3OW2R

Crystal structure of enhanced macrolide bound to 50s ribosomal subunit
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
81
structure length
81
Chain Sequence
b'SWDVIKHPHVTEKAMNDMDFQNKLQFAVDDRASKGEVADAVEEQYDVTVEQVNTQNTMDGEKKAVVRLSEDDDAQEVASRI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S RIBOSOMAL RNA
molecule tags Ribosome
total genus 20
structure length 81
sequence length 81
ec nomenclature
pdb deposition date 2010-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
R PF00276 Ribosomal_L23 Ribosomal protein L23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3ow2R00
3HHNB 1WF2A 1QM9A 2MY8A 3SDEB 3BO2A 3NMRA 1BY9A 2M52A 3UWTA 2XS2A 2MJNA 3DXBA 4W92B 1NU4A 4M5DB 4EGLA 3LPYA 3CCRS 1IQTA 1URNA 1W2BR 2MKIA 4CIOA 3NNCA 4CH1A 1A9NB 2MXYA 2CPJA 3I55S 3ZZYA 1VQ4S 2LMIA 2MMYA 2QFJA 1SJFA 2CPFA 4WKRA 3S6EA 1X5TA 4Z2XA 5DDOC 4YUDA 2KG0A 4QQBA 1OO0B 3J7ZT 1R8PA 5CYJA 3CC2S 1YHQS 5LJ3Y 1D8ZA 5LSLA 1RK8A 4TLQA 2KG1A 4PKDB 2XS7A 1M5PC 2CQDA 4A8XA 1FXLA 1KOOA 2E5JA 2XSFA 2RRAA 2XB2D 3MUTP 1N52B 2MZTA 1U1QA 2VOPA 1WEXA 2SXLA 3IRWP 2JRSA 2CPZA 4WCEQ 1YIJS 4WIIA 1CVJA 1A7GE 1HA1A 2DISA 1FO1A 1YTYA 5LSOA 3CCMS 2N82B 3VAGA 2D3OR 2NZ4A 2N3LA 1VQPS 5D78A 1RKJA 2AYBA 5DM6Q 2M70A 4WFNQ 3G4SS 3CCJS 4IUFA 3BEGB 2M8HA 1PGZA 1P1TA 2HYIB 1QVGR 2YWKA 2CQCA 3U1LA 5IQQA 1VQOS 3VAIA 3H2VE 2M88A 2ADBA 1WEZA 3S8SA 1YI2S 3NS6A 4ERDA 1G2EA 5EN1A 4FXVA 3Q2SC 3Q2TC 4OZ0A 2RS2A 1HD0A 5GADU 2XNRA 2L9WA 2KFYA 2YH1A 3BS9A 3RW6A 1M5KC 1P27B 4C4WA 1KC8T 2RS8A 2HVZA 1N88A 2MQOA 2K8GA 4BS2A 2BOPA 2D9OA 2KT5A 2LEBA 3EX7B 5IM0A 4YB1P 1VQ6S 3R1LA 2OSRA 2XS5A 3P49B 2CQ1A 1M5OC 3S7RA 2O3DA 2PEHA 1X4EA 2DGTA 2DHGA 1VQNS 3B4MA 4Y00A 2GO9A 2DO0A 1WG5A 1VBXA 1VQLS 2MKHA 1UAWA 2DO4A 2MZRA 1N54B 2KYXA 3EGZA 2DGWA 1U2FA 3MUVP 1WELA 3G8SA 2CQGA 2DNRA 2RQ4A 2N7CA 2CQ0A 1WG1A 2DH9A 3I56S 2G4BA 1X0FA 4ED5A 2LA4A 3SMZA 1DBDA 4P6QA 2MKKA 2YKAA 2RU3A 2CQ2A 1SJ4P 2DNHA 1X4FA 3CULA 2DNGA 2M4MA 2U1AA 1L3KA 1VBZA 5IFMA 2RNEA 2DGXA 3CC7S 2B0GA 3LQVA 1F9FA 2MZQA 3SDEA 3UCUP 1K73T 5LXRA 1M1KT 2CPXA 4UY8T 2VODA 3P5TL 2F3JA 4Y0FA 1OWXA 3TP2A 5DETA 3CF5Q 3HI9A 4U67Q 2DH7A 2CQPA 2GHPA 2XNQA 3ZZZA 2ZJPQ 3CCQS 3VAMA 2DH8A 1H6KX 5LJ5Y 1Q81T 3CMES 2DGSA 4FXWA 1X5OA 1YWXA 1VC0A 3NNHA 2OIHA 2J0SD 2EK6A 4LIRA 5MLCV 3G8TA 2I2YA 3MOJB 3G96A 3BO4A 2UP1A 3G9CA 2DNLA 1S79A 3MD3A 3S01A 5GAGU 3CC4S 1VC5A 2RT3A 2CQIA 3MDFA 2KI2A 1U1OA 2MQMA 3V4MA 1U1RA 1OIAA 2HGNA 5D77A 2E44A 2CPDA 3CMAS 2DNPA 1PO6A 2LXUA 4PRFA 2PE8A 3THTA 1DRZA 4F26A 3CUNA 3EGNA 3VF0B 2KVIA 4PR6A 2I38A 1UFWA 5LXYA 3CCES 3VAHA 1Q82T 3FEYB 2DIVA 2G1DA 2EK1A 1WTBA 2L41A 1U1KA 2X1AA 2KRBA 2AYGA 2YH0A 2DNKA 1YJNS 1X4AA 2DNYA 2LA6A 2DNZA 2HGMA 3K0JA 2U2FA 2DGOA 3MUMP 2RQCA 2VOOA 1WEYA 2QA4S 1U6BA 2DHXA 1QVFR 3CPWR 3JB9k 2MQNA 5GAEU 2DGUA 1VBYA 1ZH5A 1DZ5A 1HD1A 2MGZB 2HZCA 2X1FA 1X4HA 2JVOA 5GVQA 1X4CA 1M5VC 4OZ1A 3B4DA 1SJQA 1JJHA 3CXCR 2FC8A 1VQ7S 3UD3P 4RU2A 1U1MA 3FEXB 3UD4P 3D2WA 2DNMA 3NS5A 3CCVS 4F02A 2CPIA 3P6YC 1X4DA 1VQ5S 2M8DB 1U1NA 2OTJS 2MB0B 3U1MA 1X4GA 2MKCA 1SJ3P 1WF0A 2E5HA 2MSTA 3VAFA 3VAKA 2CQ3A 1D9AA 1WHWA 2LEAA 3R1HA 5IM0B 4QU7A 2KXNB 2L08A 2QEXS 1Q86T 1UW4A 1FHTA 1KQSR 2HGLA 2AYEA 3PIPQ 2DGQA 2KM8B 3H2UB 1JJ2R 1SJRA 1N8RT 3DLLQ 4C0OC 2DB1A 1WI8A 2X1GA 4LJMA 2ADCA 2M7SA 2Q79A 2DIUA 2MYFA 1WG4A 3RW7A 3IWNC 2DGVA 1X5PA 2AD9A 2FHOB 5CXTA 5ITHA 1YJWS 4TU7A 2CQBA 3CTRA 4J5OA 2MHNA 2N3OA 1FNXH 2LCWA 1WHVA 2CPYA 1YITS 2FY1A 1WF1A 2J8AA 3G71S 2F9JA 2J76E 2MZJA 2MKJA 2FPHX 1M90T 1VC6A 1JJ4A 1VQKS 3BO3A 4ZKAA 4WF9Q 1AUDA 1U1PA 5GAHU 1H2TZ 2FC9A 2MQPA 1U1LA 2RUGA 2DNQA 2KXFA 2V94A 4TU8A 2BZ2A 5BJRA 2LXIA 2X1BA 3MD1A 3VAJA 2MY7A 3CCSS 2JWNA 2DITA 2CPEA 3PIOQ 1SXLA 1S72S 1U6FA 3N9UC 2MQQA 2KU7A 2G0CA 1NJIT 1FJ7A 1B7FA 4F25A 2MKSA 2CQ4A 2VONA 2ERRA 2DNOA 3OW2R 2RRBA 2MQLA 2KN4A 2JX2A 5H1SV 2MZ1A 3CCLS 2KM8C 2F9DA 2ZJQQ 2DHSA 3UE2A 1FJEB 2CQHA 1HL6A 2DHAA 2CPHA 1VQMS 2YTCA 2A3JA 1UP1A 3MXHP 1WWHA 2LECA 2JVRA 1DHMA 4WFBQ 5DM7Q 4LMZA 1XN9A 2M9KA 3L3CA 4CQ1A 5CA5A 3US5A 5DDPC 3VALA 5FJ4A 2E5IA 1X5SA 2WBRA 3TO8A 3CD6S 5JVGQ 2LQ5A 4QU6A 3MURP 2MGZA 4W90B 3UCZP 2MPUA 2ZJRQ 1K9MT 2MSSA 4UQTA 3ULHA 4WFAQ 2KRRA 2M0GB 2J0QD 1VQ9S 4CH0S 2M2BA 1NO8A 1O0PA 2OSQA 1FT8A 3UCGA 1ZZNA 1R8HA 1H2UX 5HO4A 2OJ3A 4TU9A 2MJUA 1KOHA 3J7YU 4V19X 2KXHA 3NNAA 2DK2A 2KH9A 1Q7YT 4IOAQ 1WI6A 5JVHQ 4C7QA 1JMTA 2MZSA 4YOEA 5HL7Q 2E5GA 4IOCQ 3MI7X 3R27A 2RVJA 1H2VZ 1WHXA 1OPIA 5DDRC 2DNNA 1K8AT 5GMKa 2EVZA 3P3DA 4IO9Q 2D9PA 3G6ES 2OTLS 3CCUS 1WHYA 2LYVA 2CJKA 3THPA 1FJCA 2NLWA 2LKZA 1VQ8S 3SXLA 1KD1T 1X4BA 2AYMA 5DDQC 2K3KA 1ZZFA 2KHCA 4QPTA 1YJ9S 3TYTA
chains in the Genus database with same CATH superfamily
2PEBA 2VDIA 3MM9A 3QBCA 2V67A 2MY8A 1K1QA 3HLUA 4LRBA 2MLYA 4W92B 1H74A 3GPAA 4XPEA 5D4OA 1ICEB 1B7YB 5DDOC 1QSSA 1OO0B 1OQ6A 3J7ZT 1OSCA 1XMBA 2HWIA 1SIZA 2JHEA 1LW0B 2NXUA 2HW3A 3PACA 4G1QA 3V4IA 1K44A 4DL3A 1D9FA 4PZVA 2UUCJ 4O3PA 3M2UB 3H40A 3KLVA 2NUUG 3HHLA 4QR2A 2N3LA 1U02A 1RI7A 2I0XA 3QRRA 3KLEB 1SIWB 1IKYA 1JQGA 2WONB 4WPAA 1VGYA 3PJXA 2WAQD 2HHQA 1R6YA 1N4LA 2UVRA 5AT1B 2UXDF 3Q2SC 1H3DA 3J7A1 4K4YA 3BS9A 4AT1B 1S4EA 2MLZA 3PCOB 1IBMJ 3R5BA 2L48A 1P8GA 2DPIA 1XMOJ 5IM0A 4ZVFA 1DARA 4ED7A 2BE2B 2OFGX 1SCJB 3TAMB 3MUVP 2DNRA 3OTDA 4Q45A 1X0FA 1NK8A 2R7UA 3DGPA 4DV6J 4TN2A 4KR0B 3MFIA 3TARA 2B9WA 1MN9A 5EUHA 5LT5A 4C8LA 2HAIA 4UUWA 2R7OA 3LQVA 3NAHA 1M1KT 2W9CB 3M2RB 2F63A 1YLXA 4C97A 4OYWA 3C66A 3CCQS 1EIYB 3HSDA 1Q81T 5ETLA 1WC6A 2YBVA 2EI5A 2Q43A 3H98A 2J0SD 5IT0A 4ZA1A 4BBYA 2K2PA 2W4DA 2R7TA 3D9BA 1LW0A 2HGNA 1Y11A 4HHUA 1T8EA 3AY0A 5L8RC 5L1JA 2V4QA 3CUNA 3VF0B 2KVIA 2ZM6F 2E1RA 3CW2C 1R0BG 2ASDA 2RB7A 4B9SA 2DNKA 3H5UA 1YJNS 1VJQA 2Y8YA 3VVUA 3NWRA 2B4PA 2VOOA 2AZ3A 1GK8A 4KAIA 4WE1B 2UUCF 1VBYA 2MGZB 3ETMA 2HZVA 2Y1RI 1VQ7S 4JV1A 4OJ1A 1LXJA 3GTYX 3NCQA 4ZPBA 2O01C 4JI3F 4RX6A 4QIEA 5CD4H 2OTJS 1C2PA 2X3GA 4S0MA 3VAKA 2CVEA 5D3GB 3A13A 1MWQA 2KXNB 1N36J 4NL5A 4QWEA 1KQSR 3NKYA 3M6XA 4DN9A 3HX9A 3QJJA 4B3SF 4P2MA 4F3OA 1ULRA 3D6HB 3F0NA 2DIUA 1EAYC 5F8MA 4NLRA 2AD9A 4KHMA 1R0CB 4KKOA 1LFWA 2JOQA 2MTLA 4USHA 2P9EA 2O5DA 3HD1A 4DV6F 3FBFA 3HJFA 2QYGA 4GVLA 1IBLF 4DUYF 2HHVA 2GAGC 2VIHA 2RJZA 2Y3YA 2LXIA 1GMWA 3MD1A 3CCSS 4M95A 3PX4A 1U7LA 2QA1A 1ZM2A 2VPXB 3FMBA 1FFSB 1NDLA 2V2ZA 4RW9B 2K7KA 4EUVA 4GKJJ 1RUSA 4N5SA 1SV5B 2CPHA 2DY1A 3GJQB 3AH6A 3RTVA 3DMJA 4NX9A 5T14A 4CNZA 3BJYA 1BWEA 2WBRA 1YZ7A 4RO0A 4K5SA 3MURP 2R4FA 2MGZA 3K5NA 2IDLA 1TL3A 3GG0A 5IOLA 4EU0A 2AGPA 4F3MA 4G3IA 3O6QA 3ZTSA 2VBWA 3BREA 1IJEB 1SQEA 3J7YU 3Q89A 1Q7YT 5KG1A 3M6VA 4NLTA 3T19A 1L3TA 1TKXB 4C11A 3NXZA 1IVZA 3EUNA 3KK2B 4IOCQ 3TJ9A 5ETOA 3ILJA 2HZAA 1RHJB 5BXIA 1NK6A 4IO9Q 2OTLS 4J90A 4DI6A 3IWXA 3CIZA 3NCRA 4OV6A 2K3KA 4WP3A 1QD1A 3FMWA 2B51A 3S1TA 4NZ6A 1ZAXA 3RBDA 3DRSA 5KT5A 3ZZYA 2W25A 1N48A 3LALA 1SJFA 2YNHB 3R7NB 4LF4J 2IAJB 2VICA 1ZM3A 2L9DA 4P73A 3D0GE 1FXLA 5F8NA 2WK4A 2YWFA 1WEXA 3IRWP 1YIJS 1HNWJ 3D4JA 1SV5A 1X0PA 1G1XA 2Z57B 3DYAA 2HBYB 2M8HA 4RLEA 3OHAA 2OEJA 2V63A 2RDIA 2YWKA 1CPZA 1RTJA 3RUBL 3PX0A 4F36A 1T02A 4RUHA 1S1WA 5L38A 5KFKA 2XYGB 4OZ0A 1H73A 1F1BB 2ZH2A 1M5KC 4C3KA 1K1SA 4HVZA 2D9OA 4YR2A 2YX7A 2KVQE 1TKXA 1RU2A 2L9NA 5CQGA 1FKPA 3D6TB 3TUIC 4KIAA 3DLEB 4RPFA 5DQIA 5ADZA 1NCLA 1WELA 1HI0P 3G8SA 1XMQF 2R42A 1DY3A 4DQRA 3SMZA 4CP5A 2MKKA 1WOOA 1HQEB 2YKQA 4CNYA 2XGQA 4M63A 2CPXA 1FDAA 4DR3F 5DETA 3CF5Q 4CLFA 2UU9F 3L09A 4F2RA 2VUGA 5KFZA 3CT9A 1B0TA 2B5JA 2NR0A 2YNHA 1AZSA 1YSJA 3M6WA 2A6OA 2IAJA 5GAGU 1EP4A 1VC5A 4U96A 4ZCLA 1MU2B 2CPDA 3IG1A 2PE8A 1BQXA 3WZ0A 3TUJC 4PR6A 1NPRA 3QYYA 1REVA 4C3MA 4HT5A 4I6WA 3I9ZA 5KFVA 3R2CJ 4WP9A 2RQCA 3CDWA 2KTQA 3RGIA 3BGLA 1F3FA 1QVFR 2YWGA 4I2PB 1DLOB 1NHVA 3UD3P 1IR0A 2BOAA 4KQZA 2ZOMA 2OD6A 1KSPA 4LF7F 1SL0A 3BPSP 2BANB 4UOGA 3LTOA 1WF0A 3KG0A 1JKHB 2IVYA 1U45A 2HHUA 3U1NA 4LF5F 1F5AA 1FEHA 3NEKA 1YJVA 3O2IA 3ELHA 1KKHA 2HFVA 4JV5J 4ZIVA 1NHKL 4ECXA 5SZTA 1RHUB 2W7AA 1N32J 4UF4A 4A8MP 2J76E 3WDOA 1S9GB 4NMXA 3EPIA 2FC9A 2YKNA 3ENAA 5DZ7A 1QAJA 2X1BA 3TNVA 4J9PA 1HNVB 2FTRA 1MU2A 5KG3A 2VPYB 2VB6A 3CCTA 4LFBF 2OGUA 4NLSA 5A2QY 4ED1A 3MMCA 3U02A 4Z37A 5KOWA 5KFMA 4BDPA 1GFWB 3O44A 1RTZA 4MFBB 4WBFA 5HMYA 2DHAA 3JTOA 3NAIA 2Z58B 4C8KA 4ILLA 3MXHP 1WTFA 2LECA 3I4HX 2ZD1B 4ECQA 3OD2A 4HTIA 4W90B 2OELA 3LP0B 2PT0A 1DLOA 4L73A 3G6YA 3PRDA 4JI5J 4WXOA 2E9ZA 3U7JA 4CYUA 1S6PB 4TU9A 3K59A 4V19X 5CH7B 4NLYA 1XIQA 4C7QA 4N76A 2F8EX 2EG2A 3M9NB 1RJJA 4ZLJA 4FYXB 3PW7A 3FEZA 2KFNA 2ZWPA 4JV0A 2LYVA 2XLJA 3NRBA 3MCOA 4JI6J 1X4BA 5DDQC 1C0UB 1C1BB 1UETA 2GJFA 2R2SA 3AT1B 2FYXA 3EGWB 5IC4B 3OLAA 4DZ6A 1KLMB 1RACB 4Q43A 4DUZJ 2CJ9A 2AHOB 3BF4A 2HFNA 4M5DB 3ENVA 3RYLA 1W2BR 2CXEA 5EWEA 4LR8A 4BLGA 2RHQB 1KNZA 2QE5A 3VZHA 4KRWA 3CC2S 2PI4A 3LP1A 4AXJA 4B9TA 3D3CJ 2CQDA 1RT3B 4LIWA 1JLFA 4EBDA 3MUTP 3C2PA 4RW8B 3R5JB 3P96A 5C7PA 3EYZA 2D3OR 4LREA 3IR6B 1LK7A 1VQPS 1LW2A 4X2BA 3BEGB 2QX0A 2ZD1A 1HNXF 4A8KA 4J9VA 1LK5A 3HCXA 3ZNUA 3D7SB 2AEJA 1VQOS 3TAQA 3LP0A 2LQJA 2ZE2B 4ERDA 1NAQA 4LBIA 1VIXA 2FLLA 4DCOB 1S6PA 3KXDA 1CC7A 1ZOTA 2CRLA 3GYGA 1T9UA 4I56A 4HYKA 2DXEA 2LU2A 3W64A 2QN6B 2DO4A 2EXUA 5MAOA 2RQ4A 2IVFB 3OQ2A 2KJVA 2RU3A 4Z7YA 4FYVB 2DNGA 4ILRA 2R7WA 4Q5VA 1VFJA 3O1LA 1FRMA 3BQ2A 1HMVB 5LXRA 2LLZA 1ZAVA 4P72A 3IMQJ 1ZM9A 3QGPA 2IYGA 1X9MA 1S57A 3DOKB 2ZH5A 3G86A 3A8IA 3M8PB 1VC0A 2HK2A 2OIHA 1SL1A 1S7HA 4NLQA 3KOAA 4DQIA 2UUBJ 4DG1A 3WIUA 4WTOB 2LXUA 2R9LA 3RAMA 3FUYA 4OV1A 4RW8A 1BWVA 4QJVA 2G1DA 2VHGA 3SV4A 4LF9F 1RTDB 2X1AA 4IDKB 2BEFA 2OFHX 4K50A 2W2OP 2F40A 2QSFA 5F8IA 3M9OB 4C0HA 3CNQP 9RUBA 1RAGB 4RL1A 1NZ8A 3OBIA 3MMAB 1U1MA 3FEXB 3RJMB 2IM2A 1EARA 3BM7A 4F02A 1REGX 1K0TA 1U1NA 3AD7C 3OJUA 3H2LA 6AT1B 1A6LA 1NLKL 2W2QP 4J9RA 4X4RA 2VA2A 4PWWA 4O23A 1EJ7L 4KO0A 1T94A 1Q95G 2CJXB 3BGOP 4Y34A 3D6MB 1T03B 2AYEA 4QWCA 4MIAA 5FD1A 2V8HA 3FJ2A 4RUAA 1XNQF 3AOCA 2PI5A 2HHWA 2VFSA 8RUCA 3VZIA 2N3OA 1H7XA 1NK4A 3BSOA 2CWKA 4CLPA 1SC1B 2DVIA 2ZKUA 2DRAA 1BE4A 1P6TA 1XJWB 1WD6A 4ZP7A 1UA0A 2XBPA 2Q6BA 4AL5A 1B7FA 1GNKA 1RWMB 2MHEA 4J9QA 1HQ2A 1S76D 3SIPB 4NXNJ 5DZ6A 3TEHB 4ECYA 3IRXB 1RTDA 2BKOA 4I67A 2DRDA 4CQ1A 5CA5A 1UZHA 3U27A 2JLGA 1JNRB 4JP8A 4LFCF 1SJ1A 3AJ2A 3TR5A 2RDDA 2M0GB 4ZJLA 3ZZUA 2V9WA 1R7IA 5G4DA 4X65J 4JI2F 1N5YA 4Y28C 3DLJA 2BQUA 1QDUB 2A0FB 2MJUA 1XK8A 3NCPA 3W2WA 2VJUA 2AP6A 2D3UA 1RAFB 2ZBRA 5HL7Q 5D0EA 2RVJA 2IJNA 4DV7J 5M2PA 5GMKa 3P3DA 1T03A 1LWFB 3PW0A 3IC1A 4IH5A 4OJGA 3THPA 1KHVA 3V6DB 3JQKA 2OPQB 1FWLA 2F8MA 2UUWA 1C4AA 2W2NP 1YZ6A 2ZBQA 3QZ8A 1HYSB 3MHYA 1Q1KA 4M5MA 3OV7A 3T5KA 4K0KF 5L46A 4PXCA 3S6EA 2I5JB 4LBHA 3UQSA 1D8ZA 3CJTA 4LRDA 1YGYA 2HPUA 1HPZA 1N52B 4ZPVR 4DSEA 4WCEQ 5HI7A 4P2SA 1FO1A 1YTYA 2CUYA 3Q8PB 4RJVA 1Q0NA 4IUFA 2DCLA 4UZCA 2ZWOA 1TKZB 1V3SA 5HROA 3C15A 3J80U 4JB8B 3Q0AA 2VBXA 1R8BA 3MCNA 3POTB 1YJUA 4FXVA 4RUBA 1M1GA 2KFYA 4USWA 1V9OA 3PVXA 2NXCA 2QL9B 2C2ZB 3CCWA 1F3VA 3W9IA 3B8HA 3R1LA 3PKYA 2CFXA 4OQJA 1UPPA 3MM6B 4U8YA 1VBXA 4EO6A 1YRUA 1UKUA 2DH9A 3V6DA 3ITHA 4MTPA 4JBCA 4ZP9A 1RTHB 2U1AA 1VBZA 2H5JB 4WYLA 5D0RA 4NLPA 3WQPA 1VHFA 2M3DA 3W62A 2AW0A 1GX6A 2VG6A 3SFGA 2CJBA 2CQPA 2QLWA 4O44B 4ED0A 5EHHA 2I5JA 2JEGA 2QV6A 2DNLA 1D0EA 4IQXA 3ZZTA 3NGSA 5BYQA 3CMAS 4CWBA 4TXSA 3THTA 2QFIA 1VLOA 3FEYB 1SH2A 2ACYA 1U1KA 1WNEA 2IRYA 1X4AA 3HHEA 5A2QU 4EBEA 3MUMP 1TKZA 4NASA 4DFPA 2QA4S 3LWLA 1HQUA 2CZ9A 2E5LJ 4PUOB 2HBZB 1S1TB 2OO4A 4YHHJ 2VFUA 4KHRA 5E33A 2BRLA 2BMBA 3NS5A 3CCVS 1H38A 3P6YC 2M8DB 4KHPJ 2Y0BB 1N5SA 2ZDOA 2MKCA 3UDLA 4UY85 2RKIA 4DR1F 1S49A 2VBZA 2XQCA 1TFWA 3HSJA 3CJ5A 3SQGB 3PIPQ 2DGQA 4ELVA 1XNRF 1AYEA 4KH0B 2PFDA 4LJMA 3MR6A 4RNFA 1S1XB 1SC3B 2FZCB 4CTAB 3AD8C 3IBCB 3MZIA 1RYRA 1P1LA 4OX8A 4LBPA 3LANA 4HKQA 2ZHAA 4O44A 1TK0A 1U2RA 2OH2A 1BLUA 2BZ2A 4NWBA 3EM1A 4EK2A 2UUAJ 5BJRA 2CPEA 3M4XA 1GH8A 2CWXA 1NJIT 3KJFB 2IM1A 4MK7A 4B3MF 2Z56B 4CDIA 4NRTA 5HQLA 1XTZA 1FCAA 3SQOP 2GHVC 2JC1A 3ET6B 5BYRA 4H4KC 4OHXA 4KH1B 3ZZPA 5DDPC 3D0HE 3EE3A 2YNIA 5LOQA 1UTAA 1I1GA 3Q8VA 4NLWA 1K9MT 1S1TA 2KRRA 4AE5A 1S0MA 4PPZA 3FNNA 3H20A 2HMIB 3HSGA 3PO5A 4XTTA 3RBXA 4OX9J 1JB0C 3D66A 3PW4A 3AOAA 4YB7A 5F8JA 1EZZB 1YRXA 3FBCA 1AFIA 2WOMA 1K8AT 4DV0J 2XLIA 1Z4UA 3SQGA 4PPDA 4KHPF 4OZ3A 1IKXB 3MCMA 1Z2LA 1DQAA 1IBCB 3SV3A 4JI7F 2VF3A 4W98A 4HL9A 4Q2MA 3QFHA 1WDDA 3L9ZA 1APSA 1S1XA 5H9EK 3P8BB 3NGRA 3EXYA 1UWBB 5KFHA 1FTRA 3NP5A 1GXTA 4KY3A 2I1RA 2MXYA 4WZMA 2CPJA 1N33J 2CIMA 5A8RB 1TK5A 3QGIA 4WKRA 3GFYA 3K5PA 4DCPB 4B3TF 4BHQA 1HR0J 1T9VA 2IMOA 3HFZB 5LSLA 2VL1A 1VCTA 4DN0A 4FBUA 1N5QA 4OZ2A 4DL7A 1F5BA 2VPWB 3GONA 4FS2A 1I94J 2XWXA 3K5LA 4WIIA 2DR7A 5B08A 3SI8A 3M8YA 4OHYA 5IWAF 2IRXA 4OYMA 2N82B 2J6TA 4A8QA 5C24B 3AD9C 1S48A 5KOXA 4ZN1A 3G4SS 4WFNQ 3PX6A 3HKZD 2QGFB 1P1TA 1LQ9A 1FKAF 3DDKA 4NRUA 2B7CB 4ZPCA 4B9UA 4DU8A 5A0YB 3MEEA 2FIUA 2XNRA 1J5EF 1DJ0A 2GVZB 3CJSA 3TI0A 3UDCA 3P4UB 4HEA9 2G9OA 1MMDA 1X31C 3GYNA 4ZLPA 4DL6A 1T3OA 4DX8H 4OX6A 2WVFA 3KLGB 4MK9A 3GIMA 2MZRA 4O4RA 3OFHA 3T3FA 3QSYB 4Y2CA 1VRTB 3ZTQA 3GJTB 5K20B 3PJWA 3OTOF 1NDCA 3DN9A 4F4AA 2B0GA 5CZVA 3G2XA 3BH6B 3P5TL 3HT3A 3TANA 1H6KX 1YBUA 3EXCX 1QUPA 3H25A 1R43A 2QMXA 4DPYA 1U0HB 3AOBA 1U1RA 5K14B 4OHVA 3EGNA 1UFWA 3VV2B 2HQCA 1LEOA 4DFMA 4K4TA 4OL8A 2L41A 2NS1B 1AROP 4PG5A 3UNGC 1HR0F 4EZ9A 4NYPA 1SB6A 5KFNA 1RCOB 2LP4A 2DGOA 2H9ZA 1TUGB 3KG1A 5IT9U 4PG4A 3OXFA 4OZ1A 1NPKA 1JJHA 2CYYA 2ZOFA 2GVZA 2CA9A 2DNMA 4DPWA 2AJ0A 4O3RA 5J1EA 3ILIA 1N0UA 1YX2A 4NCAA 5ETRA 4C8MA 3VAFA 4MJKA 4F3QA 5B0FA 2CQ3A 2LEAA 2HRTA 1UW4A 3BGFA 4QIWD 5IV3A 2A10A 4LFAF 2B8PA 2HQGA 3CJ2A 2KM8B 4N56A 1VRTA 1N8RT 4K4SA 1TL1B 3KUGA 4ED4A 5CXTA 3CTRA 2EFQA 3UN5A 1O5JA 1FNXH 2CPYA 1YITS 1WF1A 2J8AA 4I6YA 2XMUA 4UQGA 1GTHA 4DR5F 3BGRB 3GCXP 4ZVUB 1N56A 1AUDA 1U1PA 3QAEA 1FE4A 1U0HA 1SXLA 5THWA 4DPOA 2KU7A 5KFQA 5K14A 1TKDA 2QLBB 2RRBA 3BYRA 1KFDA 4QWDA 1WSRA 3AB2B 3UD5A 4DXLA 5I3QA 4M5KA 2Z2MA 2RE1A 1SKUB 5K8NA 2GIRA 2AJFE 2IDEA 1DHMA 4ZN3A 5LMNJ 2G13A 4LMZA 5HLFB 2D1CA 2ABYA 2D69A 2F4VJ 2APOA 5KT2A 1NUEA 3OSPA 3QLHB 1E6VB 1QUVA 3FFIA 1J5OB 2BDPA 1P9YA 1TFYA 2XMMA 2JL9A 3J81j 2OJ3A 1HW9A 2YKMB 2XC9A 3MECB 4ZJOA 4EEYA 1KTQA 3T1YJ 4TKTA 4GO5X 2E5GA 3X1LB 2JJ4D 2OAUA 4ECVA 4KGVB 4DSLA 4DR4J 3TJ8A 3UN2A 3RR7A 3PJ9A 3LP2B 1IQZA 3CCUS 3BBCA 4EO8A 5ETKA 3E8OA 3SXLA 2QLJB 3MMBA 3HULA 3GR0A 2V50A 4PQUB 4P2XA 1VK3A 1N34J 3H8YA 4ICLB 3QGGA 4DV1J 2MJNA 3AQPA 1NU4A 2EKNA 4QBUA 4LR9A 3FSYA 3BGRA 3O3LA 1B0VA 1RTIA 5I3PA 4ZS6A 4DPUA 3I5CA 4XDDA 4GC6A 5DQHA 4EYHB 3HVRA 1RT1B 2Z0GA 2V5HG 2ZVIA 2E5JA 2FUG9 4URQU 4K2JA 1VS3A 1VYAA 2SXLA 1VJWA 4G65A 5BR8J 4ZPDA 2C2NA 4KB7A 2OHDA 4CLWA 3LH2S 3T1HJ 4LVOP 4DX7A 2DHHA 1CJTA 3DLGB 4URGA 3UPFA 1CJKA 1RE1B 2FVQA 5EWGA 4HI2A 5CYQB 1CJVB 1M5HA 5KT4A 3OUYB 1E6VA 3PHEA 5B7WA 4JYAF 3HVWA 2ZEJA 5LMNF 3Q8YA 4EFAC 2DEIA 4C4WA 2IA6A 3V2UC 5F41A 1PBAA 3TJAA 1Y4ZB 3KFWX 1Q8KA 3KTQA 1CLFA 4JI1J 2Q6CA 3PHTA 1BGXT 1U2FA 2K1RB 4OYPA 4K4UA 3G6XA 3QMQA 4UW2A 3QSIA 3QIPB 1LWCB 1RT2B 2OPRA 1UJ5A 3CJKB 1Q8IA 2Q66A 3EDQB 3UFCX 3UDVA 3QT5A 3HDSA 1KVJA 5ETPA 3KHGA 4ZMMA 2OUGA 2H48B 4U67Q 4TYAA 2NPFA 1X5OA 4EWTA 4C8YA 1RT4B 4LIRA 2OMOA 2ZHOA 1XR7A 2VKZG 2ZH4A 4DR2J 1P9QC 3SBMA 3RAQA 4OZNA 1JLAA 4AQYJ 4CLKA 2O1PA 3FCHA 4IH7A 2QG9B 1Q82T 3W9HA 1KFSA 5KFJA 1PBUA 3DGVA 1NSKL 3KLFB 5KG0A 3DLGA 3W63A 4DWIA 2PA3A 4RZRA 4GKKJ 4N7TA 4PEOA 5IXUA 5CYQA 1XR5A 3OFFA 4MMOA 1CJVA 5GAEU 4KSEB 4J9KA 4ZVTB 4ZLNA 3MM5B 2JVOA 5KG5A 4L3NA 4DPXA 1Y3JA 3OVSA 2YWEA 2ZFHA 1DURA 4NPOA 2CPIA 4ZITA 1ELOA 3BGUA 1S9EA 5GMEA 2GIQA 4Y2MA 4AXIA 2W4CA 1X4GA 1VOMA 5KG6A 2CNNB 3M8RA 2AJ4A 3HZGA 3R1HA 2XY6A 3QT6A 1LOUA 4LQ3A 3BKFA 3RB4A 4OI3A 2QEXS 1T95A 5KT7A 5J2NA 4NLGA 1SC6A 2AIRB 5E2QA 2XMTA 4K4XA 2HKEA 3AHPA 1WI8A 2ADCA 3H5SA 2XMVA 1RT2A 1PYTA 3CJKA 2KHDA 2FHOB 4NXMJ 1I3OB 3BSNA 1EKRA 4AFFA 4JI1F 3D28A 3ZXWA 3BR8A 1CSJA 1L3SA 3WC2A 5KFTA 1HBMB 3HXMA 3H5YA 1JLGB 4DX5A 3K57A 2G2ZA 2DJWA 4FNHA 1KP6A 2IY5B 3N9UC 3HHKA 1PIEA 1AXQA 3O5TB 4F25A 1NK0A 4ID8A 1FX4A 4NYOA 4B9MA 3GIRA 2XGPA 2BJ7A 4ZVQB 4DV4F 2W7PA 4FXDA 2Z2ZA 3KLFA 2YTCA 4KC5A 3MGJA 3US5A 3F73A 1HBUB 3VALA 1ZTTA 3TO8A 3I0RB 2LQ5A 5T41A 2VJVA 1G7CB 2GMHA 3ULHA 2JC0A 1KVKA 3HK2A 4UOFA 1O0PA 4OIXA 4R0EA 1OYEA 5I42B 2OD4A 4I7FA 1FJGJ 5JVHQ 4K4WA 5HVHA 2H65B 1DAXA 2CZ4A 4RW7A 4HDHA 4OJ3A 2K7JA 3HMJG 1KHWA 4E98A 4IYQA 3QO9A 3LO3A 4YY3J 4KGKA 4B02A 3JYTA 3G6VA 4K5RA 4L75A 3WX4A 2FGCA 3MEDB 4DR6J 2KDOA 3GJRB 4K8RA 4CO0A 5GADI 2UVWA 2R7VA 4MKBA 4LF6J 1IUJA 3R7SB 2H3EB 4NA1A 2PGCA 2B56A 2XZTB 1M0SA 3VGSA 4DMZA 1HBMA 2VQEJ 4PXBA 5GMDA 2BE7D 3KNAA 1IBKF 5ETMA 5C42B 3AAWB 4A8XA 5KFBA 2BVZA 2RRAA 2XB2D 5KAKA 4A8SA 2N4DA 1JXEA 3TZXA 1J2VA 2BJ8A 1Q8LA 4F4XA 4ZLLA 3KHRA 3CJRA 2HS3A 3CIMA 5D0HA 1QVGR 4NYZA 3VAIA 2M88A 3SCLE 1S59A 4CM2A 1WEZA 2PFFB 2YX4A 4XAKA 1HD0A 5GADU 4IOBA 5GAHI 2N4CA 5D4PA 1TUWA 5I42A 2NXJA 2PDAA 3PFOA 1HARA 2MQOA 1FERA 3PTWA 5FLXY 2IIHA 3UR3C 3IBFB 3CSKA 5A8KB 1VISA 1IKVA 1BQMA 2Z2YB 1U25A 2RH3A 1RHQB 3I56S 5KFCA 3GR1A 3BH7B 4ANCA 3M8SA 3CD5A 2LA4A 3R2DJ 3DRRB 1PYOB 3Q8UA 1FJGF 2HHPA 5IFMA 1BXNA 5CYMB 3G82A 1NH7A 3UDEA 3AB4B 4YY3F 3PY8A 2DH8A 3CMES 1RLDA 3V6KA 4DV3J 4LQ9A 5IC6B 2VKRA 3MOJB 1FWKA 4YR0A 3UVJB 2CQIA 4G6VB 4OI0A 5AJ3J 4NEZA 4HLBA 2MQMA 3PO4A 3ETOA 3FQLA 1RT7B 4G1QB 3PV8A 3V4IB 3MEKA 4RU9A 2ZH9A 3PZPA 5HP1B 3D68A 1NJXA 4URSA 4J9NA 2KRBA 1IKWA 2CG4A 4HTJA 4ID5B 4CLZA 1HI1A 1L3VA 3HHLB 2BW2A 1ZPVA 2D41A 1ZTWA 4HH1A 1Z2ZA 5E3AA 1XWLA 3BKTA 1RWWB 3T5LA 1R31A 3OPKA 1FDNA 2B3TB 3NGKA 3MPVA 1M5VC 2CNOB 4IR9A 4ZJQA 4Y2AA 5AXLA 2YPYA 1MROA 1S9FA 3F56A 2EPIA 2WW8A 2H54B 3I4PA 3GFZA 5A8KA 2ZNZA 5IM0B 5F8GA 2FLPA 1WSVA 2VQFJ 3LGHA 5FIIA 2IFXA 3H2UB 3DRRA 3MR2A 3LW5C 2X1GA 4O3SA 2Q79A 2R3VA 2WVDA 3DGPB 5SUHA 1SC4B 2XZDB 1G3OA 2CQBA 3I87A 4J5OA 2HHHJ 1PJ6A 4J9SA 1WHVA 4I0WA 5HQ8A 3SZ2A 4CLTA 2MKJA 4M5NA 2HQDA 1KBRA 2V4RA 1KEKA 4PG7A 3DM2B 2DD8S 4YEAA 2MQPA 3UVJA 4J9OA 5J2QA 2MY7A 3QAUA 2QSWA 2JH3A 2EG1A 5F0WA 1RT7A 1SH3A 3FCVA 2VONA 4LF8F 1QTMA 2WB1D 4XO0A 5HP1A 4H54A 2VFRA 4WTYA 4ED6A 4UOCA 4CO2A 1FJEB 4ID5A 1RHMB 1UZDA 4O4GA 3TWZA 6FD1A 1UP1A 3DI6A 4NI2A 4ZVSB 4DSKA 2Y0SD 1YKWA 2MPUA 4ZK7M 2HK3A 1FESA 1FDDA 4YB6A 5KFYA 3LAKA 4ES2A 5KG4A 3AXKA 2FVRA 4U9RA 2XHWA 4PG8A 5D4NA 3BZQA 3DOLB 1WHXA 3BBFA 4XDCA 5DDRC 4M94A 1HHQA 4K4VA 1B64A 3F41A 2UVUA 1T9TA 3K2YA 2R8HA 4IO1A 1KD1T 2BABA 4QPTA 1RBAA 1TELA 3K7RA 1BQNA 4FF4A 2KFZA 2UXCF 3DXBA 5C25B 3TA2A 4DV2F 4ZPWR 4NA3A 4RNMA 4FKXA 2MKIA 4KKOB 2VASA 2ILYA 1CJUA 1V3RA 3DM2A 1YDLA 4P7TA 3GLJA 1CS4B 2C22A 5CYJA 2E7WA 1B99A 1S4FA 2UV8G 1RWKB 1HIYA 3MR5A 2GX8A 4ER8A 2GAHC 2D3ZA 4IFVB 2VOPA 5C5JA 2GC8A 3IP0A 1HBNA 2I9SA 1JXVA 3BBBA 3MEGB 5B09A 3CCJS 3NY0A 3MPUB 3DMJB 1CULB 1T7PA 2IA0A 3ZTPA 4OYZA 5E3CA 2DBBA 2ZBIA 3S8SA 2NQPA 5U47A 3E51A 5EN1A 4NE9C 1IJFB 1TL3B 2AKWB 2KZZA 4P71A 2L3MA 2RS8A 2GJIA 3D1OA 3OLBA 3OTBA 2LEBA 4OX7A 4AD6A 4QZVB 3DOLA 4YB1P 3T5HA 1SUQB 3OL6A 4RWWA 4GO7X 2BYCA 2DHGA 2E1MC 3JAMU 1R3NA 4FNIA 4B9VA 2ZH1A 1QJHA 1KS2A 4C11B 2KT3A 4I4BA 2XCAA 4UZBA 1RISA 1VDHA 3MM7A 5FDLA 1SJ4P 1L5UA 3V81A 1MN7A 4MYUA 2JFDA 2EBGA 1IBMF 2EFPA 3HJVA 2E1PA 2W2PP 1XMOF 5D8HB 2ZITA 5F9LA 2QLFB 2NXEA 3IO1A 2V2QA 5C25A 2GHPA 3PR4A 2HHTA 4ED2A 5HATA 2ALZA 2C3OA 4FKYA 2EFGA 5KFSA 3DRSB 3QJPA 4C98A 3MWBA 1CS4A 2I2YA 1RWXB 4USUA 3J7YI 2UP1A 1HHSA 4ZVPB 2WSCC 3JTNA 4ELTA 4YMEA 1D3WA 5D77A 4PG6A 4Y65A 3I0SA 1R8CA 2CJQA 4DS4A 4IFVA 3EPGA 2EK1A 1Q8BA 2AJQA 3B82A 1VQYA 3MEGA 4KFBB 1RBLA 1PAUB 2U2FA 4MT1A 3G8QA 1CULA 3DYAB 3T9ZA 3JB9k 2FVPA 4V1Ak 2JZ5A 2QYCA 5AXNA 1RTJB 3I31A 1F9EB 4ECWA 4YDXA 3OXLA 4LF1A 1S1WB 4J9UE 3D2WA 3JQJA 5JMNA 2BM1A 3Q8RB 1GTEA 4Y6IA 2POKA 2V8PA 2C42A 1SUQA 4ECZA 5ETVA 3W5XA 2W1BA 3SSQA 2UXBJ 5EWFA 2DXFA 1RLCL 3GILA 1FKPB 5DGAA 5AXMA 5E5NA 2YKPA 3DLLQ 1NKEA 4ZVEA 1RWPB 3PG9A 3KJQB 2ZUAA 3PNIA 2HS4A 3KHLA 1XBWA 5DG8A 3IFEA 2ZZNA 3G71S 1N36F 3IAS9 1X9SA 2XI3A 4E8UA 1FK9A 4X4TA 3JXOA 3FRYA 2EW9A 2B5JB 1T9YA 4NCBA 2IHR1 2LDYA 1AZSB 2E1CA 2H5IB 1EP4B 3DCAA 1TZ0A 2MKSA 2CQ4A 5ETTA 2DNOA 3N0VA 3IG1B 3AQOA 3NMAA 1FRLA 3ISNC 1IWAA 1B3TA 2F9DA 4KPCA 4KFBA 1UVIA 1VQMS 1REVB 2GVDA 4BWJA 3TA0A 2ACMA 2BKPA 1X5SA 1F60B 1D1UA 2PN6A 1AB8A 3DHXA 3Q24A 1FFGB 1J27A 4GC7A 2RRNA 3CD7A 2VH7A 2ZBPA 4GKJF 1FT8A 2ZH8A 5GAGI 2HWHA 3CJ3A 4ECUA 2HQ3A 2KXHA 3CO9A 2YXLA 1X9WA 4F0HA 3VQTA 3QQCD 1ZA2B 1T9WA 4WFYA 5HQMA 1C0TB 4F4KA 3DDNA 2DNNA 4FVCA 2HBQB 5FLXU 2D9PA 2RF2B 1WDTA 2DXDA 4F2SA 4Q0BB 2Y1IA 2OI2A 3K58A 1VQ8S 1ACMB 2JNJA 3HHNB 3OVBA 4Q7AA 2CNKB 2VV5A 3I82A 2FVCA 3TW0A 2ZZMA 2HG4A 1AT1B 4CH7A 4YB5A 4B3RJ 5E7OB 4B3OA 2CAJA 3I55S 1VQ4S 1M5SA 3RRGA 3GB0A 1SKSA 1EKSA 1NSPA 1YJRA 3TAPA 2YKNB 5LMUJ 5CHCB 2D7SA 2HRYA 1U1QA 1U6ZA 2CPZA 3HKWA 4DJBA 4EYIB 2WZ1A 1FRIA 3DLBA 3AJDA 1KRPA 3MMCB 4NOHA 2XSJA 4LF4F 1QAIA 5DM6Q 2M70A 2HIYA 2VA3A 1RA7A 3J80Y 1KN6A 3AA9A 3M05A 4M5LA 2P6TA 4YDDB 5K8MA 4KBIA 3H2VE 3B54A 2E9RX 3NS6A 1HNWF 2H1YA 2RIJA 2PMWA 4JI4J 3VWSA 1JLBB 2B8QA 4TNOA 1P27B 2HVZA 4NA2A 4CYUB 2P5VA 4DF8A 2C2MB 4R5PB 5HVFA 4KGMA 5AXKA 2DGTA 1X4EA 1C0TA 1WC1A 2XLKA 3B4MA 4X4NA 1TAUA 5EX3A 2RF2A 3MR3A 3GZ7A 2G4BA 4Q0BA 3R8YA 4H4KA 4DPTA 2FJWA 1MW7A 1VBKA 2YKAA 4WWSA 1I6JA 1VI7A 5DRKA 2FJEB 4ZPAA 2NSBA 2MZQA 3CDAA 3NOGA 2J9DE 3TQEA 1T05A 1Y0HA 3W7BA 4LUBA 4FXWA 2N7YA 1S77D 3DDIA 4R8UA 4QOTA 3T6JA 1UJ6A 1S79A 3S01A 5ETQA 2CDRB 2E29A 2BRKA 2NZCA 2IVMA 1PC4A 4O3OA 3RB3A 4R25A 1SH0A 1PO6A 1KQFB 3LP1B 4B3RF 3PEHA 4TYBA 1JLFB 4I68A 2BJEA 3IA0A 2HFZA 5DS7A 2LA6A 4OI2A 1NHUA 3AODA 2H4YB 2VBYA 1ROFA 1PJ7A 1LW2B 1U6BA 4F0MA 2DGUA 2UVVA 3HHLD 2UUTA 4XPCA 3B4DA 3THVA 3W5ZA 1IXKA 4UUXA 3UD4P 2D74B 2V4JB 2B43A 3V6JA 1B4SA 1RA6A 1JLBA 2PO4A 2OPSA 4C9DA 3Q23A 2Q1LA 2R2TA 4R5PA 3U1MA 1RHRB 5AE1A 3KG4A 1UEVA 4N77A 1SPBP 2QL5B 2W8KA 2L08A 5DGBA 5DJBA 3FCWA 2F4FA 2P6SA 4ETZA 1EB0A 4OYBA 3A3NB 2HQIA 2YNFA 3IWNC 4LVNP 3I32A 5ITHA 4QYZJ 4P74A 4ZHRB 3MTJA 4EZ6A 2MHNA 4CT9A 1HHTP 1WKLA 2FY1A 4L72B 1VC6A 1U24A 3RZAA 1HFEL 4JV5F 2WBMA 2JWNA 1S72S 2UV8A 4YN3B 5KFGA 4ZCKA 4DG1B 1N32F 3ADAC 3HPOA 2ERRA 3ZZOA 3A1YG 1JLCA 4IR1A 3MF5A 4Q2LA 2MZ1A 1NJZA 3M8QA 1HKAA 4TY9A 1RDRA 3CE8A 4A8OA 2FY8A 4D3HA 1XC9A 4I6AA 5EDWA 4ETXA 3VGUA 2M9KA 5IQ6A 5DLFA 5FJ4A 2E5IA 1ZS6A 2A6MA 4OZJA 4F7VA 2GNKA 4DR7J 4PXDA 4UQTA 1IM4A 1OY9A 1IR1A 3GWCA 2V4JA 3FBEA 3BSCA 4UT4A 2PMHA 1Y7PA 2W2MP 1FVQA 1KOHA 4IOAQ 1NH8A 1IM6A 3C8YA 4RW4A 3MI7X 4GVBA 2PMZD 4JI5F 4KO0B 5DO2A 3G6ES 1NSAA 1NPPA 3NLCA 2X7IA 2YX1A 4ATNA 1NJWA 2LKZA 1N5TA 2HFOA 3DLKA 4CRJA 1DTTB 4DUTA 2J6SA 4ZHRA 3BO2A 2W01A 3T9NA 3KNGA 3MAHA 2M52A 4AYBD 3N5BA 5HBMA 2HLUA 2B6AA 2QMWA 2QO3A 1SBRA 5F0UA 4PWUA 4MYTA 3EVMA 2ZDPA 3TUZC 2QFJA 3OL7A 1X5TA 4Z2XA 4JI6F 1RZMA 4QQBA 4TLRA 4KYZA 2WSFC 5LJ3Y 1HWJA 1HBOB 4DUZF 1UJ4A 2Y9HA 4KGZB 4HDGA 3PYEA 4ZVGA 1GMWD 2J9DA 2J7UA 2UXDJ 1A7GE 3GV5B 3VAGA 2OPPA 2PD1A 3OJSA 5KFFA 1UFKA 3CCZA 3DHWC 5KFAA 5M2RA 1RT5B 1PGZA 2HYIB 5KT6A 4QIFA 2ZUGA 2MDAA 1KTVA 3PXGa 1LXNA 1U48A 4MKYA 4LSNB 3A12A 4Y2KA 2NYIA 3W65A 3WBZA 4CM0A 1Z1ZA 2FQQB 3SEOA 1TKTB 1RB0A 3QWPA 1E6YA 3FKBA 1N5YB 3W61A 1NDPA 2R7SA 4WP8A 2NSCA 1M5OC 3B78A 3W2WB 2GO9A 3QT7A 4X4UA 3R5AA 1NNDA 5T7LA 1S99A 3BV8A 3J81Y 3EMTA 1AFJA 4J7CA 1DTQB 1AA1B 3GSIA 1DTTA 3JSMB 1RSCA 2DGXA 2WW4A 3KUEA 1ZETA 4ZIWA 4K4ZA 2EKYA 4UY8T 3PKMA 3IXQA 1OWXA 4ALZA 4X4PA 4FZVA 3DXSX 2GGPA 2ZM6J 3EZ5A 4F0KA 1TR0A 2PC6A 4HHHA 3W8PA 3PDNA 5A8WB 2EFVA 1HLWA 3BO4A 3G9CA 8ATCB 3CC4S 2RT3A 1HI8A 2YQ3A 5K8OA 1FKOB 1HBOA 2DNPA 1NKBA 3HFKA 4RW6A 4U7CA 2OMLA 3GIJA 4C8ZA 2F65A 2YPZA 4Q8EA 1HPZB 3FDSA 4P2FA 3CGIA 1UA1A 2GS8A 2XY5A 3SFUA 4ILMA 1QE1B 7FD1A 5KFOA 4JI3J 1S0NA 3DFEA 2UUBF 1XQIA 5IT9Y 3W3SA 1RT5A 1D9DA 3B6BA 3CPWR 2LQ9A 1ZH5A 2H51B 2ZNYA 5F3ZA 5HROB 5F8HA 3CXCR 1L3UA 4LSNA 4RNOA 3C15B 3CJ8A 4H4MA 2FLNA 3SCJE 3VVTA 1D8YA 2E66A 4B3SJ 1NK7A 2R7XA 1TKTA 2MB0B 5B0EA 4ZP6A 3N4WA 1T3NA 1X60A 4WJBA 1Q86T 4KT0C 2HFSA 4AL7A 1WKJA 4ANDA 2LU1A 3KLHA 1WACA 1IBLJ 1JJ2R 4U7UD 2IC3A 1TTHB 4DUYJ 1DTQA 1V5IB 3JSMA 2GCFA 3ITHB 1Y10A 1NK9A 3QT8A 4JUZA 3OFGA 1TK8A 3MTKA 2MZJA 2HVIA 2HNDB 5HK4A 4YP3A 2XZWA 2VG6B 5A8WA 2C3PA 2B9XA 4WF9Q 2RSQA 2RUGA 1XEZA 2DITA 3DNCA 2MQQA 1FKOA 1R8AA 2ATCB 2AF6A 5H9FJ 8AT1B 1U8WA 3M2UA 4HT7A 4B17A 5L1LA 2JX2A 3ZZ0A 3FZBA 4OYXA 3CJ4A 1QE1A 2KM8C 2E9TA 2FZGB 3KLEA 2OEKA 5CAAA 4LSZB 3M9MB 2WONA 4ECRA 3LA0A 2EWHA 4LSLB 2RD5C 3CO0P 4E0DA 1HQUB 4NXNF 1JWWA 1VQ9S 3A3OB 3H7HB 3E3XA 1R89A 1ZZNA 1R8HA 5ETNA 1FWPA 2DR6A 2BE2A 2C2RA 6FDRA 1JMTA 2MZSA 3TX0A 2RUSA 3TAMA 1GXUA 3UW1A 3FRZA 3EZOA 4X66J 2BE9B 2RKIB 3BPDA 4M8LA 3ENWA 1GXLA 1Q53A 4X65F 2BW7A 1URRA 5LM7E 4FF3A 2W9CA 3M2RA 4F4YA 2RAQA 3TYTA 4RKUC 3SDEB 1IR2A 2DTJA 5AE3A 1BY9A 4ZVOB 2FB0A 3Q8SB 4ITSA 4EGLA 2ZBCA 4DV7F 4IH6A 2HNDA 4USIA 2AT1B 2CPFA 4EI2A 3I5BA 3GU0A 2KG0A 4WFXA 1YHQS 1Q78A 3CDBA 2J0XA 4V19J 2XS7A 5G0RB 2GZOA 2NYHA 4RBUA 1GEHA 3MR7A 3M8ZA 1SKWA 4YFUA 3QNWB 2NPIA 4DSIA 2NZ4A 4IG0B 5D78A 4Q44A 2H4WB 4X62J 4WE1A 2J9EA 3RBZA 1TVRB 4G1IA 4LSLA 4ZOSA 3K8VA 3MMJA 2YNIB 3GG1A 1XMQJ 1EQMA 2EFOA 4WZQA 3RW6A 1F2GA 3QIDA 5D3GA 1Y5LB 3EX7B 3PFEA 2FHKA 1VQ6S 4PWDB 2XS5A 2C3MA 1DFDA 2IPOB 3PEJA 4DR3J 2GFFA 3A8JA 1RHKB 2UU9J 2DO0A 1FI4A 4LR7A 2HIQA 1WG1A 2LEPA 2WOMB 1DBDA 2HRUA 3R9LA 3J7Z5 3DLHA 2CQ2A 1L3KA 3FSXA 3D6FB 1FEEA 4X66F 3SDEA 1D09B 5KFDA 3VQSA 4XK8C 4Y0FA 1UWAA 3P5BP 1DQ9A 1PJ5A 2A2DA 4CLYA 3VAMA 1FRJA 2XCPA 3R5DA 3BR9A 2DGSA 1BD6A 1IWGA 4BC7A 2HS0A 5MLCV 3G8TA 2AMCB 3SSRA 2FHMA 2KI2A 1U1OA 1VR6A 5C2CA 2FHJD 5G0RA 4RW9A 2X3DA 4N8NA 1VHIA 4PRFA 4DLGA 2OEMA 3TA1A 3ILOA 1GX5A 3W2VB 4FS1A 5L39A 5LXYA 2DIVA 4W4MA 2GMJA 4I69A 2HEKA 4USMA 4RBVA 2YH0A 4IG0A 4LF7J 3FVYA 2EC0A 1HWKA 3GQCA 1TVRA 2XWYA 1WEYA 4PABA 1KQGB 2BUNA 2Z8QA 2RQMA 1DZ5A 1GMVA 2Z2LA 1ZM4A 1KLNA 3MEEB 4LF5J 4O3NA 4X62F 2WTFA 2B4VA 4USKA 1HNIB 3CB4A 3KK2A 2J6UA 4PWDA 4NLVA 2DR8A 1RP5A 2LVWA 2JLEA 4CCHA 2E5LF 3GCWP 1ZBTA 3UNYA 4YHHF 2CKWA 3DU5A 3FSIA 2HLTA 4WU3A 3JTPA 2M7SA 2MYFA 4U95A 5D4LA 1OQ3A 1PC5A 4LFBJ 5M2UA 2QMUB 2JEJA 1VLYA 4QCLA 3N28A 2QIFA 3M2VB 2V0NA 2KXFA 3EICA 3OTCA 4P10A 3KWMA 2KZMA 2RDJA 5HANA 1OPZA 4YR3A 4CLLA 2K06A 1F9HA 2I6WA 3MPWA 5HMXA 3W2VA 3OW2R 2MQLA 4FPIA 1MMNA 2H5EA 1U09A 4QWBA 2JSXA 4X64J 4CLUA 2JVRA 2UUAF 3QWUA 2CG8A 1F0XA 1NB2A 3KK1B 2FJXA 3H5XA 3DU6A 4JV2A 3BN4A 2Z30B 1HNIA 2EC2A 5HO4A 3ZFVA 2HQFA 4CLSA 2J8SA 2DK2A 1S1VB 5J1EB 4CZCA 3QFWA 3DLEA 1VMBA 1ZYQA 5HJXA 4DLEA 5D0GA 3HO1A 4CO1A 3KHHA 2DY9A 1HQEA 4BC9A 1B70B 3GIKA 2R7RA 5HN0A 3BQ0A 2EEYA 4OX9F 4O3QA 2NCKL 4F67A 3J81U 1Y00A 3CCRS 1RKIA 1IQTA 4DV0F 3EZUA 2HWTA 1I51B 3M2VA 3OL9A 2MMYA 2HNZB 1VK8A 1N0VC 3LWMA 1R8PA 3IS9B 3LPEA 3HZEA 4PKDB 4K7QA 1HNXJ 1KOOA 5B0AA 1VQSA 1RCXB 4ZPTR 4B9LA 4C6AA 2WVEA 1S1UB 1NXIA 1CVJA 1FNOA 2DISA 2FZKB 1N33F 5E3QA 2ZHBA 4WIQA 2R7QA 2QZ8A 2WCXA 1RKJA 2AYBA 2PIIA 1T0TV 3KK1A 5DQGA 5IQQA 4I2PA 3D54A 2W4PA 1I94F 3K5OA 4X64F 3IM8A 2ZH3A 2VDHA 1LV5A 2BANA 1Y3KA 3FFIB 3AFGA 3R6LB 3H4BA 1NSQA 1JKHA 1R0AB 2KT5A 1S1VA 1MWZA 4C2MA 4Y2IA 2O3DA 1YBAA 4ENOA 1VQLS 1NM2A 2YNGB 1PAEX 2XY7A 2KYXA 4NLOA 2XO6A 2IM0A 2P2CB 2XG8A 4ED5A 2I8EA 3HSZA 3UO0A 4Q8FA 1TMJA 3EDRB 2Z4PA 1WC0A 2DNHA 2KB2A 4JI0J 2BBEA 3ISND 3MMBB 3ZTRA 4DDFA 4RBTA 3CEDA 2AU0A 2FHJA 1NMEB 3D3BJ 3EVOA 5KG2A 3ZZZA 4MIWA 1S9GA 3D67A 3DRXA 2XO7A 4LF9J 2HNZA 4XIUA 1HNVA 4DFKA 3KMSA 2VG5B 4N47A 5LL6d 3IS9A 3PYDA 2AGOA 1RTIB 4F4ZA 2CADA 3BKUA 2VC1A 1GMUA 2FJVA 3L4BC 2ROEA 4MFBA 1S1UA 4HACB 1WTBA 5RUBA 3C46A 9ATCB 4AUKA 3HT0A 2AQ4A 1ZA1B 1RGVA 1CJTB 2HNYB 2XMKA 1CJKB 2QA2A 3DRYA 5GVQA 5KFWA 2FC8A 3TVYA 2AX1A 1KDNA 3JSRA 5CZXA 2W24A 1VQ5S 4UOHA 5I4MA 1XNQJ 3RB6A 1RAIB 1RWVB 1R0AA 4TQSA 3PR5B 2QRRA 1TU0B 2FLOA 2YNGA 3GV7B 2DCUB 3MFHA 1CBKA 1C0UA 1C1BA 4X4OA 4M5HA 4WFZA 4DCJB 2VU5A 2BACA 1KLMA 3HHLC 1YJ7A 3KJVB 4M5DA 1U8SA 2OPRB 3GSDA 4Z7CA 1JIHA 3R5GA 2G0IA 3DKDA 2BA9A 1WORA 2VD3A 2MQ8A 3BO3A 3R6GB 4JI0F 5KFRA 2B4UA 2VG5A 3RBEA 1RT3A 3MPYA 1VRQC 1SQFA 2QL7B 1U6FA 2G0CA 4LFCJ 4KTQA 2P9GA 4ELUA 5KFEA 4HACA 1NDKA 1JLAB 3CCLS 2QTWA 3UE2A 4ZDNA 2F7VA 3GYXB 4JI2J 4E2FB 3Q86A 4ZCMA 2AZ1A 5DM7Q 1T9XA 2HNYA 2ZE2A 2ASJA 1NBEB 2HHXA 1SI9A 3T1AA 2GO8A 3CJQA 3NS7B 3PW2A 3C14B 4WK1A 1QY7A 4O0NA 1NO8A 5HAOA 4RUCA 2W8LA 3BYPA 3F44A 3NNAA 2GA7A 1S9EB 4HH0A 4YOEA 3R7BB 2F4VF 4OHZA 3R27A 1H2VZ 1WC3A 4DSFA 4K0KJ 1FJCA 1OMSA 5LSRA 5J2NB 3M7VA 2ATLA 3KJVA 1HMVA 2J7WA 3T1YF 3ZO7A 5GAEI 3QRQA 4FYWB 5E3RA 1T11A 3TVKA 3DOKA 2DKOB 4IRKA 3M8PA 3M1VB 4DR4F 1URNA 1FTCA 3BDPA 4PQAA 3CDUA 3R5CA 4C0BA 1V3ZA 2RMLA 3KYLA 3GIIA 3TX8A 2KG1A 1N34F 2RU9A 2GIFA 2DEJA 4DV1F 2V34A 4MH8A 5I3UB 2KKHA 3QJLA 2JRSA 4KE5A 4NCGB 4IDKA 4U7UK 3GFXA 1UCNA 3FQKA 1UEKA 4LT6A 7FDRA 4G1PA 3V6HA 2CQCA 2OLWA 1FX2A 3CVKA 2ZVSA 3MAQA 3MMAA 4A47A 5L9XA 1U47A 3C14A 3D1QA 5BR8F 3LAMA 4HHJA 4MK8A 4ECTA 2RS2A 2COLA 3T1HF 4ES3A 3QPIA 4B08A 2ZOGA 1N88A 1V6HA 1OJ4A 1WJ9A 2BR0A 3JAMY 3LGMA 5BYSA 4I7FB 3SCIE 2R2UA 2G2OA 3S7RA 1OYDA 5A76A 3W60A 1JLEB 4OHWA 1WG5A 2MKHA 4RW7B 1RABB 1N54B 2DGWA 2CQ0A 1MWYA 5IV4A 2AJ1A 1KR4A 3QO9B 4RNNA 5ETSA 1Y5NB 3JYTB 1LKZA 1F9FA 4H4OB 2VODA 4CI0B 5IT4A 2YQ0A 2F3JA 4C3LA 4DFJA 5L1KA 1TQLA 1FDBA 3M1VA 2V8VA 3A8EA 2XNQA 1NJYA 1CC8A 3FGVA 1K0VA 3G96A 4K59A 4P52A 2W7OA 1RWNB 4ANEA 4USJC 1F2HA 1PG5B 1S6QB 5I3UA 3UI3A 3IRXA 4NCGA 1NZAA 5B0DA 4QWAA 2VZ9A 5J2MB 1F5CA 4FPRA 2AYGA 2FD2A 2B4OA 1NRKA 2HGMA 4DR2F 1PILA 3WIVA 3Q8QB 4AQYF 4DR1J 1UFLA 2MQNA 1G4CA 1LWEB 4RWXA 1X4CA 2GQCA 2FJAB 2CJYB 4L6V3 3KDNA 1LNQA 1XNRJ 2IYIA 3PYGA 2HVDA 1PCAA 3LF0A 4OLOA 2YWWA 1H7WA 3NG8A 5AE2A 4YQWA 3ICLA 1U2CA 4ES1A 1YRTA 4GKKF 1ZAWA 1D9AA 1JLEA 1LWFA 4U6PA 2WVCA 2E1AA 3M6UA 1FHTA 2HGLA 5IS2A 3MM8B 4DBQA 1IKVB 1BQMB 4FYYB 4M5IA 2FJDB 2G0JA 2OPQA 3CWJA 2XMAA 1X7VA 1JXLA 3C6TB 2D3O1 1HW8A 3W9JA 1WG4A 3RW7A 1X5PA 3A4TA 4DQQA 1HYSA 2WVBA 4H4OA 4DQSA 2CJAA 4PAAA 4B3MJ 3G82B 5KFUA 4F50A 2PSZA 1JJ4A 3UR0A 4TU8A 2Q3PA 1WUUA 3P45B 5JJBA 4NXMF 3M8WA 4PYAA 1FJ7A 1FA0A 1S6QA 2EBEA 2GW8A 3I5AA 5H1SV 1WC4A 1RT6B 3JS9A 1KWMA 5J2MA 2ZC4A 1QSYA 1HWIA 2BKNA 2ASLA 1WWHA 2GQ2A 1IKWB 1XN9A 3KDOA 5F8LA 2IJFA 3UN3A 4L74A 1AW0A 3ENQA 4QU6A 1LWEA 3POTA 1S5ZA 1TL5A 5K5MA 2ZJRQ 3JSBA 1W7WA 4CH0S 2M2BA 4NEYA 4CO4A 2AGQA 3GV8B 3TRGA 3W5YA 4JI7J 4Y3CA 1MROB 1WI6A 1RXOB 3MM6A 4USVA 2JLFA 1RAOA 1EETB 3MM8A 4OYAA 3CD0A 1TV6B 2CJKA 3GE9A 1RTHA 4OZ5A 1KQKA 3PM9A 1PSDA 4B3TJ 3C6TA 4A8WA 2AYMA 4ZVHA 3I96A 4L76A 4DEZA 4ZCIA 1WF2A 2ROPA 1QM9A 1RAHB 2DR5A 1PYSB 4WKYA 3NMRA 2XS2A 4C8NA 2IBOA 1MNEA 4KGXB 4LRAA 1MLAA 5KTQA 2C3UA 4CH1A 5IWAJ 1R27B 1R6VA 1B0PA 1FRXA 4DX6A 1FXDA 4QR1A 3FZ2A 4DR6F 3H0PA 3W66A 1Q5YA 1RK8A 4TLQA 2NREA 5J2QB 5L1IA 1X8DA 1RT6A 4LF6F 1IN0A 1UVKA 3TVZA 1QLNA 3CCMS 3CMQA 1J5EJ 1Q7LB 1JK9B 1EHWA 2MLXA 4P9SA 4FF2A 2VQEF 4JOUA 3D1HA 4O4GB 4WYWA 3DI6B 4NI2B 4PUOA 3TQ1A 1UPMB 2F1FA 1EQ0A 3HF5A 5HJYA 2QA4G 2BM0A 1SVDA 2A1BA 3K8WA 5HMWA 5JUMA 1O8BA 3K17A 4F8RA 3JQMA 2E7VA 3OTOJ 2K8GA 5KFLA 1UL3A 2OSRA 4UTGA 1LWXA 2C1EB 3HM9A 4X84A 4Y00A 2GV1A 1EETA 1RU1A 1YG0A 3TUPA 2N7CA 1TV6A 3RB0A 3GJSB 2WHOA 4DS5A 3MAAB 1Q5VA 4P6QA 1FF2A 3DC2A 1KONA 4M5JA 4CTAA 2M4MA 4OFZA 2C2DA 2ZC3A 3HHDA 2RNEA 1N6QB 3CC7S 2HBRB 2IBKA 2J7KA 4TQRA 4OYOA 1BQNB 2DRBA 4MAKA 5LJ5Y 5B0BA 3NNHA 4J9LA 1RWUA 1CEZA 2GMLA 4USTA 1CJUB 1BUXA 3EGVA 1NEEA 1F6TA 3LOUA 1OIAA 2K3IA 2W9BB 2R2RA 2E44A 3T6BA 1DRZA 4F26A 3DOMB 3H4DA 3IR7B 3NOCA 2DYAA 3ET6A 4DV3F 1HBNB 3M30B 3OHBA 2FGOA 2O66A 1KVIA 3BB5A 2IMWP 3VGVA 5AJ3F 1PKUA 3KMQA 2AEFA 3HFVA 3BSAA 1HD1A 4IG3B 2C2KB 2M5YA 2QLXA 3HVAA 4A4JA 4LFAJ 2BQRA 1SQGA 4GRSA 1OY8A 2ROGA 4QYZK 3WHIA 2HMIA 2JEIA 1X4DA 5K8PA 2BV3A 2OP5A 2ILZA 2CDQA 1WHWA 1MMLA 4FN5A 2WSEC 1IKXA 1JX4A 4WK3A 1TAQA 4DR5J 2HAFA 2JEFA 4DSJA 2B9YA 3MAAA 2XMJA 4I1TA 3H90A 4M5GA 1S97A 1W26A 1N6QA 3M32B 3MM7B 2A2CA 5FDLB 3V81B 1UWBA 1ITPA 5K9FA 3VGTA 4FYDA 2V6AA 3I9V9 2LCWA 5A8RA 2XHCA 1YBTA 2HVEA 2VQFF 2FPHX 3IGVA 1FFWB 3MPDA 2LQ8A 1VQKS 2DNQA 4P75A 4DL5A 2VC0A 4ECSA 3ZNJ1 3VAJA 2MKYA 3L95X 2W9BA 4EMDA 4L3KA 3ZC4A 3FBBA 4QYRA 4QR0A 3A8KA 2HHHF 3DOMA 3OSNA 3I0SB 3OR2B 3FC9A 5C24A 3ONQA 2CNLB 5A6WA 3M30A 2ZJQQ 4WFBQ 5A0YA 4A48A 3L3CA 5F9NA 2BX6A 5J2PB 5JVGQ 2ASYA 4NZ7A 4IG3A 2V8GA 3UCZP 1Y5IB 4WFAQ 2J0QD 2XEXA 1G6BA 2O67A 4EBCA 3OL8A 2YKOA 4X4VA 3Q83A 1H2UX 2ZH6A 1UW9A 4QIGA 3HD2A 2XI2A 3E01B 4NLUA 3KLGA 1CQNA 3QGHA 2KT2A 1S12A 4R0JA 1OY6A 3R97A 1ZZFA 5KFXA 3M32A 1ZPWX 4RR5A 4U8VA 4A46A 1S0VA 2DPJA 3CJ0A 1OSDA 2ZKTA 2YWHA 3LPYA 5B0CA 3NNCA 3QZ7A 2ZZTA 2LMIA 2BXJA 3JSYA 2WRMA 4JI8J 1S7IA 1C1CB 3C16B 4YS2A 1FK9B 1S0OA 4P7VA 5DG7A 3IGNA 1XR6A 3IWLA 4QPXA 3VR1A 2LDIA 3OR2A 2R8JA 1TL7B 1I5OB 4FP9A 4JYAJ 4LRCA 5LSOA 4CO5A 1UVLA 3OR1B 2LFVA 3IN5A 2AV5A 1SKRA 1EX8A 2GVDB 3PW5A 3U1LA 1FRKA 5J2PA 3EWGA 1FVSA 4A8YA 3T5JA 3NGUA 4MKVA 1GAOA 4FF1A 2ADBA 1G2EA 3AXMA 3Q2TC 2L9WA 1HWUA 2YH1A 1A0OB 1CG2A 2ALYB 1U49A 1YQHA 4DL2A 2BJDA 2YVSA 4DU7A 3SYZA 1H98A 4DF4A 5KFIA 3E01A 4RNHA 3RAXA 3P49B 2CQ1A 2PEHA 3E2EA 1HNZJ 1UAWA 4NMLA 3EGZA 3PYFA 2CQGA 2DT9A 1TL1A 1U4BA 4DV5J 3CULA 2GHWA 1RADB 1DQ8A 5HVGA 4FBTA 3UCUP 3W1YC 4OMFG 2IRUA 2AX0A 5IZHA 1QTNB 3TP2A 3HI9A 3D5MA 2B7BB 2DH7A 2ZJPQ 4C8OA 1YWXA 3ISZA 1RBOB 1C1CA 4B3OB 1W25A 3C16A 4J91A 3MOZA 2DR9A 3DRPB 3MDFA 3K5MA 3K89A 4NZ0A 3V4MA 4QW9A 1LFPA 1AUSL 2FDNA 4QIVA 4QW8A 4IKAA 1GQEA 2QT7A 1BHNA 1TL7A 2I38A 3CCES 4N41A 3RG6A 4JI8F 1FNMA 3OR1A 4DL0C 1W2IA 5HLFA 2AJ2A 2RILA 2DNZA 1FRHA 4KV8B 2XSJB 1QAXA 5F3TA 2KJWA 1Q79A 2DHXA 3QLHA 3VCDA 2HZCA 1J5OA 1X4HA 5CCMA 1SJQA 4MKAA 1TL4A 4RU2A 2P9CA 3J7AN 5L9NA 2YKMA 3C3LA 2Y8WA 3MECA 3X3UA 4NLXA 1WOSA 2AEMA 1JLQB 2VFVA 5B0GA 1SJ3P 2MSTA 3AJ1A 2NXNA 3LP2A 1H72C 3N6NA 2V68A 3WC0A 3SCKE 3C19A 1UEUA 1TUVA 2VPZB 3GMGA 4I64A 5D15A 4PQUA 1U0SA 5H9FK 4ED3A 5E41A 4X4QA 1V5VA 4ICLA 1N5VA 4ZP8A 1VRUB 5J1NA 1FXRA 1YJWS 4LF2A 1HNZF 1RWOB 3RU0A 3HVTB 2UXBF 3QATA 4TY8B 4NLDA 4O0IA 2F9JA 1K47A 2VG7B 4IFYB 1WKKA 4DV5F 1M90T 2QJ3A 3GP9A 4DV4J 1M1HA 1T05B 1WC5A 3MCSA 3DRPA 2V94A 5A6PA 4R8UB 3QRPA 1RT1A 5JXSA 3T41A 1FD2A 3PIOQ 2JDJA 4DHVA 1RQ0A 3CDEA 2FJBB 1RYSA 3IBWA 1TMMA 2DHSA 1S6UA 2CQHA 3FK4A 2A3JA 3LUYA 3N6MA 3D0IE 2A18A 4KV8A 3BQ1A 3NBPB 2RQKA 3OUYA 3IM9A 4BWMA 3KJNB 1HWLA 1MSWD 2MSSA 1RAAB 1FD8A 3IR5B 1S10A 2OSQA 3VTIA 4FDFA 3UCGA 1JLQA 4HR2A 4I2QB 4ED8A 5KG7A 2HHSA 2OPSB 3O8WA 2K1RA 3A3PB 3TEGA 3Q22A 1WHYA 3QIPA 1LWCA 2BJ1A 2F5GA 4IRDA 2X51A 2KHCA 1SL2A 2V8DA 1IBKJ 1YJ9S 2R8IA 2OKQA 1VRUA 3WX8A 4OJHA 2YNFB 4WXWA 3HVTA 4OI1A 3UWTA 3LGNA 4TY8A 2VG7A 1RT4A 4IFYA 4CIOA 2G2YA 1A9NB 5DG9A 1Q4RA 4MIBA 4YUDA 4FVMA 1JJCB 2MEWA 4ZVRB 4J37A 3RRKA 1M5PC 1YK9A 5D6GA 2XSFA 2J5AA 2MZTA 3OT9A 3OXGA 1NB7A 1H0HB 5CABA 5H9EJ 1HA1A 5HMZA 1JLCB 2V2VA 4AL6A 2J0WA 2V9KA 7AT1B 3ILLA 3M8QB 1Y9OA 1GT8A 1CQMA 3NGDA 3G87A 3NBPA 5LMUF 3MM5A 4J9MA 2PA8D 3KKFA 2QC3A 2XM3A 4B9NA 1YI2S 3KUHA 3I6PA 2E7XA 1BMQB 4CO3A 2C2OB 1RAJA 2V2KA 4I2QA 1KC8T 3R3TA 4BS2A 2BOPA 3N6LA 4DQPA 5EX0A 4DZDA 1NK5A 4OYIA 4C48A 1VQNS 2CVIA 4RW4B 4A8FA 3NL0A 1UVMA 4DOZA 4GVBB 1RAEB 3BDEA 4JI4F 1WOPA 4BCAA 3TZZA 3H59A 1X4FA 2BQ3A 3RR8A 1K73T 3DLKB 4N8OA 2HFUA 2B9EA 2GJ2A 5HBMB 3EVWA 2B6AB 1JLGA 2CZVC 2EK6A 3N01A 3OTEA 2YY3A 3L7OA 5J1PA 3MD3A 3L7PA 2LXFA 2NUHA 3RRHA 3N5FA 5CD4A 2V69A 1NKCA 2IJRA 2P8IA 3VAHA 2KYZA 4LRFA 2DNYA 4M1KA 3H42A 3EJMA 4DL4A 2OPPB 5KT3A 1HBUA 5E0OA 3K0JA 3I0RA 4IRCA 1C4CA 3TOQA 3TZYA 2X1FA 1FE0A 5C2GA 2R8KA 2C28A 2C3YA 1TP7A 4OLPA 4HI1A 2HURA 2E5HA 1E6YB 3N79A 3NWGA 4IQMA 5HSPA 5CCLA 4QU7A 2XYPB 2XYHB 1UMJA 3MEDA 3C6UB 1Q16B 3KLIB 1SJRA 3OFEA 4D3GA 4C0OC 2DB1A 2VFTA 3KK3B 3PRVA 2EFNA 5T7LB 2DGVA 3HP6A 4PXEA 3MM9B 2BJ3A 4TU7A 1O51A 2WB4A 4LF8J 2FVSA 2JFKA 4CT8A 2KO1A 2LQBA 2XMWA 1JNZB 2KL8A 2GGPB 4F04B 2G1HA 1UVNA 4ZKAA 5GAHU 1H2TZ 1U1LA 1XERA 5EGYA 5C42A 4F4WA 1QSLA 2BJ9A 4PCQA 4KJIA 2RHSB 3SSSA 4KPYA 2J9CA 4OZLA 2KN4A 4X4SA 1VIOA 3L7UA 1O6XA 4RW6B 3IAM9 2ZH7A 2Y1JA 2F8HA 1HL6A 3TZWA 2HSEB 2GQQA 3ZZRA 1IKYB 2C2EA 2Y1LB 3CD6S 5DLGA 5E3PA 2IM3A 1U26A 4PYDA 3ZTOA 1YVFA 1BC6A 2W9AA 2XTJP 4WU2A 4H4MB 3NGTA 3GFHA 2KH9A 2XULA 1YJTA 4OI4A 3AA8A 2UXCJ 3PRBA 5KFPA 2YQ1A 4DV2J 1OPIA 4TVAB 4DR7F 2HVHA 2EVZA 3BN7A 3VHQA 2AWZA 3C6UA 1UVJA 1S6OA 3KLIA 1MG7A 3V5RA 2UZAA 2R8GA 2NLWA 3W8GA 1OS5A 3KLHB 3KK3A 4K2XA 5CYMA 4OI6A 1QAYA 3OVAA 2IC3B 4GMKA
chains in the Genus database with same CATH topology
1S1XA 3HHNB 3OVBA 4Q7AA 3T1YF 3MM9A 2VV5A 3I82A 2FVCA 1K1QA 2MY8A 3TW0A 5GAEI 2ZZMA 3HLUA 5E3RA 2HG4A 3TVKA 4CH7A 3DOKA 4W92B 4YB5A 4IRKA 3EXYA 1UWBB 3M8PA 5KFHA 3M1VB 4DR4F 5E7OB 1FTRA 1URNA 3NP5A 1FTCA 1GXTA 4B3OA 2I1RA 2MXYA 4WZMA 2CPJA 4XPEA 3I55S 2CIMA 5A8RB 1VQ4S 3BDPA 1M5SA 5D4OA 1TK5A 3RRGA 4PQAA 3QGIA 4WKRA 3GFYA 3CDUA 3GB0A 1SKSA 3K5PA 5DDOC 1QSSA 4B3TF 1OO0B 1OQ6A 3R5CA 3J7ZT 1YJRA 1OSCA 4C0BA 4BHQA 1V3ZA 2RMLA 1XMBA 2HWIA 3KYLA 3GIIA 1SIZA 2IMOA 5LSLA 3TAPA 2JHEA 2VL1A 2YKNB 3TX8A 2KG1A 1LW0B 4DN0A 1N5QA 5CHCB 4FBUA 1N34F 2RU9A 2D7SA 2NXUA 2HW3A 3PACA 2HRYA 4G1QA 4DL7A 3V4IA 1F5BA 2VPWB 4DV1F 4DL3A 1U1QA 1D9FA 4MH8A 5I3UB 2KKHA 4FS2A 3QJLA 1U6ZA 2JRSA 4KE5A 4NCGB 2CPZA 2XWXA 4O3PA 3HKWA 4IDKA 4DJBA 3K5LA 4WIIA 4EYIB 3M2UB 2DR7A 4U7UK 5B08A 1FRIA 3GFXA 3H40A 3SI8A 5IWAF 3DLBA 4OHYA 2IRXA 2N82B 2J6TA 3FQKA 3KLVA 2NUUG 4A8QA 1KRPA 5C24B 3HHLA 3MMCB 4QR2A 4NOHA 1S48A 2N3LA 2XSJA 5KOXA 4LF4F 1QAIA 5DM6Q 2M70A 4WFNQ 3G4SS 3PX6A 1RI7A 2I0XA 4LT6A 3KLEB 1SIWB 3HKZD 2VA3A 1IKYA 7FDRA 1RA7A 3J80Y 1P1TA 1LQ9A 1FKAF 3DDKA 4G1PA 2CQCA 4NRUA 3AA9A 2B7CB 2OLWA 2WONB 3M05A 4ZPCA 1KN6A 4B9UA 1VGYA 3PJXA 2P6TA 5A0YB 3CVKA 2WAQD 2ZVSA 4YDDB 5K8MA 3MAQA 4KBIA 3H2VE 3MMAA 2HHQA 3MEEA 4A47A 5L9XA 1R6YA 1N4LA 2E9RX 1U47A 3NS6A 3D1QA 5BR8F 3LAMA 2UVRA 1HNWF 4HHJA 2UXDF 4MK8A 2RIJA 4ECTA 3Q2SC 2FIUA 2RS2A 2XNRA 1H3DA 1J5EF 1DJ0A 3J7A1 4K4YA 3BS9A 2COLA 3VWSA 3T1HF 1JLBB 4ES3A 3TI0A 4TNOA 3QPIA 1P27B 3UDCA 4B08A 4HEA9 2ZOGA 2G9OA 1MMDA 1N88A 2HVZA 4NA2A 2P5VA 1V6HA 2BR0A 4DF8A 3R5BA 3JAMY 2L48A 1P8GA 3GYNA 4ZLPA 4R5PB 2DPIA 5IM0A 3LGMA 5BYSA 4ZVFA 4I7FB 4KGMA 4DL6A 1DARA 1T3OA 4DX8H 2BE2B 5AXKA 3SCIE 2R2UA 4ED7A 3S7RA 1X4EA 2DGTA 1C0TA 2XLKA 1JLEB 3B4MA 4OHWA 4OX6A 3KLGB 2OFGX 1WG5A 4MK9A 4X4NA 2MKHA 3TAMB 3GIMA 1TAUA 2MZRA 4RW7B 4O4RA 1N54B 3OFHA 5EX3A 2DGWA 3MUVP 2RF2A 3T3FA 3MR3A 2DNRA 3OTDA 2CQ0A 3GZ7A 2G4BA 4Q45A 1X0FA 1NK8A 1MWYA 2R7UA 4Q0BA 4Y2CA 2AJ1A 1KR4A 3DGPA 4H4KA 3QO9B 1VRTB 4TN2A 4KR0B 1MW7A 3MFIA 4RNNA 2FJWA 3TARA 2YKAA 1Y5NB 1I6JA 2B9WA 5EUHA 1VI7A 3PJWA 3JYTB 3OTOF 5DRKA 2FJEB 4ZPAA 5LT5A 3DN9A 4C8LA 2NSBA 2HAIA 4UUWA 2R7OA 1LKZA 2B0GA 3LQVA 5CZVA 1F9FA 2MZQA 3CDAA 3NAHA 1M1KT 4H4OB 2W9CB 3M2RB 2VODA 3P5TL 4CI0B 5IT4A 2F3JA 4C3LA 4DFJA 4C97A 5L1KA 1TQLA 3HT3A 1FDBA 2J9DE 3M1VA 2V8VA 3TANA 3A8EA 3C66A 2XNQA 3CCQS 1T05A 1Y0HA 3W7BA 1H6KX 4LUBA 1NJYA 1CC8A 1Q81T 4FXWA 3FGVA 2N7YA 1S77D 2EI5A 2Q43A 3H98A 4R8UA 2J0SD 5IT0A 4QOTA 3T6JA 3EXCX 1QUPA 4ZA1A 1K0VA 4BBYA 2K2PA 4K59A 3G96A 2W7OA 1UJ6A 2W4DA 1S79A 3H25A 3S01A 1R43A 2E29A 2QMXA 2BRKA 2R7TA 2IVMA 1LW0A 1PC4A 4USJC 2HGNA 4R25A 4O3OA 3RB3A 1U1RA 1SH0A 1PO6A 1T8EA 1KQFB 3LP1B 5K14B 4B3RF 3AY0A 5L8RC 5L1JA 4OHVA 1S6QB 2V4QA 3CUNA 3EGNA 5I3UA 3UI3A 3VF0B 2KVIA 2ZM6F 3PEHA 3IRXA 1UFWA 4NCGA 1NZAA 2E1RA 4TYBA 1JLFB 4I68A 5B0DA 4DFMA 2BJEA 4QWAA 2VZ9A 3IA0A 2ASDA 4K4TA 4OL8A 2HFZA 5J2MB 5DS7A 1F5CA 2NS1B 2L41A 2RB7A 1AROP 4B9SA 4FPRA 4PG5A 3UNGC 2AYGA 1HR0F 2FD2A 4EZ9A 2DNKA 3H5UA 1YJNS 2LA6A 4OI2A 4NYPA 1NHUA 1SB6A 2B4OA 1NRKA 5KFNA 2HGMA 2VBYA 1ROFA 2DGOA 4DR2F 2B4PA 1PILA 2H9ZA 2VOOA 1LW2B 3KG1A 1U6BA 4KAIA 3Q8QB 4WE1B 4AQYF 2UUCF 1UFLA 2MQNA 4PG4A 2DGUA 3OXFA 1VBYA 2UVVA 3HHLD 2MGZB 1LWEB 4RWXA 2UUTA 1X4CA 4OZ1A 4XPCA 3B4DA 2GQCA 2Y1RI 1JJHA 1VQ7S 4JV1A 3THVA 4OJ1A 1IXKA 2FJAB 2CYYA 4UUXA 2ZOFA 3UD4P 2D74B 2V4JB 1LXJA 2B43A 4L6V3 2DNMA 3V6JA 3NCQA 2AJ0A 2O01C 4ZPBA 4JI3F 4RX6A 1RA6A 2IYIA 1JLBA 2PO4A 4QIEA 4O3RA 5CD4H 2OTJS 5J1EA 2OPSA 3LF0A 4OLOA 4C9DA 3NG8A 1C2PA 1H7WA 2Q1LA 1N0UA 2X3GA 3ICLA 5AE2A 4YQWA 3Q23A 2R2TA 4R5PA 3U1MA 4NCAA 4ES1A 1YRTA 4GKKF 4C8MA 3VAKA 2CVEA 3VAFA 5D3GB 5AE1A 1ZAWA 4MJKA 3KG4A 4F3QA 5B0FA 2CQ3A 1D9AA 1JLEA 2LEAA 1UEVA 4N77A 1LWFA 4U6PA 2W8KA 2KXNB 2L08A 5DGBA 1UW4A 2E1AA 3M6UA 3BGFA 4NL5A 4QIWD 2HGLA 5IS2A 4QWEA 1KQSR 5DJBA 2A10A 3MM8B 3NKYA 4LFAF 4DBQA 1IKVB 1BQMB 3M6XA 3CJ2A 2KM8B 4DN9A 4N56A 3HX9A 3QJJA 2FJDB 2OPQA 1VRTA 2P6SA 1N8RT 3CWJA 4B3SF 4K4SA 1X7VA 1JXLA 3C6TB 4ETZA 4F3OA 1ULRA 1HW8A 2DIUA 1TL1B 2HQIA 1WG4A 2YNFA 3RW7A 5F8MA 3IWNC 4LVNP 1X5PA 4NLRA 4DQQA 2AD9A 3I32A 5CXTA 1HYSA 5ITHA 4QYZJ 4H4OA 4ZHRB 4DQSA 3CTRA 3MTJA 2CJAA 4KHMA 4EZ6A 2MHNA 2EFQA 4CT9A 1O5JA 4KKOA 1FNXH 1HHTP 1LFWA 2CPYA 2JOQA 1YITS 2FY1A 1WF1A 4USHA 2J8AA 2P9EA 4I6YA 5KFUA 2O5DA 4L72B 2XMUA 4UQGA 4DV6F 4F50A 3HJFA 1GTHA 4DR5F 2PSZA 3BGRB 1JJ4A 1VC6A 1IBLF 1N56A 1AUDA 4DUYF 3UR0A 1U1PA 2HHVA 1U24A 3QAEA 3RZAA 1HFEL 4JV5F 1FE4A 2WBMA 2RJZA 4TU8A 2Q3PA 2LXIA 3MD1A 3CCSS 2JWNA 4M95A 5JJBA 3PX4A 1S72S 1SXLA 1U7LA 2QA1A 2UV8A 1ZM2A 2VPXB 5THWA 2KU7A 4DPOA 5KFGA 5KFQA 3V6HA 4NXMF 4ZCKA 4DG1B 3FMBA 5K14A 1FJ7A 1TKDA 1FA0A 1N32F 1S6QA 2EBEA 2GW8A 3HPOA 2ERRA 3I5AA 2RRBA 4RW9B