3OWCA

Crystal structure of gnat superfamily protein pa2578 from pseudomonas aeruginosa
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
172
structure length
172
Chain Sequence
ELQLVPFQLGHFPILQRWFATEKELVQWAGPALRHPLSLEQMHEDLAESRRRPPLRLLWSACRDDQVIGHCQLLFDRRNGVVRLARIVLAPSARGQGLGLPMLEALLAEAFADADIERVELNVYDWNAAARHLYRRAGFREEGLRRSATRVGRERWNVVLMGLLRQEWAAGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of GNAT superfamily protein PA2578 from Pseudomonas aeruginosa
rcsb
source organism Pseudomonas aeruginosa
molecule tags Transferase
molecule keywords Probable acetyltransferase
total genus 48
structure length 172
sequence length 172
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 3owcA00
2FIAA 4QVTA 4BMHA 1KZFA 1P0HA 4HNYB 4L8AA 1M4DA 3R96A 4E0AA 2ZXVA 1OZPA 1XE4A 2EUIA 3S6KA 2Q0YA 5J8CA 3DR8A 1S7KA 5DWNA 2ZW5A 2FCKA 2Z10A 4QC6A 3NE7A 4IUSA 4UWIA 1RO5A 4PK2A 2FSRA 2K5TA 3PP9A 4RI1A 4AVBA 4KVXA 4KVOE 1NMTA 3EY5A 4KOUA 4B5OA 1I12A 4OAEA 3FRMA 3I3GA 2OZGA 4R87A 1N71A 4KOVA 1YVOA 4M3SA 4UBRA 2VEZA 2F5IA 4KUAA 4ONUA 3DDDA 3C26A 4LUAA 2R1IA 3EFAA 3SXOA 3TFYA 2D4OA 1YR0A 2VZYA 1I1DA 4E2AA 5H84A 3G8WA 4MHDA 1M44A 1M1DA 1SQHA 3TTHA 1XEBA 3TO9A 2AE6A 2FL4A 3QB8A 2B4DB 2ARHA 2OU2A 4YFJA 4AG9A 5JPHA 3R1KA 4NXYA 2CNMA 1KUYA 4NSQA 2P6EA 2FIWA 1U6MA 3MGDA 5I0CA 4FD7A 1PU9A 3SHPA 2Q4VA 1CJWA 2OZHA 3FBUA 3BLNA 1IYKA 4YRHA 2C27A 1NSLA 4HKFA 3S6FA 1Q2DA 4RS2A 2G3AA 4XPDC 4QBJA 1MJ9A 2Q4YA 4CS0B 3W6SA 2REFA 5GCNA 2JLMA 1NE9A 3OWCA 2HV2A 3EC4A 3E0KA 4KORA 2RC4A 1GHEA 4F0YA 3FIXA 1YLEA 2B3UA 4CAVA 1Q2CA 1KUVA 2P6GA 2CNSA 4L89A 2PDOA 5C88A 4KZTA 2QECA 2JEVA 4DNCA 4KOSA 3N7ZA 2REEA 3LD2A 3FXTA 5J8FA 4XPKA 3T90A 4Y49C 1YVKA 3TCVA 2IL4A 1Y7RA 2BL1A 4UWJA 4KOWA 1Y9WA 1MK4A 2KCWA 1QSNA 4AVCA 1UFHA 5IB0A 2CNTA 2GANA 3D8PA 1FY7A 2PRBA 4Y49B 4AB7A 3F8KA 2J8MA 1Q2YA 1Z4RA 4JD6A 3ZZIA 4UA3A 3P2FA 4CAWA 1S60A 3P2HA 1PUAA 1QSRA 3DSBA 2ZW4A 1XIXA 4KUBA 2WPWA 3PZJA 3H4QA 3R9GA 3TOAA 5KTAA 1WK4A 4I49A 4U9YA 4E8OA 3GY9A 1IYLA 4U5YA 3D2PA 2GE3A 1YREA 4R3LA 3DR6A 1YGHA 5KTDA 2PC1A 1BOBA 1B87A 4F6AA 4ORFA 1ON0A 4M85A 4KLVA 4PSWA 1XMTA 2HUZA 3JUWA 2HQYA 1IICA 4K30A 2EVNA 2FE7A 1YK3A 2J8RA 4JJXA 2OZUA 3B8GA 3I9SA 4JLYA 5E96A 2PSWA 3QAHA 2WPXA 4EVYA 4NEXA 1VKCA 2FS5A 2R8VA 1V0CA 3CXQA 4AG7A 5F48A 5C82A 2ZW6A 3BJ7A 4R57A 4B5PB 3K9UA 4FD6A 2PQ8A 4CAXA 1Z4EA 4XPLA 5ISVA 5F46A 4MY3A 4OADA 3D3SA 5F49A 1B6BA 1M4GA 4MJ8A 1CM0A 2B4DA 4H89A 5H86A 2J8NA 2FXFA 3W6XA 4KOYA 3S6GA 4X5KA 4H6ZA 2P6FA 4FD4A 1LRZA 3GKRA 4R9MA 2D4PA 2P0WA 4U9ZA 1M4IA 2H5MA 3V8IA 3RYOA 2Y0MA 1TIQA 1R57A 1S7FA 1MJBA 1QSTA 3CXPA 4JXRA 4QUSA 3W91A 3TO7A 2QMLA 2FT0A 3VWEA 4MI4A 5CNPA 4KLWA 3R95A 3SXNA 3CXSA 3TT2A 4HNWB 2Q44A 2X7BA 3TO6A 3JVNA 3F0AA 2G3TA 3KKWA 3FYNA 2PR1A 5DWMA 3GYAA 3R9FA 1BO4A 1P4NA 4NCZA 2OB0A 3FNCA 2GIVA 3T9YA 3LODA 4QB9A 4KOXA 2BUEA 1S7NA 2A4NA 2CY2A 4CRYB 2VXKA 3TOBA 4XNHB 4PSXA 3FB3A 5KTCA 3PGPA 3ZJ0A 2DXQA 1RXTA 4YGOA 3EXNA 1J4JA 2JDDA 5HMNA 4B5PA 5IX3A 3R9EA 1IIDA 1QSOA 1XF8A 2B3VA 4J3GA 2Q04A 1S3ZA 2B5GA 2VQYA 4AVAA 4OLLA 2ZPAA 5HH1A 2Q7BA 4R3KA 4XPDB 2ATRA 4JXQA 1S7LA 1VHSA 3G3SA 3UY5A 1Y9KA 3WR7A 4NF1A 1L0CA 3S6HA 3VWDA 4PV6A 3IGRA 1K4JA 5F47A 2VBQA 5FVJA 1YX0A 4MY0A 2NMTA 3BJ8A 2I00A 2B4BA 2PR8A 2ZW7A 5IV0A 4KVME 3IWGA 1IB1E 3EO4A 1S5KA 2B5GB 5EC4A 2BSWA 4LX9A 2O28A 4GS4A 2VZZA 2Z0ZA 4ZBGA 5EBVA 4MBUA 1KUXA 5JQ4A 2JDCA 2R98A 2Z11A 4FD5A 1I21A 2AJ6A 1QSMA 2VI7A 4II9A 3F5BA 4H6UA 2G0BA 2BEIA 2R7HA 4HNXB 1Z9UA 4JWPA 3TE4A 1WWZA 4PK3A 4XNHC 4CRZB 3DNSA 2I79A 1MJAA 2OH1A 3D2MA 2B58A 4KOTA 2QIRA 4IF5A
chains in the Genus database with same CATH superfamily
5G20A 3B2YA 5LRKA 1CPXA 2FIAA 4P45A 4QVTA 1KZFA 1P0HA 4HNYB 2PJ3A 4BMHA 4L8AA 1M4DA 3R96A 2JEWA 4E0AA 2ZXVA 4YWYA 1OZPA 2V8DA 1XE4A 3H8GA 2EUIA 4JZ0A 2Q0YA 3S6KA 5J8CA 3V7ZA 3DR8A 1M4LA 1S7KA 1HDQA 5DWNA 4CGPA 2ZW5A 1AYEA 2FCKA 2Z10A 3FECA 3NE7A 4QC6A 4IUSA 4UWIA 3K2KA 1RO5A 3SI0A 4F8ZA 5HVHA 4CGNA 4PK2A 2FSRA 1F57A 3SI2A 2K5TA 3PP9A 1Z8TA 4RI1A 5CPAA 4AVBA 4KVXA 4KVOE 2Q51A 3KQZA 1NMTA 1TF9A 3MRUA 4ZY2A 3EY5A 4KOUA 4A38A 4B5OA 1I12A 4OAEA 3FRMA 4CGLA 3I3GA 4OIWA 2CTCA 1TKHA 3VATA 3D67A 2WUUA 2OZGA 4R87A 2PJCA 1XOVA 1N71A 5CBMA 1BPNA 1X10A 4KOVA 1YVOA 4M3SA 4UBRA 3CDXA 2VEZA 4BBHA 5AG5A 4ZI6A 1UWYA 2V8HA 2F5IA 1ARMA 4KUAA 2Z3NA 2CIJA 4ONUA 5G22A 1Y7EA 3DDDA 2RFHA 3C26A 4LUAA 4IF5A 2R1IA 3EFAA 4CGOA 2ZEPA 3CZXA 7CPAA 3SXOA 2ZEEA 3TFYA 2D4OA 4KSIA 1YR0A 2VZYA 1I1DA 2ZEGA 4E2AA 4OC2A 1A2ZA 2PVVA 3FEDA 3G8WA 5H84A 5HVGA 3D68A 1M44A 1M1DA 4MHDA 1SQHA 1ZLIA 3TTHA 3JRUA 1XEBA 4A30A 3TO9A 2AE6A 2FL4A 3QB8A 3BXMA 2B4DB 4A37A 4MCPA 4PXBA 4A31A 2ARHA 2OU2A 4YFJA 4AG9A 5JPHA 3R1KA 2ZENA 2CNMA 1Z8LA 4NXYA 1KUYA 4NSQA 8CPAA 1IOIA 4NGMA 2P6EA 2PCUA 2FIWA 3IC1A 1U6MA 4RN7A 4A2ZA 2GLJA 3MGDA 1F2OA 5I0CA 2IJZA 4FD7A 3PFOA 3KR4A 4FWUA 1PU9A 3KQXA 3GUXA 3SHPA 2Z3MA 2Q4VA 2ZELA 1F2PA 1CJWA 4NGSA 4UFVA 2CXAA 2JBJA 1XFOA 2OZHA 3FBUA 5I4MA 3BLNA 2QJ8A 1IYKA 4YRHA 2C27A 1NSLA 4HKFA 3BI0A 4PPZA 3LACA 4NFRA 4WJBA 3S6FA 5K8NA 1Q2DA 4RS2A 5AG7A 3NA6A 2YNCC 2G3AA 4XPDC 2ANPA 3FVLA 4QBJA 2I3CA 3PEIA 2OOTA 1LAPA 2XEGA 1MJ9A 1CBXA 2Q4YA 3S9MA 3W6SA 2REFA 4CS0B 4UF4A 4A39A 3D7DA 2AFSA 4KS9A 5GCNA 2JLMA 1NE9A 5JM6A 3QNVA 5JH9A 4A95A 3BI1A 4P4JA 1BPMA 3OWCA 1TXRA 2HV2A 2CTBA 3PB9X 1Z5RA 3EC4A 4CYOA 3E0KA 4KORA 2PJBA 2RC4A 1GHEA 3RBUA 4MHPA 5HVFA 5JGFA 1VGYA 2DPTA 4F0YA 1YQEA 1YLEA 2B3UA 3FIXA 3PFEA 2Q7SA 4CAVA 1Q2CA 1KUVA 2P6GA 1JWQA 2CNSA 3GB0A 4X2TA 4L89A 3IIBA 5THWA 2PDOA 2ZEHA 3VH9A 5C88A 4KZTA 5LRGA 1LOKA 2QECA 2PJ4A 1PYTB 1QQ9A 2JEVA 4DNCA 4KOSA 3N7ZA 3NH5A 2REEA 3LD2A 4RUHA 3LWUA 3SI1A 2GU2A 3FXTA 5J8FA 4XPKA 3TX8A 3T90A 4EFDA 4Y49C 1YVKA 5K8OA 3RAMA 3KHZA 3TCVA 3L2NA 2J9AA 2IL4A 1Y7RA 2WZNA 1ZG8A 3B3TA 2BL1A 3LMSA 5ELYA 4UWJA 2V8VA 4KOWA 1Y9WA 1OBRA 1MK4A 2KCWA 1QSNA 4AVCA 1UFHA 2EK8A 4Q36A 2CNTA 2GANA 5IB0A 1R43A 5LYIA 3D8PA 1FY7A 2PRBA 4Y49B 4AB7A 4FAIA 1CP6A 4GXHA 4C7HA 2EK9A 4C7IA 5K8MA 3F8KA 4ZY1A 4UIBA 5BWAB 2J8MA 1Q2YA 1Z4RA 2YNEA 3JTKA 4JD6A 4NGPA 3ZZIA 4UA3A 3P2FA 4CAWA 3B3VA 1S60A 2OR4A 3IEHA 3P2HA 3I1UA 4UEFA 1PUAA 3NH4A 2ZOFA 4ZYQA 1QSRA 3DSBA 2ZW4A 1XIXA 4KUBA 2RB7A 2WPWA 3PZJA 3FMCA 3H4QA 1HEEA 4ONWA 3R9GA 3TOAA 5KTAA 1AUGA 1WK4A 4I49A 4ZY0A 4U9YA 2DF5A 4E8OA 3GY9A 1IYLA 4F9VA 4M6HA 4U5YA 4KSAA 3D2PA 1YLOA 5G1ZA 2GE3A 1YREA 3DR6A 4R3LA 2XEFA 1YGHA 5F09A 2PJ9A 5KTDA 2PC1A 2GLFA 4NGNA 4UEEA 1BOBA 1XRYA 1ELLP 3KI9A 4R6TA 1B87A 4DUKA 4F6AA 4A94A 4ORFA 1ON0A 4M85A 4KLVA 4PSWA 4MFJA 3FH4A 2PIYA 1XMTA 2AFMA 2HUZA 3CPAA 3JUWA 2HQYA 5LYLA 4HPSA 1IICA 4K30A 2EVNA 2FE7A 1YK3A 2J8RA 4YU9A 2PJ6A 4JJXA 2OZUA 3B8GA 3I9SA 4JLYA 5E96A 2PSWA 4WWVA 3ISXA 4IK2A 3PBBA 3QAHA 1BLLE 2WPXA 5G21A 4EVYA 1ZG7A 1VKCA 2FS5A 2R8VA 1NSAA 2BO9A 3PB7X 4NEXA 4NJRA 5LRJA 4NGQA 3SJGA 4P4DA 2JBKA 3TC8A 4OIDA 5LYFA 1YMEA 2O4HA 1LAMA 1V0CA 2ZEFA 3CXQA 4AG7A 1CG2A 5F48A 3WC7A 5C82A 2ZW6A 3B3WA 3NH8A 3BJ7A 1TF8A 4R57A 2PJ1A 3K9UA 3SJXA 4FD6A 4B5PB 2PQ8A 4CAXA 4P10A 1Z4EA 4MCRA 4XPLA 4B13A 4MHZA 5ISVA 3KHXA 5F46A 1ELMP 4MY3A 3VARA 2ODFA 3IU1A 4PXEA 4GM5A 4OADA 1RTQA 1LFWA 3D3SA 5F49A 1ZLHA 1B6BA 4R8FA 5A28A 4OP4A 3H8EA 4M6IA 1M4GA 4MJ8A 4UCPA 4R76A 1TKJA 2PJ2A 2DPSA 3PB6X 2BCOA 3D4UA 3KGQA 1CM0A 2B4DA 4H89A 5H86A 1Y0RA 2J8NA 2FXFA 3RO0A 4C2XA 3W6XA 4KOYA 3S6GA 4MCQA 2F7VA 2O53A 4H6ZA 4X5KA 2EWBA 4X3RA 1LCPA 2P6FA 3DGVA 4FD4A 1LRZA 3PBEA 3S9LA 3GKRA 4R9MA 2D4PA 2P0WA 3A9LA 4U9ZA 1M4IA 4TNUA 2H5MA 3V8IA 4F9UA 1DE4C 4OC4A 3RYOA 2Y0MA 1TIQA 1R57A 3D7FA 4F0XA 4UIAA 4W9YA 1S7FA 3SJFA 1MJBA 4DYOA 6CPAA 1QSTA 1XJOA 4AXVA 3N5FA 1QMUA 3CT9A 3HUVA 3CXPA 4JXRA 4QUSA 4G1PA 4LQGA 3W91A 4CYQA 1IGBA 2QYVA 2QMLA 4UFWA 3TO7A 5K8PA 2HB6A 4P6YA 2FT0A 3VWEA 4MCSA 3IO1A 4ZX8A 4Q38A 3H8FA 2HC9A 3D7GA 2FVGA 3WABA 4A32A 4C2YA 4B12A 4MI4A 4CAFA 5CNPA 3H5ZA 4KLWA 3R95A 4B10A 3B7IA 4C2ZA 3SXNA 4MFKA 3PB4X 4MXUA 2AFZA 3CXSA 3TT2A 2PE3A 3BHXA 1GYTA 4HNWB 2F8HA 2Q44A 2X7BA 3TO6A 3JVNA 2ZEMA 2AFWA 3F0AA 2G3TA 3KKWA 3FEEA 4MMOA 2WSAA 3FYNA 2PR1A 5DWMA 4UCMA 1JQGA 3GYAA 4NGRA 4CYNA 4OC3A 4JYWA 3R9FA 4P4FA 1R3NA 1YSJA 1Q7LA 1BO4A 3B3SA 2V8GA 3V38A 2YNDA 1P4NA 2EBJA 5EMIA 4NCZA 2OB0A 4KSFA 3FNCA 2Q43A 2GIVA 4PXDA 1FNOA 2PJ7A 2POKA 3LODA 3T9YA 1YW6A 4CGMA 2AFXA 3IWEA 1LANA 4QB9A 2PJ8A 2BUEA 1S7NA 4KOXA 1HDUA 2GREA 5DS0A 4PXCA 4IAVA 4X8IA 1EE3P 2A4NA 3KZWA 2PIZA 2CY2A 4CRYB 2G9DA 2XEJA 2VXKA 3RNZA 1KWMA 2C1CA 4BINA 5AG6A 2NYQA 4OC1A 4XNHB 3TOBA 4PSXA 5D29A 4LQ6A 4EWTA 2XEIA 3FB3A 1IOFA 5KTCA 1VIXA 3CPXA 5D8NA 5LYDA 2AFOA 3PGPA 3SJEA 4OC0A 2DXQA 3ZJ0A 1RXTA 4YGOA 3EXNA 1J4JA 2JDDA 2AFUA 1CPSA 3IWWA 2PJAA 5HMNA 3WC5A 2PJ5A 4B5PA 4Z65A 5IX3A 3R9EA 1IIDA 1QSOA 5HXDA 4UFXA 1XF8A 2B3VA 4MFZA 4R7MA 4J3GA 4CYPA 4EMEA 2YGWA 2Q04A 2Z3OA 1S3ZA 2B5GA 2CF4A 2ZEDA 5AG4A 2EO8A 2VQYA 1DTDA 5A27A 4CAEA 4AVAA 4A33A 3IJ3A 1VHEA 4OLLA 4OKOA 2C6PA 2ZPAA 5HH1A 2Q7BA 3PB8X 1TKFA 4R3KA 2GFQA 4XPDB 2ATRA 4FBEA 4JXQA 4P44A 1S7LA 1VHSA 3G3SA 3UY5A 4M6GA 1Y9KA 3WR7A 4OMEA 3DLJA 1IY7A 1FT7A 3B3CA 4NF1A 1L0CA 1ARLA 3S6HA 3VWDA 2PJ0A 4PV6A 3IGRA 1IU8A 1K4JA 4MHNA 2V77A 3PRTA 5F47A 3KASA 5J1QA 2VBQA 3KR5A 4MHYA 5FVJA 4DJLA 4UEZA 4P4IA 3D7HA 1PCAA 2C6CA 4K3NA 1YX0A 3B35A 4MY0A 2NMTA 2YNCA 3KL9A 4OC5A 3BJ8A 2NSMA 2I00A 2B4BA 2PR8A 2ZW7A 5IV0A 2Z3KA 4KVME 2QVPA 2VL1A 3IWGA 1IB1E 4NGTA 5AGEA 3EO4A 3T8WA 1Z8WA 2PVWA 4ZGYB 1S5KA 2B5GB 4MRIA 5EC4A 2BSWA 2ZEOA 1XMBA 4LX9A 4C68A 1VHOA 4PQAA 1XBUA 1ZG9A 4H2KA 2O28A 2PRQA 4GS4A 1CP7A 2VZZA 2Z0ZA 2Q4ZA 4ZX9A 4ZBGA 2IMOA 1BAVA 1Z8XA 3HLPA 5EBVA 2WYRA 4O23A 4B14A 4MBUA 1X12A 3FJUA 3RZAA 4UCNA 1KUXA 3GLJA 5JQ4A 2ZOGA 4CPAA 2DEAA 2JDCA 2R98A 1H8LA 2Z11A 3IU2A 4TWEA 3WC6A 2Z3LA 1YW4A 1AMPA 1Z2LA 1ZO0A 4MFQA 4P4EA 3NFZA 3FX6A 1I21A 4MFLA 2AJ6A 4BD9A 1QSMA 3QAYA 2ABZA 3IFEA 2VI7A 4P4BA 4IHMA 4II9A 4Q7AA 3F5BA 4H6UA 2G0BA 3D66A 3NE8A 2BEIA 2R7HA 4FUUA 4HNXB 3S9NA 1Z9UA 4JWPA 3TE4A 2IQ6A 3ISZA 3K9TA 3GIUA 1WWZA 4PK3A 4XNHC 4CRZB 3DNSA 2I79A 4MFPA 1CX8A 2BOAA 4B6ZA 4B11A 1MJAA 3WT4A 2OH1A 3D2MA 1Y0YA 3FF3A 4NJQA 2Z3PA 2B58A 5IB9A 2C6GA 4KOTA 2QIRA 3MN8A 4FD5A
chains in the Genus database with same CATH topology
5G20A 2FIAA 4QVTA 4BMHA 1KZFA 1P0HA 4HNYB 4L8AA 1M4DA 3R96A 4E0AA 2ZXVA 1OZPA 1XE4A 2EUIA 3S6KA 2Q0YA 5J8CA 3DR8A 1S7KA 5DWNA 4CGPA 2ZW5A 2FCKA 2Z10A 3NE7A 4QC6A 4IUSA 4UWIA 1RO5A 4CGNA 4PK2A 2FSRA 2K5TA 3PP9A 4RI1A 4AVBA 4KVXA 4KVOE 1NMTA 3EY5A 4KOUA 4B5OA 1I12A 4OAEA 3FRMA 4CGLA 3I3GA 2WUUA 2OZGA 4R87A 1N71A 4KOVA 1YVOA 4M3SA 4UBRA 4BBHA 2VEZA 5AG5A 2F5IA 4KUAA 2Z3NA 4ONUA 5G22A 3DDDA 3C26A 4LUAA 4CGOA 2R1IA 3EFAA 3SXOA 3TFYA 2D4OA 1YR0A 2VZYA 1I1DA 4E2AA 5H84A 3G8WA 4MHDA 1M44A 1M1DA 1SQHA 3TTHA 1XEBA 4A30A 3TO9A 2AE6A 2FL4A 3QB8A 2B4DB 4A31A 2ARHA 2OU2A 4YFJA 4AG9A 5JPHA 3R1KA 4NXYA 2CNMA 1KUYA 4NSQA 2P6EA 2FIWA 1U6MA 4A2ZA 3MGDA 5I0CA 4FD7A 1PU9A 3SHPA 2Z3MA 2Q4VA 1CJWA 4UFVA 2CXAA 2OZHA 3FBUA 3BLNA 1IYKA 4YRHA 2C27A 1NSLA 4HKFA 3S6FA 1Q2DA 4RS2A 5AG7A 2YNCC 2G3AA 4XPDC 4QBJA 1MJ9A 2Q4YA 4CS0B 3W6SA 2REFA 4KS9A 5GCNA 2JLMA 1NE9A 4A95A 3OWCA 2HV2A 4CYOA 3EC4A 3E0KA 4KORA 2RC4A 1GHEA 2DPTA 4F0YA 3FIXA 1YLEA 2B3UA 4CAVA 1Q2CA 1KUVA 2P6GA 2CNSA 4L89A 2PDOA 5C88A 4KZTA 2QECA 2JEVA 4DNCA 4KOSA 3N7ZA 2REEA 3LD2A 3FXTA 5J8FA 4XPKA 3T90A 4Y49C 1YVKA 3TCVA 2IL4A 1Y7RA 2BL1A 4UWJA 4KOWA 1Y9WA 1MK4A 2KCWA 1QSNA 4AVCA 1UFHA 4Q36A 5IB0A 2CNTA 2GANA 3D8PA 1FY7A 2PRBA 4Y49B 4AB7A 4C7HA 4C7IA 3F8KA 5BWAB 2J8MA 1Q2YA 1Z4RA 2YNEA 3JTKA 4JD6A 3ZZIA 4UA3A 3P2FA 4CAWA 1S60A 3P2HA 1PUAA 1QSRA 3DSBA 2ZW4A 1XIXA 4KUBA 2WPWA 3PZJA 3H4QA 3R9GA 3TOAA 5KTAA 1WK4A 4I49A 4U9YA 4E8OA 3GY9A 1IYLA 4U5YA 4KSAA 3D2PA 5G1ZA 2GE3A 1YREA 3DR6A 4R3LA 1YGHA 5KTDA 2PC1A 1BOBA 1B87A 4F6AA 4ORFA 1ON0A 4M85A 4KLVA 4PSWA 4MFJA 1XMTA 2HUZA 3JUWA 2HQYA 1IICA 4K30A 2EVNA 2FE7A 1YK3A 2J8RA 4JJXA 2OZUA 3B8GA 3I9SA 4JLYA 5E96A 2PSWA 3QAHA 2WPXA 5G21A 4EVYA 4NEXA 1VKCA 2FS5A 2R8VA 1V0CA 3CXQA 4AG7A 5F48A 5C82A 2ZW6A 3BJ7A 4R57A 4B5PB 3K9UA 4FD6A 2PQ8A 4CAXA 1Z4EA 4XPLA 4B13A 5ISVA 5F46A 4MY3A 3IU1A 4OADA 3D3SA 5F49A 1B6BA 5A28A 1M4GA 4MJ8A 4UCPA 2DPSA 1CM0A 2B4DA 4H89A 5H86A 2J8NA 2FXFA 4C2XA 3W6XA 4KOYA 3S6GA 4X5KA 4H6ZA 2P6FA 4FD4A 1LRZA 3GKRA 4R9MA 2D4PA 2P0WA 3A9LA 4U9ZA 1M4IA 2H5MA 3V8IA 3RYOA 2Y0MA 1TIQA 1R57A 4F0XA 1S7FA 1MJBA 1QSTA 3CXPA 4JXRA 4QUSA 3W91A 4CYQA 4UFWA 3TO7A 2QMLA 2FT0A 3VWEA 4Q38A 4A32A 4C2YA 4B12A 4MI4A 4CAFA 5CNPA 3H5ZA 4KLWA 3R95A 4B10A 4C2ZA 3SXNA 4MFKA 3CXSA 3TT2A 4HNWB 2Q44A 2X7BA 3TO6A 3JVNA 3F0AA 2G3TA 3KKWA 2WSAA 3FYNA 2PR1A 5DWMA 4UCMA 3GYAA 4CYNA 3R9FA 1BO4A 2YNDA 1P4NA 4NCZA 2OB0A 4KSFA 3FNCA 2GIVA 3T9YA 3LODA 4CGMA 3IWEA 4QB9A 4KOXA 2BUEA 1S7NA 2A4NA 2CY2A 4CRYB 2VXKA 5AG6A 3TOBA 4XNHB 4PSXA 3FB3A 5KTCA 3PGPA 3ZJ0A 2DXQA 1RXTA 4YGOA 3EXNA 1J4JA 2JDDA 5HMNA 4B5PA 5IX3A 3R9EA 1IIDA 1QSOA 4UFXA 1XF8A 2B3VA 4MFZA 4CYPA 4J3GA 2YGWA 2Q04A 2Z3OA 1S3ZA 2B5GA 5AG4A 2VQYA 5A27A 4CAEA 4AVAA 4A33A 4OLLA 2ZPAA 5HH1A 2Q7BA 4R3KA 4XPDB 2ATRA 4JXQA 1S7LA 1VHSA 3G3SA 3UY5A 1Y9KA 3WR7A 4NF1A 1L0CA 3S6HA 3VWDA 4PV6A 3IGRA 1K4JA 5F47A 2VBQA 5FVJA 1YX0A 4MY0A 2NMTA 2YNCA 3BJ8A 2I00A 2B4BA 2PR8A 2ZW7A 5IV0A 2Z3KA 4KVME 3IWGA 1IB1E 5AGEA 3EO4A 4ZGYB 1S5KA 2B5GB 5EC4A 2BSWA 4LX9A 4C68A 2O28A 4GS4A 2VZZA 2Z0ZA 4ZBGA 5EBVA 4B14A 4MBUA 4UCNA 1KUXA 5JQ4A 2JDCA 2R98A 2Z11A 3IU2A 4FD5A 2Z3LA 1ZO0A 4MFQA 1I21A 4MFLA 2AJ6A 1QSMA 2VI7A 4II9A 3F5BA 4H6UA 2G0BA 2BEIA 2R7HA 4HNXB 1Z9UA 4JWPA 3TE4A 1WWZA 4PK3A 4XNHC 4CRZB 3DNSA 2I79A 4MFPA 4B11A 1MJAA 2OH1A 3D2MA 2Z3PA 2B58A 4KOTA 2QIRA 4IF5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FIA A;  4QVT A;  4BMH A;  1KZF A;  1P0H A;  4HNY B;  4L8A A;  1M4D A;  3R96 A;  4E0A A;  2ZXV A;  1OZP A;  1XE4 A;  2EUI A;  3S6K A;  2Q0Y A;  5J8C A;  3DR8 A;  1S7K A;  5DWN A;  2ZW5 A;  2FCK A;  2Z10 A;  4QC6 A;  3NE7 A;  4IUS A;  4UWI A;  1RO5 A;  4PK2 A;  2FSR A;  2K5T A;  3PP9 A;  4RI1 A;  4AVB A;  4KVX A;  4KVO E;  1NMT A;  3EY5 A;  4KOU A;  4B5O A;  1I12 A;  4OAE A;  3FRM A;  3I3G A;  2OZG A;  4R87 A;  1N71 A;  4KOV A;  1YVO A;  4M3S A;  4UBR A;  2VEZ A;  2F5I A;  4KUA A;  4ONU A;  3DDD A;  3C26 A;  4LUA A;  2R1I A;  3EFA A;  3SXO A;  3TFY A;  2D4O A;  1YR0 A;  2VZY A;  1I1D A;  4E2A A;  5H84 A;  3G8W A;  4MHD A;  1M44 A;  1M1D A;  1SQH A;  3TTH A;  1XEB A;  3TO9 A;  2AE6 A;  2FL4 A;  3QB8 A;  2B4D B;  2ARH A;  2OU2 A;  4YFJ A;  4AG9 A;  5JPH A;  3R1K A;  4NXY A;  2CNM A;  1KUY A;  4NSQ A;  2P6E A;  2FIW A;  1U6M A;  3MGD A;  5I0C A;  4FD7 A;  1PU9 A;  3SHP A;  2Q4V A;  1CJW A;  2OZH A;  3FBU A;  3BLN A;  1IYK A;  4YRH A;  2C27 A;  1NSL A;  4HKF A;  3S6F A;  1Q2D A;  4RS2 A;  2G3A A;  4XPD C;  4QBJ A;  1MJ9 A;  2Q4Y A;  4CS0 B;  3W6S A;  2REF A;  5GCN A;  2JLM A;  1NE9 A;  3OWC A;  2HV2 A;  3EC4 A;  3E0K A;  4KOR A;  2RC4 A;  1GHE A;  4F0Y A;  3FIX A;  1YLE A;  2B3U A;  4CAV A;  1Q2C A;  1KUV A;  2P6G A;  2CNS A;  4L89 A;  2PDO A;  5C88 A;  4KZT A;  2QEC A;  2JEV A;  4DNC A;  4KOS A;  3N7Z A;  2REE A;  3LD2 A;  3FXT A;  5J8F A;  4XPK A;  3T90 A;  4Y49 C;  1YVK A;  3TCV A;  2IL4 A;  1Y7R A;  2BL1 A;  4UWJ A;  4KOW A;  1Y9W A;  1MK4 A;  2KCW A;  1QSN A;  4AVC A;  1UFH A;  5IB0 A;  2CNT A;  2GAN A;  3D8P A;  1FY7 A;  2PRB A;  4Y49 B;  4AB7 A;  3F8K A;  2J8M A;  1Q2Y A;  1Z4R A;  4JD6 A;  3ZZI A;  4UA3 A;  3P2F A;  4CAW A;  1S60 A;  3P2H A;  1PUA A;  1QSR A;  3DSB A;  2ZW4 A;  1XIX A;  4KUB A;  2WPW A;  3PZJ A;  3H4Q A;  3R9G A;  3TOA A;  5KTA A;  1WK4 A;  4I49 A;  4U9Y A;  4E8O A;  3GY9 A;  1IYL A;  4U5Y A;  3D2P A;  2GE3 A;  1YRE A;  4R3L A;  3DR6 A;  1YGH A;  5KTD A;  2PC1 A;  1BOB A;  1B87 A;  4F6A A;  4ORF A;  1ON0 A;  4M85 A;  4KLV A;  4PSW A;  1XMT A;  2HUZ A;  3JUW A;  2HQY A;  1IIC A;  4K30 A;  2EVN A;  2FE7 A;  1YK3 A;  2J8R A;  4JJX A;  2OZU A;  3B8G A;  3I9S A;  4JLY A;  5E96 A;  2PSW A;  3QAH A;  2WPX A;  4EVY A;  4NEX A;  1VKC A;  2FS5 A;  2R8V A;  1V0C A;  3CXQ A;  4AG7 A;  5F48 A;  5C82 A;  2ZW6 A;  3BJ7 A;  4R57 A;  4B5P B;  3K9U A;  4FD6 A;  2PQ8 A;  4CAX A;  1Z4E A;  4XPL A;  5ISV A;  5F46 A;  4MY3 A;  4OAD A;  3D3S A;  5F49 A;  1B6B A;  1M4G A;  4MJ8 A;  1CM0 A;  2B4D A;  4H89 A;  5H86 A;  2J8N A;  2FXF A;  3W6X A;  4KOY A;  3S6G A;  4X5K A;  4H6Z A;  2P6F A;  4FD4 A;  1LRZ A;  3GKR A;  4R9M A;  2D4P A;  2P0W A;  4U9Z A;  1M4I A;  2H5M A;  3V8I A;  3RYO A;  2Y0M A;  1TIQ A;  1R57 A;  1S7F A;  1MJB A;  1QST A;  3CXP A;  4JXR A;  4QUS A;  3W91 A;  3TO7 A;  2QML A;  2FT0 A;  3VWE A;  4MI4 A;  5CNP A;  4KLW A;  3R95 A;  3SXN A;  3CXS A;  3TT2 A;  4HNW B;  2Q44 A;  2X7B A;  3TO6 A;  3JVN A;  3F0A A;  2G3T A;  3KKW A;  3FYN A;  2PR1 A;  5DWM A;  3GYA A;  3R9F A;  1BO4 A;  1P4N A;  4NCZ A;  2OB0 A;  3FNC A;  2GIV A;  3T9Y A;  3LOD A;  4QB9 A;  4KOX A;  2BUE A;  1S7N A;  2A4N A;  2CY2 A;  4CRY B;  2VXK A;  3TOB A;  4XNH B;  4PSX A;  3FB3 A;  5KTC A;  3PGP A;  3ZJ0 A;  2DXQ A;  1RXT A;  4YGO A;  3EXN A;  1J4J A;  2JDD A;  5HMN A;  4B5P A;  5IX3 A;  3R9E A;  1IID A;  1QSO A;  1XF8 A;  2B3V A;  4J3G A;  2Q04 A;  1S3Z A;  2B5G A;  2VQY A;  4AVA A;  4OLL A;  2ZPA A;  5HH1 A;  2Q7B A;  4R3K A;  4XPD B;  2ATR A;  4JXQ A;  1S7L A;  1VHS A;  3G3S A;  3UY5 A;  1Y9K A;  3WR7 A;  4NF1 A;  1L0C A;  3S6H A;  3VWD A;  4PV6 A;  3IGR A;  1K4J A;  5F47 A;  2VBQ A;  5FVJ A;  1YX0 A;  4MY0 A;  2NMT A;  3BJ8 A;  2I00 A;  2B4B A;  2PR8 A;  2ZW7 A;  5IV0 A;  4KVM E;  3IWG A;  1IB1 E;  3EO4 A;  1S5K A;  2B5G B;  5EC4 A;  2BSW A;  4LX9 A;  2O28 A;  4GS4 A;  2VZZ A;  2Z0Z A;  4ZBG A;  5EBV A;  4MBU A;  1KUX A;  5JQ4 A;  2JDC A;  2R98 A;  2Z11 A;  4FD5 A;  1I21 A;  2AJ6 A;  1QSM A;  2VI7 A;  4II9 A;  3F5B A;  4H6U A;  2G0B A;  2BEI A;  2R7H A;  4HNX B;  1Z9U A;  4JWP A;  3TE4 A;  1WWZ A;  4PK3 A;  4XNH C;  4CRZ B;  3DNS A;  2I79 A;  1MJA A;  2OH1 A;  3D2M A;  2B58 A;  4KOT A;  2QIR A;  4IF5 A; 
#chains in the Genus database with same CATH topology
 5G20 A;  3B2Y A;  5LRK A;  1CPX A;  2FIA A;  4P45 A;  4QVT A;  1KZF A;  1P0H A;  4HNY B;  2PJ3 A;  4BMH A;  4L8A A;  1M4D A;  3R96 A;  2JEW A;  4E0A A;  2ZXV A;  4YWY A;  1OZP A;  2V8D A;  1XE4 A;  3H8G A;  2EUI A;  4JZ0 A;  2Q0Y A;  3S6K A;  5J8C A;  3V7Z A;  3DR8 A;  1M4L A;  1S7K A;  1HDQ A;  5DWN A;  4CGP A;  2ZW5 A;  1AYE A;  2FCK A;  2Z10 A;  3FEC A;  3NE7 A;  4QC6 A;  4IUS A;  4UWI A;  3K2K A;  1RO5 A;  3SI0 A;  4F8Z A;  5HVH A;  4CGN A;  4PK2 A;  2FSR A;  1F57 A;  3SI2 A;  2K5T A;  3PP9 A;  1Z8T A;  4RI1 A;  5CPA A;  4AVB A;  4KVX A;  4KVO E;  2Q51 A;  3KQZ A;  1NMT A;  1TF9 A;  3MRU A;  4ZY2 A;  3EY5 A;  4KOU A;  4A38 A;  4B5O A;  1I12 A;  4OAE A;  3FRM A;  4CGL A;  3I3G A;  4OIW A;  2CTC A;  1TKH A;  3VAT A;  3D67 A;  2WUU A;  2OZG A;  4R87 A;  2PJC A;  1XOV A;  1N71 A;  5CBM A;  1BPN A;  1X10 A;  4KOV A;  1YVO A;  4M3S A;  4UBR A;  3CDX A;  2VEZ A;  4BBH A;  5AG5 A;  4ZI6 A;  1UWY A;  2V8H A;  2F5I A;  1ARM A;  4KUA A;  2Z3N A;  2CIJ A;  4ONU A;  5G22 A;  1Y7E A;  3DDD A;  2RFH A;  3C26 A;  4LUA A;  4IF5 A;  2R1I A;  3EFA A;  4CGO A;  2ZEP A;  3CZX A;  7CPA A;  3SXO A;  2ZEE A;  3TFY A;  2D4O A;  4KSI A;  1YR0 A;  2VZY A;  1I1D A;  2ZEG A;  4E2A A;  4OC2 A;  1A2Z A;  2PVV A;  3FED A;  3G8W A;  5H84 A;  5HVG A;  3D68 A;  1M44 A;  1M1D A;  4MHD A;  1SQH A;  1ZLI A;  3TTH A;  3JRU A;  1XEB A;  4A30 A;  3TO9 A;  2AE6 A;  2FL4 A;  3QB8 A;  3BXM A;  2B4D B;  4A37 A;  4MCP A;  4PXB A;  4A31 A;  2ARH A;  2OU2 A;  4YFJ A;  4AG9 A;  5JPH A;  3R1K A;  2ZEN A;  2CNM A;  1Z8L A;  4NXY A;  1KUY A;  4NSQ A;  8CPA A;  1IOI A;  4NGM A;  2P6E A;  2PCU A;  2FIW A;  3IC1 A;  1U6M A;  4RN7 A;  4A2Z A;  2GLJ A;  3MGD A;  1F2O A;  5I0C A;  2IJZ A;  4FD7 A;  3PFO A;  3KR4 A;  4FWU A;  1PU9 A;  3KQX A;  3GUX A;  3SHP A;  2Z3M A;  2Q4V A;  2ZEL A;  1F2P A;  1CJW A;  4NGS A;  4UFV A;  2CXA A;  2JBJ A;  1XFO A;  2OZH A;  3FBU A;  5I4M A;  3BLN A;  2QJ8 A;  1IYK A;  4YRH A;  2C27 A;  1NSL A;  4HKF A;  3BI0 A;  4PPZ A;  3LAC A;  4NFR A;  4WJB A;  3S6F A;  5K8N A;  1Q2D A;  4RS2 A;  5AG7 A;  3NA6 A;  2YNC C;  2G3A A;  4XPD C;  2ANP A;  3FVL A;  4QBJ A;  2I3C A;  3PEI A;  2OOT A;  1LAP A;  2XEG A;  1MJ9 A;  1CBX A;  2Q4Y A;  3S9M A;  3W6S A;  2REF A;  4CS0 B;  4UF4 A;  4A39 A;  3D7D A;  2AFS A;  4KS9 A;  5GCN A;  2JLM A;  1NE9 A;  5JM6 A;  3QNV A;  5JH9 A;  4A95 A;  3BI1 A;  4P4J A;  1BPM A;  3OWC A;  1TXR A;  2HV2 A;  2CTB A;  3PB9 X;  1Z5R A;  3EC4 A;  4CYO A;  3E0K A;  4KOR A;  2PJB A;  2RC4 A;  1GHE A;  3RBU A;  4MHP A;  5HVF A;  5JGF A;  1VGY A;  2DPT A;  4F0Y A;  1YQE A;  1YLE A;  2B3U A;  3FIX A;  3PFE A;  2Q7S A;  4CAV A;  1Q2C A;  1KUV A;  2P6G A;  1JWQ A;  2CNS A;  3GB0 A;  4X2T A;  4L89 A;  3IIB A;  5THW A;  2PDO A;  2ZEH A;  3VH9 A;  5C88 A;  4KZT A;  5LRG A;  1LOK A;  2QEC A;  2PJ4 A;  1PYT B;  1QQ9 A;  2JEV A;  4DNC A;  4KOS A;  3N7Z A;  3NH5 A;  2REE A;  3LD2 A;  4RUH A;  3LWU A;  3SI1 A;  2GU2 A;  3FXT A;  5J8F A;  4XPK A;  3TX8 A;  3T90 A;  4EFD A;  4Y49 C;  1YVK A;  5K8O A;  3RAM A;  3KHZ A;  3TCV A;  3L2N A;  2J9A A;  2IL4 A;  1Y7R A;  2WZN A;  1ZG8 A;  3B3T A;  2BL1 A;  3LMS A;  5ELY A;  4UWJ A;  2V8V A;  4KOW A;  1Y9W A;  1OBR A;  1MK4 A;  2KCW A;  1QSN A;  4AVC A;  1UFH A;  2EK8 A;  4Q36 A;  2CNT A;  2GAN A;  5IB0 A;  1R43 A;  5LYI A;  3D8P A;  1FY7 A;  2PRB A;  4Y49 B;  4AB7 A;  4FAI A;  1CP6 A;  4GXH A;  4C7H A;  2EK9 A;  4C7I A;  5K8M A;  3F8K A;  4ZY1 A;  4UIB A;  5BWA B;  2J8M A;  1Q2Y A;  1Z4R A;  2YNE A;  3JTK A;  4JD6 A;  4NGP A;  3ZZI A;  4UA3 A;  3P2F A;  4CAW A;  3B3V A;  1S60 A;  2OR4 A;  3IEH A;  3P2H A;  3I1U A;  4UEF A;  1PUA A;  3NH4 A;  2ZOF A;  4ZYQ A;  1QSR A;  3DSB A;  2ZW4 A;  1XIX A;  4KUB A;  2RB7 A;  2WPW A;  3PZJ A;  3FMC A;  3H4Q A;  1HEE A;  4ONW A;  3R9G A;  3TOA A;  5KTA A;  1AUG A;  1WK4 A;  4I49 A;  4ZY0 A;  4U9Y A;  2DF5 A;  4E8O A;  3GY9 A;  1IYL A;  4F9V A;  4M6H A;  4U5Y A;  4KSA A;  3D2P A;  1YLO A;  5G1Z A;  2GE3 A;  1YRE A;  3DR6 A;  4R3L A;  2XEF A;  1YGH A;  5F09 A;  2PJ9 A;  5KTD A;  2PC1 A;  2GLF A;  4NGN A;  4UEE A;  1BOB A;  1XRY A;  1ELL P;  3KI9 A;  4R6T A;  1B87 A;  4DUK A;  4F6A A;  4A94 A;  4ORF A;  1ON0 A;  4M85 A;  4KLV A;  4PSW A;  4MFJ A;  3FH4 A;  2PIY A;  1XMT A;  2AFM A;  2HUZ A;  3CPA A;  3JUW A;  2HQY A;  5LYL A;  4HPS A;  1IIC A;  4K30 A;  2EVN A;  2FE7 A;  1YK3 A;  2J8R A;  4YU9 A;  2PJ6 A;  4JJX A;  2OZU A;  3B8G A;  3I9S A;  4JLY A;  5E96 A;  2PSW A;  4WWV A;  3ISX A;  4IK2 A;  3PBB A;  3QAH A;  1BLL E;  2WPX A;  5G21 A;  4EVY A;  1ZG7 A;  1VKC A;  2FS5 A;  2R8V A;  1NSA A;  2BO9 A;  3PB7 X;  4NEX A;  4NJR A;  5LRJ A;  4NGQ A;  3SJG A;  4P4D A;  2JBK A;  3TC8 A;  4OID A;  5LYF A;  1YME A;  2O4H A;  1LAM A;  1V0C A;  2ZEF A;  3CXQ A;  4AG7 A;  1CG2 A;  5F48 A;  3WC7 A;  5C82 A;  2ZW6 A;  3B3W A;  3NH8 A;  3BJ7 A;  1TF8 A;  4R57 A;  2PJ1 A;  3K9U A;  3SJX A;  4FD6 A;  4B5P B;  2PQ8 A;  4CAX A;  4P10 A;  1Z4E A;  4MCR A;  4XPL A;  4B13 A;  4MHZ A;  5ISV A;  3KHX A;  5F46 A;  1ELM P;  4MY3 A;  3VAR A;  2ODF A;  3IU1 A;  4PXE A;  4GM5 A;  4OAD A;  1RTQ A;  1LFW A;  3D3S A;  5F49 A;  1ZLH A;  1B6B A;  4R8F A;  5A28 A;  4OP4 A;  3H8E A;  4M6I A;  1M4G A;  4MJ8 A;  4UCP A;  4R76 A;  1TKJ A;  2PJ2 A;  2DPS A;  3PB6 X;  2BCO A;  3D4U A;  3KGQ A;  1CM0 A;  2B4D A;  4H89 A;  5H86 A;  1Y0R A;  2J8N A;  2FXF A;  3RO0 A;  4C2X A;  3W6X A;  4KOY A;  3S6G A;  4MCQ A;  2F7V A;  2O53 A;  4H6Z A;  4X5K A;  2EWB A;  4X3R A;  1LCP A;  2P6F A;  3DGV A;  4FD4 A;  1LRZ A;  3PBE A;  3S9L A;  3GKR A;  4R9M A;  2D4P A;  2P0W A;  3A9L A;  4U9Z A;  1M4I A;  4TNU A;  2H5M A;  3V8I A;  4F9U A;  1DE4 C;  4OC4 A;  3RYO A;  2Y0M A;  1TIQ A;  1R57 A;  3D7F A;  4F0X A;  4UIA A;  4W9Y A;  1S7F A;  3SJF A;  1MJB A;  4DYO A;  6CPA A;  1QST A;  1XJO A;  4AXV A;  3N5F A;  1QMU A;  3CT9 A;  3HUV A;  3CXP A;  4JXR A;  4QUS A;  4G1P A;  4LQG A;  3W91 A;  4CYQ A;  1IGB A;  2QYV A;  2QML A;  4UFW A;  3TO7 A;  5K8P A;  2HB6 A;  4P6Y A;  2FT0 A;  3VWE A;  4MCS A;  3IO1 A;  4ZX8 A;  4Q38 A;  3H8F A;  2HC9 A;  3D7G A;  2FVG A;  3WAB A;  4A32 A;  4C2Y A;  4B12 A;  4MI4 A;  4CAF A;  5CNP A;  3H5Z A;  4KLW A;  3R95 A;  4B10 A;  3B7I A;  4C2Z A;  3SXN A;  4MFK A;  3PB4 X;  4MXU A;  2AFZ A;  3CXS A;  3TT2 A;  2PE3 A;  3BHX A;  1GYT A;  4HNW B;  2F8H A;  2Q44 A;  2X7B A;  3TO6 A;  3JVN A;  2ZEM A;  2AFW A;  3F0A A;  2G3T A;  3KKW A;  3FEE A;  4MMO A;  2WSA A;  3FYN A;  2PR1 A;  5DWM A;  4UCM A;  1JQG A;  3GYA A;  4NGR A;  4CYN A;  4OC3 A;  4JYW A;  3R9F A;  4P4F A;  1R3N A;  1YSJ A;  1Q7L A;  1BO4 A;  3B3S A;  2V8G A;  3V38 A;  2YND A;  1P4N A;  2EBJ A;  5EMI A;  4NCZ A;  2OB0 A;  4KSF A;  3FNC A;  2Q43 A;  2GIV A;  4PXD A;  1FNO A;  2PJ7 A;  2POK A;  3LOD A;  3T9Y A;  1YW6 A;  4CGM A;  2AFX A;  3IWE A;  1LAN A;  4QB9 A;  2PJ8 A;  2BUE A;  1S7N A;  4KOX A;  1HDU A;  2GRE A;  5DS0 A;  4PXC A;  4IAV A;  4X8I A;  1EE3 P;  2A4N A;  3KZW A;  2PIZ A;  2CY2 A;  4CRY B;  2G9D A;  2XEJ A;  2VXK A;  3RNZ A;  1KWM A;  2C1C A;  4BIN A;  5AG6 A;  2NYQ A;  4OC1 A;  4XNH B;  3TOB A;  4PSX A;  5D29 A;  4LQ6 A;  4EWT A;  2XEI A;  3FB3 A;  1IOF A;  5KTC A;  1VIX A;  3CPX A;  5D8N A;  5LYD A;  2AFO A;  3PGP A;  3SJE A;  4OC0 A;  2DXQ A;  3ZJ0 A;  1RXT A;  4YGO A;  3EXN A;  1J4J A;  2JDD A;  2AFU A;  1CPS A;  3IWW A;  2PJA A;  5HMN A;  3WC5 A;  2PJ5 A;  4B5P A;  4Z65 A;  5IX3 A;  3R9E A;  1IID A;  1QSO A;  5HXD A;  4UFX A;  1XF8 A;  2B3V A;  4MFZ A;  4R7M A;  4J3G A;  4CYP A;  4EME A;  2YGW A;  2Q04 A;  2Z3O A;  1S3Z A;  2B5G A;  2CF4 A;  2ZED A;  5AG4 A;  2EO8 A;  2VQY A;  1DTD A;  5A27 A;  4CAE A;  4AVA A;  4A33 A;  3IJ3 A;  1VHE A;  4OLL A;  4OKO A;  2C6P A;  2ZPA A;  5HH1 A;  2Q7B A;  3PB8 X;  1TKF A;  4R3K A;  2GFQ A;  4XPD B;  2ATR A;  4FBE A;  4JXQ A;  4P44 A;  1S7L A;  1VHS A;  3G3S A;  3UY5 A;  4M6G A;  1Y9K A;  3WR7 A;  4OME A;  3DLJ A;  1IY7 A;  1FT7 A;  3B3C A;  4NF1 A;  1L0C A;  1ARL A;  3S6H A;  3VWD A;  2PJ0 A;  4PV6 A;  3IGR A;  1IU8 A;  1K4J A;  4MHN A;  2V77 A;  3PRT A;  5F47 A;  3KAS A;  5J1Q A;  2VBQ A;  3KR5 A;  4MHY A;  5FVJ A;  4DJL A;  4UEZ A;  4P4I A;  3D7H A;  1PCA A;  2C6C A;  4K3N A;  1YX0 A;  3B35 A;  4MY0 A;  2NMT A;  2YNC A;  3KL9 A;  4OC5 A;  3BJ8 A;  2NSM A;  2I00 A;  2B4B A;  2PR8 A;  2ZW7 A;  5IV0 A;  2Z3K A;  4KVM E;  2QVP A;  2VL1 A;  3IWG A;  1IB1 E;  4NGT A;  5AGE A;  3EO4 A;  3T8W A;  1Z8W A;  2PVW A;  4ZGY B;  1S5K A;  2B5G B;  4MRI A;  5EC4 A;  2BSW A;  2ZEO A;  1XMB A;  4LX9 A;  4C68 A;  1VHO A;  4PQA A;  1XBU A;  1ZG9 A;  4H2K A;  2O28 A;  2PRQ A;  4GS4 A;  1CP7 A;  2VZZ A;  2Z0Z A;  2Q4Z A;  4ZX9 A;  4ZBG A;  2IMO A;  1BAV A;  1Z8X A;  3HLP A;  5EBV A;  2WYR A;  4O23 A;  4B14 A;  4MBU A;  1X12 A;  3FJU A;  3RZA A;  4UCN A;  1KUX A;  3GLJ A;  5JQ4 A;  2ZOG A;  4CPA A;  2DEA A;  2JDC A;  2R98 A;  1H8L A;  2Z11 A;  3IU2 A;  4TWE A;  3WC6 A;  2Z3L A;  1YW4 A;  1AMP A;  1Z2L A;  1ZO0 A;  4MFQ A;  4P4E A;  3NFZ A;  3FX6 A;  1I21 A;  4MFL A;  2AJ6 A;  4BD9 A;  1QSM A;  3QAY A;  2ABZ A;  3IFE A;  2VI7 A;  4P4B A;  4IHM A;  4II9 A;  4Q7A A;  3F5B A;  4H6U A;  2G0B A;  3D66 A;  3NE8 A;  2BEI A;  2R7H A;  4FUU A;  4HNX B;  3S9N A;  1Z9U A;  4JWP A;  3TE4 A;  2IQ6 A;  3ISZ A;  3K9T A;  3GIU A;  1WWZ A;  4PK3 A;  4XNH C;  4CRZ B;  3DNS A;  2I79 A;  4MFP A;  1CX8 A;  2BOA A;  4B6Z A;  4B11 A;  1MJA A;  3WT4 A;  2OH1 A;  3D2M A;  1Y0Y A;  3FF3 A;  4NJQ A;  2Z3P A;  2B58 A;  5IB9 A;  2C6G A;  4KOT A;  2QIR A;  3MN8 A;  4FD5 A; 
#chains in the Genus database with same CATH homology
 5G20 A;  2FIA A;  4QVT A;  4BMH A;  1KZF A;  1P0H A;  4HNY B;  4L8A A;  1M4D A;  3R96 A;  4E0A A;  2ZXV A;  1OZP A;  1XE4 A;  2EUI A;  3S6K A;  2Q0Y A;  5J8C A;  3DR8 A;  1S7K A;  5DWN A;  4CGP A;  2ZW5 A;  2FCK A;  2Z10 A;  3NE7 A;  4QC6 A;  4IUS A;  4UWI A;  1RO5 A;  4CGN A;  4PK2 A;  2FSR A;  2K5T A;  3PP9 A;  4RI1 A;  4AVB A;  4KVX A;  4KVO E;  1NMT A;  3EY5 A;  4KOU A;  4B5O A;  1I12 A;  4OAE A;  3FRM A;  4CGL A;  3I3G A;  2WUU A;  2OZG A;  4R87 A;  1N71 A;  4KOV A;  1YVO A;  4M3S A;  4UBR A;  4BBH A;  2VEZ A;  5AG5 A;  2F5I A;  4KUA A;  2Z3N A;  4ONU A;  5G22 A;  3DDD A;  3C26 A;  4LUA A;  4CGO A;  2R1I A;  3EFA A;  3SXO A;  3TFY A;  2D4O A;  1YR0 A;  2VZY A;  1I1D A;  4E2A A;  5H84 A;  3G8W A;  4MHD A;  1M44 A;  1M1D A;  1SQH A;  3TTH A;  1XEB A;  4A30 A;  3TO9 A;  2AE6 A;  2FL4 A;  3QB8 A;  2B4D B;  4A31 A;  2ARH A;  2OU2 A;  4YFJ A;  4AG9 A;  5JPH A;  3R1K A;  4NXY A;  2CNM A;  1KUY A;  4NSQ A;  2P6E A;  2FIW A;  1U6M A;  4A2Z A;  3MGD A;  5I0C A;  4FD7 A;  1PU9 A;  3SHP A;  2Z3M A;  2Q4V A;  1CJW A;  4UFV A;  2CXA A;  2OZH A;  3FBU A;  3BLN A;  1IYK A;  4YRH A;  2C27 A;  1NSL A;  4HKF A;  3S6F A;  1Q2D A;  4RS2 A;  5AG7 A;  2YNC C;  2G3A A;  4XPD C;  4QBJ A;  1MJ9 A;  2Q4Y A;  4CS0 B;  3W6S A;  2REF A;  4KS9 A;  5GCN A;  2JLM A;  1NE9 A;  4A95 A;  3OWC A;  2HV2 A;  4CYO A;  3EC4 A;  3E0K A;  4KOR A;  2RC4 A;  1GHE A;  2DPT A;  4F0Y A;  3FIX A;  1YLE A;  2B3U A;  4CAV A;  1Q2C A;  1KUV A;  2P6G A;  2CNS A;  4L89 A;  2PDO A;  5C88 A;  4KZT A;  2QEC A;  2JEV A;  4DNC A;  4KOS A;  3N7Z A;  2REE A;  3LD2 A;  3FXT A;  5J8F A;  4XPK A;  3T90 A;  4Y49 C;  1YVK A;  3TCV A;  2IL4 A;  1Y7R A;  2BL1 A;  4UWJ A;  4KOW A;  1Y9W A;  1MK4 A;  2KCW A;  1QSN A;  4AVC A;  1UFH A;  4Q36 A;  5IB0 A;  2CNT A;  2GAN A;  3D8P A;  1FY7 A;  2PRB A;  4Y49 B;  4AB7 A;  4C7H A;  4C7I A;  3F8K A;  5BWA B;  2J8M A;  1Q2Y A;  1Z4R A;  2YNE A;  3JTK A;  4JD6 A;  3ZZI A;  4UA3 A;  3P2F A;  4CAW A;  1S60 A;  3P2H A;  1PUA A;  1QSR A;  3DSB A;  2ZW4 A;  1XIX A;  4KUB A;  2WPW A;  3PZJ A;  3H4Q A;  3R9G A;  3TOA A;  5KTA A;  1WK4 A;  4I49 A;  4U9Y A;  4E8O A;  3GY9 A;  1IYL A;  4U5Y A;  4KSA A;  3D2P A;  5G1Z A;  2GE3 A;  1YRE A;  3DR6 A;  4R3L A;  1YGH A;  5KTD A;  2PC1 A;  1BOB A;  1B87 A;  4F6A A;  4ORF A;  1ON0 A;  4M85 A;  4KLV A;  4PSW A;  4MFJ A;  1XMT A;  2HUZ A;  3JUW A;  2HQY A;  1IIC A;  4K30 A;  2EVN A;  2FE7 A;  1YK3 A;  2J8R A;  4JJX A;  2OZU A;  3B8G A;  3I9S A;  4JLY A;  5E96 A;  2PSW A;  3QAH A;  2WPX A;  5G21 A;  4EVY A;  4NEX A;  1VKC A;  2FS5 A;  2R8V A;  1V0C A;  3CXQ A;  4AG7 A;  5F48 A;  5C82 A;  2ZW6 A;  3BJ7 A;  4R57 A;  4B5P B;  3K9U A;  4FD6 A;  2PQ8 A;  4CAX A;  1Z4E A;  4XPL A;  4B13 A;  5ISV A;  5F46 A;  4MY3 A;  3IU1 A;  4OAD A;  3D3S A;  5F49 A;  1B6B A;  5A28 A;  1M4G A;  4MJ8 A;  4UCP A;  2DPS A;  1CM0 A;  2B4D A;  4H89 A;  5H86 A;  2J8N A;  2FXF A;  4C2X A;  3W6X A;  4KOY A;  3S6G A;  4X5K A;  4H6Z A;  2P6F A;  4FD4 A;  1LRZ A;  3GKR A;  4R9M A;  2D4P A;  2P0W A;  3A9L A;  4U9Z A;  1M4I A;  2H5M A;  3V8I A;  3RYO A;  2Y0M A;  1TIQ A;  1R57 A;  4F0X A;  1S7F A;  1MJB A;  1QST A;  3CXP A;  4JXR A;  4QUS A;  3W91 A;  4CYQ A;  4UFW A;  3TO7 A;  2QML A;  2FT0 A;  3VWE A;  4Q38 A;  4A32 A;  4C2Y A;  4B12 A;  4MI4 A;  4CAF A;  5CNP A;  3H5Z A;  4KLW A;  3R95 A;  4B10 A;  4C2Z A;  3SXN A;  4MFK A;  3CXS A;  3TT2 A;  4HNW B;  2Q44 A;  2X7B A;  3TO6 A;  3JVN A;  3F0A A;  2G3T A;  3KKW A;  2WSA A;  3FYN A;  2PR1 A;  5DWM A;  4UCM A;  3GYA A;  4CYN A;  3R9F A;  1BO4 A;  2YND A;  1P4N A;  4NCZ A;  2OB0 A;  4KSF A;  3FNC A;  2GIV A;  3T9Y A;  3LOD A;  4CGM A;  3IWE A;  4QB9 A;  4KOX A;  2BUE A;  1S7N A;  2A4N A;  2CY2 A;  4CRY B;  2VXK A;  5AG6 A;  3TOB A;  4XNH B;  4PSX A;  3FB3 A;  5KTC A;  3PGP A;  3ZJ0 A;  2DXQ A;  1RXT A;  4YGO A;  3EXN A;  1J4J A;  2JDD A;  5HMN A;  4B5P A;  5IX3 A;  3R9E A;  1IID A;  1QSO A;  4UFX A;  1XF8 A;  2B3V A;  4MFZ A;  4CYP A;  4J3G A;  2YGW A;  2Q04 A;  2Z3O A;  1S3Z A;  2B5G A;  5AG4 A;  2VQY A;  5A27 A;  4CAE A;  4AVA A;  4A33 A;  4OLL A;  2ZPA A;  5HH1 A;  2Q7B A;  4R3K A;  4XPD B;  2ATR A;  4JXQ A;  1S7L A;  1VHS A;  3G3S A;  3UY5 A;  1Y9K A;  3WR7 A;  4NF1 A;  1L0C A;  3S6H A;  3VWD A;  4PV6 A;  3IGR A;  1K4J A;  5F47 A;  2VBQ A;  5FVJ A;  1YX0 A;  4MY0 A;  2NMT A;  2YNC A;  3BJ8 A;  2I00 A;  2B4B A;  2PR8 A;  2ZW7 A;  5IV0 A;  2Z3K A;  4KVM E;  3IWG A;  1IB1 E;  5AGE A;  3EO4 A;  4ZGY B;  1S5K A;  2B5G B;  5EC4 A;  2BSW A;  4LX9 A;  4C68 A;  2O28 A;  4GS4 A;  2VZZ A;  2Z0Z A;  4ZBG A;  5EBV A;  4B14 A;  4MBU A;  4UCN A;  1KUX A;  5JQ4 A;  2JDC A;  2R98 A;  2Z11 A;  3IU2 A;  4FD5 A;  2Z3L A;  1ZO0 A;  4MFQ A;  1I21 A;  4MFL A;  2AJ6 A;  1QSM A;  2VI7 A;  4II9 A;  3F5B A;  4H6U A;  2G0B A;  2BEI A;  2R7H A;  4HNX B;  1Z9U A;  4JWP A;  3TE4 A;  1WWZ A;  4PK3 A;  4XNH C;  4CRZ B;  3DNS A;  2I79 A;  4MFP A;  4B11 A;  1MJA A;  2OH1 A;  3D2M A;  2Z3P A;  2B58 A;  4KOT A;  2QIR A;  4IF5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...