3OW3A

Discovery of dihydrothieno- and dihydrofuropyrimidines as potent pan akt inhibitors
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
336
structure length
334
Chain Sequence
VKEFLAKAKEDFLKKWETPSQNTAQLDQFDRIKTLGTGSFGRVMLVKHKESGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVMEYVAGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTWLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVINEKCGKEFTEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords cAMP-dependent protein kinase catalytic subunit alpha
publication title Discovery of dihydrothieno- and dihydrofuropyrimidines as potent pan Akt inhibitors.
pubmed doi rcsb
source organism Mus musculus
total genus 110
structure length 334
sequence length 336
ec nomenclature ec 2.7.11.11: cAMP-dependent protein kinase.
pdb deposition date 2010-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3ow3A01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3ow3A02
3SV0A 4IB0A 5GZ8A 1YHVA 2XK9A 3GU4A 4FKRA 2Z7QA 4FNYA 2W05A 4GFMA 3WZEA 1QPCA 4GJ2A 2VN9A 4GYGA 4F6UA 3ODZX 2Y4IB 3BE9A 3ZUVA 4ASDA 2Z8CA 4FKLA 2BFXA 4S2ZA 2C5NA 1JSTA 1YKRA 4NIFA 2YN8A 3QGWA 5HIBA 4RJ8A 4FKTA 1ZZLA 3NIZA 2WMSA 3AC8A 3BGZA 4YPSA 5HU3A 3NEWA 4IX6A 4IMYA 5HG5A 5JH6A 4G31A 3HRBA 2ITOA 4V0GB 5LMKA 2ZJWA 3RK7A 3A61A 2BRNA 2ERKA 4PDYA 3KN6A 4LGDA 3HVCA 3DB6A 4D4RA 3E8EA 3BEGA 5G6VA 4AACA 2E2BA 2P4IA 3BLRA 3TV4A 1KSWA 3ID6C 2YACA 5K4JA 3LLAA 4E6DA 4BR3A 2VO7A 3ZBFA 4L9IA 5IMXA 4MNFA 1ZMWA 4QMVA 4GVJA 1H0WA 3R7GA 4UV0A 4BCPA 2OLCA 3UNJA 1F3MC 1ZXEA 2ZVAA 3SRVB 4C37A 3FMEA 2GFCA 3A8XA 1JVPP 4JBQA 4ZEGA 4LG4A 5HCYA 4BCQA 3MA3A 3FZPA 2WPAA 4K0YA 4MWHA 2GNJA 2QKWB 3EFJA 3PJCA 5DWRA 4EI4A 2UZVA 3L1SA 3BE2A 3GCSA 1FPUA 5TE0A 2R3FA 3OWLA 3R1QA 4I92A 2QG5A 2R3RA 4FUXA 2J9MA 3AT3A 3DNDA 3RHXA 4PMMA 2JFMA 3LOKA 3U6JA 3AGLA 4FG7A 2BROA 4F64A 1VZOA 2RFSA 3EQFA 5HBEA 3ZRKA 3DDQA 4C3PA 1Q8ZA 3FQSA 1Y91A 2UW6A 3MV5A 4IIRA 2FSMX 2WFYA 3R0TA 4G6OA 4YUQA 4NFNA 3ZO3A 4PPBA 3UIUA 4A9YA 5FDXA 4XOZA 5IEYA 2BR1A 4JIAA 4QYYA 2ITQA 2PY3A 3PA4A 4EUUA 3CLYA 2ZM1A 4FTTA 4M7IA 4USEA 3ZUUA 2HZNA 5CEOA 2PE0A 4HJOA 5A6NA 1QMZA 3RK5A 3QHRA 4DT8A 5L2IA 4BDGA 2XBJA 4YTFA 2B52A 5AIRA 3VWAA 3MJ1A 3RPYA 3E3BX 3QQUA 4D9UA 1OKYA 4FSTA 1FBNA 5J7HA 4APCA 2I0YA 5IQDA 3OT3A 4A4OA 3PIYA 2ITWA 4O0VA 4C0TA 2UW9A 1X8BA 5D7VA 1F5QA 2XIYA 1UU3A 3F9NA 2Z2WA 2C6KA 4IX3A 2PZ5A 1OL1A 3DZOA 4DCAA 3L9MA 3JYAA 4EHGA 4F9CA 4ZLYA 3OWPA 3GQIA 3FKLA 3AQVA 3IW8A 2V7AA 4KS7A 2SRCA 2WXVA 4PTGA 4RWKA 2R3KA 1GNGA 2GHLA 3F3VA 3FZOA 3I6UA 5ETCA 3FMHA 3R8MA 3CGFA 4XUFA 1PY5A 4O7YA 2C3IB 5AA9A 2X39A 2YWPA 3O7LB 4X21A 3IDPA 2Q0BA 3MFSA 2IN6A 4YGAA 4D1XA 4J8NA 4O1OA 1T46A 3EQCA 5CI7A 3DPKA 4BDFA 2OFUA 4UX9A 5EM5A 4MBLA 4BZNA 1OL2A 5EYCA 4EOJA 4X6QC 2OICA 3UIBA 3ZLSA 5LWMA 4BDKA 4F7NA 3D7ZA 3PJ1A 4FV5A 2C5YA 3LE6A 3ZO4A 3W32A 2OF2A 1W0XC 3KRLA 3VBXA 1R3CA 1KV1A 1P14A 5AUZA 4KD1A 5LCKA 2X0GA 2PZRA 2WMVA 4G3EA 4JDJA 1NY3A 3VUDA 4WUAA 2KTYA 3VBTA 5HNIX 4QMYA 4BDDA 2OZOA 2WQMA 1O6YA 2OF4A 3QCQA 4TNDA 3T3UA 4F99A 4FKGA 2HY81 3TIZA 2E9NA 1JBPE 4IDVA 2WO6A 4A9UA 4RFMA 5DE2A 1F0QA 1XQZA 1H1PA 2BRBA 4FVQA 2OFVA 2CKOA 4EH4A 4UALA 2W5BA 3BHHA 1U4DA 1P4OA 2R3IA 4NK9A 5CLPA 3SW7A 3Q4CA 1NW1A 4YTCA 4FT3A 5CSVA 3ACJA 3CJGA 5FTQA 3RHKA 2PVRA 4JVGA 4E6CA 4XOYA 5EDPA 4RRVA 4I23A 4M84A 3P7BA 4CD0A 4F7JA 5J8IA 3K3IA 4QP4A 5CAQA 2PSQA 3BQRA 3QZFA 3KN5A 4BCKA 4L44A 1BX6A 3QWKA 4FKSA 2GHGA 4RT7A 2C0TA 5FM3A 5CENA 4QQTA 3HDNA 1KOAA 3ZLXA 4UY9A 1ZYCA 4XLVA 5HOAA 4AZFA 3EQGA 3QLGA 4BHNA 4H05A 1ZMVA 4FNZA 2RF9A 4ZY4A 3FYKX 5KO1A 3UQFA 4FIJA 5EHOA 3GOKA 5DH3A 3DTWA 4I94A 4UXQA 4XG4A 3PLAE 4O81A 3GENA 3MVMA 3OBGA 3W33A 3MPAA 5IQHA 2JLDA 3PA5A 3MTFA 5IQCA 4IZ5A 3SOCA 3N9XA 4F0IA 3HMIA 2JIVA 3FLNC 2G9XA 1CTPE 4H1JA 2CJMA 3DA6A 4GCJA 3ZEPA 5M07A 5M08A 2OZAA 5K3YA 3NPCA 3QXOA 3TWJA 5GIOE 2W7XA 2R3OA 3ENHA 3OCBA 4KSPA 5JKGA 3DXPA 2EXEA 2VTSA 4M69B 3NAYA 1IAJA 3KF4A 4XP0A 4AA0A 4BWKA 4HW7A 2B0QA 3FHIA 3TCPA 2YJSA 3VC4A 1A9UA 4M8TA 3O8UA 2FYSA 2QI8A 2GNFA 5AP5A 3LW0A 4R5SA 3OOMA 1H1WA 4OTFA 5ETAA 5IPJA 3HV3A 5ANIA 2JEDA 3RPSA 3SD0A 3LXPA 3QUDA 4ERWA 4JDIA 3UGCA 5A4EA 2R3LA 2C3KA 1OKZA 3M1SA 3EFKA 3BGPA 4O0YA 5CS6A 1Q4LA 2WGJA 3OUNB 2V22A 4RIWA 3SQQA 4E8AA 2BIKB 5IKWA 1IRKA 3OXTA 5L2SA 5H9BA 4WSYA 4FEVA 5IDPA 2ZM4A 4GJ3A 4JBPA 4C4EA 2XNBA 5EI2A 4EOQA 2QOOA 2QOLA 4DFLA 3LXKA 4M97A 5L2QA 3WF8A 4JG7A 3OT8A 4BDAA 3UPZA 3F7ZA 2X9EA 2YM5A 3S00A 3I1AA 3UQCA 2VV9A 4RA5A 3S0OA 1PYXA 5FEEA 3WZDA 3NVKI 3PZHA 3Q52A 4G34A 5CZIA 1QPJA 5H8EA 4A4LA 4AGUA 2C6EA 5M4CA 4HGTA 4AT5A 4EWHA 2UVXA 4I0TA 3DQXA 4YC3A 3FE3A 3NUYA 4ZMEA 4DLJA 4V04A 3P4KA 4FK3A 4QYGA 2QO7A 3HV6A 4CEGA 3TL8A 3ULIA 1H07A 2BMCA 5LMBA 2QO9A 2B9FA 3MSSA 4BDHA 4EQUA 1R39A 4RFYA 4FT5A 4TYIA 2CHLA 5IG1A 4IC8A 4Z7HA 2PZIA 4KBAA 1KOBA 4QMWA 1APME 5HD7A 3O50A 3U87A 3AG9A 2YLFA 2UVZA 2WU7A 3AC1A 3FI4A 4KRDA 4PX6A 5EDQA 3FPQA 1YXUA 1OB3A 1TKIA 4M0YA 2XM9A 1SYKA 2YM7A 2J6MA 5LVPA 1WBTA 4IANA 4PWNA 2C1AA 4IB3A 4LFIA 4QMSA 2UZTA 4TRLA 3KY2A 4DG0E 3Q96A 4ZZOA 2C47A 2BRHA 4QMOA 5EKOA 4L52A 1ZOEA 5ETFA 4YHFA 1NT2A 4RJ6A 2JD5A 2Y4IC 2W1HA 3HP2A 4FIFA 3AMYA 5CALA 4MF1A 5IISA 4FTLA 4O84A 3GB2A 2IO6A 3Q5IA 3RCJA 5LVLA 1OIQA 3QF9A 3IOPA 4EZ5A 2XM8A 4NCTC 1JKTA 1PXNA 1UU7A 3CXWA 5IU2A 4CCBA 4RVLA 4FSZA 1SMHA 3PY1A 5J5TA 4YZBA 5BVOA 3PXYA 2VRXA 2XZSA 2O8YA 3LFSA 3HZTA 3PJ8A 2PL0A 1ZY5A 2R0UA 3UNZA 3ANQA 1YXXA 4JLCA 1BUHA 1E9HA 3OFMA 4UYNA 4HZRA 3QQHA 2JDOA 4FC0A 3AMAA 4GIHA 5HICA 3VUGA 4BWPA 1O6KA 5A4LA 2IVSA 1URWA 4E26A 2W5AA 4CZYB 5E91A 4E5WA 4FA2A 4KB8A 2C5VA 1WZYA 3FUPA 3W55A 2XJ0A 4FYOA 3LMHA 2GPHA 3KK8A 1PXMA 1WAKA 3CQWA 4DG2E 2VWZA 3FHRA 4MXXA 3RKBA 4LRKA 4FI1A 3IPHA 4AN2A 4ZP5A 3R7OA 3R04A 2OO8X 1KUTA 4IFGA 5K0KA 3RPRA 3JS2A 2WTJA 4ORKA 1Y6BA 4LGGA 5AV3A 3W2RA 4CKIA 2QHMA 4IAAA 4FTRA 4BZDA 2OH0E 1K9AA 1MQBA 2O3PA 5ANJA 3QC4A 5DR2A 5EQPA 1U5RA 2BDWA 3QQGA 5JFWA 3H9RA 3QUEA 4RPVA 4EOIA 2QONA 4MVFA 3ZSHA 2H8HA 2JFLA 3QC9A 4AZWA 4K9YA 4TZRA 1IA8A 3BWFA 3W18A 2B55A 2DQ7X 3FY2A 3MB6A 4C61A 3WILA 1H24A 5M44A 4AAAA 2I0VA 5DPVA 2QQ7A 3UYTA 3UO4A 4BYIA 4UMPA 1H1SA 4BWXA 1M17A 2X7OA 3EH9A 1M2QA 4FBXA 4WG4A 3U9NA 3TKHA 4ANMA 2BALA 4ERKA 3ROYA 3MH2A 5FD2A 4C38A 3Q32A 4YPDA 3W2QA 4NZWB 1WBOA 4LMUA 4FICA 4MCVA 1ZYSA 4EBWA 4NJ3A 5AEPA 4X3FA 4XX9A 4IVAA 3WZUA 3FLWA 1PKGA 3SX9A 5CSWA 2CKPA 3K2LA 3DAEA 1Y8YA 1PRYA 2VTIA 5B2MA 4K18A 2EXMA 2VWBA 2CNUA 4JJRA 3HA8A 3HV7A 5GJGA 2ITPA 3NAXA 1ZYJA 4H3PA 3OCSA 4R3RA 2F57A 4GMYA 3UG2A 4L3PA 1ZY4A 2RIOA 4CCUA 4EK8A 3LPBA 3V5JA 2BZHB 4D0XA 4AFJA 3KK9A 1WVWA 1SNUA 2QNJA 3DBDA 4F63A 5D9HA 4WA9A 4OAVB 1J1BA 2VUWA 4AN3A 5E7RA 1U5QA 4CKJA 1YXSA 4EHEA 2WTWA 2BKKA 4LL0A 3C7QA 5DRDA 3G15A 3E8CA 4BCJA 5CTPA 3BYVA 3IGGA 1Q3WA 1RJBA 2C6LA 4V0GA 3RI1A 4BRXA 4PRJA 4RJ4A 4EH5A 4JRNA 4XV3A 2F49A 2W4JA 5CF4A 3P78A 3KMMA 2QO2A 1U46A 3QTXA 4NH1A 3FZTA 3GC9A 4CV8A 3HV4A 3NNXA 4FTMA 2HIWA 4E5BA 3MA6A 1YOLA 2OJFE 5DOSA 3PWDA 4Z3VA 4FKIA 2G15A 2R3MA 2X1NA 3LXLA 1KE7A 3NUPA 4O2ZA 1TQMA 5H8GA 2I40A 1CMKE 3ORXA 5GHVA 3FEGA 4NM5A 3TKUA 4QNAA 3EIDA 4IWDA 5HBJA 4QTDA 5HVJA 4D55A 4EQMA 3DJ7A 4ITHA 1S9JA 3EKNA 3QLFA 3HECA 3HMMA 4UWCA 3LIJA 1IG1A 3U9CA 1IA9A 3LMGA 2IZSA 3OCTA 4L67A 4HNIA 4I6BA 4PMTA 4I5HA 5KZ0A 4TYHB 4MWIA 4I24A 4QMPA 5DR6A 3S4QA 4ZTLA 3S1HA 1M2PA 2UVYA 5A3XA 1JNKA 3MFTA 2XJ2A 2HZ0A 4ANLA 4DA5A 4GUEA 4JBOA 4WG5A 3CPBA 3RCDA 1RW8A 2CLXA 4IADA 4G6NA 1B38A 3ERKA 1Q62A 4PL4A 3ZO2A 4AGWA 5FTGA 2OSCA 2XIKA 3AGMA 1YI6A 3GCPA 2BAQA 3KKVA 4I20A 3LFCA 3W2OA 2Q83A 3BHYA 4ANBA 3Q6WA 2B7AA 4OGRA 1JPAA 3ODYX 3VIDA 4CNHA 4IH8A 2W9FB 4E7WA 4RIWB 3BU3A 3LQ5A 1PMEA 3DNEA 4KUJA 3EJ1A 4I93A 1NVQA 4ID7A 5KBQA 2WMRA 2GNLA 4DEEA 4DTAA 5CF8A 3DU8A 3FXZA 3RAWA 4CFWA 3SG8A 4QRCA 4QPSA 2PUUA 1YQJA 3OVVA 3PSBA 1OIUA 2VTNA 4C59A 5BQ0A 4FKQA 4I0SA 5JFVA 3P7CA 1JSVA 4II5A 1J1CA 1BLXA 2YM8A 2BUJA 3EWHA 2FH9A 3PP1A 4XHKB 4FIGA 3ZZEA 3DLZA 4AOIA 4L7FA 3ZLYA 4CG8A 2QVSE 2OXDA 3EQDA 5LQFA 4A9RA 4HCVA 5T3QA 2V5QA 3CQUA 4EH6A 3M11A 4AQCA 3ZFXA 5A4CA 5JK3A 5F95A 4E6AA 3JVSA 3NCGA 2BAJA 4KAOA 4BL1A 1SNXA 4L6QA 2PUNA 2XNGA 3BPRA 3EN6A 1MQ4A 5JGBA 2A1AB 4R7IA 4AF3A 4IE9A 4ANOA 5D1JA 3I5ZA 2ZM3A 4IXPA 4OUCA 1K2PA 4YJNA 1YXTA 4BI1A 5HZNA 1BYGA 1TQPA 5C9CA 4WNMA 3WI6A 4FG9A 3TIYA 3PY3A 2WOTA 3F3TA 4X6RA 3ULZA 2ETKA 3GQLA 4PV0A 3EOCA 3TNWA 3A60A 4HYHA 4NT4A 5HE2A 5DYJA 3PG1A 4FTKA 2KULA 4O7WA 1O6LA 4L43A 3QUPA 4F08A 3GXLA 4Z9LA 4LI5A 4EONA 4RJ3A 4PMPA 1G8SA 3P23A 4ZIMA 4OW8A 3ETAA 3E8NA 4LOOA 4ZJVA 4YJRA 4IB5A 5JGDA 3UJGA 4J99A 1OBGA 2WAJA 4MBJA 2VTMA 2A4LA 3DS6A 4M68A 3Q53A 4AZEA 4O83A 1AD5A 2F2UA 3DOGA 3QKKA 5DT0A 5BVNA 2WD1A 1OUKA 4WKQA 5IUHA 3BV3A 4IX5A 3KRWA 4WT6A 3NW5A 5M4FA 3HL7A 2YIXA 4XG9A 4JQ7A 3BELA 3CJFA 2BRMA 1M7NA 4FT9A 2XF0A 4GYIA 5LMKC 4J71A 2WMBA 2QODA 1W84A 5E8SA 4WNPA 4RVMA 5K9IA 1XH4A 4R6VA 1CKIA 4O21A 1FOTA 4BN1A 4IVBA 2XH5A 2HK5A 3MW1A 4U41A 3TT0A 3QTZA 4FT7A 3R28A 5CAPA 2WKMA 5E90A 3N51A 4YLLA 3OS3A 1QCFA 3P5KA 2R3PA 4BGGA 3CE3A 1WVXA 4I21A 4AW0A 5CU0A 4TXCA 5D11A 3UBDA 4AGDA 5EW3A 4ZS4A 1PXLA 4JI9A 5LXMA 5GJDA 1MP8A 4LOPA 3DXQA 4K8AA 3DQWA 3G2FA 4RZWA 2FO0A 2RGPA 4AA5A 5KMNA 4XV9A 2GMXA 3SGCA 5I9UA 4G6LA 3SC1A 2HYYA 3O2MA 4K6ZA 4PL5A 1UWJA 4DGNA 4EYJA 4DH5A 5AAFA 3TM0A 1UNHA 1G8AA 2J0IA 2JKOA 3COIA 2A0CX 5EM8A 4O7SA 5D41A 3POZA 4EK3A 1E1XA 4TNBA 5JMSA 5FBNC 4U0IA 1WBSA 4GV1A 4CQGA 5CQWA 4D58A 3NUAA 4FNWA 2IWIA 1OPKA 2VGPA 3FMKA 4M69A 5ANEA 3V04A 4EQCA 4KBKA 1NA7A 4Q9SA 5CNNA 2BZKB 5CVFA 3BRBA 3A7GA 3F6XA 2WOUA 3VJNA 4F9WA 2J0KA 2WNTA 1LUFA 3PY0A 2OGVA 4IC7A 4MQ1A 4XG8A 1GAGA 4EZ7A 3FY0A 4IEBA 4QPMA 3AC2A 3R30A 1SZMA 2GTMA 1NVSA 4YSJA 5JN2A 2YERA 3KULB 4IDTA 4X3FB 2BKZA 3NYOA 3VS6A 4GS6A 5FP6A 4DGLC 3Q2JA 3QKMA 2C0IA 5J9LA 2DWBA 3COMA 2HZIA 4KKGA 4D1ZA 4FEQA 2EU9A 3QTUA 3R9OA 5M51A 4YJUA 1JAMA 3LFEA 3EYHA 4OTQA 1OIYA 3V6RA 3FLZA 3GT8A 4GUBA 4GVAA 3GVUA 5CYIA 3DK6A 4DEBA 3H9OA 4ACMA 1R1WA 2QURA 1BMKA 2BFYA 1VR2A 4ZTQA 4GG5A 4QQCA 1XBCA 3QRTA 4E4NA 1DI8A 4IM0A 3SXSA 2X81A 2JGZA 4J96A 3R7EA 1TQIA 4GW8A 3FSFA 3VS0A 4YC6A 5F94A 1M2RA 5BVKA 4EH9A 3QQLA 3UZTA 2ERZE 2PVJA 3H4JA 3ORKA 3W2PA 2R7BA 2VTHA 3NMUF 2V55A 1OZ1A 2BTRA 3A99A 3NNWA 3FL5A 2IW8A 3QCYA 3A7FA 3BX5A 4CVAA 5LJJA 4RMZA 4RX7A 5I9VA 2WMXA 3LHJA 4YR8A 1O9UA 2ZB1A 4CZUA 4JR3A 2G01A 3MFRA 3RVGA 3V3VA 3R7YA 3TKIA 3UDBA 4EL9A 3OXZA 5AUWA 2R7IA 4KKEA 4JG6A 4DEHA 5A4QA 2QHNA 2C6OA 5HVKA 3R73A 3D83A 3WIKA 3BI6A 5EKNA 4W8DA 2QLQA 3KMUA 3LCKA 1U59A 3HNGA 1XR1A 5JQ8A 3BV2A 3MDYA 1MRVA 3CTJA 3ZHPC 5LWNA 3B2TA 3TXOA 1Z9XA 4DEGA 2QG7A 3QX4A 2HXLA 3AC3A 3D5WA 3L9NA 3JXWA 3D4QA 4OBQA 4WRGA 4ZY6A 3B8QA 2P3GX 4Y83A 4HVIA 1GZOA 2Y6MA 4EH8A 3GC8A 2R64A 3CKXA 1I09A 4E4LA 4IW0A 3V5LA 5CNOA 3VF9A 3FMNA 4A06A 4DF3A 2CGVA 3M2WA 4BTFA 3K3JA 3LFBA 3W16A 2ONLA 3QGYA 2H9VA 2PMNX 2X7FA 2XEZA 3KCFA 4JOAA 3RNIA 3THBA 4AT4A 5DIAA 2XB7A 4FEUA 2YHVA 3PJ3A 5M53A 5AR5A 4M67A 1OPLA 5IA5A 4ACHA 3DY7A 3TNIA 4CT1A 1Q5KA 2XA4A 4MYGA 4UZHA 1Y6AA 4I5CA 4YSMA 4FZ6A 3TNPC 3QTIA 4XG6A 5AR4A 5IEXA 3OC1A 5BVEA 3ZDUA 4BC6A 1XBBA 5L6PA 2WIPA 3FMDA 1Z57A 3SHEA 5A54A 1V0PA 5BNJA 5M06A 4LUDA 4BCNA 2GU8A 3WOWA 5L2WA 3TZ8A 5CAVA 4Y85A 1YWRA 5KMMA 5AP3A 4TYEA 5KMIA 3HDMA 5HE1A 4LV8A 4DBNA 4QMLA 4XBUA 3SOAA 3R00A 3UC3A 2A19B 3PIZA 4ZTSA 2W99B 3WF5A 4A9TA 4O0WA 3BYSA 3UOLA 3DK3A 4DT9A 2JKMA 2XJ1A 2E9OA 2LAVA 3ZCLA 3EN4A 4IAZA 3R7IA 3UNKA 1UNGA 2VZ6A 1H00A 4Y46A 4YHTA 3NDMA 2BHEA 3S95A 3HUBA 3WE8A 3MY5A 2ITTA 3ALNA 3C4CA 4O0SA 4UMQA 5L3AA 5AP6A 5AR7A 1REKA 5TO8A 4JDHA 3U4WA 5BMSA 2CNVA 2R3QA 3T8OA 3OHTA 2GFSA 2YM4A 1CKJA 3EKKA 2ITVA 1AQ1A 4U3YA 5CZHA 3UIXA 4JQEA 3R71A 2ITNA 3R8VA 1KE5A 4BFMA 4BF2A 5J1VA 3W10A 4FK6A 1FQ1B 3D14A 3RAHA 5CEPA 3TTIA 5K5NA 5M55A 2O2UA 2YABA 3KU2A 3HYHA 5H2UA 4R1VA 2BZJA 3V6SA 4KABA 4DFZE 3EZVA 2RFDA 4ZJJA 1ND4A 3EYGA 4X0MA 2C4GA 2C5XA 2YCFA 3QHWA 2GS6A 4LUEA 3WF7A 3F3UA 5IA3A 2UZDA 5DBXA 3JR1A 2GNGA 3V5WA 3NSZA 3VUIA 4HVDA 3HKOA 2O0UA 4I3ZA 5TF9A 4FSQA 2NNWB 2W4KA 3G0EA 3Q9XA 3VBWA 5E8UA 3MVJA 2ITYA 3KVWA 4QTEA 4QTCA 2J0MB 2OU7A 5HG7A 2GS2A 4X2KA 3RTPA 2ESMA 2XRUA 5HTIA 3DKGA 3DLSA 4JS8A 3E7OA 4HZSA 3VO3A 3DT1A 4QMNA 2UZNA 4C58A 1STCE 2C6MA 4QP3A 3WYXA 3TUDA 4FSUA 3T3VA 3GFEA 3FKOA 3HX4A 1GY3A 4YNOA 3GUBA 3FI3A 4FV9A 5HIEA 3TNQB 4PP7A 5C26A 3GCVA 4E4MA 3D5VA 4PDSA 2V62A 1Q24A 2Z7LA 5DHJA 3ENMA 1J3HA 3I7CA 3PWYA 1OMWA 4U9AA 4ACGA 2W1EA 3L9LA 3V5QA 4DEDA 1QL6A 5I3OA 3UYSA 4CSVA 4DFXE 3FMMA 4O91A 5JFSA 5AFVA 4DH3A 3E93A 3G5DA 1GIIA 2XCHA 3C4FA 1JSUA 5C8NA 2HAKA 3DFCB 4RQVA 4XJ0A 4X2FA 4W4XA 4IX4A 4WO5A 4E6QA 5BUJA 3MB7A 4Q2AA 3DKOA 2WELA 3N4TA 4F1OA 3UOJA 4BIEA 5BVFA 4O2PA 4WOVA 1BI7A 2VO3A 3E3PA 3NZ0A 4PP9A 3MTLA 3CSVA 1CDKA 2UW7A 4RJ5A 3F2RA 1CM8A 3II5A 2R3NA 3GBZA 4S34A 4P2KA 4TYHA 4JAIA 4CFNA 4CYJA 4FKWA 3G33A 4U80A 2VNYA 2R0IA 3EN5A 4YLKA 4J52A 4QOXA 1R78A 4NW5A 4XLIA 3JY0A 4CFMA 3FLSA 5AUTA 2A2AA 3D5UA 3HEGA 2WMWA 3KEXA 1B6CB 4AE9A 1J7UA 4KIKA 4C3RA 4V01A 2P0CA 3GOPA 5HTBA 2R9SA 3PRFA 4LOQA 3C0IA 3R8UA 4U43A 2YEXA 4MD8E 5EI6A 2GQRA 1YDTE 4GT3A 3DJ5A 3WYYA 3SLSA 4B7TA 5HORA 5LVOA 2CKQA 3OXIA 3PVUA 3QKLA 5AP2A 3EL8A 5FBOA 4FV1A 4BIDA 3ZOSA 3DDPA 4EC9A 3QCSA 3OBJA 4P4CA 2WQBA 5JEBA 4FIEA 4AUAA 4R77A 2C6DA 3LVPA 3LCDA 5CI6A 3ORLA 3ZBXA 3M42A 2PZPA 5KKRB 4FEXA 4RA4A 3R01A 1OL6A 3BYUA 2W1FA 4QYHA 5EFQA 4DH1A 3NVMB 2IVVA 4K1BA 4TKSA 5FEDA 5IA4A 2HZ4A 3O51A 3B8RA 4I1ZA 4BIBA 3A8WA 4Z7GA 1HOWA 4FL1A 3NW7A 4Q5HA 5FG8A 4AWIA 3GFWA 3VUKA 4AW5A 5ANGA 2JAMA 3P1AA 1ZRZA 3KXHA 4O0RA 1XHAA 1DM2A 2I0HA 2PE2A 3C13A 4GFOA 4ZZMA 5CF5A 5LVNA 4C62A 4RC2A 1LPUA 3VS7A 4CMOA 5IA0A 1UU8A 4OTRA 3NIEA 5DI1A 4CMUA 4Y73A 1MRYA 4IAYA 3TNHA 4BI0A 4X3FC 4FGRA 2WMAA 4JQ8A 5AP1A 3U51A 3KF7A 4MQ2A 5HO8A 3HV5A 2X2MA 4XG3A 4P5ZA 3VF8A 4C4GA 2JIUA 4PQNA 4FYNA 3SAYA 2WTVA 2X2LA 3AC4A 1Q61A 4N4SA 2PYWA 4R5YA 5ACKA 3DKFA 4E20A 4KRCA 4QTAA 4GU9A 3ZTXA 3TZ9A 4GG7A 3G6HA 3QX2A 4BYJA 4D4YA 5E8WA 4KA3A 3DB8A 3FZRA 4W4YA 5AX3A 3RGFA 2VTLA 3I6WA 4TY1A 3I5NA 5EYMA 3TDWA 4FTOA 4E93A 5HE0A 4I4EA 4D2PA 3BHUA 3FDNA 4L3JA 4EH2A 5DMZA 2YLEA 2IZTA 4RBLA 4RVKA 4YTIA 2ZDTA 3ATSA 3H30A 4ASZA 4JT3A 1BL7A 1URCA 3UVRA 4M3QA 3DZQA 3DBCA 2X6EA 1OBDA 3UODA 5AWMA 4EYMA 1YWVA 4UWYA 3IW4A 4ZSAA 2RSVA 5BUEA 1YOMA 2X2KA 3OW3A 4C02A 5KMKA 3C1XA 1UA2A 3LFDA 2QOBA 4CRSA 3CY3A 3O71A 1PJKA 2XNNA 3R1NA 3BHTA 4DGGA 2QD9A 5AUYA 4F09A 3L8PA 4Q5EA 3UG1A 3ZYAA 5EHYA 4NEUA 3K5VA 2XK3A 5KMOA 3D94A 5HLWA 4I41A 5CEQA 2W5HA 5DRBA 4EK6A 4FE2A 3AXWA 3QRJA 4FSYA 3PIXA 5CU6A 4ZAUA 2H96A 1H4LA 3PPJA 3EMGA 4BBMA 3FXXA 4RVTA 2VTAA 1OM1A 5AP0A 2IVUA 2X7GA 1KE8A 4U97A 5HLNA 5K5XA 3NLBA 4TWCA 1H26A 1Q99A 1NVRA 3LCOA 3O7LD 5DNRA 4AXAA 3F2NA 3VS2A 3R9DA 4LM5A 1UV5A 2WMUA 4FR4A 2YWVA 1BL6A 3VW8A 5IZFA 3PZEA 5BVDA 4OTWA 4X3JA 4TYGA 1FVVA 4BCFA 4HVGA 3C50A 2HCKA 2VWXA 2WHBA 3QQJA 4G9RA 4TPTA 4ZTNA 4D9TA 4CTCA 5ETIA 3QA8A 4BDCA 2HOGA 1PHKA 4B8MA 3IW6A 3C5UA 4A9SA 1OECA 2F7ZE 2W0JA 4BCGA 4FKVA 1ZOHA 1PXIA 5L2TA 4XH6A 4HVHA 4W8EA 1VEBA 3KULA 2XUUA 4QMMA 3R2YA 3G0FA 2NRYA 3W1FA 5IQGA 4BTMA 3NUUA 3VUTA 3A4PA 2JDVA 5DGZA 3DTCA 5EI8A 5B0XA 5E8VA 2XRWA 1DAWA 5CAOA 2J50A 2C6TA 2VWVA 3VNTA 4LYNA 3SKCA 1Q8UA 2F9GA 1H25A 4JBVA 4FIHA 4U81A 5J87A 4C4IA 2WQEA 4RIXB 5FLFA 4AZVA 4L42A 4IQ6A 3EQPA 3GU6A 5KZIA 4XG2A 5ITAA 5EOBA 1FINA 2PVKA 4ACDA 2EVAA 3OY1A 4IWPA 4DBXA 2CMWA 2YISA 2E9UA 2F7XE 2G1TA 2J51A 2VX1A 2RL5A 3F5GA 5FWKK 5HG9A 2PPQA 4FSNA 3P0MA 4JAJA 3ZM9A 4A7CA 4DH8A 4EOOA 4Y8DA 1J91A 3KFAA 3QALE 4FV4A 4J1RA 2CSNA 3BCEA 4J97A 3E62A 4RLKA 3MGYA 3O17A 4WD5A 3BQCA 5AJQA 4ZJIA 3RINA 3ZFYA 4XMOA 4U79A 3EFLA 4MXYA 2QR8A 1M7QA 3OWJA 5HLPA 4D0WA 4DGMA 3LCSA 1XWSA 1KE6A 4FV0A 3E5AA 4G3CA 4C8BA 5L6OA 3PFQA 3WF6A 3DBQA 1Q41A 5AUVA 4O0XA 2PK9A 3KB7A 3MIAA 3ZZWA 2C69A 3QZIA 3IONA 3OF0A 4CV9A 1SVHA 4F6SA 4ZLOA 3FMJA 5ICPA 2JC6A 2WQOA 4CFVA 5GZ9A 3I0QA 5BYLA 3VN9A 4DFUA 4WHZA 1Q8YA 4YBJA 4RGJA 4G3DA 3BU5A 4LRJA 4U6RA 1FMOE 3HMOA 3O8TA 4QP6A 5HKMA 4FODA 3LM0A 4O22A 5KE0A 3LCTA 1JOWB 4CXAA 3Q4ZA 5J79A 3KXMA 3PE1A 4PPAA 4DEIA 4GKIA 3E63A 4YO6A 4R7HA 4CGAA 4H1MA 3REPA 4NL0A 4EKKA 2Z02A 5C1QB 2HW7A 3VUMA 1Z5MA 4K11A 3UTOA 1PKDA 3TG1A 3D15A 5ACBC 4KIKB 3PSCA 5FEQA 4O7ZA 3KC3A 5CU3A 3DXNA 4ALVA 4ALUA 1PF8A 2B9HA 3OUKA 4RC3A 4OTIA 3TJDA 2Y4PA 1OITA 1ZLTA 1BKXA 4F6WA 5KCVA 4QQJA 2G2IA 2OBJA 3S2PA 3PJ2A 3Q5ZA 4ZTMA 1V0OA 4BI2A 1ZAOA 4XP3A 4XV2A 4A07A 2PTKA 4D5HA 1HCKA 3D2KA 3TN8A 4MXCA 4M15A 3ITZA 2F4JA 5DT3A 5C8KA 4ASEA 2OW3A 3CPCA 5CT7A 3R9NA 3W8QA 4RWJA 4NM7A 2Z60A 4YJQA 4QQ5A 4AP7A 4E73A 4FV7A 4F9YA 4DHFA 4AW2A 3KXNA 2FUMA 4NKSA 3ZXZA 1J7LA 4I6FA 4DAWA 4BGQA 3HP5A 3MN3A 3U6HA 2HWPA 5BVWA 2JDSA 3QA0A 2XK6A 3RPOA 3GC7A 3W2SA 4KBCA 4CG9A 5EG3A 5E9EA 5IQAA 4EEVA 3WF9A 3OEFX 5M56A 4AS0A 4R7BA 1P4FA 3F5UA 4EORA 3VS3A 5AAGA 3PXKA 2PVNA 3F5XA 3E92A 4UZDA 5T6KA 2ZAZA 4OAUC 3HUCA 2DS1A 4MX9A 3ZH8A 2ACXA 3MH3A 3IW5A 3RALA 3S3IA 2PMLX 4GU6A 4Y95A 2UW4A 2B1PA 4UMUA 3H0ZA 2V0DA 4TWNA 5LVMA 1PMUA 4E3CA 2GQGA 3MPMA 4JIKA 5HCZA 4KIQA 3VBQA 3HMNA 4GT5A 1UNLA 1OI9A 2HW6A 3KREA 1JQHA 4HPTE 4I5MA 5AV0A 4AW1A 1W8CA 3WBLA 3FLYA 5AP4A 4RX8A 2HELA 3DGKA 4XS2A 2FSTX 2CGUA 2XK4A 2XK8A 3COHA 4OTPA 3C4WA 1H27A 4YURA 5LCJA 2REIA 3BLHA 5AADA 1VYWA 2BVAA 4KS8A 3VRZA 3E7VA 4BBFA 4F4PA 3LMIA 5I5ZA 4BY9E 4QO9A 5L6WL 5KKRC 5KNJA 4IZAA 2H34A 3MY0A 4CYIA 2GDOA 5FGKA 3QL8A 3UQGA 4BGHA 4I5PA 2NO3A 4YJVA 3FZSA 2JITA 3EQBA 4Z55A 3BBTB 1FMKA 3ORPA 3ZM4A 4BDBA 4LMNA 2QU6A 4ZTHA 3EFWA 4ARKA 2P2HA 2BRGA 2CGWA 3LLTA 4O7TA 4HGSA 2CCIA 3FJQE 3PRIA 3Q6UA 2UZEA 2VTOA 1FGIA 2ZOQA 5F20A 4BDEA 3C5IA 4ZS0A 2RFEA 3Q4TA 4M13A 2OXYA 3RPVA 2OJGA 2PVYA 3KRRA 4AX8A 5K4IA 5EQYA 3E87A 2XNMA 3KVXA 3UP2A 2XNPA 2YJRA 3C4EA 2R3HA 4GEOA 5AM6A 2OJJA 3MFUA 2C6IA 3ZU7A 5IQIA 5M09A 4EKLA 4L3LA 4UBAA 3Q04A 3LJ1A 3U8WA 5CVGA 2PMIA 4ACCA 2PMOX 1UU9A 3OZ6A 4M66A 4PDPA 4ZOGA 1PYEA 4O96A 2QOQA 3C4XA 1OUYA 3VW6A 4AFEA 4FGBA 4FTIA 5CXHA 3GCQA 4EOKA 2C30A 1SVGA 1RDQE 4DEAA 5I9ZA 5F1ZA 5E8XA 4NKAA 4WBOA 4ONAA 3UC4A 3ZEWA 1ZYLA 3PVWA 4FKPA 4I0RA 3F2AA 4OT6A 4PTCA 4FG8A 4C4JA 1G5SA 1A06A 4IAIA 4CT2A 4YJSA 5EW8A 3RM7A 5FXRA 4N57A 1LEZA 5JRSA 1B39A 2UW0A 3WZJA 2ONLC 3T9TA 3SVVA 2CCHA 1REJA 4MH7A 2J5EA 2RFNA 4PL3A 2R5TA 1ZARA 5AIKA 2VX0A 5C27A 4YO4A 3ZMMA 5BUIA 4QMXA 3AC5A 3EHAA 3VS5A 3HMPA 4D2VA 4BCOA 3D0EA 3LKMA 4XRLA 2P33A 2UV2A 3LJ0A 3HAVA 4U40A 3FV8A 3JVRA 5CU4A 5F9EA 2W1GA 2IG7A 4F9BA 3CIKA 2WMTA 3QBNA 4LQMA 3MY1A 4AOTA 4E5AX 5B7VA 3UOHA 2PUIA 4DH7A 5JSMA 4FV3A 2PUPA 4WRSA 3PXFA 2BPMA 2GQSA 4IWOA 2E9VA 2X6DA 4FV8A 4YZ9A 2VAGA 2OK1A 2B4SB 2UW8A 1R0EA 4LRMA 3CC6A 3QWJA 4CTBA 2YAAA 3I7BA 2ZMDA 3R02A 3UMWA 3D2IA 1MRUA 1OKVA 3ELJA 1XH7A 4IVDA 4F1MA 3OOGA 3A7JA 4YZNA 5DVRA 1ZOGA 4L7SA 4MK0A 2XMYA 3OWKA 4IHPA 4AE6A 5IQEA 4M0ZA 4K77A 5JFXA 5BX0A 4ANNA 3UO6A 3NRMA 3A4OX 1V0BA 4DC2A 4UB7A 3PA3A 1PXPA 4BDJA 3BHVA 3ZLWA 1W82A 3L9PA 3Q4UA 4KWPA 4QP7A 3KXXA 2W1ZA 4ITJA 5CEIA 3PPZA 3ZXTA 3F5PA 4OBPA 4C33A 1ATPE 3PXQA 2CKEA 5CY3A 5LARA 1J7IA 2BILB 2QOFA 2YDIA 3NUSA 3QYWA 1DAYA 3RM6A 3ANRA 3IG7A 5HX8A 3GP0A 5AAEA 1YXVA 2OWBA 5KHWA 3PG3A 5D7AA 2XKFA 2QCSA 3QYZA 4R8QA 5AV4A 1UWHA 4M14A 4KIPA 2NPQA 4WSQA 5EHLA 3UVQA 3UZPA 3ZRMA 3UPXA 4AZSA 3DV3A 4DE4A 3ORIA 1ZWSA 5J1WA 1WBWA 4F0GA 4OR5A 4ZY5A 3RNYA 2O64A 4ZTRA 4MNEA 1PMVA 3IECA 4G2FA 5FTOA 3MIYA 5JQ5A 2VTPA 4QD6A 1CSNA 1OVEA 2OIBA 3LZBA 4QP8A 2NRUA 3GEQA 3BYMA 3DJ6A 4AZTA 4TW9A 3U55A 4RX9A 4QTBA 3P79A 2WZJA 4FZAB 3R6XA 4O0UA 4N6ZA 5DFPA 5DT4A 2HXQA 2OG8A 3CTHA 3V01A 4RC4A 4CKRA 5AUUA 5H8BA 4F9AA 2XEYA 1IAHA 4XEYA 4RZVA 1XO2B 2BAKA 1E1VA 3RWQA 3LFQA 3NYVA 5CANA 4H39A 2Y8OA 2XIRA 1BI8A 5EYKA 3N4VA 4MD7E 3EZRA 5C8MA 3PE2A 2YDJA 5M57A 4HCUA 2CN8A 4C57A 4DITA 4O7NA 4PF4A 3I60A 2GSFA 4YZMA 4D1SA 2R2PA 2IPXA 5CT0A 4IVCA 2Y9QA 3PSDA 4P7EA 3GNIB 3A7HA 2FB8A 3GC0A 3IS5A 4YU2A 4Y5QA 1YDSE 4U44A 2WTIA 4IAKA 2EB3A 4PPCA 5FQDC 3R63A 3FI8A 2WB8A 1XBAA 1U54A 5J9YA 3FAAA 3VJOA 2UW3A 3R21A 5I4NA 5C4KA 3NYXA 3BBWA 3RK9A 1KE9A 5IH5A 4B8LA 5E4HA 3UZRA 5AUXA 4ZK5A 1LEWA 1FVRA 5DN3A 1PXJA 2WTDA 4AT3A 3NGAA 4O7RA 2AC3A 5E1EA 5ANKA 3MWUA 4J98A 2VTQA 1YOJA 5JZNA 4UYAA 4O82A 3IK3A 1MUOA 2CGXA 3DAKA 3IKAA 2YCSA 4M12A 3RAIA 3LXNA 4BDIA 4C2WA 4TN6A 4EOLA 2Y7JA 1ZYDA 4HNFA 3UP7A 4GFGA 2FGIA 3I4BA 4W9WA 3P08A 5C03A 3TUCA 5AMNA 4D2WA 2I0EA 3ALOA 1WBVA 2XNEA 4N70A 4EK4A 4D4VA 2X8IA 3PPKA 4O0TA 1P5EA 4O6LA 2ITZA 3COKA 2RG6A 3PUPA 2R3JA 4FKJA 2WTKB 2UZLA 4I22A 3FL4A 2JAVA 4TWOA 4UN0C 4FEWA 5HNGA 5GIPE 4TWPA 4NU1A 2W1DA 2BDJA 4C4HA 4CLJA 2ZV2A 2VU3A 3Q2MA 3VS1A 2CNQA 3O0GA 2B53A 3JUHA 4FVRA 5GNKA 4PDOA 3W2CA 4RX5A 4YLJA 3OROA 4EOSA 4IFCA 4D2RA 1OGUA 1H1QA 4LV5A 3RP9A 4BKZA 3T9IA 4QP2A 4A4XA 2UZBA 3QAME 5GZAA 4RIOA 5H3QA 3MH0A 3MH1A 4HPUE 4D5KA 4OT5A 1P2AA 2AYPA 4G5PA 4RIXA 3D7TB 5L8JA 3WIGA 4DFYA 4WIHA 2YA9A 4BICA 2QOIA 1H8FA 1KV2A 4MXAA 3KXZA 1OKWA 2J5FA 3C51A 4GKHA 3EQIA 3GGFA 3KGAA 1XH5A 4ENYA 3UE4A 2VWUA 3IO7A 2W9ZB 5KX8A 4DGOA 3QD4A 4YBKA 2QOCA 3E8DA 3EN9A 5HU9A 5CWZA 5IQBA 3TDVA 4FZFB 5D10A 3PP0A 3TEIA 2X8DA 3FC1X 1LP4A 3RZBA 4JRVA 4N6YA 5TT7A 4TYJA 3VQUA 2PE1A 3ZDIA 2ETMA 4EZ3A 3F7WA 2X4ZA 3BIZA 2WQNA 5HG8A 3NNUA 4UWBA 4S31A 5E1SA 2JDTA 5IH4A 3PLSA 2Z7RA 5EM7A 4HYIA 1OL5A 4G1WA 2QU5A 1JKSA 2WU6A 2UZOA 2G2HA 1JKLA 2VO6A 3NCZA 5K0XA 4S30A 4C7TA 3RJCA 4J8MA 2PU8A 5AX9A 3ORTA 2OIDA 1UKHA 4KINA 3LM5A 4BTJA 2NP8A 2FA2A 1EH4A 2O5KA 3QTRA 3BU6A 4OTDA 1OPJA 5HCXA 4HGEA 3ZSIA 4BCMA 4FF8A 5I3RA 4YZDA 3NS9A 2J0LA 5J9ZA 3V8WA 3D9VA 4BB4A 4MTAA 1W83A 4IWQA 1QPEA 4FV2A 2C5OA 2CPKE 4RLLA 4YP8A 5TKDA 4F65A 4G17A 4X2JA 3R1SA 4IM3A 3TZMA 3DBFA 3FXWA 4Y5HA 5JZJA 2WEIA 3OMVA 3AT2A 5EYDA 3PDTA 3TTJA 3SA0A 5IA2A 5FUTA 1JWHA 2YIWA 3QRKA 1PW2A 1XH8A 2ZDUA 4ASXA 4CRLA 4X2GA 3LFAA 5IH6A 4EH7A 4JDKA 4C4FA 3C9WA 3ZONA 4EOMA 1HCLA 5EQEA 2EWAA 3IOKA 3CTQA 3VBYA 4RWLA 4W4WA 3BEAA 3QTSA 4XG7A 4EK5A 4EOPA 1RQQA 3JY9A 4F7SA 5ANOA 1XH6A 4CFXA 4IBMA 2PVMA 2OI4X 3R1YA 4AN9A 3KA0A 4DTBA 3CY2A 1PMNA 1Q97A 3E88A 5AR8A 3NUNA 4H58A 3OTUA 3O23A 3QCXA 4DG3E 3CR0A 4EHZA 3UVPA 2XNOA 2UZWE 5CAUA 5A4TA 5DEWA 4R3CA 4ZSLA 4MEDA 2XP2A 5CU2A 3NR9A 4PNKA 1LR4A 4XNEA 1W98A 1XJDA 4L45A 4F0FA 4QMTA 5J7BA 4H3QA 5HBHA 5HX6A 5I9WA 3V51A 2VGOA 5KHXA 2BCJA 3ZS5A 2HWOA 3L8SA 1WCCA 4X7QA 4I6QA 2O65A 4APPA 4YJTA 3QD2B 5J95A 2EUFB 2LGCA 4NIFB 4FL3A 2JDRA 4BHZA 2IVTA 5A46A 1Q8TA 3R9RA 4FOCA 2ITXA 4YNEA 3ZFMA 4IACA 4IM2A 4CFUA 4WNKA 2VD5A 3GI3A 4D4SA 1YVJA 4PUZA 4EHVA 3AOXA 4FV6A 4JXFA 4RQKA 3OD6X 4FL2A 4C3FA 5A6OA 2PULA 3IGOA 4XRJA 4XYFA 4G3GA 4EBVA 3MESA 2XIXA 1GZ8A 5AV1A 1VYZA 4ZLZA 2J4ZA 4B9DA 3K5UA 3LJ2A 4ZZNA 1YRPA 1GIJA 2X4FA 4S32A 2YDKA 4LGHA 4O27B 2UUEA 1SVEA 3V5PA 1L3RE 1DI9A 3U4UA 3FBVA 3FKNA 4P5QA 3PVBA 3O96A 5CSPA 2QOKA 4NW6A 5LOHA 2VX3A 4MNEB 3RBWA 3F3WA 5CASA 1OL7A 3OEZA 3EN7A 4JG8A 4FNXA 1PXOA 3G9NA 3RZFA 2XKCA 3MPTA 3HRFA 4KIOA 4MXOA 1XKKA 2FVDA 2PVFA 4NFMA 5EH0A 4JNWA 2PZYA 2VTJA 3UO5A 2AC5A 3LFFA 2EXCX 3VUHA 2C3LA 4FUYA 4AGCA 5KMJA 3F88A 3GCUA 1OIRA 4FZ7A 2XKDA 4MD9E 4C36A 3SW4A 2XS0A 4ENXA 3LQ3A 3H0YA 2YCQA 3I81A 5JT2A 2CDZA 4ALWA 5EDRA 4AU8A 4GL9A 1R0PA 5HVYA 2R4BA 5HO6A 3R8PA 4GH2A 4CLIA 3D5XA 3VULA 2B9IA 2F7EE 4I4FA 5EOLA 1U54B 3ACKA 2GNHA 4XBRA 2OH4A 2ETRA 4QT1A 4IZ7A 2FSLX 1DS5A 3ZC5A 1WBPA 3ZRLA 4GIIA 1GIHA 4RIYA 2C68A 4L01A 4FTQA 1Q8WA 4U5JA 2JBOA 1T45A 5HE3A 4DLIA 4FZDB 3ZSGA 4E1ZA 3BWJA 3VRYA 3OG7A 4Z16A 2OKRA 3VHEA 3KQ7A 2W06A 1YI3A 3U6IA 2EB2A 3TACA 3CP9A 2P2IA 3A62A 2VO0A 5FP5A 3KL8A 3V8SA 5CEMA 3W8LA 5KMLA 3SXFA 1UKIA 1JLUE 2BIYA 4NYEA 3IDCA 2IW6A 3FSKA 4L68A 3Q60A 3K54A 2YZLA 3LQ8A 1S9IA 4JR7A 4RFZA 4N0SA 4QMQA 2F2CB 4B6LA 1GOLA 4ANSA 1UVRA 2WMQA 3NX8A 3UMXA 5A14A 2Q0NA 4U45A 2Y6OA 5IEVA 4FKUA 4ZSJA 3EQRA 5BMMA 3P9JA 4CZTA 3L8VA 1Q3DA 1CKPA 2OJIA 3BYOA 3R7VA 3VQHA 2J7TA 4FTCA 3GU8A 4NSTA 4Y72A 4FX3A 3MBLA 3PTGA 3NYNA 5IQFA 4ZSEA 4FOBA 5G1XA 3CS9A 2VNWA 3Q9WA 4U42A 3H3CA 4AG8A 4BBEA 4DTKA 2WIHA 5AV2A 1YI4A 4C35A 4DFNA 3QQKA 1YWNA 3IW7A 4QYFA 4MBIA 5C01A 1XH9A 2FSOX 3CGOA 4HOKA 5HQ0A 3FC2A 5AR2A 2W1IA 2GCDA 3FZ1A 2VWWA 2DUVA 4CQEA 2J90A 3F3ZA 4U8ZA 3Q9ZA 5E8YA 4JX3A 2OXXA 5ANDA 4RWIA 2C1BA 3AD6A 5I9XA 2XYUA 5M4IA 2YFXA 2A27A 3H10A 5GINE 2CLQA 3R2BA 2BZIB 4NM3A 2ZYBA 5FXSA 5BYYA 2HY0A 3LFNA 2GS7A 3NW6A 2ZV7A 3FQEA 3NNVA 3CQEA 2WTKC 4FTJA 3MYGA 5D12A 2J2IB 3HLLA 1ERKA 3V5TA 4OLIA 4BZOA 4USFA 3QD0A 4USDA 4NCTA 4KNBA 1Y8GA 5CSHA 2YIQA 3C4ZA 4ZXTA 5CQUA 2UZUE 3G51A 2O63A 4PMSA 4XCUA 5F4NA 4P90A 3TV6A 3HRCA 4CFFA 4FKOA 4K33A 4YJPA 4L00A 3IDBA 4RSSA 5AP7A 4DN5A 5CSXA 5L4QA 3R22A 4MF0A 3PXRA 3AD5A 3MVLA 4UXLA 4YMJA 3V8TA 4CMTA 1PXKA 2YM3A 2OJ9A 4D2SA 3IQ7A 5HEZA 3CEKA 2J0JA 3CD8A 2X9FA 4UEUA 3OY3A 2JKQA 2UW5A 2B9JA 5FM2A 4F70A 5HESA 5CF6A 2VWIA 1WMKA 1YW2A 3VS4A 5HHWA 4K2RA 4V05A 3EB0A 3PYYA 3BZ3A 3ORMA 4ZSGA 2Y0AA 3MVHA 1G3NA 2ITUA 5HNBA 4H36A 3SDJA 4AA4A 4LL5A 4B0GA 5HGIA 3SRVA 1JKKA 4U7ZA 3FQHA 4BKJA 4RG0A 5E92A 2ZV9A 3KXGA 4IB1A 3G9LX 5B2LA 1IR3A 5I0BA 3ORZA 3CCNA 4XP2A 2RKUA 2OZAB 2PHKA 2WEVA 1YDRE 2YM6A 2QOHA 4D2TA 4MXZA 4J7BA 4GT4A 2ZV8A 4HCTA 4F1TA 4R3PA 3RMFA 3AD4A 3DKCA 2QR7A 2XCKA 3KRJA 4IZYA 3P86A 3FLQA 5HTCA 3KMWA 3TI1A 5HO7A 4O1PA 3FMLA 5HIDA 4O6EA 3JPVA 1V1KA 4GK2A 2XBAA 4BTKA 4F7LA 3Q3BA 4UMRA 2BDFA 4ANQA 5M4UA 5KUPA 4MHAA 4OTGA 3QZGA 5E8TA 3ZO1A 3QXPA 2IJMA 4FVPA 4Q9ZA 3OCGA 2I6LA 3BGQA 3PXZA 4B4LA 2RG5A 3E64A 5FXQA 5JGAA 3P7AA 4JX7A 3WZKA 1H08A 4TL0A 5CX9A 3CBLA 3F61A 3OW4A 3TZ7A 5L8KA 3G90X 4PTEA 3QTQA 3L8XA 3HGKA 4FSRA 3F82A 5A9UA 4PY1A 1WFCA 2P55A 2XIZA 2Z7SA 3TJCA 5BPYA 2JKKA 3VVHA 4YC8A 3SG9A 2QKRA 3GU7A 3MI9A 2CN5A 1K3AA 2BHHA 1Y57A 3DCVA 3MJ2A 4E4XA 4NTSA 5DEYA 2QC6A 1TVOA 4FTUA 1GZKA 1H01A 5AA8A 2PWLA 2YIYA 4YTHA 4WG3A 4KSQA 3R8ZA 4C34A 5IMEA 3DAJA 4ITIA 5IF1A 5IA1A 3R83A 3FWQA 4FTAA 3QRUA 4FMQA 5AM7A 1NXKA 3VHKA 4BCHA 1RE8A 3O8PA 5DA3A 5HI2A 4IAFA 2QLUA 1IASA 1W7HA 2YIRA 4QPAA 3DFAA 4C2VA 4DYMA 5C4LA 4GRBA 4MKCA 4UMTA 2GHMA 4GSBA 4D28A 4HYSA 4EWQA 5DR9A 1H1RA 3QQFA 3NWWA 4QNYA 4WUNA 5DLSA 4U3ZA 2YZAA 2I7QA 2GNIA 3EQHA 3OTVA 4EC8A 4EJ7A 3FYJX 1YHSA 5FRIA 2BTSA 3AT4A 3EL7A 4O38A 3F66A 3WE4A 5CEKA 3ATTA 5JRQA 1H28A 4RJ7A 5IUGA 3QRIA 3HA6A 3D7TA 5HD4A 3A2CA 4ZMFA 2DYLA 2JBPA 4JL9A 4TT7A 3KRXA 5AR3A 5B2KA 4QMUA 3ORNA 3AMBA 3QTWA 3UIMA 3QD3A 1AGWA 3QU0A 4KKHA 4W4VA 5BYZA 2VWYA 5I9YA 2X8EA 5L8LA 4EJNA 4NWMA 4AOJA 4NUSA 4B99A 4J53A 2W4OA 3LAUA 3B2WA 4S33A 2PVHA 4FSMA 3ZC6A 4I6HA 1FGKA 3C0GA 4DFBA 2JIIA 2IW9A 3R7UA 3R8LA 2PVLA 1YHWA 2E9PA 3HAMA 2IZRA 4NTTA 2WTCA 5IDNA 2G2FA 2GTNA 2W17A 3BLQA 3G6GA 4FSWA 4H3BA 4XV1A 4IJ9A 1ZMUA 1SM2A 3R9HA 3ZUTA 4PNIA 1GJOA 3SXRA 3WARA 2OIQA 4RIYB 1GZNA 4OBOA 2IZUA 5EW9A 1FVTA 2VTRA 3F69A 3RAKA 2I1MA 3H9FA 4G3FA 4L8MA 5J5SA 3FPMA 5TOZA 1QPDA 1KWPA 5TR6A 4MAOA 1M14A 3C0HA 4FTNA 5IUIA 4YHJA 1M52A 4GK3A 3I79A 3FI2A 2R3GA 4OTHA 4R78A 4R1YA 3Q9YA 1VJYA 5E8ZA 4HGLA 4QMZA 4DINA 2YITA 2B54A 5CXZA 4IJPA 4DCEA 1ZZ2A 1H0VA 4GK4A 4TTHB 3CKWA 1WBNA 5CVHA 5DG5A 5KBRA 4O7LA 2XYNA 3TV7A 2XVDA 2VTTA 4BCIA 3VAPA 4QP9A 3DBEA 3RWPA 4EH3A 1A48A 3N4UA 4L53A 4FIIA 5FDPA 2AUHA 4WNOA 3U54A 3KCKA 5GJFA 2W96B 2C0OA 2C3JA 3NUXA 2H6DA 2YAKA 3ROCA 4X2NA 4YZCA 3QFVA 4O86A 3A7IA 3MS9A 4BVUA 2YCRA 4HVSA 1I44A 4W9XA 4QP1A 3TUBA 1IEPA 2XK7A 4L46A 4G9CA 3POOA 4FT0A 4BKYA 3DK7A 3CD3A 2ZMCA 2XKEA 3OP5A 2V7OA 4HYUA 4WBBB 5EM6A 5EK7A 4YJOA 4NM0A 2W1CA 3I0OA 3QZHA 2ZB0A 1L8TA 3BKBA 4G16A 4G5JA 3PVGA 5LMAA 4NJDA 4J95A 3UOKA 4O7VA 5T68A 2HENA 3ET7A 3VBVA 1WVYA 3GU5A 4EUTA 4QYEA
chains in the Genus database with same CATH superfamily
3SV0A 4IB0A 5GZ8A 1YHVA 2XK9A 3GU4A 4FKRA 2Z7QA 4FNYA 2W05A 4GFMA 3WZEA 1QPCA 4GJ2A 2VN9A 4GYGA 4F6UA 3ODZX 2Y4IB 3BE9A 3ZUVA 4ASDA 2Z8CA 4FKLA 2BFXA 4S2ZA 2C5NA 1JSTA 1YKRA 4NIFA 2YN8A 3QGWA 5HIBA 4RJ8A 4FKTA 1ZZLA 3NIZA 2WMSA 3AC8A 3BGZA 4YPSA 5HU3A 3NEWA 4IX6A 4IMYA 5HG5A 5JH6A 4G31A 3HRBA 2ITOA 4V0GB 5LMKA 2ZJWA 3RK7A 3A61A 2BRNA 2ERKA 5BV3A 4PDYA 3KN6A 4LGDA 3HVCA 3DB6A 4D4RA 3E8EA 3BEGA 5G6VA 4AACA 2E2BA 2P4IA 3BLRA 3TV4A 1KSWA 3ID6C 2YACA 5K4JA 3LLAA 4E6DA 4BR3A 2VO7A 3ZBFA 4L9IA 5IMXA 4MNFA 1ZMWA 4QMVA 4GVJA 1H0WA 3R7GA 4UV0A 4BCPA 2OLCA 3UNJA 1F3MC 1ZXEA 2ZVAA 3SRVB 4C37A 3FMEA 2GFCA 3A8XA 1JVPP 4JBQA 4ZEGA 4LG4A 5HCYA 4BCQA 3MA3A 3FZPA 2WPAA 4K0YA 4MWHA 2GNJA 2QKWB 3EFJA 3PJCA 5DWRA 4EI4A 2UZVA 3L1SA 3BE2A 3GCSA 1FPUA 5TE0A 2R3FA 3OWLA 3R1QA 4I92A 2QG5A 2R3RA 4FUXA 2J9MA 3AT3A 3DNDA 3RHXA 4PMMA 2JFMA 3LOKA 3U6JA 3AGLA 4FG7A 2BROA 4F64A 1VZOA 2RFSA 3EQFA 5HBEA 3ZRKA 3DDQA 4C3PA 1Q8ZA 3FQSA 1Y91A 2UW6A 3MV5A 4IIRA 3P5JC 2FSMX 2WFYA 3R0TA 4G6OA 4YUQA 4NFNA 3ZO3A 4PPBA 3UIUA 4A9YA 5FDXA 4XOZA 5IEYA 2BR1A 4JIAA 4QYYA 2ITQA 2PY3A 3PA4A 4EUUA 3CLYA 2ZM1A 4FTTA 4M7IA 4USEA 3ZUUA 2HZNA 5CEOA 2PE0A 4HJOA 5A6NA 1QMZA 3RK5A 3QHRA 4DT8A 5L2IA 4BDGA 2XBJA 4YTFA 2B52A 5AIRA 3VWAA 3MJ1A 3RPYA 3E3BX 3QQUA 4D9UA 1OKYA 4FSTA 1FBNA 5J7HA 4APCA 2I0YA 5IQDA 3OT3A 4A4OA 3PIYA 2ITWA 4O0VA 4C0TA 2UW9A 1X8BA 5D7VA 1F5QA 2XIYA 1UU3A 3F9NA 2Z2WA 2C6KA 4IX3A 2PZ5A 1OL1A 3DZOA 4DCAA 3L9MA 3JYAA 4EHGA 4F9CA 4ZLYA 3OWPA 3GQIA 3FKLA 3AQVA 3IW8A 2V7AA 4KS7A 2SRCA 2WXVA 4PTGA 4RWKA 2R3KA 1GNGA 2GHLA 3F3VA 3FZOA 3I6UA 5ETCA 3FMHA 3R8MA 3CGFA 4XUFA 1PY5A 4O7YA 2C3IB 5AA9A 2X39A 2YWPA 3O7LB 4X21A 3IDPA 2Q0BA 3MFSA 2IN6A 4YGAA 3AKKA 4D1XA 4J8NA 4O1OA 1T46A 3EQCA 5CI7A 3DPKA 4BDFA 2OFUA 4UX9A 5EM5A 4MBLA 4BZNA 1OL2A 5EYCA 4EOJA 4X6QC 2OICA 3UIBA 3ZLSA 5LWMA 4BDKA 4F7NA 3D7ZA 3PJ1A 4FV5A 2C5YA 3LE6A 3ZO4A 3W32A 2OF2A 1W0XC 3KRLA 3VBXA 4FJVA 1R3CA 1KV1A 1P14A 5AUZA 4KD1A 5LCKA 2X0GA 2PZRA 2WMVA 4G3EA 4JDJA 1NY3A 3VUDA 4WUAA 2KTYA 3VBTA 2XAOA 5HNIX 4QMYA 4BDDA 2OZOA 2WQMA 1O6YA 2OF4A 3QCQA 4TNDA 3T3UA 4F99A 4FKGA 2HY81 3TIZA 2E9NA 1JBPE 4IDVA 2WO6A 4A9UA 4RFMA 5DE2A 1F0QA 1XQZA 1H1PA 2BRBA 4FVQA 2OFVA 2CKOA 4EH4A 4UALA 2W5BA 3BHHA 1U4DA 1P4OA 2R3IA 4NK9A 5CLPA 3SW7A 3Q4CA 1NW1A 4YTCA 4FT3A 5CSVA 3ACJA 3CJGA 5FTQA 3RHKA 2PVRA 4JVGA 4E6CA 4XOYA 5EDPA 4RRVA 4I23A 4M84A 3P7BA 4CD0A 4F7JA 5J8IA 3K3IA 4QP4A 5CAQA 2PSQA 3BQRA 3QZFA 3KN5A 4BCKA 4L44A 1BX6A 3QWKA 4FKSA 2GHGA 4RT7A 2C0TA 4QEBA 5FM3A 5CENA 4QQTA 4DDGA 3HDNA 1KOAA 3ZLXA 4UY9A 1ZYCA 4XLVA 5HOAA 4AZFA 3EQGA 3QLGA 4BHNA 4H05A 1ZMVA 4FNZA 2RF9A 4ZY4A 3FYKX 5KO1A 3UQFA 4FIJA 5EHOA 3GOKA 5DH3A 3DTWA 4I94A 4UXQA 4XG4A 3PLAE 4O81A 3GENA 3MVMA 3OBGA 3W33A 3MPAA 5IQHA 2JLDA 3PA5A 3MTFA 5IQCA 4IZ5A 3SOCA 3N9XA 4F0IA 3HMIA 2JIVA 3FLNC 2G9XA 1CTPE 4H1JA 2CJMA 3DA6A 4GCJA 3ZEPA 5M07A 5M08A 2OZAA 5K3YA 3NPCA 3QXOA 3TWJA 5GIOE 2W7XA 2R3OA 3ENHA 3OCBA 4KSPA 5JKGA 3DXPA 2EXEA 2VTSA 4M69B 3NAYA 1IAJA 5GIPE 3KF4A 4XP0A 4AA0A 4BWKA 4HW7A 2B0QA 3FHIA 3TCPA 2YJSA 3VC4A 1A9UA 4M8TA 3O8UA 2FYSA 2QI8A 4AXEA 2GNFA 5AP5A 3LW0A 4R5SA 3OOMA 1H1WA 4OTFA 5ETAA 5IPJA 3HV3A 5ANIA 2JEDA 3RPSA 3SD0A 3LXPA 3QUDA 4ERWA 4JDIA 3UGCA 5A4EA 2R3LA 2C3KA 1OKZA 3M1SA 3EFKA 3BGPA 4O0YA 5CS6A 1Q4LA 2WGJA 3OUNB 2V22A 4RIWA 3SQQA 4E8AA 2BIKB 5IKWA 1IRKA 3OXTA 5L2SA 5H9BA 4WSYA 2XALA 4FEVA 5IDPA 2ZM4A 4GJ3A 4JBPA 4C4EA 2XNBA 5EI2A 4EOQA 2QOOA 2QOLA 4DFLA 3LXKA 4M97A 5L2QA 3WF8A 4JG7A 3OT8A 4BDAA 3UPZA 3F7ZA 2X9EA 2YM5A 3S00A 3I1AA 3UQCA 2VV9A 4RA5A 3S0OA 1PYXA 5FEEA 3WZDA 3NVKI 3PZHA 3Q52A 4G34A 5CZIA 1QPJA 5H8EA 4A4LA 4AGUA 2C6EA 5M4CA 4HGTA 3NFFB 4AT5A 4EWHA 2UVXA 4I0TA 3DQXA 4O4EA 4YC3A 3FE3A 3NUYA 4ZMEA 4DLJA 4V04A 3P4KA 4FK3A 4QYGA 2QO7A 3HV6A 4CEGA 3TL8A 3ULIA 1H07A 2BMCA 5LMBA 2QO9A 2B9FA 3MSSA 4BDHA 4EQUA 1R39A 4RFYA 4FT5A 4TYIA 2CHLA 5IG1A 4IC8A 4Z7HA 2PZIA 4KBAA 1KOBA 4QMWA 1APME 5HD7A 3O50A 3U87A 3AG9A 2YLFA 2UVZA 2WU7A 3AC1A 3FI4A 4KRDA 4PX6A 5EDQA 3FPQA 1YXUA 1G8JA 1OB3A 4JMQA 1TKIA 3W0QA 4M0YA 2XARA 2XM9A 1SYKA 2YM7A 2J6MA 5LVPA 1WBTA 4IANA 4PWNA 2C1AA 4IB3A 4LFIA 4QMSA 2UZTA 4TRLA 3KY2A 4DG0E 3Q96A 4ZZOA 2C47A 2BRHA 4QMOA 5EKOA 4L52A 1ZOEA 5ETFA 4YHFA 1NT2A 4RJ6A 2JD5A 2Y4IC 2W1HA 3HP2A 4FIFA 3AMYA 5CALA 4MF1A 5IISA 4FTLA 4O84A 3GB2A 2IO6A 3Q5IA 3RCJA 5LVLA 1OIQA 3QF9A 3IOPA 4EZ5A 2XM8A 4NCTC 1JKTA 1PXNA 1UU7A 3CXWA 5IU2A 4CCBA 4RVLA 4FSZA 1SMHA 3PY1A 5J5TA 4YZBA 5BVOA 3PXYA 2VRXA 2XZSA 2O8YA 3LFSA 3HZTA 3PJ8A 2PL0A 1ZY5A 2R0UA 3UNZA 3ANQA 1YXXA 4JLCA 1BUHA 1E9HA 3OFMA 4UYNA 4HZRA 3QQHA 2JDOA 4FC0A 3AMAA 4GIHA 5HICA 3VUGA 4BWPA 1O6KA 5A4LA 2IVSA 1URWA 4E26A 2W5AA 4CZYB 5E91A 4E5WA 4FA2A 4KB8A 2C5VA 1WZYA 3FUPA 3W55A 2XJ0A 4FYOA 2NYAA 3LMHA 2GPHA 3KK8A 1PXMA 1WAKA 3CQWA 4DG2E 2VWZA 3FHRA 4MXXA 3RKBA 4LRKA 4FI1A 3IPHA 4AN2A 4ZP5A 3R7OA 3R04A 2OO8X 1KUTA 4F78A 4IFGA 5K0KA 3RPRA 1ST0A 3JS2A 2WTJA 4ORKA 1Y6BA 4LGGA 5AV3A 3W2RA 4CKIA 2QHMA 4IAAA 4FTRA 4BZDA 2OH0E 1K9AA 1MQBA 2O3PA 5ANJA 3QC4A 5DR2A 5EQPA 1U5RA 2BDWA 3QQGA 5JFWA 3H9RA 3QUEA 4RPVA 4EOIA 2QONA 4MVFA 3ZSHA 2H8HA 2JFLA 3QC9A 4AZWA 4K9YA 4TZRA 3NFGB 1IA8A 3BWFA 3W18A 2B55A 2DQ7X 3FY2A 3MB6A 4C61A 3WILA 1H24A 5M44A 4AAAA 2I0VA 5DPVA 2QQ7A 3UYTA 3UO4A 4BYIA 4UMPA 1H1SA 4BWXA 1M17A 2X7OA 3EH9A 1M2QA 4FBXA 4WG4A 3U9NA 3TKHA 4ANMA 2BALA 4ERKA 3ROYA 3MH2A 5FD2A 4C38A 3Q32A 4YPDA 3W2QA 4NZWB 1WBOA 4LMUA 4FICA 4MCVA 1ZYSA 4EBWA 4NJ3A 1XMMA 5AEPA 4X3FA 4XX9A 4IVAA 3WZUA 3FLWA 1PKGA 3SX9A 5CSWA 2CKPA 3K2LA 3DAEA 1Y8YA 1PRYA 2VTIA 5B2MA 4K18A 2EXMA 2VWBA 2CNUA 4JJRA 3HA8A 3HV7A 5GJGA 2ITPA 3NAXA 1ZYJA 4H3PA 3OCSA 4R3RA 2F57A 4GMYA 3UG2A 4L3PA 1ZY4A 2RIOA 4CCUA 4EK8A 3LPBA 3V5JA 2A98A 2BZHB 4D0XA 4AFJA 3KK9A 1WVWA 1SNUA 2QNJA 3DBDA 4F63A 5D9HA 4WA9A 4OAVB 1J1BA 2VUWA 4AN3A 5E7RA 1U5QA 4CKJA 1YXSA 4EHEA 2WTWA 2BKKA 4LL0A 3C7QA 4BJJB 4O4DA 5DRDA 3G15A 3E8CA 4BCJA 5CTPA 3BYVA 3IGGA 1Q3WA 1RJBA 2C6LA 4V0GA 3RI1A 4BRXA 2X0PA 4PRJA 4RJ4A 4EH5A 4JRNA 4XV3A 2F49A 2W4JA 5CF4A 3P78A 3KMMA 2QO2A 1U46A 3QTXA 4NH1A 3FZTA 3GC9A 4CV8A 3HV4A 3NNXA 4FTMA 2HIWA 4E5BA 3MA6A 1YOLA 2OJFE 5DOSA 3PWDA 4Z3VA 4FKIA 2G15A 2R3MA 2X1NA 3LXLA 1KE7A 3NUPA 4O2ZA 1TQMA 5H8GA 2I40A 1CMKE 3ORXA 5GHVA 3FEGA 4NM5A 3TKUA 4QNAA 3EIDA 4IWDA 5HBJA 4QTDA 5HVJA 4D55A 4EQMA 3DJ7A 4ITHA 1S9JA 3EKNA 3QLFA 3HECA 3HMMA 4UWCA 3LIJA 1IG1A 3U9CA 1IA9A 3LMGA 2IZSA 3OCTA 4L67A 4HNIA 4I6BA 4PMTA 4I5HA 5KZ0A 4TYHB 4MWIA 4I24A 4QMPA 5DR6A 3S4QA 4ZTLA 3S1HA 1M2PA 2UVYA 5A3XA 1JNKA 3MFTA 2XJ2A 2HZ0A 4ANLA 4DA5A 4GUEA 4JBOA 4WG5A 3CPBA 3RCDA 1RW8A 2CLXA 4IADA 4G6NA 1B38A 3ERKA 1Q62A 4PL4A 3ZO2A 4AGWA 5FTGA 2OSCA 2XIKA 3AGMA 1YI6A 2X0OA 2BAQA 3GCPA 3KKVA 3LFCA 4I20A 3W2OA 3BHYA 4ANBA 2Q83A 3Q6WA 2B7AA 4OGRA 1JPAA 3ODYX 3VIDA 4CNHA 4IH8A 2W9FB 4E7WA 4RIWB 3BU3A 3LQ5A 1PMEA 3DNEA 4KUJA 3EJ1A 4I93A 1NVQA 4ID7A 5KBQA 2WMRA 2GNLA 4DEEA 4DTAA 5CF8A 3DU8A 3FXZA 4AXFA 3RAWA 4CFWA 3SG8A 4QRCA 2AQXA 4QPSA 2PUUA 1YQJA 3OVVA 3PSBA 1OIUA 2VTNA 4C59A 5BQ0A 4FKQA 4I0SA 5JFVA 3P7CA 1JSVA 4II5A 4AXCA 2AEGA 1J1CA 1BLXA 2YM8A 2BUJA 3EWHA 2FH9A 3PP1A 4XHKB 4FIGA 3ZZEA 3DLZA 4AOIA 4L7FA 3ZLYA 4CG8A 2QVSE 2OXDA 3EQDA 5LQFA 4A9RA 4HCVA 5T3QA 2V5QA 3CQUA 4EH6A 3M11A 4AQCA 3ZFXA 5A4CA 5JK3A 5F95A 4E6AA 3JVSA 3NCGA 2BAJA 4KAOA 4BL1A 1SNXA 4L6QA 2PUNA 2XNGA 3BPRA 3EN6A 1MQ4A 5JGBA 2A1AB 4R7IA 4AF3A 4IE9A 4ANOA 5D1JA 3I5ZA 2ZM3A 4IXPA 4OUCA 1K2PA 4YJNA 1YXTA 4BI1A 5HZNA 1BYGA 1TQPA 5C9CA 4WNMA 3WI6A 4FG9A 3TIYA 3PY3A 2WOTA 3F3TA 4X6RA 3ULZA 2ETKA 3GQLA 4PV0A 3EOCA 3TNWA 3A60A 4HYHA 4NT4A 5HE2A 5DYJA 3PG1A 4FTKA 2KULA 4O7WA 1O6LA 4L43A 3QUPA 4F08A 3GXLA 4Z9LA 4LI5A 4EONA 4RJ3A 4PMPA 1G8SA 3P23A 4ZIMA 4OW8A 3ETAA 3E8NA 4LOOA 4ZJVA 4YJRA 4IB5A 5JGDA 3UJGA 4J99A 1OBGA 2WAJA 4MBJA 2VTMA 2A4LA 3DS6A 4M68A 3Q53A 4AZEA 4O83A 1AD5A 2F2UA 3DOGA 3QKKA 5DT0A 5BVNA 2WD1A 1OUKA 4WKQA 5IUHA 3BV3A 4IX5A 3KRWA 4WT6A 3NW5A 5M4FA 3HL7A 2YIXA 4XG9A 4JQ7A 3BELA 3CJFA 2BRMA 1M7NA 4FT9A 2XF0A 4GYIA 5LMKC 4J71A 2WMBA 2QODA 1W84A 5E8SA 4WNPA 4RVMA 5K9IA 1XH4A 4R6VA 1CKIA 4O21A 1FOTA 4BN1A 4IVBA 2XH5A 2HK5A 3MW1A 4U41A 3TT0A 3QTZA 4FT7A 1G8KA 3UDSA 3R28A 5CAPA 2WKMA 5E90A 3N51A 4YLLA 3OS3A 1QCFA 3P5KA 2R3PA 4BGGA 3CE3A 1WVXA 4I21A 4AW0A 5CU0A 4TXCA 5D11A 3UBDA 4AGDA 5EW3A 4ZS4A 1PXLA 4JI9A 5LXMA 5GJDA 1MP8A 4LOPA 3DXQA 4K8AA 3DQWA 3G2FA 4RZWA 2FO0A 2RGPA 4AA5A 5KMNA 4XV9A 2GMXA 3SGCA 5I9UA 4G6LA 3SC1A 2HYYA 3O2MA 4K6ZA 4PL5A 1UWJA 4DGNA 4EYJA 4DH5A 5AAFA 3TM0A 1UNHA 1G8AA 2J0IA 2JKOA 3COIA 2A0CX 5EM8A 4DDIA 4O7SA 5D41A 3POZA 4EK3A 1E1XA 4TNBA 5JMSA 5FBNC 4U0IA 1WBSA 4GV1A 4CQGA 5CQWA 4D58A 3NUAA 4FNWA 2IWIA 1OPKA 2VGPA 3FMKA 4M69A 5ANEA 3V04A 4EQCA 4KBKA 1NA7A 4Q9SA 5CNNA 2BZKB 5CVFA 3BRBA 3A7GA 3F6XA 2WOUA 3VJNA 4F9WA 1TFFA 2J0KA 2WNTA 1LUFA 3PY0A 2OGVA 4IC7A 4MQ1A 4XG8A 1GAGA 4EZ7A 3FY0A 4IEBA 4QPMA 3AC2A 3R30A 1SZMA 2GTMA 1VLRA 1NVSA 4YSJA 5JN2A 2YERA 3KULB 4IDTA 4O4BB 4X3FB 2BKZA 3NYOA 3VS6A 4GS6A 5FP6A 4DGLC 3Q2JA 2X0QA 3QKMA 2C0IA 5J9LA 2DWBA 3COMA 2HZIA 4KKGA 4D1ZA 4FEQA 2EU9A 3QTUA 3R9OA 5M51A 4YJUA 1JAMA 3LFEA 3EYHA 4OTQA 1OIYA 3V6RA 3FLZA 3GT8A 4GUBA 4GVAA 3GVUA 5CYIA 3DK6A 4DEBA 3H9OA 4ACMA 1R1WA 2QURA 1BMKA 2BFYA 1VR2A 4ZTQA 4GG5A 4QQCA 1XBCA 3QRTA 4E4NA 1DI8A 4IM0A 3SXSA 2X81A 2JGZA 4J96A 3R7EA 1TQIA 4GW8A 3FSFA 3VS0A 4YC6A 5F94A 1M2RA 3O5AA 5BVKA 4EH9A 3QQLA 3UZTA 2ERZE 2PVJA 3H4JA 3ORKA 3W2PA 2R7BA 2VTHA 3NMUF 2V55A 1OZ1A 2BTRA 3A99A 3NNWA 3FL5A 2IW8A 3QCYA 3A7FA 3BX5A 4CVAA 5LJJA 4RMZA 4RX7A 4LV7A 5I9VA 2WMXA 3LHJA 4YR8A 1O9UA 2ZB1A 4CZUA 4JR3A 2G01A 3MFRA 3RVGA 3V3VA 3R7YA 3TKIA 3UDBA 4EL9A 3OXZA 5AUWA 2R7IA 4KKEA 4JG6A 4DEHA 5A4QA 2QHNA 2C6OA 5HVKA 3R73A 3D83A 3WIKA 3BI6A 5EKNA 4W8DA 2QLQA 3KMUA 3LCKA 1U59A 3HNGA 1XR1A 5JQ8A 3BV2A 3MDYA 1MRVA 3CTJA 3ZHPC 5LWNA 3B2TA 3TXOA 1Z9XA 4DEGA 2QG7A 3QX4A 2HXLA 3AC3A 3D5WA 3L9NA 3JXWA 3D4QA 4OBQA 4WRGA 4ZY6A 3B8QA 2P3GX 3W0RA 4Y83A 4HVIA 1GZOA 2Y6MA 4EH8A 3GC8A 2R64A 3CKXA 1I09A 4E4LA 4IW0A 3V5LA 5CNOA 3VF9A 3FMNA 4A06A 4DF3A 2CGVA 3M2WA 4BTFA 3K3JA 3LFBA 3W16A 2ONLA 3QGYA 2H9VA 2PMNX 2X7FA 2XEZA 3KCFA 4JOAA 3RNIA 3THBA 4AT4A 5DIAA 2XB7A 4FEUA 2YHVA 3PJ3A 5M53A 5AR5A 4M67A 1OPLA 5IA5A 4ACHA 3DY7A 3TNIA 4CT1A 1Q5KA 2XA4A 4MYGA 4UZHA 1Y6AA 4I5CA 4YSMA 4FZ6A 3TNPC 3QTIA 4XG6A 5AR4A 5IEXA 3OC1A 5BVEA 3ZDUA 4BC6A 1XBBA 5L6PA 2WIPA 3FMDA 1Z57A 3SHEA 5A54A 1V0PA 5BNJA 5M06A 4LUDA 4BCNA 2GU8A 3WOWA 5L2WA 3TZ8A 5CAVA 4Y85A 1YWRA 5KMMA 5AP3A 4TYEA 5KMIA 3HDMA 5HE1A 4LV8A 4DBNA 4QMLA 4XBUA 3SOAA 3R00A 3UC3A 2A19B 3PIZA 4ZTSA 2W99B 3WF5A 4A9TA 4O0WA 3BYSA 3UOLA 3DK3A 4DT9A 2JKMA 2XJ1A 2E9OA 2LAVA 3ZCLA 3EN4A 4IAZA 3R7IA 3UNKA 1UNGA 2VZ6A 1H00A 4Y46A 4YHTA 3NDMA 2BHEA 3S95A 3HUBA 3WE8A 3MY5A 2ITTA 3ALNA 3C4CA 4O0SA 4UMQA 5L3AA 5AP6A 5AR7A 1REKA 5TO8A 4JDHA 3U4WA 5BMSA 2CNVA 2R3QA 3T8OA 3OHTA 2GFSA 2YM4A 1CKJA 3EKKA 2ITVA 1AQ1A 4U3YA 5CZHA 3UIXA 4JQEA 3R71A 2ITNA 3R8VA 1KE5A 4BFMA 4BF2A 5J1VA 3W10A 4FK6A 1FQ1B 3D14A 3RAHA 5CEPA 3TTIA 5K5NA 5M55A 2O2UA 2YABA 3KU2A 3HYHA 4DHIB 5H2UA 4R1VA 2BZJA 3V6SA 4KABA 4DFZE 3EZVA 2RFDA 4ZJJA 1ND4A 3EYGA 4X0MA 2C4GA 2C5XA 2YCFA 3QHWA 2GS6A 4LUEA 3WF7A 3F3UA 5IA3A 2UZDA 5DBXA 3JR1A 2GNGA 3V5WA 3NSZA 3VUIA 4HVDA 3HKOA 2O0UA 4I3ZA 5TF9A 4FSQA 2NNWB 2W4KA 3G0EA 3Q9XA 3VBWA 5E8UA 3MVJA 2ITYA 3KVWA 4QTEA 4QTCA 2J0MB 2OU7A 5HG7A 2GS2A 4X2KA 3RTPA 2ESMA 2XRUA 5HTIA 3DKGA 4QDEA 3DLSA 4JS8A 3E7OA 4HZSA 3VO3A 3DT1A 4QMNA 2UZNA 4C58A 1STCE 2C6MA 4QP3A 3WYXA 3TUDA 4BJJA 4FSUA 3T3VA 3GFEA 3FKOA 3HX4A 1GY3A 4YNOA 3GUBA 3FI3A 4FV9A 5HIEA 3TNQB 4PP7A 5C26A 1OGYA 3GCVA 4E4MA 3D5VA 4PDSA 2V62A 1Q24A 2Z7LA 5DHJA 3ENMA 1J3HA 3I7CA 3PWYA 1OMWA 4U9AA 4ACGA 2W1EA 3L9LA 3V5QA 4DEDA 1QL6A 5I3OA 3UYSA 4CSVA 4DFXE 3FMMA 4O91A 5JFSA 5AFVA 4DH3A 3E93A 3G5DA 1GIIA 2XCHA 3C4FA 1JSUA 5C8NA 2HAKA 1ST4A 3DFCB 4RQVA 4XJ0A 4MUQA 4X2FA 4W4XA 4IX4A 4WO5A 4E6QA 5BUJA 3MB7A 4Q2AA 3DKOA 2WELA 3N4TA 4F1OA 3UOJA 4BIEA 5BVFA 4O2PA 4WOVA 1BI7A 2VO3A 3E3PA 3NZ0A 4PP9A 3MTLA 3CSVA 1CDKA 2UW7A 4RJ5A 3F2RA 1CM8A 3II5A 2R3NA 3GBZA 4S34A 4P2KA 4TYHA 4JAIA 4CFNA 4CYJA 4FKWA 3G33A 4U80A 2VNYA 2R0IA 3EN5A 4YLKA 4J52A 4QOXA 1R78A 4NW5A 4XLIA 3JY0A 4CFMA 3FLSA 5AUTA 2A2AA 3D5UA 3HEGA 2WMWA 3KEXA 1B6CB 4AE9A 1J7UA 4KIKA 4C3RA 4V01A 2P0CA 3GOPA 4DHJA 5HTBA 2R9SA 3PRFA 4LOQA 3C0IA 3R8UA 4U43A 2YEXA 4MD8E 5EI6A 2GQRA 1YDTE 4GT3A 3DJ5A 3WYYA 3SLSA 4B7TA 5HORA 5LVOA 2CKQA 3OXIA 3PVUA 3QKLA 2IEWA 5AP2A 3EL8A 5FBOA 4FV1A 4BIDA 3ZOSA 3DDPA 4EC9A 3QCSA 3OBJA 4P4CA 2WQBA 5JEBA 4FIEA 4AUAA 4R77A 2C6DA 3LVPA 3LCDA 5CI6A 3ORLA 3ZBXA 3M42A 2PZPA 5KKRB 4FEXA 4RA4A 3R01A 1OL6A 3BYUA 2W1FA 4QYHA 5EFQA 4DH1A 3NVMB 2IVVA 4K1BA 4TKSA 5FEDA 5IA4A 2HZ4A 3O51A 3B8RA 4I1ZA 4BIBA 3A8WA 4Z7GA 1W2FA 1HOWA 4FL1A 3NW7A 4Q5HA 5FG8A 4AWIA 3GFWA 3VUKA 4O4FA 4AW5A 5ANGA 2JAMA 3P1AA 1ZRZA 3KXHA 4O0RA 1XHAA 2IF8A 1DM2A 2I0HA 2PE2A 3C13A 4GFOA 4ZZMA 5CF5A 5LVNA 4C62A 4RC2A 1LPUA 3VS7A 4CMOA 5IA0A 1UU8A 4OTRA 3NIEA 5DI1A 4CMUA 4Y73A 1MRYA 4IAYA 3TNHA 4BI0A 4X3FC 4FGRA 2WMAA 4JQ8A 5AP1A 3U51A 3KF7A 4MQ2A 5HO8A 3HV5A 2X2MA 4XG3A 4P5ZA 3VF8A 4C4GA 2JIUA 4PQNA 4FYNA 3SAYA 2WTVA 2X2LA 3AC4A 1Q61A 4N4SA 2PYWA 4R5YA 5ACKA 3DKFA 4E20A 4KRCA 4QTAA 4GU9A 3ZTXA 3TZ9A 4GG7A 3G6HA 3QX2A 4BYJA 4D4YA 5E8WA 4KA3A 3DB8A 3FZRA 4W4YA 5AX3A 3RGFA 2VTLA 3I6WA 4TY1A 3I5NA 5EYMA 3TDWA 4FTOA 4E93A 5HE0A 4I4EA 4D2PA 3BHUA 3FDNA 4L3JA 4EH2A 5DMZA 2YLEA 2IZTA 4RBLA 4RVKA 4YTIA 2ZDTA 3ATSA 3H30A 4ASZA 3W0PA 4JT3A 1BL7A 1URCA 3UVRA 4M3QA 3DZQA 3DBCA 2X6EA 1OBDA 3UODA 5AWMA 4EYMA 1YWVA 4UWYA 3IW4A 4ZSAA 2RSVA 5BUEA 1YOMA 2X2KA 3OW3A 4C02A 5KMKA 3C1XA 1UA2A 3LFDA 2QOBA 4CRSA 3CY3A 3O71A 1PJKA 2XNNA 3R1NA 3BHTA 4DGGA 2QD9A 5AUYA