3V4D A;  4C8G A;  4C8E A;  3OBY A;  1KNK A;  1H48 A;  1SA0 B;  2PHN A;  3HKD B;  5GON B;  4B62 A;  4O2A A;  1W5F A;  2HQS C;  3JCM M;  3F0G A;  3CPW F;  1CN7 A;  4O4H A;  2LBT A;  1YQN A;  3UT5 A;  5GIO C;  3DC2 A;  3C9T A;  5J2U B;  2DT4 A;  4NUT A;  3C9R A;  2EWC A;  3FD6 A;  5JVD A;  2Z1E A;  5G4U C;  4ZHW A;  1COM A;  5BMV A;  2HVY D;  2UZH A;  3ZP7 A;  1CK2 A;  1ZWZ A;  3C9U A;  3J7A R;  1SDS A;  4IHJ A;  5HWE A;  1W58 1;  1TVK B;  2RHJ A;  3S0Y A;  4HNA A;  4X3M A;  3CD6 F;  4LNU A;  3B6N A;  3HKC B;  1FFX B;  5IJ0 B;  1W5A A;  5EZY B;  2GZL A;  1RA4 A;  4O4I A;  3LYB A;  2R6R 1;  2UYK A;  4ZOL B;  2Q1Y A;  5CA0 B;  5CA1 B;  1RQ2 A;  3LWP C;  1M90 H;  2LBX A;  2WAL A;  4G4Y A;  3OW2 F;  4FFB B;  5HXZ A;  4WBN A;  3JAS A;  3WJP A;  2B33 A;  1R1M A;  1VQ8 F;  3NVK E;  1VQO F;  4X20 A;  3PLA C;  1ODE A;  3CG6 A;  1JFF B;  2CHT A;  4I50 A;  3TD3 A;  1Q8R A;  3N2K B;  3RA6 A;  4BT2 A;  5HP7 A;  1YIJ F;  3MCA B;  3WPW A;  3M4S A;  4TUY B;  4BVQ A;  1X7O A;  5JH7 B;  5JCO A;  4BW0 B;  3VOB A;  3L7Q A;  1IV3 A;  3G4S F;  3HKE B;  4O4L A;  3RYC B;  2UYP A;  5J2T A;  3P4E A;  2LBW A;  4TV8 A;  1J7H A;  5EAZ A;  2ALE A;  3HWU A;  2UYN A;  4DRX A;  3JAT B;  3CPQ A;  4PWT A;  2H8C A;  2L26 A;  4BVS A;  3VYS C;  1QVG F;  4TV9 A;  4U39 A;  3ZP4 A;  5MN5 A;  5GAN K;  3CC7 F;  1VQ6 F;  2CHS A;  2ZF8 A;  4B46 A;  1FSZ A;  2Q1X A;  1Q7Y H;  3KJK A;  3SIV A;  3C8L A;  4F6R B;  4BT4 A;  5FJ4 C;  3KJJ A;  2LCA A;  5LP6 A;  4ZHV A;  3S0H A;  1JN1 A;  5HXU A;  1QD9 A;  5A2Q M;  1TUB B;  3WGM A;  5JQG B;  3MQW A;  2K1S A;  3CYQ A;  3VI6 A;  1YHQ F;  5IJ9 A;  5HY0 A;  5JCO C;  2HS0 A;  4ZI7 A;  5KX5 B;  4EI8 A;  2GVI A;  3D01 A;  2RHH A;  1W40 A;  4U3J B;  1GO0 A;  2Z1U A;  5KMG B;  3J81 M;  4O4J A;  3WJQ A;  2QTP A;  4IIJ A;  3RYF A;  2P6Y A;  5EB0 A;  3TD5 A;  4EI7 A;  5GON A;  3RE3 A;  5LOV B;  2QA4 F;  3K14 A;  4RHA A;  1U3L A;  1T0K B;  4E6E A;  4YJ3 B;  3WGN A;  3CYP B;  3JAR B;  3MCQ A;  3RYI B;  4C4W C;  3VMF B;  3VIU A;  3E1Y A;  3QTY A;  3WJR A;  5LP6 C;  4X1I A;  1CLI A;  1SZQ A;  1U3P A;  2VAM A;  3KIZ A;  5IYZ A;  3J80 M;  4TZZ A;  4LCK A;  3VO8 A;  4DXD A;  3JAL B;  3CCU F;  3D54 A;  3N4Y A;  4KWE A;  3HAX D;  1VQ4 F;  1VH8 A;  3WGK A;  2UYJ A;  3E20 B;  5EIB D;  5LYJ B;  4O2A B;  3IMP A;  4G4W A;  3CB2 A;  1W5B A;  4BVT A;  1Q86 H;  4ZOL A;  5CA0 A;  3LDT A;  4C82 A;  2KG4 A;  4O4H B;  5LXT A;  1Q81 H;  1M1K H;  3HKB B;  3UT5 B;  1U43 A;  1NJI H;  1VQ7 F;  3CXC F;  4BVR A;  5JVD B;  4ZHQ A;  3HJW C;  3KE1 A;  2YXZ A;  1XBI A;  5HY4 A;  3VOA A;  4X1K A;  3N2G A;  5MN4 A;  3ESJ A;  2Z01 A;  4B45 A;  2HX0 A;  4IHJ B;  3IKE A;  3RYH B;  1IV1 A;  4HNA B;  4EB6 A;  4EI9 A;  1VQV A;  4LNU B;  4X3L A;  4G4V A;  1VQK F;  3VYU C;  2RB9 A;  5LA6 B;  5G4V C;  1W3E X;  3N4Z A;  4I55 A;  3C9S A;  5FNV A;  1GX1 A; 
#chains in the Genus database with same CATH homology
 5FLX M;  1KC8 H;  4NQ3 A;  1Q7Y H;  5EO3 A;  3JAM M;  3SIV A;  2VGM A;  2F9Z C;  1RLG A;  3LWO C;  5FJ4 C;  5GIN C;  2I6D A;  3IR9 A;  5EWR A;  2GLZ A;  5HXU A;  5A2Q M;  1K8A H;  3O85 A;  3OBY A;  3VI6 A;  3V7Q A;  1YHQ F;  2OTJ F;  1YJW F;  5HY0 A;  1X52 A;  2OTL F;  1N8R H;  3JCM M;  2OZB A;  3CPW F;  3CMA F;  3LWR C;  4EI8 A;  5GAP K;  1CN7 A;  1KQS F;  1W40 A;  5GIO C;  1GO0 A;  1GO1 A;  3J81 M;  2QI2 A;  1PXW A;  1W41 A;  1VQ9 F;  4NUT A;  5G4U C;  3I55 F;  1W2B F;  2HVY D;  3LWV C;  1X7P A;  3ON1 A;  4EI7 A;  1CK2 A;  1ZWZ A;  3J7A R;  1SDS A;  3CCS F;  5HWE A;  2AIF A;  2QA4 F;  2BO1 A;  1Q82 H;  1DT9 A;  1QVF F;  3CD6 F;  4X3M A;  2KTU A;  1T0K B;  3D00 A;  3WXM B;  2QEX F;  1NMU B;  1GZ0 A;  4C4W C;  3VMF B;  1RA4 A;  3CCR F;  3CCL F;  3GYQ A;  3CME F;  3E1Y A;  3LFO A;  3G71 F;  3I56 F;  3NVI B;  3LWP C;  3SIU A;  1M90 H;  2LBX A;  3CC4 F;  2WAL A;  3OW2 F;  5HXZ A;  3J80 M;  4TZZ A;  3RA5 A;  4LCK A;  3LWQ C;  3OBW A;  1YJN F;  1VQ8 F;  3NVK E;  1VQO F;  3PLA C;  3CCU F;  1S72 F;  3CG6 A;  3N4Y A;  3V7E A;  1K9M H;  3HAX D;  1VQ4 F;  3RA6 A;  2JNB A;  3CCE F;  1VQL F;  3E20 B;  3CCJ F;  1YIJ F;  3G6E F;  3NMU C;  3MCA B;  4BVQ A;  1X7O A;  4BVT A;  1VQP F;  1Q86 H;  1VQN F;  2KG4 A;  1Q81 H;  4BW0 B;  5IT9 M;  1M1K H;  3G4S F;  5GIP C;  1NJI H;  2OHW A;  1VQ7 F;  1VQM F;  3CXC F;  4BVR A;  2LBW A;  3HJW C;  2ALE A;  1XBI A;  1VQ5 F;  5HY4 A;  3FFM A;  3CPQ A;  1K73 H;  1E7K A;  3V3T A;  5HY2 A;  1KD1 H;  2VGN A;  3CCQ F;  1YI2 F;  1H7M A;  3AGK A;  4BVS A;  1W42 A;  1JJ2 F;  1QVG F;  3CC2 F;  3NK6 A;  3CCV F;  4EI9 A;  1IPA A;  2FC3 A;  2KTV A;  5GAN K;  3NK7 A;  3CCM F;  5DCV A;  3CC7 F;  2CZW A;  4X3L A;  1VQK F;  1VQ6 F;  2FGY A;  1YIT F;  3PAF A;  4XCQ A;  5G4V C;  1W3E X;  5HY1 A;  4BY9 D;  3N4Z A;  1YJ9 F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...