3OW2N

Crystal structure of enhanced macrolide bound to 50s ribosomal subunit
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
115
structure length
115
Chain Sequence
b'SKTNPRLSSLIADLKSAARSSGGAVWGDVAERLEKPRRTHAEVNLGRIERYAQEDETVVVPGKVLGSGVLQKDVTVAAVDFSGTAETKIDQVGEAVSLEQAIENNPEGSHVRVIR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S RIBOSOMAL RNA
molecule tags Ribosome
total genus 34
structure length 115
sequence length 115
ec nomenclature
pdb deposition date 2010-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
N PF00828 Ribosomal_L27A Ribosomal proteins 50S-L15, 50S-L18e, 60S-L27A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.100.10.10 Alpha Beta Ribosomal Protein L15; Chain: K; domain 2 Ribosomal Protein L15; Chain: K; domain 2 Ribosomal Protein L15; Chain: K; domain 2 3ow2N00
1YHQL 1NJIM 3CC7L 2QA4O 1S72L 1Q81P 3CCJO 3CC2O 1W2BN 3CCJL 3OW2K 3CMEL 3G71O 1YJ9O 3G71L 1QVFK 3CCSO 1K73P 3CCSL 3I56O 1KC8M 3CXCN 1M90P 2QEXO 1N8RP 1Q86M 1Q81M 3CCRO 1YJNL 1VQ6O 1VQKO 3I55L 1VQPO 2QA4L 3CCLO 3CC2L 1VQNO 1Q82M 1K73M 1VQ7O 3G4SO 1VQ7L 1M90M 1YJ9L 1JJ2K 1K9MP 3CPWN 1KQSN 3CCMO 1W2BK 1N8RM 3I56L 1VQOO 1VQ8O 2QEXL 3CCVO 1VQ8L 3CCVL 3CMAO 1VQ5O 1QVGN 1VQMO 1VQML 3CCRL 1VQ6L 1KD1P 1VQKL 3CXCK 2OTJO 1VQPL 3CD6O 3CCLL 1YITO 1YI2O 1VQNL 3CD6L 1YITL 1VQLO 3CC4O 3CCUO 3G4SL 3CC4L 3CCEO 3CCUL 1YJWO 1Q7YP 3OW2N 1KC8P 3CCML 1VQ9O 3CCQO 1VQOL 2OTLO 1YHQO 3CC7O 1KD1M 1QVFN 1S72O 2OTLL 1Q86P 3CMAL 1VQ5L 1M1KP 3CPWK 1K8AP 1KQSK 3CMEO 1NJIP 3G6EO 3G6EL 2OTJL 1YIJO 1Q82P 1K9MM 1YIJL 1QVGK 1YI2L 1VQ4O 1Q7YM 1VQLL 1VQ4L 3CCEL 1YJWL 1YJNO 1M1KM 1VQ9L 1K8AM 3CCQL 1JJ2N 3I55O
chains in the Genus database with same CATH superfamily
1YHQL 1NJIM 3CC7L 2QA4O 1S72L 1Q81P 3CCJO 3CC2O 1W2BN 3CCJL 5DLJA 3OW2K 3CMEL 3G71O 1YJ9O 3G71L 1QVFK 5DQZA 3CCSO 1K73P 5DS4A 4P6IC 3CCSL 3I56O 1KC8M 3CXCN 1M90P 2QEXO 5DS6A 1N8RP 1Q86M 1Q81M 3CCRO 1YJNL 1VQ6O 2YZSA 1VQKO 3I55L 1VQPO 2QA4L 3CCLO 3CC2L 1VQNO 1Q82M 4QDLA 1VQ7O 1K73M 3G4SO 1VQ7L 1M90M 1YJ9L 1JJ2K 1K9MP 3CPWN 1KQSN 3CCMO 1W2BK 1N8RM 3I56L 1VQOO 1VQ8O 4WJ0A 2QEXL 3CCVO 1VQ8L 3CCVL 3CMAO 1VQ5O 1QVGN 1VQMO 1VQML 4N06A 3CCRL 1VQ6L 1KD1P 1VQKL 3CXCK 2OTJO 1VQPL 4XTKA 3CD6O 3CCLL 1YITO 1YI2O 1VQNL 3CD6L 1YITL 4W8KA 1VQLO 3CC4O 3CCUO 3G4SL 3CC4L 3CCEO 3CCUL 1YJWO 5DS5A 1Q7YP 3OW2N 1KC8P 3CCML 1VQ9O 3CCQO 1VQOL 5DQTA 2OTLO 1YHQO 3CC7O 1KD1M 1QVFN 1S72O 2OTLL 1Q86P 5FCLA 3CMAL 1VQ5L 1M1KP 3CPWK 1K8AP 1KQSK 3CMEO 1NJIP 3NKDA 3G6EO 3G6EL 2OTJL 1YIJO 1Q82P 1K9MM 1YIJL 1QVGK 1YI2L 1VQ4O 1Q7YM 1VQLL 1VQ4L 3GODA 3CCEL 1YJWL 1YJNO 1M1KM 1VQ9L 1K8AM 3CCQL 1JJ2N 3I55O
chains in the Genus database with same CATH topology
1YHQL 1NJIM 3CC7L 2QA4O 1S72L 1Q81P 3CCJO 3CC2O 1W2BN 3CCJL 5DLJA 3OW2K 3CMEL 3G71O 1YJ9O 3G71L 1QVFK 5DQZA 3CCSO 1K73P 5DS4A 4P6IC 3CCSL 3I56O 1KC8M 3CXCN 1M90P 2QEXO 5DS6A 1N8RP 1Q86M 1Q81M 3CCRO 1YJNL 1VQ6O 2YZSA 1VQKO 3I55L 1VQPO 2QA4L 3CCLO 3CC2L 1VQNO 1Q82M 4QDLA 1VQ7O 1K73M 3G4SO 1VQ7L 1M90M 1YJ9L 1JJ2K 1K9MP 3CPWN 1KQSN 3CCMO 1W2BK 1N8RM 3I56L 1VQOO 1VQ8O 4WJ0A 2QEXL 3CCVO 1VQ8L 3CCVL 3CMAO 1VQ5O 1QVGN 1VQMO 1VQML 4N06A 3CCRL 1VQ6L 1KD1P 1VQKL 3CXCK 2OTJO 1VQPL 4XTKA 3CD6O 3CCLL 1YITO 1YI2O 1VQNL 3CD6L 1YITL 4W8KA 1VQLO 3CC4O 3CCUO 3G4SL 3CC4L 3CCEO 3CCUL 1YJWO 5DS5A 1Q7YP 3OW2N 1KC8P 3CCML 1VQ9O 3CCQO 1VQOL 5DQTA 2OTLO 1YHQO 3CC7O 1KD1M 1QVFN 1S72O 2OTLL 1Q86P 5FCLA 3CMAL 1VQ5L 1M1KP 3CPWK 1K8AP 1KQSK 3CMEO 1NJIP 3NKDA 3G6EO 3G6EL 2OTJL 1YIJO 1Q82P 1K9MM 1YIJL 1QVGK 1YI2L 1VQ4O 1Q7YM 1VQLL 1VQ4L 3GODA 3CCEL 1YJWL 1YJNO 1M1KM 1VQ9L 1K8AM 3CCQL 1JJ2N 3I55O
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YHQ L;  1NJI M;  3CC7 L;  2QA4 O;  1S72 L;  1Q81 P;  3CCJ O;  3CC2 O;  1W2B N;  3CCJ L;  3OW2 K;  3CME L;  3G71 O;  1YJ9 O;  3G71 L;  1QVF K;  3CCS O;  1K73 P;  3CCS L;  3I56 O;  1KC8 M;  3CXC N;  1M90 P;  2QEX O;  1N8R P;  1Q86 M;  1Q81 M;  3CCR O;  1YJN L;  1VQ6 O;  1VQK O;  3I55 L;  1VQP O;  2QA4 L;  3CCL O;  3CC2 L;  1VQN O;  1Q82 M;  1K73 M;  1VQ7 O;  3G4S O;  1VQ7 L;  1M90 M;  1YJ9 L;  1JJ2 K;  1K9M P;  3CPW N;  1KQS N;  3CCM O;  1W2B K;  1N8R M;  3I56 L;  1VQO O;  1VQ8 O;  2QEX L;  3CCV O;  1VQ8 L;  3CCV L;  3CMA O;  1VQ5 O;  1QVG N;  1VQM O;  1VQM L;  3CCR L;  1VQ6 L;  1KD1 P;  1VQK L;  3CXC K;  2OTJ O;  1VQP L;  3CD6 O;  3CCL L;  1YIT O;  1YI2 O;  1VQN L;  3CD6 L;  1YIT L;  1VQL O;  3CC4 O;  3CCU O;  3G4S L;  3CC4 L;  3CCE O;  3CCU L;  1YJW O;  1Q7Y P;  3OW2 N;  1KC8 P;  3CCM L;  1VQ9 O;  3CCQ O;  1VQO L;  2OTL O;  1YHQ O;  3CC7 O;  1KD1 M;  1QVF N;  1S72 O;  2OTL L;  1Q86 P;  3CMA L;  1VQ5 L;  1M1K P;  3CPW K;  1K8A P;  1KQS K;  3CME O;  1NJI P;  3G6E O;  3G6E L;  2OTJ L;  1YIJ O;  1Q82 P;  1K9M M;  1YIJ L;  1QVG K;  1YI2 L;  1VQ4 O;  1Q7Y M;  1VQL L;  1VQ4 L;  3CCE L;  1YJW L;  1YJN O;  1M1K M;  1VQ9 L;  1K8A M;  3CCQ L;  1JJ2 N;  3I55 O; 
#chains in the Genus database with same CATH topology
 1YHQ L;  1NJI M;  3CC7 L;  2QA4 O;  1S72 L;  1Q81 P;  3CCJ O;  3CC2 O;  1W2B N;  3CCJ L;  5DLJ A;  3OW2 K;  3CME L;  3G71 O;  1YJ9 O;  3G71 L;  1QVF K;  5DQZ A;  3CCS O;  1K73 P;  5DS4 A;  4P6I C;  3CCS L;  3I56 O;  1KC8 M;  3CXC N;  1M90 P;  2QEX O;  5DS6 A;  1N8R P;  1Q86 M;  1Q81 M;  3CCR O;  1YJN L;  1VQ6 O;  2YZS A;  1VQK O;  3I55 L;  1VQP O;  2QA4 L;  3CCL O;  3CC2 L;  1VQN O;  1Q82 M;  4QDL A;  1VQ7 O;  1K73 M;  3G4S O;  1VQ7 L;  1M90 M;  1YJ9 L;  1JJ2 K;  1K9M P;  3CPW N;  1KQS N;  3CCM O;  1W2B K;  1N8R M;  3I56 L;  1VQO O;  1VQ8 O;  4WJ0 A;  2QEX L;  3CCV O;  1VQ8 L;  3CCV L;  3CMA O;  1VQ5 O;  1QVG N;  1VQM O;  1VQM L;  4N06 A;  3CCR L;  1VQ6 L;  1KD1 P;  1VQK L;  3CXC K;  2OTJ O;  1VQP L;  4XTK A;  3CD6 O;  3CCL L;  1YIT O;  1YI2 O;  1VQN L;  3CD6 L;  1YIT L;  4W8K A;  1VQL O;  3CC4 O;  3CCU O;  3G4S L;  3CC4 L;  3CCE O;  3CCU L;  1YJW O;  5DS5 A;  1Q7Y P;  3OW2 N;  1KC8 P;  3CCM L;  1VQ9 O;  3CCQ O;  1VQO L;  5DQT A;  2OTL O;  1YHQ O;  3CC7 O;  1KD1 M;  1QVF N;  1S72 O;  2OTL L;  1Q86 P;  5FCL A;  3CMA L;  1VQ5 L;  1M1K P;  3CPW K;  1K8A P;  1KQS K;  3CME O;  1NJI P;  3NKD A;  3G6E O;  3G6E L;  2OTJ L;  1YIJ O;  1Q82 P;  1K9M M;  1YIJ L;  1QVG K;  1YI2 L;  1VQ4 O;  1Q7Y M;  1VQL L;  1VQ4 L;  3GOD A;  3CCE L;  1YJW L;  1YJN O;  1M1K M;  1VQ9 L;  1K8A M;  3CCQ L;  1JJ2 N;  3I55 O; 
#chains in the Genus database with same CATH homology
 1YHQ L;  1NJI M;  3CC7 L;  2QA4 O;  1S72 L;  1Q81 P;  3CCJ O;  3CC2 O;  1W2B N;  3CCJ L;  5DLJ A;  3OW2 K;  3CME L;  3G71 O;  1YJ9 O;  3G71 L;  1QVF K;  5DQZ A;  3CCS O;  1K73 P;  5DS4 A;  4P6I C;  3CCS L;  3I56 O;  1KC8 M;  3CXC N;  1M90 P;  2QEX O;  5DS6 A;  1N8R P;  1Q86 M;  1Q81 M;  3CCR O;  1YJN L;  1VQ6 O;  2YZS A;  1VQK O;  3I55 L;  1VQP O;  2QA4 L;  3CCL O;  3CC2 L;  1VQN O;  1Q82 M;  4QDL A;  1VQ7 O;  1K73 M;  3G4S O;  1VQ7 L;  1M90 M;  1YJ9 L;  1JJ2 K;  1K9M P;  3CPW N;  1KQS N;  3CCM O;  1W2B K;  1N8R M;  3I56 L;  1VQO O;  1VQ8 O;  4WJ0 A;  2QEX L;  3CCV O;  1VQ8 L;  3CCV L;  3CMA O;  1VQ5 O;  1QVG N;  1VQM O;  1VQM L;  4N06 A;  3CCR L;  1VQ6 L;  1KD1 P;  1VQK L;  3CXC K;  2OTJ O;  1VQP L;  4XTK A;  3CD6 O;  3CCL L;  1YIT O;  1YI2 O;  1VQN L;  3CD6 L;  1YIT L;  4W8K A;  1VQL O;  3CC4 O;  3CCU O;  3G4S L;  3CC4 L;  3CCE O;  3CCU L;  1YJW O;  5DS5 A;  1Q7Y P;  3OW2 N;  1KC8 P;  3CCM L;  1VQ9 O;  3CCQ O;  1VQO L;  5DQT A;  2OTL O;  1YHQ O;  3CC7 O;  1KD1 M;  1QVF N;  1S72 O;  2OTL L;  1Q86 P;  5FCL A;  3CMA L;  1VQ5 L;  1M1K P;  3CPW K;  1K8A P;  1KQS K;  3CME O;  1NJI P;  3NKD A;  3G6E O;  3G6E L;  2OTJ L;  1YIJ O;  1Q82 P;  1K9M M;  1YIJ L;  1QVG K;  1YI2 L;  1VQ4 O;  1Q7Y M;  1VQL L;  1VQ4 L;  3GOD A;  3CCE L;  1YJW L;  1YJN O;  1M1K M;  1VQ9 L;  1K8A M;  3CCQ L;  1JJ2 N;  3I55 O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...