3OWCA

Crystal structure of gnat superfamily protein pa2578 from pseudomonas aeruginosa
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
172
structure length
172
Chain Sequence
ELQLVPFQLGHFPILQRWFATEKELVQWAGPALRHPLSLEQMHEDLAESRRRPPLRLLWSACRDDQVIGHCQLLFDRRNGVVRLARIVLAPSARGQGLGLPMLEALLAEAFADADIERVELNVYDWNAAARHLYRRAGFREEGLRRSATRVGRERWNVVLMGLLRQEWAAGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable acetyltransferase
publication title Crystal structure of GNAT superfamily protein PA2578 from Pseudomonas aeruginosa
rcsb
source organism Pseudomonas aeruginosa
molecule tags Transferase
total genus 48
structure length 172
sequence length 172
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 3owcA00
1IB1E 3WR7A 4ORFA 4UA3A 1NMTA 3E0KA 3S6HA 3BJ8A 4PSXA 1BO4A 1IICA 4XPKA 4DNCA 2BEIA 2K5TA 1Z4EA 3EFAA 2B3UA 2I00A 5FVJA 2X7BA 5J8CA 2B3VA 2GE3A 1IIDA 2Q4VA 2ZW7A 1PU9A 4IUSA 2Q4YA 4F6AA 3OWCA 1N71A 3FBUA 1Y7RA 1M4GA 1QSRA 2JEVA 2NMTA 1Y9WA 1L0CA 3BLNA 4KOXA 4LX9A 4R9MA 1IYKA 2FIAA 2A4NA 5H86A 5EC4A 2JDDA 3F5BA 3EO4A 3R1KA 1S7FA 3VWEA 4MHDA 1KUYA 4IF5A 4FD5A 1S7LA 2P6EA 1MJBA 3N7ZA 3QB8A 4QC6A 3GKRA 1XF8A 2Q44A 3TOAA 3I9SA 2JLMA 3W6SA 2Z10A 4F0YA 5KTAA 1Q2YA 2PSWA 4FD7A 3EC4A 4M85A 2G0BA 3CXQA 4OAEA 4KOYA 3R9EA 5HH1A 2FE7A 4E8OA 4B5OA 4NXYA 3IWGA 4XPDC 3GYAA 1MJ9A 5IX3A 1WK4A 4QUSA 4AG7A 2B5GA 1KZFA 4UWIA 4B5PB 1TIQA 4ONUA 2REEA 2KCWA 4AVCA 3FIXA 1YX0A 1Z9UA 4HNYB 2WPXA 5KTCA 1KUXA 1S3ZA 3IGRA 3H4QA 4XNHC 1XIXA 4HKFA 4R57A 2ATRA 2PDOA 4I49A 3TOBA 4JJXA 3SXNA 4AB7A 4ZBGA 1K4JA 4HNXB 3LD2A 2Y0MA 3JUWA 2P6FA 1XEBA 2P6GA 2ZW4A 1XMTA 1CM0A 2VZZA 1RXTA 4KOTA 5JPHA 3FNCA 2FXFA 4HNWB 3TE4A 4PV6A 5JQ4A 3EXNA 5GCNA 1Z4RA 4YRHA 1LRZA 2OZGA 2VI7A 2B5GB 5E96A 2ARHA 4Y49B 1U6MA 3KKWA 3F0AA 1Q2DA 3TFYA 1QSOA 1S7NA 4U9YA 4UWJA 4KVME 2REFA 2F5IA 3P2HA 5F48A 1CJWA 2VZYA 3R96A 1QSTA 3FRMA 2ZW5A 3DSBA 4OADA 4L89A 3D8PA 4H6UA 2CNMA 3FB3A 3JVNA 2B58A 1MJAA 4KOWA 1VHSA 1MK4A 2B4BA 2OZUA 4FD4A 4CRZB 3ZZIA 3P2FA 4NF1A 2D4PA 2JDCA 3TTHA 1IYLA 4CRYB 4PK3A 2R98A 1Q2CA 4E0AA 3R9GA 3MGDA 3LODA 3V8IA 3SHPA 4X5KA 2B4DA 3VWDA 3TCVA 1WWZA 4QB9A 4KOSA 1YREA 2HUZA 1M1DA 2H5MA 3NE7A 5DWMA 3S6FA 4K30A 4JXQA 1BOBA 3UY5A 2RC4A 1M4DA 4QBJA 5ISVA 2FL4A 3I3GA 3PP9A 3R9FA 2PC1A 3D2MA 4LUAA 4MI4A 5I0CA 3FYNA 5C88A 1S60A 1P0HA 2Z11A 3K9UA 3TO7A 3PGPA 2R7HA 4XPDB 3ZJ0A 4KLWA 2OB0A 4KZTA 4KLVA 2D4OA 4R3KA 2FSRA 2J8NA 2OZHA 3CXPA 2FIWA 2I79A 2B4DB 2ZXVA 4CAWA 2BUEA 2Q04A 2R8VA 4U9ZA 2O28A 4EVYA 5HMNA 5J8FA 5F46A 1YVOA 2EUIA 1S5KA 1SQHA 5F47A 4FD6A 3DR8A 4BMHA 2FT0A 1I12A 4CS0B 1KUVA 2C27A 2CNTA 3TO6A 2R1IA 4KVXA 4CAVA 4Y49C 1QSMA 4MY3A 1RO5A 5CNPA 1R57A 3CXSA 1XE4A 1PUAA 1OZPA 4AVBA 4H89A 4RI1A 2CNSA 1J4JA 2VEZA 1FY7A 5H84A 4UBRA 4M3SA 2Q7BA 3F8KA 2FCKA 4JWPA 2QECA 3S6GA 4OLLA 5DWNA 3SXOA 2VXKA 1UFHA 2VBQA 1YGHA 3QAHA 2ZW6A 2CY2A 2EVNA 4RS2A 4JLYA 3D2PA 2OU2A 1B6BA 3T9YA 4H6ZA 4YFJA 4PSWA 2ZPAA 1GHEA 4U5YA 1P4NA 5C82A 3W6XA 3TT2A 3S6KA 1YLEA 4B5PA 2VQYA 3TO9A 1M4IA 2GANA 2Z0ZA 2OH1A 1NE9A 2BSWA 2GIVA 4XPLA 2QMLA 2PRBA 4KOUA 2BL1A 4YGOA 3BJ7A 2HV2A 4MJ8A 2PQ8A 3B8GA 1YK3A 2Q0YA 4R87A 3T90A 1I21A 3W91A 3D3SA 5EBVA 4E2AA 4J3GA 1YVKA 4NSQA 5KTDA 2DXQA 1YR0A 2P0WA 1V0CA 2WPWA 4MBUA 3C26A 4QVTA 1B87A 1ON0A 2PR8A 4PK2A 5IV0A 3DR6A 1I1DA 4KOVA 3EY5A 4GS4A 4MY0A 2J8MA 4R3LA 2AJ6A 1M44A 3PZJA 4NEXA 4JD6A 1S7KA 2QIRA 3DDDA 3FXTA 1Y9KA 5IB0A 4KUAA 2G3TA 3G3SA 2FS5A 3DNSA 4CAXA 2J8RA 2IL4A 4II9A 4AG9A 4L8AA 5F49A 3RYOA 4JXRA 2HQYA 3G8WA 1QSNA 3R95A 1VKCA 4AVAA 2G3AA 2PR1A 3GY9A 2AE6A 4KUBA 4KVOE 4XNHB 1NSLA 4KORA 4NCZA
chains in the Genus database with same CATH superfamily
2Z3KA 1IB1E 3RZAA 3WR7A 4ORFA 3FECA 2PIYA 1RTQA 2HB6A 2I3CA 1NMTA 1Q7LA 4UA3A 3E0KA 4MXUA 5AG7A 3S6HA 1A2ZA 2J9AA 3BJ8A 4MFQA 4PSXA 1BO4A 4PXCA 4R6TA 4YWYA 3TX8A 4RUHA 1IICA 4XPKA 4PQAA 5EMIA 4DNCA 2BEIA 2K5TA 3I1UA 3SJXA 1ZG8A 2C6PA 1Z4EA 4ZGYB 2V8GA 3EFAA 2B3UA 2I00A 1IOFA 4UEZA 2X7BA 4Q36A 5FVJA 4B11A 5J8CA 1VHOA 1XBUA 4X3RA 4C7IA 2GE3A 2B3VA 1IIDA 1ZO0A 2Q4VA 1PU9A 2ZW7A 3H8GA 2Q4YA 4IUSA 4F6AA 4MCPA 2ZEOA 3OWCA 2PE3A 1N71A 3FBUA 2ODFA 4KS9A 4Z65A 1Y7RA 1M4GA 1TKJA 1QSRA 2HC9A 2ZEMA 3GIUA 2JEVA 2NMTA 3RO0A 1Y9WA 1TF9A 1L0CA 3BLNA 4KOXA 4LX9A 4R9MA 4A2ZA 4KSFA 1IYKA 2FIAA 4M6GA 2A4NA 5H86A 5EC4A 2XEIA 2C6GA 2JDDA 4CAEA 3F5BA 2XEGA 4K3NA 1TKHA 4P4JA 3EO4A 3R1KA 1S7FA 4MMOA 3MRUA 1XJOA 2FVGA 5AG5A 2PJ8A 3VWEA 3BXMA 1KUYA 4MHDA 4UF4A 1XMBA 4IF5A 4UCPA 1X10A 2QJ8A 4FD5A 1S7LA 3CPAA 2P6EA 4CPAA 3L2NA 2GLFA 3WC5A 3PFOA 1MJBA 3KQZA 2PVWA 3N7ZA 3QB8A 4Q38A 4QC6A 1BLLE 2YNCA 3GKRA 4B14A 4F0XA 5BWAB 1XF8A 2C6CA 2Q44A 3HLPA 4F9UA 1VGYA 3TOAA 3I9SA 4MFZA 4R8FA 2Q51A 2JLMA 2Q7SA 4JZ0A 3W6SA 4H2KA 4MFPA 3D7FA 4MFKA 5LRKA 2Z10A 4F0YA 5KTAA 1Q2YA 2Z3NA 2PSWA 4PXBA 4FD7A 5HVHA 4MCSA 3EC4A 4M85A 2G0BA 3ISZA 5JGFA 3CXQA 1ZG9A 2YGWA 3D7GA 2GFQA 2PJ0A 4OAEA 4KOYA 4UIBA 3R9EA 2EWBA 4A38A 3PRTA 3BI0A 3IFEA 5HH1A 2FE7A 4P44A 3B35A 1QMUA 1LOKA 3RBUA 4E8OA 4B5OA 4NXYA 4NGQA 3IWGA 4UEFA 4IK2A 4XPDC 2DF5A 3SJGA 2AFZA 3GYAA 4JYWA 1MJ9A 4IAVA 5IX3A 1WK4A 4QUSA 5LRJA 3V7ZA 2EK8A 1ELLP 2B5GA 2PJ1A 4AG7A 1AUGA 1KZFA 4UWIA 4B5PB 1TIQA 2PJCA 4ONUA 2PRQA 4P45A 1Z8XA 2REEA 2KCWA 4C7HA 2F8HA 4DJLA 1TKFA 3KHZA 3KGQA 3GB0A 4UEEA 5D29A 4AVCA 2CF4A 3FIXA 1YX0A 2PJ5A 5CBMA 1Z9UA 1X12A 4HNYB 3MN8A 3SI0A 4ZY0A 2WPXA 5KTCA 1KUXA 1S3ZA 3IGRA 3H4QA 4MHZA 4NGPA 4IHMA 5HXDA 3VARA 4XNHC 4ZX9A 3WC6A 1XIXA 4GM5A 4HKFA 2V8VA 4R57A 2ATRA 3IU2A 2YNEA 4O23A 4P4FA 4CYNA 3IWWA 1CX8A 2PDOA 4I49A 3TOBA 3QAYA 4CGLA 4JJXA 3SI1A 3SXNA 4AB7A 4ZBGA 2F7VA 1XFOA 5J1QA 1K4JA 2CIJA 4HNXB 1CP6A 1Z8LA 2Z3MA 1CBXA 2Y0MA 3LD2A 3GUXA 3JUWA 2XEJA 2P6FA 1XEBA 2P6GA 2ZW4A 3KHXA 3PB4X 3WT4A 1XMTA 1CM0A 3H5ZA 4Q7AA 2VZZA 1RXTA 3KQXA 5HVGA 5A27A 4KOTA 4OC1A 2O53A 1NSAA 1DE4C 3FNCA 5JPHA 2FXFA 1F2OA 3NFZA 1DTDA 4HNWB 3TE4A 4PV6A 5JQ4A 4OIDA 3A9LA 1ZG7A 3EXNA 3IU1A 4GXHA 1Z4RA 5GCNA 2NYQA 4YRHA 1LRZA 2PVVA 2AFOA 2OZGA 2VI7A 4P4IA 5DS0A 4ZX8A 2B5GB 5THWA 5E96A 2IJZA 2AFXA 2ARHA 4Y49B 3HUVA 1U6MA 3KKWA 2PJ9A 3F0AA 1BPMA 2POKA 3IIBA 1Q2DA 3TFYA 1QSOA 1S7NA 4ZYQA 3D7DA 2PJBA 1ARLA 2ZEEA 4A31A 4U9YA 4UWJA 4KVME 2REFA 2BO9A 2F5IA 1EE3P 2Q4ZA 3GLJA 3P2HA 5F48A 1AYEA 1CJWA 4MCRA 1Z8TA 2VZYA 3R96A 1QSTA 2ZOFA 3FRMA 2ZW5A 3DSBA 4OADA 4AXVA 1ZLHA 3NA6A 4L89A 3SJFA 3RAMA 3LACA 3D8PA 4YU9A 2Q43A 2PJ2A 2EK9A 4H6UA 5A28A 1CPXA 2CNMA 3FB3A 3JVNA 4F8ZA 3S9LA 3D66A 2IQ6A 5CPAA 3DLJA 2B58A 1MJAA 4KOWA 1VHSA 2EBJA 1MK4A 1LANA 1QQ9A 2B4BA 4OC5A 4MFLA 2OZUA 2OOTA 4FD4A 1TF8A 3B7IA 4CRZB 3ZZIA 3P2FA 8CPAA 5G22A 3B3WA 4NF1A 2D4PA 2JDCA 3TTHA 1IYLA 1CP7A 3NE8A 4CRYB 4PK3A 6CPAA 2R98A 2ZEFA 4B6ZA 4NGSA 3FVLA 4EWTA 1Q2CA 4CYOA 4E0AA 3R9GA 4NJRA 4UIAA 3MGDA 4MHNA 4P4DA 3LODA 4KSIA 3V8IA 3SHPA 1TXRA 3ISXA 4X5KA 3KZWA 2BCOA 2B4DA 1YW6A 2AFSA 3VWDA 3D4UA 4MFJA 3TCVA 1R3NA 4HPSA 4WWVA 1WWZA 4QB9A 4CAFA 4DYOA 5JH9A 4KOSA 3FEEA 1YREA 3V38A 2HUZA 1M1DA 4UCNA 2H5MA 3IEHA 1Z8WA 2QYVA 2WYRA 5G20A 4CGPA 3N5FA 3NE7A 4A32A 4OP4A 4UCMA 1LFWA 1IGBA 4PXEA 2OR4A 1CPSA 3KI9A 5DWMA 3S6FA 4K30A 4JXQA 5I4MA 1BOBA 3B3CA 4OC3A 2RC4A 3UY5A 2ZEHA 1M4DA 4MHYA 1ZLIA 4ONWA 4QBJA 2ZEPA 5D8NA 1Y0YA 4OC0A 5ISVA 2ABZA 2FL4A 2WUUA 3I3GA 5LYFA 3K9TA 3PP9A 3R9FA 2PC1A 1YQEA 3K2KA 3BI1A 4F9VA 3D2MA 3PB9X 4A37A 2ZOGA 4LUAA 4MI4A 5I0CA 3B3TA 3FYNA 5C88A 4C2ZA 1JWQA 2ZELA 3QNVA 1S60A 2JBKA 1P0HA 2Z11A 3K9UA 4G1PA 3TO7A 5IB9A 4C2XA 4P4BA 3PGPA 2RB7A 2R7HA 4MCQA 4XPDB 3ZJ0A 5G21A 4KLWA 2OB0A 4KZTA 4M6IA 4KLVA 2V8DA 4X2TA 2D4OA 3B2YA 4NGTA 4R3KA 2FSRA 1Y7EA 2J8NA 5K8NA 1Z2LA 2OZHA 3CXPA 2FIWA 4A95A 2I79A 2B4DB 2ZXVA 4CAWA 5K8OA 2BUEA 2Q04A 2R8VA 3IC1A 2O28A 4U9ZA 3RNZA 4A30A 4EVYA 5HMNA 5F46A 2VL1A 5J8FA 1YVOA 2EUIA 5AG6A 2ZENA 1S5KA 1SQHA 4TWEA 5F47A 4FD6A 4A94A 3DR8A 4BMHA 4PPZA 2FT0A 1I12A 4NGNA 2AFMA 4FWUA 4A39A 4CS0B 1KUVA 2C27A 2CNTA 4NGMA 1FT7A 5HVFA 1ARMA 2PJ4A 3TO6A 2R1IA 4OC2A 4KVXA 4CAVA 4CGMA 3CT9A 4Y49C 2PIZA 4BBHA 4ZY1A 3PFEA 1QSMA 2EO8A 4MY3A 4NFRA 1H8LA 1RO5A 3IWEA 5LYDA 2V77A 5CNPA 5G1ZA 1R57A 4B10A 3CXSA 1LAPA 4A33A 3LMSA 1XE4A 1PUAA 1OZPA 4AVBA 4H89A 4RI1A 3LWUA 1AMPA 2CNSA 1J4JA 1PCAA 2VEZA 1FY7A 5ELYA 2WZNA 3BHXA 4BD9A 5H84A 1LCPA 2GLJA 3TC8A 1YLOA 1OBRA 3CPXA 4UBRA 3B3SA 2DEAA 3F8KA 2FCKA 4M3SA 2Q7BA 3IJ3A 4JWPA 2QECA 3FJUA 3S6GA 3FF3A 3NH4A 4X8IA 1VIXA 4OLLA 5DWNA 5LYLA 1F2PA 2PJ3A 4EFDA 3SXOA 2VXKA 1UFHA 4R7MA 2CXAA 2VBQA 4MHPA 1F57A 4DUKA 1YGHA 3QAHA 4C2YA 3H8FA 3PEIA 2ZW6A 3FEDA 2CY2A 5AGEA 2EVNA 4RS2A 4JLYA 3D2PA 2OU2A 4PXDA 3JTKA 3PB8X 5K8MA 1B6BA 3T9YA 4H6ZA 1UWYA 4B12A 4OMEA 4YFJA 4PSWA 2ZPAA 3S9MA 1GHEA 4OIWA 1Y0RA 3KL9A 4U5YA 2GREA 4NJQA 1P4NA 1YW4A 5C82A 2YNDA 3KR5A 3S9NA 4LQ6A 1BAVA 3W6XA 4FBEA 3TT2A 3S6KA 1YLEA 4B5PA 2VQYA 3TO9A 1M4IA 2GANA 4EMEA 2Z3PA 2Z0ZA 3PBEA 2OH1A 1R43A 3D67A 1NE9A 2DPSA 2ANPA 2O4HA 2PCUA 2BSWA 2RFHA 4RN7A 1YMEA 2GIVA 2G9DA 4XPLA 1LAMA 2QMLA 2PRBA 2Z3OA 4KOUA 2BL1A 4P4EA 3IO1A 4YGOA 3BJ7A 3FMCA 2PJAA 3KR4A 2HV2A 3JRUA 3NH8A 1FNOA 1GYTA 4MJ8A 1HDQA 2PQ8A 3CDXA 4ZY2A 1JQGA 3B3VA 3B8GA 4CYQA 5LRGA 2ZEDA 1YK3A 4B13A 4W9YA 3WABA 2V8HA 4R76A 2Q0YA 4R87A 3DGVA 3T90A 1CG2A 2IMOA 1I21A 3W91A 3D3SA 5EBVA 2JEWA 4C68A 4E2AA 3SI2A 4J3GA 5AG4A 4NGRA 1YVKA 7CPAA 4NSQA 2AFWA 4CYPA 2C1CA 5KTDA 2JBJA 4FUUA 4CGNA 2DXQA 4BINA 2NSMA 1IU8A 4MRIA 3PBBA 3CZXA 4WJBA 1YR0A 2P0WA 1V0CA 2WPWA 3VATA 4MBUA 4UFXA 1YSJA 2DPTA 1M4LA 3C26A 3FX6A 5JM6A 1XOVA 1IY7A 1B87A 2BOAA 4QVTA 2GU2A 1ON0A 2PR8A 2YNCC 4KSAA 4PK2A 5F09A 5IV0A 2PJ7A 3DR6A 1I1DA 4OKOA 4P10A 4KOVA 3EY5A 3PB6X 4GS4A 4UFVA 1IOIA 4MY0A 2J8MA 4R3LA 2AJ6A 4ZI6A 1HDUA 1M44A 3PZJA 4NEXA 3WC7A 2WSAA 5LYIA 4JD6A 1S7KA 1VHEA 2QIRA 3D7HA 4UFWA 2PJ6A 3DDDA 4TNUA 4LQGA 1BPNA 3FXTA 3SJEA 3VH9A 1Y9KA 1XRYA 1HEEA 5IB0A 4KUAA 3H8EA 2G3TA 3G3SA 1KWMA 2FS5A 2ZEGA 3DNSA 4CAXA 2J8RA 2CTCA 3T8WA 3KASA 2IL4A 4P6YA 4II9A 4CGOA 4AG9A 4L8AA 2CTBA 5F49A 3RYOA 4JXRA 2HQYA 3G8WA 1QSNA 2Z3LA 1VKCA 3R95A 1Z5RA 4AVAA 2QVPA 3D68A 5K8PA 2G3AA 2PR1A 3GY9A 4OC4A 3FH4A 2AE6A 3NH5A 4KUBA 2XEFA 1ELMP 4KVOE 1PYTB 4M6HA 4XNHB 2AFUA 3PB7X 1NSLA 4KORA 4FAIA 4NCZA
chains in the Genus database with same CATH topology
2Z3KA 1IB1E 3WR7A 4ORFA 4UA3A 1NMTA 3E0KA 5AG7A 3S6HA 3BJ8A 4MFQA 4PSXA 1BO4A 1IICA 4XPKA 4DNCA 2BEIA 2K5TA 1Z4EA 4ZGYB 3EFAA 2B3UA 2I00A 5FVJA 2X7BA 4Q36A 4B11A 5J8CA 4C7IA 2B3VA 2GE3A 1IIDA 1ZO0A 2Q4VA 1PU9A 2ZW7A 4IUSA 2Q4YA 4F6AA 3OWCA 1N71A 3FBUA 4KS9A 1Y7RA 1M4GA 1QSRA 2JEVA 2NMTA 1Y9WA 1L0CA 3BLNA 4KOXA 4LX9A 4R9MA 4A2ZA 4KSFA 1IYKA 2FIAA 2A4NA 5H86A 5EC4A 2JDDA 4CAEA 3F5BA 3EO4A 3R1KA 1S7FA 5AG5A 3VWEA 4MHDA 1KUYA 4IF5A 4UCPA 4FD5A 1S7LA 2P6EA 1MJBA 3N7ZA 3QB8A 4Q38A 4QC6A 4F0XA 2YNCA 3GKRA 4B14A 5BWAB 1XF8A 2Q44A 3TOAA 3I9SA 4MFZA 2JLMA 3W6SA 4MFPA 4MFKA 2Z10A 4F0YA 5KTAA 1Q2YA 2Z3NA 2PSWA 4FD7A 3EC4A 4M85A 2G0BA 3CXQA 2YGWA 4OAEA 4KOYA 3R9EA 5HH1A 2FE7A 4E8OA 4B5OA 4NXYA 3IWGA 4XPDC 3GYAA 1MJ9A 5IX3A 1WK4A 4QUSA 4AG7A 2B5GA 1KZFA 4UWIA 4B5PB 1TIQA 4ONUA 2REEA 2KCWA 4C7HA 4AVCA 3FIXA 1YX0A 1Z9UA 4HNYB 2WPXA 5KTCA 1KUXA 1S3ZA 3IGRA 3H4QA 4XNHC 1XIXA 4HKFA 4R57A 2ATRA 3IU2A 2YNEA 4CYNA 2PDOA 4I49A 3TOBA 4CGLA 4JJXA 3SXNA 4AB7A 4ZBGA 1K4JA 4HNXB 2Z3MA 3LD2A 2Y0MA 3JUWA 2P6FA 1XEBA 2P6GA 2ZW4A 1XMTA 1CM0A 3H5ZA 2VZZA 1RXTA 5A27A 4KOTA 5JPHA 3FNCA 2FXFA 4HNWB 3TE4A 4PV6A 5JQ4A 3A9LA 3EXNA 3IU1A 5GCNA 1Z4RA 4YRHA 1LRZA 2OZGA 2VI7A 2B5GB 5E96A 2ARHA 4Y49B 1U6MA 3KKWA 3F0AA 1Q2DA 3TFYA 1QSOA 1S7NA 4A31A 4U9YA 4UWJA 4KVME 2REFA 2F5IA 3P2HA 5F48A 1CJWA 2VZYA 3R96A 1QSTA 3FRMA 2ZW5A 3DSBA 4OADA 4L89A 3D8PA 4H6UA 5A28A 2CNMA 3FB3A 3JVNA 2B58A 1MJAA 4KOWA 1VHSA 1MK4A 2B4BA 4MFLA 2OZUA 4FD4A 4CRZB 3ZZIA 3P2FA 5G22A 4NF1A 2D4PA 2JDCA 3TTHA 1IYLA 4CRYB 4PK3A 2R98A 1Q2CA 4CYOA 4E0AA 3R9GA 3MGDA 3LODA 3V8IA 3SHPA 4X5KA 2B4DA 3VWDA 4MFJA 3TCVA 1WWZA 4QB9A 4CAFA 4KOSA 1YREA 2HUZA 1M1DA 4UCNA 2H5MA 5G20A 4CGPA 3NE7A 4A32A 4UCMA 5DWMA 3S6FA 4K30A 4JXQA 1BOBA 3UY5A 2RC4A 1M4DA 4QBJA 5ISVA 2FL4A 2WUUA 3I3GA 3PP9A 3R9FA 2PC1A 3D2MA 4LUAA 4MI4A 5I0CA 3FYNA 5C88A 4C2ZA 1S60A 1P0HA 2Z11A 3K9UA 3TO7A 4C2XA 3PGPA 2R7HA 4XPDB 3ZJ0A 5G21A 4KLWA 2OB0A 4KZTA 4KLVA 2D4OA 4R3KA 2FSRA 2J8NA 2OZHA 3CXPA 2FIWA 4A95A 2I79A 2B4DB 2ZXVA 4CAWA 2BUEA 2Q04A 2R8VA 4U9ZA 2O28A 4EVYA 4A30A 5HMNA 5J8FA 5F46A 1YVOA 2EUIA 5AG6A 1S5KA 1SQHA 5F47A 4FD6A 3DR8A 4BMHA 2FT0A 1I12A 4CS0B 1KUVA 2C27A 2CNTA 3TO6A 2R1IA 4KVXA 4CAVA 4CGMA 4Y49C 4BBHA 1QSMA 4MY3A 1RO5A 3IWEA 5CNPA 5G1ZA 1R57A 4B10A 3CXSA 4A33A 1XE4A 1PUAA 1OZPA 4AVBA 4H89A 4RI1A 2CNSA 1J4JA 2VEZA 1FY7A 5H84A 4UBRA 4M3SA 2Q7BA 3F8KA 2FCKA 4JWPA 2QECA 3S6GA 4OLLA 5DWNA 3SXOA 2VXKA 1UFHA 2CXAA 2VBQA 1YGHA 3QAHA 4C2YA 2ZW6A 2CY2A 5AGEA 2EVNA 4RS2A 4JLYA 3D2PA 2OU2A 3JTKA 1B6BA 3T9YA 4H6ZA 4B12A 4YFJA 4PSWA 2ZPAA 1GHEA 4U5YA 1P4NA 5C82A 2YNDA 3W6XA 3TT2A 3S6KA 1YLEA 4B5PA 2VQYA 3TO9A 1M4IA 2GANA 2Z3PA 2Z0ZA 2OH1A 1NE9A 2DPSA 2BSWA 2GIVA 4XPLA 2QMLA 2Z3OA 2PRBA 4KOUA 2BL1A 4YGOA 3BJ7A 2HV2A 4MJ8A 2PQ8A 3B8GA 4CYQA 1YK3A 4B13A 2Q0YA 4R87A 3T90A 1I21A 3W91A 3D3SA 5EBVA 4C68A 4E2AA 4J3GA 5AG4A 1YVKA 4NSQA 4CYPA 5KTDA 4CGNA 2DXQA 1YR0A 2P0WA 1V0CA 2WPWA 4MBUA 4UFXA 3C26A 2DPTA 4QVTA 1B87A 1ON0A 2PR8A 2YNCC 4KSAA 4PK2A 5IV0A 3DR6A 1I1DA 4KOVA 3EY5A 4GS4A 4UFVA 4MY0A 2J8MA 4R3LA 2AJ6A 1M44A 3PZJA 4NEXA 2WSAA 4JD6A 1S7KA 2QIRA 4UFWA 3DDDA 3FXTA 1Y9KA 5IB0A 4KUAA 2G3TA 3G3SA 2FS5A 3DNSA 4CAXA 2J8RA 2IL4A 4II9A 4CGOA 4AG9A 4L8AA 5F49A 3RYOA 4JXRA 2HQYA 3G8WA 1QSNA 2Z3LA 1VKCA 3R95A 4AVAA 2G3AA 2PR1A 3GY9A 2AE6A 4KUBA 4KVOE 4XNHB 1NSLA 4KORA 4NCZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IB1 E;  3WR7 A;  4ORF A;  4UA3 A;  1NMT A;  3E0K A;  3S6H A;  3BJ8 A;  4PSX A;  1BO4 A;  1IIC A;  4XPK A;  4DNC A;  2BEI A;  2K5T A;  1Z4E A;  3EFA A;  2B3U A;  2I00 A;  5FVJ A;  2X7B A;  5J8C A;  2B3V A;  2GE3 A;  1IID A;  2Q4V A;  2ZW7 A;  1PU9 A;  4IUS A;  2Q4Y A;  4F6A A;  3OWC A;  1N71 A;  3FBU A;  1Y7R A;  1M4G A;  1QSR A;  2JEV A;  2NMT A;  1Y9W A;  1L0C A;  3BLN A;  4KOX A;  4LX9 A;  4R9M A;  1IYK A;  2FIA A;  2A4N A;  5H86 A;  5EC4 A;  2JDD A;  3F5B A;  3EO4 A;  3R1K A;  1S7F A;  3VWE A;  4MHD A;  1KUY A;  4IF5 A;  4FD5 A;  1S7L A;  2P6E A;  1MJB A;  3N7Z A;  3QB8 A;  4QC6 A;  3GKR A;  1XF8 A;  2Q44 A;  3TOA A;  3I9S A;  2JLM A;  3W6S A;  2Z10 A;  4F0Y A;  5KTA A;  1Q2Y A;  2PSW A;  4FD7 A;  3EC4 A;  4M85 A;  2G0B A;  3CXQ A;  4OAE A;  4KOY A;  3R9E A;  5HH1 A;  2FE7 A;  4E8O A;  4B5O A;  4NXY A;  3IWG A;  4XPD C;  3GYA A;  1MJ9 A;  5IX3 A;  1WK4 A;  4QUS A;  4AG7 A;  2B5G A;  1KZF A;  4UWI A;  4B5P B;  1TIQ A;  4ONU A;  2REE A;  2KCW A;  4AVC A;  3FIX A;  1YX0 A;  1Z9U A;  4HNY B;  2WPX A;  5KTC A;  1KUX A;  1S3Z A;  3IGR A;  3H4Q A;  4XNH C;  1XIX A;  4HKF A;  4R57 A;  2ATR A;  2PDO A;  4I49 A;  3TOB A;  4JJX A;  3SXN A;  4AB7 A;  4ZBG A;  1K4J A;  4HNX B;  3LD2 A;  2Y0M A;  3JUW A;  2P6F A;  1XEB A;  2P6G A;  2ZW4 A;  1XMT A;  1CM0 A;  2VZZ A;  1RXT A;  4KOT A;  5JPH A;  3FNC A;  2FXF A;  4HNW B;  3TE4 A;  4PV6 A;  5JQ4 A;  3EXN A;  5GCN A;  1Z4R A;  4YRH A;  1LRZ A;  2OZG A;  2VI7 A;  2B5G B;  5E96 A;  2ARH A;  4Y49 B;  1U6M A;  3KKW A;  3F0A A;  1Q2D A;  3TFY A;  1QSO A;  1S7N A;  4U9Y A;  4UWJ A;  4KVM E;  2REF A;  2F5I A;  3P2H A;  5F48 A;  1CJW A;  2VZY A;  3R96 A;  1QST A;  3FRM A;  2ZW5 A;  3DSB A;  4OAD A;  4L89 A;  3D8P A;  4H6U A;  2CNM A;  3FB3 A;  3JVN A;  2B58 A;  1MJA A;  4KOW A;  1VHS A;  1MK4 A;  2B4B A;  2OZU A;  4FD4 A;  4CRZ B;  3ZZI A;  3P2F A;  4NF1 A;  2D4P A;  2JDC A;  3TTH A;  1IYL A;  4CRY B;  4PK3 A;  2R98 A;  1Q2C A;  4E0A A;  3R9G A;  3MGD A;  3LOD A;  3V8I A;  3SHP A;  4X5K A;  2B4D A;  3VWD A;  3TCV A;  1WWZ A;  4QB9 A;  4KOS A;  1YRE A;  2HUZ A;  1M1D A;  2H5M A;  3NE7 A;  5DWM A;  3S6F A;  4K30 A;  4JXQ A;  1BOB A;  3UY5 A;  2RC4 A;  1M4D A;  4QBJ A;  5ISV A;  2FL4 A;  3I3G A;  3PP9 A;  3R9F A;  2PC1 A;  3D2M A;  4LUA A;  4MI4 A;  5I0C A;  3FYN A;  5C88 A;  1S60 A;  1P0H A;  2Z11 A;  3K9U A;  3TO7 A;  3PGP A;  2R7H A;  4XPD B;  3ZJ0 A;  4KLW A;  2OB0 A;  4KZT A;  4KLV A;  2D4O A;  4R3K A;  2FSR A;  2J8N A;  2OZH A;  3CXP A;  2FIW A;  2I79 A;  2B4D B;  2ZXV A;  4CAW A;  2BUE A;  2Q04 A;  2R8V A;  4U9Z A;  2O28 A;  4EVY A;  5HMN A;  5J8F A;  5F46 A;  1YVO A;  2EUI A;  1S5K A;  1SQH A;  5F47 A;  4FD6 A;  3DR8 A;  4BMH A;  2FT0 A;  1I12 A;  4CS0 B;  1KUV A;  2C27 A;  2CNT A;  3TO6 A;  2R1I A;  4KVX A;  4CAV A;  4Y49 C;  1QSM A;  4MY3 A;  1RO5 A;  5CNP A;  1R57 A;  3CXS A;  1XE4 A;  1PUA A;  1OZP A;  4AVB A;  4H89 A;  4RI1 A;  2CNS A;  1J4J A;  2VEZ A;  1FY7 A;  5H84 A;  4UBR A;  4M3S A;  2Q7B A;  3F8K A;  2FCK A;  4JWP A;  2QEC A;  3S6G A;  4OLL A;  5DWN A;  3SXO A;  2VXK A;  1UFH A;  2VBQ A;  1YGH A;  3QAH A;  2ZW6 A;  2CY2 A;  2EVN A;  4RS2 A;  4JLY A;  3D2P A;  2OU2 A;  1B6B A;  3T9Y A;  4H6Z A;  4YFJ A;  4PSW A;  2ZPA A;  1GHE A;  4U5Y A;  1P4N A;  5C82 A;  3W6X A;  3TT2 A;  3S6K A;  1YLE A;  4B5P A;  2VQY A;  3TO9 A;  1M4I A;  2GAN A;  2Z0Z A;  2OH1 A;  1NE9 A;  2BSW A;  2GIV A;  4XPL A;  2QML A;  2PRB A;  4KOU A;  2BL1 A;  4YGO A;  3BJ7 A;  2HV2 A;  4MJ8 A;  2PQ8 A;  3B8G A;  1YK3 A;  2Q0Y A;  4R87 A;  3T90 A;  1I21 A;  3W91 A;  3D3S A;  5EBV A;  4E2A A;  4J3G A;  1YVK A;  4NSQ A;  5KTD A;  2DXQ A;  1YR0 A;  2P0W A;  1V0C A;  2WPW A;  4MBU A;  3C26 A;  4QVT A;  1B87 A;  1ON0 A;  2PR8 A;  4PK2 A;  5IV0 A;  3DR6 A;  1I1D A;  4KOV A;  3EY5 A;  4GS4 A;  4MY0 A;  2J8M A;  4R3L A;  2AJ6 A;  1M44 A;  3PZJ A;  4NEX A;  4JD6 A;  1S7K A;  2QIR A;  3DDD A;  3FXT A;  1Y9K A;  5IB0 A;  4KUA A;  2G3T A;  3G3S A;  2FS5 A;  3DNS A;  4CAX A;  2J8R A;  2IL4 A;  4II9 A;  4AG9 A;  4L8A A;  5F49 A;  3RYO A;  4JXR A;  2HQY A;  3G8W A;  1QSN A;  3R95 A;  1VKC A;  4AVA A;  2G3A A;  2PR1 A;  3GY9 A;  2AE6 A;  4KUB A;  4KVO E;  4XNH B;  1NSL A;  4KOR A;  4NCZ A; 
#chains in the Genus database with same CATH topology
 2Z3K A;  1IB1 E;  3RZA A;  3WR7 A;  4ORF A;  3FEC A;  2PIY A;  1RTQ A;  2HB6 A;  2I3C A;  1NMT A;  1Q7L A;  4UA3 A;  3E0K A;  4MXU A;  5AG7 A;  3S6H A;  1A2Z A;  2J9A A;  3BJ8 A;  4MFQ A;  4PSX A;  1BO4 A;  4PXC A;  4R6T A;  4YWY A;  3TX8 A;  4RUH A;  1IIC A;  4XPK A;  4PQA A;  5EMI A;  4DNC A;  2BEI A;  2K5T A;  3I1U A;  3SJX A;  1ZG8 A;  2C6P A;  1Z4E A;  4ZGY B;  2V8G A;  3EFA A;  2B3U A;  2I00 A;  1IOF A;  4UEZ A;  2X7B A;  4Q36 A;  5FVJ A;  4B11 A;  5J8C A;  1VHO A;  1XBU A;  4X3R A;  4C7I A;  2GE3 A;  2B3V A;  1IID A;  1ZO0 A;  2Q4V A;  1PU9 A;  2ZW7 A;  3H8G A;  2Q4Y A;  4IUS A;  4F6A A;  4MCP A;  2ZEO A;  3OWC A;  2PE3 A;  1N71 A;  3FBU A;  2ODF A;  4KS9 A;  4Z65 A;  1Y7R A;  1M4G A;  1TKJ A;  1QSR A;  2HC9 A;  2ZEM A;  3GIU A;  2JEV A;  2NMT A;  3RO0 A;  1Y9W A;  1TF9 A;  1L0C A;  3BLN A;  4KOX A;  4LX9 A;  4R9M A;  4A2Z A;  4KSF A;  1IYK A;  2FIA A;  4M6G A;  2A4N A;  5H86 A;  5EC4 A;  2XEI A;  2C6G A;  2JDD A;  4CAE A;  3F5B A;  2XEG A;  4K3N A;  1TKH A;  4P4J A;  3EO4 A;  3R1K A;  1S7F A;  4MMO A;  3MRU A;  1XJO A;  2FVG A;  5AG5 A;  2PJ8 A;  3VWE A;  3BXM A;  1KUY A;  4MHD A;  4UF4 A;  1XMB A;  4IF5 A;  4UCP A;  1X10 A;  2QJ8 A;  4FD5 A;  1S7L A;  3CPA A;  2P6E A;  4CPA A;  3L2N A;  2GLF A;  3WC5 A;  3PFO A;  1MJB A;  3KQZ A;  2PVW A;  3N7Z A;  3QB8 A;  4Q38 A;  4QC6 A;  1BLL E;  2YNC A;  3GKR A;  4B14 A;  4F0X A;  5BWA B;  1XF8 A;  2C6C A;  2Q44 A;  3HLP A;  4F9U A;  1VGY A;  3TOA A;  3I9S A;  4MFZ A;  4R8F A;  2Q51 A;  2JLM A;  2Q7S A;  4JZ0 A;  3W6S A;  4H2K A;  4MFP A;  3D7F A;  4MFK A;  5LRK A;  2Z10 A;  4F0Y A;  5KTA A;  1Q2Y A;  2Z3N A;  2PSW A;  4PXB A;  4FD7 A;  5HVH A;  4MCS A;  3EC4 A;  4M85 A;  2G0B A;  3ISZ A;  5JGF A;  3CXQ A;  1ZG9 A;  2YGW A;  3D7G A;  2GFQ A;  2PJ0 A;  4OAE A;  4KOY A;  4UIB A;  3R9E A;  2EWB A;  4A38 A;  3PRT A;  3BI0 A;  3IFE A;  5HH1 A;  2FE7 A;  4P44 A;  3B35 A;  1QMU A;  1LOK A;  3RBU A;  4E8O A;  4B5O A;  4NXY A;  4NGQ A;  3IWG A;  4UEF A;  4IK2 A;  4XPD C;  2DF5 A;  3SJG A;  2AFZ A;  3GYA A;  4JYW A;  1MJ9 A;  4IAV A;  5IX3 A;  1WK4 A;  4QUS A;  5LRJ A;  3V7Z A;  2EK8 A;  1ELL P;  2B5G A;  2PJ1 A;  4AG7 A;  1AUG A;  1KZF A;  4UWI A;  4B5P B;  1TIQ A;  2PJC A;  4ONU A;  2PRQ A;  4P45 A;  1Z8X A;  2REE A;  2KCW A;  4C7H A;  2F8H A;  4DJL A;  1TKF A;  3KHZ A;  3KGQ A;  3GB0 A;  4UEE A;  5D29 A;  4AVC A;  2CF4 A;  3FIX A;  1YX0 A;  2PJ5 A;  5CBM A;  1Z9U A;  1X12 A;  4HNY B;  3MN8 A;  3SI0 A;  4ZY0 A;  2WPX A;  5KTC A;  1KUX A;  1S3Z A;  3IGR A;  3H4Q A;  4MHZ A;  4NGP A;  4IHM A;  5HXD A;  3VAR A;  4XNH C;  4ZX9 A;  3WC6 A;  1XIX A;  4GM5 A;  4HKF A;  2V8V A;  4R57 A;  2ATR A;  3IU2 A;  2YNE A;  4O23 A;  4P4F A;  4CYN A;  3IWW A;  1CX8 A;  2PDO A;  4I49 A;  3TOB A;  3QAY A;  4CGL A;  4JJX A;  3SI1 A;  3SXN A;  4AB7 A;  4ZBG A;  2F7V A;  1XFO A;  5J1Q A;  1K4J A;  2CIJ A;  4HNX B;  1CP6 A;  1Z8L A;  2Z3M A;  1CBX A;  2Y0M A;  3LD2 A;  3GUX A;  3JUW A;  2XEJ A;  2P6F A;  1XEB A;  2P6G A;  2ZW4 A;  3KHX A;  3PB4 X;  3WT4 A;  1XMT A;  1CM0 A;  3H5Z A;  4Q7A A;  2VZZ A;  1RXT A;  3KQX A;  5HVG A;  5A27 A;  4KOT A;  4OC1 A;  2O53 A;  1NSA A;  1DE4 C;  3FNC A;  5JPH A;  2FXF A;  1F2O A;  3NFZ A;  1DTD A;  4HNW B;  3TE4 A;  4PV6 A;  5JQ4 A;  4OID A;  3A9L A;  1ZG7 A;  3EXN A;  3IU1 A;  4GXH A;  1Z4R A;  5GCN A;  2NYQ A;  4YRH A;  1LRZ A;  2PVV A;  2AFO A;  2OZG A;  2VI7 A;  4P4I A;  5DS0 A;  4ZX8 A;  2B5G B;  5THW A;  5E96 A;  2IJZ A;  2AFX A;  2ARH A;  4Y49 B;  3HUV A;  1U6M A;  3KKW A;  2PJ9 A;  3F0A A;  1BPM A;  2POK A;  3IIB A;  1Q2D A;  3TFY A;  1QSO A;  1S7N A;  4ZYQ A;  3D7D A;  2PJB A;  1ARL A;  2ZEE A;  4A31 A;  4U9Y A;  4UWJ A;  4KVM E;  2REF A;  2BO9 A;  2F5I A;  1EE3 P;  2Q4Z A;  3GLJ A;  3P2H A;  5F48 A;  1AYE A;  1CJW A;  4MCR A;  1Z8T A;  2VZY A;  3R96 A;  1QST A;  2ZOF A;  3FRM A;  2ZW5 A;  3DSB A;  4OAD A;  4AXV A;  1ZLH A;  3NA6 A;  4L89 A;  3SJF A;  3RAM A;  3LAC A;  3D8P A;  4YU9 A;  2Q43 A;  2PJ2 A;  2EK9 A;  4H6U A;  5A28 A;  1CPX A;  2CNM A;  3FB3 A;  3JVN A;  4F8Z A;  3S9L A;  3D66 A;  2IQ6 A;  5CPA A;  3DLJ A;  2B58 A;  1MJA A;  4KOW A;  1VHS A;  2EBJ A;  1MK4 A;  1LAN A;  1QQ9 A;  2B4B A;  4OC5 A;  4MFL A;  2OZU A;  2OOT A;  4FD4 A;  1TF8 A;  3B7I A;  4CRZ B;  3ZZI A;  3P2F A;  8CPA A;  5G22 A;  3B3W A;  4NF1 A;  2D4P A;  2JDC A;  3TTH A;  1IYL A;  1CP7 A;  3NE8 A;  4CRY B;  4PK3 A;  6CPA A;  2R98 A;  2ZEF A;  4B6Z A;  4NGS A;  3FVL A;  4EWT A;  1Q2C A;  4CYO A;  4E0A A;  3R9G A;  4NJR A;  4UIA A;  3MGD A;  4MHN A;  4P4D A;  3LOD A;  4KSI A;  3V8I A;  3SHP A;  1TXR A;  3ISX A;  4X5K A;  3KZW A;  2BCO A;  2B4D A;  1YW6 A;  2AFS A;  3VWD A;  3D4U A;  4MFJ A;  3TCV A;  1R3N A;  4HPS A;  4WWV A;  1WWZ A;  4QB9 A;  4CAF A;  4DYO A;  5JH9 A;  4KOS A;  3FEE A;  1YRE A;  3V38 A;  2HUZ A;  1M1D A;  4UCN A;  2H5M A;  3IEH A;  1Z8W A;  2QYV A;  2WYR A;  5G20 A;  4CGP A;  3N5F A;  3NE7 A;  4A32 A;  4OP4 A;  4UCM A;  1LFW A;  1IGB A;  4PXE A;  2OR4 A;  1CPS A;  3KI9 A;  5DWM A;  3S6F A;  4K30 A;  4JXQ A;  5I4M A;  1BOB A;  3B3C A;  4OC3 A;  2RC4 A;  3UY5 A;  2ZEH A;  1M4D A;  4MHY A;  1ZLI A;  4ONW A;  4QBJ A;  2ZEP A;  5D8N A;  1Y0Y A;  4OC0 A;  5ISV A;  2ABZ A;  2FL4 A;  2WUU A;  3I3G A;  5LYF A;  3K9T A;  3PP9 A;  3R9F A;  2PC1 A;  1YQE A;  3K2K A;  3BI1 A;  4F9V A;  3D2M A;  3PB9 X;  4A37 A;  2ZOG A;  4LUA A;  4MI4 A;  5I0C A;  3B3T A;  3FYN A;  5C88 A;  4C2Z A;  1JWQ A;  2ZEL A;  3QNV A;  1S60 A;  2JBK A;  1P0H A;  2Z11 A;  3K9U A;  4G1P A;  3TO7 A;  5IB9 A;  4C2X A;  4P4B A;  3PGP A;  2RB7 A;  2R7H A;  4MCQ A;  4XPD B;  3ZJ0 A;  5G21 A;  4KLW A;  2OB0 A;  4KZT A;  4M6I A;  4KLV A;  2V8D A;  4X2T A;  2D4O A;  3B2Y A;  4NGT A;  4R3K A;  2FSR A;  1Y7E A;  2J8N A;  5K8N A;  1Z2L A;  2OZH A;  3CXP A;  2FIW A;  4A95 A;  2I79 A;  2B4D B;  2ZXV A;  4CAW A;  5K8O A;  2BUE A;  2Q04 A;  2R8V A;  3IC1 A;  2O28 A;  4U9Z A;  3RNZ A;  4A30 A;  4EVY A;  5HMN A;  5F46 A;  2VL1 A;  5J8F A;  1YVO A;  2EUI A;  5AG6 A;  2ZEN A;  1S5K A;  1SQH A;  4TWE A;  5F47 A;  4FD6 A;  4A94 A;  3DR8 A;  4BMH A;  4PPZ A;  2FT0 A;  1I12 A;  4NGN A;  2AFM A;  4FWU A;  4A39 A;  4CS0 B;  1KUV A;  2C27 A;  2CNT A;  4NGM A;  1FT7 A;  5HVF A;  1ARM A;  2PJ4 A;  3TO6 A;  2R1I A;  4OC2 A;  4KVX A;  4CAV A;  4CGM A;  3CT9 A;  4Y49 C;  2PIZ A;  4BBH A;  4ZY1 A;  3PFE A;  1QSM A;  2EO8 A;  4MY3 A;  4NFR A;  1H8L A;  1RO5 A;  3IWE A;  5LYD A;  2V77 A;  5CNP A;  5G1Z A;  1R57 A;  4B10 A;  3CXS A;  1LAP A;  4A33 A;  3LMS A;  1XE4 A;  1PUA A;  1OZP A;  4AVB A;  4H89 A;  4RI1 A;  3LWU A;  1AMP A;  2CNS A;  1J4J A;  1PCA A;  2VEZ A;  1FY7 A;  5ELY A;  2WZN A;  3BHX A;  4BD9 A;  5H84 A;  1LCP A;  2GLJ A;  3TC8 A;  1YLO A;  1OBR A;  3CPX A;  4UBR A;  3B3S A;  2DEA A;  3F8K A;  2FCK A;  4M3S A;  2Q7B A;  3IJ3 A;  4JWP A;  2QEC A;  3FJU A;  3S6G A;  3FF3 A;  3NH4 A;  4X8I A;  1VIX A;  4OLL A;  5DWN A;  5LYL A;  1F2P A;  2PJ3 A;  4EFD A;  3SXO A;  2VXK A;  1UFH A;  4R7M A;  2CXA A;  2VBQ A;  4MHP A;  1F57 A;  4DUK A;  1YGH A;  3QAH A;  4C2Y A;  3H8F A;  3PEI A;  2ZW6 A;  3FED A;  2CY2 A;  5AGE A;  2EVN A;  4RS2 A;  4JLY A;  3D2P A;  2OU2 A;  4PXD A;  3JTK A;  3PB8 X;  5K8M A;  1B6B A;  3T9Y A;  4H6Z A;  1UWY A;  4B12 A;  4OME A;  4YFJ A;  4PSW A;  2ZPA A;  3S9M A;  1GHE A;  4OIW A;  1Y0R A;  3KL9 A;  4U5Y A;  2GRE A;  4NJQ A;  1P4N A;  1YW4 A;  5C82 A;  2YND A;  3KR5 A;  3S9N A;  4LQ6 A;  1BAV A;  3W6X A;  4FBE A;  3TT2 A;  3S6K A;  1YLE A;  4B5P A;  2VQY A;  3TO9 A;  1M4I A;  2GAN A;  4EME A;  2Z3P A;  2Z0Z A;  3PBE A;  2OH1 A;  1R43 A;  3D67 A;  1NE9 A;  2DPS A;  2ANP A;  2O4H A;  2PCU A;  2BSW A;  2RFH A;  4RN7 A;  1YME A;  2GIV A;  2G9D A;  4XPL A;  1LAM A;  2QML A;  2PRB A;  2Z3O A;  4KOU A;  2BL1 A;  4P4E A;  3IO1 A;  4YGO A;  3BJ7 A;  3FMC A;  2PJA A;  3KR4 A;  2HV2 A;  3JRU A;  3NH8 A;  1FNO A;  1GYT A;  4MJ8 A;  1HDQ A;  2PQ8 A;  3CDX A;  4ZY2 A;  1JQG A;  3B3V A;  3B8G A;  4CYQ A;  5LRG A;  2ZED A;  1YK3 A;  4B13 A;  4W9Y A;  3WAB A;  2V8H A;  4R76 A;  2Q0Y A;  4R87 A;  3DGV A;  3T90 A;  1CG2 A;  2IMO A;  1I21 A;  3W91 A;  3D3S A;  5EBV A;  2JEW A;  4C68 A;  4E2A A;  3SI2 A;  4J3G A;  5AG4 A;  4NGR A;  1YVK A;  7CPA A;  4NSQ A;  2AFW A;  4CYP A;  2C1C A;  5KTD A;  2JBJ A;  4FUU A;  4CGN A;  2DXQ A;  4BIN A;  2NSM A;  1IU8 A;  4MRI A;  3PBB A;  3CZX A;  4WJB A;  1YR0 A;  2P0W A;  1V0C A;  2WPW A;  3VAT A;  4MBU A;  4UFX A;  1YSJ A;  2DPT A;  1M4L A;  3C26 A;  3FX6 A;  5JM6 A;  1XOV A;  1IY7 A;  1B87 A;  2BOA A;  4QVT A;  2GU2 A;  1ON0 A;  2PR8 A;  2YNC C;  4KSA A;  4PK2 A;  5F09 A;  5IV0 A;  2PJ7 A;  3DR6 A;  1I1D A;  4OKO A;  4P10 A;  4KOV A;  3EY5 A;  3PB6 X;  4GS4 A;  4UFV A;  1IOI A;  4MY0 A;  2J8M A;  4R3L A;  2AJ6 A;  4ZI6 A;  1HDU A;  1M44 A;  3PZJ A;  4NEX A;  3WC7 A;  2WSA A;  5LYI A;  4JD6 A;  1S7K A;  1VHE A;  2QIR A;  3D7H A;  4UFW A;  2PJ6 A;  3DDD A;  4TNU A;  4LQG A;  1BPN A;  3FXT A;  3SJE A;  3VH9 A;  1Y9K A;  1XRY A;  1HEE A;  5IB0 A;  4KUA A;  3H8E A;  2G3T A;  3G3S A;  1KWM A;  2FS5 A;  2ZEG A;  3DNS A;  4CAX A;  2J8R A;  2CTC A;  3T8W A;  3KAS A;  2IL4 A;  4P6Y A;  4II9 A;  4CGO A;  4AG9 A;  4L8A A;  2CTB A;  5F49 A;  3RYO A;  4JXR A;  2HQY A;  3G8W A;  1QSN A;  2Z3L A;  1VKC A;  3R95 A;  1Z5R A;  4AVA A;  2QVP A;  3D68 A;  5K8P A;  2G3A A;  2PR1 A;  3GY9 A;  4OC4 A;  3FH4 A;  2AE6 A;  3NH5 A;  4KUB A;  2XEF A;  1ELM P;  4KVO E;  1PYT B;  4M6H A;  4XNH B;  2AFU A;  3PB7 X;  1NSL A;  4KOR A;  4FAI A;  4NCZ A; 
#chains in the Genus database with same CATH homology
 2Z3K A;  1IB1 E;  3WR7 A;  4ORF A;  4UA3 A;  1NMT A;  3E0K A;  5AG7 A;  3S6H A;  3BJ8 A;  4MFQ A;  4PSX A;  1BO4 A;  1IIC A;  4XPK A;  4DNC A;  2BEI A;  2K5T A;  1Z4E A;  4ZGY B;  3EFA A;  2B3U A;  2I00 A;  5FVJ A;  2X7B A;  4Q36 A;  4B11 A;  5J8C A;  4C7I A;  2B3V A;  2GE3 A;  1IID A;  1ZO0 A;  2Q4V A;  1PU9 A;  2ZW7 A;  4IUS A;  2Q4Y A;  4F6A A;  3OWC A;  1N71 A;  3FBU A;  4KS9 A;  1Y7R A;  1M4G A;  1QSR A;  2JEV A;  2NMT A;  1Y9W A;  1L0C A;  3BLN A;  4KOX A;  4LX9 A;  4R9M A;  4A2Z A;  4KSF A;  1IYK A;  2FIA A;  2A4N A;  5H86 A;  5EC4 A;  2JDD A;  4CAE A;  3F5B A;  3EO4 A;  3R1K A;  1S7F A;  5AG5 A;  3VWE A;  4MHD A;  1KUY A;  4IF5 A;  4UCP A;  4FD5 A;  1S7L A;  2P6E A;  1MJB A;  3N7Z A;  3QB8 A;  4Q38 A;  4QC6 A;  4F0X A;  2YNC A;  3GKR A;  4B14 A;  5BWA B;  1XF8 A;  2Q44 A;  3TOA A;  3I9S A;  4MFZ A;  2JLM A;  3W6S A;  4MFP A;  4MFK A;  2Z10 A;  4F0Y A;  5KTA A;  1Q2Y A;  2Z3N A;  2PSW A;  4FD7 A;  3EC4 A;  4M85 A;  2G0B A;  3CXQ A;  2YGW A;  4OAE A;  4KOY A;  3R9E A;  5HH1 A;  2FE7 A;  4E8O A;  4B5O A;  4NXY A;  3IWG A;  4XPD C;  3GYA A;  1MJ9 A;  5IX3 A;  1WK4 A;  4QUS A;  4AG7 A;  2B5G A;  1KZF A;  4UWI A;  4B5P B;  1TIQ A;  4ONU A;  2REE A;  2KCW A;  4C7H A;  4AVC A;  3FIX A;  1YX0 A;  1Z9U A;  4HNY B;  2WPX A;  5KTC A;  1KUX A;  1S3Z A;  3IGR A;  3H4Q A;  4XNH C;  1XIX A;  4HKF A;  4R57 A;  2ATR A;  3IU2 A;  2YNE A;  4CYN A;  2PDO A;  4I49 A;  3TOB A;  4CGL A;  4JJX A;  3SXN A;  4AB7 A;  4ZBG A;  1K4J A;  4HNX B;  2Z3M A;  3LD2 A;  2Y0M A;  3JUW A;  2P6F A;  1XEB A;  2P6G A;  2ZW4 A;  1XMT A;  1CM0 A;  3H5Z A;  2VZZ A;  1RXT A;  5A27 A;  4KOT A;  5JPH A;  3FNC A;  2FXF A;  4HNW B;  3TE4 A;  4PV6 A;  5JQ4 A;  3A9L A;  3EXN A;  3IU1 A;  5GCN A;  1Z4R A;  4YRH A;  1LRZ A;  2OZG A;  2VI7 A;  2B5G B;  5E96 A;  2ARH A;  4Y49 B;  1U6M A;  3KKW A;  3F0A A;  1Q2D A;  3TFY A;  1QSO A;  1S7N A;  4A31 A;  4U9Y A;  4UWJ A;  4KVM E;  2REF A;  2F5I A;  3P2H A;  5F48 A;  1CJW A;  2VZY A;  3R96 A;  1QST A;  3FRM A;  2ZW5 A;  3DSB A;  4OAD A;  4L89 A;  3D8P A;  4H6U A;  5A28 A;  2CNM A;  3FB3 A;  3JVN A;  2B58 A;  1MJA A;  4KOW A;  1VHS A;  1MK4 A;  2B4B A;  4MFL A;  2OZU A;  4FD4 A;  4CRZ B;  3ZZI A;  3P2F A;  5G22 A;  4NF1 A;  2D4P A;  2JDC A;  3TTH A;  1IYL A;  4CRY B;  4PK3 A;  2R98 A;  1Q2C A;  4CYO A;  4E0A A;  3R9G A;  3MGD A;  3LOD A;  3V8I A;  3SHP A;  4X5K A;  2B4D A;  3VWD A;  4MFJ A;  3TCV A;  1WWZ A;  4QB9 A;  4CAF A;  4KOS A;  1YRE A;  2HUZ A;  1M1D A;  4UCN A;  2H5M A;  5G20 A;  4CGP A;  3NE7 A;  4A32 A;  4UCM A;  5DWM A;  3S6F A;  4K30 A;  4JXQ A;  1BOB A;  3UY5 A;  2RC4 A;  1M4D A;  4QBJ A;  5ISV A;  2FL4 A;  2WUU A;  3I3G A;  3PP9 A;  3R9F A;  2PC1 A;  3D2M A;  4LUA A;  4MI4 A;  5I0C A;  3FYN A;  5C88 A;  4C2Z A;  1S60 A;  1P0H A;  2Z11 A;  3K9U A;  3TO7 A;  4C2X A;  3PGP A;  2R7H A;  4XPD B;  3ZJ0 A;  5G21 A;  4KLW A;  2OB0 A;  4KZT A;  4KLV A;  2D4O A;  4R3K A;  2FSR A;  2J8N A;  2OZH A;  3CXP A;  2FIW A;  4A95 A;  2I79 A;  2B4D B;  2ZXV A;  4CAW A;  2BUE A;  2Q04 A;  2R8V A;  4U9Z A;  2O28 A;  4EVY A;  4A30 A;  5HMN A;  5J8F A;  5F46 A;  1YVO A;  2EUI A;  5AG6 A;  1S5K A;  1SQH A;  5F47 A;  4FD6 A;  3DR8 A;  4BMH A;  2FT0 A;  1I12 A;  4CS0 B;  1KUV A;  2C27 A;  2CNT A;  3TO6 A;  2R1I A;  4KVX A;  4CAV A;  4CGM A;  4Y49 C;  4BBH A;  1QSM A;  4MY3 A;  1RO5 A;  3IWE A;  5CNP A;  5G1Z A;  1R57 A;  4B10 A;  3CXS A;  4A33 A;  1XE4 A;  1PUA A;  1OZP A;  4AVB A;  4H89 A;  4RI1 A;  2CNS A;  1J4J A;  2VEZ A;  1FY7 A;  5H84 A;  4UBR A;  4M3S A;  2Q7B A;  3F8K A;  2FCK A;  4JWP A;  2QEC A;  3S6G A;  4OLL A;  5DWN A;  3SXO A;  2VXK A;  1UFH A;  2CXA A;  2VBQ A;  1YGH A;  3QAH A;  4C2Y A;  2ZW6 A;  2CY2 A;  5AGE A;  2EVN A;  4RS2 A;  4JLY A;  3D2P A;  2OU2 A;  3JTK A;  1B6B A;  3T9Y A;  4H6Z A;  4B12 A;  4YFJ A;  4PSW A;  2ZPA A;  1GHE A;  4U5Y A;  1P4N A;  5C82 A;  2YND A;  3W6X A;  3TT2 A;  3S6K A;  1YLE A;  4B5P A;  2VQY A;  3TO9 A;  1M4I A;  2GAN A;  2Z3P A;  2Z0Z A;  2OH1 A;  1NE9 A;  2DPS A;  2BSW A;  2GIV A;  4XPL A;  2QML A;  2Z3O A;  2PRB A;  4KOU A;  2BL1 A;  4YGO A;  3BJ7 A;  2HV2 A;  4MJ8 A;  2PQ8 A;  3B8G A;  4CYQ A;  1YK3 A;  4B13 A;  2Q0Y A;  4R87 A;  3T90 A;  1I21 A;  3W91 A;  3D3S A;  5EBV A;  4C68 A;  4E2A A;  4J3G A;  5AG4 A;  1YVK A;  4NSQ A;  4CYP A;  5KTD A;  4CGN A;  2DXQ A;  1YR0 A;  2P0W A;  1V0C A;  2WPW A;  4MBU A;  4UFX A;  3C26 A;  2DPT A;  4QVT A;  1B87 A;  1ON0 A;  2PR8 A;  2YNC C;  4KSA A;  4PK2 A;  5IV0 A;  3DR6 A;  1I1D A;  4KOV A;  3EY5 A;  4GS4 A;  4UFV A;  4MY0 A;  2J8M A;  4R3L A;  2AJ6 A;  1M44 A;  3PZJ A;  4NEX A;  2WSA A;  4JD6 A;  1S7K A;  2QIR A;  4UFW A;  3DDD A;  3FXT A;  1Y9K A;  5IB0 A;  4KUA A;  2G3T A;  3G3S A;  2FS5 A;  3DNS A;  4CAX A;  2J8R A;  2IL4 A;  4II9 A;  4CGO A;  4AG9 A;  4L8A A;  5F49 A;  3RYO A;  4JXR A;  2HQY A;  3G8W A;  1QSN A;  2Z3L A;  1VKC A;  3R95 A;  4AVA A;  2G3A A;  2PR1 A;  3GY9 A;  2AE6 A;  4KUB A;  4KVO E;  4XNH B;  1NSL A;  4KOR A;  4NCZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...