3OWFA

Crystal structure of staphylococcal nuclease variant delta+phs v66r at cryogenic temperature
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
135
structure length
135
Chain Sequence
ATSTKKLHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMRENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thermonuclease
publication title Domain swapping promoted by a single mutation that introduces an ionizable group into the hydrophobic core of a protein
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 34
structure length 135
sequence length 135
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2010-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3owfA00
4DFAA 3EROA 4WRDA 5I6YA 5CV8A 4B9WA 4QF4A 4ZUIA 1JOOA 2EY5A 4IUNA 1RKNA 3MZ5A 1II3A 1KDBA 3RUZA 4EQPA 3MEHA 3ERQA 1EQVA 2PYKA 4HMJA 4IALA 4KY5A 2EY2A 3BDLA 3HEJA 3BDCA 3OSOA 3OMCA 4PMBA 5CR3A 2EXZA 1SYFA 4WORA 3TP7A 2F0IA 2F0TA 5EGTA 4ME5A 3LX0A 4S3SA 4K5VA 4K5WA 5CV9A 1STYA 2EYHA 1JOKA 3NHHA 2KHSA 5NUCA 5IGEA 2F0FA 2RDFA 2EYLA 1SNCA 3V2TA 3NXWA 3T13A 3NP8A 4K8JA 3TMEA 5I9PA 5IGBA 4K8IA 4NDXA 5KYIA 2WACA 5C3XA 5C5MA 5IGGA 5KEEA 4OL7A 1NUCA 5C6AA 3MVVA 4ID6A 4RKLA 5KGUA 2NUCA 2ENBA 2EYMA 2OXPA 2PZTA 2F0WA 4QB4A 4I65A 1F2MA 5JOBA 3C1FA 1IHZA 4KD4A 4LAAA 1EY5A 4ODGA 4HTHA 5F2DA 1EY0A 5IOCA 1JOQA 5CGKA 5J39A 4KY7A 2RBMA 1STBA 1TQOA 2F3VA 3D6CA 5HGTA 3S9WA 4DU9A 1STGA 3SHLA 1EYAA 3EJIA 2F0GA 3SK8A 4K6DA 1EYCA 3MXPA 5IGDA 3QOLA 1KDAA 3R3OA 4K14A 1SYDA 4NP5A 2OF1A 5I6WA 1EY6A 2F0QA 3E5SA 4DGZA 3C1EA 4KJNA 3SR1A 3NQTA 4K2LA 5KRUA 1SYBA 4J6HA 4B9XA 3U9OA 3D4DA 2PW7A 3EVQA 5E3FA 1STHA 5CV5A 4EQNA 5I9OA 1A3TA 2M00A 3TP8A 3P1HA 2QDBA 3MHBA 2EY1A 4K2KA 5IIFA 3VA5A 5C4HA 2F3WA 1SNQA 3P75A 3TP5A 4KJOA 1EZ6A 3OMGA 4RKBA 5IODA 1JORA 4F8MA 5J22A 2PZWA 4KV6A 2OEOA 3SK5A 2EY6A 2PZUA 3QOJA 1EY4A 4G57A 2F0DA 2F0NA 1A2TA 1SYEA 3H6MA 2F0EA 3SK4A 2F0SA 1F2ZA 3NK9A 2F0PA 2F0UA 2F0OA 4MIUA 1SNOA 3PMFA 4K5XA 1EY7A 5EKKA 2HQEA 5C5LA 4EQOA 5C3WA 5C4ZA 5HURA 3DHQA 4KD3A 2PW5A 4YIJA 3D8GA 1SNMA 2PQEA 5CC4A 4PNYA 5JAVA 5KIXA 2EYFA 5M9OA 3DMUA 2LKVA 4KHVA 5K5PA 1STNA 4DF7A 1SYCA 4J1MA 4R8NA 2F0KA 5CV6A 5E1FA 1F2YA 5ISRA 1SNPA 3D4WA 2KQ3A 3ITPA 1KABA 3NUCA 4HMIA 1STAA 2SNSA 4ZQ3A 5CV7A 5IGFA 5J1ZA 2F0VA 2F0HA 3T16A 2F0LA 5DEHA 1KDCA 1U9RA 1EZ8A 2EYJA 2EYOA 5DAUA 2SOBA 3SK6A 4KY6A 1A3VA 5IGCA 1EY9A 4KTAA 5EKLA 2O4XA 2RKSA 2EYPA 1EYDA 1A2UA 1ENAA 4IZ8A 1KAAA 1NSNS 4E6IA 3SXHA 2F0MA 4TRDA 4F7XA 4NKLA 1A3UA 3QB3A 3TP6A 4EVOA 4N9PA 1AEXA 1SNDA 1SYGA 1TR5A 2SNMA 4N9TA 4NMZA 4QMGA 5CV4A 4ZUJA 3HZXA 4H7BA 3OWFA 5KYLA 1ENCA 1EY8A 2F0JA 4PMCA 1TT2A
chains in the Genus database with same CATH superfamily
4C1NI 1VQ8A 1UE6A 1JMCA 3H3VI 2R7ZG 2NN6I 4LF9Q 3HOUH 4KY5A 1Q81C 4G7OC 1E24A 5A2QL 5EKIA 3J80E 4CDEC 3ULPA 4DR4Q 4WORA 2IPKD 3HOVB 4O2DA 2RSNA 3RLOA 4HAEA 3O13A 1G91A 1L1OA 3NP8A 5I9PA 5IGBA 5LMNW 2PPBC 1JB7A 1EU3A 2K33A 1A0IA 1E1OA 2DY8A 4ID6A 1RIPA 3G71A 3L3OC 2HT1A 2PZTA 2F0WA 3MXNB 3A56A 4C2MH 5IWAQ 5K36G 3HOXH 1C7YA 3A5ZB 4KY7A 4B3RQ 1KNEA 2YTVA 3T51B 3SE0A 1P16A 4CGYB 1ESRA 1VF7A 2XWJB 3K8AA 3P7JA 2ALYB 1XPOA 3I4MB 1Q12A 4P75A 3E0EA 4JI2L 2BDOA 4L8JA 2EJGC 5LMNL 3A8JE 4ME3A 3ULLA 1PZJD 2EY1A 3J7ZC 3GO5A 2TMPA 1NY4A 1FYCA 1HTPA 2F4VL 1CKMA 4X3UA 2QILA 3MXNA 1VQBA 3A7AB 4K0KL 3E9IA 1IBMQ 1RCVD 2KCNA 3Q8DA 2C35B 2JA8H 1PH8A 1VQHA 1WCMG 2KHIA 1FGBD 1D8LA 1LTSD 4A3GB 2H5XA 1SNMA 4R4IA 2G5DA 1SXTA 3K5LA 1QVCA 2UUAL 4DV6L 4F87A 4BBRB 4HMIA 3U4VA 5AJ3L 2EYOA 5C4XG 1PVOA 4WJ4A 1KNAA 1VCIA 3M7NA 1DYQA 2Y0SE 2B2WA 2JA5G 4TRDA 4EQ5A 4MN3A 3CPWA 4NW2A 1RTNA 1AEXA 4LF4L 2IW3A 1I6HB 4OHJA 1XPUA 3JAMc 4QUFA 1DCZA 2F03A 1HA6A 4X65Q 3J81j 1VQ7A 5ELOA 3M7GA 4LFAQ 1IBLQ 3PO2G 1ZKOA 2CW0C 1J8IA 5C3EG 2R7FA 1V1QA 2PNRC 4B3TL 4LJZC 4I7AA 1R9TB 1M8AA 5CR3A 5CYUA 3U58A 2L9HA 1QVFA 4B3SL 3LX0A 1RF2D 3OOCA 1JOKA 2WFWA 3EN2A 4GKKQ 3V2TA 2AKWB 3TZUA 3T13A 4KHZA 4K8IA 4Q0FA 5C0XJ 1KC8C 3KF6A 5C5MA 1JJ2A 4HJAA 1Q86C 3CW2C 2KBNA 3KF8A 3R93A 4AQYQ 3VYTA 2VL6A 1TWAH 1JOQA 3HS0C 3RR5A 3CD6A 3S9WA 5COYA 1CUKA 3PIP3 1M1KC 1SYDA 2L4NA 3RZOH 1EY6A 2IX3A 4KJNA 4LFCQ 1D7QA 3GTOH 3G4SA 5T1IA 4XQNA 1CQFA 1WYDA 1VMCA 3BDOA 4JYAQ 5IYDH 4QUCA 2VUMG 5C4HA 4A3IB 3W3AA 4DR3L 2EXDA 3R2IA 4QIWE 3D4RA 2LMCB 1S5ED 1SEBD 3A54A 2E5LL 4JBMA 1HZBA 4A3DG 1S4ZA 2F0UA 3PGZA 1FNVA 5C5LA 4KD3A 4DXFA 4A3FG 1YIJA 4C3JB 2D0PA 4DUYL 4A3EG 5K5PA 1D2BA 4DF7A 4DR2L 4XDXA 3EBEA 5M5XH 4KI0A 5I4DA 2F0VA 4LUVA 1I94L 4DR5L 1EZ8A 5IGCA 4JW0A 4DR1Q 4YY3L 2VW9A 4JOIA 5EKLA 2RVLA 2ID0A 1SFOH 3IRBA 3URYA 2CCZA 2KA7A 4MZ9A 4FXGC 1NMGA 4NMZA 1LTBD 2B2VA 1YJNA 3NTHA 1LYLA 4DK0A 1MI2A 2JK8A 1NR2A 3EROA 4WRDA 2MP1A 1D6EC 4B9WA 1MJCA 2JA7G 3Q0AA 1VQEA 3KLSA 1O7IA 4LW1A 1VQGA 4U68A 4FDBA 1SJED 2MGSA 3FEWX 4JI5L 3BZCA 2EYHA 3GQBA 4GN5A 4H0LC 1ESFA 4J15A 2EDGA 2QCPX 2JA6B 2WB1G 2BOSA 4FF1A 1PTOF 1ENFA 1WFQA 2PO4A 1X55A 4JPBW 3M4OB 3CU7A 5C4JB 1CT1D 2B2VC 2LSSA 3HKZE 4Y7NH 2NYZD 4A3JH 1N34Q 3C1FA 4LAAA 4RGNA 1FL0A 4DK6C 4YHHQ 2F3VA 1STGA 2VQFQ 3S2DH 4XTCS 5I6WA 4GNXB 3FPUB 1EOVA 3S1RB 1R4PB 3L7ZC 3HOUB 1Y1VG 1C4QA 4N8X1 2ZM6Q 3TRZA 4P72A 2BA0A 1SYBA 5EPLA 1SN8A 2ASBA 3OWEB 5E4XA 2B63H 3AFPA 2IHFA 2WKDA 5DM63 5IIFA 2FFKB 3HG9A 4OELB 3K57A 1SNQA 2JSOA 3I91A 3T1YQ 1IKMA 1KIXA 1BBWA 4A3KG 4NXNL 2R93G 3IFDA 1H9SB 3RD4A 3D31A 4H02A 3S1QH 1PFNA 2D5DA 3OW2A 3HOXB 1RDPD 2NB0A 1TWGB 3UE0A 1MHWC 2AUKA 5CC4A 1STNA 3G6EA 4R8NA 1HNZL 3I8ZA 3RNUA 2UU9Q 2GA4B 1SNPA 4A93H 1YHQA 2SEBD 1T9HA 3W2DA 4A3MH 5L37A 3PIPA 1G291 2A69D 3OYYA 1EY9A 4KTAA 1Q1EA 5EAYA 3ULJA 5M5YB 1WTQA 1A2UA 4IZ8A 1TWHH 2Z0SA 4OX9L 2CWAA 2MHVA 1NMFA 1H9KA 2Z6BA 4HIKA 4Q5VA 1SMYD 3BYTB 5CV4A 1G8ZD 2K52A 2QKIC 2A74C 4DA2A 5KNCA 4XYQA 1VQLA 2HDLA 1WD0A 4X6AH 1JOOA 4ZKBB 3BZKA 4L5QA 1MSGA 1EQVA 2Y0SB 1ILPA 5BR8L 1JCKB 2Z6KA 5JJLA 3KLWA 1I5FA 2AMCB 2RHSB 1PTOC 1DOMA 1N32Q 1BKBA 1HZCA 5FLXE 1ICFB 4A3BG 1F9PA 1SNCA 1BVSA 3NBIA 2ICIA 2XSCA 1LABA 4JC0A 1KRSA 2Q8RE 2UXBL 1NUCA 1FJGL 2TSSA 1B1ZA 1QJOA 4LNQA 2IX0A 4APVA 1ET6A 1WTPA 2EYMA 1Y8OB 1BCPF 4ULLA 1DJRD 2QF7A 3I4MH 1B9NA 1HZ9A 1S5CD 1TQOA 1M4VA 3EJIA 2FXQA 4HSVA 3R3OA 2FHTA 3DXJC 2VXWA 5IYDG 2VB2X 1YBYA 1HQRD 1ONLA 1MKHA 1XXGA 4DR7L 1D1IA 2LXJA 4DUZL 3VDYA 3GD7A 1YNND 3CCVA 5E3FA 3GV3A 4A3CH 5ELNA 4UP9A 3OTOQ 3PUVA 3UE1A 3VA5A 2RHQB 3U9SA 3CCEA 3KJOA 2R92B 1JORA 4FP5D 1BF4A 3NWSA 1I4GA 1BDOA 1TWCB 4K6LA 2F0EA 1K8MA 1BCPB 2F0SA 3G48A 3K6OA 5M3MB 3HOYH 5JPNC 4BBRH 1IBKQ 2DUDA 4DAYB 1HZAA 1TKWB 1LT6D 2IWHA 4NXMQ 3RZOB 2EVBA 2G9DA 4QIWB 4YCUA 4DR6L 3ITPA 2KQ3A 2SNSA 3VYUA 3L2PA 4LF5Q 1IW7C 1RJTA 4IJHA 4RA8A 1CTMA 1YNXA 1I6HH 4R4QA 4R4OA 4AH6A 1JWMD 3CRLC 1E1TA 4FF2A 4C3IG 1I4QA 3I56A 4GZYC 2JJQA 1X3PA 3AYHB 1XMQL 4AIMA 3TREA 4X64Q 4QF4A 1R9TH 4YWMA 2HD3A 2B2TC 2VQEQ 3CCRA 4AYBG 4DN4M 3K80C 1Z9FA 1TY0A 4DV0Q 4HJ8A 3BDCA 5D3DA 1P8LA 3FHWA 4LF9L 3CCLA 2EPBA 3OIQA 3JAMi 5M5XB 4DR4L 2K50A 1XNQQ 3TS0A 4HSPA 1SE2A 2F3IA 2MJ8A 1SFOB 1YNJC 4C1NK 2WACA 3K7AH 3KBXA 4IQZA 2ZJPA 3H0GB 5CBAE 3GDEA 4CDDC 4DV7L 4QB4A 4HJ7A 3CCUA 2XRSD 1GD7A 1DONA 3GTKH 1IL8A 4HJ9A 5F2DA 4HTHA 1EQQA 3NBHA 4RH6A 2JEBI 1QILA 1KAWA 3EFXD 5CGKA 5J39A 1N36L 1TWFH 1EYAA 3N6RA 4KKSA 3KJPA 4B3RL 2OF1A 1E0BA 2XVSA 2WAQB 1WI5A 3S1NH 4POFA 3CCSA 3J81i 3HKZB 3NEMA 1JWSD 1J9OA 4UP8A 5CV5A 3UI2A 3Q24A 2XRQD 3LNNA 1E7ZA 5BN4A 2KENA 3GP7A 3HRZC 3IFTA 5IODA 4JBKA 1L0YB 4ABNA 1HCZA 3S1MB 4IFDG 5D14A 1TS3A 1KL9A 4C3JH 1K83B 2G9HD 4Y7NB 4A3JB 2K01A 2NZOA 1E22A 1H9MA 2FJ2A 2F0PA 1G51A 1EFID 1YJWA 5FO8B 2A68D 2JP1A 2B3GA 1VQFA 2OTLA 2EYFA 3HGBA 1V1PB 4BBSB 1NBWA 1Y1WG 5ISRA 2L5TA 1KXLA 4LF7L 5IYCH 2F0LA 2EYJA 3SK6A 2B63B 3MFYA 2N49A 4BWGB 2MUYA 4X66Q 4XT1B 2JXMB 3HOVG 1MGSA 1SNDA 1LTLA 4PMWA 3CXCA 3HZXA 1GHKA 2GVBA 3F2UA 2I5MX 4DV1Q 4FF3A 4PZ6A 3D3RA 2XTIA 4JVZA 1JB3A 1XNRQ 4X65L 1O80A 4DAMA 4LFAL 1IBLL 1B9MA 5C0XI 3MTSA 2RF4A 4IJLA 4YCWA 2MNAA 2UUCQ 3TP7A 4MHEA 1PHJA 3M4OH 4OXPA 1I6VC 2KCMA 1F9RA 4GKKL 3I4MG 1HNWQ 1TWHB 3PF5A 1ILQA 3HOZB 2E75C 4FYDA 5JOBA 2A73B 4I65A 4BY7G 3S1RH 1OXTA 3MXUA 3KOJA 1K8AC 2QEJC 3I4NB 4AQYL 4UHVA 4A3CG 4JI6Q 4K6DA 2EJFC 2KHJA 4RCNA 4CJ1B 1MD2D 3CRKC 2L15A 1FNWA 5JEAG 4RHSA 2IX1A 1K8GA 3S24A 4B9XA 4LFCL 4EQNA 2M00A 4A3GG 1QNUA 1RODA 4L6TB 4UY8C 2A69C 5IY0A 1EZ6A 4RKBA 4BBRG 3TN2A 1TWGH 1CZGA 1K73C 3A0JA 3SK5A 4FVMA 2F0DA 3AU7A 2O2LD 1SMYC 1N33Q 3SK4A 4OO1I 3PIO3 1U5KA 3STBC 4K5XA 1A8VA 1U4PA 4ZYSA 1E2WA 2KUMA 4ALPA 4P2CB 3D8GA 2LFNA 2YV5A 2YTYA 4KHVA 4DV5L 1Z6HA 5M5YH 1EQTA 5TSSA 3LWUA 5C0XG 1PH9A 2LY7A 2WV6D 3J7AF 1I4XA 2F0HA 3T16A 4DAPA 4GLVB 5DAUA 2CHBD 1WTOA 2BDNA 2SOBA 1C48A 2E2JB 2IJ0A 2E8GA 3MAQA 4BXXH 1VDZA 1KAAA 1NSNS 1B44D 4DR1L 3AMUA 3MC0B 4C3HG 1OTCA 1SYGA 1KD1C 2BE5C 3HOWG 2R7ZB 2IT1A 1KQSA 3NE5B 3NQIA 3ND9A 3F2CA 2AWOA 3HOYB 2EY5A 2KEDA 2NN6G 1RKNA 2YTXA 1II3A 4JG2A 1OXUA 3S16H 2K03A 4LWCA 1XMOL 3M9BA 2B8FA 3GTMB 2EY2A 3HEJA 1FGUA 2MFIA 1CA6A 3X3MA 3PF4A 3J7AV 1PRTC 4K5VA 1EWHA 4B08A 2K4KA 1YNNC 1EIFA 4A3LH 3PUYA 2PQAB 3KF6B 4BY1G 1EU4A 2AQ3B 3MXGA 3MVVA 3KF8B 1W6JA 2A5HA 1CSQA 3QO2A 1PZKD 1QUQA 4X62L 4A3IG 1A15A 3K7UC 3RMHA 1NJIC 4DU9A 1IL2A 3PO3H 1EYCA 4OO1G 2DGYA 3TEHB 2VQFL 3NQTA 1AFPA 4RWSC 5FK9C 3OPOA 2PW7A 3V96A 2R92H 2ZM6L 4DV2L 2PQAA 2DNEA 3DM1A 4JI8Q 1EIGA 2K75A 1TWCH 4KJOA 5C44B 3TQYA 5M3MH 3K7AB 3RZDH 3I4LA 1CZWA 2PZWA 2JA9A 1WCMB 1K0SA 1SAPA 3VR5A 2F52A 3GTKB 1YHAA 2F0OA 3FPPA 3V05A 1TWFB 3VR2A 1YHBA 5M9OA 5ELEA 3DWAA 5IP9G 1PMRA 1EWIA 5CV6A 3S1NB 2RDHA 4DAVA 1LTID 4R9WA 2HDMA 4JCVE 3ERSX 4XT3B 4JI3Q 4KY6A 2B2YC 5FJ8H 1EYDA 1I3QB 4IUUA 5EQ0A 4G7HC 1VS0A 4JI7Q 3QIAA 2I46A 1CKOA 1OXVA 3D0FA 3CQZH 3M4YA 3CC7A 1PDQA 4F88A 1A6XA 4EVOA 3J80L 5IYBH 3L9AX 1EY8A 2PMZB 1O7LA 1WTHA 3FDTA 2JA6G 1BCPD 2UUBQ 1DOLA 3PUWA 3L0OA 5GAEC 4OEMB 1BR9A 3H91A 3KK7A 3HP3A 5FLMH 1VF5C 1PH4A 4LF6Q 3PIOA 3NENA 5CV9A 2I5LX 1KHIA 3H0GH 5LMNQ 1VQ4A 3T1HL 3HOUG 4M1UB 2XIWA 4HJ5A 4JV5Q 5KYIA 4GLAC 3LGJA 1QZHA 3H3VC 1U0LA 1EQRA 3E0JA 2Q2HA 4IOAA 4PV1C 1Q8IA 1K9MC 2K5HA 1IYJB 2ZT9C 3K5OA 3I2ZA 5HGTA 1SSOA 1UE7A 4KN4C 1Y69U 4DKAC 3T4AC 1E2VA 4LFBQ 2A6ED 2BCOA 1EEFD 1PXUA 3DWQA 2UUAQ 3K5MA 3CC4A 2K7VA 3HOXG 3D4DA 1HFNA 5AJ3Q 3S1MH 1EOTA 5EBDA 1O7YA 2WAQE 1SE3A 4GOPC 3PV0A 3P75A 1K83H 3TP5A 3OTOL 3S17H 3TBIB 1TIID 5J22A 1QZGA 4KV6A 2K1BA 3A8KE 4KKUA 3J7A5 1CI3M 4OIJA 4LF4Q 4L5TA 1KRTA 1F2ZA 4A3FB 4BBSH 4QJFA 3A5UA 1MIUA 1SNOA 1H9JA 2HQEA 2CH4W 4N8FA 2AUJD 4R4CA 4PNYA 5CORA 1JWUD 1IBKL 1SYCA 4KMUC 2JA8G 3F1ZA 2RCNA 4NXML 1PFSA 2N55A 1PTOB 2Q2TA 4OONA 2Y0SG 4LF5L 1LT4D 4B3ML 2EYPA 4FO2A 1BBUA 1V43A 5ELCA 3GTPH 3SXHA 2QEXA 1B3AA 1QG7A 1PLFA 1E2ZA 4N9TA 3FKIB 2JA7B 5LL6X 1B7YB 2RDGA 2E2DC 4QCLA 1CKNA 3K5NA 1KLUD 5JPMC 4LF8Q 1MJEA 3WDNA 4TVAB 3SVMA 2M9VA 2VQEL 3CCQA 2K04A 3OMCA 3RLNA 4HCEA 2A8VA 5EGTA 1KTKA 2WB1B 4ME5A 4S3SA 5GAHC 2L0CA 1XX8A 1S40A 5IGEA 2EIFA 2HIVA 1K0RA 3HOZH 1G2SA 1R4QB 2EQSA 1XNQL 3T53B 5C3XA 1ML0D 3I4NH 1Q7YC 1GUWA 3JAME 1G6PA 2C5CA 1LTRD 2OXPA 2WP8J 4KD4A 1EY5A 4JK1C 1TS2A 2N8NA 5AFWA 2Z8LA 1Y1VB 4JI4Q 4IURA 3SHLA 2UXCQ 1SJHD 1UNSA 2F0GA 3PUZA 2R92G 1HRJA 1L0WA 1KDAA 2X6LA 4NP5A 3S16B 1D1KA 5FO7B 3E5SA 3C1EA 4DUYQ 3A7LA 2NZ1D 2HHHQ 1AE2A 5H1SE 1A3TA 3MEFA 2HCCA 4DR5Q 1O7ZA 1LTAD 4A3KB 1CHPD 2AQ1B 2R93B 1Y14B 4KHPQ 4OWTB 3OMGA 3J81E 1AZPA 1EIYB 2YU9B 4GN4B 5HY6A 3I70A 3X3NA 2OEOA 1Y8PB 3OIPA 2PZUA 3TDQA 3DLLA 3EIVA 4GKJQ 3ND8A 3PMFA 5M3FH 1IZ6A 2J4XA 3CHBD 4YIJA 5ELDA 1PH5A 3PO3B 4O0AA 5FJ8G 1DGSA 3CCMA 2E2JH 1S5DD 2KECA 2YYZA 1STAA 3J80c 1X56A 4M8AA 4O1NA 4RG1A 1EUJA 3BS1A 2ZJRA 1NR4A 2ZXOA 1ENAA 2R7ZH 2D62A 1ASYA 2NVQB 4NKLA 3UDFA 1S5BD 3QB3A 3RZDB 1XTDA 4X66L 2BH8A 4CDFC 4U673 2Z4HA 5HURA 1WTXA 4P74A 2B2TA 3GTMH 4DXGA 1CQVA 2GN5A 3MZ5A 2CH4A 2DY7A 2PYKA 4HN7A 1XNRL 5D3IB 4FXDA 4DPGA 4YWKA 3BDLA 5E4WC 3CMEA 4HIDA 2CW0D 4XYOA 2QW7A 3OSOA 1K3BC 2EXZA 4A3BB 1G2TA 2F0TA 3ONAB 4K5WA 5LMUQ 1KLGD 3NHHA 4DV4Q 2UUCL 5GAGC 3C2PA 3M4QA 3K0YA 1L2FA 4JBJA 3GTJB 2OQ0A 1VQOA 2NVXB 5JJKA 4RAUC 5A2QE 3HKZG 3CQZB 2QDLA 1HNWL 1J5EQ 1Y8NB 1AP0A 5KGUA 2KCCA 3TSSA 2KCTA 1RL2A 3NBHB 3H15A 4DV3Q 2K6AA 3OW7A 3I55A 3R8BA 3H09A 4Y52H 4KLKA 2EZVA 4CJ2C 1SBBB 4LMQD 4A3JG 3S14B 1CHQD 1K3RA 1HR0Q 4PZ7A 3PSIA 5C44H 1XPRA 1CFMA 2N3SA 1D5XC 2QDBA 3P1HA 1WCMH 2K5WA 1X65A 2UXDQ 2F3WA 2Z4IA 1QWYA 1PH3A 3F2BA 4TKOB 3H94A 3I90A 1JJGA 2OT2A 5FKAC 5IWAL 1EY4A 1EWCA 3HFZB 2B63G 5G3LF 3UDIA 4PZ8A 2GVAA 4MIUA 5C4XH 5EKKA 1N33L 3CP0A 1GVPA 2PW5A 4GN3B 3DMUA 2JA5H 2Q2IA 1WVLA 3IKJA 1F2YA 2B2UC 5DNFA 1I3QH 1TU2B 1X9NA 1NAPA 2N88A 3GTGH 4RHRA 4I7ZC 1KDCA 1U9RA 1PYBA 4C3IB 1VQNA 3PO2H 3TZDA 4IUTA 1YZ6A 1IBML 1X3EA 2B29A 4X3TA 4F7XA 1WTVA 3S17B 1F2LA 3S15H 4A93G 1VQ5A 4RGMA 1W3SA 1QCBD 1OXXK 3UDXA 4A3MG 4HIOA 4PQXA 4PMCA 5FLXL 5I6YA 1I50B 2P5ZX 5GADC 4H44C 4EQPA 4KKTA 3RUZA 4QQBX 2CVRA 3MEHA 1DZ1A 4HMJA 1C8CA 2PNHA 5JJIA 2PMZE 2XGTA 2BA1A 2FMCA 4EGVA 1X6OA 4DR7Q 1X32A 2EJMA 1F9QA 5IE8A 1STYA 3CMAA 1YEZA 4UAIA 5KNDA 4J8QA 2CQOA 2F0FA 1UE1A 4IOCA 2DJGC 1CK1A 1LO5D 2A1AA 1TS5A 4QY7A 1EEID 3GTPB 3ZYYX 1WTWA 1Q1BA 1BXTA 4O42A 5KEEA 4OWWB 1HNXQ 1GUNA 2E2HH 1HH2P 2XNAC 1LTGD 3ZJYC 3VYRA 1STBA 2M2LA 1VQAA 2J0TD 1GO3E 1EIHA 2VUMH 1I4PA 2XWBB 4RGOS 2X6GA 4DGZA 2PCFB 1IYUA 1OXSC 2ES2A 4K2LA 1WJJA 4IPCA 4J6HA 1DXMA 1PRTF 4CKCA 3K58A 1STHA 4RMFA 4ZLTF 1HUNA 2K05A 2SDFA 2A6HD 4IPHA 1S5FD 4JI8L 4A3FH 1UUPA 3C3LA 1X3FA 4A3EH 5M5WH 1Q8KA 1EL0A 1UAPA 1N9WA 3U50C 2K5VA 4UP7A 1PH7A 3WOEA 4LUZA 1Y1WB 1HHVA 1B2TA 5JAVA 1PTOH 1YITA 1UEAB 2O5IC 4IFDJ 1ET9A 2QGQA 2FINB 5FOBB 4XQQA 2Z9HA 1TXYA 5J1ZA 2HUGA 2HCIA 3HOYG 1PRTB 5DEHA 4JYAL 4G4KA 3FKIH 2JA7H 1SDFA 5FO9B 4JI3L 1ZXTA 1I4RA 3T56B 5IT9E 2E74C 3M4PA 1Q90A 4JI7L 4EX5A 1TR5A 3LWEA 4DV7Q 1MSHA 1TT2A 1VQ6A 3SDZA 2AWNA 4GS3A 1GKHA 3RN5A 4IUNA 1N36Q 1U4LA 2RA4A 5M3FB 1BUVT 2X69A 1NE3A 4BA1I 1TVXA 4L5SA 2UUBL 1RHPA 2R61A 2K32A 2NTTA 2NTSA 3W5OA 1PTOD 4LF6L 2MPMA 2RDFA 3KFUA 1UWVA 2IL8A 1IYVA 4X3SA 1V9PA 3Q23A 2WB1E 1QNKA 1XWEA 3RLFA 4BY7B 1L1OC 2JE6I 4KK7A 5C6AA 2VNUD 4JV5L 1Y1VH 3VA7A 1QOHA 1QUQB 1BQQT 2L12A 2Q8IB 1EY0A 1NTGA 5EPKA 1B50A 1VQPA 2H4OA 5C44G 3SK8A 5ELFA 5IGDA 1I4HA 2JN4A 3GTQH 4JI0Q 1B70B 4FNFA 4HR7B 1VQ9A 5ELBA 3QJYA 4HIMA 2E76C 3W1GA 4LFBL 4A3KH 2R93H 4V190 3PCOB 3Q6SA 1AE3A 2YU9H 5I9OA 3HKSA 4LF7Q 1X3GA 1BBXC 3GTLH 1ZYRD 1HFGA 3Q22A 1CSPA 5JVH3 1GJXA 1FNUA 1ICWA 5JEAJ 3AEVA 1H9RA 1N34L 4IPDA 4YWLA 4JI1Q 3TS2A 1G6ZA 3H6MA 1V8QA 1JT8A 4YHHL 3NK9A 1JE4A 3CAMA 3UDGA 1M90C 3M3YB 2Q8TA 1K8OA 2PQEA 2L1BA 1O78A 2L11A 1Z7TA 4OGQC 1KABA 4C3JG 4HEDA 5IGFA 2B2YA 2NVQH 5IP7H 1IW7D 2B39A 3BYYB 1F77A 1CM9A 2O4XA 4C3HB 2RKSA 2XN9C 5FLXc 3T1YL 1SR3A 3HOWB 2F0MA 3CC2A 3CPFA 2IY5B 1VQJA 3TP6A 2MO1A 3I72A 2B2WC 4QL5A 5EBCA 1W6KA 1PFBA 5IYCG 1T5EA 3J80i 3NTIA 1Q3LA 5J3BA 5CBEE 4WJ3M 5I2XA 1UE5A 4ZUIA 3J81c 1HQMC 1FR3A 4A3BH 5C4XB 3NELA 2K5DA 5JVG3 4LF8L 2UU9L 4BS9A 2JA5B 3GTJH 2NVYB 4R4TA 2NVXH 1LUZA 3BVZA 3A55A 2NVTB 2KHSA 3GTGB 4BY1B 1B3QA 1HTLD 4HCSA 3TMEA 1V1OA 1JE5A 3PO2B 3FVQA 4NDXA 4GOPB 5LL6S 3E9HA 1YNJD 4OL7A 4TQUS 3AB9A 4A4IA 1PH2A 3S15B 5C3EB 1LM0A 2NZHA 1F2MA 3U4ZA 4KN7C 1WTRA 1AZQA 3DM3A 3N52A 3D6CA 3S14H 2ZXPA 1A63A 4JI2Q 3QOLA 4K14A 1B53A 2PI2A 4JI4L 2UXCL 4UDUC 1IXRA 1XTCD 1DM0B 2IHEA 1D5ZC 1JJCB 4DV5Q 2CQAA 5BN3A 1N32L 3U9OA 1VQKA 5IT9L 2F4VQ 3WOFA 4GOPA 3TP8A 3E6ZX 2HHHL 4BA2I 1BOSA 4K0KQ 1RTOA 1GM5A 2RCFA 2CFMA 4P73A 1AW7A 2F1MA 1T5XD 4ILWA 4KHPL 3E3XA 3QOJA 4G57A 2F0NA 2E2HB 2N78A 3PUXA 1C9OA 4C56C 2A68C 5GROA 2NBFA 4GKJL 3I7FA 4POGA 2WINB 2VUMB 4DV6Q 1XMOQ 1Q82C 2E2IB 3FKIG 4C3IH 2F0KA 5DLQE 1H95A 2HQLA 4ZQ3A 3NUCA 4P71A 1LT5D 2JYOA 4LK1C 1JR0D 1PYWD 3S2HB 4GLXA 2ZTCA 3M85A 2JQOA 3ER0A 4A3DB 1EYGA 2OWOA 3MA2B 2ICEC 4JOIC 4NB3A 4UPAA 1I50H 1X54A 2HIXA 1HXYD 4A3EB 5M5WB 3QR8A 3OWFA 3B6YA 1HUMA 2A19A 1CKNB 4X62Q 2WKCA 4BXXG 3QWNA 1PV4A 1KDBA 1SE8A 3ERQA 2Q2UA 4B3TQ 4IALA 4B3SQ 4AYBE 1YI2A 3R2TA 1WD1A 3RN2A 4L5RC 3EQLC 1K28A 1S3OA 4DV2Q 4OIKA 1WOCA 5LMUL 2BH2A 4DV4L 1XJVA 2EE1A 4R1JA 1HR0W 2K5QA 2A6HC 1UEBA 4A75A 1SROA 3FMCA 4RFBA 2ZJQA 3VR4A 4RKLA 1JC7A 4X64L 1IHZA 1FD7D 1J5EL 3DWPA 2OQKA 1FVIA 4A3LG 5G3LD 3I3CA 3MXPA 4DV0L 4DV3L 1PYSB 3W1BA 4GNXA 4C2MB 5D65A 4IFDH 1GUGA 4FXKC 2VS1A 1HR0L 4WJWA 4DR3Q 3PO3G 1PH6A 2UXDL 4DK1A 3BG3A 2DNCA 2ZXRA 2D9UA 5I2YA 3EA6A 2E5LQ 1JQYD 3BVMA 3KBGA 1IKLA 2AQ2B 1H9SA 1Y1WH 2OTJA 1A2TA 1SYEA 3AFQA 1OO9B 1EY7A 5C4ZA 3STBD 2JA8B 5IP7G 2ZTEA 4GNXC 4YCVA 4CDCC 4MTKA 2C9OA 4Z9CB 4DR2Q 1EFWA 5KIXA 5M3MG 3GTQB 4ZCKA 4J1MA 5E1FA 3HOVH 1XYIA 1I94Q 5E7NA 1AN8A 1LTTD 3QG1A 5DM73 4YY3Q 1E3PA 1LV9A 1SMXA 1A3VA 3GTLB 2Z1CA 3T1HQ 1NNXA 4DK3C 3BZDB 4DNIA 1B4OA 3DUZA 4CJ0B 4N9PA 4IO9A 1PFMA 4QMGA 1QE6A 2F0JA 3FRPB 3IAYA 2BE5D 4DNRB 2D2CC 2KJXA 1PH1A 2O5JC 3KYHC 1W2BA 4JI5Q 4LUOA 3SGIA 4IUPA 4PMBA 3G7LA 4PG3A 1SYFA 5IYBG 1YVCA 3P20A 4BY7H 2Z6KC 1PRTD 4ZRZA 2EYLA 4CKEA 1U4MA 1ZYRC 5IGGA 5FLMG 5JEAH 5JJZA 3DEOA 4DV1L 1HNXL 2WIIB 3H0GG 4ODGA 4JBWA 1JICA 1D5MC 3MWYW 2KEEA 5IT9c 4XIGS 3VR6A 4MTNA 3GV6A 4A3GH 1GOZA 3VYSA 2VZAA 2F0QA 2R3ZA 3MFGA 1TWAB 5K36H 1U4RA 4V0BA 4MNOA 4ZAIA 3SR1A 1SLJA 2RQXA 3CF5A 1GXDC 3EVQA 2WAQG 2J7ZA 4ZKCB 1LT3D 1J6QA 3WWVA 3MHBA 1LACA 1ZEQX 5A35A 3GTOB 1Z47A 4B3MQ 4NXNQ 2B8GA 1QB5D 1VMPA 4F8MA 3M3YH 3KDFB 1DD2A 2I07B 4IUVA 2OCEA 4IFDI 4CBVA 4OWXB 5C0XH 2V1CC 2KOLA 5HGQA 2AHOB 2RSOA 4JI6L 3BJUA 1A62A 2K14A 5KRUA 4DAYA 1SRUA 1HNZQ 4L63B 2B2UA 4CKBA 1AH9A 4XQJA 4IUQA 2MO0A 2LKVA 1GUSA 2JEAI 4RGTA 1DOKA 1F9SA 2CKZB 5GQOA 4C3HH 1GUOA 3PQIA 2DN8A 3BVGA 3JC66 3HOWH 4BBSG 3NTKA 1VQMA 4OX9Q 2QA4A 1ASZA 1X3QA 2V4DA 3H3VH 1HA5A 3SEBA 2NN6H 2FMMA 3KDFA 4E6IA 1NCVA 5EPJA 3F2DA 2L55A 1VQIA 4QGUA 1VQDA 1A3UA 5CMDA 2MQHA 2R6GA 3D6WA 3C46A 4TSSA 3OHXC 4H7BA 1HPCA 5KYLA 1ENCA 1BCPC 4CHTB 2NWGA 4DFAA 5T1GA 2EOTA 5CV8A 4G7ZC 2LXKA 5BR8Q 1CA5A 1RD9D 2NVYH 3I73A 1C0AA 3A8IE 3VR3A 3ICEA 2NVTH 2D0OA 4IPGA 4BY1H 3NPPA 3CCJA 1HJPA 3JAML 3IL8A 2F0IA 3CKIB 2K5NA 2ZTDA 2KVMA 5NUCA 4A3IH 2UXBQ 3K0XA 5C3EH 3NXWA 4K8JA 2VY3A 1FJGQ 1STEA 2PI2E 4OO1H 4AYBB 4NPSA 1PZID 1MBYA 1GUTA 3AQQA 3KUPA 4ZK9B 2NUCA 2ENBA 1Q46A 1PA6A 5IOCA 5BN5A 3HOZG 2RBMA 3NWTA 2I5HA 2A6EC 1LLRD 5KNBA 4DUZQ 3I4NG 3J81L 4X3KA 4H13C 3F8TA 4JI0L 1L0XB 3S2DB 3NSWA 4XXEA 1B8AA 1QVGA 4K2KA 4FF4A 2R7DA 1VQCA 1GHJA 2I0QA 2CWPA 3K59A 1S72A 4IN3A 5IP9H 2ATWA 2EY6A 1N8RC 4A76A 4RCOA 4JI1L 2E2IH 4EQOA 5C3WA 1SE4A 3DHQA 1BO0A 2DJFC 3FP9A 5EJWA 4DR6Q 3S1QB 3S2HH 4R8IA 2K28A 1V1PA 3DEPA 3KLRA 4A3DH 3D4WA 3I4OA 2H1EA 5CV7A 2LS01 2F4IA 2JA6H 3A74A 5M3FG 1TY2A 5LHY1 4A93B 3G6JB 1BNZA 3KLSX 4A3MB 5C4JH 1YJ9A 1XMQQ 3K81C 1L1OB 1TS4A 2SNMA 3BU2A 4ZUJA 2VB3X 3J7YW 4DNTB 4WFN3
chains in the Genus database with same CATH topology
4C1NI 2NN6I 4KY5A 4G7OC 5A2QL 5EKIA 3J80E 4WORA 2IPKD 3HOVB 2RSNA 4HAEA 3O13A 1G91A 3NP8A 5I9PA 5IGBA 2PPBC 1EU3A 2K33A 2DY8A 4ID6A 3L3OC 2PZTA 2F0WA 3A56A 5K36G 4KY7A 1KNEA 3T51B 3SE0A 4CGYB 1ESRA 1VF7A 2XWJB 3P7JA 3I4MB 1Q12A 2BDOA 4L8JA 2EJGC 3A8JE 1PZJD 2EY1A 3GO5A 2TMPA 1FYCA 1HTPA 4X3UA 2QILA 3MXNA 3A7AB 1RCVD 2KCNA 1FGBD 1LTSD 4A3GB 1SNMA 1SXTA 3K5LA 4F87A 4BBRB 4HMIA 2EYOA 1KNAA 1VCIA 3M7NA 1DYQA 2B2WA 4TRDA 4MN3A 4NW2A 1RTNA 1AEXA 2IW3A 1I6HB 4OHJA 2F03A 4QUFA 1DCZA 1HA6A 3M7GA 1ZKOA 2CW0C 1J8IA 2PNRC 4LJZC 1R9TB 1M8AA 5CR3A 5CYUA 2L9HA 3LX0A 1RF2D 3OOCA 1JOKA 3V2TA 3TZUA 3T13A 4KHZA 4K8IA 4Q0FA 5C0XJ 5C5MA 3KF8A 3R93A 3VYTA 1JOQA 3HS0C 3S9WA 5COYA 3PIP3 1SYDA 2L4NA 1EY6A 2IX3A 4KJNA 5T1IA 4XQNA 1CQFA 1VMCA 3BDOA 4QUCA 5C4HA 4A3IB 3W3AA 3R2IA 3D4RA 2LMCB 1S5ED 1SEBD 3A54A 1S4ZA 2F0UA 1FNVA 5C5LA 4KD3A 4DXFA 4C3JB 5K5PA 1D2BA 4DF7A 4XDXA 4KI0A 5I4DA 2F0VA 1EZ8A 5IGCA 5EKLA 2RVLA 2ID0A 3URYA 2KA7A 4FXGC 4NMZA 1LTBD 2B2VA 3NTHA 4DK0A 1MI2A 1NR2A 3EROA 4WRDA 2MP1A 1D6EC 4B9WA 3Q0AA 3KLSA 4U68A 1SJED 2MGSA 3FEWX 2EYHA 3GQBA 4H0LC 1ESFA 2EDGA 2QCPX 2JA6B 2BOSA 4FF1A 1PTOF 1ENFA 2PO4A 3M4OB 3CU7A 5C4JB 1CT1D 2B2VC 2NYZD 3C1FA 4LAAA 4RGNA 2F3VA 1STGA 4XTCS 5I6WA 3FPUB 3S1RB 1R4PB 3L7ZC 3HOUB 1C4QA 2BA0A 1SYBA 5EPLA 3OWEB 5E4XA 2WKDA 5DM63 5IIFA 2FFKB 3HG9A 3K57A 1SNQA 2JSOA 3I91A 1IKMA 3IFDA 1H9SB 3RD4A 3D31A 1PFNA 2D5DA 3HOXB 1RDPD 2NB0A 1TWGB 2AUKA 5CC4A 1STNA 4R8NA 3I8ZA 2GA4B 1SNPA 2SEBD 3W2DA 1G291 2A69D 1EY9A 4KTAA 1Q1EA 5M5YB 1WTQA 1A2UA 4IZ8A 2MHVA 1H9KA 4Q5VA 1SMYD 3BYTB 5CV4A 1G8ZD 2QKIC 2A74C 4DA2A 5KNCA 4XYQA 2HDLA 1WD0A 1JOOA 4ZKBB 1MSGA 1EQVA 2Y0SB 1ILPA 1JCKB 1PTOC 1DOMA 5FLXE 1F9PA 1SNCA 3NBIA 2ICIA 2XSCA 1LABA 2Q8RE 1NUCA 2TSSA 1B1ZA 1QJOA 2IX0A 1ET6A 1WTPA 2EYMA 1Y8OB 1BCPF 4ULLA 1DJRD 2QF7A 1B9NA 1TQOA 1S5CD 1M4VA 3EJIA 4HSVA 3R3OA 2FHTA 3DXJC 2VXWA 2VB2X 1HQRD 1ONLA 1XXGA 1D1IA 3GD7A 1YNND 5E3FA 3GV3A 3PUVA 3VA5A 3U9SA 2R92B 1JORA 4FP5D 1BF4A 3NWSA 1I4GA 1BDOA 1TWCB 4K6LA 2F0EA 1K8MA 1BCPB 2F0SA 3K6OA 5M3MB 5JPNC 1TKWB 1LT6D 2IWHA 3RZOB 2EVBA 2G9DA 4QIWB 3ITPA 2KQ3A 2SNSA 3VYUA 1IW7C 1RJTA 4RA8A 1CTMA 1JWMD 3CRLC 4FF2A 4C3IG 1I4QA 4GZYC 1X3PA 4QF4A 2B2TC 4DN4M 1TY0A 3BDCA 5D3DA 2EPBA 3OIQA 5M5XB 4HSPA 1SE2A 2MJ8A 1SFOB 1YNJC 4C1NK 2WACA 4IQZA 3KBXA 3H0GB 5CBAE 4QB4A 2XRSD 1DONA 1IL8A 5F2DA 4HTHA 3NBHA 4RH6A 2JEBI 1QILA 3EFXD 5CGKA 5J39A 1EYAA 3N6RA 4KKSA 2OF1A 1E0BA 2XVSA 2WAQB 3HKZB 1JWSD 1J9OA 5CV5A 3UI2A 3Q24A 2XRQD 3LNNA 5BN4A 3GP7A 3HRZC 3IFTA 5IODA 1L0YB 4ABNA 1HCZA 3S1MB 4IFDG 5D14A 1TS3A 4Y7NB 1K83B 2G9HD 4A3JB 2K01A 1H9MA 2FJ2A 2F0PA 1EFID 5FO8B 2A68D 2JP1A 2EYFA 3HGBA 1V1PB 4BBSB 5ISRA 2L5TA 2F0LA 2EYJA 3SK6A 2B63B 3MFYA 4BWGB 2MUYA 4XT1B 2JXMB 1MGSA 1SNDA 4PMWA 3HZXA 1GHKA 3F2UA 4FF3A 3D3RA 1JB3A 1O80A 1B9MA 5C0XI 3MTSA 3TP7A 4MHEA 1I6VC 1F9RA 1TWHB 1ILQA 3HOZB 2E75C 4FYDA 5JOBA 2A73B 4I65A 1OXTA 3MXUA 2QEJC 3I4NB 4K6DA 2EJFC 4RCNA 4CJ1B 1MD2D 3CRKC 1FNWA 5JEAG 4RHSA 2IX1A 4B9XA 4EQNA 2M00A 1QNUA 1RODA 4L6TB 2A69C 1EZ6A 4RKBA 3TN2A 1CZGA 3SK5A 4FVMA 2F0DA 3AU7A 2O2LD 1SMYC 3SK4A 4OO1I 3PIO3 4K5XA 1U4PA 4ZYSA 1E2WA 2KUMA 4P2CB 3D8GA 2LFNA 4KHVA 1Z6HA 1EQTA 5TSSA 3LWUA 5C0XG 2LY7A 2WV6D 3J7AF 1I4XA 2F0HA 3T16A 4DAPA 5DAUA 2CHBD 1WTOA 2BDNA 2SOBA 1C48A 2E2JB 2IJ0A 3MAQA 1VDZA 1KAAA 1NSNS 1B44D 3AMUA 3MC0B 4C3HG 1SYGA 2BE5C 2R7ZB 2IT1A 3NE5B 3NQIA 3ND9A 2AWOA 3HOYB 2EY5A 2KEDA 2NN6G 1RKNA 1II3A 1OXUA 2K03A 2B8FA 3GTMB 2EY2A 3HEJA 1CA6A 3X3MA 3J7AV 1PRTC 4K5VA 1EWHA 4B08A 1YNNC 3PUYA 1EU4A 2AQ3B 3MXGA 3MVVA 1W6JA 2A5HA 3QO2A 1PZKD 1A15A 3RMHA 4DU9A 1EYCA 4OO1G 3NQTA 1AFPA 4RWSC 5FK9C 3OPOA 2PW7A 3V96A 2DNEA 3DM1A 1EIGA 4KJOA 5C44B 3K7AB 3I4LA 1CZWA 2PZWA 1WCMB 1SAPA 3VR5A 3GTKB 2F0OA 3FPPA 3V05A 1TWFB 3VR2A 5M9OA 5ELEA 3DWAA 1PMRA 5CV6A 3S1NB 2RDHA 4DAVA 1LTID 4R9WA 2HDMA 4XT3B 4KY6A 2B2YC 1EYDA 1I3QB 4IUUA 5EQ0A 4G7HC 3QIAA 2I46A 1OXVA 3M4YA 1PDQA 4F88A 1A6XA 4EVOA 3J80L 1EY8A 2PMZB 3FDTA 1O7LA 3L9AX 1BCPD 1DOLA 3PUWA 1BR9A 3H91A 3KK7A 3HP3A 1VF5C 5CV9A 4M1UB 2XIWA 5KYIA 3H3VC 3E0JA 4PV1C 1Q8IA 2ZT9C 3K5OA 5HGTA 1SSOA 4KN4C 1Y69U 3T4AC 1E2VA 2A6ED 2BCOA 1EEFD 1PXUA 3DWQA 3K5MA 2K7VA 3D4DA 1HFNA 1EOTA 5EBDA 1O7YA 1SE3A 3PV0A 3P75A 3TP5A 3TBIB 1TIID 5J22A 4KV6A 2K1BA 3A8KE 4KKUA 1CI3M 4OIJA 1F2ZA 4A3FB 1SNOA 1H9JA 2HQEA 2AUJD 4PNYA 5CORA 1JWUD 1SYCA 4KMUC 2N55A 1PTOB 1LT4D 2EYPA 4FO2A 5ELCA 1V43A 3SXHA 1B3AA 1QG7A 1PLFA 1E2ZA 4N9TA 3FKIB 2JA7B 5LL6X 2RDGA 2E2DC 4QCLA 3K5NA 1KLUD 5JPMC 3WDNA 3SVMA 2M9VA 2K04A 3OMCA 4HCEA 5EGTA 1KTKA 2WB1B 4ME5A 4S3SA 2L0CA 1XX8A 5IGEA 1G2SA 1R4QB 3T53B 5C3XA 1ML0D 1GUWA 3JAME 2C5CA 1LTRD 2OXPA 2WP8J 4KD4A 1EY5A 4JK1C 1TS2A 5AFWA 2Z8LA 1Y1VB 4IURA 3SHLA 1HRJA 1SJHD 1UNSA 2F0GA 3PUZA 1KDAA 2X6LA 4NP5A 3S16B 1D1KA 5FO7B 3E5SA 3C1EA 3A7LA 2NZ1D 1A3TA 2HCCA 1O7ZA 1LTAD 4A3KB 1CHPD 2AQ1B 2R93B 3OMGA 3J81E 1AZPA 2YU9B 3I70A 3X3NA 2OEOA 1Y8PB 3OIPA 2PZUA 3TDQA 3ND8A 3PMFA 2J4XA 3CHBD 4YIJA 5ELDA 3PO3B 1S5DD 2KECA 2YYZA 1STAA 4M8AA 4O1NA 3BS1A 1NR4A 2ZXOA 1ENAA 2D62A 2NVQB 4NKLA 1S5BD 3QB3A 3RZDB 4U673 2Z4HA 5HURA 1WTXA 2B2TA 4DXGA 1CQVA 3MZ5A 2DY7A 2PYKA 4HN7A 5D3IB 4FXDA 3BDLA 5E4WC 2CW0D 4XYOA 3OSOA 2EXZA 4A3BB 1G2TA 2F0TA 3ONAB 4K5WA 1KLGD 3NHHA 3C2PA 3K0YA 3GTJB 2NVXB 4RAUC 5A2QE 3CQZB 1Y8NB 1AP0A 5KGUA 2KCCA 3TSSA 2K6AA 3OW7A 3R8BA 3H09A 2EZVA 4CJ2C 1SBBB 4LMQD 3S14B 1CHQD 1CFMA 3P1HA 1D5XC 2QDBA 2K5WA 2F3WA 2Z4IA 1QWYA 4TKOB 3H94A 3I90A 2OT2A 5FKAC 1EY4A 1EWCA 5G3LF 4MIUA 5EKKA 2PW5A 3DMUA 1WVLA 3IKJA 1F2YA 2B2UC 5DNFA 1TU2B 1NAPA 2N88A 4RHRA 4I7ZC 1KDCA 1U9RA 4C3IB 3TZDA 4IUTA 4F7XA 4X3TA 1WTVA 3S17B 1F2LA 4RGMA 1QCBD 1OXXK 4PQXA 4PMCA 5FLXL 5I6YA 1I50B 4H44C 4EQPA 4KKTA 3RUZA 1DZ1A 2CVRA 3MEHA 4HMJA 1C8CA 2BA1A 2FMCA 4EGVA 1X32A 2EJMA 1F9QA 1STYA 4UAIA 5KNDA 4J8QA 2F0FA 1CK1A 1LO5D 1TS5A 1EEID 3GTPB 3ZYYX 1WTWA 1Q1BA 1BXTA 4O42A 5KEEA 1GUNA 2XNAC 1LTGD 3VYRA 1STBA 2M2LA 2J0TD 1EIHA 1I4PA 2XWBB 4RGOS 2X6GA 4DGZA 2PCFB 1IYUA 1OXSC 4K2LA 4J6HA 1DXMA 1PRTF 4CKCA 3K58A 1STHA 4ZLTF 1HUNA 2K05A 2SDFA 2A6HD 1S5FD 1UUPA 3C3LA 1EL0A 1UAPA 3WOEA 1Y1WB 1HHVA 1B2TA 5JAVA 1PTOH 1UEAB 2O5IC 4IFDJ 1ET9A 2FINB 5FOBB 4XQQA 5J1ZA 2HUGA 2HCIA 1PRTB 5DEHA 4G4KA 1SDFA 5FO9B 1ZXTA 1I4RA 3T56B 5IT9E 2E74C 1Q90A 1TR5A 3LWEA 1MSHA 1TT2A 3SDZA 2AWNA 4IUNA 1U4LA 2RA4A 5M3FB 1BUVT 2X69A 4BA1I 1TVXA 1RHPA 2R61A 2K32A 2NTTA 2NTSA 1PTOD 2MPMA 2RDFA 2IL8A 1IYVA 4X3SA 3Q23A 1QNKA 1XWEA 3RLFA 4BY7B 2JE6I 5C6AA 4KK7A 2VNUD 3VA7A 1QOHA 1BQQT 2L12A 2Q8IB 1EY0A 5EPKA 1B50A 2H4OA 3SK8A 5ELFA 5IGDA 1I4HA 4FNFA 4HR7B 5ELBA 3QJYA 2E76C 4V190 3Q6SA 5I9OA 1BBXC 1ZYRD 1HFGA 3Q22A 5JVH3 1GJXA 1FNUA 1ICWA 5JEAJ 1H9RA 1G6ZA 3H6MA 1V8QA 3NK9A 1JE4A 3M3YB 2Q8TA 1K8OA 2PQEA 2L1BA 1O78A 2L11A 1Z7TA 4OGQC 1KABA 4C3JG 4HEDA 5IGFA 2B2YA 1IW7D 2B39A 3BYYB 1F77A 1CM9A 2O4XA 4C3HB 2RKSA 2XN9C 3HOWB 2F0MA 3TP6A 3I72A 2B2WC 5EBCA 1W6KA 1PFBA 1T5EA 3NTIA 5CBEE 1Q3LA 5I2XA 4ZUIA 1HQMC 1FR3A 5C4XB 2K5DA 5JVG3 4BS9A 2JA5B 2NVYB 3BVZA 3A55A 2NVTB 2KHSA 3GTGB 4BY1B 1HTLD 4HCSA 3TMEA 1V1OA 3PO2B 3FVQA 4NDXA 5LL6S 1YNJD 4OL7A 4TQUS 3AB9A 3S15B 5C3EB 1F2MA 4KN7C 1WTRA 1AZQA 3N52A 3D6CA 2ZXPA 3QOLA 4K14A 1B53A 4UDUC 1XTCD 1DM0B 1D5ZC 2CQAA 5BN3A 3U9OA 5IT9L 3WOFA 3TP8A 3E6ZX 4BA2I 1BOSA 1RTOA 1AW7A 2F1MA 1T5XD 4ILWA 3QOJA 4G57A 2F0NA 2E2HB 3PUXA 4C56C 2A68C 2NBFA 2WINB 2VUMB 2E2IB 2F0KA 4ZQ3A 3NUCA 1LT5D 2JYOA 4LK1C 1JR0D 1PYWD 3S2HB 3M85A 4A3DB 3MA2B 2ICEC 1HXYD 4A3EB 5M5WB 3OWFA 1HUMA 2WKCA 3QWNA 1KDBA 3ERQA 4IALA 3R2TA 1WD1A 3EQLC 4OIKA 2EE1A 2K5QA 2A6HC 3FMCA 4RFBA 3VR4A 4RKLA 1JC7A 1IHZA 1FD7D 3DWPA 5G3LD 3I3CA 3MXPA 4C2MB 5D65A 4IFDH 1GUGA 4FXKC 4WJWA 4DK1A 3BG3A 2DNCA 2ZXRA 2D9UA 5I2YA 3EA6A 1JQYD 3BVMA 3KBGA 1IKLA 2AQ2B 1H9SA 1A2TA 1SYEA 1OO9B 1EY7A 5C4ZA 2JA8B 2C9OA 4Z9CB 5KIXA 3GTQB 4J1MA 5E1FA 1XYIA 1AN8A 5DM73 1LTTD 3QG1A 1LV9A 1A3VA 3GTLB 2Z1CA 3BZDB 1B4OA 3DUZA 4CJ0B 4N9PA 1PFMA 4QMGA 1QE6A 2F0JA 3FRPB 3IAYA 4DNRB 2BE5D 2D2CC 2KJXA 2O5JC 4IUPA 4PMBA 3G7LA 1SYFA 3P20A 1PRTD 4ZRZA 2EYLA 4CKEA 1U4MA 1ZYRC 5IGGA 5JEAH 5JJZA 3DEOA 2WIIB 4ODGA 4JBWA 1JICA 1D5MC 3MWYW 2KEEA 4XIGS 3VR6A 3GV6A 1GOZA 3VYSA 2F0QA 2R3ZA 3MFGA 1TWAB 5K36H 1U4RA 4V0BA 4ZAIA 3SR1A 2RQXA 1GXDC 3EVQA 2J7ZA 4ZKCB 1LT3D 3MHBA 1LACA 1ZEQX 5A35A 3GTOB 1Z47A 2B8GA 1QB5D 1VMPA 4F8MA 1DD2A 2I07B 4IUVA 4IFDI 4CBVA 5C0XH 2KOLA 2RSOA 5KRUA 4DAYA 4L63B 2B2UA 4CKBA 4XQJA 4IUQA 2LKVA 1GUSA 2JEAI 4RGTA 1DOKA 1F9SA 1GUOA 2DN8A 3BVGA 3NTKA 1X3QA 2V4DA 1HA5A 3SEBA 2NN6H 2FMMA 4E6IA 1NCVA 5EPJA 2L55A 5CMDA 1A3UA 2R6GA 3D6WA 3C46A 4TSSA 3OHXC 4H7BA 1HPCA 5KYLA 1ENCA 1BCPC 4CHTB 2NWGA 4DFAA 5T1GA 2EOTA 5CV8A 4G7ZC 1CA5A 1RD9D 3I73A 3A8IE 3VR3A 3NPPA 3JAML 3IL8A 2F0IA 3CKIB 2KVMA 5NUCA 3NXWA 4K8JA 1STEA 4OO1H 4AYBB 1PZID 1MBYA 1GUTA 3KUPA 4ZK9B 2NUCA 2ENBA 5IOCA 5BN5A 2RBMA 3NWTA 2A6EC 1LLRD 5KNBA 3J81L 4X3KA 4H13C 1L0XB 3S2DB 3NSWA 4XXEA 4K2KA 4FF4A 1GHJA 3K59A 4IN3A 2EY6A 4RCOA 4EQOA 5C3WA 1SE4A 3DHQA 1BO0A 5EJWA 3S1QB 4R8IA 2K28A 1V1PA 3DEPA 3KLRA 3D4WA 2H1EA 5CV7A 2LS01 2F4IA 1TY2A 5LHY1 4A93B 3G6JB 1BNZA 3KLSX 4A3MB 1TS4A 2SNMA 4ZUJA 2VB3X 3J7YW 4DNTB 4WFN3
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DFA A;  3ERO A;  4WRD A;  5I6Y A;  5CV8 A;  4B9W A;  4QF4 A;  4ZUI A;  1JOO A;  2EY5 A;  4IUN A;  1RKN A;  3MZ5 A;  1II3 A;  1KDB A;  3RUZ A;  4EQP A;  3MEH A;  3ERQ A;  1EQV A;  2PYK A;  4HMJ A;  4IAL A;  4KY5 A;  2EY2 A;  3BDL A;  3HEJ A;  3BDC A;  3OSO A;  3OMC A;  4PMB A;  5CR3 A;  2EXZ A;  1SYF A;  4WOR A;  3TP7 A;  2F0I A;  2F0T A;  5EGT A;  4ME5 A;  3LX0 A;  4S3S A;  4K5V A;  4K5W A;  5CV9 A;  1STY A;  2EYH A;  1JOK A;  3NHH A;  2KHS A;  5NUC A;  5IGE A;  2F0F A;  2RDF A;  2EYL A;  1SNC A;  3V2T A;  3NXW A;  3T13 A;  3NP8 A;  4K8J A;  3TME A;  5I9P A;  5IGB A;  4K8I A;  4NDX A;  5KYI A;  2WAC A;  5C3X A;  5C5M A;  5IGG A;  5KEE A;  4OL7 A;  1NUC A;  5C6A A;  3MVV A;  4ID6 A;  4RKL A;  5KGU A;  2NUC A;  2ENB A;  2EYM A;  2OXP A;  2PZT A;  2F0W A;  4QB4 A;  4I65 A;  1F2M A;  5JOB A;  3C1F A;  1IHZ A;  4KD4 A;  4LAA A;  1EY5 A;  4ODG A;  4HTH A;  5F2D A;  1EY0 A;  5IOC A;  1JOQ A;  5CGK A;  5J39 A;  4KY7 A;  2RBM A;  1STB A;  1TQO A;  2F3V A;  3D6C A;  5HGT A;  3S9W A;  4DU9 A;  1STG A;  3SHL A;  1EYA A;  3EJI A;  2F0G A;  3SK8 A;  4K6D A;  1EYC A;  3MXP A;  5IGD A;  3QOL A;  1KDA A;  3R3O A;  4K14 A;  1SYD A;  4NP5 A;  2OF1 A;  5I6W A;  1EY6 A;  2F0Q A;  3E5S A;  4DGZ A;  3C1E A;  4KJN A;  3SR1 A;  3NQT A;  4K2L A;  5KRU A;  1SYB A;  4J6H A;  4B9X A;  3U9O A;  3D4D A;  2PW7 A;  3EVQ A;  5E3F A;  1STH A;  5CV5 A;  4EQN A;  5I9O A;  1A3T A;  2M00 A;  3TP8 A;  3P1H A;  2QDB A;  3MHB A;  2EY1 A;  4K2K A;  5IIF A;  3VA5 A;  5C4H A;  2F3W A;  1SNQ A;  3P75 A;  3TP5 A;  4KJO A;  1EZ6 A;  3OMG A;  4RKB A;  5IOD A;  1JOR A;  4F8M A;  5J22 A;  2PZW A;  4KV6 A;  2OEO A;  3SK5 A;  2EY6 A;  2PZU A;  3QOJ A;  1EY4 A;  4G57 A;  2F0D A;  2F0N A;  1A2T A;  1SYE A;  3H6M A;  2F0E A;  3SK4 A;  2F0S A;  1F2Z A;  3NK9 A;  2F0P A;  2F0U A;  2F0O A;  4MIU A;  1SNO A;  3PMF A;  4K5X A;  1EY7 A;  5EKK A;  2HQE A;  5C5L A;  4EQO A;  5C3W A;  5C4Z A;  5HUR A;  3DHQ A;  4KD3 A;  2PW5 A;  4YIJ A;  3D8G A;  1SNM A;  2PQE A;  5CC4 A;  4PNY A;  5JAV A;  5KIX A;  2EYF A;  5M9O A;  3DMU A;  2LKV A;  4KHV A;  5K5P A;  1STN A;  4DF7 A;  1SYC A;  4J1M A;  4R8N A;  2F0K A;  5CV6 A;  5E1F A;  1F2Y A;  5ISR A;  1SNP A;  3D4W A;  2KQ3 A;  3ITP A;  1KAB A;  3NUC A;  4HMI A;  1STA A;  2SNS A;  4ZQ3 A;  5CV7 A;  5IGF A;  5J1Z A;  2F0V A;  2F0H A;  3T16 A;  2F0L A;  5DEH A;  1KDC A;  1U9R A;  1EZ8 A;  2EYJ A;  2EYO A;  5DAU A;  2SOB A;  3SK6 A;  4KY6 A;  1A3V A;  5IGC A;  1EY9 A;  4KTA A;  5EKL A;  2O4X A;  2RKS A;  2EYP A;  1EYD A;  1A2U A;  1ENA A;  4IZ8 A;  1KAA A;  1NSN S;  4E6I A;  3SXH A;  2F0M A;  4TRD A;  4F7X A;  4NKL A;  1A3U A;  3QB3 A;  3TP6 A;  4EVO A;  4N9P A;  1AEX A;  1SND A;  1SYG A;  1TR5 A;  2SNM A;  4N9T A;  4NMZ A;  4QMG A;  5CV4 A;  4ZUJ A;  3HZX A;  4H7B A;  3OWF A;  5KYL A;  1ENC A;  1EY8 A;  2F0J A;  4PMC A;  1TT2 A; 
#chains in the Genus database with same CATH topology
 4C1N I;  1VQ8 A;  1UE6 A;  1JMC A;  3H3V I;  2R7Z G;  2NN6 I;  4LF9 Q;  3HOU H;  4KY5 A;  1Q81 C;  4G7O C;  1E24 A;  5A2Q L;  5EKI A;  3J80 E;  4CDE C;  3ULP A;  4DR4 Q;  4WOR A;  2IPK D;  3HOV B;  4O2D A;  2RSN A;  3RLO A;  4HAE A;  3O13 A;  1G91 A;  1L1O A;  3NP8 A;  5I9P A;  5IGB A;  5LMN W;  2PPB C;  1JB7 A;  1EU3 A;  2K33 A;  1A0I A;  1E1O A;  2DY8 A;  4ID6 A;  1RIP A;  3G71 A;  3L3O C;  2HT1 A;  2PZT A;  2F0W A;  3MXN B;  3A56 A;  4C2M H;  5IWA Q;  5K36 G;  3HOX H;  1C7Y A;  3A5Z B;  4KY7 A;  4B3R Q;  1KNE A;  2YTV A;  3T51 B;  3SE0 A;  1P16 A;  4CGY B;  1ESR A;  1VF7 A;  2XWJ B;  3K8A A;  3P7J A;  2ALY B;  1XPO A;  3I4M B;  1Q12 A;  4P75 A;  3E0E A;  4JI2 L;  2BDO A;  4L8J A;  2EJG C;  5LMN L;  3A8J E;  4ME3 A;  3ULL A;  1PZJ D;  2EY1 A;  3J7Z C;  3GO5 A;  2TMP A;  1NY4 A;  1FYC A;  1HTP A;  2F4V L;  1CKM A;  4X3U A;  2QIL A;  3MXN A;  1VQB A;  3A7A B;  4K0K L;  3E9I A;  1IBM Q;  1RCV D;  2KCN A;  3Q8D A;  2C35 B;  2JA8 H;  1PH8 A;  1VQH A;  1WCM G;  2KHI A;  1FGB D;  1D8L A;  1LTS D;  4A3G B;  2H5X A;  1SNM A;  4R4I A;  2G5D A;  1SXT A;  3K5L A;  1QVC A;  2UUA L;  4DV6 L;  4F87 A;  4BBR B;  4HMI A;  3U4V A;  5AJ3 L;  2EYO A;  5C4X G;  1PVO A;  4WJ4 A;  1KNA A;  1VCI A;  3M7N A;  1DYQ A;  2Y0S E;  2B2W A;  2JA5 G;  4TRD A;  4EQ5 A;  4MN3 A;  3CPW A;  4NW2 A;  1RTN A;  1AEX A;  4LF4 L;  2IW3 A;  1I6H B;  4OHJ A;  1XPU A;  3JAM c;  4QUF A;  1DCZ A;  2F03 A;  1HA6 A;  4X65 Q;  3J81 j;  1VQ7 A;  5ELO A;  3M7G A;  4LFA Q;  1IBL Q;  3PO2 G;  1ZKO A;  2CW0 C;  1J8I A;  5C3E G;  2R7F A;  1V1Q A;  2PNR C;  4B3T L;  4LJZ C;  4I7A A;  1R9T B;  1M8A A;  5CR3 A;  5CYU A;  3U58 A;  2L9H A;  1QVF A;  4B3S L;  3LX0 A;  1RF2 D;  3OOC A;  1JOK A;  2WFW A;  3EN2 A;  4GKK Q;  3V2T A;  2AKW B;  3TZU A;  3T13 A;  4KHZ A;  4K8I A;  4Q0F A;  5C0X J;  1KC8 C;  3KF6 A;  5C5M A;  1JJ2 A;  4HJA A;  1Q86 C;  3CW2 C;  2KBN A;  3KF8 A;  3R93 A;  4AQY Q;  3VYT A;  2VL6 A;  1TWA H;  1JOQ A;  3HS0 C;  3RR5 A;  3CD6 A;  3S9W A;  5COY A;  1CUK A;  3PIP 3;  1M1K C;  1SYD A;  2L4N A;  3RZO H;  1EY6 A;  2IX3 A;  4KJN A;  4LFC Q;  1D7Q A;  3GTO H;  3G4S A;  5T1I A;  4XQN A;  1CQF A;  1WYD A;  1VMC A;  3BDO A;  4JYA Q;  5IYD H;  4QUC A;  2VUM G;  5C4H A;  4A3I B;  3W3A A;  4DR3 L;  2EXD A;  3R2I A;  4QIW E;  3D4R A;  2LMC B;  1S5E D;  1SEB D;  3A54 A;  2E5L L;  4JBM A;  1HZB A;  4A3D G;  1S4Z A;  2F0U A;  3PGZ A;  1FNV A;  5C5L A;  4KD3 A;  4DXF A;  4A3F G;  1YIJ A;  4C3J B;  2D0P A;  4DUY L;  4A3E G;  5K5P A;  1D2B A;  4DF7 A;  4DR2 L;  4XDX A;  3EBE A;  5M5X H;  4KI0 A;  5I4D A;  2F0V A;  4LUV A;  1I94 L;  4DR5 L;  1EZ8 A;  5IGC A;  4JW0 A;  4DR1 Q;  4YY3 L;  2VW9 A;  4JOI A;  5EKL A;  2RVL A;  2ID0 A;  1SFO H;  3IRB A;  3URY A;  2CCZ A;  2KA7 A;  4MZ9 A;  4FXG C;  1NMG A;  4NMZ A;  1LTB D;  2B2V A;  1YJN A;  3NTH A;  1LYL A;  4DK0 A;  1MI2 A;  2JK8 A;  1NR2 A;  3ERO A;  4WRD A;  2MP1 A;  1D6E C;  4B9W A;  1MJC A;  2JA7 G;  3Q0A A;  1VQE A;  3KLS A;  1O7I A;  4LW1 A;  1VQG A;  4U68 A;  4FDB A;  1SJE D;  2MGS A;  3FEW X;  4JI5 L;  3BZC A;  2EYH A;  3GQB A;  4GN5 A;  4H0L C;  1ESF A;  4J15 A;  2EDG A;  2QCP X;  2JA6 B;  2WB1 G;  2BOS A;  4FF1 A;  1PTO F;  1ENF A;  1WFQ A;  2PO4 A;  1X55 A;  4JPB W;  3M4O B;  3CU7 A;  5C4J B;  1CT1 D;  2B2V C;  2LSS A;  3HKZ E;  4Y7N H;  2NYZ D;  4A3J H;  1N34 Q;  3C1F A;  4LAA A;  4RGN A;  1FL0 A;  4DK6 C;  4YHH Q;  2F3V A;  1STG A;  2VQF Q;  3S2D H;  4XTC S;  5I6W A;  4GNX B;  3FPU B;  1EOV A;  3S1R B;  1R4P B;  3L7Z C;  3HOU B;  1Y1V G;  1C4Q A;  4N8X 1;  2ZM6 Q;  3TRZ A;  4P72 A;  2BA0 A;  1SYB A;  5EPL A;  1SN8 A;  2ASB A;  3OWE B;  5E4X A;  2B63 H;  3AFP A;  2IHF A;  2WKD A;  5DM6 3;  5IIF A;  2FFK B;  3HG9 A;  4OEL B;  3K57 A;  1SNQ A;  2JSO A;  3I91 A;  3T1Y Q;  1IKM A;  1KIX A;  1BBW A;  4A3K G;  4NXN L;  2R93 G;  3IFD A;  1H9S B;  3RD4 A;  3D31 A;  4H02 A;  3S1Q H;  1PFN A;  2D5D A;  3OW2 A;  3HOX B;  1RDP D;  2NB0 A;  1TWG B;  3UE0 A;  1MHW C;  2AUK A;  5CC4 A;  1STN A;  3G6E A;  4R8N A;  1HNZ L;  3I8Z A;  3RNU A;  2UU9 Q;  2GA4 B;  1SNP A;  4A93 H;  1YHQ A;  2SEB D;  1T9H A;  3W2D A;  4A3M H;  5L37 A;  3PIP A;  1G29 1;  2A69 D;  3OYY A;  1EY9 A;  4KTA A;  1Q1E A;  5EAY A;  3ULJ A;  5M5Y B;  1WTQ A;  1A2U A;  4IZ8 A;  1TWH H;  2Z0S A;  4OX9 L;  2CWA A;  2MHV A;  1NMF A;  1H9K A;  2Z6B A;  4HIK A;  4Q5V A;  1SMY D;  3BYT B;  5CV4 A;  1G8Z D;  2K52 A;  2QKI C;  2A74 C;  4DA2 A;  5KNC A;  4XYQ A;  1VQL A;  2HDL A;  1WD0 A;  4X6A H;  1JOO A;  4ZKB B;  3BZK A;  4L5Q A;  1MSG A;  1EQV A;  2Y0S B;  1ILP A;  5BR8 L;  1JCK B;  2Z6K A;  5JJL A;  3KLW A;  1I5F A;  2AMC B;  2RHS B;  1PTO C;  1DOM A;  1N32 Q;  1BKB A;  1HZC A;  5FLX E;  1ICF B;  4A3B G;  1F9P A;  1SNC A;  1BVS A;  3NBI A;  2ICI A;  2XSC A;  1LAB A;  4JC0 A;  1KRS A;  2Q8R E;  2UXB L;  1NUC A;  1FJG L;  2TSS A;  1B1Z A;  1QJO A;  4LNQ A;  2IX0 A;  4APV A;  1ET6 A;  1WTP A;  2EYM A;  1Y8O B;  1BCP F;  4ULL A;  1DJR D;  2QF7 A;  3I4M H;  1B9N A;  1HZ9 A;  1S5C D;  1TQO A;  1M4V A;  3EJI A;  2FXQ A;  4HSV A;  3R3O A;  2FHT A;  3DXJ C;  2VXW A;  5IYD G;  2VB2 X;  1YBY A;  1HQR D;  1ONL A;  1MKH A;  1XXG A;  4DR7 L;  1D1I A;  2LXJ A;  4DUZ L;  3VDY A;  3GD7 A;  1YNN D;  3CCV A;  5E3F A;  3GV3 A;  4A3C H;  5ELN A;  4UP9 A;  3OTO Q;  3PUV A;  3UE1 A;  3VA5 A;  2RHQ B;  3U9S A;  3CCE A;  3KJO A;  2R92 B;  1JOR A;  4FP5 D;  1BF4 A;  3NWS A;  1I4G A;  1BDO A;  1TWC B;  4K6L A;  2F0E A;  1K8M A;  1BCP B;  2F0S A;  3G48 A;  3K6O A;  5M3M B;  3HOY H;  5JPN C;  4BBR H;  1IBK Q;  2DUD A;  4DAY B;  1HZA A;  1TKW B;  1LT6 D;  2IWH A;  4NXM Q;  3RZO B;  2EVB A;  2G9D A;  4QIW B;  4YCU A;  4DR6 L;  3ITP A;  2KQ3 A;  2SNS A;  3VYU A;  3L2P A;  4LF5 Q;  1IW7 C;  1RJT A;  4IJH A;  4RA8 A;  1CTM A;  1YNX A;  1I6H H;  4R4Q A;  4R4O A;  4AH6 A;  1JWM D;  3CRL C;  1E1T A;  4FF2 A;  4C3I G;  1I4Q A;  3I56 A;  4GZY C;  2JJQ A;  1X3P A;  3AYH B;  1XMQ L;  4AIM A;  3TRE A;  4X64 Q;  4QF4 A;  1R9T H;  4YWM A;  2HD3 A;  2B2T C;  2VQE Q;  3CCR A;  4AYB G;  4DN4 M;  3K80 C;  1Z9F A;  1TY0 A;  4DV0 Q;  4HJ8 A;  3BDC A;  5D3D A;  1P8L A;  3FHW A;  4LF9 L;  3CCL A;  2EPB A;  3OIQ A;  3JAM i;  5M5X B;  4DR4 L;  2K50 A;  1XNQ Q;  3TS0 A;  4HSP A;  1SE2 A;  2F3I A;  2MJ8 A;  1SFO B;  1YNJ C;  4C1N K;  2WAC A;  3K7A H;  3KBX A;  4IQZ A;  2ZJP A;  3H0G B;  5CBA E;  3GDE A;  4CDD C;  4DV7 L;  4QB4 A;  4HJ7 A;  3CCU A;  2XRS D;  1GD7 A;  1DON A;  3GTK H;  1IL8 A;  4HJ9 A;  5F2D A;  4HTH A;  1EQQ A;  3NBH A;  4RH6 A;  2JEB I;  1QIL A;  1KAW A;  3EFX D;  5CGK A;  5J39 A;  1N36 L;  1TWF H;  1EYA A;  3N6R A;  4KKS A;  3KJP A;  4B3R L;  2OF1 A;  1E0B A;  2XVS A;  2WAQ B;  1WI5 A;  3S1N H;  4POF A;  3CCS A;  3J81 i;  3HKZ B;  3NEM A;  1JWS D;  1J9O A;  4UP8 A;  5CV5 A;  3UI2 A;  3Q24 A;  2XRQ D;  3LNN A;  1E7Z A;  5BN4 A;  2KEN A;  3GP7 A;  3HRZ C;  3IFT A;  5IOD A;  4JBK A;  1L0Y B;  4ABN A;  1HCZ A;  3S1M B;  4IFD G;  5D14 A;  1TS3 A;  1KL9 A;  4C3J H;  1K83 B;  2G9H D;  4Y7N B;  4A3J B;  2K01 A;  2NZO A;  1E22 A;  1H9M A;  2FJ2 A;  2F0P A;  1G51 A;  1EFI D;  1YJW A;  5FO8 B;  2A68 D;  2JP1 A;  2B3G A;  1VQF A;  2OTL A;  2EYF A;  3HGB A;  1V1P B;  4BBS B;  1NBW A;  1Y1W G;  5ISR A;  2L5T A;  1KXL A;  4LF7 L;  5IYC H;  2F0L A;  2EYJ A;  3SK6 A;  2B63 B;  3MFY A;  2N49 A;  4BWG B;  2MUY A;  4X66 Q;  4XT1 B;  2JXM B;  3HOV G;  1MGS A;  1SND A;  1LTL A;  4PMW A;  3CXC A;  3HZX A;  1GHK A;  2GVB A;  3F2U A;  2I5M X;  4DV1 Q;  4FF3 A;  4PZ6 A;  3D3R A;  2XTI A;  4JVZ A;  1JB3 A;  1XNR Q;  4X65 L;  1O80 A;  4DAM A;  4LFA L;  1IBL L;  1B9M A;  5C0X I;  3MTS A;  2RF4 A;  4IJL A;  4YCW A;  2MNA A;  2UUC Q;  3TP7 A;  4MHE A;  1PHJ A;  3M4O H;  4OXP A;  1I6V C;  2KCM A;  1F9R A;  4GKK L;  3I4M G;  1HNW Q;  1TWH B;  3PF5 A;  1ILQ A;  3HOZ B;  2E75 C;  4FYD A;  5JOB A;  2A73 B;  4I65 A;  4BY7 G;  3S1R H;  1OXT A;  3MXU A;  3KOJ A;  1K8A C;  2QEJ C;  3I4N B;  4AQY L;  4UHV A;  4A3C G;  4JI6 Q;  4K6D A;  2EJF C;  2KHJ A;  4RCN A;  4CJ1 B;  1MD2 D;  3CRK C;  2L15 A;  1FNW A;  5JEA G;  4RHS A;  2IX1 A;  1K8G A;  3S24 A;  4B9X A;  4LFC L;  4EQN A;  2M00 A;  4A3G G;  1QNU A;  1ROD A;  4L6T B;  4UY8 C;  2A69 C;  5IY0 A;  1EZ6 A;  4RKB A;  4BBR G;  3TN2 A;  1TWG H;  1CZG A;  1K73 C;  3A0J A;  3SK5 A;  4FVM A;  2F0D A;  3AU7 A;  2O2L D;  1SMY C;  1N33 Q;  3SK4 A;  4OO1 I;  3PIO 3;  1U5K A;  3STB C;  4K5X A;  1A8V A;  1U4P A;  4ZYS A;  1E2W A;  2KUM A;  4ALP A;  4P2C B;  3D8G A;  2LFN A;  2YV5 A;  2YTY A;  4KHV A;  4DV5 L;  1Z6H A;  5M5Y H;  1EQT A;  5TSS A;  3LWU A;  5C0X G;  1PH9 A;  2LY7 A;  2WV6 D;  3J7A F;  1I4X A;  2F0H A;  3T16 A;  4DAP A;  4GLV B;  5DAU A;  2CHB D;  1WTO A;  2BDN A;  2SOB A;  1C48 A;  2E2J B;  2IJ0 A;  2E8G A;  3MAQ A;  4BXX H;  1VDZ A;  1KAA A;  1NSN S;  1B44 D;  4DR1 L;  3AMU A;  3MC0 B;  4C3H G;  1OTC A;  1SYG A;  1KD1 C;  2BE5 C;  3HOW G;  2R7Z B;  2IT1 A;  1KQS A;  3NE5 B;  3NQI A;  3ND9 A;  3F2C A;  2AWO A;  3HOY B;  2EY5 A;  2KED A;  2NN6 G;  1RKN A;  2YTX A;  1II3 A;  4JG2 A;  1OXU A;  3S16 H;  2K03 A;  4LWC A;  1XMO L;  3M9B A;  2B8F A;  3GTM B;  2EY2 A;  3HEJ A;  1FGU A;  2MFI A;  1CA6 A;  3X3M A;  3PF4 A;  3J7A V;  1PRT C;  4K5V A;  1EWH A;  4B08 A;  2K4K A;  1YNN C;  1EIF A;  4A3L H;  3PUY A;  2PQA B;  3KF6 B;  4BY1 G;  1EU4 A;  2AQ3 B;  3MXG A;  3MVV A;  3KF8 B;  1W6J A;  2A5H A;  1CSQ A;  3QO2 A;  1PZK D;  1QUQ A;  4X62 L;  4A3I G;  1A15 A;  3K7U C;  3RMH A;  1NJI C;  4DU9 A;  1IL2 A;  3PO3 H;  1EYC A;  4OO1 G;  2DGY A;  3TEH B;  2VQF L;  3NQT A;  1AFP A;  4RWS C;  5FK9 C;  3OPO A;  2PW7 A;  3V96 A;  2R92 H;  2ZM6 L;  4DV2 L;  2PQA A;  2DNE A;  3DM1 A;  4JI8 Q;  1EIG A;  2K75 A;  1TWC H;  4KJO A;  5C44 B;  3TQY A;  5M3M H;  3K7A B;  3RZD H;  3I4L A;  1CZW A;  2PZW A;  2JA9 A;  1WCM B;  1K0S A;  1SAP A;  3VR5 A;  2F52 A;  3GTK B;  1YHA A;  2F0O A;  3FPP A;  3V05 A;  1TWF B;  3VR2 A;  1YHB A;  5M9O A;  5ELE A;  3DWA A;  5IP9 G;  1PMR A;  1EWI A;  5CV6 A;  3S1N B;  2RDH A;  4DAV A;  1LTI D;  4R9W A;  2HDM A;  4JCV E;  3ERS X;  4XT3 B;  4JI3 Q;  4KY6 A;  2B2Y C;  5FJ8 H;  1EYD A;  1I3Q B;  4IUU A;  5EQ0 A;  4G7H C;  1VS0 A;  4JI7 Q;  3QIA A;  2I46 A;  1CKO A;  1OXV A;  3D0F A;  3CQZ H;  3M4Y A;  3CC7 A;  1PDQ A;  4F88 A;  1A6X A;  4EVO A;  3J80 L;  5IYB H;  3L9A X;  1EY8 A;  2PMZ B;  1O7L A;  1WTH A;  3FDT A;  2JA6 G;  1BCP D;  2UUB Q;  1DOL A;  3PUW A;  3L0O A;  5GAE C;  4OEM B;  1BR9 A;  3H91 A;  3KK7 A;  3HP3 A;  5FLM H;  1VF5 C;  1PH4 A;  4LF6 Q;  3PIO A;  3NEN A;  5CV9 A;  2I5L X;  1KHI A;  3H0G H;  5LMN Q;  1VQ4 A;  3T1H L;  3HOU G;  4M1U B;  2XIW A;  4HJ5 A;  4JV5 Q;  5KYI A;  4GLA C;  3LGJ A;  1QZH A;  3H3V C;  1U0L A;  1EQR A;  3E0J A;  2Q2H A;  4IOA A;  4PV1 C;  1Q8I A;  1K9M C;  2K5H A;  1IYJ B;  2ZT9 C;  3K5O A;  3I2Z A;  5HGT A;  1SSO A;  1UE7 A;  4KN4 C;  1Y69 U;  4DKA C;  3T4A C;  1E2V A;  4LFB Q;  2A6E D;  2BCO A;  1EEF D;  1PXU A;  3DWQ A;  2UUA Q;  3K5M A;  3CC4 A;  2K7V A;  3HOX G;  3D4D A;  1HFN A;  5AJ3 Q;  3S1M H;  1EOT A;  5EBD A;  1O7Y A;  2WAQ E;  1SE3 A;  4GOP C;  3PV0 A;  3P75 A;  1K83 H;  3TP5 A;  3OTO L;  3S17 H;  3TBI B;  1TII D;  5J22 A;  1QZG A;  4KV6 A;  2K1B A;  3A8K E;  4KKU A;  3J7A 5;  1CI3 M;  4OIJ A;  4LF4 Q;  4L5T A;  1KRT A;  1F2Z A;  4A3F B;  4BBS H;  4QJF A;  3A5U A;  1MIU A;  1SNO A;  1H9J A;  2HQE A;  2CH4 W;  4N8F A;  2AUJ D;  4R4C A;  4PNY A;  5COR A;  1JWU D;  1IBK L;  1SYC A;  4KMU C;  2JA8 G;  3F1Z A;  2RCN A;  4NXM L;  1PFS A;  2N55 A;  1PTO B;  2Q2T A;  4OON A;  2Y0S G;  4LF5 L;  1LT4 D;  4B3M L;  2EYP A;  4FO2 A;  1BBU A;  1V43 A;  5ELC A;  3GTP H;  3SXH A;  2QEX A;  1B3A A;  1QG7 A;  1PLF A;  1E2Z A;  4N9T A;  3FKI B;  2JA7 B;  5LL6 X;  1B7Y B;  2RDG A;  2E2D C;  4QCL A;  1CKN A;  3K5N A;  1KLU D;  5JPM C;  4LF8 Q;  1MJE A;  3WDN A;  4TVA B;  3SVM A;  2M9V A;  2VQE L;  3CCQ A;  2K04 A;  3OMC A;  3RLN A;  4HCE A;  2A8V A;  5EGT A;  1KTK A;  2WB1 B;  4ME5 A;  4S3S A;  5GAH C;  2L0C A;  1XX8 A;  1S40 A;  5IGE A;  2EIF A;  2HIV A;  1K0R A;  3HOZ H;  1G2S A;  1R4Q B;  2EQS A;  1XNQ L;  3T53 B;  5C3X A;  1ML0 D;  3I4N H;  1Q7Y C;  1GUW A;  3JAM E;  1G6P A;  2C5C A;  1LTR D;  2OXP A;  2WP8 J;  4KD4 A;  1EY5 A;  4JK1 C;  1TS2 A;  2N8N A;  5AFW A;  2Z8L A;  1Y1V B;  4JI4 Q;  4IUR A;  3SHL A;  2UXC Q;  1SJH D;  1UNS A;  2F0G A;  3PUZ A;  2R92 G;  1HRJ A;  1L0W A;  1KDA A;  2X6L A;  4NP5 A;  3S16 B;  1D1K A;  5FO7 B;  3E5S A;  3C1E A;  4DUY Q;  3A7L A;  2NZ1 D;  2HHH Q;  1AE2 A;  5H1S E;  1A3T A;  3MEF A;  2HCC A;  4DR5 Q;  1O7Z A;  1LTA D;  4A3K B;  1CHP D;  2AQ1 B;  2R93 B;  1Y14 B;  4KHP Q;  4OWT B;  3OMG A;  3J81 E;  1AZP A;  1EIY B;  2YU9 B;  4GN4 B;  5HY6 A;  3I70 A;  3X3N A;  2OEO A;  1Y8P B;  3OIP A;  2PZU A;  3TDQ A;  3DLL A;  3EIV A;  4GKJ Q;  3ND8 A;  3PMF A;  5M3F H;  1IZ6 A;  2J4X A;  3CHB D;  4YIJ A;  5ELD A;  1PH5 A;  3PO3 B;  4O0A A;  5FJ8 G;  1DGS A;  3CCM A;  2E2J H;  1S5D D;  2KEC A;  2YYZ A;  1STA A;  3J80 c;  1X56 A;  4M8A A;  4O1N A;  4RG1 A;  1EUJ A;  3BS1 A;  2ZJR A;  1NR4 A;  2ZXO A;  1ENA A;  2R7Z H;  2D62 A;  1ASY A;  2NVQ B;  4NKL A;  3UDF A;  1S5B D;  3QB3 A;  3RZD B;  1XTD A;  4X66 L;  2BH8 A;  4CDF C;  4U67 3;  2Z4H A;  5HUR A;  1WTX A;  4P74 A;  2B2T A;  3GTM H;  4DXG A;  1CQV A;  2GN5 A;  3MZ5 A;  2CH4 A;  2DY7 A;  2PYK A;  4HN7 A;  1XNR L;  5D3I B;  4FXD A;  4DPG A;  4YWK A;  3BDL A;  5E4W C;  3CME A;  4HID A;  2CW0 D;  4XYO A;  2QW7 A;  3OSO A;  1K3B C;  2EXZ A;  4A3B B;  1G2T A;  2F0T A;  3ONA B;  4K5W A;  5LMU Q;  1KLG D;  3NHH A;  4DV4 Q;  2UUC L;  5GAG C;  3C2P A;  3M4Q A;  3K0Y A;  1L2F A;  4JBJ A;  3GTJ B;  2OQ0 A;  1VQO A;  2NVX B;  5JJK A;  4RAU C;  5A2Q E;  3HKZ G;  3CQZ B;  2QDL A;  1HNW L;  1J5E Q;  1Y8N B;  1AP0 A;  5KGU A;  2KCC A;  3TSS A;  2KCT A;  1RL2 A;  3NBH B;  3H15 A;  4DV3 Q;  2K6A A;  3OW7 A;  3I55 A;  3R8B A;  3H09 A;  4Y52 H;  4KLK A;  2EZV A;  4CJ2 C;  1SBB B;  4LMQ D;  4A3J G;  3S14 B;  1CHQ D;  1K3R A;  1HR0 Q;  4PZ7 A;  3PSI A;  5C44 H;  1XPR A;  1CFM A;  2N3S A;  1D5X C;  2QDB A;  3P1H A;  1WCM H;  2K5W A;  1X65 A;  2UXD Q;  2F3W A;  2Z4I A;  1QWY A;  1PH3 A;  3F2B A;  4TKO B;  3H94 A;  3I90 A;  1JJG A;  2OT2 A;  5FKA C;  5IWA L;  1EY4 A;  1EWC A;  3HFZ B;  2B63 G;  5G3L F;  3UDI A;  4PZ8 A;  2GVA A;  4MIU A;  5C4X H;  5EKK A;  1N33 L;  3CP0 A;  1GVP A;  2PW5 A;  4GN3 B;  3DMU A;  2JA5 H;  2Q2I A;  1WVL A;  3IKJ A;  1F2Y A;  2B2U C;  5DNF A;  1I3Q H;  1TU2 B;  1X9N A;  1NAP A;  2N88 A;  3GTG H;  4RHR A;  4I7Z C;  1KDC A;  1U9R A;  1PYB A;  4C3I B;  1VQN A;  3PO2 H;  3TZD A;  4IUT A;  1YZ6 A;  1IBM L;  1X3E A;  2B29 A;  4X3T A;  4F7X A;  1WTV A;  3S17 B;  1F2L A;  3S15 H;  4A93 G;  1VQ5 A;  4RGM A;  1W3S A;  1QCB D;  1OXX K;  3UDX A;  4A3M G;  4HIO A;  4PQX A;  4PMC A;  5FLX L;  5I6Y A;  1I50 B;  2P5Z X;  5GAD C;  4H44 C;  4EQP A;  4KKT A;  3RUZ A;  4QQB X;  2CVR A;  3MEH A;  1DZ1 A;  4HMJ A;  1C8C A;  2PNH A;  5JJI A;  2PMZ E;  2XGT A;  2BA1 A;  2FMC A;  4EGV A;  1X6O A;  4DR7 Q;  1X32 A;  2EJM A;  1F9Q A;  5IE8 A;  1STY A;  3CMA A;  1YEZ A;  4UAI A;  5KND A;  4J8Q A;  2CQO A;  2F0F A;  1UE1 A;  4IOC A;  2DJG C;  1CK1 A;  1LO5 D;  2A1A A;  1TS5 A;  4QY7 A;  1EEI D;  3GTP B;  3ZYY X;  1WTW A;  1Q1B A;  1BXT A;  4O42 A;  5KEE A;  4OWW B;  1HNX Q;  1GUN A;  2E2H H;  1HH2 P;  2XNA C;  1LTG D;  3ZJY C;  3VYR A;  1STB A;  2M2L A;  1VQA A;  2J0T D;  1GO3 E;  1EIH A;  2VUM H;  1I4P A;  2XWB B;  4RGO S;  2X6G A;  4DGZ A;  2PCF B;  1IYU A;  1OXS C;  2ES2 A;  4K2L A;  1WJJ A;  4IPC A;  4J6H A;  1DXM A;  1PRT F;  4CKC A;  3K58 A;  1STH A;  4RMF A;  4ZLT F;  1HUN A;  2K05 A;  2SDF A;  2A6H D;  4IPH A;  1S5F D;  4JI8 L;  4A3F H;  1UUP A;  3C3L A;  1X3F A;  4A3E H;  5M5W H;  1Q8K A;  1EL0 A;  1UAP A;  1N9W A;  3U50 C;  2K5V A;  4UP7 A;  1PH7 A;  3WOE A;  4LUZ A;  1Y1W B;  1HHV A;  1B2T A;  5JAV A;  1PTO H;  1YIT A;  1UEA B;  2O5I C;  4IFD J;  1ET9 A;  2QGQ A;  2FIN B;  5FOB B;  4XQQ A;  2Z9H A;  1TXY A;  5J1Z A;  2HUG A;  2HCI A;  3HOY G;  1PRT B;  5DEH A;  4JYA L;  4G4K A;  3FKI H;  2JA7 H;  1SDF A;  5FO9 B;  4JI3 L;  1ZXT A;  1I4R A;  3T56 B;  5IT9 E;  2E74 C;  3M4P A;  1Q90 A;  4JI7 L;  4EX5 A;  1TR5 A;  3LWE A;  4DV7 Q;  1MSH A;  1TT2 A;  1VQ6 A;  3SDZ A;  2AWN A;  4GS3 A;  1GKH A;  3RN5 A;  4IUN A;  1N36 Q;  1U4L A;  2RA4 A;  5M3F B;  1BUV T;  2X69 A;  1NE3 A;  4BA1 I;  1TVX A;  4L5S A;  2UUB L;  1RHP A;  2R61 A;  2K32 A;  2NTT A;  2NTS A;  3W5O A;  1PTO D;  4LF6 L;  2MPM A;  2RDF A;  3KFU A;  1UWV A;  2IL8 A;  1IYV A;  4X3S A;  1V9P A;  3Q23 A;  2WB1 E;  1QNK A;  1XWE A;  3RLF A;  4BY7 B;  1L1O C;  2JE6 I;  4KK7 A;  5C6A A;  2VNU D;  4JV5 L;  1Y1V H;  3VA7 A;  1QOH A;  1QUQ B;  1BQQ T;  2L12 A;  2Q8I B;  1EY0 A;  1NTG A;  5EPK A;  1B50 A;  1VQP A;  2H4O A;  5C44 G;  3SK8 A;  5ELF A;  5IGD A;  1I4H A;  2JN4 A;  3GTQ H;  4JI0 Q;  1B70 B;  4FNF A;  4HR7 B;  1VQ9 A;  5ELB A;  3QJY A;  4HIM A;  2E76 C;  3W1G A;  4LFB L;  4A3K H;  2R93 H;  4V19 0;  3PCO B;  3Q6S A;  1AE3 A;  2YU9 H;  5I9O A;  3HKS A;  4LF7 Q;  1X3G A;  1BBX C;  3GTL H;  1ZYR D;  1HFG A;  3Q22 A;  1CSP A;  5JVH 3;  1GJX A;  1FNU A;  1ICW A;  5JEA J;  3AEV A;  1H9R A;  1N34 L;  4IPD A;  4YWL A;  4JI1 Q;  3TS2 A;  1G6Z A;  3H6M A;  1V8Q A;  1JT8 A;  4YHH L;  3NK9 A;  1JE4 A;  3CAM A;  3UDG A;  1M90 C;  3M3Y B;  2Q8T A;  1K8O A;  2PQE A;  2L1B A;  1O78 A;  2L11 A;  1Z7T A;  4OGQ C;  1KAB A;  4C3J G;  4HED A;  5IGF A;  2B2Y A;  2NVQ H;  5IP7 H;  1IW7 D;  2B39 A;  3BYY B;  1F77 A;  1CM9 A;  2O4X A;  4C3H B;  2RKS A;  2XN9 C;  5FLX c;  3T1Y L;  1SR3 A;  3HOW B;  2F0M A;  3CC2 A;  3CPF A;  2IY5 B;  1VQJ A;  3TP6 A;  2MO1 A;  3I72 A;  2B2W C;  4QL5 A;  5EBC A;  1W6K A;  1PFB A;  5IYC G;  1T5E A;  3J80 i;  3NTI A;  1Q3L A;  5J3B A;  5CBE E;  4WJ3 M;  5I2X A;  1UE5 A;  4ZUI A;  3J81 c;  1HQM C;  1FR3 A;  4A3B H;  5C4X B;  3NEL A;  2K5D A;  5JVG 3;  4LF8 L;  2UU9 L;  4BS9 A;  2JA5 B;  3GTJ H;  2NVY B;  4R4T A;  2NVX H;  1LUZ A;  3BVZ A;  3A55 A;  2NVT B;  2KHS A;  3GTG B;  4BY1 B;  1B3Q A;  1HTL D;  4HCS A;  3TME A;  1V1O A;  1JE5 A;  3PO2 B;  3FVQ A;  4NDX A;  4GOP B;  5LL6 S;  3E9H A;  1YNJ D;  4OL7 A;  4TQU S;  3AB9 A;  4A4I A;  1PH2 A;  3S15 B;  5C3E B;  1LM0 A;  2NZH A;  1F2M A;  3U4Z A;  4KN7 C;  1WTR A;  1AZQ A;  3DM3 A;  3N52 A;  3D6C A;  3S14 H;  2ZXP A;  1A63 A;  4JI2 Q;  3QOL A;  4K14 A;  1B53 A;  2PI2 A;  4JI4 L;  2UXC L;  4UDU C;  1IXR A;  1XTC D;  1DM0 B;  2IHE A;  1D5Z C;  1JJC B;  4DV5 Q;  2CQA A;  5BN3 A;  1N32 L;  3U9O A;  1VQK A;  5IT9 L;  2F4V Q;  3WOF A;  4GOP A;  3TP8 A;  3E6Z X;  2HHH L;  4BA2 I;  1BOS A;  4K0K Q;  1RTO A;  1GM5 A;  2RCF A;  2CFM A;  4P73 A;  1AW7 A;  2F1M A;  1T5X D;  4ILW A;  4KHP L;  3E3X A;  3QOJ A;  4G57 A;  2F0N A;  2E2H B;  2N78 A;  3PUX A;  1C9O A;  4C56 C;  2A68 C;  5GRO A;  2NBF A;  4GKJ L;  3I7F A;  4POG A;  2WIN B;  2VUM B;  4DV6 Q;  1XMO Q;  1Q82 C;  2E2I B;  3FKI G;  4C3I H;  2F0K A;  5DLQ E;  1H95 A;  2HQL A;  4ZQ3 A;  3NUC A;  4P71 A;  1LT5 D;  2JYO A;  4LK1 C;  1JR0 D;  1PYW D;  3S2H B;  4GLX A;  2ZTC A;  3M85 A;  2JQO A;  3ER0 A;  4A3D B;  1EYG A;  2OWO A;  3MA2 B;  2ICE C;  4JOI C;  4NB3 A;  4UPA A;  1I50 H;  1X54 A;  2HIX A;  1HXY D;  4A3E B;  5M5W B;  3QR8 A;  3OWF A;  3B6Y A;  1HUM A;  2A19 A;  1CKN B;  4X62 Q;  2WKC A;  4BXX G;  3QWN A;  1PV4 A;  1KDB A;  1SE8 A;  3ERQ A;  2Q2U A;  4B3T Q;  4IAL A;  4B3S Q;  4AYB E;  1YI2 A;  3R2T A;  1WD1 A;  3RN2 A;  4L5R C;  3EQL C;  1K28 A;  1S3O A;  4DV2 Q;  4OIK A;  1WOC A;  5LMU L;  2BH2 A;  4DV4 L;  1XJV A;  2EE1 A;  4R1J A;  1HR0 W;  2K5Q A;  2A6H C;  1UEB A;  4A75 A;  1SRO A;  3FMC A;  4RFB A;  2ZJQ A;  3VR4 A;  4RKL A;  1JC7 A;  4X64 L;  1IHZ A;  1FD7 D;  1J5E L;  3DWP A;  2OQK A;  1FVI A;  4A3L G;  5G3L D;  3I3C A;  3MXP A;  4DV0 L;  4DV3 L;  1PYS B;  3W1B A;  4GNX A;  4C2M B;  5D65 A;  4IFD H;  1GUG A;  4FXK C;  2VS1 A;  1HR0 L;  4WJW A;  4DR3 Q;  3PO3 G;  1PH6 A;  2UXD L;  4DK1 A;  3BG3 A;  2DNC A;  2ZXR A;  2D9U A;  5I2Y A;  3EA6 A;  2E5L Q;  1JQY D;  3BVM A;  3KBG A;  1IKL A;  2AQ2 B;  1H9S A;  1Y1W H;  2OTJ A;  1A2T A;  1SYE A;  3AFQ A;  1OO9 B;  1EY7 A;  5C4Z A;  3STB D;  2JA8 B;  5IP7 G;  2ZTE A;  4GNX C;  4YCV A;  4CDC C;  4MTK A;  2C9O A;  4Z9C B;  4DR2 Q;  1EFW A;  5KIX A;  5M3M G;  3GTQ B;  4ZCK A;  4J1M A;  5E1F A;  3HOV H;  1XYI A;  1I94 Q;  5E7N A;  1AN8 A;  1LTT D;  3QG1 A;  5DM7 3;  4YY3 Q;  1E3P A;  1LV9 A;  1SMX A;  1A3V A;  3GTL B;  2Z1C A;  3T1H Q;  1NNX A;  4DK3 C;  3BZD B;  4DNI A;  1B4O A;  3DUZ A;  4CJ0 B;  4N9P A;  4IO9 A;  1PFM A;  4QMG A;  1QE6 A;  2F0J A;  3FRP B;  3IAY A;  2BE5 D;  4DNR B;  2D2C C;  2KJX A;  1PH1 A;  2O5J C;  3KYH C;  1W2B A;  4JI5 Q;  4LUO A;  3SGI A;  4IUP A;  4PMB A;  3G7L A;  4PG3 A;  1SYF A;  5IYB G;  1YVC A;  3P20 A;  4BY7 H;  2Z6K C;  1PRT D;  4ZRZ A;  2EYL A;  4CKE A;  1U4M A;  1ZYR C;  5IGG A;  5FLM G;  5JEA H;  5JJZ A;  3DEO A;  4DV1 L;  1HNX L;  2WII B;  3H0G G;  4ODG A;  4JBW A;  1JIC A;  1D5M C;  3MWY W;  2KEE A;  5IT9 c;  4XIG S;  3VR6 A;  4MTN A;  3GV6 A;  4A3G H;  1GOZ A;  3VYS A;  2VZA A;  2F0Q A;  2R3Z A;  3MFG A;  1TWA B;  5K36 H;  1U4R A;  4V0B A;  4MNO A;  4ZAI A;  3SR1 A;  1SLJ A;  2RQX A;  3CF5 A;  1GXD C;  3EVQ A;  2WAQ G;  2J7Z A;  4ZKC B;  1LT3 D;  1J6Q A;  3WWV A;  3MHB A;  1LAC A;  1ZEQ X;  5A35 A;  3GTO B;  1Z47 A;  4B3M Q;  4NXN Q;  2B8G A;  1QB5 D;  1VMP A;  4F8M A;  3M3Y H;  3KDF B;  1DD2 A;  2I07 B;  4IUV A;  2OCE A;  4IFD I;  4CBV A;  4OWX B;  5C0X H;  2V1C C;  2KOL A;  5HGQ A;  2AHO B;  2RSO A;  4JI6 L;  3BJU A;  1A62 A;  2K14 A;  5KRU A;  4DAY A;  1SRU A;  1HNZ Q;  4L63 B;  2B2U A;  4CKB A;  1AH9 A;  4XQJ A;  4IUQ A;  2MO0 A;  2LKV A;  1GUS A;  2JEA I;  4RGT A;  1DOK A;  1F9S A;  2CKZ B;  5GQO A;  4C3H H;  1GUO A;  3PQI A;  2DN8 A;  3BVG A;  3JC6 6;  3HOW H;  4BBS G;  3NTK A;  1VQM A;  4OX9 Q;  2QA4 A;  1ASZ A;  1X3Q A;  2V4D A;  3H3V H;  1HA5 A;  3SEB A;  2NN6 H;  2FMM A;  3KDF A;  4E6I A;  1NCV A;  5EPJ A;  3F2D A;  2L55 A;  1VQI A;  4QGU A;  1VQD A;  1A3U A;  5CMD A;  2MQH A;  2R6G A;  3D6W A;  3C46 A;  4TSS A;  3OHX C;  4H7B A;  1HPC A;  5KYL A;  1ENC A;  1BCP C;  4CHT B;  2NWG A;  4DFA A;  5T1G A;  2EOT A;  5CV8 A;  4G7Z C;  2LXK A;  5BR8 Q;  1CA5 A;  1RD9 D;  2NVY H;  3I73 A;  1C0A A;  3A8I E;  3VR3 A;  3ICE A;  2NVT H;  2D0O A;  4IPG A;  4BY1 H;  3NPP A;  3CCJ A;  1HJP A;  3JAM L;  3IL8 A;  2F0I A;  3CKI B;  2K5N A;  2ZTD A;  2KVM A;  5NUC A;  4A3I H;  2UXB Q;  3K0X A;  5C3E H;  3NXW A;  4K8J A;  2VY3 A;  1FJG Q;  1STE A;  2PI2 E;  4OO1 H;  4AYB B;  4NPS A;  1PZI D;  1MBY A;  1GUT A;  3AQQ A;  3KUP A;  4ZK9 B;  2NUC A;  2ENB A;  1Q46 A;  1PA6 A;  5IOC A;  5BN5 A;  3HOZ G;  2RBM A;  3NWT A;  2I5H A;  2A6E C;  1LLR D;  5KNB A;  4DUZ Q;  3I4N G;  3J81 L;  4X3K A;  4H13 C;  3F8T A;  4JI0 L;  1L0X B;  3S2D B;  3NSW A;  4XXE A;  1B8A A;  1QVG A;  4K2K A;  4FF4 A;  2R7D A;  1VQC A;  1GHJ A;  2I0Q A;  2CWP A;  3K59 A;  1S72 A;  4IN3 A;  5IP9 H;  2ATW A;  2EY6 A;  1N8R C;  4A76 A;  4RCO A;  4JI1 L;  2E2I H;  4EQO A;  5C3W A;  1SE4 A;  3DHQ A;  1BO0 A;  2DJF C;  3FP9 A;  5EJW A;  4DR6 Q;  3S1Q B;  3S2H H;  4R8I A;  2K28 A;  1V1P A;  3DEP A;  3KLR A;  4A3D H;  3D4W A;  3I4O A;  2H1E A;  5CV7 A;  2LS0 1;  2F4I A;  2JA6 H;  3A74 A;  5M3F G;  1TY2 A;  5LHY 1;  4A93 B;  3G6J B;  1BNZ A;  3KLS X;  4A3M B;  5C4J H;  1YJ9 A;  1XMQ Q;  3K81 C;  1L1O B;  1TS4 A;  2SNM A;  3BU2 A;  4ZUJ A;  2VB3 X;  3J7Y W;  4DNT B;  4WFN 3; 
#chains in the Genus database with same CATH homology
 4C1N I;  2NN6 I;  4KY5 A;  4G7O C;  5A2Q L;  5EKI A;  3J80 E;  4WOR A;  2IPK D;  3HOV B;  2RSN A;  4HAE A;  3O13 A;  1G91 A;  3NP8 A;  5I9P A;  5IGB A;  2PPB C;  1EU3 A;  2K33 A;  2DY8 A;  4ID6 A;  3L3O C;  2PZT A;  2F0W A;  3A56 A;  5K36 G;  4KY7 A;  1KNE A;  3T51 B;  3SE0 A;  4CGY B;  1ESR A;  1VF7 A;  2XWJ B;  3P7J A;  3I4M B;  1Q12 A;  2BDO A;  4L8J A;  2EJG C;  3A8J E;  1PZJ D;  2EY1 A;  3GO5 A;  2TMP A;  1FYC A;  1HTP A;  4X3U A;  2QIL A;  3MXN A;  3A7A B;  1RCV D;  2KCN A;  1FGB D;  1LTS D;  4A3G B;  1SNM A;  1SXT A;  3K5L A;  4F87 A;  4BBR B;  4HMI A;  2EYO A;  1KNA A;  1VCI A;  3M7N A;  1DYQ A;  2B2W A;  4TRD A;  4MN3 A;  4NW2 A;  1RTN A;  1AEX A;  2IW3 A;  1I6H B;  4OHJ A;  2F03 A;  4QUF A;  1DCZ A;  1HA6 A;  3M7G A;  1ZKO A;  2CW0 C;  1J8I A;  2PNR C;  4LJZ C;  1R9T B;  1M8A A;  5CR3 A;  5CYU A;  2L9H A;  3LX0 A;  1RF2 D;  3OOC A;  1JOK A;  3V2T A;  3TZU A;  3T13 A;  4KHZ A;  4K8I A;  4Q0F A;  5C0X J;  5C5M A;  3KF8 A;  3R93 A;  3VYT A;  1JOQ A;  3HS0 C;  3S9W A;  5COY A;  3PIP 3;  1SYD A;  2L4N A;  1EY6 A;  2IX3 A;  4KJN A;  5T1I A;  4XQN A;  1CQF A;  1VMC A;  3BDO A;  4QUC A;  5C4H A;  4A3I B;  3W3A A;  3R2I A;  3D4R A;  2LMC B;  1S5E D;  1SEB D;  3A54 A;  1S4Z A;  2F0U A;  1FNV A;  5C5L A;  4KD3 A;  4DXF A;  4C3J B;  5K5P A;  1D2B A;  4DF7 A;  4XDX A;  4KI0 A;  5I4D A;  2F0V A;  1EZ8 A;  5IGC A;  5EKL A;  2RVL A;  2ID0 A;  3URY A;  2KA7 A;  4FXG C;  4NMZ A;  1LTB D;  2B2V A;  3NTH A;  4DK0 A;  1MI2 A;  1NR2 A;  3ERO A;  4WRD A;  2MP1 A;  1D6E C;  4B9W A;  3Q0A A;  3KLS A;  4U68 A;  1SJE D;  2MGS A;  3FEW X;  2EYH A;  3GQB A;  4H0L C;  1ESF A;  2EDG A;  2QCP X;  2JA6 B;  2BOS A;  4FF1 A;  1PTO F;  1ENF A;  2PO4 A;  3M4O B;  3CU7 A;  5C4J B;  1CT1 D;  2B2V C;  2NYZ D;  3C1F A;  4LAA A;  4RGN A;  2F3V A;  1STG A;  4XTC S;  5I6W A;  3FPU B;  3S1R B;  1R4P B;  3L7Z C;  3HOU B;  1C4Q A;  2BA0 A;  1SYB A;  5EPL A;  3OWE B;  5E4X A;  2WKD A;  5DM6 3;  5IIF A;  2FFK B;  3HG9 A;  3K57 A;  1SNQ A;  2JSO A;  3I91 A;  1IKM A;  3IFD A;  1H9S B;  3RD4 A;  3D31 A;  1PFN A;  2D5D A;  3HOX B;  1RDP D;  2NB0 A;  1TWG B;  2AUK A;  5CC4 A;  1STN A;  4R8N A;  3I8Z A;  2GA4 B;  1SNP A;  2SEB D;  3W2D A;  1G29 1;  2A69 D;  1EY9 A;  4KTA A;  1Q1E A;  5M5Y B;  1WTQ A;  1A2U A;  4IZ8 A;  2MHV A;  1H9K A;  4Q5V A;  1SMY D;  3BYT B;  5CV4 A;  1G8Z D;  2QKI C;  2A74 C;  4DA2 A;  5KNC A;  4XYQ A;  2HDL A;  1WD0 A;  1JOO A;  4ZKB B;  1MSG A;  1EQV A;  2Y0S B;  1ILP A;  1JCK B;  1PTO C;  1DOM A;  5FLX E;  1F9P A;  1SNC A;  3NBI A;  2ICI A;  2XSC A;  1LAB A;  2Q8R E;  1NUC A;  2TSS A;  1B1Z A;  1QJO A;  2IX0 A;  1ET6 A;  1WTP A;  2EYM A;  1Y8O B;  1BCP F;  4ULL A;  1DJR D;  2QF7 A;  1B9N A;  1TQO A;  1S5C D;  1M4V A;  3EJI A;  4HSV A;  3R3O A;  2FHT A;  3DXJ C;  2VXW A;  2VB2 X;  1HQR D;  1ONL A;  1XXG A;  1D1I A;  3GD7 A;  1YNN D;  5E3F A;  3GV3 A;  3PUV A;  3VA5 A;  3U9S A;  2R92 B;  1JOR A;  4FP5 D;  1BF4 A;  3NWS A;  1I4G A;  1BDO A;  1TWC B;  4K6L A;  2F0E A;  1K8M A;  1BCP B;  2F0S A;  3K6O A;  5M3M B;  5JPN C;  1TKW B;  1LT6 D;  2IWH A;  3RZO B;  2EVB A;  2G9D A;  4QIW B;  3ITP A;  2KQ3 A;  2SNS A;  3VYU A;  1IW7 C;  1RJT A;  4RA8 A;  1CTM A;  1JWM D;  3CRL C;  4FF2 A;  4C3I G;  1I4Q A;  4GZY C;  1X3P A;  4QF4 A;  2B2T C;  4DN4 M;  1TY0 A;  3BDC A;  5D3D A;  2EPB A;  3OIQ A;  5M5X B;  4HSP A;  1SE2 A;  2MJ8 A;  1SFO B;  1YNJ C;  4C1N K;  2WAC A;  4IQZ A;  3KBX A;  3H0G B;  5CBA E;  4QB4 A;  2XRS D;  1DON A;  1IL8 A;  5F2D A;  4HTH A;  3NBH A;  4RH6 A;  2JEB I;  1QIL A;  3EFX D;  5CGK A;  5J39 A;  1EYA A;  3N6R A;  4KKS A;  2OF1 A;  1E0B A;  2XVS A;  2WAQ B;  3HKZ B;  1JWS D;  1J9O A;  5CV5 A;  3UI2 A;  3Q24 A;  2XRQ D;  3LNN A;  5BN4 A;  3GP7 A;  3HRZ C;  3IFT A;  5IOD A;  1L0Y B;  4ABN A;  1HCZ A;  3S1M B;  4IFD G;  5D14 A;  1TS3 A;  4Y7N B;  1K83 B;  2G9H D;  4A3J B;  2K01 A;  1H9M A;  2FJ2 A;  2F0P A;  1EFI D;  5FO8 B;  2A68 D;  2JP1 A;  2EYF A;  3HGB A;  1V1P B;  4BBS B;  5ISR A;  2L5T A;  2F0L A;  2EYJ A;  3SK6 A;  2B63 B;  3MFY A;  4BWG B;  2MUY A;  4XT1 B;  2JXM B;  1MGS A;  1SND A;  4PMW A;  3HZX A;  1GHK A;  3F2U A;  4FF3 A;  3D3R A;  1JB3 A;  1O80 A;  1B9M A;  5C0X I;  3MTS A;  3TP7 A;  4MHE A;  1I6V C;  1F9R A;  1TWH B;  1ILQ A;  3HOZ B;  2E75 C;  4FYD A;  5JOB A;  2A73 B;  4I65 A;  1OXT A;  3MXU A;  2QEJ C;  3I4N B;  4K6D A;  2EJF C;  4RCN A;  4CJ1 B;  1MD2 D;  3CRK C;  1FNW A;  5JEA G;  4RHS A;  2IX1 A;  4B9X A;  4EQN A;  2M00 A;  1QNU A;  1ROD A;  4L6T B;  2A69 C;  1EZ6 A;  4RKB A;  3TN2 A;  1CZG A;  3SK5 A;  4FVM A;  2F0D A;  3AU7 A;  2O2L D;  1SMY C;  3SK4 A;  4OO1 I;  3PIO 3;  4K5X A;  1U4P A;  4ZYS A;  1E2W A;  2KUM A;  4P2C B;  3D8G A;  2LFN A;  4KHV A;  1Z6H A;  1EQT A;  5TSS A;  3LWU A;  5C0X G;  2LY7 A;  2WV6 D;  3J7A F;  1I4X A;  2F0H A;  3T16 A;  4DAP A;  5DAU A;  2CHB D;  1WTO A;  2BDN A;  2SOB A;  1C48 A;  2E2J B;  2IJ0 A;  3MAQ A;  1VDZ A;  1KAA A;  1NSN S;  1B44 D;  3AMU A;  3MC0 B;  4C3H G;  1SYG A;  2BE5 C;  2R7Z B;  2IT1 A;  3NE5 B;  3NQI A;  3ND9 A;  2AWO A;  3HOY B;  2EY5 A;  2KED A;  2NN6 G;  1RKN A;  1II3 A;  1OXU A;  2K03 A;  2B8F A;  3GTM B;  2EY2 A;  3HEJ A;  1CA6 A;  3X3M A;  3J7A V;  1PRT C;  4K5V A;  1EWH A;  4B08 A;  1YNN C;  3PUY A;  1EU4 A;  2AQ3 B;  3MXG A;  3MVV A;  1W6J A;  2A5H A;  3QO2 A;  1PZK D;  1A15 A;  3RMH A;  4DU9 A;  1EYC A;  4OO1 G;  3NQT A;  1AFP A;  4RWS C;  5FK9 C;  3OPO A;  2PW7 A;  3V96 A;  2DNE A;  3DM1 A;  1EIG A;  4KJO A;  5C44 B;  3K7A B;  3I4L A;  1CZW A;  2PZW A;  1WCM B;  1SAP A;  3VR5 A;  3GTK B;  2F0O A;  3FPP A;  3V05 A;  1TWF B;  3VR2 A;  5M9O A;  5ELE A;  3DWA A;  1PMR A;  5CV6 A;  3S1N B;  2RDH A;  4DAV A;  1LTI D;  4R9W A;  2HDM A;  4XT3 B;  4KY6 A;  2B2Y C;  1EYD A;  1I3Q B;  4IUU A;  5EQ0 A;  4G7H C;  3QIA A;  2I46 A;  1OXV A;  3M4Y A;  1PDQ A;  4F88 A;  1A6X A;  4EVO A;  3J80 L;  1EY8 A;  2PMZ B;  3FDT A;  1O7L A;  3L9A X;  1BCP D;  1DOL A;  3PUW A;  1BR9 A;  3H91 A;  3KK7 A;  3HP3 A;  1VF5 C;  5CV9 A;  4M1U B;  2XIW A;  5KYI A;  3H3V C;  3E0J A;  4PV1 C;  1Q8I A;  2ZT9 C;  3K5O A;  5HGT A;  1SSO A;  4KN4 C;  1Y69 U;  3T4A C;  1E2V A;  2A6E D;  2BCO A;  1EEF D;  1PXU A;  3DWQ A;  3K5M A;  2K7V A;  3D4D A;  1HFN A;  1EOT A;  5EBD A;  1O7Y A;  1SE3 A;  3PV0 A;  3P75 A;  3TP5 A;  3TBI B;  1TII D;  5J22 A;  4KV6 A;  2K1B A;  3A8K E;  4KKU A;  1CI3 M;  4OIJ A;  1F2Z A;  4A3F B;  1SNO A;  1H9J A;  2HQE A;  2AUJ D;  4PNY A;  5COR A;  1JWU D;  1SYC A;  4KMU C;  2N55 A;  1PTO B;  1LT4 D;  2EYP A;  4FO2 A;  5ELC A;  1V43 A;  3SXH A;  1B3A A;  1QG7 A;  1PLF A;  1E2Z A;  4N9T A;  3FKI B;  2JA7 B;  5LL6 X;  2RDG A;  2E2D C;  4QCL A;  3K5N A;  1KLU D;  5JPM C;  3WDN A;  3SVM A;  2M9V A;  2K04 A;  3OMC A;  4HCE A;  5EGT A;  1KTK A;  2WB1 B;  4ME5 A;  4S3S A;  2L0C A;  1XX8 A;  5IGE A;  1G2S A;  1R4Q B;  3T53 B;  5C3X A;  1ML0 D;  1GUW A;  3JAM E;  2C5C A;  1LTR D;  2OXP A;  2WP8 J;  4KD4 A;  1EY5 A;  4JK1 C;  1TS2 A;  5AFW A;  2Z8L A;  1Y1V B;  4IUR A;  3SHL A;  1HRJ A;  1SJH D;  1UNS A;  2F0G A;  3PUZ A;  1KDA A;  2X6L A;  4NP5 A;  3S16 B;  1D1K A;  5FO7 B;  3E5S A;  3C1E A;  3A7L A;  2NZ1 D;  1A3T A;  2HCC A;  1O7Z A;  1LTA D;  4A3K B;  1CHP D;  2AQ1 B;  2R93 B;  3OMG A;  3J81 E;  1AZP A;  2YU9 B;  3I70 A;  3X3N A;  2OEO A;  1Y8P B;  3OIP A;  2PZU A;  3TDQ A;  3ND8 A;  3PMF A;  2J4X A;  3CHB D;  4YIJ A;  5ELD A;  3PO3 B;  1S5D D;  2KEC A;  2YYZ A;  1STA A;  4M8A A;  4O1N A;  3BS1 A;  1NR4 A;  2ZXO A;  1ENA A;  2D62 A;  2NVQ B;  4NKL A;  1S5B D;  3QB3 A;  3RZD B;  4U67 3;  2Z4H A;  5HUR A;  1WTX A;  2B2T A;  4DXG A;  1CQV A;  3MZ5 A;  2DY7 A;  2PYK A;  4HN7 A;  5D3I B;  4FXD A;  3BDL A;  5E4W C;  2CW0 D;  4XYO A;  3OSO A;  2EXZ A;  4A3B B;  1G2T A;  2F0T A;  3ONA B;  4K5W A;  1KLG D;  3NHH A;  3C2P A;  3K0Y A;  3GTJ B;  2NVX B;  4RAU C;  5A2Q E;  3CQZ B;  1Y8N B;  1AP0 A;  5KGU A;  2KCC A;  3TSS A;  2K6A A;  3OW7 A;  3R8B A;  3H09 A;  2EZV A;  4CJ2 C;  1SBB B;  4LMQ D;  3S14 B;  1CHQ D;  1CFM A;  3P1H A;  1D5X C;  2QDB A;  2K5W A;  2F3W A;  2Z4I A;  1QWY A;  4TKO B;  3H94 A;  3I90 A;  2OT2 A;  5FKA C;  1EY4 A;  1EWC A;  5G3L F;  4MIU A;  5EKK A;  2PW5 A;  3DMU A;  1WVL A;  3IKJ A;  1F2Y A;  2B2U C;  5DNF A;  1TU2 B;  1NAP A;  2N88 A;  4RHR A;  4I7Z C;  1KDC A;  1U9R A;  4C3I B;  3TZD A;  4IUT A;  4F7X A;  4X3T A;  1WTV A;  3S17 B;  1F2L A;  4RGM A;  1QCB D;  1OXX K;  4PQX A;  4PMC A;  5FLX L;  5I6Y A;  1I50 B;  4H44 C;  4EQP A;  4KKT A;  3RUZ A;  1DZ1 A;  2CVR A;  3MEH A;  4HMJ A;  1C8C A;  2BA1 A;  2FMC A;  4EGV A;  1X32 A;  2EJM A;  1F9Q A;  1STY A;  4UAI A;  5KND A;  4J8Q A;  2F0F A;  1CK1 A;  1LO5 D;  1TS5 A;  1EEI D;  3GTP B;  3ZYY X;  1WTW A;  1Q1B A;  1BXT A;  4O42 A;  5KEE A;  1GUN A;  2XNA C;  1LTG D;  3VYR A;  1STB A;  2M2L A;  2J0T D;  1EIH A;  1I4P A;  2XWB B;  4RGO S;  2X6G A;  4DGZ A;  2PCF B;  1IYU A;  1OXS C;  4K2L A;  4J6H A;  1DXM A;  1PRT F;  4CKC A;  3K58 A;  1STH A;  4ZLT F;  1HUN A;  2K05 A;  2SDF A;  2A6H D;  1S5F D;  1UUP A;  3C3L A;  1EL0 A;  1UAP A;  3WOE A;  1Y1W B;  1HHV A;  1B2T A;  5JAV A;  1PTO H;  1UEA B;  2O5I C;  4IFD J;  1ET9 A;  2FIN B;  5FOB B;  4XQQ A;  5J1Z A;  2HUG A;  2HCI A;  1PRT B;  5DEH A;  4G4K A;  1SDF A;  5FO9 B;  1ZXT A;  1I4R A;  3T56 B;  5IT9 E;  2E74 C;  1Q90 A;  1TR5 A;  3LWE A;  1MSH A;  1TT2 A;  3SDZ A;  2AWN A;  4IUN A;  1U4L A;  2RA4 A;  5M3F B;  1BUV T;  2X69 A;  4BA1 I;  1TVX A;  1RHP A;  2R61 A;  2K32 A;  2NTT A;  2NTS A;  1PTO D;  2MPM A;  2RDF A;  2IL8 A;  1IYV A;  4X3S A;  3Q23 A;  1QNK A;  1XWE A;  3RLF A;  4BY7 B;  2JE6 I;  5C6A A;  4KK7 A;  2VNU D;  3VA7 A;  1QOH A;  1BQQ T;  2L12 A;  2Q8I B;  1EY0 A;  5EPK A;  1B50 A;  2H4O A;  3SK8 A;  5ELF A;  5IGD A;  1I4H A;  4FNF A;  4HR7 B;  5ELB A;  3QJY A;  2E76 C;  4V19 0;  3Q6S A;  5I9O A;  1BBX C;  1ZYR D;  1HFG A;  3Q22 A;  5JVH 3;  1GJX A;  1FNU A;  1ICW A;  5JEA J;  1H9R A;  1G6Z A;  3H6M A;  1V8Q A;  3NK9 A;  1JE4 A;  3M3Y B;  2Q8T A;  1K8O A;  2PQE A;  2L1B A;  1O78 A;  2L11 A;  1Z7T A;  4OGQ C;  1KAB A;  4C3J G;  4HED A;  5IGF A;  2B2Y A;  1IW7 D;  2B39 A;  3BYY B;  1F77 A;  1CM9 A;  2O4X A;  4C3H B;  2RKS A;  2XN9 C;  3HOW B;  2F0M A;  3TP6 A;  3I72 A;  2B2W C;  5EBC A;  1W6K A;  1PFB A;  1T5E A;  3NTI A;  5CBE E;  1Q3L A;  5I2X A;  4ZUI A;  1HQM C;  1FR3 A;  5C4X B;  2K5D A;  5JVG 3;  4BS9 A;  2JA5 B;  2NVY B;  3BVZ A;  3A55 A;  2NVT B;  2KHS A;  3GTG B;  4BY1 B;  1HTL D;  4HCS A;  3TME A;  1V1O A;  3PO2 B;  3FVQ A;  4NDX A;  5LL6 S;  1YNJ D;  4OL7 A;  4TQU S;  3AB9 A;  3S15 B;  5C3E B;  1F2M A;  4KN7 C;  1WTR A;  1AZQ A;  3N52 A;  3D6C A;  2ZXP A;  3QOL A;  4K14 A;  1B53 A;  4UDU C;  1XTC D;  1DM0 B;  1D5Z C;  2CQA A;  5BN3 A;  3U9O A;  5IT9 L;  3WOF A;  3TP8 A;  3E6Z X;  4BA2 I;  1BOS A;  1RTO A;  1AW7 A;  2F1M A;  1T5X D;  4ILW A;  3QOJ A;  4G57 A;  2F0N A;  2E2H B;  3PUX A;  4C56 C;  2A68 C;  2NBF A;  2WIN B;  2VUM B;  2E2I B;  2F0K A;  4ZQ3 A;  3NUC A;  1LT5 D;  2JYO A;  4LK1 C;  1JR0 D;  1PYW D;  3S2H B;  3M85 A;  4A3D B;  3MA2 B;  2ICE C;  1HXY D;  4A3E B;  5M5W B;  3OWF A;  1HUM A;  2WKC A;  3QWN A;  1KDB A;  3ERQ A;  4IAL A;  3R2T A;  1WD1 A;  3EQL C;  4OIK A;  2EE1 A;  2K5Q A;  2A6H C;  3FMC A;  4RFB A;  3VR4 A;  4RKL A;  1JC7 A;  1IHZ A;  1FD7 D;  3DWP A;  5G3L D;  3I3C A;  3MXP A;  4C2M B;  5D65 A;  4IFD H;  1GUG A;  4FXK C;  4WJW A;  4DK1 A;  3BG3 A;  2DNC A;  2ZXR A;  2D9U A;  5I2Y A;  3EA6 A;  1JQY D;  3BVM A;  3KBG A;  1IKL A;  2AQ2 B;  1H9S A;  1A2T A;  1SYE A;  1OO9 B;  1EY7 A;  5C4Z A;  2JA8 B;  2C9O A;  4Z9C B;  5KIX A;  3GTQ B;  4J1M A;  5E1F A;  1XYI A;  1AN8 A;  5DM7 3;  1LTT D;  3QG1 A;  1LV9 A;  1A3V A;  3GTL B;  2Z1C A;  3BZD B;  1B4O A;  3DUZ A;  4CJ0 B;  4N9P A;  1PFM A;  4QMG A;  1QE6 A;  2F0J A;  3FRP B;  3IAY A;  4DNR B;  2BE5 D;  2D2C C;  2KJX A;  2O5J C;  4IUP A;  4PMB A;  3G7L A;  1SYF A;  3P20 A;  1PRT D;  4ZRZ A;  2EYL A;  4CKE A;  1U4M A;  1ZYR C;  5IGG A;  5JEA H;  5JJZ A;  3DEO A;  2WII B;  4ODG A;  4JBW A;  1JIC A;  1D5M C;  3MWY W;  2KEE A;  4XIG S;  3VR6 A;  3GV6 A;  1GOZ A;  3VYS A;  2F0Q A;  2R3Z A;  3MFG A;  1TWA B;  5K36 H;  1U4R A;  4V0B A;  4ZAI A;  3SR1 A;  2RQX A;  1GXD C;  3EVQ A;  2J7Z A;  4ZKC B;  1LT3 D;  3MHB A;  1LAC A;  1ZEQ X;  5A35 A;  3GTO B;  1Z47 A;  2B8G A;  1QB5 D;  1VMP A;  4F8M A;  1DD2 A;  2I07 B;  4IUV A;  4IFD I;  4CBV A;  5C0X H;  2KOL A;  2RSO A;  5KRU A;  4DAY A;  4L63 B;  2B2U A;  4CKB A;  4XQJ A;  4IUQ A;  2LKV A;  1GUS A;  2JEA I;  4RGT A;  1DOK A;  1F9S A;  1GUO A;  2DN8 A;  3BVG A;  3NTK A;  1X3Q A;  2V4D A;  1HA5 A;  3SEB A;  2NN6 H;  2FMM A;  4E6I A;  1NCV A;  5EPJ A;  2L55 A;  5CMD A;  1A3U A;  2R6G A;  3D6W A;  3C46 A;  4TSS A;  3OHX C;  4H7B A;  1HPC A;  5KYL A;  1ENC A;  1BCP C;  4CHT B;  2NWG A;  4DFA A;  5T1G A;  2EOT A;  5CV8 A;  4G7Z C;  1CA5 A;  1RD9 D;  3I73 A;  3A8I E;  3VR3 A;  3NPP A;  3JAM L;  3IL8 A;  2F0I A;  3CKI B;  2KVM A;  5NUC A;  3NXW A;  4K8J A;  1STE A;  4OO1 H;  4AYB B;  1PZI D;  1MBY A;  1GUT A;  3KUP A;  4ZK9 B;  2NUC A;  2ENB A;  5IOC A;  5BN5 A;  2RBM A;  3NWT A;  2A6E C;  1LLR D;  5KNB A;  3J81 L;  4X3K A;  4H13 C;  1L0X B;  3S2D B;  3NSW A;  4XXE A;  4K2K A;  4FF4 A;  1GHJ A;  3K59 A;  4IN3 A;  2EY6 A;  4RCO A;  4EQO A;  5C3W A;  1SE4 A;  3DHQ A;  1BO0 A;  5EJW A;  3S1Q B;  4R8I A;  2K28 A;  1V1P A;  3DEP A;  3KLR A;  3D4W A;  2H1E A;  5CV7 A;  2LS0 1;  2F4I A;  1TY2 A;  5LHY 1;  4A93 B;  3G6J B;  1BNZ A;  3KLS X;  4A3M B;  1TS4 A;  2SNM A;  4ZUJ A;  2VB3 X;  3J7Y W;  4DNT B;  4WFN 3; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...