3OWFA

Crystal structure of staphylococcal nuclease variant delta+phs v66r at cryogenic temperature
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
135
structure length
135
Chain Sequence
b'ATSTKKLHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMRENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thermonuclease
publication title Domain swapping promoted by a single mutation that introduces an ionizable group into the hydrophobic core of a protein
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 34
structure length 135
sequence length 135
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2010-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3owfA00
2F0GA 4DF7A 4K8JA 3MVVA 1A3TA 2F0DA 2PZTA 2EXZA 5C5LA 1KABA 1SYGA 5E1FA 4KV6A 2EYFA 1EYAA 4ZUIA 4J6HA 4KD3A 4R8NA 2M00A 2F0IA 1SYFA 1KDBA 4KY7A 4IUNA 3MHBA 3OSOA 3OMCA 4K2KA 4NP5A 4B9WA 5CV7A 5C6AA 3S9WA 3TP8A 2EYLA 5CGKA 4KY6A 1NUCA 2RBMA 3TP6A 2OXPA 5IGBA 3RUZA 2EYMA 2F0LA 4I65A 5CR3A 5CV8A 1STNA 2EYPA 4K6DA 5DEHA 2OF1A 3TP7A 2F0JA 1EQVA 3NUCA 1F2ZA 4OL7A 4EQPA 4EQOA 5IIFA 1A2TA 2F0FA 3C1EA 5I6YA 3NHHA 1KDCA 3DMUA 2F0VA 4MIUA 1F2YA 2PZWA 2F0UA 1EY9A 4QB4A 1U9RA 3SXHA 5KRUA 5M9OA 1F2MA 1SYBA 3EROA 3NK9A 3TP5A 1A3VA 2EYOA 3SHLA 5CC4A 4TRDA 1KDAA 1EYCA 4DGZA 4ODGA 3BDCA 3SR1A 4N9PA 4PNYA 4S3SA 3P1HA 4LAAA 1EZ8A 3OMGA 4ZQ3A 2KHSA 1EY6A 3QOLA 4K14A 4RKBA 5EKKA 1STGA 5J1ZA 1SNDA 3NQTA 4E6IA 1EY4A 2EY1A 5C4ZA 5IGFA 4QMGA 2OEOA 2O4XA 3MEHA 4N9TA 4ME5A 4H7BA 5CV9A 2EY2A 5HGTA 5IGGA 1SNQA 5I6WA 5KGUA 1SNCA 1II3A 1EYDA 3QB3A 3V2TA 2PQEA 2SNSA 1A2UA 2F0HA 2PW5A 1TT2A 2EY5A 2WACA 2LKVA 2QDBA 3E5SA 3LX0A 4IZ8A 5CV5A 3T16A 4B9XA 1STBA 4KHVA 4KJOA 3VA5A 4QF4A 5KEEA 5KYLA 2F0TA 3NP8A 3DHQA 4YIJA 2F0SA 3BDLA 2F3VA 4PMCA 3D6CA 1RKNA 2ENBA 1TQOA 5C3WA 4IALA 4DU9A 5C5MA 4EVOA 3H6MA 5IODA 4K5WA 2PW7A 3SK5A 3C1FA 1EY0A 1STAA 4NDXA 2KQ3A 1ENAA 1STYA 5CV4A 1ENCA 4NKLA 5K5PA 2F0QA 5J22A 3NXWA 4KY5A 4K5VA 5ISRA 3EJIA 5EKLA 4K2LA 5IGEA 1JORA 4RKLA 5IGDA 2PZUA 1SYCA 2RDFA 2F0NA 1SNMA 3ERQA 2F0EA 4K5XA 4EQNA 4HMIA 3P75A 4NMZA 1SNOA 3MXPA 2EY6A 4J1MA 4PMBA 3D4WA 1JOQA 4ZUJA 2HQEA 3D8GA 1JOKA 5KIXA 2PYKA 4HTHA 1AEXA 3HEJA 1A3UA 2F0WA 4KJNA 5I9PA 3T13A 5KYIA 2EYJA 5E3FA 5C4HA 4WRDA 2F0PA 5NUCA 1EY5A 4F8MA 1EY8A 4DFAA 4G57A 3SK8A 2F3WA 4KTAA 1IHZA 5J39A 1NSNS 4K8IA 4HMJA 5DAUA 2SOBA 2F0MA 1KAAA 5JOBA 2NUCA 3SK4A 2F0OA 5C3XA 5I9OA 1SYEA 4ID6A 1EZ6A 2EYHA 2RKSA 3MZ5A 4WORA 3EVQA 4F7XA 5F2DA 1SNPA 5EGTA 5JAVA 5HURA 3ITPA 3U9OA 1SYDA 2SNMA 1STHA 3SK6A 3TMEA 3D4DA 1JOOA 3HZXA 5IGCA 1EY7A 3OWFA 3QOJA 5CV6A 3PMFA 3R3OA 4KD4A 5IOCA 1TR5A 2F0KA
chains in the Genus database with same CATH superfamily
4LFCL 5FK9C 3KLSA 1HNZQ 4DXFA 5D14A 3M4OB 1I4XA 1SYGA 1KXLA 2WKDA 2EYFA 3T1HQ 3BVZA 3T53B 3HFZB 4GLAC 1RF2D 3OSOA 4C3JB 4DR7L 4BBRH 5DLQE 2JN4A 2CVRA 2NTTA 1OXSC 4JI3L 4BS9A 2QDLA 1JJCB 2PQAB 3K5NA 2ZXPA 5M3FG 1QVCA 2ZTDA 1XPOA 3MFGA 3MEFA 2RDHA 2JEAI 3PQIA 1V8QA 4RCNA 1LTID 2N88A 4A3GG 1SYBA 3R8BA 1K28A 3TZUA 2HHHQ 3A56A 4CJ1B 5AJ3Q 3GV3A 4JYAQ 4CJ0B 4BY1H 1BXTA 1HZBA 2FFKB 3HKZE 4A93B 1LTGD 3QJYA 1YEZA 2K01A 3BVMA 3NE5B 4QMGA 1R9TH 1HR0L 5IGGA 4YY3L 1EYDA 1PFMA 2GVBA 3U50C 1H9KA 1N33L 2LKVA 3KF6A 2F0TA 3NP8A 1M8AA 2K52A 1VS0A 1RKNA 2JJQA 2CKZB 2JA7B 4UHVA 1V1PA 4Q5VA 4A3EB 1SE4A 1JWMD 1OXVA 1PRTD 1PYBA 3MXNA 3T51B 1WD0A 4JBJA 3HOWB 2ZJQA 4YCWA 3ERQA 3F2BA 3KLWA 4HMIA 2XN9C 3HS0C 1PYSB 1JOQA 1ML0D 2HQEA 4NB3A 3NTIA 2MJ8A 1Q82C 3HOVG 1PV4A 3PGZA 4DK0A 5FLXc 3CRKC 5DAUA 4L8JA 3ULLA 1K73C 4X64Q 1M4VA 5T1IA 1GJXA 2VW9A 2R7FA 5CORA 2OQKA 2VB2X 3GTQH 2IT1A 2R7ZG 3T16A 4JI6L 4L5QA 4OX9Q 2Z6KC 3ICEA 2KOLA 4JVZA 4KV6A 3PUZA 1HFNA 1K8AC 4HJ5A 2KCNA 1SYFA 4GOPA 1WJJA 3K5LA 4K2KA 4DV4L 2KEEA 1ENFA 4YHHL 4JPBW 1MIUA 4B3TL 1EYGA 2EYMA 2QGQA 1GUWA 3HKSA 1N36Q 1L1OA 1JE4A 3S14H 4LF7Q 1BCPC 2N55A 1YBYA 1X6OA 3OPOA 3HOZG 3PO3H 1MBYA 3I4NB 5ELFA 5M9OA 3OOCA 2R61A 3VA7A 4DGZA 1DGSA 4IFDJ 3I8ZA 3MXGA 4HCSA 4DUZQ 4OWWB 2GVAA 4A3KG 4DR6Q 3M7NA 3GD7A 3I4MB 3VR6A 1EY4A 2ICIA 3U9SA 5IYCH 1EOVA 2LSSA 1SNCA 1RL2A 3V2TA 4DR1L 2K5HA 1ZXTA 3FVQA 1E24A 3A74A 1IKLA 4CJ2C 4WFN3 1X65A 3H3VC 1HTPA 5M5WH 1EY0A 2J0TD 1ENCA 1FJGQ 3OYYA 2G9HD 1Q86C 3S17B 2MP1A 5ISRA 3JAML 4B3MQ 4LMQD 4K2LA 2ASBA 2RSNA 1JJGA 2JP1A 2MHVA 2F0NA 2VUMG 3TS2A 1JCKB 1LLRD 3SVMA 1XYIA 1S72A 1E2ZA 3HEJA 5I9PA 4FYDA 3H09A 4XIGS 1F9SA 2EYJA 3S2DH 2VL6A 1D8LA 3A7LA 2Q8IB 2SOBA 1C0AA 1HHVA 5F2DA 3LWEA 3HOXG 1EQTA 3CCQA 1XMQL 1SROA 2B2UC 2B63B 4XT1B 2MO1A 1E2WA 3D4DA 1S5ED 1AE3A 3KJOA 3QOJA 4KD4A 2OTLA 3UE1A 4RHSA 1OXUA 4NXMQ 3TQYA 1V9PA 2F0IA 5GAGC 1KDBA 5C6AA 3S9WA 1CFMA 2E75C 5FOBB 4ZCKA 2LMCB 1Y1WB 3AFPA 2ATWA 1UEAB 4TQUS 5IGBA 2FXQA 1W6JA 4HSVA 1IBLQ 2RSOA 5M5XB 2A6HD 2OF1A 2I46A 3FPPA 4DNTB 4PZ7A 3DWQA 3DMUA 2NVXH 1G91A 1XTDA 1U9RA 3NQIA 4JI4Q 3NK9A 5IT9E 3QO2A 4R4IA 3CRLC 1TWFH 3DUZA 4A3DB 2R92H 1Y1VH 2D0OA 3J81c 4KLKA 2SEBD 4APVA 4LF8L 1S5CD 1RHPA 3OW2A 1Y1VG 4RKBA 3K5MA 3BZCA 5JJIA 4LNQA 4GNXC 1NAPA 4X3UA 2D0PA 1ICWA 1TT2A 4RMFA 1VQBA 2QDBA 1EEFD 4B9XA 5IP9H 2UUBQ 4KHVA 4OWXB 3K59A 1TY0A 1PTOH 5EJWA 4YIJA 4QUFA 3D6CA 1QOHA 5IP9G 3ER0A 4ZKCB 4A3BH 1CKOA 4XYQA 1CUKA 2PW7A 4NDXA 4DAMA 1JJ2A 1I50H 5J22A 1K3BC 2NB0A 5C0XH 1N34L 4G7OC 3GTOB 1W3SA 5EQ0A 1U4MA 5IGEA 3M4QA 2WAQB 3DM1A 2Y0SG 2ZM6Q 4UP7A 3UDIA 3W5OA 5H1SE 3S16B 2FHTA 4DV5L 4A3FH 3PO2G 3D6WA 4ULLA 2JA6H 1U4RA 4FF2A 2BA1A 5BR8L 1R4QB 4A3CG 1Q12A 2ZTEA 1XMOQ 2JA5H 1VQMA 3STBD 4DR2Q 4C3IG 2DJGC 1L0YB 1VDZA 1YNNC 4CKEA 4ID6A 4X3TA 2JQOA 1G6ZA 4GOPC 1B3QA 1HA5A 3AMUA 1PYWD 1L0XB 2D5DA 5C4XG 4POFA 4BY7H 1PRTB 1YZ6A 5KNCA 4OEMB 4AQYQ 2BE5D 4NXNL 1DZ1A 1L1OC 5E4WC 4XDXA 2E2IB 4YCUA 4FDBA 4NP5A 2B8GA 4OXPA 4GKKQ 3FP9A 1X3EA 4DPGA 1KIXA 5M3MB 1LM0A 2AQ3B 5C0XI 2Q2UA 2HD3A 4JW0A 1UE5A 4OWTB 3CF5A 4WJWA 1DYQA 5I2XA 3FKIB 2VZAA 1D6EC 4R1JA 1F2YA 4JG2A 1MKHA 3LWUA 5EBDA 1E1TA 3NBHA 1BCPF 2F4VL 1O80A 1AW7A 3SEBA 1S3OA 3CCEA 4MN3A 4ZQ3A 3R93A 1TS4A 3G6JB 3RN2A 2WP8J 1EWIA 1PH2A 1J8IA 1WTHA 2K6AA 5A2QL 4DN4M 5LHY1 5DNFA 3CQZH 1ASYA 5KGUA 3HOYB 5C3EB 3HOUG 1WTOA 3Q6SA 1KRSA 4IFDG 4X65Q 4DV1L 1STEA 4O1NA 4KKSA 5C4JB 4P74A 3M4YA 4DV2Q 4KHZA 5C3WA 4DV0Q 2MGSA 4A3MG 3OTOQ 3ERSX 4AYBB 2IX1A 3C1FA 2A73B 1IW7D 1IZ6A 5CV4A 1ENAA 4DNIA 5IYDG 2XTIA 3NWSA 3LNNA 2KCTA 3ZJYC 1T5XD 4LF9L 3EJIA 1A63A 3Q8DA 2TMPA 4LF4Q 1IKMA 4QY7A 1IBML 2O5IC 5AFWA 4CDCC 3D4WA 3T4AC 2KHIA 2CH4A 3WWVA 5C44G 2R93G 1FYCA 2F0WA 1ASZA 1E1OA 1LUZA 4ILWA 1EY5A 3H0GH 3RZOB 5GADC 1B44D 4A3IH 1D1KA 1NSNS 3PSIA 2K05A 2DGYA 1LTTD 4X62L 2IJ0A 5LMNQ 5C3XA 1LT3D 2K4KA 1G291 1VQIA 1SNPA 2F3IA 4C56C 5KNBA 4HIOA 4RFBA 2E76C 3SK6A 2QEJC 4R9WA 4L6TB 3PMFA 4FVMA 4GLVB 1JB7A 1QB5D 2IPKD 4JCVE 3EQLC 2Q2IA 1B8AA 5E1FA 5FO9B 4JBMA 4XYOA 4MHEA 3MHBA 1VQ6A 1ONLA 1FNUA 3ND8A 1U5KA 1VQPA 1QILA 5DM73 1CSQA 1HZ9A 4IPCA 1VQ7A 1NUCA 4G7ZC 3PIP3 3P20A 1NCVA 4JI8Q 1TWGB 4K6DA 4M1UB 2XRSD 4TVAB 4ZYSA 4IJLA 3I91A 4C3JG 2CH4W 1E7ZA 1JC7A 4QB4A 4JBKA 2JA8H 1SXTA 3I72A 4Y7NH 2E2HH 4C2MH 1G8ZD 3SR1A 2JA8G 1S5DD 2PNHA 1SFOH 2C5CA 3BJUA 2J7ZA 4RCOA 3UDGA 4A3JB 4HIMA 2N78A 2H1EA 5CV9A 4N9TA 3K0XA 1PH7A 1SEBD 1VQCA 2F0HA 2PW5A 1G2SA 3DEPA 4R4TA 1I6HH 4BBSH 3C2PA 1GVPA 4A93G 2A68D 3E0EA 1HQMC 2J4XA 1TS2A 2A6ED 3PUXA 1W2BA 1M90C 4WJ4A 3BZDB 1WFQA 3KYHC 3GTJB 3S1RB 1YNJC 2KCMA 2WB1B 5I2YA 1MHWC 2HT1A 3C46A 1SYCA 5GROA 3SGIA 2QCPX 4C1NI 1AZQA 2JA7G 2EY6A 3MWYW 4B3SL 4JI2Q 4A3EG 2K28A 1NBWA 4C3HH 4G7HC 5KIXA 1EFWA 1TWCB 4HTHA 2A74C 2CW0D 1PHJA 3HOWG 2ES2A 4LFBQ 2A1AA 1WVLA 3OHXC 3KUPA 2E74C 4XT3B 2F0OA 1EU4A 1K0RA 1ICFB 1SN8A 2C35B 4GS3A 3HZXA 1JOOA 1KRTA 1QCBD 4DAPA 2F0GA 4DF7A 3MVVA 1HNZL 1X3GA 2QF7A 1MSHA 3NWTA 2I5LX 4LJZC 3T1HL 4R8NA 2M00A 1E3PA 4B9WA 4FXKC 2UU9L 2FINB 1SR3A 1TWHB 2QA4A 1SE2A 1I6VC 1WTRA 4EQOA 2Z4IA 1UUPA 1EIYB 3GTKB 3J7ZC 2L5TA 4OO1I 2XSCA 3W3AA 1AZPA 2MUYA 3TP5A 4F87A 5IYBG 1EIGA 5AJ3L 1CKNA 2JEBI 5LL6S 1MJEA 1XNRQ 4S3SA 1YHAA 4U68A 1EZ8A 4DAYA 2B2UA 3B6YA 1KNAA 1M1KC 3I4LA 1LYLA 5M3FH 5GAHC 3H91A 2GA4B 3I4NG 1SE3A 2F0KA 1I94L 1HCZA 1YI2A 3M3YB 3E5SA 2E2DC 4IZ8A 4A3GH 2UXBQ 1TS5A 5FO7B 4KJOA 3VA5A 1W6KA 4QF4A 4UDUC 5KYLA 1BOSA 2KEDA 1I4RA 4RGNA 2ZJPA 2UUCL 4PMCA 3I4MG 1CA5A 2LS01 1K8GA 1STYA 3GTMB 1K83B 3QIAA 4QIWB 1I3QH 5GQOA 4UP8A 3M4PA 4DAVA 3U58A 4BXXG 4LFCQ 3P75A 1PH4A 3Q23A 1D5MC 1FR3A 3G48A 1ESFA 1YJ9A 1YJNA 1AEXA 4KJNA 4X66Q 2YU9H 1BR9A 1Y8PB 2F3WA 3J81i 1TS3A 1KD1C 1N32Q 5JJLA 5K36G 2VNUD 3D0FA 4GNXA 5IT9L 3HG9A 4O2DA 3A8KE 3CCSA 3TMEA 2WAQE 3J7A5 1R4PB 2VQFL 3OWFA 4KN7C 2QW7A 1H9SB 5D3DA 3KF8A 4RAUC 1MI2A 4DXGA 4K8JA 3HOVH 4F88A 1JR0D 2A5HA 1VQHA 2NZ1D 3DXJC 2BA0A 2B63G 2AUKA 3D31A 3TRZA 1GUSA 1DXMA 3NEMA 1Q81C 3RN5A 4IO9A 1I4QA 2K5NA 2MQHA 3UDFA 2HCCA 1HR0Q 1XX8A 2R7ZH 4YY3Q 3EIVA 1LT5D 1PFBA 1V43A 2KBNA 1QVFA 1E0BA 2N8NA 5EPKA 1PRTC 1FVIA 4LF7L 1EOTA 1Y1WG 1KTKA 2HUGA 2B2YC 2MFIA 1P8LA 4A3LG 2QILA 3I7FA 1QZGA 1BDOA 1Y8OB 1K8OA 3KJPA 4DUZL 2JE6I 3S1MH 1B53A 3J80c 2ZT9C 1CHPD 3J7AF 4PG3A 5FLXE 1S40A 1EL0A 1OXTA 4TSSA 4A3DG 1XXGA 5I6WA 2AWNA 1C48A 3HOZH 3LX0A 4NPSA 2CFMA 3DHQA 1NE3A 1PH9A 3DWAA 3S2HB 5KNDA 1YVCA 4ZRZA 1L2FA 4Y52H 1PVOA 1SRUA 4A3KH 1YHBA 3SK5A 3L2PA 3GTPH 1FJGL 2F0QA 4MNOA 1VQKA 4ABNA 2V4DA 3AB9A 2D2CC 2I5HA 2PZUA 1VQ9A 3MXPA 4GN4B 2N3SA 4BBRB 4DV6L 4LF6L 4R4CA 2PYKA 5KYIA 1A3UA 2ZXOA 5C4HA 5L37A 3RLNA 2WAQG 3SK8A 1IHZA 4YHHQ 3DWPA 2L1BA 4B3TQ 1PTOD 2IW3A 2PQAA 2VUMH 3UDXA 1EY7A 1PDQA 1X3FA 5CV6A 3W1GA 1XNQL 1TU2B 1TKWB 1B9MA 2JSOA 4BY1B 3E9HA 3L7ZC 4GN5A 1JB3A 3D4RA 4NXML 4QJFA 4L5RC 2Y0SE 3A0JA 3E3XA 2L4NA 1R9TB 3HOXH 1DM0B 1BKBA 1IBLL 2CQOA 4HJAA 3G4SA 2EYPA 1HNXQ 2WV6D 1O7LA 5IIFA 2IHEA 4XTCS 1NTGA 2F0FA 2EJFC 1ET9A 4DR1Q 2O5JC 1KDCA 2LXJA 4LF5L 3P7JA 2F0UA 1UAPA 3RR5A 1B9NA 2HDMA 3BDOA 5KRUA 5M3MG 1TY2A 3F2CA 1VQ8A 3KDFA 1S5FD 3OMGA 5FLMG 1P16A 4DV3Q 1D5ZC 3FKIG 2L0CA 4ZLTF 3Q22A 1KNEA 5EKKA 2L15A 5FKAC 5CBEE 4LW1A 1QG7A 1GUGA 5IT9c 1B50A 2EY1A 1LT6D 1UWVA 2O4XA 4DV7L 4LFAL 4K0KL 1QUQB 2Q8RE 3K7AH 4X3SA 3A8JE 4HEDA 4ZUJA 2PO4A 4JI0Q 1FGBD 2UUBL 2F03A 1IBKL 1V1QA 1O7YA 1TWAH 3BDLA 4OELB 2NBFA 3H6MA 5IP7G 4KHPL 1KAWA 3HOYG 5C3EG 2KQ3A 3BS1A 3GTQB 2DNCA 4EX5A 3H3VH 4R8IA 2ZM6L 5JEAG 3QG1A 5IGDA 5ELDA 2NWGA 3I90A 4NMZA 1SNOA 4PMBA 4AYBG 2DY8A 4HAEA 2VQEL 4YWMA 2A6HC 3QWNA 1CZGA 2K7VA 3T1YL 3S15H 2NVTH 1XMOL 1Q3LA 4FXGC 4IPGA 3VYRA 2B2WC 4B3RL 3SK4A 2F0MA 1KAAA 1Z47A 4JC0A 3NSWA 3HKZB 4H13C 3G71A 1GUOA 3MZ5A 3S14B 3EVQA 5JAVA 2K04A 2WB1E 1IXRA 3VYSA 1DD2A 3OIPA 3PO3B 3PO2H 3I4OA 3J81E 4JK1C 2EIFA 2IX3A 1J5EQ 3J7AV 2PMZB 2F0DA 2AMCB 4A3CH 1HA6A 5C5LA 4AQYL 4L63B 1D2BA 4C3IH 1FNVA 2K03A 3IKJA 3S1QH 4KY7A 3ULJA 4HIKA 2Z4HA 5CYUA 1QVGA 4LF8Q 5JVH3 1CSPA 1RTOA 4QL5A 5C4XH 1B7YB 2YTVA 3H3VI 1PZKD 2K1BA 1G2TA 1AN8A 2HDLA 4DK6C 3RNUA 1PH5A 1VQLA 2NZHA 2AKWB 5M5WB 4O42A 5G3LD 5FJ8G 2M2LA 3NPPA 2NTSA 1TVXA 2EYOA 1PRTF 4DR3L 1LABA 4IUPA 1HNWQ 3RMHA 3RZDH 4K14A 2E5LQ 3STBC 3J7YW 2UXDQ 1WCMH 3JAMc 3CD6A 3A5UA 2RCFA 2UUAQ 3CAMA 3S2DB 3KLSX 2DNEA 1II3A 1WCMG 3F2DA 5BR8Q 4MZ9A 1HJPA 3S1NH 4X65L 1Q8KA 1CZWA 4CBVA 4A3JG 1K8MA 4DV2L 1SAPA 5I4DA 4DV0L 4YWLA 2KENA 3NTHA 4EVOA 5IODA 2JYOA 2BE5C 4DA2A 1T9HA 3CPFA 1JQYD 5M5YH 2HIXA 2RHQB 3G7LA 1MD2D 3CPWA 4K5XA 3HOUH 3HRZC 4LF4L 4IFDH 1YJWA 4J1MA 2CWPA 3TZDA 1VQ4A 4NXNQ 1CQVA 1SE8A 3VYTA 4A3MH 2WB1G 5NUCA 4F8MA 4A4IA 4CKCA 5IYDH 2B8FA 4IUVA 3CC2A 2IY5B 5LMNL 2NVYH 2NYZD 2UXCQ 5LL6X 5EGTA 2NVXB 5HURA 4KKTA 1LV9A 4L5TA 1Q46A 1TWFB 5C44H 2R92B 2R93H 1Y1VB 2KHJA 3GTGH 4CDEC 2NN6H 3PF4A 3AU7A 1A62A 2A69D 2E2JH 2VY3A 1UE1A 2NN6G 5CBAE 4H02A 5E4XA 2KA7A 1OXXK 1HFGA 1O78A 5LMNW 5JPMC 3GTLH 1IW7C 1PTOB 2F0JA 4FO2A 3A5ZB 4KMUC 3V05A 2XRQD 2N49A 5ELNA 4A3BB 4EGVA 3A55A 4IFDI 1H9RA 1VQFA 4IJHA 2HQLA 5ELEA 1I50B 3S24A 1X3QA 2K5DA 2NVQH 1A3VA 2TSSA 2H5XA 1XPRA 1PH1A 2L9HA 5EPJA 3RLOA 4ZAIA 1CKNB 3M4OH 1RODA 4B08A 4A3FB 2K5WA 5JJZA 4LF9Q 2JA6B 4JI1Q 4DNRB 3H94A 4C1NK 2DUDA 1SMYD 4C3JH 2R7DA 2B2TA 2EJMA 3NTKA 4H7BA 2JA5B 3IAYA 4BA1I 2FMMA 2PQEA 2RCNA 4DR4L 1ZKOA 1GUNA 2XVSA 2Q2TA 1LTBD 2F3VA 3K6OA 3BYTB 4PV1C 2CHBD 4IPDA 1ILQA 4GKJQ 4JBWA 4BY7B 4DUYQ 3TEHB 4NKLA 1SDFA 2H4OA 3NXWA 1U4LA 1JORA 1RIPA 5GAEC 1B70B 2VS1A 3UE0A 1Q1BA 1VQEA 2B2YA 2G9DA 4A93H 1VQNA 4JV5L 3R2IA 1E2VA 2AHOB 1JOKA 1BUVT 1HH2P 2WIIB 2DN8A 4JI5L 4CKBA 4LFBL 1EY8A 3KF6B 4KTAA 3E9IA 4HIDA 5JOBA 3AYHB 4OONA 4WORA 4XQQA 1V1PB 3J80i 3K0YA 1WTPA 4J15A 3K8AA 4DR5Q 2JA7H 4A75A 4HJ9A 2B29A 3MXNB 4JI7L 4A3EH 4XQJA 1VMPA 1A3TA 3MC0B 3HOWH 3PIPA 4BWGB 1KABA 1JT8A 4RGOS 1K0SA 5JPNC 4HN7A 5FLXL 2YYZA 1NR2A 3I70A 1KHIA 2EE1A 4DK1A 1PFNA 5CV7A 1KLGD 2VXWA 3ULPA 2EYLA 2A68C 3CQZB 1GKHA 1VQJA 3M7GA 1LO5D 2F0LA 3BG3A 4I7ZC 4R4QA 5JJKA 3W1BA 3U4VA 2A6EC 2IX0A 4Q0FA 1PH6A 2PCFB 2B39A 1HXYD 1NNXA 2B2VA 1HZAA 1FD7D 2PZWA 4OO1G 1EY9A 3MFYA 5J39A 3EROA 3L9AX 2CQAA 3G6EA 4MTNA 1XNRL 1D1IA 1ZYRD 5ELCA 4LAAA 1DONA 2CW0C 5IWAQ 4GOPB 1NMGA 1OTCA 2OTJA 1U0LA 1NY4A 1YITA 3N52A 2OCEA 1KLUD 4RWSC 4RGTA 5HGTA 4OHJA 2K5VA 3H0GB 3RD4A 4A3IB 2EY5A 2Z0SA 2UXBL 5CV5A 1L1OB 1WTQA 1STBA 5IYBH 5KEEA 2EZVA 1X32A 3HGBA 5A2QE 4HR7B 1CA6A 2BDOA 2HHHL 5FO8B 1DOLA 4AH6A 4JYAL 3I4NH 4LWCA 3KFUA 3GO5A 5HGQA 1LTAD 5LMUQ 4X6AH 5EKLA 3IRBA 2BCOA 1SNMA 3FDTA 3WOEA 3CCLA 2MNAA 1EQRA 5JEAJ 2MPMA 3I4MH 4X66L 2K33A 1UE7A 3GP7A 3K81C 3GQBA 1EEID 3TS0A 1ILPA 2VB3X 1Y14B 2UU9Q 3ND9A 1PFSA 4N8X1 2RHSB 2QEXA 1N32L 1E22A 3GV6A 3I2ZA 4P73A 4BBRG 2EYHA 1WTVA 2PI2E 2QKIC 3ITPA 4BXXH 3A7AB 1HPCA 2JA8B 4Y7NB 1PMRA 3PF5A 2E2HB 3R3OA 4C2MB 4UP9A 5BN4A 3PIO3 3IFDA 2Z1CA 3S17H 1SFOB 2PZTA 4GZYC 1V1OA 3J81j 3NELA 4HCEA 2MO0A 1F77A 1Q90A 4DR7Q 1CM9A 1FNWA 5K36H 1NR4A 1VCIA 1PLFA 3TP8A 3URYA 2R6GA 4OIKA 4KY6A 1N8RC 4BY1G 1IYVA 4QUCA 3WDNA 4JI3Q 2FJ2A 1Y69U 4ZK9B 3RLFA 4X64L 4BBSB 1I6HB 1KL9A 5EAYA 3TP7A 2ID0A 5A35A 1I94Q 1B2TA 2JXMB 3AFQA 3C1EA 2PMZE 3AEVA 3CCUA 1QNKA 5C0XJ 2B2TC 2Z9HA 2B63H 2B2WA 2BDNA 3CHBD 3K7UC 2UUCQ 4OX9L 2Z8LA 3A54A 1C9OA 1G6PA 4N9PA 1CK1A 1Z7TA 4IQZA 3JC66 2WKCA 3KDFB 2BH8A 3QOLA 3WOFA 4AIMA 3BYYB 3CW2C 5D3IB 4C3HB 1WTXA 3MAQA 2OEOA 1SSOA 2KUMA 4LK1C 1N9WA 2EY2A 1GXDC 1ET6A 1Y1WH 1N36L 5ELBA 2X69A 2YTXA 4V190 1HR0W 1N33Q 5M5XH 3CCMA 1Z6HA 1IL8A 4J8QA 4A3LH 1JICA 3J81L 1TQOA 4IALA 3T56B 1IYUA 1BBXC 1YNXA 2EVBA 3PIOA 3FHWA 2L11A 1JWUD 4KY5A 4K5VA 1BCPD 4DR6L 1EWHA 4KKUA 4POGA 3I56A 3EN2A 2VQFQ 4A3DH 4RKLA 1I5FA 2Q2HA 1AFPA 2LFNA 2AQ2B 1BF4A 3D8GA 3D3RA 3T13A 4WRDA 2G5DA 4QQBX 2EJGC 2I07B 3FEWX 3F1ZA 1U4PA 1MSGA 5BN3A 3VR2A 2HCIA 2ZTCA 3U9OA 2SNMA 1STHA 4H0LC 4XXEA 4B3ML 4RGMA 3JAMi 4M8AA 1BBUA 1TXYA 3PCOB 4JI6Q 2B3GA 1DOMA 3FMCA 1DOKA 2EPBA 3Q24A 3GTOH 3J80E 3HKZG 1S5BD 5CMDA 1XWEA 4P75A 3S16H 1WOCA 4P2CB 4ZUIA 2D62A 3VYUA 5M3FB 3PO3G 2B2VC 1Y8NB 2IWHA 4IUNA 4JOIA 4CHTB 4ME3A 3PUWA 4DV4Q 3MA2B 4AYBE 5CGKA 1BQQT 1RD9D 4UPAA 3TP6A 4A3GB 2XIWA 3PV0A 2KECA 3I3CA 1HNXL 4PQXA 3NUCA 4OL7A 4EQPA 4FP5D 3X3MA 1PH3A 3FPUB 3KK7A 1F2LA 4NW2A 5IYCG 2ALYB 4I7AA 2Q8TA 3M85A 1I3QB 2RDGA 3I73A 1EYCA 3SE0A 1HZCA 4PNYA 3P1HA 1PA6A 4DV3L 3CKIB 4P72A 3X3NA 1EY6A 2KJXA 4X3KA 2E2IH 2AWOA 4KN4C 5J1ZA 4E6IA 5C4ZA 3MEHA 2KVMA 1PTOC 2YU9B 5EBCA 4DV6Q 4LF6Q 1VQ5A 5EPLA 5M3MH 2JA9A 4JI0L 1X3PA 3AQQA 1XTCD 4JI4L 3E6ZX 4V0BA 5FLMH 1Q1EA 3FKIH 4ZKBB 2RF4A 3NBHB 5T1GA 4HJ7A 2XGTA 4TKOB 1K9MC 2DJFC 4HJ8A 4EQ5A 2AUJD 4RG1A 3HOVB 1H9SA 2WFWA 5DM63 3CC7A 3ZYYX 1XNQQ 1EU3A 1SLJA 1QNUA 1ESRA 4IUUA 3CC4A 1SMXA 2L55A 1X56A 5IP7H 3HOYH 5C3EH 2RA4A 4G4KA 2R7ZB 4CDFC 4IURA 1C8CA 1C4QA 2NUCA 3TREA 2RKSA 5C4JH 5JEAH 1XMQQ 3DM3A 4H44C 2ZJRA 1J6QA 1PZID 3TDQA 5IGCA 2K32A 1AE2A 2F4IA 1BVSA 3L0OA 4TRDA 1X9NA 1IL2A 1O7ZA 1BO0A 1VMCA 3L3OC 1J5EL 4LF5Q 1LTLA 3CMAA 1T5EA 3CMEA 2EXZA 3KLRA 3S1MB 2F52A 1Q8IA 3H15A 1SBBB 4PMWA 1KQSA 4DR2L 3CCVA 1LACA 4UAIA 5IY0A 2FMCA 2R92G 3HOZB 1QJOA 4L5SA 2OXPA 3VR5A 2F1MA 3ONAB 1STNA 4LFAQ 3OWEB 4DV7Q 1I4GA 3K5OA 3NENA 3RZOH 4K0KQ 2KCCA 1I4PA 1I4HA 4ALPA 4A3KB 3O13A 4MIUA 3GTPB 1IBKQ 1YNND 5CC4A 3SHLA 3DEOA 3K57A 4ODGA 1IYJB 4KHPQ 2XNAC 1RTNA 5D65A 1LTRD 5HY6A 1QWYA 4GKKL 1HNWL 4A3BG 1A6XA 1AP0A 4RHRA 2E5LL 1EIFA 2YTYA 2UXDL 5C0XG 5IGFA 1A0IA 4ME5A 3EBEA 2UUAL 5FJ8H 2VQEQ 3IL8A 1A2UA 2WACA 1TWGH 4MTKA 4PZ6A 4A3FG 3T1YQ 2JA6G 1H9JA 2VUMB 4B3RQ 1UNSA 3K58A 5C5MA 2L12A 2K75A 4GLXA 1HRJA 2JA5G 1RJTA 1B3AA 1STAA 1WI5A 4YCVA 4HSPA 3A8IE 1N34Q 1MJCA 1VQAA 3TN2A 4QCLA 4QGUA 1DCZA 2F0EA 4DV5Q 4PZ8A 1DJRD 3SDZA 1HUMA 5JVG3 4A3JH 4BY7G 3FRPB 3IFTA 1O7IA 3HOXB 1Q7YC 2CCZA 4BA2I 2F0PA 1S4ZA 4DFAA 1NJIC 4FF1A 1QZHA 3OTOL 4LUOA 1GOZA 4IUTA 5I9OA 4F7XA 2UXCL 3GDEA 4RA8A 1YHQA 4JOIC 3U4ZA 1WD1A 1LTSD 5IOCA 1BCPB 2LY7A 3GTJH 3S1RH 2V1CC 2OWOA 1CHQD 3JAME 4KD3A 3E0JA 4DR3Q 1Z9FA 5COYA 1F9PA 2E8GA 3NBIA 1KC8C 5TSSA 3W2DA 2JK8A 4A76A 2P5ZX 1TWCH 1GM5A 3K7AB 4WJ3M 1VF7A 2RBMA 2SDFA 4FF4A 4IOAA 4QIWE 3RUZA 2CWAA 5CR3A 4FF3A 5DEHA 2GN5A 4IPHA 1QUQA 3K80C 3N6RA 1EQVA 3CCRA 1TWAB 1A2TA 1RCVD 2HIVA 2XWJB 3LGJA 1VF5C 3CXCA 2K5QA 1LT4D 1WYDA 1X54A 3CP0A 2R3ZA 1VQOA 1VQGA 1EUJA 3SXHA 3VDYA 1PXUA 2F4VQ 1D5XC 3PUYA 1FGUA 2PI2A 4LUZA 4KI0A 1BBWA 1STGA 4JI1L 1XPUA 1F9RA 4JI8L 1D7QA 1L0WA 3S15B 1SJED 2NVTB 1SNQA 1TWHH 1A8VA 2IL8A 2SNSA 1OO9B 4DV1Q 1F9QA 1MGSA 1PTOF 2D9UA 3DLLA 2Y0SB 4KK7A 2ENBA 1SJHD 3GTKH 1H95A 1NMFA 3TSSA 3EA6A 3PO2B 4K5WA 2YV5A 4GKJL 3H0GG 2OQ0A 4DUYL 1QE6A 5K5PA 4A3IG 2A69C 2EXDA 3F2UA 4DAYB 1JMCA 2RQXA 2EQSA 3QR8A 1GHJA 4C3IB 2I5MX 5EKIA 3S1QB 1IBMQ 2BH2A 4YWKA 2O2LD 5E3FA 3VR3A 5BN5A 5C4XB 4N8FA 2NZOA 1VQDA 4G57A 2NN6I 3HP3A 4CDDC 3M3YH 4OGQC 1EFID 4HMJA 4X62Q 2I0QA 4IN3A 4DK3C 2K50A 4DR5L 1EQQA 4FNFA 5ELOA 4XQNA 2X6LA 3GTMH 1K83H 1TR5A 5E7NA 1SMYC 4JI2L 2IHFA 4DKAC 1JE5A 2WINB 3RZDB 1A15A 1EYAA 1UEBA 4J6HA 3OMCA 1WCMB 1YNJD 1H9MA 3OW7A 1CT1D 5J3BA 1CKMA 3KBXA 3BVGA 4I65A 5CV8A 3S1NB 4R4OA 1F2ZA 2A8VA 2Z6KA 4GNXB 1AH9A 1YIJA 5I6YA 3NHHA 4U673 1EIHA 1B4OA 4DR4Q 2F0VA 1CTMA 3KF8B 2EOTA 1GHKA 1F2MA 1CI3M 4BBSG 2A19A 1KDAA 4CGYB 4FXDA 5M5YB 3BDCA 3TBIB 2ICEC 4P71A 1XJVA 3HOUB 2KHSA 5IWAL 3C3LA 3KBGA 4IUQA 4IOCA 4RH6A 3KOJA 3R2TA 2AQ1B 3VR4A 1UE6A 1CQFA 1SNDA 3NQTA 1WTWA 1B1ZA 4OIJA 4A3MB 1HTLD 4LUVA 3QB3A 3CCJA 4JV5Q 4OO1H 2RVLA 3Q0AA 2LXKA 2X6GA 5IE8A 2NVYB 4JI5Q 1ZEQX 3PUVA 1HQRD 2F0SA 4C3HG 4O0AA 3F8TA 1GO3E 4DU9A 4GN3B 2M9VA 1TIID 1RDPD 1BNZA 4Z9CB 3J80L 3M9BA 2XWBB 1GUTA 1J9OA 5C44B 2R93B 4UY8C 1HUNA 2ZXRA 4K6LA 3GTGB 1EWCA 5LMUL 1G51A 2OT2A 3V96A 3CU7A 1C7YA 2BOSA 4JI7Q 2RDFA 3EFXD 1X55A 4EQNA 2K14A 1PH8A 2E2JB 1GD7A 4B3SQ 2Z6BA 3MXUA 1K3RA 2EDGA 3BU2A 2PNRC 3UI2A 3GTLB 4K8IA 1JWSD 2C9OA 1SYEA 1EZ6A 3OIQA 3S2HH 1FL0A 1ZYRC 1SYDA 1PZJD 5G3LF 2DY7A 2NVQB 2PPBC 3BZKA 3I55A 3MTSA
chains in the Genus database with same CATH topology
5FK9C 3KLSA 4DXFA 5D14A 3M4OB 1I4XA 1SYGA 2WKDA 2EYFA 3BVZA 3T53B 1RF2D 3OSOA 4C3JB 2CVRA 2NTTA 1OXSC 4BS9A 3K5NA 2ZXPA 3MFGA 2RDHA 2JEAI 1V8QA 4RCNA 1LTID 2N88A 1SYBA 3R8BA 3TZUA 3A56A 4CJ1B 3GV3A 4CJ0B 1BXTA 2FFKB 4A93B 1LTGD 3QJYA 2K01A 3BVMA 3NE5B 4QMGA 5IGGA 1EYDA 1PFMA 1H9KA 2LKVA 2F0TA 3NP8A 1M8AA 1RKNA 2JA7B 1V1PA 4Q5VA 4A3EB 1SE4A 1JWMD 1OXVA 1PRTD 3MXNA 1WD0A 3T51B 3HOWB 3ERQA 4HMIA 2XN9C 3HS0C 1JOQA 1ML0D 2HQEA 3NTIA 2MJ8A 4DK0A 3CRKC 5DAUA 4L8JA 1M4VA 5T1IA 1GJXA 5CORA 2VB2X 2IT1A 3T16A 2KOLA 4KV6A 3PUZA 1HFNA 2KCNA 1SYFA 3K5LA 4K2KA 2KEEA 1ENFA 2EYMA 1GUWA 1JE4A 1BCPC 2N55A 3OPOA 1MBYA 3I4NB 5ELFA 5M9OA 3OOCA 2R61A 3VA7A 4DGZA 4IFDJ 3I8ZA 3MXGA 4HCSA 3M7NA 3GD7A 3I4MB 3VR6A 1EY4A 2ICIA 3U9SA 1SNCA 3V2TA 1ZXTA 3FVQA 1IKLA 4CJ2C 4WFN3 3H3VC 1HTPA 1EY0A 2J0TD 1ENCA 2G9HD 3S17B 2MP1A 5ISRA 3JAML 4LMQD 4K2LA 2RSNA 2JP1A 2MHVA 2F0NA 1JCKB 1LLRD 3SVMA 1XYIA 1E2ZA 3HEJA 5I9PA 4FYDA 3H09A 4XIGS 1F9SA 2EYJA 3A7LA 2Q8IB 2SOBA 1HHVA 5F2DA 3LWEA 1EQTA 2B2UC 2B63B 4XT1B 1E2WA 3D4DA 1S5ED 3QOJA 4KD4A 4RHSA 1OXUA 2F0IA 1KDBA 5C6AA 3S9WA 1CFMA 2E75C 5FOBB 2LMCB 1Y1WB 1UEAB 4TQUS 5IGBA 4HSVA 1W6JA 2RSOA 5M5XB 2A6HD 2OF1A 2I46A 3FPPA 4DNTB 3DWQA 3DMUA 1G91A 1U9RA 3NQIA 3NK9A 5IT9E 3QO2A 3CRLC 3DUZA 4A3DB 2SEBD 1S5CD 1RHPA 4RKBA 3K5MA 1NAPA 4X3UA 1ICWA 1TT2A 2QDBA 1EEFD 4B9XA 4KHVA 3K59A 1TY0A 1PTOH 5EJWA 4YIJA 4QUFA 3D6CA 1QOHA 4ZKCB 4XYQA 2PW7A 4NDXA 5J22A 2NB0A 5C0XH 4G7OC 3GTOB 5EQ0A 1U4MA 5IGEA 2WAQB 3DM1A 3S16B 2FHTA 3D6WA 4ULLA 1U4RA 4FF2A 2BA1A 1R4QB 1Q12A 4C3IG 1L0YB 1VDZA 1YNNC 4CKEA 4ID6A 4X3TA 1G6ZA 1HA5A 3AMUA 1PYWD 1L0XB 2D5DA 1PRTB 5KNCA 2BE5D 1DZ1A 5E4WC 4XDXA 2E2IB 4NP5A 2B8GA 5M3MB 2AQ3B 5C0XI 4WJWA 1DYQA 5I2XA 3FKIB 1D6EC 1F2YA 3LWUA 5EBDA 3NBHA 1BCPF 1O80A 1AW7A 3SEBA 4MN3A 4ZQ3A 3R93A 1TS4A 3G6JB 2WP8J 1J8IA 2K6AA 5A2QL 4DN4M 5LHY1 5DNFA 5KGUA 3HOYB 5C3EB 1WTOA 3Q6SA 4IFDG 1STEA 4O1NA 4KKSA 5C4JB 3M4YA 4KHZA 5C3WA 2MGSA 4AYBB 2IX1A 3C1FA 2A73B 1IW7D 5CV4A 1ENAA 3NWSA 3LNNA 1T5XD 3EJIA 2TMPA 1IKMA 2O5IC 5AFWA 3D4WA 3T4AC 1FYCA 2F0WA 4ILWA 1EY5A 3RZOB 1B44D 1D1KA 1NSNS 2K05A 1LTTD 2IJ0A 5C3XA 1LT3D 1G291 1SNPA 4C56C 5KNBA 4RFBA 2E76C 3SK6A 2QEJC 4R9WA 4L6TB 3PMFA 4FVMA 1QB5D 2IPKD 3EQLC 5E1FA 5FO9B 4XYOA 4MHEA 3MHBA 1ONLA 1FNUA 3ND8A 1QILA 5DM73 1NUCA 4G7ZC 3PIP3 3P20A 1NCVA 1TWGB 4K6DA 4M1UB 2XRSD 4ZYSA 3I91A 4C3JG 1JC7A 4QB4A 1SXTA 3I72A 1G8ZD 3SR1A 1S5DD 2C5CA 2J7ZA 4RCOA 4A3JB 2H1EA 5CV9A 4N9TA 1SEBD 2F0HA 2PW5A 1G2SA 3DEPA 3C2PA 2A68D 1HQMC 2J4XA 1TS2A 2A6ED 3PUXA 3BZDB 3GTJB 3S1RB 1YNJC 2WB1B 5I2YA 3C46A 1SYCA 4C1NI 2QCPX 1AZQA 2EY6A 3MWYW 2K28A 4G7HC 5KIXA 1TWCB 4HTHA 2A74C 2CW0D 1WVLA 3OHXC 3KUPA 2E74C 4XT3B 2F0OA 1EU4A 3HZXA 1JOOA 1QCBD 4DAPA 2F0GA 4DF7A 3MVVA 2QF7A 1MSHA 3NWTA 4LJZC 4R8NA 2M00A 4B9WA 4FXKC 2FINB 1TWHB 1SE2A 1I6VC 1WTRA 4EQOA 2Z4IA 1UUPA 3GTKB 2L5TA 4OO1I 2XSCA 3W3AA 1AZPA 2MUYA 3TP5A 4F87A 1EIGA 5LL6S 2JEBI 4S3SA 4U68A 1EZ8A 4DAYA 2B2UA 1KNAA 3I4LA 3H91A 2GA4B 1SE3A 2F0KA 1HCZA 3M3YB 3E5SA 2E2DC 4IZ8A 1TS5A 5FO7B 4KJOA 3VA5A 1W6KA 4QF4A 4UDUC 5KYLA 1BOSA 2KEDA 1I4RA 4RGNA 4PMCA 1CA5A 2LS01 1STYA 3GTMB 1K83B 3QIAA 4QIWB 4DAVA 3P75A 3Q23A 1D5MC 1FR3A 1ESFA 1AEXA 4KJNA 1BR9A 1Y8PB 2F3WA 1TS3A 5K36G 2VNUD 5IT9L 3HG9A 3A8KE 3TMEA 1R4PB 3OWFA 4KN7C 1H9SB 5D3DA 3KF8A 4RAUC 1MI2A 4DXGA 4K8JA 4F88A 1JR0D 2A5HA 2NZ1D 3DXJC 2BA0A 2AUKA 3D31A 1GUSA 1DXMA 1I4QA 2HCCA 1XX8A 1LT5D 1PFBA 1V43A 1E0BA 5EPKA 1PRTC 1EOTA 1KTKA 2HUGA 2B2YC 2QILA 1BDOA 1Y8OB 1K8OA 2JE6I 1B53A 2ZT9C 1CHPD 3J7AF 5FLXE 1EL0A 1OXTA 4TSSA 1XXGA 5I6WA 2AWNA 1C48A 3LX0A 3DHQA 3DWAA 3S2HB 5KNDA 4ZRZA 3SK5A 2F0QA 4ABNA 2V4DA 3AB9A 2D2CC 2PZUA 3MXPA 4BBRB 2PYKA 5KYIA 1A3UA 2ZXOA 5C4HA 3SK8A 1IHZA 3DWPA 2L1BA 1PTOD 2IW3A 1EY7A 1PDQA 5CV6A 1TU2B 1TKWB 1B9MA 2JSOA 4BY1B 3L7ZC 1JB3A 3D4RA 2L4NA 1R9TB 1DM0B 2EYPA 2WV6D 1O7LA 5IIFA 4XTCS 2F0FA 2EJFC 1ET9A 2O5JC 1KDCA 3P7JA 2F0UA 1UAPA 1B9NA 2HDMA 3BDOA 5KRUA 1TY2A 1S5FD 3OMGA 1D5ZC 4ZLTF 2L0CA 3Q22A 1KNEA 5EKKA 5FKAC 5CBEE 1QG7A 1GUGA 1B50A 2EY1A 1LT6D 2O4XA 2Q8RE 4X3SA 3A8JE 4HEDA 4ZUJA 2PO4A 1FGBD 2F03A 1O7YA 3BDLA 2NBFA 3H6MA 2KQ3A 3BS1A 3GTQB 2DNCA 4R8IA 5JEAG 3QG1A 5IGDA 5ELDA 2NWGA 3I90A 4NMZA 1SNOA 4PMBA 2DY8A 4HAEA 2A6HC 3QWNA 1CZGA 2K7VA 1Q3LA 4FXGC 3VYRA 2B2WC 3SK4A 2F0MA 1KAAA 1Z47A 3HKZB 3NSWA 4H13C 1GUOA 3MZ5A 3S14B 3EVQA 5JAVA 2K04A 1DD2A 3VYSA 3OIPA 3PO3B 3J81E 4JK1C 2IX3A 3J7AV 2PMZB 2F0DA 1HA6A 5C5LA 4L63B 1D2BA 1FNVA 2K03A 3IKJA 4KY7A 2Z4HA 5CYUA 5JVH3 1RTOA 1PZKD 2K1BA 1G2TA 1AN8A 2HDLA 5M5WB 4O42A 5G3LD 2M2LA 3NPPA 2NTSA 1TVXA 2EYOA 1PRTF 1LABA 4IUPA 3RMHA 4K14A 3J7YW 3S2DB 3KLSX 2DNEA 1II3A 1CZWA 4CBVA 1K8MA 1SAPA 5I4DA 3NTHA 4EVOA 5IODA 2JYOA 2BE5C 4DA2A 1JQYD 3G7LA 1MD2D 4K5XA 3HRZC 4IFDH 4J1MA 3TZDA 1CQVA 3VYTA 5NUCA 4F8MA 4CKCA 2B8FA 4IUVA 2NYZD 5LL6X 5EGTA 2NVXB 5HURA 4KKTA 1LV9A 1TWFB 2R92B 1Y1VB 2NN6H 3AU7A 2A69D 2NN6G 5CBAE 5E4XA 2KA7A 1OXXK 1HFGA 1O78A 5JPMC 1IW7C 1PTOB 2F0JA 4FO2A 4KMUC 3V05A 2XRQD 4A3BB 4EGVA 3A55A 4IFDI 1H9RA 5ELEA 1I50B 1X3QA 2K5DA 1A3VA 2TSSA 2L9HA 5EPJA 4ZAIA 1RODA 4B08A 4A3FB 2K5WA 5JJZA 2JA6B 4DNRB 3H94A 4C1NK 1SMYD 2B2TA 2EJMA 3NTKA 4H7BA 2JA5B 3IAYA 4BA1I 2FMMA 2PQEA 1ZKOA 1GUNA 2XVSA 1LTBD 2F3VA 3K6OA 3BYTB 4PV1C 2CHBD 1ILQA 4JBWA 4BY7B 4NKLA 1SDFA 2H4OA 3NXWA 1U4LA 1JORA 1Q1BA 2B2YA 2G9DA 3R2IA 1E2VA 1JOKA 1BUVT 2WIIB 2DN8A 4CKBA 1EY8A 4KTAA 5JOBA 4WORA 4XQQA 1V1PB 3K0YA 1WTPA 4XQJA 1VMPA 1A3TA 3MC0B 4BWGB 1KABA 4RGOS 5JPNC 4HN7A 5FLXL 2YYZA 1NR2A 3I70A 2EE1A 4DK1A 1PFNA 5CV7A 1KLGD 2VXWA 2EYLA 2A68C 3CQZB 3M7GA 1LO5D 2F0LA 3BG3A 4I7ZC 2A6EC 2IX0A 4Q0FA 2B39A 1HXYD 2PCFB 2B2VA 1FD7D 2PZWA 4OO1G 1EY9A 3MFYA 5J39A 3EROA 3L9AX 2CQAA 1D1IA 1ZYRD 5ELCA 4LAAA 1DONA 2CW0C 3N52A 4RWSC 1KLUD 4RGTA 5HGTA 4OHJA 3H0GB 3RD4A 4A3IB 2EY5A 5CV5A 1WTQA 1STBA 5KEEA 2EZVA 1X32A 3HGBA 5A2QE 4HR7B 1CA6A 2BDOA 5FO8B 1DOLA 3GO5A 1LTAD 5EKLA 2BCOA 1SNMA 3FDTA 3WOEA 5JEAJ 2MPMA 2K33A 3GP7A 3GQBA 1EEID 1ILPA 2VB3X 3ND9A 3GV6A 2EYHA 1WTVA 2QKIC 3ITPA 3A7AB 1HPCA 2JA8B 4Y7NB 1PMRA 2E2HB 3R3OA 4C2MB 5BN4A 3PIO3 3IFDA 2Z1CA 1SFOB 2PZTA 4GZYC 1V1OA 4HCEA 1F77A 1Q90A 1CM9A 1FNWA 5K36H 1NR4A 1VCIA 1PLFA 3TP8A 3URYA 2R6GA 4OIKA 4KY6A 1IYVA 4QUCA 3WDNA 2FJ2A 1Y69U 4ZK9B 3RLFA 4BBSB 1I6HB 3TP7A 2ID0A 5A35A 1B2TA 2JXMB 3C1EA 1QNKA 5C0XJ 2B2TC 2B2WA 2BDNA 3CHBD 2Z8LA 3A54A 4N9PA 1CK1A 1Z7TA 4IQZA 2WKCA 3WOFA 3QOLA 3BYYB 5D3IB 4C3HB 1WTXA 3MAQA 2KUMA 1SSOA 2OEOA 4LK1C 2EY2A 1GXDC 1ET6A 5ELBA 2X69A 4V190 1Z6HA 1IL8A 4J8QA 1JICA 3J81L 1TQOA 4IALA 3T56B 1IYUA 1BBXC 2EVBA 2L11A 1JWUD 4KY5A 4K5VA 1BCPD 1EWHA 4KKUA 4RKLA 1AFPA 2LFNA 2AQ2B 1BF4A 3D8GA 3D3RA 3T13A 4WRDA 2EJGC 2I07B 3FEWX 1U4PA 1MSGA 5BN3A 3VR2A 2HCIA 3U9OA 2SNMA 1STHA 4H0LC 4XXEA 4RGMA 4M8AA 1DOMA 3FMCA 1DOKA 2EPBA 3Q24A 3J80E 1S5BD 5CMDA 1XWEA 4P2CB 4ZUIA 2D62A 3VYUA 5M3FB 2B2VC 1Y8NB 2IWHA 4IUNA 4CHTB 3PUWA 3MA2B 5CGKA 1BQQT 1RD9D 3TP6A 4A3GB 2XIWA 3PV0A 2KECA 3I3CA 4PQXA 3NUCA 4OL7A 4EQPA 4FP5D 3X3MA 3FPUB 3KK7A 1F2LA 4NW2A 2Q8TA 3M85A 1I3QB 2RDGA 3I73A 1EYCA 3SE0A 4PNYA 3P1HA 3CKIB 3X3NA 1EY6A 2KJXA 4X3KA 2AWOA 4KN4C 5J1ZA 4E6IA 5C4ZA 3MEHA 2KVMA 1PTOC 2YU9B 5EBCA 5EPLA 1X3PA 1XTCD 3E6ZX 4V0BA 1Q1EA 4ZKBB 5T1GA 4TKOB 2AUJD 3HOVB 1H9SA 5DM63 3ZYYX 1EU3A 1QNUA 1ESRA 4IUUA 2L55A 2RA4A 4G4KA 2R7ZB 4IURA 1C8CA 1C4QA 2NUCA 2RKSA 5JEAH 4H44C 1PZID 3TDQA 5IGCA 2K32A 2F4IA 4TRDA 1O7ZA 1BO0A 1VMCA 3L3OC 1T5EA 2EXZA 3KLRA 3S1MB 1Q8IA 1SBBB 4PMWA 1LACA 4UAIA 2FMCA 3HOZB 1QJOA 2OXPA 3VR5A 2F1MA 3ONAB 1STNA 3OWEB 1I4GA 3K5OA 2KCCA 1I4PA 1I4HA 4A3KB 3O13A 4MIUA 3GTPB 1YNND 5CC4A 3SHLA 3DEOA 3K57A 4ODGA 2XNAC 1RTNA 5D65A 1LTRD 1QWYA 1A6XA 1AP0A 4RHRA 5C0XG 5IGFA 4ME5A 3IL8A 1A2UA 2WACA 1H9JA 2VUMB 1UNSA 3K58A 5C5MA 2L12A 1HRJA 1RJTA 1B3AA 1STAA 4HSPA 3A8IE 3TN2A 4QCLA 1DCZA 2F0EA 1DJRD 3SDZA 1HUMA 5JVG3 3FRPB 3IFTA 3HOXB 4BA2I 2F0PA 1S4ZA 4DFAA 4FF1A 1GOZA 4IUTA 5I9OA 4F7XA 4RA8A 1WD1A 1LTSD 5IOCA 1BCPB 2LY7A 1CHQD 3JAME 4KD3A 3E0JA 5COYA 1F9PA 3NBIA 5TSSA 3W2DA 3K7AB 1VF7A 2RBMA 2SDFA 4FF4A 3RUZA 5CR3A 4FF3A 5DEHA 3N6RA 1EQVA 1TWAB 1A2TA 1RCVD 2XWJB 1VF5C 2K5QA 1LT4D 2R3ZA 3SXHA 1PXUA 1D5XC 3PUYA 4KI0A 1STGA 1F9RA 3S15B 1SJED 2NVTB 1SNQA 2IL8A 2SNSA 1OO9B 1F9QA 1MGSA 1PTOF 2D9UA 2Y0SB 4KK7A 2ENBA 1SJHD 3TSSA 3EA6A 3PO2B 4K5WA 1QE6A 5K5PA 2A69C 3F2UA 2RQXA 1GHJA 4C3IB 5EKIA 3S1QB 2O2LD 5E3FA 3VR3A 5BN5A 5C4XB 4G57A 2NN6I 3HP3A 4OGQC 1EFID 4HMJA 4IN3A 4FNFA 4XQNA 2X6LA 1TR5A 1SMYC 2WINB 3RZDB 1A15A 1EYAA 4J6HA 3OMCA 1WCMB 1YNJD 1H9MA 3OW7A 1CT1D 3KBXA 3BVGA 4I65A 5CV8A 3S1NB 1F2ZA 5I6YA 3NHHA 4U673 1EIHA 1B4OA 2F0VA 1CTMA 2EOTA 1GHKA 1F2MA 1CI3M 1KDAA 4CGYB 4FXDA 5M5YB 3BDCA 3TBIB 2ICEC 3HOUB 2KHSA 3C3LA 3KBGA 4IUQA 4RH6A 3R2TA 2AQ1B 3VR4A 1CQFA 1SNDA 3NQTA 1WTWA 1B1ZA 4OIJA 4A3MB 1HTLD 3QB3A 4OO1H 2RVLA 3Q0AA 2X6GA 2NVYB 1ZEQX 3PUVA 1HQRD 2F0SA 4C3HG 4DU9A 2M9VA 1TIID 1RDPD 1BNZA 4Z9CB 3J80L 2XWBB 1GUTA 1J9OA 5C44B 2R93B 1HUNA 2ZXRA 4K6LA 3GTGB 1EWCA 2OT2A 3V96A 3CU7A 2BOSA 2RDFA 3EFXD 4EQNA 2E2JB 3MXUA 2EDGA 2PNRC 3UI2A 3GTLB 4K8IA 1JWSD 2C9OA 1SYEA 1EZ6A 3OIQA 1ZYRC 1SYDA 1PZJD 5G3LF 2DY7A 2NVQB 2PPBC 3MTSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F0G A;  4DF7 A;  4K8J A;  3MVV A;  1A3T A;  2F0D A;  2PZT A;  2EXZ A;  5C5L A;  1KAB A;  1SYG A;  5E1F A;  4KV6 A;  2EYF A;  1EYA A;  4ZUI A;  4J6H A;  4KD3 A;  4R8N A;  2M00 A;  2F0I A;  1SYF A;  1KDB A;  4KY7 A;  4IUN A;  3MHB A;  3OSO A;  3OMC A;  4K2K A;  4NP5 A;  4B9W A;  5CV7 A;  5C6A A;  3S9W A;  3TP8 A;  2EYL A;  5CGK A;  4KY6 A;  1NUC A;  2RBM A;  3TP6 A;  2OXP A;  5IGB A;  3RUZ A;  2EYM A;  2F0L A;  4I65 A;  5CR3 A;  5CV8 A;  1STN A;  2EYP A;  4K6D A;  5DEH A;  2OF1 A;  3TP7 A;  2F0J A;  1EQV A;  3NUC A;  1F2Z A;  4OL7 A;  4EQP A;  4EQO A;  5IIF A;  1A2T A;  2F0F A;  3C1E A;  5I6Y A;  3NHH A;  1KDC A;  3DMU A;  2F0V A;  4MIU A;  1F2Y A;  2PZW A;  2F0U A;  1EY9 A;  4QB4 A;  1U9R A;  3SXH A;  5KRU A;  5M9O A;  1F2M A;  1SYB A;  3ERO A;  3NK9 A;  3TP5 A;  1A3V A;  2EYO A;  3SHL A;  5CC4 A;  4TRD A;  1KDA A;  1EYC A;  4DGZ A;  4ODG A;  3BDC A;  3SR1 A;  4N9P A;  4PNY A;  4S3S A;  3P1H A;  4LAA A;  1EZ8 A;  3OMG A;  4ZQ3 A;  2KHS A;  1EY6 A;  3QOL A;  4K14 A;  4RKB A;  5EKK A;  1STG A;  5J1Z A;  1SND A;  3NQT A;  4E6I A;  1EY4 A;  2EY1 A;  5C4Z A;  5IGF A;  4QMG A;  2OEO A;  2O4X A;  3MEH A;  4N9T A;  4ME5 A;  4H7B A;  5CV9 A;  2EY2 A;  5HGT A;  5IGG A;  1SNQ A;  5I6W A;  5KGU A;  1SNC A;  1II3 A;  1EYD A;  3QB3 A;  3V2T A;  2PQE A;  2SNS A;  1A2U A;  2F0H A;  2PW5 A;  1TT2 A;  2EY5 A;  2WAC A;  2LKV A;  2QDB A;  3E5S A;  3LX0 A;  4IZ8 A;  5CV5 A;  3T16 A;  4B9X A;  1STB A;  4KHV A;  4KJO A;  3VA5 A;  4QF4 A;  5KEE A;  5KYL A;  2F0T A;  3NP8 A;  3DHQ A;  4YIJ A;  2F0S A;  3BDL A;  2F3V A;  4PMC A;  3D6C A;  1RKN A;  2ENB A;  1TQO A;  5C3W A;  4IAL A;  4DU9 A;  5C5M A;  4EVO A;  3H6M A;  5IOD A;  4K5W A;  2PW7 A;  3SK5 A;  3C1F A;  1EY0 A;  1STA A;  4NDX A;  2KQ3 A;  1ENA A;  1STY A;  5CV4 A;  1ENC A;  4NKL A;  5K5P A;  2F0Q A;  5J22 A;  3NXW A;  4KY5 A;  4K5V A;  5ISR A;  3EJI A;  5EKL A;  4K2L A;  5IGE A;  1JOR A;  4RKL A;  5IGD A;  2PZU A;  1SYC A;  2RDF A;  2F0N A;  1SNM A;  3ERQ A;  2F0E A;  4K5X A;  4EQN A;  4HMI A;  3P75 A;  4NMZ A;  1SNO A;  3MXP A;  2EY6 A;  4J1M A;  4PMB A;  3D4W A;  1JOQ A;  4ZUJ A;  2HQE A;  3D8G A;  1JOK A;  5KIX A;  2PYK A;  4HTH A;  1AEX A;  3HEJ A;  1A3U A;  2F0W A;  4KJN A;  5I9P A;  3T13 A;  5KYI A;  2EYJ A;  5E3F A;  5C4H A;  4WRD A;  2F0P A;  5NUC A;  1EY5 A;  4F8M A;  1EY8 A;  4DFA A;  4G57 A;  3SK8 A;  2F3W A;  4KTA A;  1IHZ A;  5J39 A;  1NSN S;  4K8I A;  4HMJ A;  5DAU A;  2SOB A;  2F0M A;  1KAA A;  5JOB A;  2NUC A;  3SK4 A;  2F0O A;  5C3X A;  5I9O A;  1SYE A;  4ID6 A;  1EZ6 A;  2EYH A;  2RKS A;  3MZ5 A;  4WOR A;  3EVQ A;  4F7X A;  5F2D A;  1SNP A;  5EGT A;  5JAV A;  5HUR A;  3ITP A;  3U9O A;  1SYD A;  2SNM A;  1STH A;  3SK6 A;  3TME A;  3D4D A;  1JOO A;  3HZX A;  5IGC A;  1EY7 A;  3OWF A;  3QOJ A;  5CV6 A;  3PMF A;  3R3O A;  4KD4 A;  5IOC A;  1TR5 A;  2F0K A; 
#chains in the Genus database with same CATH topology
 4LFC L;  5FK9 C;  3KLS A;  1HNZ Q;  4DXF A;  5D14 A;  3M4O B;  1I4X A;  1SYG A;  1KXL A;  2WKD A;  2EYF A;  3T1H Q;  3BVZ A;  3T53 B;  3HFZ B;  4GLA C;  1RF2 D;  3OSO A;  4C3J B;  4DR7 L;  4BBR H;  5DLQ E;  2JN4 A;  2CVR A;  2NTT A;  1OXS C;  4JI3 L;  4BS9 A;  2QDL A;  1JJC B;  2PQA B;  3K5N A;  2ZXP A;  5M3F G;  1QVC A;  2ZTD A;  1XPO A;  3MFG A;  3MEF A;  2RDH A;  2JEA I;  3PQI A;  1V8Q A;  4RCN A;  1LTI D;  2N88 A;  4A3G G;  1SYB A;  3R8B A;  1K28 A;  3TZU A;  2HHH Q;  3A56 A;  4CJ1 B;  5AJ3 Q;  3GV3 A;  4JYA Q;  4CJ0 B;  4BY1 H;  1BXT A;  1HZB A;  2FFK B;  3HKZ E;  4A93 B;  1LTG D;  3QJY A;  1YEZ A;  2K01 A;  3BVM A;  3NE5 B;  4QMG A;  1R9T H;  1HR0 L;  5IGG A;  4YY3 L;  1EYD A;  1PFM A;  2GVB A;  3U50 C;  1H9K A;  1N33 L;  2LKV A;  3KF6 A;  2F0T A;  3NP8 A;  1M8A A;  2K52 A;  1VS0 A;  1RKN A;  2JJQ A;  2CKZ B;  2JA7 B;  4UHV A;  1V1P A;  4Q5V A;  4A3E B;  1SE4 A;  1JWM D;  1OXV A;  1PRT D;  1PYB A;  3MXN A;  3T51 B;  1WD0 A;  4JBJ A;  3HOW B;  2ZJQ A;  4YCW A;  3ERQ A;  3F2B A;  3KLW A;  4HMI A;  2XN9 C;  3HS0 C;  1PYS B;  1JOQ A;  1ML0 D;  2HQE A;  4NB3 A;  3NTI A;  2MJ8 A;  1Q82 C;  3HOV G;  1PV4 A;  3PGZ A;  4DK0 A;  5FLX c;  3CRK C;  5DAU A;  4L8J A;  3ULL A;  1K73 C;  4X64 Q;  1M4V A;  5T1I A;  1GJX A;  2VW9 A;  2R7F A;  5COR A;  2OQK A;  2VB2 X;  3GTQ H;  2IT1 A;  2R7Z G;  3T16 A;  4JI6 L;  4L5Q A;  4OX9 Q;  2Z6K C;  3ICE A;  2KOL A;  4JVZ A;  4KV6 A;  3PUZ A;  1HFN A;  1K8A C;  4HJ5 A;  2KCN A;  1SYF A;  4GOP A;  1WJJ A;  3K5L A;  4K2K A;  4DV4 L;  2KEE A;  1ENF A;  4YHH L;  4JPB W;  1MIU A;  4B3T L;  1EYG A;  2EYM A;  2QGQ A;  1GUW A;  3HKS A;  1N36 Q;  1L1O A;  1JE4 A;  3S14 H;  4LF7 Q;  1BCP C;  2N55 A;  1YBY A;  1X6O A;  3OPO A;  3HOZ G;  3PO3 H;  1MBY A;  3I4N B;  5ELF A;  5M9O A;  3OOC A;  2R61 A;  3VA7 A;  4DGZ A;  1DGS A;  4IFD J;  3I8Z A;  3MXG A;  4HCS A;  4DUZ Q;  4OWW B;  2GVA A;  4A3K G;  4DR6 Q;  3M7N A;  3GD7 A;  3I4M B;  3VR6 A;  1EY4 A;  2ICI A;  3U9S A;  5IYC H;  1EOV A;  2LSS A;  1SNC A;  1RL2 A;  3V2T A;  4DR1 L;  2K5H A;  1ZXT A;  3FVQ A;  1E24 A;  3A74 A;  1IKL A;  4CJ2 C;  4WFN 3;  1X65 A;  3H3V C;  1HTP A;  5M5W H;  1EY0 A;  2J0T D;  1ENC A;  1FJG Q;  3OYY A;  2G9H D;  1Q86 C;  3S17 B;  2MP1 A;  5ISR A;  3JAM L;  4B3M Q;  4LMQ D;  4K2L A;  2ASB A;  2RSN A;  1JJG A;  2JP1 A;  2MHV A;  2F0N A;  2VUM G;  3TS2 A;  1JCK B;  1LLR D;  3SVM A;  1XYI A;  1S72 A;  1E2Z A;  3HEJ A;  5I9P A;  4FYD A;  3H09 A;  4XIG S;  1F9S A;  2EYJ A;  3S2D H;  2VL6 A;  1D8L A;  3A7L A;  2Q8I B;  2SOB A;  1C0A A;  1HHV A;  5F2D A;  3LWE A;  3HOX G;  1EQT A;  3CCQ A;  1XMQ L;  1SRO A;  2B2U C;  2B63 B;  4XT1 B;  2MO1 A;  1E2W A;  3D4D A;  1S5E D;  1AE3 A;  3KJO A;  3QOJ A;  4KD4 A;  2OTL A;  3UE1 A;  4RHS A;  1OXU A;  4NXM Q;  3TQY A;  1V9P A;  2F0I A;  5GAG C;  1KDB A;  5C6A A;  3S9W A;  1CFM A;  2E75 C;  5FOB B;  4ZCK A;  2LMC B;  1Y1W B;  3AFP A;  2ATW A;  1UEA B;  4TQU S;  5IGB A;  2FXQ A;  1W6J A;  4HSV A;  1IBL Q;  2RSO A;  5M5X B;  2A6H D;  2OF1 A;  2I46 A;  3FPP A;  4DNT B;  4PZ7 A;  3DWQ A;  3DMU A;  2NVX H;  1G91 A;  1XTD A;  1U9R A;  3NQI A;  4JI4 Q;  3NK9 A;  5IT9 E;  3QO2 A;  4R4I A;  3CRL C;  1TWF H;  3DUZ A;  4A3D B;  2R92 H;  1Y1V H;  2D0O A;  3J81 c;  4KLK A;  2SEB D;  4APV A;  4LF8 L;  1S5C D;  1RHP A;  3OW2 A;  1Y1V G;  4RKB A;  3K5M A;  3BZC A;  5JJI A;  4LNQ A;  4GNX C;  1NAP A;  4X3U A;  2D0P A;  1ICW A;  1TT2 A;  4RMF A;  1VQB A;  2QDB A;  1EEF D;  4B9X A;  5IP9 H;  2UUB Q;  4KHV A;  4OWX B;  3K59 A;  1TY0 A;  1PTO H;  5EJW A;  4YIJ A;  4QUF A;  3D6C A;  1QOH A;  5IP9 G;  3ER0 A;  4ZKC B;  4A3B H;  1CKO A;  4XYQ A;  1CUK A;  2PW7 A;  4NDX A;  4DAM A;  1JJ2 A;  1I50 H;  5J22 A;  1K3B C;  2NB0 A;  5C0X H;  1N34 L;  4G7O C;  3GTO B;  1W3S A;  5EQ0 A;  1U4M A;  5IGE A;  3M4Q A;  2WAQ B;  3DM1 A;  2Y0S G;  2ZM6 Q;  4UP7 A;  3UDI A;  3W5O A;  5H1S E;  3S16 B;  2FHT A;  4DV5 L;  4A3F H;  3PO2 G;  3D6W A;  4ULL A;  2JA6 H;  1U4R A;  4FF2 A;  2BA1 A;  5BR8 L;  1R4Q B;  4A3C G;  1Q12 A;  2ZTE A;  1XMO Q;  2JA5 H;  1VQM A;  3STB D;  4DR2 Q;  4C3I G;  2DJG C;  1L0Y B;  1VDZ A;  1YNN C;  4CKE A;  4ID6 A;  4X3T A;  2JQO A;  1G6Z A;  4GOP C;  1B3Q A;  1HA5 A;  3AMU A;  1PYW D;  1L0X B;  2D5D A;  5C4X G;  4POF A;  4BY7 H;  1PRT B;  1YZ6 A;  5KNC A;  4OEM B;  4AQY Q;  2BE5 D;  4NXN L;  1DZ1 A;  1L1O C;  5E4W C;  4XDX A;  2E2I B;  4YCU A;  4FDB A;  4NP5 A;  2B8G A;  4OXP A;  4GKK Q;  3FP9 A;  1X3E A;  4DPG A;  1KIX A;  5M3M B;  1LM0 A;  2AQ3 B;  5C0X I;  2Q2U A;  2HD3 A;  4JW0 A;  1UE5 A;  4OWT B;  3CF5 A;  4WJW A;  1DYQ A;  5I2X A;  3FKI B;  2VZA A;  1D6E C;  4R1J A;  1F2Y A;  4JG2 A;  1MKH A;  3LWU A;  5EBD A;  1E1T A;  3NBH A;  1BCP F;  2F4V L;  1O80 A;  1AW7 A;  3SEB A;  1S3O A;  3CCE A;  4MN3 A;  4ZQ3 A;  3R93 A;  1TS4 A;  3G6J B;  3RN2 A;  2WP8 J;  1EWI A;  1PH2 A;  1J8I A;  1WTH A;  2K6A A;  5A2Q L;  4DN4 M;  5LHY 1;  5DNF A;  3CQZ H;  1ASY A;  5KGU A;  3HOY B;  5C3E B;  3HOU G;  1WTO A;  3Q6S A;  1KRS A;  4IFD G;  4X65 Q;  4DV1 L;  1STE A;  4O1N A;  4KKS A;  5C4J B;  4P74 A;  3M4Y A;  4DV2 Q;  4KHZ A;  5C3W A;  4DV0 Q;  2MGS A;  4A3M G;  3OTO Q;  3ERS X;  4AYB B;  2IX1 A;  3C1F A;  2A73 B;  1IW7 D;  1IZ6 A;  5CV4 A;  1ENA A;  4DNI A;  5IYD G;  2XTI A;  3NWS A;  3LNN A;  2KCT A;  3ZJY C;  1T5X D;  4LF9 L;  3EJI A;  1A63 A;  3Q8D A;  2TMP A;  4LF4 Q;  1IKM A;  4QY7 A;  1IBM L;  2O5I C;  5AFW A;  4CDC C;  3D4W A;  3T4A C;  2KHI A;  2CH4 A;  3WWV A;  5C44 G;  2R93 G;  1FYC A;  2F0W A;  1ASZ A;  1E1O A;  1LUZ A;  4ILW A;  1EY5 A;  3H0G H;  3RZO B;  5GAD C;  1B44 D;  4A3I H;  1D1K A;  1NSN S;  3PSI A;  2K05 A;  2DGY A;  1LTT D;  4X62 L;  2IJ0 A;  5LMN Q;  5C3X A;  1LT3 D;  2K4K A;  1G29 1;  1VQI A;  1SNP A;  2F3I A;  4C56 C;  5KNB A;  4HIO A;  4RFB A;  2E76 C;  3SK6 A;  2QEJ C;  4R9W A;  4L6T B;  3PMF A;  4FVM A;  4GLV B;  1JB7 A;  1QB5 D;  2IPK D;  4JCV E;  3EQL C;  2Q2I A;  1B8A A;  5E1F A;  5FO9 B;  4JBM A;  4XYO A;  4MHE A;  3MHB A;  1VQ6 A;  1ONL A;  1FNU A;  3ND8 A;  1U5K A;  1VQP A;  1QIL A;  5DM7 3;  1CSQ A;  1HZ9 A;  4IPC A;  1VQ7 A;  1NUC A;  4G7Z C;  3PIP 3;  3P20 A;  1NCV A;  4JI8 Q;  1TWG B;  4K6D A;  4M1U B;  2XRS D;  4TVA B;  4ZYS A;  4IJL A;  3I91 A;  4C3J G;  2CH4 W;  1E7Z A;  1JC7 A;  4QB4 A;  4JBK A;  2JA8 H;  1SXT A;  3I72 A;  4Y7N H;  2E2H H;  4C2M H;  1G8Z D;  3SR1 A;  2JA8 G;  1S5D D;  2PNH A;  1SFO H;  2C5C A;  3BJU A;  2J7Z A;  4RCO A;  3UDG A;  4A3J B;  4HIM A;  2N78 A;  2H1E A;  5CV9 A;  4N9T A;  3K0X A;  1PH7 A;  1SEB D;  1VQC A;  2F0H A;  2PW5 A;  1G2S A;  3DEP A;  4R4T A;  1I6H H;  4BBS H;  3C2P A;  1GVP A;  4A93 G;  2A68 D;  3E0E A;  1HQM C;  2J4X A;  1TS2 A;  2A6E D;  3PUX A;  1W2B A;  1M90 C;  4WJ4 A;  3BZD B;  1WFQ A;  3KYH C;  3GTJ B;  3S1R B;  1YNJ C;  2KCM A;  2WB1 B;  5I2Y A;  1MHW C;  2HT1 A;  3C46 A;  1SYC A;  5GRO A;  3SGI A;  2QCP X;  4C1N I;  1AZQ A;  2JA7 G;  2EY6 A;  3MWY W;  4B3S L;  4JI2 Q;  4A3E G;  2K28 A;  1NBW A;  4C3H H;  4G7H C;  5KIX A;  1EFW A;  1TWC B;  4HTH A;  2A74 C;  2CW0 D;  1PHJ A;  3HOW G;  2ES2 A;  4LFB Q;  2A1A A;  1WVL A;  3OHX C;  3KUP A;  2E74 C;  4XT3 B;  2F0O A;  1EU4 A;  1K0R A;  1ICF B;  1SN8 A;  2C35 B;  4GS3 A;  3HZX A;  1JOO A;  1KRT A;  1QCB D;  4DAP A;  2F0G A;  4DF7 A;  3MVV A;  1HNZ L;  1X3G A;  2QF7 A;  1MSH A;  3NWT A;  2I5L X;  4LJZ C;  3T1H L;  4R8N A;  2M00 A;  1E3P A;  4B9W A;  4FXK C;  2UU9 L;  2FIN B;  1SR3 A;  1TWH B;  2QA4 A;  1SE2 A;  1I6V C;  1WTR A;  4EQO A;  2Z4I A;  1UUP A;  1EIY B;  3GTK B;  3J7Z C;  2L5T A;  4OO1 I;  2XSC A;  3W3A A;  1AZP A;  2MUY A;  3TP5 A;  4F87 A;  5IYB G;  1EIG A;  5AJ3 L;  1CKN A;  2JEB I;  5LL6 S;  1MJE A;  1XNR Q;  4S3S A;  1YHA A;  4U68 A;  1EZ8 A;  4DAY A;  2B2U A;  3B6Y A;  1KNA A;  1M1K C;  3I4L A;  1LYL A;  5M3F H;  5GAH C;  3H91 A;  2GA4 B;  3I4N G;  1SE3 A;  2F0K A;  1I94 L;  1HCZ A;  1YI2 A;  3M3Y B;  3E5S A;  2E2D C;  4IZ8 A;  4A3G H;  2UXB Q;  1TS5 A;  5FO7 B;  4KJO A;  3VA5 A;  1W6K A;  4QF4 A;  4UDU C;  5KYL A;  1BOS A;  2KED A;  1I4R A;  4RGN A;  2ZJP A;  2UUC L;  4PMC A;  3I4M G;  1CA5 A;  2LS0 1;  1K8G A;  1STY A;  3GTM B;  1K83 B;  3QIA A;  4QIW B;  1I3Q H;  5GQO A;  4UP8 A;  3M4P A;  4DAV A;  3U58 A;  4BXX G;  4LFC Q;  3P75 A;  1PH4 A;  3Q23 A;  1D5M C;  1FR3 A;  3G48 A;  1ESF A;  1YJ9 A;  1YJN A;  1AEX A;  4KJN A;  4X66 Q;  2YU9 H;  1BR9 A;  1Y8P B;  2F3W A;  3J81 i;  1TS3 A;  1KD1 C;  1N32 Q;  5JJL A;  5K36 G;  2VNU D;  3D0F A;  4GNX A;  5IT9 L;  3HG9 A;  4O2D A;  3A8K E;  3CCS A;  3TME A;  2WAQ E;  3J7A 5;  1R4P B;  2VQF L;  3OWF A;  4KN7 C;  2QW7 A;  1H9S B;  5D3D A;  3KF8 A;  4RAU C;  1MI2 A;  4DXG A;  4K8J A;  3HOV H;  4F88 A;  1JR0 D;  2A5H A;  1VQH A;  2NZ1 D;  3DXJ C;  2BA0 A;  2B63 G;  2AUK A;  3D31 A;  3TRZ A;  1GUS A;  1DXM A;  3NEM A;  1Q81 C;  3RN5 A;  4IO9 A;  1I4Q A;  2K5N A;  2MQH A;  3UDF A;  2HCC A;  1HR0 Q;  1XX8 A;  2R7Z H;  4YY3 Q;  3EIV A;  1LT5 D;  1PFB A;  1V43 A;  2KBN A;  1QVF A;  1E0B A;  2N8N A;  5EPK A;  1PRT C;  1FVI A;  4LF7 L;  1EOT A;  1Y1W G;  1KTK A;  2HUG A;  2B2Y C;  2MFI A;  1P8L A;  4A3L G;  2QIL A;  3I7F A;  1QZG A;  1BDO A;  1Y8O B;  1K8O A;  3KJP A;  4DUZ L;  2JE6 I;  3S1M H;  1B53 A;  3J80 c;  2ZT9 C;  1CHP D;  3J7A F;  4PG3 A;  5FLX E;  1S40 A;  1EL0 A;  1OXT A;  4TSS A;  4A3D G;  1XXG A;  5I6W A;  2AWN A;  1C48 A;  3HOZ H;  3LX0 A;  4NPS A;  2CFM A;  3DHQ A;  1NE3 A;  1PH9 A;  3DWA A;  3S2H B;  5KND A;  1YVC A;  4ZRZ A;  1L2F A;  4Y52 H;  1PVO A;  1SRU A;  4A3K H;  1YHB A;  3SK5 A;  3L2P A;  3GTP H;  1FJG L;  2F0Q A;  4MNO A;  1VQK A;  4ABN A;  2V4D A;  3AB9 A;  2D2C C;  2I5H A;  2PZU A;  1VQ9 A;  3MXP A;  4GN4 B;  2N3S A;  4BBR B;  4DV6 L;  4LF6 L;  4R4C A;  2PYK A;  5KYI A;  1A3U A;  2ZXO A;  5C4H A;  5L37 A;  3RLN A;  2WAQ G;  3SK8 A;  1IHZ A;  4YHH Q;  3DWP A;  2L1B A;  4B3T Q;  1PTO D;  2IW3 A;  2PQA A;  2VUM H;  3UDX A;  1EY7 A;  1PDQ A;  1X3F A;  5CV6 A;  3W1G A;  1XNQ L;  1TU2 B;  1TKW B;  1B9M A;  2JSO A;  4BY1 B;  3E9H A;  3L7Z C;  4GN5 A;  1JB3 A;  3D4R A;  4NXM L;  4QJF A;  4L5R C;  2Y0S E;  3A0J A;  3E3X A;  2L4N A;  1R9T B;  3HOX H;  1DM0 B;  1BKB A;  1IBL L;  2CQO A;  4HJA A;  3G4S A;  2EYP A;  1HNX Q;  2WV6 D;  1O7L A;  5IIF A;  2IHE A;  4XTC S;  1NTG A;  2F0F A;  2EJF C;  1ET9 A;  4DR1 Q;  2O5J C;  1KDC A;  2LXJ A;  4LF5 L;  3P7J A;  2F0U A;  1UAP A;  3RR5 A;  1B9N A;  2HDM A;  3BDO A;  5KRU A;  5M3M G;  1TY2 A;  3F2C A;  1VQ8 A;  3KDF A;  1S5F D;  3OMG A;  5FLM G;  1P16 A;  4DV3 Q;  1D5Z C;  3FKI G;  2L0C A;  4ZLT F;  3Q22 A;  1KNE A;  5EKK A;  2L15 A;  5FKA C;  5CBE E;  4LW1 A;  1QG7 A;  1GUG A;  5IT9 c;  1B50 A;  2EY1 A;  1LT6 D;  1UWV A;  2O4X A;  4DV7 L;  4LFA L;  4K0K L;  1QUQ B;  2Q8R E;  3K7A H;  4X3S A;  3A8J E;  4HED A;  4ZUJ A;  2PO4 A;  4JI0 Q;  1FGB D;  2UUB L;  2F03 A;  1IBK L;  1V1Q A;  1O7Y A;  1TWA H;  3BDL A;  4OEL B;  2NBF A;  3H6M A;  5IP7 G;  4KHP L;  1KAW A;  3HOY G;  5C3E G;  2KQ3 A;  3BS1 A;  3GTQ B;  2DNC A;  4EX5 A;  3H3V H;  4R8I A;  2ZM6 L;  5JEA G;  3QG1 A;  5IGD A;  5ELD A;  2NWG A;  3I90 A;  4NMZ A;  1SNO A;  4PMB A;  4AYB G;  2DY8 A;  4HAE A;  2VQE L;  4YWM A;  2A6H C;  3QWN A;  1CZG A;  2K7V A;  3T1Y L;  3S15 H;  2NVT H;  1XMO L;  1Q3L A;  4FXG C;  4IPG A;  3VYR A;  2B2W C;  4B3R L;  3SK4 A;  2F0M A;  1KAA A;  1Z47 A;  4JC0 A;  3NSW A;  3HKZ B;  4H13 C;  3G71 A;  1GUO A;  3MZ5 A;  3S14 B;  3EVQ A;  5JAV A;  2K04 A;  2WB1 E;  1IXR A;  3VYS A;  1DD2 A;  3OIP A;  3PO3 B;  3PO2 H;  3I4O A;  3J81 E;  4JK1 C;  2EIF A;  2IX3 A;  1J5E Q;  3J7A V;  2PMZ B;  2F0D A;  2AMC B;  4A3C H;  1HA6 A;  5C5L A;  4AQY L;  4L63 B;  1D2B A;  4C3I H;  1FNV A;  2K03 A;  3IKJ A;  3S1Q H;  4KY7 A;  3ULJ A;  4HIK A;  2Z4H A;  5CYU A;  1QVG A;  4LF8 Q;  5JVH 3;  1CSP A;  1RTO A;  4QL5 A;  5C4X H;  1B7Y B;  2YTV A;  3H3V I;  1PZK D;  2K1B A;  1G2T A;  1AN8 A;  2HDL A;  4DK6 C;  3RNU A;  1PH5 A;  1VQL A;  2NZH A;  2AKW B;  5M5W B;  4O42 A;  5G3L D;  5FJ8 G;  2M2L A;  3NPP A;  2NTS A;  1TVX A;  2EYO A;  1PRT F;  4DR3 L;  1LAB A;  4IUP A;  1HNW Q;  3RMH A;  3RZD H;  4K14 A;  2E5L Q;  3STB C;  3J7Y W;  2UXD Q;  1WCM H;  3JAM c;  3CD6 A;  3A5U A;  2RCF A;  2UUA Q;  3CAM A;  3S2D B;  3KLS X;  2DNE A;  1II3 A;  1WCM G;  3F2D A;  5BR8 Q;  4MZ9 A;  1HJP A;  3S1N H;  4X65 L;  1Q8K A;  1CZW A;  4CBV A;  4A3J G;  1K8M A;  4DV2 L;  1SAP A;  5I4D A;  4DV0 L;  4YWL A;  2KEN A;  3NTH A;  4EVO A;  5IOD A;  2JYO A;  2BE5 C;  4DA2 A;  1T9H A;  3CPF A;  1JQY D;  5M5Y H;  2HIX A;  2RHQ B;  3G7L A;  1MD2 D;  3CPW A;  4K5X A;  3HOU H;  3HRZ C;  4LF4 L;  4IFD H;  1YJW A;  4J1M A;  2CWP A;  3TZD A;  1VQ4 A;  4NXN Q;  1CQV A;  1SE8 A;  3VYT A;  4A3M H;  2WB1 G;  5NUC A;  4F8M A;  4A4I A;  4CKC A;  5IYD H;  2B8F A;  4IUV A;  3CC2 A;  2IY5 B;  5LMN L;  2NVY H;  2NYZ D;  2UXC Q;  5LL6 X;  5EGT A;  2NVX B;  5HUR A;  4KKT A;  1LV9 A;  4L5T A;  1Q46 A;  1TWF B;  5C44 H;  2R92 B;  2R93 H;  1Y1V B;  2KHJ A;  3GTG H;  4CDE C;  2NN6 H;  3PF4 A;  3AU7 A;  1A62 A;  2A69 D;  2E2J H;  2VY3 A;  1UE1 A;  2NN6 G;  5CBA E;  4H02 A;  5E4X A;  2KA7 A;  1OXX K;  1HFG A;  1O78 A;  5LMN W;  5JPM C;  3GTL H;  1IW7 C;  1PTO B;  2F0J A;  4FO2 A;  3A5Z B;  4KMU C;  3V05 A;  2XRQ D;  2N49 A;  5ELN A;  4A3B B;  4EGV A;  3A55 A;  4IFD I;  1H9R A;  1VQF A;  4IJH A;  2HQL A;  5ELE A;  1I50 B;  3S24 A;  1X3Q A;  2K5D A;  2NVQ H;  1A3V A;  2TSS A;  2H5X A;  1XPR A;  1PH1 A;  2L9H A;  5EPJ A;  3RLO A;  4ZAI A;  1CKN B;  3M4O H;  1ROD A;  4B08 A;  4A3F B;  2K5W A;  5JJZ A;  4LF9 Q;  2JA6 B;  4JI1 Q;  4DNR B;  3H94 A;  4C1N K;  2DUD A;  1SMY D;  4C3J H;  2R7D A;  2B2T A;  2EJM A;  3NTK A;  4H7B A;  2JA5 B;  3IAY A;  4BA1 I;  2FMM A;  2PQE A;  2RCN A;  4DR4 L;  1ZKO A;  1GUN A;  2XVS A;  2Q2T A;  1LTB D;  2F3V A;  3K6O A;  3BYT B;  4PV1 C;  2CHB D;  4IPD A;  1ILQ A;  4GKJ Q;  4JBW A;  4BY7 B;  4DUY Q;  3TEH B;  4NKL A;  1SDF A;  2H4O A;  3NXW A;  1U4L A;  1JOR A;  1RIP A;  5GAE C;  1B70 B;  2VS1 A;  3UE0 A;  1Q1B A;  1VQE A;  2B2Y A;  2G9D A;  4A93 H;  1VQN A;  4JV5 L;  3R2I A;  1E2V A;  2AHO B;  1JOK A;  1BUV T;  1HH2 P;  2WII B;  2DN8 A;  4JI5 L;  4CKB A;  4LFB L;  1EY8 A;  3KF6 B;  4KTA A;  3E9I A;  4HID A;  5JOB A;  3AYH B;  4OON A;  4WOR A;  4XQQ A;  1V1P B;  3J80 i;  3K0Y A;  1WTP A;  4J15 A;  3K8A A;  4DR5 Q;  2JA7 H;  4A75 A;  4HJ9 A;  2B29 A;  3MXN B;  4JI7 L;  4A3E H;  4XQJ A;  1VMP A;  1A3T A;  3MC0 B;  3HOW H;  3PIP A;  4BWG B;  1KAB A;  1JT8 A;  4RGO S;  1K0S A;  5JPN C;  4HN7 A;  5FLX L;  2YYZ A;  1NR2 A;  3I70 A;  1KHI A;  2EE1 A;  4DK1 A;  1PFN A;  5CV7 A;  1KLG D;  2VXW A;  3ULP A;  2EYL A;  2A68 C;  3CQZ B;  1GKH A;  1VQJ A;  3M7G A;  1LO5 D;  2F0L A;  3BG3 A;  4I7Z C;  4R4Q A;  5JJK A;  3W1B A;  3U4V A;  2A6E C;  2IX0 A;  4Q0F A;  1PH6 A;  2PCF B;  2B39 A;  1HXY D;  1NNX A;  2B2V A;  1HZA A;  1FD7 D;  2PZW A;  4OO1 G;  1EY9 A;  3MFY A;  5J39 A;  3ERO A;  3L9A X;  2CQA A;  3G6E A;  4MTN A;  1XNR L;  1D1I A;  1ZYR D;  5ELC A;  4LAA A;  1DON A;  2CW0 C;  5IWA Q;  4GOP B;  1NMG A;  1OTC A;  2OTJ A;  1U0L A;  1NY4 A;  1YIT A;  3N52 A;  2OCE A;  1KLU D;  4RWS C;  4RGT A;  5HGT A;  4OHJ A;  2K5V A;  3H0G B;  3RD4 A;  4A3I B;  2EY5 A;  2Z0S A;  2UXB L;  5CV5 A;  1L1O B;  1WTQ A;  1STB A;  5IYB H;  5KEE A;  2EZV A;  1X32 A;  3HGB A;  5A2Q E;  4HR7 B;  1CA6 A;  2BDO A;  2HHH L;  5FO8 B;  1DOL A;  4AH6 A;  4JYA L;  3I4N H;  4LWC A;  3KFU A;  3GO5 A;  5HGQ A;  1LTA D;  5LMU Q;  4X6A H;  5EKL A;  3IRB A;  2BCO A;  1SNM A;  3FDT A;  3WOE A;  3CCL A;  2MNA A;  1EQR A;  5JEA J;  2MPM A;  3I4M H;  4X66 L;  2K33 A;  1UE7 A;  3GP7 A;  3K81 C;  3GQB A;  1EEI D;  3TS0 A;  1ILP A;  2VB3 X;  1Y14 B;  2UU9 Q;  3ND9 A;  1PFS A;  4N8X 1;  2RHS B;  2QEX A;  1N32 L;  1E22 A;  3GV6 A;  3I2Z A;  4P73 A;  4BBR G;  2EYH A;  1WTV A;  2PI2 E;  2QKI C;  3ITP A;  4BXX H;  3A7A B;  1HPC A;  2JA8 B;  4Y7N B;  1PMR A;  3PF5 A;  2E2H B;  3R3O A;  4C2M B;  4UP9 A;  5BN4 A;  3PIO 3;  3IFD A;  2Z1C A;  3S17 H;  1SFO B;  2PZT A;  4GZY C;  1V1O A;  3J81 j;  3NEL A;  4HCE A;  2MO0 A;  1F77 A;  1Q90 A;  4DR7 Q;  1CM9 A;  1FNW A;  5K36 H;  1NR4 A;  1VCI A;  1PLF A;  3TP8 A;  3URY A;  2R6G A;  4OIK A;  4KY6 A;  1N8R C;  4BY1 G;  1IYV A;  4QUC A;  3WDN A;  4JI3 Q;  2FJ2 A;  1Y69 U;  4ZK9 B;  3RLF A;  4X64 L;  4BBS B;  1I6H B;  1KL9 A;  5EAY A;  3TP7 A;  2ID0 A;  5A35 A;  1I94 Q;  1B2T A;  2JXM B;  3AFQ A;  3C1E A;  2PMZ E;  3AEV A;  3CCU A;  1QNK A;  5C0X J;  2B2T C;  2Z9H A;  2B63 H;  2B2W A;  2BDN A;  3CHB D;  3K7U C;  2UUC Q;  4OX9 L;  2Z8L A;  3A54 A;  1C9O A;  1G6P A;  4N9P A;  1CK1 A;  1Z7T A;  4IQZ A;  3JC6 6;  2WKC A;  3KDF B;  2BH8 A;  3QOL A;  3WOF A;  4AIM A;  3BYY B;  3CW2 C;  5D3I B;  4C3H B;  1WTX A;  3MAQ A;  2OEO A;  1SSO A;  2KUM A;  4LK1 C;  1N9W A;  2EY2 A;  1GXD C;  1ET6 A;  1Y1W H;  1N36 L;  5ELB A;  2X69 A;  2YTX A;  4V19 0;  1HR0 W;  1N33 Q;  5M5X H;  3CCM A;  1Z6H A;  1IL8 A;  4J8Q A;  4A3L H;  1JIC A;  3J81 L;  1TQO A;  4IAL A;  3T56 B;  1IYU A;  1BBX C;  1YNX A;  2EVB A;  3PIO A;  3FHW A;  2L11 A;  1JWU D;  4KY5 A;  4K5V A;  1BCP D;  4DR6 L;  1EWH A;  4KKU A;  4POG A;  3I56 A;  3EN2 A;  2VQF Q;  4A3D H;  4RKL A;  1I5F A;  2Q2H A;  1AFP A;  2LFN A;  2AQ2 B;  1BF4 A;  3D8G A;  3D3R A;  3T13 A;  4WRD A;  2G5D A;  4QQB X;  2EJG C;  2I07 B;  3FEW X;  3F1Z A;  1U4P A;  1MSG A;  5BN3 A;  3VR2 A;  2HCI A;  2ZTC A;  3U9O A;  2SNM A;  1STH A;  4H0L C;  4XXE A;  4B3M L;  4RGM A;  3JAM i;  4M8A A;  1BBU A;  1TXY A;  3PCO B;  4JI6 Q;  2B3G A;  1DOM A;  3FMC A;  1DOK A;  2EPB A;  3Q24 A;  3GTO H;  3J80 E;  3HKZ G;  1S5B D;  5CMD A;  1XWE A;  4P75 A;  3S16 H;  1WOC A;  4P2C B;  4ZUI A;  2D62 A;  3VYU A;  5M3F B;  3PO3 G;  2B2V C;  1Y8N B;  2IWH A;  4IUN A;  4JOI A;  4CHT B;  4ME3 A;  3PUW A;  4DV4 Q;  3MA2 B;  4AYB E;  5CGK A;  1BQQ T;  1RD9 D;  4UPA A;  3TP6 A;  4A3G B;  2XIW A;  3PV0 A;  2KEC A;  3I3C A;  1HNX L;  4PQX A;  3NUC A;  4OL7 A;  4EQP A;  4FP5 D;  3X3M A;  1PH3 A;  3FPU B;  3KK7 A;  1F2L A;  4NW2 A;  5IYC G;  2ALY B;  4I7A A;  2Q8T A;  3M85 A;  1I3Q B;  2RDG A;  3I73 A;  1EYC A;  3SE0 A;  1HZC A;  4PNY A;  3P1H A;  1PA6 A;  4DV3 L;  3CKI B;  4P72 A;  3X3N A;  1EY6 A;  2KJX A;  4X3K A;  2E2I H;  2AWO A;  4KN4 C;  5J1Z A;  4E6I A;  5C4Z A;  3MEH A;  2KVM A;  1PTO C;  2YU9 B;  5EBC A;  4DV6 Q;  4LF6 Q;  1VQ5 A;  5EPL A;  5M3M H;  2JA9 A;  4JI0 L;  1X3P A;  3AQQ A;  1XTC D;  4JI4 L;  3E6Z X;  4V0B A;  5FLM H;  1Q1E A;  3FKI H;  4ZKB B;  2RF4 A;  3NBH B;  5T1G A;  4HJ7 A;  2XGT A;  4TKO B;  1K9M C;  2DJF C;  4HJ8 A;  4EQ5 A;  2AUJ D;  4RG1 A;  3HOV B;  1H9S A;  2WFW A;  5DM6 3;  3CC7 A;  3ZYY X;  1XNQ Q;  1EU3 A;  1SLJ A;  1QNU A;  1ESR A;  4IUU A;  3CC4 A;  1SMX A;  2L55 A;  1X56 A;  5IP7 H;  3HOY H;  5C3E H;  2RA4 A;  4G4K A;  2R7Z B;  4CDF C;  4IUR A;  1C8C A;  1C4Q A;  2NUC A;  3TRE A;  2RKS A;  5C4J H;  5JEA H;  1XMQ Q;  3DM3 A;  4H44 C;  2ZJR A;  1J6Q A;  1PZI D;  3TDQ A;  5IGC A;  2K32 A;  1AE2 A;  2F4I A;  1BVS A;  3L0O A;  4TRD A;  1X9N A;  1IL2 A;  1O7Z A;  1BO0 A;  1VMC A;  3L3O C;  1J5E L;  4LF5 Q;  1LTL A;  3CMA A;  1T5E A;  3CME A;  2EXZ A;  3KLR A;  3S1M B;  2F52 A;  1Q8I A;  3H15 A;  1SBB B;  4PMW A;  1KQS A;  4DR2 L;  3CCV A;  1LAC A;  4UAI A;  5IY0 A;  2FMC A;  2R92 G;  3HOZ B;  1QJO A;  4L5S A;  2OXP A;  3VR5 A;  2F1M A;  3ONA B;  1STN A;  4LFA Q;  3OWE B;  4DV7 Q;  1I4G A;  3K5O A;  3NEN A;  3RZO H;  4K0K Q;  2KCC A;  1I4P A;  1I4H A;  4ALP A;  4A3K B;  3O13 A;  4MIU A;  3GTP B;  1IBK Q;  1YNN D;  5CC4 A;  3SHL A;  3DEO A;  3K57 A;  4ODG A;  1IYJ B;  4KHP Q;  2XNA C;  1RTN A;  5D65 A;  1LTR D;  5HY6 A;  1QWY A;  4GKK L;  1HNW L;  4A3B G;  1A6X A;  1AP0 A;  4RHR A;  2E5L L;  1EIF A;  2YTY A;  2UXD L;  5C0X G;  5IGF A;  1A0I A;  4ME5 A;  3EBE A;  2UUA L;  5FJ8 H;  2VQE Q;  3IL8 A;  1A2U A;  2WAC A;  1TWG H;  4MTK A;  4PZ6 A;  4A3F G;  3T1Y Q;  2JA6 G;  1H9J A;  2VUM B;  4B3R Q;  1UNS A;  3K58 A;  5C5M A;  2L12 A;  2K75 A;  4GLX A;  1HRJ A;  2JA5 G;  1RJT A;  1B3A A;  1STA A;  1WI5 A;  4YCV A;  4HSP A;  3A8I E;  1N34 Q;  1MJC A;  1VQA A;  3TN2 A;  4QCL A;  4QGU A;  1DCZ A;  2F0E A;  4DV5 Q;  4PZ8 A;  1DJR D;  3SDZ A;  1HUM A;  5JVG 3;  4A3J H;  4BY7 G;  3FRP B;  3IFT A;  1O7I A;  3HOX B;  1Q7Y C;  2CCZ A;  4BA2 I;  2F0P A;  1S4Z A;  4DFA A;  1NJI C;  4FF1 A;  1QZH A;  3OTO L;  4LUO A;  1GOZ A;  4IUT A;  5I9O A;  4F7X A;  2UXC L;  3GDE A;  4RA8 A;  1YHQ A;  4JOI C;  3U4Z A;  1WD1 A;  1LTS D;  5IOC A;  1BCP B;  2LY7 A;  3GTJ H;  3S1R H;  2V1C C;  2OWO A;  1CHQ D;  3JAM E;  4KD3 A;  3E0J A;  4DR3 Q;  1Z9F A;  5COY A;  1F9P A;  2E8G A;  3NBI A;  1KC8 C;  5TSS A;  3W2D A;  2JK8 A;  4A76 A;  2P5Z X;  1TWC H;  1GM5 A;  3K7A B;  4WJ3 M;  1VF7 A;  2RBM A;  2SDF A;  4FF4 A;  4IOA A;  4QIW E;  3RUZ A;  2CWA A;  5CR3 A;  4FF3 A;  5DEH A;  2GN5 A;  4IPH A;  1QUQ A;  3K80 C;  3N6R A;  1EQV A;  3CCR A;  1TWA B;  1A2T A;  1RCV D;  2HIV A;  2XWJ B;  3LGJ A;  1VF5 C;  3CXC A;  2K5Q A;  1LT4 D;  1WYD A;  1X54 A;  3CP0 A;  2R3Z A;  1VQO A;  1VQG A;  1EUJ A;  3SXH A;  3VDY A;  1PXU A;  2F4V Q;  1D5X C;  3PUY A;  1FGU A;  2PI2 A;  4LUZ A;  4KI0 A;  1BBW A;  1STG A;  4JI1 L;  1XPU A;  1F9R A;  4JI8 L;  1D7Q A;  1L0W A;  3S15 B;  1SJE D;  2NVT B;  1SNQ A;  1TWH H;  1A8V A;  2IL8 A;  2SNS A;  1OO9 B;  4DV1 Q;  1F9Q A;  1MGS A;  1PTO F;  2D9U A;  3DLL A;  2Y0S B;  4KK7 A;  2ENB A;  1SJH D;  3GTK H;  1H95 A;  1NMF A;  3TSS A;  3EA6 A;  3PO2 B;  4K5W A;  2YV5 A;  4GKJ L;  3H0G G;  2OQ0 A;  4DUY L;  1QE6 A;  5K5P A;  4A3I G;  2A69 C;  2EXD A;  3F2U A;  4DAY B;  1JMC A;  2RQX A;  2EQS A;  3QR8 A;  1GHJ A;  4C3I B;  2I5M X;  5EKI A;  3S1Q B;  1IBM Q;  2BH2 A;  4YWK A;  2O2L D;  5E3F A;  3VR3 A;  5BN5 A;  5C4X B;  4N8F A;  2NZO A;  1VQD A;  4G57 A;  2NN6 I;  3HP3 A;  4CDD C;  3M3Y H;  4OGQ C;  1EFI D;  4HMJ A;  4X62 Q;  2I0Q A;  4IN3 A;  4DK3 C;  2K50 A;  4DR5 L;  1EQQ A;  4FNF A;  5ELO A;  4XQN A;  2X6L A;  3GTM H;  1K83 H;  1TR5 A;  5E7N A;  1SMY C;  4JI2 L;  2IHF A;  4DKA C;  1JE5 A;  2WIN B;  3RZD B;  1A15 A;  1EYA A;  1UEB A;  4J6H A;  3OMC A;  1WCM B;  1YNJ D;  1H9M A;  3OW7 A;  1CT1 D;  5J3B A;  1CKM A;  3KBX A;  3BVG A;  4I65 A;  5CV8 A;  3S1N B;  4R4O A;  1F2Z A;  2A8V A;  2Z6K A;  4GNX B;  1AH9 A;  1YIJ A;  5I6Y A;  3NHH A;  4U67 3;  1EIH A;  1B4O A;  4DR4 Q;  2F0V A;  1CTM A;  3KF8 B;  2EOT A;  1GHK A;  1F2M A;  1CI3 M;  4BBS G;  2A19 A;  1KDA A;  4CGY B;  4FXD A;  5M5Y B;  3BDC A;  3TBI B;  2ICE C;  4P71 A;  1XJV A;  3HOU B;  2KHS A;  5IWA L;  3C3L A;  3KBG A;  4IUQ A;  4IOC A;  4RH6 A;  3KOJ A;  3R2T A;  2AQ1 B;  3VR4 A;  1UE6 A;  1CQF A;  1SND A;  3NQT A;  1WTW A;  1B1Z A;  4OIJ A;  4A3M B;  1HTL D;  4LUV A;  3QB3 A;  3CCJ A;  4JV5 Q;  4OO1 H;  2RVL A;  3Q0A A;  2LXK A;  2X6G A;  5IE8 A;  2NVY B;  4JI5 Q;  1ZEQ X;  3PUV A;  1HQR D;  2F0S A;  4C3H G;  4O0A A;  3F8T A;  1GO3 E;  4DU9 A;  4GN3 B;  2M9V A;  1TII D;  1RDP D;  1BNZ A;  4Z9C B;  3J80 L;  3M9B A;  2XWB B;  1GUT A;  1J9O A;  5C44 B;  2R93 B;  4UY8 C;  1HUN A;  2ZXR A;  4K6L A;  3GTG B;  1EWC A;  5LMU L;  1G51 A;  2OT2 A;  3V96 A;  3CU7 A;  1C7Y A;  2BOS A;  4JI7 Q;  2RDF A;  3EFX D;  1X55 A;  4EQN A;  2K14 A;  1PH8 A;  2E2J B;  1GD7 A;  4B3S Q;  2Z6B A;  3MXU A;  1K3R A;  2EDG A;  3BU2 A;  2PNR C;  3UI2 A;  3GTL B;  4K8I A;  1JWS D;  2C9O A;  1SYE A;  1EZ6 A;  3OIQ A;  3S2H H;  1FL0 A;  1ZYR C;  1SYD A;  1PZJ D;  5G3L F;  2DY7 A;  2NVQ B;  2PPB C;  3BZK A;  3I55 A;  3MTS A; 
#chains in the Genus database with same CATH homology
 5FK9 C;  3KLS A;  4DXF A;  5D14 A;  3M4O B;  1I4X A;  1SYG A;  2WKD A;  2EYF A;  3BVZ A;  3T53 B;  1RF2 D;  3OSO A;  4C3J B;  2CVR A;  2NTT A;  1OXS C;  4BS9 A;  3K5N A;  2ZXP A;  3MFG A;  2RDH A;  2JEA I;  1V8Q A;  4RCN A;  1LTI D;  2N88 A;  1SYB A;  3R8B A;  3TZU A;  3A56 A;  4CJ1 B;  3GV3 A;  4CJ0 B;  1BXT A;  2FFK B;  4A93 B;  1LTG D;  3QJY A;  2K01 A;  3BVM A;  3NE5 B;  4QMG A;  5IGG A;  1EYD A;  1PFM A;  1H9K A;  2LKV A;  2F0T A;  3NP8 A;  1M8A A;  1RKN A;  2JA7 B;  1V1P A;  4Q5V A;  4A3E B;  1SE4 A;  1JWM D;  1OXV A;  1PRT D;  3MXN A;  1WD0 A;  3T51 B;  3HOW B;  3ERQ A;  4HMI A;  2XN9 C;  3HS0 C;  1JOQ A;  1ML0 D;  2HQE A;  3NTI A;  2MJ8 A;  4DK0 A;  3CRK C;  5DAU A;  4L8J A;  1M4V A;  5T1I A;  1GJX A;  5COR A;  2VB2 X;  2IT1 A;  3T16 A;  2KOL A;  4KV6 A;  3PUZ A;  1HFN A;  2KCN A;  1SYF A;  3K5L A;  4K2K A;  2KEE A;  1ENF A;  2EYM A;  1GUW A;  1JE4 A;  1BCP C;  2N55 A;  3OPO A;  1MBY A;  3I4N B;  5ELF A;  5M9O A;  3OOC A;  2R61 A;  3VA7 A;  4DGZ A;  4IFD J;  3I8Z A;  3MXG A;  4HCS A;  3M7N A;  3GD7 A;  3I4M B;  3VR6 A;  1EY4 A;  2ICI A;  3U9S A;  1SNC A;  3V2T A;  1ZXT A;  3FVQ A;  1IKL A;  4CJ2 C;  4WFN 3;  3H3V C;  1HTP A;  1EY0 A;  2J0T D;  1ENC A;  2G9H D;  3S17 B;  2MP1 A;  5ISR A;  3JAM L;  4LMQ D;  4K2L A;  2RSN A;  2JP1 A;  2MHV A;  2F0N A;  1JCK B;  1LLR D;  3SVM A;  1XYI A;  1E2Z A;  3HEJ A;  5I9P A;  4FYD A;  3H09 A;  4XIG S;  1F9S A;  2EYJ A;  3A7L A;  2Q8I B;  2SOB A;  1HHV A;  5F2D A;  3LWE A;  1EQT A;  2B2U C;  2B63 B;  4XT1 B;  1E2W A;  3D4D A;  1S5E D;  3QOJ A;  4KD4 A;  4RHS A;  1OXU A;  2F0I A;  1KDB A;  5C6A A;  3S9W A;  1CFM A;  2E75 C;  5FOB B;  2LMC B;  1Y1W B;  1UEA B;  4TQU S;  5IGB A;  4HSV A;  1W6J A;  2RSO A;  5M5X B;  2A6H D;  2OF1 A;  2I46 A;  3FPP A;  4DNT B;  3DWQ A;  3DMU A;  1G91 A;  1U9R A;  3NQI A;  3NK9 A;  5IT9 E;  3QO2 A;  3CRL C;  3DUZ A;  4A3D B;  2SEB D;  1S5C D;  1RHP A;  4RKB A;  3K5M A;  1NAP A;  4X3U A;  1ICW A;  1TT2 A;  2QDB A;  1EEF D;  4B9X A;  4KHV A;  3K59 A;  1TY0 A;  1PTO H;  5EJW A;  4YIJ A;  4QUF A;  3D6C A;  1QOH A;  4ZKC B;  4XYQ A;  2PW7 A;  4NDX A;  5J22 A;  2NB0 A;  5C0X H;  4G7O C;  3GTO B;  5EQ0 A;  1U4M A;  5IGE A;  2WAQ B;  3DM1 A;  3S16 B;  2FHT A;  3D6W A;  4ULL A;  1U4R A;  4FF2 A;  2BA1 A;  1R4Q B;  1Q12 A;  4C3I G;  1L0Y B;  1VDZ A;  1YNN C;  4CKE A;  4ID6 A;  4X3T A;  1G6Z A;  1HA5 A;  3AMU A;  1PYW D;  1L0X B;  2D5D A;  1PRT B;  5KNC A;  2BE5 D;  1DZ1 A;  5E4W C;  4XDX A;  2E2I B;  4NP5 A;  2B8G A;  5M3M B;  2AQ3 B;  5C0X I;  4WJW A;  1DYQ A;  5I2X A;  3FKI B;  1D6E C;  1F2Y A;  3LWU A;  5EBD A;  3NBH A;  1BCP F;  1O80 A;  1AW7 A;  3SEB A;  4MN3 A;  4ZQ3 A;  3R93 A;  1TS4 A;  3G6J B;  2WP8 J;  1J8I A;  2K6A A;  5A2Q L;  4DN4 M;  5LHY 1;  5DNF A;  5KGU A;  3HOY B;  5C3E B;  1WTO A;  3Q6S A;  4IFD G;  1STE A;  4O1N A;  4KKS A;  5C4J B;  3M4Y A;  4KHZ A;  5C3W A;  2MGS A;  4AYB B;  2IX1 A;  3C1F A;  2A73 B;  1IW7 D;  5CV4 A;  1ENA A;  3NWS A;  3LNN A;  1T5X D;  3EJI A;  2TMP A;  1IKM A;  2O5I C;  5AFW A;  3D4W A;  3T4A C;  1FYC A;  2F0W A;  4ILW A;  1EY5 A;  3RZO B;  1B44 D;  1D1K A;  1NSN S;  2K05 A;  1LTT D;  2IJ0 A;  5C3X A;  1LT3 D;  1G29 1;  1SNP A;  4C56 C;  5KNB A;  4RFB A;  2E76 C;  3SK6 A;  2QEJ C;  4R9W A;  4L6T B;  3PMF A;  4FVM A;  1QB5 D;  2IPK D;  3EQL C;  5E1F A;  5FO9 B;  4XYO A;  4MHE A;  3MHB A;  1ONL A;  1FNU A;  3ND8 A;  1QIL A;  5DM7 3;  1NUC A;  4G7Z C;  3PIP 3;  3P20 A;  1NCV A;  1TWG B;  4K6D A;  4M1U B;  2XRS D;  4ZYS A;  3I91 A;  4C3J G;  1JC7 A;  4QB4 A;  1SXT A;  3I72 A;  1G8Z D;  3SR1 A;  1S5D D;  2C5C A;  2J7Z A;  4RCO A;  4A3J B;  2H1E A;  5CV9 A;  4N9T A;  1SEB D;  2F0H A;  2PW5 A;  1G2S A;  3DEP A;  3C2P A;  2A68 D;  1HQM C;  2J4X A;  1TS2 A;  2A6E D;  3PUX A;  3BZD B;  3GTJ B;  3S1R B;  1YNJ C;  2WB1 B;  5I2Y A;  3C46 A;  1SYC A;  4C1N I;  2QCP X;  1AZQ A;  2EY6 A;  3MWY W;  2K28 A;  4G7H C;  5KIX A;  1TWC B;  4HTH A;  2A74 C;  2CW0 D;  1WVL A;  3OHX C;  3KUP A;  2E74 C;  4XT3 B;  2F0O A;  1EU4 A;  3HZX A;  1JOO A;  1QCB D;  4DAP A;  2F0G A;  4DF7 A;  3MVV A;  2QF7 A;  1MSH A;  3NWT A;  4LJZ C;  4R8N A;  2M00 A;  4B9W A;  4FXK C;  2FIN B;  1TWH B;  1SE2 A;  1I6V C;  1WTR A;  4EQO A;  2Z4I A;  1UUP A;  3GTK B;  2L5T A;  4OO1 I;  2XSC A;  3W3A A;  1AZP A;  2MUY A;  3TP5 A;  4F87 A;  1EIG A;  5LL6 S;  2JEB I;  4S3S A;  4U68 A;  1EZ8 A;  4DAY A;  2B2U A;  1KNA A;  3I4L A;  3H91 A;  2GA4 B;  1SE3 A;  2F0K A;  1HCZ A;  3M3Y B;  3E5S A;  2E2D C;  4IZ8 A;  1TS5 A;  5FO7 B;  4KJO A;  3VA5 A;  1W6K A;  4QF4 A;  4UDU C;  5KYL A;  1BOS A;  2KED A;  1I4R A;  4RGN A;  4PMC A;  1CA5 A;  2LS0 1;  1STY A;  3GTM B;  1K83 B;  3QIA A;  4QIW B;  4DAV A;  3P75 A;  3Q23 A;  1D5M C;  1FR3 A;  1ESF A;  1AEX A;  4KJN A;  1BR9 A;  1Y8P B;  2F3W A;  1TS3 A;  5K36 G;  2VNU D;  5IT9 L;  3HG9 A;  3A8K E;  3TME A;  1R4P B;  3OWF A;  4KN7 C;  1H9S B;  5D3D A;  3KF8 A;  4RAU C;  1MI2 A;  4DXG A;  4K8J A;  4F88 A;  1JR0 D;  2A5H A;  2NZ1 D;  3DXJ C;  2BA0 A;  2AUK A;  3D31 A;  1GUS A;  1DXM A;  1I4Q A;  2HCC A;  1XX8 A;  1LT5 D;  1PFB A;  1V43 A;  1E0B A;  5EPK A;  1PRT C;  1EOT A;  1KTK A;  2HUG A;  2B2Y C;  2QIL A;  1BDO A;  1Y8O B;  1K8O A;  2JE6 I;  1B53 A;  2ZT9 C;  1CHP D;  3J7A F;  5FLX E;  1EL0 A;  1OXT A;  4TSS A;  1XXG A;  5I6W A;  2AWN A;  1C48 A;  3LX0 A;  3DHQ A;  3DWA A;  3S2H B;  5KND A;  4ZRZ A;  3SK5 A;  2F0Q A;  4ABN A;  2V4D A;  3AB9 A;  2D2C C;  2PZU A;  3MXP A;  4BBR B;  2PYK A;  5KYI A;  1A3U A;  2ZXO A;  5C4H A;  3SK8 A;  1IHZ A;  3DWP A;  2L1B A;  1PTO D;  2IW3 A;  1EY7 A;  1PDQ A;  5CV6 A;  1TU2 B;  1TKW B;  1B9M A;  2JSO A;  4BY1 B;  3L7Z C;  1JB3 A;  3D4R A;  2L4N A;  1R9T B;  1DM0 B;  2EYP A;  2WV6 D;  1O7L A;  5IIF A;  4XTC S;  2F0F A;  2EJF C;  1ET9 A;  2O5J C;  1KDC A;  3P7J A;  2F0U A;  1UAP A;  1B9N A;  2HDM A;  3BDO A;  5KRU A;  1TY2 A;  1S5F D;  3OMG A;  1D5Z C;  4ZLT F;  2L0C A;  3Q22 A;  1KNE A;  5EKK A;  5FKA C;  5CBE E;  1QG7 A;  1GUG A;  1B50 A;  2EY1 A;  1LT6 D;  2O4X A;  2Q8R E;  4X3S A;  3A8J E;  4HED A;  4ZUJ A;  2PO4 A;  1FGB D;  2F03 A;  1O7Y A;  3BDL A;  2NBF A;  3H6M A;  2KQ3 A;  3BS1 A;  3GTQ B;  2DNC A;  4R8I A;  5JEA G;  3QG1 A;  5IGD A;  5ELD A;  2NWG A;  3I90 A;  4NMZ A;  1SNO A;  4PMB A;  2DY8 A;  4HAE A;  2A6H C;  3QWN A;  1CZG A;  2K7V A;  1Q3L A;  4FXG C;  3VYR A;  2B2W C;  3SK4 A;  2F0M A;  1KAA A;  1Z47 A;  3HKZ B;  3NSW A;  4H13 C;  1GUO A;  3MZ5 A;  3S14 B;  3EVQ A;  5JAV A;  2K04 A;  1DD2 A;  3VYS A;  3OIP A;  3PO3 B;  3J81 E;  4JK1 C;  2IX3 A;  3J7A V;  2PMZ B;  2F0D A;  1HA6 A;  5C5L A;  4L63 B;  1D2B A;  1FNV A;  2K03 A;  3IKJ A;  4KY7 A;  2Z4H A;  5CYU A;  5JVH 3;  1RTO A;  1PZK D;  2K1B A;  1G2T A;  1AN8 A;  2HDL A;  5M5W B;  4O42 A;  5G3L D;  2M2L A;  3NPP A;  2NTS A;  1TVX A;  2EYO A;  1PRT F;  1LAB A;  4IUP A;  3RMH A;  4K14 A;  3J7Y W;  3S2D B;  3KLS X;  2DNE A;  1II3 A;  1CZW A;  4CBV A;  1K8M A;  1SAP A;  5I4D A;  3NTH A;  4EVO A;  5IOD A;  2JYO A;  2BE5 C;  4DA2 A;  1JQY D;  3G7L A;  1MD2 D;  4K5X A;  3HRZ C;  4IFD H;  4J1M A;  3TZD A;  1CQV A;  3VYT A;  5NUC A;  4F8M A;  4CKC A;  2B8F A;  4IUV A;  2NYZ D;  5LL6 X;  5EGT A;  2NVX B;  5HUR A;  4KKT A;  1LV9 A;  1TWF B;  2R92 B;  1Y1V B;  2NN6 H;  3AU7 A;  2A69 D;  2NN6 G;  5CBA E;  5E4X A;  2KA7 A;  1OXX K;  1HFG A;  1O78 A;  5JPM C;  1IW7 C;  1PTO B;  2F0J A;  4FO2 A;  4KMU C;  3V05 A;  2XRQ D;  4A3B B;  4EGV A;  3A55 A;  4IFD I;  1H9R A;  5ELE A;  1I50 B;  1X3Q A;  2K5D A;  1A3V A;  2TSS A;  2L9H A;  5EPJ A;  4ZAI A;  1ROD A;  4B08 A;  4A3F B;  2K5W A;  5JJZ A;  2JA6 B;  4DNR B;  3H94 A;  4C1N K;  1SMY D;  2B2T A;  2EJM A;  3NTK A;  4H7B A;  2JA5 B;  3IAY A;  4BA1 I;  2FMM A;  2PQE A;  1ZKO A;  1GUN A;  2XVS A;  1LTB D;  2F3V A;  3K6O A;  3BYT B;  4PV1 C;  2CHB D;  1ILQ A;  4JBW A;  4BY7 B;  4NKL A;  1SDF A;  2H4O A;  3NXW A;  1U4L A;  1JOR A;  1Q1B A;  2B2Y A;  2G9D A;  3R2I A;  1E2V A;  1JOK A;  1BUV T;  2WII B;  2DN8 A;  4CKB A;  1EY8 A;  4KTA A;  5JOB A;  4WOR A;  4XQQ A;  1V1P B;  3K0Y A;  1WTP A;  4XQJ A;  1VMP A;  1A3T A;  3MC0 B;  4BWG B;  1KAB A;  4RGO S;  5JPN C;  4HN7 A;  5FLX L;  2YYZ A;  1NR2 A;  3I70 A;  2EE1 A;  4DK1 A;  1PFN A;  5CV7 A;  1KLG D;  2VXW A;  2EYL A;  2A68 C;  3CQZ B;  3M7G A;  1LO5 D;  2F0L A;  3BG3 A;  4I7Z C;  2A6E C;  2IX0 A;  4Q0F A;  2B39 A;  1HXY D;  2PCF B;  2B2V A;  1FD7 D;  2PZW A;  4OO1 G;  1EY9 A;  3MFY A;  5J39 A;  3ERO A;  3L9A X;  2CQA A;  1D1I A;  1ZYR D;  5ELC A;  4LAA A;  1DON A;  2CW0 C;  3N52 A;  4RWS C;  1KLU D;  4RGT A;  5HGT A;  4OHJ A;  3H0G B;  3RD4 A;  4A3I B;  2EY5 A;  5CV5 A;  1WTQ A;  1STB A;  5KEE A;  2EZV A;  1X32 A;  3HGB A;  5A2Q E;  4HR7 B;  1CA6 A;  2BDO A;  5FO8 B;  1DOL A;  3GO5 A;  1LTA D;  5EKL A;  2BCO A;  1SNM A;  3FDT A;  3WOE A;  5JEA J;  2MPM A;  2K33 A;  3GP7 A;  3GQB A;  1EEI D;  1ILP A;  2VB3 X;  3ND9 A;  3GV6 A;  2EYH A;  1WTV A;  2QKI C;  3ITP A;  3A7A B;  1HPC A;  2JA8 B;  4Y7N B;  1PMR A;  2E2H B;  3R3O A;  4C2M B;  5BN4 A;  3PIO 3;  3IFD A;  2Z1C A;  1SFO B;  2PZT A;  4GZY C;  1V1O A;  4HCE A;  1F77 A;  1Q90 A;  1CM9 A;  1FNW A;  5K36 H;  1NR4 A;  1VCI A;  1PLF A;  3TP8 A;  3URY A;  2R6G A;  4OIK A;  4KY6 A;  1IYV A;  4QUC A;  3WDN A;  2FJ2 A;  1Y69 U;  4ZK9 B;  3RLF A;  4BBS B;  1I6H B;  3TP7 A;  2ID0 A;  5A35 A;  1B2T A;  2JXM B;  3C1E A;  1QNK A;  5C0X J;  2B2T C;  2B2W A;  2BDN A;  3CHB D;  2Z8L A;  3A54 A;  4N9P A;  1CK1 A;  1Z7T A;  4IQZ A;  2WKC A;  3WOF A;  3QOL A;  3BYY B;  5D3I B;  4C3H B;  1WTX A;  3MAQ A;  2KUM A;  1SSO A;  2OEO A;  4LK1 C;  2EY2 A;  1GXD C;  1ET6 A;  5ELB A;  2X69 A;  4V19 0;  1Z6H A;  1IL8 A;  4J8Q A;  1JIC A;  3J81 L;  1TQO A;  4IAL A;  3T56 B;  1IYU A;  1BBX C;  2EVB A;  2L11 A;  1JWU D;  4KY5 A;  4K5V A;  1BCP D;  1EWH A;  4KKU A;  4RKL A;  1AFP A;  2LFN A;  2AQ2 B;  1BF4 A;  3D8G A;  3D3R A;  3T13 A;  4WRD A;  2EJG C;  2I07 B;  3FEW X;  1U4P A;  1MSG A;  5BN3 A;  3VR2 A;  2HCI A;  3U9O A;  2SNM A;  1STH A;  4H0L C;  4XXE A;  4RGM A;  4M8A A;  1DOM A;  3FMC A;  1DOK A;  2EPB A;  3Q24 A;  3J80 E;  1S5B D;  5CMD A;  1XWE A;  4P2C B;  4ZUI A;  2D62 A;  3VYU A;  5M3F B;  2B2V C;  1Y8N B;  2IWH A;  4IUN A;  4CHT B;  3PUW A;  3MA2 B;  5CGK A;  1BQQ T;  1RD9 D;  3TP6 A;  4A3G B;  2XIW A;  3PV0 A;  2KEC A;  3I3C A;  4PQX A;  3NUC A;  4OL7 A;  4EQP A;  4FP5 D;  3X3M A;  3FPU B;  3KK7 A;  1F2L A;  4NW2 A;  2Q8T A;  3M85 A;  1I3Q B;  2RDG A;  3I73 A;  1EYC A;  3SE0 A;  4PNY A;  3P1H A;  3CKI B;  3X3N A;  1EY6 A;  2KJX A;  4X3K A;  2AWO A;  4KN4 C;  5J1Z A;  4E6I A;  5C4Z A;  3MEH A;  2KVM A;  1PTO C;  2YU9 B;  5EBC A;  5EPL A;  1X3P A;  1XTC D;  3E6Z X;  4V0B A;  1Q1E A;  4ZKB B;  5T1G A;  4TKO B;  2AUJ D;  3HOV B;  1H9S A;  5DM6 3;  3ZYY X;  1EU3 A;  1QNU A;  1ESR A;  4IUU A;  2L55 A;  2RA4 A;  4G4K A;  2R7Z B;  4IUR A;  1C8C A;  1C4Q A;  2NUC A;  2RKS A;  5JEA H;  4H44 C;  1PZI D;  3TDQ A;  5IGC A;  2K32 A;  2F4I A;  4TRD A;  1O7Z A;  1BO0 A;  1VMC A;  3L3O C;  1T5E A;  2EXZ A;  3KLR A;  3S1M B;  1Q8I A;  1SBB B;  4PMW A;  1LAC A;  4UAI A;  2FMC A;  3HOZ B;  1QJO A;  2OXP A;  3VR5 A;  2F1M A;  3ONA B;  1STN A;  3OWE B;  1I4G A;  3K5O A;  2KCC A;  1I4P A;  1I4H A;  4A3K B;  3O13 A;  4MIU A;  3GTP B;  1YNN D;  5CC4 A;  3SHL A;  3DEO A;  3K57 A;  4ODG A;  2XNA C;  1RTN A;  5D65 A;  1LTR D;  1QWY A;  1A6X A;  1AP0 A;  4RHR A;  5C0X G;  5IGF A;  4ME5 A;  3IL8 A;  1A2U A;  2WAC A;  1H9J A;  2VUM B;  1UNS A;  3K58 A;  5C5M A;  2L12 A;  1HRJ A;  1RJT A;  1B3A A;  1STA A;  4HSP A;  3A8I E;  3TN2 A;  4QCL A;  1DCZ A;  2F0E A;  1DJR D;  3SDZ A;  1HUM A;  5JVG 3;  3FRP B;  3IFT A;  3HOX B;  4BA2 I;  2F0P A;  1S4Z A;  4DFA A;  4FF1 A;  1GOZ A;  4IUT A;  5I9O A;  4F7X A;  4RA8 A;  1WD1 A;  1LTS D;  5IOC A;  1BCP B;  2LY7 A;  1CHQ D;  3JAM E;  4KD3 A;  3E0J A;  5COY A;  1F9P A;  3NBI A;  5TSS A;  3W2D A;  3K7A B;  1VF7 A;  2RBM A;  2SDF A;  4FF4 A;  3RUZ A;  5CR3 A;  4FF3 A;  5DEH A;  3N6R A;  1EQV A;  1TWA B;  1A2T A;  1RCV D;  2XWJ B;  1VF5 C;  2K5Q A;  1LT4 D;  2R3Z A;  3SXH A;  1PXU A;  1D5X C;  3PUY A;  4KI0 A;  1STG A;  1F9R A;  3S15 B;  1SJE D;  2NVT B;  1SNQ A;  2IL8 A;  2SNS A;  1OO9 B;  1F9Q A;  1MGS A;  1PTO F;  2D9U A;  2Y0S B;  4KK7 A;  2ENB A;  1SJH D;  3TSS A;  3EA6 A;  3PO2 B;  4K5W A;  1QE6 A;  5K5P A;  2A69 C;  3F2U A;  2RQX A;  1GHJ A;  4C3I B;  5EKI A;  3S1Q B;  2O2L D;  5E3F A;  3VR3 A;  5BN5 A;  5C4X B;  4G57 A;  2NN6 I;  3HP3 A;  4OGQ C;  1EFI D;  4HMJ A;  4IN3 A;  4FNF A;  4XQN A;  2X6L A;  1TR5 A;  1SMY C;  2WIN B;  3RZD B;  1A15 A;  1EYA A;  4J6H A;  3OMC A;  1WCM B;  1YNJ D;  1H9M A;  3OW7 A;  1CT1 D;  3KBX A;  3BVG A;  4I65 A;  5CV8 A;  3S1N B;  1F2Z A;  5I6Y A;  3NHH A;  4U67 3;  1EIH A;  1B4O A;  2F0V A;  1CTM A;  2EOT A;  1GHK A;  1F2M A;  1CI3 M;  1KDA A;  4CGY B;  4FXD A;  5M5Y B;  3BDC A;  3TBI B;  2ICE C;  3HOU B;  2KHS A;  3C3L A;  3KBG A;  4IUQ A;  4RH6 A;  3R2T A;  2AQ1 B;  3VR4 A;  1CQF A;  1SND A;  3NQT A;  1WTW A;  1B1Z A;  4OIJ A;  4A3M B;  1HTL D;  3QB3 A;  4OO1 H;  2RVL A;  3Q0A A;  2X6G A;  2NVY B;  1ZEQ X;  3PUV A;  1HQR D;  2F0S A;  4C3H G;  4DU9 A;  2M9V A;  1TII D;  1RDP D;  1BNZ A;  4Z9C B;  3J80 L;  2XWB B;  1GUT A;  1J9O A;  5C44 B;  2R93 B;  1HUN A;  2ZXR A;  4K6L A;  3GTG B;  1EWC A;  2OT2 A;  3V96 A;  3CU7 A;  2BOS A;  2RDF A;  3EFX D;  4EQN A;  2E2J B;  3MXU A;  2EDG A;  2PNR C;  3UI2 A;  3GTL B;  4K8I A;  1JWS D;  2C9O A;  1SYE A;  1EZ6 A;  3OIQ A;  1ZYR C;  1SYD A;  1PZJ D;  5G3L F;  2DY7 A;  2NVQ B;  2PPB C;  3MTS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...