3OWCA

Crystal structure of gnat superfamily protein pa2578 from pseudomonas aeruginosa
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
172
structure length
172
Chain Sequence
b'ELQLVPFQLGHFPILQRWFATEKELVQWAGPALRHPLSLEQMHEDLAESRRRPPLRLLWSACRDDQVIGHCQLLFDRRNGVVRLARIVLAPSARGQGLGLPMLEALLAEAFADADIERVELNVYDWNAAARHLYRRAGFREEGLRRSATRVGRERWNVVLMGLLRQEWAAGG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable acetyltransferase
publication title Crystal structure of GNAT superfamily protein PA2578 from Pseudomonas aeruginosa
rcsb
source organism Pseudomonas aeruginosa
molecule tags Transferase
total genus 48
structure length 172
sequence length 172
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 3owcA00
4KZTA 3G3SA 4GS4A 3JVNA 4NXYA 3VWEA 3R9GA 1LRZA 5H84A 1GHEA 1Y7RA 3DR8A 3UY5A 5I0CA 2ZW4A 4I49A 3BJ7A 1KUVA 3QB8A 4JWPA 3S6KA 5F47A 4JD6A 1UFHA 2HV2A 2ZPAA 1YREA 5C88A 3QAHA 2OZUA 2G3TA 1S7LA 2PRBA 1YX0A 4X5KA 3W91A 3I9SA 2G0BA 4KLVA 3DDDA 1XF8A 3FBUA 3GKRA 4JXRA 3VWDA 1VHSA 2JLMA 4QB9A 2ARHA 1XE4A 3CXQA 2VBQA 3TTHA 4KOSA 5HH1A 5DWNA 3W6XA 1BO4A 3NE7A 4MY0A 3ZZIA 3PP9A 3E0KA 1QSRA 2GANA 1QSNA 1S7KA 5HMNA 4KUBA 2GE3A 3P2HA 2D4PA 5E96A 5JPHA 1ON0A 2P6GA 2G3AA 1Z4RA 5IX3A 1Y9KA 4RI1A 1S7FA 4UBRA 2Y0MA 3C26A 5F48A 5F49A 1P4NA 4YFJA 3DSBA 1B6BA 3D2MA 2QMLA 2Q4VA 4NF1A 2K5TA 2VXKA 2PSWA 2B4DA 3R9FA 4ZBGA 1R57A 4B5PA 2ATRA 4LUAA 1RO5A 3K9UA 2X7BA 2B5GB 3MGDA 2BUEA 1I1DA 1J4JA 2GIVA 2PDOA 4F6AA 4II9A 4MJ8A 5GCNA 3P2FA 1OZPA 3R95A 1Y9WA 2IL4A 1MK4A 4OAEA 1MJAA 2Q44A 3SHPA 2JDDA 2AJ6A 3TCVA 3F8KA 2B58A 4PSWA 4YGOA 4XPKA 2CNMA 1IICA 5ISVA 2JEVA 4B5PB 2EUIA 1IB1E 3IWGA 1KZFA 1CM0A 3PZJA 4AVAA 3OWCA 2Q4YA 4AVBA 3GY9A 4AG9A 2Q04A 3LD2A 4KOVA 4IUSA 4EVYA 3TFYA 4XNHC 3EXNA 5KTCA 1Z4EA 2FE7A 3TT2A 2VQYA 4CAWA 1YR0A 1IIDA 4QBJA 5EC4A 2OZGA 2HUZA 2ZW5A 3F5BA 2P0WA 4U9ZA 2REFA 2DXQA 1M4IA 4KOUA 4LX9A 5J8CA 1YVKA 3IGRA 4NSQA 4CAVA 3W6SA 3F0AA 2Q7BA 2RC4A 4KVXA 3DR6A 1V0CA 4UWJA 4QVTA 3T9YA 4JXQA 4KOWA 3FXTA 1U6MA 3CXSA 3EO4A 4KOTA 3BJ8A 1Q2YA 5CNPA 1QSOA 2WPXA 1TIQA 3T90A 4IF5A 4XPDC 2B3VA 3GYAA 3N7ZA 3D2PA 4HNYB 4H89A 1I12A 4R3LA 1MJ9A 1K4JA 2FSRA 1CJWA 4L8AA 2FT0A 4HNWB 2FIWA 2Z10A 4U9YA 4AVCA 1KUXA 2OU2A 2VZZA 2BL1A 2A4NA 2I79A 2VI7A 4CRYB 3FRMA 1SQHA 2PQ8A 2BSWA 3FB3A 4KLWA 3LODA 3S6GA 3EFAA 1NE9A 1Q2CA 2EVNA 2F5IA 2KCWA 4Y49C 2JDCA 4FD5A 4L89A 4HKFA 1IYKA 3TO7A 1XIXA 3S6FA 3B8GA 2J8RA 3SXNA 2WPWA 2C27A 1FY7A 3JUWA 1M44A 2Z11A 4AG7A 1PUAA 4YRHA 2I00A 1S5KA 1RXTA 2NMTA 1YGHA 3D8PA 2R1IA 2B4DB 2PR8A 2R98A 2REEA 4DNCA 1XMTA 3S6HA 1MJBA 1M4GA 4OADA 1L0CA 3PGPA 4OLLA 4PK2A 4PK3A 1M1DA 2Q0YA 4M85A 4MHDA 4KUAA 5J8FA 1PU9A 4F0YA 3RYOA 2HQYA 1S3ZA 2AE6A 2OZHA 2D4OA 2J8NA 4UWIA 4KVME 4QC6A 2FIAA 5KTDA 1YK3A 3V8IA 4KOXA 2B3UA 3EC4A 3G8WA 4MY3A 3I3GA 3D3SA 2P6FA 3SXOA 4R57A 2CNTA 2FXFA 2H5MA 5C82A 1WK4A 4KVOE 4CS0B 2FS5A 2ZXVA 1BOBA 4FD6A 4XNHB 3DNSA 4FD4A 4UA3A 1YVOA 2FCKA 3WR7A 4B5OA 1QSMA 4PSXA 2B5GA 5H86A 4NEXA 1I21A 3TOBA 3CXPA 3EY5A 1Z9UA 2J8MA 2R7HA 2QIRA 3BLNA 4XPLA 3FYNA 2VEZA 3KKWA 4PV6A 1B87A 4R87A 3H4QA 4R3KA 2PC1A 1WWZA 3TOAA 4QUSA 2R8VA 4RS2A 1YLEA 2OH1A 3FNCA 4CRZB 4J3GA 1NSLA 4E0AA 4NCZA 4ORFA 2B4BA 4M3SA 4R9MA 4AB7A 4BMHA 5KTAA 4XPDB 2FL4A 4KORA 2ZW7A 3R9EA 2P6EA 3TE4A 1QSTA 5EBVA 1KUYA 1NMTA 4KOYA 4HNXB 2VZYA 1Q2DA 1XEBA 1N71A 4CAXA 4H6ZA 3ZJ0A 2Z0ZA 4MBUA 5DWMA 4E2AA 2O28A 1M4DA 1P0HA 4U5YA 2CY2A 4K30A 1VKCA 5FVJA 2QECA 2OB0A 3FIXA 5IB0A 5IV0A 3R96A 1S7NA 5JQ4A 3TO6A 5F46A 2ZW6A 4ONUA 4JLYA 2BEIA 1IYLA 3R1KA 4E8OA 3TO9A 1S60A 2PR1A 4MI4A 4FD7A 2CNSA 4H6UA 4Y49B 4JJXA
chains in the Genus database with same CATH superfamily
1XJOA 4KZTA 3G3SA 4GS4A 4HPSA 2EK9A 4CYNA 3JVNA 2ZEPA 4NXYA 4K3NA 2PJ6A 4M6HA 3VWEA 2I3CA 3R9GA 1LRZA 3SI2A 3NA6A 2PJ5A 2CXAA 5D29A 4LQ6A 5H84A 4A37A 1GHEA 1Y7RA 3DR8A 3UY5A 5I0CA 4Z65A 2ZW4A 4I49A 2Q7SA 3BJ7A 1KUVA 3QB8A 4RN7A 4JWPA 4MCSA 4BD9A 4O23A 2POKA 4ONWA 1Z5RA 3S6KA 2HB6A 2V8GA 4OC3A 5F47A 4JD6A 1UFHA 7CPAA 3NE8A 2HV2A 2AFOA 2ZPAA 4B12A 1X12A 2QJ8A 1YREA 3KHZA 5C88A 4JZ0A 3H8FA 2V8HA 3QAHA 4JYWA 2OZUA 2IMOA 2G3TA 1S7LA 3SJXA 3WABA 2AFMA 2PRBA 4A39A 1ZG8A 1Z2LA 5D8NA 1YX0A 4X5KA 3W91A 3PBBA 3WT4A 3I9SA 3B3VA 2JBJA 2G0BA 1IOIA 4KLVA 4P10A 2AFXA 2ZEGA 3DDDA 3TX8A 1XF8A 2Q43A 3FBUA 4WWVA 2EK8A 3GKRA 1EE3P 1XRYA 4B13A 4JXRA 4PXCA 4PXBA 3SI0A 3PB7X 3VWDA 1VHSA 2JLMA 3RZAA 4F9VA 4QB9A 3A9LA 4X3RA 2ARHA 1XE4A 4P4EA 4CPAA 3CXQA 2YNEA 5AG5A 5G22A 4FAIA 2VBQA 3TTHA 4MMOA 4KOSA 3FF3A 8CPAA 2NSMA 2ZELA 5HH1A 5DWNA 3W6XA 2YNDA 4MCQA 1BO4A 3KI9A 3NE7A 4MY0A 3KZWA 3TC8A 1JWQA 4MFLA 3PP9A 3ZZIA 3E0KA 1QSRA 2GANA 1QSNA 2PCUA 4UIBA 1S7KA 4OC4A 5HMNA 4KUBA 2GE3A 3P2HA 5JM6A 2D4PA 5E96A 1Z8WA 5JPHA 1VIXA 2XEFA 1ON0A 2Z3LA 2P6GA 3S9MA 2ZENA 2XEIA 2G3AA 2Z3PA 3T8WA 1Z4RA 5IX3A 4NGMA 4X8IA 2PJ0A 5IB9A 1Y9KA 1TXRA 2CF4A 3PFEA 4UFVA 1Y0RA 3IIBA 4RI1A 1S7FA 2ZEDA 3CZXA 2PJ7A 5A27A 4ZY0A 3JTKA 4IHMA 4UBRA 2Y0MA 5LRKA 3C26A 5F48A 5F49A 4A94A 3PB6X 1P4NA 3FJUA 2EBJA 3KL9A 5HVFA 4YFJA 3DSBA 2DF5A 4OIDA 1B6BA 5G20A 2GU2A 3D2MA 2QMLA 2ZOGA 4YU9A 4NFRA 3RBUA 2Q4VA 5AG4A 4NF1A 5CBMA 2K5TA 2VXKA 2PSWA 2B4DA 4Q36A 3R9FA 4P4BA 2F7VA 1R57A 2VL1A 3KR4A 4ZBGA 4B5PA 1LOKA 5ELYA 2ATRA 4LUAA 3GUXA 1RO5A 3K9UA 3N5FA 4PXEA 1TKJA 4NGPA 5AG7A 2X7BA 2B5GB 5BWAB 5K8OA 1ELLP 3MGDA 3ISZA 3B3TA 3MRUA 2BUEA 3K2KA 4GXHA 1I1DA 2Z3MA 3DLJA 1DTDA 4KSFA 1J4JA 2GIVA 2PDOA 4F6AA 4II9A 3MN8A 4A95A 4OKOA 1UWYA 1ARLA 2HC9A 4MJ8A 4NGSA 4A2ZA 4W9YA 2CTCA 2PJ9A 5GCNA 3CPAA 4M6IA 3B3SA 3ISXA 3P2FA 4P44A 1LCPA 1BPMA 1OZPA 1Y9WA 3R95A 1LANA 2IL4A 4FUUA 2PVVA 4UFXA 1CPXA 2Q51A 1MK4A 4OAEA 2PE3A 1MJAA 2IJZA 2Q44A 4Q7AA 3SHPA 2C6PA 2JDDA 2PIYA 2AJ6A 2DPTA 3QNVA 5K8MA 2ODFA 3F8KA 5LYIA 2B58A 4P4JA 3GIUA 2C1CA 3TCVA 3IFEA 4ZYQA 2QYVA 4ZY2A 4PSWA 4YGOA 4F8ZA 3WC7A 4XPKA 2CNMA 1IICA 5ISVA 3KGQA 1ZO0A 2JEVA 4MFKA 4B5PB 2WUUA 3D67A 2EUIA 2Z3KA 2J9AA 1IB1E 3IWGA 3NH8A 4Q38A 1KZFA 3S9NA 1CM0A 3PZJA 4C2YA 2PRQA 1XMBA 4AVAA 1OBRA 3OWCA 4F9UA 2Q4YA 4OP4A 4ZX8A 4C7IA 4AVBA 2OR4A 3GY9A 5G21A 4C68A 4WJBA 4AG9A 2Q04A 3LD2A 4KOVA 1ARMA 3GLJA 4IUSA 4EVYA 3TFYA 4XNHC 4A31A 3B7IA 3EXNA 5KTCA 1TKHA 4UF4A 1Z4EA 3B3CA 3D66A 2FE7A 3TT2A 2VQYA 4P4FA 4CAWA 1Z8LA 2G9DA 1YR0A 1IIDA 4QBJA 5EC4A 2OZGA 2HUZA 2ZW5A 3F5BA 3IO1A 4MCRA 4F0XA 2P0WA 2ZEHA 4U9ZA 4M6GA 4NGNA 1AUGA 2REFA 2DXQA 2YGWA 1M4IA 4KOUA 4MRIA 4LX9A 1R43A 1HDQA 5J8CA 4CAFA 3D7DA 1YVKA 3IGRA 4H2KA 2GFQA 3LWUA 4NSQA 2O4HA 1HDUA 4UFWA 4CAVA 3W6SA 3B35A 3CPXA 3F0AA 2Q7BA 2XEJA 2RC4A 3FECA 3DR6A 4KVXA 1V0CA 1F57A 4UWJA 4NGTA 4QVTA 3LACA 3T9YA 4JXQA 2PJCA 4KOWA 4GM5A 3FXTA 1U6MA 4P6YA 1X10A 3CXSA 3EO4A 4KOTA 2YNCA 3IU1A 4DJLA 1VHEA 3CDXA 3BJ8A 1Q2YA 4R8FA 5CNPA 2OOTA 3BXMA 1QSOA 2BO9A 3GB0A 1HEEA 4OC2A 2O53A 1YQEA 2WPXA 1TIQA 3T90A 4IF5A 4XPDC 2CTBA 2B3VA 4MFZA 4A38A 3IC1A 4CAEA 4OIWA 4ZX9A 3GYAA 3N7ZA 3D2PA 4HNYB 1CP7A 4B11A 5K8NA 1LAMA 3NFZA 5EMIA 4H89A 1I12A 4KS9A 4R3LA 4NJRA 1MJ9A 3WC5A 1K4JA 2FSRA 4CGLA 2YNCC 1CJWA 2BCOA 4MXUA 2PJ8A 4L8AA 4P4DA 3D7GA 3HUVA 1XBUA 3VATA 3VARA 2FT0A 4OC0A 1LFWA 3DGVA 1ELMP 1NSAA 4HNWB 4MCPA 2FIWA 4PXDA 2ZOFA 3B3WA 4OC5A 2Z10A 4U9YA 4AVCA 1CG2A 3BI0A 1KUXA 2OU2A 4TWEA 3VH9A 2Q4ZA 3S9LA 2VZZA 2BL1A 2A4NA 2I79A 2VI7A 1FT7A 4CRYB 3FRMA 2C6GA 1M4LA 1SQHA 2PQ8A 5AGEA 2BSWA 3FB3A 3H5ZA 4KLWA 1Z8XA 1CBXA 3LODA 1XFOA 5DS0A 5LRJA 3EFAA 3S6GA 1NE9A 4MFPA 1Q2CA 1QQ9A 3SJFA 2EVNA 2F5IA 2KCWA 4RUHA 4MHNA 4R76A 4Y49C 4C7HA 2JDCA 4FD5A 4L89A 2GREA 2Z3OA 2JEWA 4HKFA 1R3NA 4P4IA 1IYKA 3PB4X 4B6ZA 3TO7A 1XIXA 1CP6A 3S6FA 3IWEA 2AFSA 3B8GA 2J8RA 1YW4A 3SXNA 4DYOA 2DPSA 2WPWA 2WYRA 2ZEFA 2C27A 1Z8TA 2WZNA 1RTQA 4NJQA 4X2TA 1FY7A 1KWMA 3BHXA 3FEEA 3JUWA 1M44A 4C2ZA 1IOFA 1IGBA 2Z11A 2AFUA 1QMUA 3FEDA 4AG7A 1PUAA 2XEGA 4UIAA 1ZG9A 3IEHA 4ZY1A 4C2XA 4YRHA 4NGRA 2BOAA 2I00A 4A32A 1S5KA 1RXTA 2NMTA 1YGHA 1XOVA 2RFHA 4TNUA 1TF9A 1YSJA 2V77A 3D8PA 4P45A 4R6TA 5CPAA 5LYLA 3KQXA 3RO0A 2R1IA 2B4DB 3CT9A 4CGMA 2PR8A 2R98A 2REEA 4DNCA 1XMTA 5AG6A 3S6HA 5JGFA 2ANPA 1MJBA 1M4GA 2F8HA 4OADA 1BAVA 3D7HA 1L0CA 3NH5A 3PRTA 5A28A 4MFJA 3FMCA 3PGPA 5J1QA 3HLPA 3FVLA 4OLLA 4DUKA 5LYFA 5HVHA 4KSIA 4PK2A 4PK3A 1M1DA 4CYQA 2Q0YA 3FH4A 4M85A 4KUAA 4MHDA 2NYQA 1PU9A 4MHYA 5J8FA 3NH4A 3RYOA 1GYTA 4F0YA 2HQYA 1VGYA 1S3ZA 2AE6A 4R7MA 3H8EA 2EO8A 3B2YA 4CGPA 4EFDA 3QAYA 1BLLE 4MHPA 2OZHA 3H8GA 2D4OA 3PB8X 5G1ZA 1JQGA 2J8NA 4UWIA 4KVME 2PJ1A 3IWWA 2PJ3A 3I1UA 4QC6A 5HXDA 2FIAA 5KTDA 1YK3A 5LYDA 1VHOA 4BINA 3V8IA 4KOXA 4EMEA 1AYEA 2B3UA 3EC4A 3G8WA 3WC6A 1AMPA 1CX8A 1ZLIA 4MY3A 3I3GA 3IJ3A 4CYPA 1TF8A 3D3SA 2P6FA 3SXOA 2C6CA 4R57A 2CNTA 4LQGA 2PJBA 2FXFA 2H5MA 4PPZA 2JBKA 2ZEEA 5C82A 1WK4A 4BBHA 4KVOE 4G1PA 1YW6A 2FS5A 2ZXVA 3SJEA 4CS0B 3KQZA 1BOBA 4FD6A 3KR5A 2PJ2A 3DNSA 1LAPA 3K9TA 4FD4A 2ZEMA 4UA3A 4XNHB 4UCNA 1YVOA 2PJAA 2FCKA 3WR7A 4B5OA 3D7FA 1QSMA 4PSXA 3LMSA 4UCMA 1A2ZA 2B5GA 5H86A 4NEXA 2WSAA 2DEAA 2Z3NA 5HVGA 4UEFA 1TKFA 5I4MA 1Y7EA 1I21A 4IAVA 4MFQA 3CXPA 2V8DA 3EY5A 3TOBA 2RB7A 3PBEA 1YLOA 1Z9UA 1F2PA 1PYTB 1YMEA 2AFWA 2J8MA 2R7HA 2QIRA 3BLNA 2PJ4A 1DE4C 2IQ6A 4XPLA 3SJGA 3FYNA 2VEZA 3KKWA 3PEIA 3JRUA 1IY7A 1B87A 4PV6A 1CPSA 4R87A 4PQAA 3H4QA 4ZGYB 4R3KA 3RNZA 2PC1A 1WWZA 3V7ZA 3TOAA 2EWBA 3D4UA 2PVWA 4QUSA 2R8VA 4RS2A 4AXVA 1YLEA 2GLJA 4CGOA 2OH1A 3FNCA 4B10A 4CRZB 1Y0YA 4J3GA 1ZLHA 1NSLA 4NCZA 4NGQA 4ORFA 4E0AA 2B4BA 4M3SA 4R9MA 1PCAA 6CPAA 4AB7A 4BMHA 5KTAA 4XPDB 2FL4A 3BI1A 4KORA 2ZW7A 4A33A 4CYOA 3R9EA 2P6EA 3TE4A 1QSTA 5EBVA 1KUYA 5K8PA 1NMTA 4KOYA 4UEEA 4HNXB 3V38A 4CGNA 4EWTA 2VZYA 1Q2DA 1XEBA 5JH9A 4ZI6A 4UCPA 3PFOA 2PIZA 1N71A 4CAXA 3RAMA 1FNOA 4H6ZA 3ZJ0A 2FVGA 2Z0ZA 2AFZA 2ZEOA 4MBUA 1H8LA 2ABZA 5DWMA 4E2AA 2O28A 1M4DA 1P0HA 4YWYA 4U5YA 1IU8A 2CY2A 4K30A 1VKCA 5FVJA 2QECA 3KASA 3IU2A 5F09A 2OB0A 3FIXA 4FBEA 5IB0A 4B14A 5IV0A 4IK2A 5LRGA 3R96A 1S7NA 5JQ4A 5THWA 3TO6A 1Q7LA 5F46A 2ZW6A 4ONUA 4JLYA 4OC1A 2BEIA 4MHZA 1IYLA 3FX6A 4FWUA 4UEZA 2QVPA 2V8VA 3R1KA 3TO9A 1BPNA 4E8OA 3L2NA 3SI1A 1S60A 4OMEA 3D68A 1ZG7A 2PR1A 2CIJA 2GLFA 4KSAA 4MI4A 3KHXA 3PB9X 4FD7A 4A30A 2CNSA 4H6UA 1F2OA 4JJXA 4Y49B
chains in the Genus database with same CATH topology
4KZTA 3G3SA 4GS4A 4CYNA 3JVNA 4NXYA 3VWEA 3R9GA 1LRZA 2CXAA 5H84A 1GHEA 1Y7RA 3DR8A 3UY5A 5I0CA 2ZW4A 4I49A 3BJ7A 1KUVA 3QB8A 4JWPA 3S6KA 5F47A 4JD6A 1UFHA 2HV2A 2ZPAA 4B12A 1YREA 5C88A 3QAHA 2OZUA 2G3TA 1S7LA 2PRBA 1YX0A 4X5KA 3W91A 3I9SA 2G0BA 4KLVA 3DDDA 1XF8A 3FBUA 3GKRA 4B13A 4JXRA 3VWDA 1VHSA 2JLMA 4QB9A 3A9LA 2ARHA 1XE4A 3CXQA 2YNEA 5AG5A 5G22A 2VBQA 3TTHA 4KOSA 5HH1A 5DWNA 3W6XA 2YNDA 1BO4A 3NE7A 4MY0A 4MFLA 3PP9A 3ZZIA 3E0KA 1QSRA 2GANA 1QSNA 1S7KA 5HMNA 4KUBA 2GE3A 3P2HA 2D4PA 5E96A 5JPHA 1ON0A 2Z3LA 2P6GA 2G3AA 2Z3PA 1Z4RA 5IX3A 1Y9KA 4UFVA 4RI1A 1S7FA 5A27A 3JTKA 4UBRA 2Y0MA 3C26A 5F48A 5F49A 1P4NA 4YFJA 3DSBA 1B6BA 5G20A 3D2MA 2QMLA 2Q4VA 5AG4A 4NF1A 2K5TA 2VXKA 2PSWA 2B4DA 4Q36A 3R9FA 4ZBGA 1R57A 4B5PA 2ATRA 4LUAA 1RO5A 3K9UA 5AG7A 2X7BA 2B5GB 5BWAB 3MGDA 2BUEA 1I1DA 2Z3MA 4KSFA 1J4JA 2GIVA 2PDOA 4F6AA 4II9A 4A95A 4MJ8A 4A2ZA 5GCNA 3P2FA 1OZPA 3R95A 1Y9WA 2IL4A 4UFXA 1MK4A 4OAEA 1MJAA 2Q44A 3SHPA 2JDDA 2AJ6A 2DPTA 3TCVA 3F8KA 2B58A 4PSWA 4YGOA 4XPKA 2CNMA 1IICA 5ISVA 4MFKA 1ZO0A 2JEVA 4B5PB 2WUUA 2EUIA 2Z3KA 1IB1E 3IWGA 4Q38A 1KZFA 1CM0A 3PZJA 4C2YA 4AVAA 3OWCA 2Q4YA 4C7IA 4AVBA 4C68A 3GY9A 5G21A 4AG9A 2Q04A 3LD2A 4KOVA 4IUSA 4EVYA 3TFYA 4XNHC 4A31A 3EXNA 5KTCA 1Z4EA 2FE7A 3TT2A 2VQYA 4CAWA 1YR0A 1IIDA 4QBJA 5EC4A 2OZGA 2HUZA 2ZW5A 3F5BA 4F0XA 2P0WA 4U9ZA 2REFA 2DXQA 2YGWA 1M4IA 4KOUA 4LX9A 5J8CA 4CAFA 4B10A 1YVKA 3IGRA 4NSQA 4CAVA 4UFWA 3W6SA 3F0AA 2Q7BA 2RC4A 4KVXA 3DR6A 1V0CA 4UWJA 4QVTA 3T9YA 4JXQA 4KOWA 3FXTA 1U6MA 3CXSA 3EO4A 4KOTA 2YNCA 3IU1A 3BJ8A 1Q2YA 5CNPA 1QSOA 2WPXA 1TIQA 3T90A 4IF5A 4XPDC 2B3VA 4MFZA 4CAEA 3GYAA 3N7ZA 3D2PA 4HNYB 4B11A 4H89A 1I12A 4KS9A 4R3LA 1MJ9A 1K4JA 2FSRA 4CGLA 2YNCC 1CJWA 4L8AA 2FT0A 4HNWB 2FIWA 2Z10A 4U9YA 4AVCA 1KUXA 2OU2A 2VZZA 2BL1A 2A4NA 2I79A 2VI7A 4CRYB 3FRMA 1SQHA 2PQ8A 5AGEA 2BSWA 3FB3A 3H5ZA 4KLWA 3LODA 3S6GA 3EFAA 1NE9A 4MFPA 1Q2CA 2EVNA 2F5IA 2KCWA 4Y49C 4C7HA 2JDCA 4FD5A 4L89A 2Z3OA 4HKFA 1IYKA 3TO7A 1XIXA 3S6FA 3IWEA 3B8GA 2J8RA 3SXNA 2DPSA 2WPWA 2C27A 1FY7A 3JUWA 1M44A 4C2ZA 2Z11A 4AG7A 1PUAA 4C2XA 4YRHA 2I00A 4A32A 1S5KA 1RXTA 2NMTA 1YGHA 3D8PA 2R1IA 2B4DB 4CGMA 2PR8A 2R98A 2REEA 4DNCA 1XMTA 5AG6A 3S6HA 1MJBA 1M4GA 4OADA 1L0CA 5A28A 4MFJA 3PGPA 4OLLA 4PK2A 4PK3A 1M1DA 4CYQA 2Q0YA 4M85A 4MHDA 4KUAA 5J8FA 1PU9A 4F0YA 3RYOA 2HQYA 1S3ZA 2AE6A 4CGPA 2OZHA 2D4OA 5G1ZA 2J8NA 4UWIA 4KVME 4QC6A 2FIAA 5KTDA 1YK3A 3V8IA 4KOXA 2B3UA 3EC4A 3G8WA 4MY3A 3I3GA 4CYPA 3D3SA 2P6FA 3SXOA 4R57A 2CNTA 2FXFA 2H5MA 5C82A 1WK4A 4BBHA 4KVOE 4CS0B 2FS5A 2ZXVA 1BOBA 4FD6A 4XNHB 3DNSA 4FD4A 4UA3A 4UCNA 1YVOA 2FCKA 3WR7A 4B5OA 1QSMA 4PSXA 4UCMA 2B5GA 5H86A 4NEXA 2WSAA 2Z3NA 1I21A 3TOBA 4MFQA 3CXPA 3EY5A 1Z9UA 2J8MA 2R7HA 2QIRA 3BLNA 4XPLA 3FYNA 2VEZA 3KKWA 4PV6A 1B87A 4R87A 3H4QA 4ZGYB 4R3KA 2PC1A 1WWZA 3TOAA 4QUSA 2R8VA 4RS2A 1YLEA 4CGOA 2OH1A 3FNCA 4CRZB 4J3GA 1NSLA 4E0AA 4NCZA 4ORFA 2B4BA 4M3SA 4R9MA 4AB7A 4BMHA 5KTAA 4XPDB 2FL4A 4KORA 2ZW7A 4A33A 4CYOA 3R9EA 2P6EA 3TE4A 1QSTA 5EBVA 1KUYA 1NMTA 4KOYA 4HNXB 4CGNA 2VZYA 1Q2DA 1XEBA 4UCPA 1N71A 4CAXA 4H6ZA 3ZJ0A 2Z0ZA 4MBUA 5DWMA 4E2AA 2O28A 1M4DA 1P0HA 4U5YA 2CY2A 4K30A 1VKCA 5FVJA 2QECA 3IU2A 2OB0A 3FIXA 5IB0A 4B14A 5IV0A 3R96A 1S7NA 5JQ4A 3TO6A 5F46A 2ZW6A 4ONUA 4JLYA 2BEIA 1IYLA 3R1KA 4E8OA 3TO9A 1S60A 2PR1A 4KSAA 4MI4A 4A30A 4FD7A 2CNSA 4H6UA 4Y49B 4JJXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KZT A;  3G3S A;  4GS4 A;  3JVN A;  4NXY A;  3VWE A;  3R9G A;  1LRZ A;  5H84 A;  1GHE A;  1Y7R A;  3DR8 A;  3UY5 A;  5I0C A;  2ZW4 A;  4I49 A;  3BJ7 A;  1KUV A;  3QB8 A;  4JWP A;  3S6K A;  5F47 A;  4JD6 A;  1UFH A;  2HV2 A;  2ZPA A;  1YRE A;  5C88 A;  3QAH A;  2OZU A;  2G3T A;  1S7L A;  2PRB A;  1YX0 A;  4X5K A;  3W91 A;  3I9S A;  2G0B A;  4KLV A;  3DDD A;  1XF8 A;  3FBU A;  3GKR A;  4JXR A;  3VWD A;  1VHS A;  2JLM A;  4QB9 A;  2ARH A;  1XE4 A;  3CXQ A;  2VBQ A;  3TTH A;  4KOS A;  5HH1 A;  5DWN A;  3W6X A;  1BO4 A;  3NE7 A;  4MY0 A;  3ZZI A;  3PP9 A;  3E0K A;  1QSR A;  2GAN A;  1QSN A;  1S7K A;  5HMN A;  4KUB A;  2GE3 A;  3P2H A;  2D4P A;  5E96 A;  5JPH A;  1ON0 A;  2P6G A;  2G3A A;  1Z4R A;  5IX3 A;  1Y9K A;  4RI1 A;  1S7F A;  4UBR A;  2Y0M A;  3C26 A;  5F48 A;  5F49 A;  1P4N A;  4YFJ A;  3DSB A;  1B6B A;  3D2M A;  2QML A;  2Q4V A;  4NF1 A;  2K5T A;  2VXK A;  2PSW A;  2B4D A;  3R9F A;  4ZBG A;  1R57 A;  4B5P A;  2ATR A;  4LUA A;  1RO5 A;  3K9U A;  2X7B A;  2B5G B;  3MGD A;  2BUE A;  1I1D A;  1J4J A;  2GIV A;  2PDO A;  4F6A A;  4II9 A;  4MJ8 A;  5GCN A;  3P2F A;  1OZP A;  3R95 A;  1Y9W A;  2IL4 A;  1MK4 A;  4OAE A;  1MJA A;  2Q44 A;  3SHP A;  2JDD A;  2AJ6 A;  3TCV A;  3F8K A;  2B58 A;  4PSW A;  4YGO A;  4XPK A;  2CNM A;  1IIC A;  5ISV A;  2JEV A;  4B5P B;  2EUI A;  1IB1 E;  3IWG A;  1KZF A;  1CM0 A;  3PZJ A;  4AVA A;  3OWC A;  2Q4Y A;  4AVB A;  3GY9 A;  4AG9 A;  2Q04 A;  3LD2 A;  4KOV A;  4IUS A;  4EVY A;  3TFY A;  4XNH C;  3EXN A;  5KTC A;  1Z4E A;  2FE7 A;  3TT2 A;  2VQY A;  4CAW A;  1YR0 A;  1IID A;  4QBJ A;  5EC4 A;  2OZG A;  2HUZ A;  2ZW5 A;  3F5B A;  2P0W A;  4U9Z A;  2REF A;  2DXQ A;  1M4I A;  4KOU A;  4LX9 A;  5J8C A;  1YVK A;  3IGR A;  4NSQ A;  4CAV A;  3W6S A;  3F0A A;  2Q7B A;  2RC4 A;  4KVX A;  3DR6 A;  1V0C A;  4UWJ A;  4QVT A;  3T9Y A;  4JXQ A;  4KOW A;  3FXT A;  1U6M A;  3CXS A;  3EO4 A;  4KOT A;  3BJ8 A;  1Q2Y A;  5CNP A;  1QSO A;  2WPX A;  1TIQ A;  3T90 A;  4IF5 A;  4XPD C;  2B3V A;  3GYA A;  3N7Z A;  3D2P A;  4HNY B;  4H89 A;  1I12 A;  4R3L A;  1MJ9 A;  1K4J A;  2FSR A;  1CJW A;  4L8A A;  2FT0 A;  4HNW B;  2FIW A;  2Z10 A;  4U9Y A;  4AVC A;  1KUX A;  2OU2 A;  2VZZ A;  2BL1 A;  2A4N A;  2I79 A;  2VI7 A;  4CRY B;  3FRM A;  1SQH A;  2PQ8 A;  2BSW A;  3FB3 A;  4KLW A;  3LOD A;  3S6G A;  3EFA A;  1NE9 A;  1Q2C A;  2EVN A;  2F5I A;  2KCW A;  4Y49 C;  2JDC A;  4FD5 A;  4L89 A;  4HKF A;  1IYK A;  3TO7 A;  1XIX A;  3S6F A;  3B8G A;  2J8R A;  3SXN A;  2WPW A;  2C27 A;  1FY7 A;  3JUW A;  1M44 A;  2Z11 A;  4AG7 A;  1PUA A;  4YRH A;  2I00 A;  1S5K A;  1RXT A;  2NMT A;  1YGH A;  3D8P A;  2R1I A;  2B4D B;  2PR8 A;  2R98 A;  2REE A;  4DNC A;  1XMT A;  3S6H A;  1MJB A;  1M4G A;  4OAD A;  1L0C A;  3PGP A;  4OLL A;  4PK2 A;  4PK3 A;  1M1D A;  2Q0Y A;  4M85 A;  4MHD A;  4KUA A;  5J8F A;  1PU9 A;  4F0Y A;  3RYO A;  2HQY A;  1S3Z A;  2AE6 A;  2OZH A;  2D4O A;  2J8N A;  4UWI A;  4KVM E;  4QC6 A;  2FIA A;  5KTD A;  1YK3 A;  3V8I A;  4KOX A;  2B3U A;  3EC4 A;  3G8W A;  4MY3 A;  3I3G A;  3D3S A;  2P6F A;  3SXO A;  4R57 A;  2CNT A;  2FXF A;  2H5M A;  5C82 A;  1WK4 A;  4KVO E;  4CS0 B;  2FS5 A;  2ZXV A;  1BOB A;  4FD6 A;  4XNH B;  3DNS A;  4FD4 A;  4UA3 A;  1YVO A;  2FCK A;  3WR7 A;  4B5O A;  1QSM A;  4PSX A;  2B5G A;  5H86 A;  4NEX A;  1I21 A;  3TOB A;  3CXP A;  3EY5 A;  1Z9U A;  2J8M A;  2R7H A;  2QIR A;  3BLN A;  4XPL A;  3FYN A;  2VEZ A;  3KKW A;  4PV6 A;  1B87 A;  4R87 A;  3H4Q A;  4R3K A;  2PC1 A;  1WWZ A;  3TOA A;  4QUS A;  2R8V A;  4RS2 A;  1YLE A;  2OH1 A;  3FNC A;  4CRZ B;  4J3G A;  1NSL A;  4E0A A;  4NCZ A;  4ORF A;  2B4B A;  4M3S A;  4R9M A;  4AB7 A;  4BMH A;  5KTA A;  4XPD B;  2FL4 A;  4KOR A;  2ZW7 A;  3R9E A;  2P6E A;  3TE4 A;  1QST A;  5EBV A;  1KUY A;  1NMT A;  4KOY A;  4HNX B;  2VZY A;  1Q2D A;  1XEB A;  1N71 A;  4CAX A;  4H6Z A;  3ZJ0 A;  2Z0Z A;  4MBU A;  5DWM A;  4E2A A;  2O28 A;  1M4D A;  1P0H A;  4U5Y A;  2CY2 A;  4K30 A;  1VKC A;  5FVJ A;  2QEC A;  2OB0 A;  3FIX A;  5IB0 A;  5IV0 A;  3R96 A;  1S7N A;  5JQ4 A;  3TO6 A;  5F46 A;  2ZW6 A;  4ONU A;  4JLY A;  2BEI A;  1IYL A;  3R1K A;  4E8O A;  3TO9 A;  1S60 A;  2PR1 A;  4MI4 A;  4FD7 A;  2CNS A;  4H6U A;  4Y49 B;  4JJX A; 
#chains in the Genus database with same CATH topology
 1XJO A;  4KZT A;  3G3S A;  4GS4 A;  4HPS A;  2EK9 A;  4CYN A;  3JVN A;  2ZEP A;  4NXY A;  4K3N A;  2PJ6 A;  4M6H A;  3VWE A;  2I3C A;  3R9G A;  1LRZ A;  3SI2 A;  3NA6 A;  2PJ5 A;  2CXA A;  5D29 A;  4LQ6 A;  5H84 A;  4A37 A;  1GHE A;  1Y7R A;  3DR8 A;  3UY5 A;  5I0C A;  4Z65 A;  2ZW4 A;  4I49 A;  2Q7S A;  3BJ7 A;  1KUV A;  3QB8 A;  4RN7 A;  4JWP A;  4MCS A;  4BD9 A;  4O23 A;  2POK A;  4ONW A;  1Z5R A;  3S6K A;  2HB6 A;  2V8G A;  4OC3 A;  5F47 A;  4JD6 A;  1UFH A;  7CPA A;  3NE8 A;  2HV2 A;  2AFO A;  2ZPA A;  4B12 A;  1X12 A;  2QJ8 A;  1YRE A;  3KHZ A;  5C88 A;  4JZ0 A;  3H8F A;  2V8H A;  3QAH A;  4JYW A;  2OZU A;  2IMO A;  2G3T A;  1S7L A;  3SJX A;  3WAB A;  2AFM A;  2PRB A;  4A39 A;  1ZG8 A;  1Z2L A;  5D8N A;  1YX0 A;  4X5K A;  3W91 A;  3PBB A;  3WT4 A;  3I9S A;  3B3V A;  2JBJ A;  2G0B A;  1IOI A;  4KLV A;  4P10 A;  2AFX A;  2ZEG A;  3DDD A;  3TX8 A;  1XF8 A;  2Q43 A;  3FBU A;  4WWV A;  2EK8 A;  3GKR A;  1EE3 P;  1XRY A;  4B13 A;  4JXR A;  4PXC A;  4PXB A;  3SI0 A;  3PB7 X;  3VWD A;  1VHS A;  2JLM A;  3RZA A;  4F9V A;  4QB9 A;  3A9L A;  4X3R A;  2ARH A;  1XE4 A;  4P4E A;  4CPA A;  3CXQ A;  2YNE A;  5AG5 A;  5G22 A;  4FAI A;  2VBQ A;  3TTH A;  4MMO A;  4KOS A;  3FF3 A;  8CPA A;  2NSM A;  2ZEL A;  5HH1 A;  5DWN A;  3W6X A;  2YND A;  4MCQ A;  1BO4 A;  3KI9 A;  3NE7 A;  4MY0 A;  3KZW A;  3TC8 A;  1JWQ A;  4MFL A;  3PP9 A;  3ZZI A;  3E0K A;  1QSR A;  2GAN A;  1QSN A;  2PCU A;  4UIB A;  1S7K A;  4OC4 A;  5HMN A;  4KUB A;  2GE3 A;  3P2H A;  5JM6 A;  2D4P A;  5E96 A;  1Z8W A;  5JPH A;  1VIX A;  2XEF A;  1ON0 A;  2Z3L A;  2P6G A;  3S9M A;  2ZEN A;  2XEI A;  2G3A A;  2Z3P A;  3T8W A;  1Z4R A;  5IX3 A;  4NGM A;  4X8I A;  2PJ0 A;  5IB9 A;  1Y9K A;  1TXR A;  2CF4 A;  3PFE A;  4UFV A;  1Y0R A;  3IIB A;  4RI1 A;  1S7F A;  2ZED A;  3CZX A;  2PJ7 A;  5A27 A;  4ZY0 A;  3JTK A;  4IHM A;  4UBR A;  2Y0M A;  5LRK A;  3C26 A;  5F48 A;  5F49 A;  4A94 A;  3PB6 X;  1P4N A;  3FJU A;  2EBJ A;  3KL9 A;  5HVF A;  4YFJ A;  3DSB A;  2DF5 A;  4OID A;  1B6B A;  5G20 A;  2GU2 A;  3D2M A;  2QML A;  2ZOG A;  4YU9 A;  4NFR A;  3RBU A;  2Q4V A;  5AG4 A;  4NF1 A;  5CBM A;  2K5T A;  2VXK A;  2PSW A;  2B4D A;  4Q36 A;  3R9F A;  4P4B A;  2F7V A;  1R57 A;  2VL1 A;  3KR4 A;  4ZBG A;  4B5P A;  1LOK A;  5ELY A;  2ATR A;  4LUA A;  3GUX A;  1RO5 A;  3K9U A;  3N5F A;  4PXE A;  1TKJ A;  4NGP A;  5AG7 A;  2X7B A;  2B5G B;  5BWA B;  5K8O A;  1ELL P;  3MGD A;  3ISZ A;  3B3T A;  3MRU A;  2BUE A;  3K2K A;  4GXH A;  1I1D A;  2Z3M A;  3DLJ A;  1DTD A;  4KSF A;  1J4J A;  2GIV A;  2PDO A;  4F6A A;  4II9 A;  3MN8 A;  4A95 A;  4OKO A;  1UWY A;  1ARL A;  2HC9 A;  4MJ8 A;  4NGS A;  4A2Z A;  4W9Y A;  2CTC A;  2PJ9 A;  5GCN A;  3CPA A;  4M6I A;  3B3S A;  3ISX A;  3P2F A;  4P44 A;  1LCP A;  1BPM A;  1OZP A;  1Y9W A;  3R95 A;  1LAN A;  2IL4 A;  4FUU A;  2PVV A;  4UFX A;  1CPX A;  2Q51 A;  1MK4 A;  4OAE A;  2PE3 A;  1MJA A;  2IJZ A;  2Q44 A;  4Q7A A;  3SHP A;  2C6P A;  2JDD A;  2PIY A;  2AJ6 A;  2DPT A;  3QNV A;  5K8M A;  2ODF A;  3F8K A;  5LYI A;  2B58 A;  4P4J A;  3GIU A;  2C1C A;  3TCV A;  3IFE A;  4ZYQ A;  2QYV A;  4ZY2 A;  4PSW A;  4YGO A;  4F8Z A;  3WC7 A;  4XPK A;  2CNM A;  1IIC A;  5ISV A;  3KGQ A;  1ZO0 A;  2JEV A;  4MFK A;  4B5P B;  2WUU A;  3D67 A;  2EUI A;  2Z3K A;  2J9A A;  1IB1 E;  3IWG A;  3NH8 A;  4Q38 A;  1KZF A;  3S9N A;  1CM0 A;  3PZJ A;  4C2Y A;  2PRQ A;  1XMB A;  4AVA A;  1OBR A;  3OWC A;  4F9U A;  2Q4Y A;  4OP4 A;  4ZX8 A;  4C7I A;  4AVB A;  2OR4 A;  3GY9 A;  5G21 A;  4C68 A;  4WJB A;  4AG9 A;  2Q04 A;  3LD2 A;  4KOV A;  1ARM A;  3GLJ A;  4IUS A;  4EVY A;  3TFY A;  4XNH C;  4A31 A;  3B7I A;  3EXN A;  5KTC A;  1TKH A;  4UF4 A;  1Z4E A;  3B3C A;  3D66 A;  2FE7 A;  3TT2 A;  2VQY A;  4P4F A;  4CAW A;  1Z8L A;  2G9D A;  1YR0 A;  1IID A;  4QBJ A;  5EC4 A;  2OZG A;  2HUZ A;  2ZW5 A;  3F5B A;  3IO1 A;  4MCR A;  4F0X A;  2P0W A;  2ZEH A;  4U9Z A;  4M6G A;  4NGN A;  1AUG A;  2REF A;  2DXQ A;  2YGW A;  1M4I A;  4KOU A;  4MRI A;  4LX9 A;  1R43 A;  1HDQ A;  5J8C A;  4CAF A;  3D7D A;  1YVK A;  3IGR A;  4H2K A;  2GFQ A;  3LWU A;  4NSQ A;  2O4H A;  1HDU A;  4UFW A;  4CAV A;  3W6S A;  3B35 A;  3CPX A;  3F0A A;  2Q7B A;  2XEJ A;  2RC4 A;  3FEC A;  3DR6 A;  4KVX A;  1V0C A;  1F57 A;  4UWJ A;  4NGT A;  4QVT A;  3LAC A;  3T9Y A;  4JXQ A;  2PJC A;  4KOW A;  4GM5 A;  3FXT A;  1U6M A;  4P6Y A;  1X10 A;  3CXS A;  3EO4 A;  4KOT A;  2YNC A;  3IU1 A;  4DJL A;  1VHE A;  3CDX A;  3BJ8 A;  1Q2Y A;  4R8F A;  5CNP A;  2OOT A;  3BXM A;  1QSO A;  2BO9 A;  3GB0 A;  1HEE A;  4OC2 A;  2O53 A;  1YQE A;  2WPX A;  1TIQ A;  3T90 A;  4IF5 A;  4XPD C;  2CTB A;  2B3V A;  4MFZ A;  4A38 A;  3IC1 A;  4CAE A;  4OIW A;  4ZX9 A;  3GYA A;  3N7Z A;  3D2P A;  4HNY B;  1CP7 A;  4B11 A;  5K8N A;  1LAM A;  3NFZ A;  5EMI A;  4H89 A;  1I12 A;  4KS9 A;  4R3L A;  4NJR A;  1MJ9 A;  3WC5 A;  1K4J A;  2FSR A;  4CGL A;  2YNC C;  1CJW A;  2BCO A;  4MXU A;  2PJ8 A;  4L8A A;  4P4D A;  3D7G A;  3HUV A;  1XBU A;  3VAT A;  3VAR A;  2FT0 A;  4OC0 A;  1LFW A;  3DGV A;  1ELM P;  1NSA A;  4HNW B;  4MCP A;  2FIW A;  4PXD A;  2ZOF A;  3B3W A;  4OC5 A;  2Z10 A;  4U9Y A;  4AVC A;  1CG2 A;  3BI0 A;  1KUX A;  2OU2 A;  4TWE A;  3VH9 A;  2Q4Z A;  3S9L A;  2VZZ A;  2BL1 A;  2A4N A;  2I79 A;  2VI7 A;  1FT7 A;  4CRY B;  3FRM A;  2C6G A;  1M4L A;  1SQH A;  2PQ8 A;  5AGE A;  2BSW A;  3FB3 A;  3H5Z A;  4KLW A;  1Z8X A;  1CBX A;  3LOD A;  1XFO A;  5DS0 A;  5LRJ A;  3EFA A;  3S6G A;  1NE9 A;  4MFP A;  1Q2C A;  1QQ9 A;  3SJF A;  2EVN A;  2F5I A;  2KCW A;  4RUH A;  4MHN A;  4R76 A;  4Y49 C;  4C7H A;  2JDC A;  4FD5 A;  4L89 A;  2GRE A;  2Z3O A;  2JEW A;  4HKF A;  1R3N A;  4P4I A;  1IYK A;  3PB4 X;  4B6Z A;  3TO7 A;  1XIX A;  1CP6 A;  3S6F A;  3IWE A;  2AFS A;  3B8G A;  2J8R A;  1YW4 A;  3SXN A;  4DYO A;  2DPS A;  2WPW A;  2WYR A;  2ZEF A;  2C27 A;  1Z8T A;  2WZN A;  1RTQ A;  4NJQ A;  4X2T A;  1FY7 A;  1KWM A;  3BHX A;  3FEE A;  3JUW A;  1M44 A;  4C2Z A;  1IOF A;  1IGB A;  2Z11 A;  2AFU A;  1QMU A;  3FED A;  4AG7 A;  1PUA A;  2XEG A;  4UIA A;  1ZG9 A;  3IEH A;  4ZY1 A;  4C2X A;  4YRH A;  4NGR A;  2BOA A;  2I00 A;  4A32 A;  1S5K A;  1RXT A;  2NMT A;  1YGH A;  1XOV A;  2RFH A;  4TNU A;  1TF9 A;  1YSJ A;  2V77 A;  3D8P A;  4P45 A;  4R6T A;  5CPA A;  5LYL A;  3KQX A;  3RO0 A;  2R1I A;  2B4D B;  3CT9 A;  4CGM A;  2PR8 A;  2R98 A;  2REE A;  4DNC A;  1XMT A;  5AG6 A;  3S6H A;  5JGF A;  2ANP A;  1MJB A;  1M4G A;  2F8H A;  4OAD A;  1BAV A;  3D7H A;  1L0C A;  3NH5 A;  3PRT A;  5A28 A;  4MFJ A;  3FMC A;  3PGP A;  5J1Q A;  3HLP A;  3FVL A;  4OLL A;  4DUK A;  5LYF A;  5HVH A;  4KSI A;  4PK2 A;  4PK3 A;  1M1D A;  4CYQ A;  2Q0Y A;  3FH4 A;  4M85 A;  4KUA A;  4MHD A;  2NYQ A;  1PU9 A;  4MHY A;  5J8F A;  3NH4 A;  3RYO A;  1GYT A;  4F0Y A;  2HQY A;  1VGY A;  1S3Z A;  2AE6 A;  4R7M A;  3H8E A;  2EO8 A;  3B2Y A;  4CGP A;  4EFD A;  3QAY A;  1BLL E;  4MHP A;  2OZH A;  3H8G A;  2D4O A;  3PB8 X;  5G1Z A;  1JQG A;  2J8N A;  4UWI A;  4KVM E;  2PJ1 A;  3IWW A;  2PJ3 A;  3I1U A;  4QC6 A;  5HXD A;  2FIA A;  5KTD A;  1YK3 A;  5LYD A;  1VHO A;  4BIN A;  3V8I A;  4KOX A;  4EME A;  1AYE A;  2B3U A;  3EC4 A;  3G8W A;  3WC6 A;  1AMP A;  1CX8 A;  1ZLI A;  4MY3 A;  3I3G A;  3IJ3 A;  4CYP A;  1TF8 A;  3D3S A;  2P6F A;  3SXO A;  2C6C A;  4R57 A;  2CNT A;  4LQG A;  2PJB A;  2FXF A;  2H5M A;  4PPZ A;  2JBK A;  2ZEE A;  5C82 A;  1WK4 A;  4BBH A;  4KVO E;  4G1P A;  1YW6 A;  2FS5 A;  2ZXV A;  3SJE A;  4CS0 B;  3KQZ A;  1BOB A;  4FD6 A;  3KR5 A;  2PJ2 A;  3DNS A;  1LAP A;  3K9T A;  4FD4 A;  2ZEM A;  4UA3 A;  4XNH B;  4UCN A;  1YVO A;  2PJA A;  2FCK A;  3WR7 A;  4B5O A;  3D7F A;  1QSM A;  4PSX A;  3LMS A;  4UCM A;  1A2Z A;  2B5G A;  5H86 A;  4NEX A;  2WSA A;  2DEA A;  2Z3N A;  5HVG A;  4UEF A;  1TKF A;  5I4M A;  1Y7E A;  1I21 A;  4IAV A;  4MFQ A;  3CXP A;  2V8D A;  3EY5 A;  3TOB A;  2RB7 A;  3PBE A;  1YLO A;  1Z9U A;  1F2P A;  1PYT B;  1YME A;  2AFW A;  2J8M A;  2R7H A;  2QIR A;  3BLN A;  2PJ4 A;  1DE4 C;  2IQ6 A;  4XPL A;  3SJG A;  3FYN A;  2VEZ A;  3KKW A;  3PEI A;  3JRU A;  1IY7 A;  1B87 A;  4PV6 A;  1CPS A;  4R87 A;  4PQA A;  3H4Q A;  4ZGY B;  4R3K A;  3RNZ A;  2PC1 A;  1WWZ A;  3V7Z A;  3TOA A;  2EWB A;  3D4U A;  2PVW A;  4QUS A;  2R8V A;  4RS2 A;  4AXV A;  1YLE A;  2GLJ A;  4CGO A;  2OH1 A;  3FNC A;  4B10 A;  4CRZ B;  1Y0Y A;  4J3G A;  1ZLH A;  1NSL A;  4NCZ A;  4NGQ A;  4ORF A;  4E0A A;  2B4B A;  4M3S A;  4R9M A;  1PCA A;  6CPA A;  4AB7 A;  4BMH A;  5KTA A;  4XPD B;  2FL4 A;  3BI1 A;  4KOR A;  2ZW7 A;  4A33 A;  4CYO A;  3R9E A;  2P6E A;  3TE4 A;  1QST A;  5EBV A;  1KUY A;  5K8P A;  1NMT A;  4KOY A;  4UEE A;  4HNX B;  3V38 A;  4CGN A;  4EWT A;  2VZY A;  1Q2D A;  1XEB A;  5JH9 A;  4ZI6 A;  4UCP A;  3PFO A;  2PIZ A;  1N71 A;  4CAX A;  3RAM A;  1FNO A;  4H6Z A;  3ZJ0 A;  2FVG A;  2Z0Z A;  2AFZ A;  2ZEO A;  4MBU A;  1H8L A;  2ABZ A;  5DWM A;  4E2A A;  2O28 A;  1M4D A;  1P0H A;  4YWY A;  4U5Y A;  1IU8 A;  2CY2 A;  4K30 A;  1VKC A;  5FVJ A;  2QEC A;  3KAS A;  3IU2 A;  5F09 A;  2OB0 A;  3FIX A;  4FBE A;  5IB0 A;  4B14 A;  5IV0 A;  4IK2 A;  5LRG A;  3R96 A;  1S7N A;  5JQ4 A;  5THW A;  3TO6 A;  1Q7L A;  5F46 A;  2ZW6 A;  4ONU A;  4JLY A;  4OC1 A;  2BEI A;  4MHZ A;  1IYL A;  3FX6 A;  4FWU A;  4UEZ A;  2QVP A;  2V8V A;  3R1K A;  3TO9 A;  1BPN A;  4E8O A;  3L2N A;  3SI1 A;  1S60 A;  4OME A;  3D68 A;  1ZG7 A;  2PR1 A;  2CIJ A;  2GLF A;  4KSA A;  4MI4 A;  3KHX A;  3PB9 X;  4FD7 A;  4A30 A;  2CNS A;  4H6U A;  1F2O A;  4JJX A;  4Y49 B; 
#chains in the Genus database with same CATH homology
 4KZT A;  3G3S A;  4GS4 A;  4CYN A;  3JVN A;  4NXY A;  3VWE A;  3R9G A;  1LRZ A;  2CXA A;  5H84 A;  1GHE A;  1Y7R A;  3DR8 A;  3UY5 A;  5I0C A;  2ZW4 A;  4I49 A;  3BJ7 A;  1KUV A;  3QB8 A;  4JWP A;  3S6K A;  5F47 A;  4JD6 A;  1UFH A;  2HV2 A;  2ZPA A;  4B12 A;  1YRE A;  5C88 A;  3QAH A;  2OZU A;  2G3T A;  1S7L A;  2PRB A;  1YX0 A;  4X5K A;  3W91 A;  3I9S A;  2G0B A;  4KLV A;  3DDD A;  1XF8 A;  3FBU A;  3GKR A;  4B13 A;  4JXR A;  3VWD A;  1VHS A;  2JLM A;  4QB9 A;  3A9L A;  2ARH A;  1XE4 A;  3CXQ A;  2YNE A;  5AG5 A;  5G22 A;  2VBQ A;  3TTH A;  4KOS A;  5HH1 A;  5DWN A;  3W6X A;  2YND A;  1BO4 A;  3NE7 A;  4MY0 A;  4MFL A;  3PP9 A;  3ZZI A;  3E0K A;  1QSR A;  2GAN A;  1QSN A;  1S7K A;  5HMN A;  4KUB A;  2GE3 A;  3P2H A;  2D4P A;  5E96 A;  5JPH A;  1ON0 A;  2Z3L A;  2P6G A;  2G3A A;  2Z3P A;  1Z4R A;  5IX3 A;  1Y9K A;  4UFV A;  4RI1 A;  1S7F A;  5A27 A;  3JTK A;  4UBR A;  2Y0M A;  3C26 A;  5F48 A;  5F49 A;  1P4N A;  4YFJ A;  3DSB A;  1B6B A;  5G20 A;  3D2M A;  2QML A;  2Q4V A;  5AG4 A;  4NF1 A;  2K5T A;  2VXK A;  2PSW A;  2B4D A;  4Q36 A;  3R9F A;  4ZBG A;  1R57 A;  4B5P A;  2ATR A;  4LUA A;  1RO5 A;  3K9U A;  5AG7 A;  2X7B A;  2B5G B;  5BWA B;  3MGD A;  2BUE A;  1I1D A;  2Z3M A;  4KSF A;  1J4J A;  2GIV A;  2PDO A;  4F6A A;  4II9 A;  4A95 A;  4MJ8 A;  4A2Z A;  5GCN A;  3P2F A;  1OZP A;  3R95 A;  1Y9W A;  2IL4 A;  4UFX A;  1MK4 A;  4OAE A;  1MJA A;  2Q44 A;  3SHP A;  2JDD A;  2AJ6 A;  2DPT A;  3TCV A;  3F8K A;  2B58 A;  4PSW A;  4YGO A;  4XPK A;  2CNM A;  1IIC A;  5ISV A;  4MFK A;  1ZO0 A;  2JEV A;  4B5P B;  2WUU A;  2EUI A;  2Z3K A;  1IB1 E;  3IWG A;  4Q38 A;  1KZF A;  1CM0 A;  3PZJ A;  4C2Y A;  4AVA A;  3OWC A;  2Q4Y A;  4C7I A;  4AVB A;  4C68 A;  3GY9 A;  5G21 A;  4AG9 A;  2Q04 A;  3LD2 A;  4KOV A;  4IUS A;  4EVY A;  3TFY A;  4XNH C;  4A31 A;  3EXN A;  5KTC A;  1Z4E A;  2FE7 A;  3TT2 A;  2VQY A;  4CAW A;  1YR0 A;  1IID A;  4QBJ A;  5EC4 A;  2OZG A;  2HUZ A;  2ZW5 A;  3F5B A;  4F0X A;  2P0W A;  4U9Z A;  2REF A;  2DXQ A;  2YGW A;  1M4I A;  4KOU A;  4LX9 A;  5J8C A;  4CAF A;  4B10 A;  1YVK A;  3IGR A;  4NSQ A;  4CAV A;  4UFW A;  3W6S A;  3F0A A;  2Q7B A;  2RC4 A;  4KVX A;  3DR6 A;  1V0C A;  4UWJ A;  4QVT A;  3T9Y A;  4JXQ A;  4KOW A;  3FXT A;  1U6M A;  3CXS A;  3EO4 A;  4KOT A;  2YNC A;  3IU1 A;  3BJ8 A;  1Q2Y A;  5CNP A;  1QSO A;  2WPX A;  1TIQ A;  3T90 A;  4IF5 A;  4XPD C;  2B3V A;  4MFZ A;  4CAE A;  3GYA A;  3N7Z A;  3D2P A;  4HNY B;  4B11 A;  4H89 A;  1I12 A;  4KS9 A;  4R3L A;  1MJ9 A;  1K4J A;  2FSR A;  4CGL A;  2YNC C;  1CJW A;  4L8A A;  2FT0 A;  4HNW B;  2FIW A;  2Z10 A;  4U9Y A;  4AVC A;  1KUX A;  2OU2 A;  2VZZ A;  2BL1 A;  2A4N A;  2I79 A;  2VI7 A;  4CRY B;  3FRM A;  1SQH A;  2PQ8 A;  5AGE A;  2BSW A;  3FB3 A;  3H5Z A;  4KLW A;  3LOD A;  3S6G A;  3EFA A;  1NE9 A;  4MFP A;  1Q2C A;  2EVN A;  2F5I A;  2KCW A;  4Y49 C;  4C7H A;  2JDC A;  4FD5 A;  4L89 A;  2Z3O A;  4HKF A;  1IYK A;  3TO7 A;  1XIX A;  3S6F A;  3IWE A;  3B8G A;  2J8R A;  3SXN A;  2DPS A;  2WPW A;  2C27 A;  1FY7 A;  3JUW A;  1M44 A;  4C2Z A;  2Z11 A;  4AG7 A;  1PUA A;  4C2X A;  4YRH A;  2I00 A;  4A32 A;  1S5K A;  1RXT A;  2NMT A;  1YGH A;  3D8P A;  2R1I A;  2B4D B;  4CGM A;  2PR8 A;  2R98 A;  2REE A;  4DNC A;  1XMT A;  5AG6 A;  3S6H A;  1MJB A;  1M4G A;  4OAD A;  1L0C A;  5A28 A;  4MFJ A;  3PGP A;  4OLL A;  4PK2 A;  4PK3 A;  1M1D A;  4CYQ A;  2Q0Y A;  4M85 A;  4MHD A;  4KUA A;  5J8F A;  1PU9 A;  4F0Y A;  3RYO A;  2HQY A;  1S3Z A;  2AE6 A;  4CGP A;  2OZH A;  2D4O A;  5G1Z A;  2J8N A;  4UWI A;  4KVM E;  4QC6 A;  2FIA A;  5KTD A;  1YK3 A;  3V8I A;  4KOX A;  2B3U A;  3EC4 A;  3G8W A;  4MY3 A;  3I3G A;  4CYP A;  3D3S A;  2P6F A;  3SXO A;  4R57 A;  2CNT A;  2FXF A;  2H5M A;  5C82 A;  1WK4 A;  4BBH A;  4KVO E;  4CS0 B;  2FS5 A;  2ZXV A;  1BOB A;  4FD6 A;  4XNH B;  3DNS A;  4FD4 A;  4UA3 A;  4UCN A;  1YVO A;  2FCK A;  3WR7 A;  4B5O A;  1QSM A;  4PSX A;  4UCM A;  2B5G A;  5H86 A;  4NEX A;  2WSA A;  2Z3N A;  1I21 A;  3TOB A;  4MFQ A;  3CXP A;  3EY5 A;  1Z9U A;  2J8M A;  2R7H A;  2QIR A;  3BLN A;  4XPL A;  3FYN A;  2VEZ A;  3KKW A;  4PV6 A;  1B87 A;  4R87 A;  3H4Q A;  4ZGY B;  4R3K A;  2PC1 A;  1WWZ A;  3TOA A;  4QUS A;  2R8V A;  4RS2 A;  1YLE A;  4CGO A;  2OH1 A;  3FNC A;  4CRZ B;  4J3G A;  1NSL A;  4E0A A;  4NCZ A;  4ORF A;  2B4B A;  4M3S A;  4R9M A;  4AB7 A;  4BMH A;  5KTA A;  4XPD B;  2FL4 A;  4KOR A;  2ZW7 A;  4A33 A;  4CYO A;  3R9E A;  2P6E A;  3TE4 A;  1QST A;  5EBV A;  1KUY A;  1NMT A;  4KOY A;  4HNX B;  4CGN A;  2VZY A;  1Q2D A;  1XEB A;  4UCP A;  1N71 A;  4CAX A;  4H6Z A;  3ZJ0 A;  2Z0Z A;  4MBU A;  5DWM A;  4E2A A;  2O28 A;  1M4D A;  1P0H A;  4U5Y A;  2CY2 A;  4K30 A;  1VKC A;  5FVJ A;  2QEC A;  3IU2 A;  2OB0 A;  3FIX A;  5IB0 A;  4B14 A;  5IV0 A;  3R96 A;  1S7N A;  5JQ4 A;  3TO6 A;  5F46 A;  2ZW6 A;  4ONU A;  4JLY A;  2BEI A;  1IYL A;  3R1K A;  4E8O A;  3TO9 A;  1S60 A;  2PR1 A;  4KSA A;  4MI4 A;  4A30 A;  4FD7 A;  2CNS A;  4H6U A;  4Y49 B;  4JJX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...