3OWGA

Crystal structure of vaccinia virus polyadenylate polymerase(vp55)
Total Genus 133
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
133
sequence length
468
structure length
457
Chain Sequence
NITLKIIETYLGRVPSVNEYHMLKSQARNIQKITVFNKDIFVSLVKKNKKRFFSDVNTSASEIKDRILSYFSKQTQTYNIGKLFTIIELQSVLVTTYTDILGVLTIKAPNVISSKISYNVTSMEELARDMLNSMNVAVVSSLVKNVNKLMEEYLRRHNKSCICYGSYSLYLINPNIRYGDIDILQTNSRTFLIDLAFLIKFITGNNIILSKIPYLRNYMVIKDENDNHIIDSFNIRQDTMNVVPKIFIDNIYIVDPTFQLLNMIKMFSQIDRLEDLSKDPEKFNARMATMLEYVRYTHGIVFDGKRNNMPMKCIIDENNRIVTVTTKDYFSFKKCLVYLDENVLSSDILDLNADTSCDFESVTNSVYLIHDNIMYTYFSNTILLSDKGKVHEISARGLCAHILLYQMLTSGEYKQCLSDLLNSMMNRDKIPIYSHTERDKKPGRHGFINIEKDIIVF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Domain-level rocking motion within a polymerase that translocates on single-stranded nucleic acid.
pubmed doi rcsb
source organism Vaccinia virus wr
molecule tags Transferase
molecule keywords Poly(A) polymerase catalytic subunit
total genus 133
structure length 457
sequence length 468
chains with identical sequence B
ec nomenclature ec 2.7.7.19: Polynucleotide adenylyltransferase.
pdb deposition date 2010-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03296 Pox_polyA_pol Poxvirus poly(A) polymerase nucleotidyltransferase domain
A PF12629 Pox_polyA_pol_C Poxvirus poly(A) polymerase C-terminal domain
A PF12630 Pox_polyA_pol_N Poxvirus poly(A) polymerase N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.320 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Substrate Binding Domain Of Dnak; Chain:A; Domain 2 3owgA01
3.30.460.60 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase; domain 2 3owgA03
3ER9B 2GA9D 2GAFD 3OWGA 3ERCC 3ER8C
chains in the Genus database with same CATH superfamily
8ICUA 4QZFA 4WBZA 5CB1A 4QZGA 4JLXA 1HTYA 1HUZA 2YL9A 8ICMA 9ICIA 5DBBA 2F7RA 1ZQFA 1JMSA 5CFSA 8ICKA 2C08A 3BVUA 3EJUA 7ICUA 1JQRA 4OAFA 1ZQPA 4EZSA 2F1BA 1OA1A 4AKVA 8ICWA 2B51A 4FM3A 7ICFA 4KLGA 4TUSA 7ICJA 4LEVA 1BPXA 3QWEA 5CHEA 4XA5A 3UXOA 8ICIA 1TV9A 3B51X 3DX2A 4WC0A 3B53X 4TUQA 4FHPA 2BBJA 4LEZA 5HHHA 1ZQCA 9ICPA 4FZOA 1GNTA 3EJTA 3JCFA 3NKUA 4OAGA 4PH5A 4WC4A 2X5CA 4IWQA 5J2GA 3O3MB 5D46A 3OVBA 4R5IA 2RAJA 5J0QA 4UB1A 4XJEA 4HR1B 4AZHA 4UB5A 2EWFA 8ICNA 4KLIA 4LZDA 3C18A 2PFPA 3JYYA 3F7WA 5J0UA 4I2JA 7ICMA 2RT6A 4UAWA 3UQ2A 1TVAA 3MBYA 3LMFA 2IHOA 1BPDA 1ZQUA 1MIVA 2PBEA 1FA0A 5J0OA 2ZH8A 4Z6FA 4EZQA 4I0UA 2F7OA 3DX1A 1YLQA 1I49A 5FLEX 4JLZA 4EZUA 2ND1A 2YI8A 1U00A 2EFKA 4KLTA 4RT3A 3H37A 5IILA 7ICRA 4F00A 1I4LA 9ICKA 3I39X 4KLDA 3HAHA 4AZGA 9ICFA 1QWNA 3O3NB 3CV5A 2X3WA 4H6IA 4NXZA 4PGYA 2V0OA 3PMNA 3AQLA 3PMLA 5HRFA 4UBBA 4I2FA 3V7JA 3T4AG 3CVRA 5BOLA 3HIYA 1R34A 3CZSA 4FHXA 4WCWA 4PHPA 2BCSA 4O5EA 2ISOA 8ICFA 3QNJA 2YLAA 5DECA 2M2UA 7ICVA 1GPJA 1RPLA 4M0AA 1ZQVA 3SYVA 1NO5A 1ZQJA 4NXVA 2GWSA 4I2IA 2ZH2A 4I2HA 8ICQA 4MFAA 2EFLA 4NKTA 1R33A 2FCLA 3WFPA 1UETA 1VFGA 5CFTA 2BBHA 4RPXA 3D4ZA 3Q0KA 3OK8A 8ICAA 4GXJA 4NY8A 1Y2OA 1BPYA 1ZQAA 4IM0A 4RQ3A 3AQKA 4AT7A 1TQUA 2BPFA 9ICEA 4RQ6A 5D62A 4PGXA 4IW0A 9ICSA 3BUIA 2YIVX 4F01A 4S3NA 7ICIA 4QZBA 3RJIA 1TFYA 1QX1A 8ICSA 4M9NA 3HX0A 4K4GA 2ZHAA 3QA8A 1PS3A 4UD4A 5CHGA 4K8VA 4X4QA 5DBCA 4UAZA 4P4OA 4EZXA 4PPXA 3OVAA 5IIOA 1XSNA 3B0YA 1E1DA 2LM0A 8ICZA 4RWPA 4K97A 4FH3A 2Q12A 4WC5A 5D63A 1JN3A 3T48A 1ZQYA 4X4RA 5J2KA 1ZQEA 4JWDA 9ICRA 4UB3A 2Z0VA 4Z6CA 5DDMA 7ICSA 4KLOA 3CAZA 7ICGA 8ICJA 5IIKA 2F7QA 1O7DB 9ICTA 3UITA 1ZQGA 2QKWA 1RZTA 1HWWA 4M0MA 4YD2A 4JNFA 1X04A 3AU6A 4RT2A 3BUDA 2YIAA 2OBLA 5C5BB 4ATMA 4E80A 5J0WA 4FO1A 4TUPA 2O5AA 4M47A 2BCUA 1YWMA 4QZCA 2OO2A 4I2GA 4KLJA 4XQ8A 2YLLA 3C2MA 2ZH5A 8ICGA 3O3OB 8ICBA 2FYVA 7ICLA 4RQ2A 4MF2A 3WFQE 4OAHA 5CP2A 4KLQA 3D50A 2VANA 4YMNA 3WFOA 8ICVA 3RJGA 1ZWWA 2X3XA 4IQWA 2DR9A 4EZRA 4O5CA 4QZ9A 4WQLA 4EZZA 4EZYA 3KDRA 7ICOA 3DPQA 3C2LA 9ICHA 4UBCA 3OV7A 1OA0A 4M2YA 2JNSA 5J0PA 2YKTA 4YD1A 1ZJNA 4WC6A 1NOMA 4QZEA 4PO2A 9ICOA 4JN4A 3TFSA 3JPRA 3AUOA 4NM2A 7ICHA 4DOBA 4RQ0A 3BLBA 1WOTA 3AU2A 3V7KA 2P66A 4NLNA 1KDHA 4EZTA 5D4BA 3DYTA 4NKUA 1SU6A 3DDFA 4X4NA 3UXPA 3CK6A 3BUPA 3HWTA 2PFOA 4UAYA 2DR7A 8ICTA 4WC7A 2O0I1 4WPCA 2QXLA 4R5LA 4JNEA 4EZWA 1R89A 2BCRA 4RQ5A 3V72A 4K9BA 4UDXX 5DB9A 3UQ0A 1TQWA 5CWRA 4DYLA 2FMPA 4I2EA 4UB2A 4EP7A 4O5KA 7ICPA 3GI7A 4RWQA 4X4SA 1Q78A 4R5GA 4I2CA 5J0SA 4NXXA 3HAJA 1XSLA 1DKZA 3K7DA 4GXIA 4IM3A 2ELBA 1DKYA 2D4CA 5DDYA 4WC3A 1ZQHA 4KLHA 3MDCA 4X0AA 2YL8A 3RPMA 1TFWA 1W9MA 2HHPA 3OUYA 2WYHA 3ABHA 1TQTA 4F5OA 3BVTA 4OAIZ 3L9DA 3G9GA 9ICGA 4WC1A 2GF4A 4EZPA 4JWCA 1ZJMA 4R5JA 4M9JA 4NXUA 1SUFA 3JPTA 3RH6A 5J2DA 5IIIA 4XRHA 4JWEA 4F5RA 3QNIA 4X0BA 4YCXA 5J2FA 3LVTA 3D2EA 3M3WA 1R8CA 4EEDA 3JPQA 4RQ7A 4IWOA 5HRHA 2QFFA 2GAFD 4KLUA 4FZPA 3TFRA 5BPCA 5HREA 4IQUA 4UB4A 1MQ2A 4NLKA 2YL5A 3CKDA 4AVMA 1XSPA 5F2VO 4XQ7A 5DKWA 4RPZA 1PX5A 9ICUA 4DOCA 4QZ8A 4K4HA 4GXKA 5HRKA 4HX0A 4WPEA 4IWPA 8ICOA 2PY6A 3H3AA 4FHWA 4N7RA 4RWOA 5C5BA 3BVVA 3NVOA 1ZQIA 4Z6EA 1V4AA 3DX4A 3OWGA 4H8SA 2M2VA 2ZH3A 4I1QA 3C5FA 1KEJA 4LZGA 4EEBA 4O68A 7ICQA 3MCRA 3LLLA 4BNEA 1ZQZA 2W9MA 4WOYA 5FIGA 4AT9A 4EGWA 5IIMA 4EBKA 4JWIA 3PNCA 4NSWA 8ICCA 3ZEDA 2BPCA 3I01A 2LXYA 4YN4A 4F5NA 1UEVA 3KAVA 4KIKA 8ICHA 4FH5A 2OZNB 3JPOA 1TQSA 2OW7A 1UPXA 5J2BA 5J29A 1E9VA 4UDYX 3UPSA 3MGHA 3RJJA 2F1AA 4LT6A 4X4VA 2IHMA 4X4PA 4JWMA 4LEYA 3GDXA 4UD5A 3ISDA 4QZAA 1GN9A 4AT7B 1X03A 4Z6DA 5CA7A 5CR0A 3MGIA 5B3PA 9ICVA 2X3VA 4F5QA 4DCNC 5J2EA 3DX0A 5DB8A 2FMSA 3RJEA 1Q79A 3LQCB 1ZQWA 3OGUA 4IG8A 4O69A 9ICQA 3D4YA 4FHVA 2ALWA 9ICJA 1BPEA 2RAIA 2BCQA 4MFFA 9ICAA 1DKXA 4H6HA 3ER9B 3WFSC 4NQIA 4AT8B 4K9AA 4YMOA 5J2HA 4WQKA 4KLSA 3D51A 5DB6A 4I29A 2WYIA 2HN1A 4RPYA 3JPPA 4IQTA 1R8BA 3RJFA 5CFUA 4I2BA 3ER8C 4PHEA 1MQ3A 1ZQDA 4AZ7A 1ZQBA 4JLCA 4RQ1A 4NLZA 3VEAA 4RQ8A 4XUSA 1OAOA 5HHIA 5KBPA 4M9GA 3KAWA 9ICXA 4K4IA 2F7PA 2ISPA 1E2UA 3D52A 4NXWA 4FHYA 4WH5A 1MIYA 2GA9D 5J0YA 1R5EA 3H39A 5HRIA 3C66A 3LK9A 1BPZA 1ZQQA 1URUA 5DB7A 3EJSA 5IINA 9ICNA 3RH5A 3Q84A 3C5GA 3JPSA 2DRBA 8ICEA 7ICTA 1O7DC 2KHOA 4HY9A 4QZDA 4EV6A 5J2AA 3SOGA 4B9QA 4RQ4A 2B56A 1LQ7A 3UPQA 1UEUA 4NPHA 4WC2A 2RAKA 2DR5A 3C2KA 2BE3A 4QZHA 2PXIA 4LEWA 4K98A 3C7NA 2ZH1A 3AQMA 9ICWA 5DEDA 4X4UA 4FO6A 1BPBA 2NRKA 4I2DA 1ZQMA 4I27A 3BUQA 5IIJA 4X5VA 2NCZA 4E81A 4P2HA 2Q66A 3WFRE 5HC9A 2FICA 3AQNA 5J0TA 4G6QA 4E3CA 4IQVA 4O6AA 4HR1A 3OVSA 4E7XA 4EZNA 3DX3A 1WDZA 5EOZA 4KLMA 1MJGA 2EWRA 4KLFA 4M04A 1GNLA 1TQVA 4QZIA 1ZQSA 4I28A 9ICBA 2OBMA 3RV0A 4X4TA 8ICYA 4O67A 2PFQA 5D49A 3K75D 7ICNA 4PHAA 3VEBA 3RJKA 4HYBA 4KLLA 2F18A 3H38A 3JPNA 3QE6A 1I4DA 2N3KA 4NM1A 4RWNA 5J0RA 3ACOA 4IM2A 4ATBB 4WBYA 3NYBA 4PGQA 2DVIA 1R8AA 3OHXM 2ZH6A 3EJRA 3V7LA 9ICCA 2ID1A 3B52X 3OUYB 4KM5A 4M5DA 2RFFA 4R65A 3L3PA 1KNYA 4F5PA 1ZQKA 2ZH4A 4FZSA 4AT8A 2YI9A 3BVXA 1ZQRA 1JQKA 2Z0NA 4MF8A 1OU5A 8ICPA 5JTGA 3HW8A 2PFNA 5HRLA 4K96A 5J2IA 4MFCA 2Z8YA 2PMRA 8ICXA 3I2WA 1ZQTA 2D1LA 2DRAA 8ICRA 3A98A 5E84A 4AZ6A 3RV1A 5HRBA 5HRGA 3RJHA 2BCVA 4P4PA 9ICMA 5J2CA 1HXKA 4M9HA 4R5KA 3DPOA 4EBJA 2Q13A 4R63A 2ZHBA 2JNKA 4JL9A 5TZVA 4M9LA 2ZXQA 4DO9A 2YIBA 1MIWA 4DOAA 3FD9A 4NXTA 4O9MA 4AZCB 4KLEA 3UXNA 3B0XA 4R66A 2EX3B 4PHDA 2O1PA 1SU7A 3T47A 1SU8A 2M2TA 1ZQOA 3EF2A 1QWUA 5HR9A 4TURA 2BPGA 1ZYLA 5B3QA 5HRDA 4R64A 5J0XA 2YL6A 4E8FA 2ZH9A 2MI7A 5DBAA 2M2WA 4I2AA 4P4MA 4AZBA 3I04A 4ATBA 4LVSA 3HAIA 4YMMA 4KB6A 2ND0A 4MKPA 2HN2A 1ZQNA 3MDAA 2DR8A 2FMQA 3T46A 2I9GA 3ERCC 3NWIA 8ICLA 3DDGA 4D8JA 2OW6A 1ZQXA 7ICKA 5TKYA 4K99A 2Z0OA 3PLTA 2IUBA 3D2FA 3ISBA 1VJ7A 1ZQLA 2WINM 4AZ5A 4AZIA 3T49A 4AT9B 4X4OA 1JAJA 3PHZA 3EJQA 2B4VA 5D61A 1F5AA 3HJ4A 3EJPA 1I4TA 3VKHA 3RH4A 1HUOA 3BVWA 9ICLA 3HJ1A 4EZVA 5CJ7A 3DPPA 3ISCA 2ZH7A 5BOMA 3BUBA 4KIKB 3JZ0A 3L3OM 7ICEA 4EZOA 4JWNA 4AZCA 5J2JA 3CZNA
chains in the Genus database with same CATH topology
2LM0A 4K97A 2NCZA 4E81A 5D63A 4JLXA 3T48A 4HX0A 4G6QA 4E3CA 4IWPA 4O6AA 2PY6A 4HR1A 4JWDA 4N7RA 4EZNA 5CFSA 3OWGA 1MJGA 2EWRA 3UITA 1GNLA 4OAFA 4EZSA 4M0MA 4JNFA 4O68A 2OBMA 3RV0A 1OA1A 2YIAA 3MCRA 2OBLA 2B51A 4O67A 4FM3A 4FO1A 4LEVA 4WOYA 5FIGA 5CHEA 4JWIA 3B51X 3ZEDA 3VEBA 4HYBA 3B53X 2N3KA 3I01A 3O3OB 4IM2A 1GNTA 4OAGA 3OHXM 3NKUA 2X5CA 4IWQA 3KAVA 3O3MB 4KIKA 3B52X 4R5IA 1UPXA 4OAHA 4KM5A 1E9VA 4UDYX 4XJEA 4HR1B 2EWFA 4LEYA 2YI9A 1JQKA 4EZRA 1GN9A 3F7WA 4WQLA 4EZZA 2RT6A 4EZYA 4K96A 3KDRA 5B3PA 3DPQA 3LMFA 2IHOA 2Z8YA 1OA0A 2JNSA 3A98A 5E84A 4O69A 3RV1A 4PO2A 4JN4A 4EZQA 4R5KA 3DPOA 5FLEX 4JLZA 4EZUA 2ND1A 2YI8A 1U00A 4EZTA 1DKXA 4JL9A 1SU6A 4H6HA 4F00A 2YIBA 3ER9B 3I39X 3FD9A 4NXTA 4K9AA 4WQKA 2QXLA 4R5LA 4JNEA 4EZWA 3O3NB 4H6IA 4K9BA 2EX3B 4UDXX 1SU7A 3T47A 1SU8A 3T4AG 3EF2A 1ZYLA 5B3QA 5CFUA 3GI7A 3ER8C 4R5GA 3QNJA 4NXXA 4JLCA 1DKZA 3VEAA 1GPJA 3K7DA 3I04A 4IM3A 1DKYA 4NXVA 4KB6A 2ND0A 4MKPA 1OAOA 2FCLA 1W9MA 3KAWA 3T46A 3ERCC 5CFTA 1E2UA 4NXWA 4D8JA 4WH5A 2GA9D 4OAIZ 5TKYA 4K99A 4EZPA 4IM0A 4JWCA 4R5JA 4NXUA 1SUFA 3D2FA 2KHOA 4HY9A 5D62A 2WINM 4IW0A 4JWEA 3T49A 2YIVX 4F01A 3PHZA 4B9QA 3D2EA 2B4VA 2B56A 4NPHA 5D61A 4IWOA 3VKHA 2QFFA 2GAFD 3QA8A 4LEWA 4EZVA 3DPPA 4K98A 3C7NA 4K8VA 4KIKB 4EZXA 3L3OM 4EZOA 1E1DA 4LEZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ER9 B;  2GA9 D;  2GAF D;  3OWG A;  3ERC C;  3ER8 C; 
#chains in the Genus database with same CATH topology
 8ICU A;  4QZF A;  4WBZ A;  5CB1 A;  4QZG A;  4JLX A;  1HTY A;  1HUZ A;  2YL9 A;  8ICM A;  9ICI A;  5DBB A;  2F7R A;  1ZQF A;  1JMS A;  5CFS A;  8ICK A;  2C08 A;  3BVU A;  3EJU A;  7ICU A;  1JQR A;  4OAF A;  1ZQP A;  4EZS A;  2F1B A;  1OA1 A;  4AKV A;  8ICW A;  2B51 A;  4FM3 A;  7ICF A;  4KLG A;  4TUS A;  7ICJ A;  4LEV A;  1BPX A;  3QWE A;  5CHE A;  4XA5 A;  3UXO A;  8ICI A;  1TV9 A;  3B51 X;  3DX2 A;  4WC0 A;  3B53 X;  4TUQ A;  4FHP A;  2BBJ A;  4LEZ A;  5HHH A;  1ZQC A;  9ICP A;  4FZO A;  1GNT A;  3EJT A;  3JCF A;  3NKU A;  4OAG A;  4PH5 A;  4WC4 A;  2X5C A;  4IWQ A;  5J2G A;  3O3M B;  5D46 A;  3OVB A;  4R5I A;  2RAJ A;  5J0Q A;  4UB1 A;  4XJE A;  4HR1 B;  4AZH A;  4UB5 A;  2EWF A;  8ICN A;  4KLI A;  4LZD A;  3C18 A;  2PFP A;  3JYY A;  3F7W A;  5J0U A;  4I2J A;  7ICM A;  2RT6 A;  4UAW A;  3UQ2 A;  1TVA A;  3MBY A;  3LMF A;  2IHO A;  1BPD A;  1ZQU A;  1MIV A;  2PBE A;  1FA0 A;  5J0O A;  2ZH8 A;  4Z6F A;  4EZQ A;  4I0U A;  2F7O A;  3DX1 A;  1YLQ A;  1I49 A;  5FLE X;  4JLZ A;  4EZU A;  2ND1 A;  2YI8 A;  1U00 A;  2EFK A;  4KLT A;  4RT3 A;  3H37 A;  5IIL A;  7ICR A;  4F00 A;  1I4L A;  9ICK A;  3I39 X;  4KLD A;  3HAH A;  4AZG A;  9ICF A;  1QWN A;  3O3N B;  3CV5 A;  2X3W A;  4H6I A;  4NXZ A;  4PGY A;  2V0O A;  3PMN A;  3AQL A;  3PML A;  5HRF A;  4UBB A;  4I2F A;  3V7J A;  3T4A G;  3CVR A;  5BOL A;  3HIY A;  1R34 A;  3CZS A;  4FHX A;  4WCW A;  4PHP A;  2BCS A;  4O5E A;  2ISO A;  8ICF A;  3QNJ A;  2YLA A;  5DEC A;  2M2U A;  7ICV A;  1GPJ A;  1RPL A;  4M0A A;  1ZQV A;  3SYV A;  1NO5 A;  1ZQJ A;  4NXV A;  2GWS A;  4I2I A;  2ZH2 A;  4I2H A;  8ICQ A;  4MFA A;  2EFL A;  4NKT A;  1R33 A;  2FCL A;  3WFP A;  1UET A;  1VFG A;  5CFT A;  2BBH A;  4RPX A;  3D4Z A;  3Q0K A;  3OK8 A;  8ICA A;  4GXJ A;  4NY8 A;  1Y2O A;  1BPY A;  1ZQA A;  4IM0 A;  4RQ3 A;  3AQK A;  4AT7 A;  1TQU A;  2BPF A;  9ICE A;  4RQ6 A;  5D62 A;  4PGX A;  4IW0 A;  9ICS A;  3BUI A;  2YIV X;  4F01 A;  4S3N A;  7ICI A;  4QZB A;  3RJI A;  1TFY A;  1QX1 A;  8ICS A;  4M9N A;  3HX0 A;  4K4G A;  2ZHA A;  3QA8 A;  1PS3 A;  4UD4 A;  5CHG A;  4K8V A;  4X4Q A;  5DBC A;  4UAZ A;  4P4O A;  4EZX A;  4PPX A;  3OVA A;  5IIO A;  1XSN A;  3B0Y A;  1E1D A;  2LM0 A;  8ICZ A;  4RWP A;  4K97 A;  4FH3 A;  2Q12 A;  4WC5 A;  5D63 A;  1JN3 A;  3T48 A;  1ZQY A;  4X4R A;  5J2K A;  1ZQE A;  4JWD A;  9ICR A;  4UB3 A;  2Z0V A;  4Z6C A;  5DDM A;  7ICS A;  4KLO A;  3CAZ A;  7ICG A;  8ICJ A;  5IIK A;  2F7Q A;  1O7D B;  9ICT A;  3UIT A;  1ZQG A;  2QKW A;  1RZT A;  1HWW A;  4M0M A;  4YD2 A;  4JNF A;  1X04 A;  3AU6 A;  4RT2 A;  3BUD A;  2YIA A;  2OBL A;  5C5B B;  4ATM A;  4E80 A;  5J0W A;  4FO1 A;  4TUP A;  2O5A A;  4M47 A;  2BCU A;  1YWM A;  4QZC A;  2OO2 A;  4I2G A;  4KLJ A;  4XQ8 A;  2YLL A;  3C2M A;  2ZH5 A;  8ICG A;  3O3O B;  8ICB A;  2FYV A;  7ICL A;  4RQ2 A;  4MF2 A;  3WFQ E;  4OAH A;  5CP2 A;  4KLQ A;  3D50 A;  2VAN A;  4YMN A;  3WFO A;  8ICV A;  3RJG A;  1ZWW A;  2X3X A;  4IQW A;  2DR9 A;  4EZR A;  4O5C A;  4QZ9 A;  4WQL A;  4EZZ A;  4EZY A;  3KDR A;  7ICO A;  3DPQ A;  3C2L A;  9ICH A;  4UBC A;  3OV7 A;  1OA0 A;  4M2Y A;  2JNS A;  5J0P A;  2YKT A;  4YD1 A;  1ZJN A;  4WC6 A;  1NOM A;  4QZE A;  4PO2 A;  9ICO A;  4JN4 A;  3TFS A;  3JPR A;  3AUO A;  4NM2 A;  7ICH A;  4DOB A;  4RQ0 A;  3BLB A;  1WOT A;  3AU2 A;  3V7K A;  2P66 A;  4NLN A;  1KDH A;  4EZT A;  5D4B A;  3DYT A;  4NKU A;  1SU6 A;  3DDF A;  4X4N A;  3UXP A;  3CK6 A;  3BUP A;  3HWT A;  2PFO A;  4UAY A;  2DR7 A;  8ICT A;  4WC7 A;  2O0I 1;  4WPC A;  2QXL A;  4R5L A;  4JNE A;  4EZW A;  1R89 A;  2BCR A;  4RQ5 A;  3V72 A;  4K9B A;  4UDX X;  5DB9 A;  3UQ0 A;  1TQW A;  5CWR A;  4DYL A;  2FMP A;  4I2E A;  4UB2 A;  4EP7 A;  4O5K A;  7ICP A;  3GI7 A;  4RWQ A;  4X4S A;  1Q78 A;  4R5G A;  4I2C A;  5J0S A;  4NXX A;  3HAJ A;  1XSL A;  1DKZ A;  3K7D A;  4GXI A;  4IM3 A;  2ELB A;  1DKY A;  2D4C A;  5DDY A;  4WC3 A;  1ZQH A;  4KLH A;  3MDC A;  4X0A A;  2YL8 A;  3RPM A;  1TFW A;  1W9M A;  2HHP A;  3OUY A;  2WYH A;  3ABH A;  1TQT A;  4F5O A;  3BVT A;  4OAI Z;  3L9D A;  3G9G A;  9ICG A;  4WC1 A;  2GF4 A;  4EZP A;  4JWC A;  1ZJM A;  4R5J A;  4M9J A;  4NXU A;  1SUF A;  3JPT A;  3RH6 A;  5J2D A;  5III A;  4XRH A;  4JWE A;  4F5R A;  3QNI A;  4X0B A;  4YCX A;  5J2F A;  3LVT A;  3D2E A;  3M3W A;  1R8C A;  4EED A;  3JPQ A;  4RQ7 A;  4IWO A;  5HRH A;  2QFF A;  2GAF D;  4KLU A;  4FZP A;  3TFR A;  5BPC A;  5HRE A;  4IQU A;  4UB4 A;  1MQ2 A;  4NLK A;  2YL5 A;  3CKD A;  4AVM A;  1XSP A;  5F2V O;  4XQ7 A;  5DKW A;  4RPZ A;  1PX5 A;  9ICU A;  4DOC A;  4QZ8 A;  4K4H A;  4GXK A;  5HRK A;  4HX0 A;  4WPE A;  4IWP A;  8ICO A;  2PY6 A;  3H3A A;  4FHW A;  4N7R A;  4RWO A;  5C5B A;  3BVV A;  3NVO A;  1ZQI A;  4Z6E A;  1V4A A;  3DX4 A;  3OWG A;  4H8S A;  2M2V A;  2ZH3 A;  4I1Q A;  3C5F A;  1KEJ A;  4LZG A;  4EEB A;  4O68 A;  7ICQ A;  3MCR A;  3LLL A;  4BNE A;  1ZQZ A;  2W9M A;  4WOY A;  5FIG A;  4AT9 A;  4EGW A;  5IIM A;  4EBK A;  4JWI A;  3PNC A;  4NSW A;  8ICC A;  3ZED A;  2BPC A;  3I01 A;  2LXY A;  4YN4 A;  4F5N A;  1UEV A;  3KAV A;  4KIK A;  8ICH A;  4FH5 A;  2OZN B;  3JPO A;  1TQS A;  2OW7 A;  1UPX A;  5J2B A;  5J29 A;  1E9V A;  4UDY X;  3UPS A;  3MGH A;  3RJJ A;  2F1A A;  4LT6 A;  4X4V A;  2IHM A;  4X4P A;  4JWM A;  4LEY A;  3GDX A;  4UD5 A;  3ISD A;  4QZA A;  1GN9 A;  4AT7 B;  1X03 A;  4Z6D A;  5CA7 A;  5CR0 A;  3MGI A;  5B3P A;  9ICV A;  2X3V A;  4F5Q A;  4DCN C;  5J2E A;  3DX0 A;  5DB8 A;  2FMS A;  3RJE A;  1Q79 A;  3LQC B;  1ZQW A;  3OGU A;  4IG8 A;  4O69 A;  9ICQ A;  3D4Y A;  4FHV A;  2ALW A;  9ICJ A;  1BPE A;  2RAI A;  2BCQ A;  4MFF A;  9ICA A;  1DKX A;  4H6H A;  3ER9 B;  3WFS C;  4NQI A;  4AT8 B;  4K9A A;  4YMO A;  5J2H A;  4WQK A;  4KLS A;  3D51 A;  5DB6 A;  4I29 A;  2WYI A;  2HN1 A;  4RPY A;  3JPP A;  4IQT A;  1R8B A;  3RJF A;  5CFU A;  4I2B A;  3ER8 C;  4PHE A;  1MQ3 A;  1ZQD A;  4AZ7 A;  1ZQB A;  4JLC A;  4RQ1 A;  4NLZ A;  3VEA A;  4RQ8 A;  4XUS A;  1OAO A;  5HHI A;  5KBP A;  4M9G A;  3KAW A;  9ICX A;  4K4I A;  2F7P A;  2ISP A;  1E2U A;  3D52 A;  4NXW A;  4FHY A;  4WH5 A;  1MIY A;  2GA9 D;  5J0Y A;  1R5E A;  3H39 A;  5HRI A;  3C66 A;  3LK9 A;  1BPZ A;  1ZQQ A;  1URU A;  5DB7 A;  3EJS A;  5IIN A;  9ICN A;  3RH5 A;  3Q84 A;  3C5G A;  3JPS A;  2DRB A;  8ICE A;  7ICT A;  1O7D C;  2KHO A;  4HY9 A;  4QZD A;  4EV6 A;  5J2A A;  3SOG A;  4B9Q A;  4RQ4 A;  2B56 A;  1LQ7 A;  3UPQ A;  1UEU A;  4NPH A;  4WC2 A;  2RAK A;  2DR5 A;  3C2K A;  2BE3 A;  4QZH A;  2PXI A;  4LEW A;  4K98 A;  3C7N A;  2ZH1 A;  3AQM A;  9ICW A;  5DED A;  4X4U A;  4FO6 A;  1BPB A;  2NRK A;  4I2D A;  1ZQM A;  4I27 A;  3BUQ A;  5IIJ A;  4X5V A;  2NCZ A;  4E81 A;  4P2H A;  2Q66 A;  3WFR E;  5HC9 A;  2FIC A;  3AQN A;  5J0T A;  4G6Q A;  4E3C A;  4IQV A;  4O6A A;  4HR1 A;  3OVS A;  4E7X A;  4EZN A;  3DX3 A;  1WDZ A;  5EOZ A;  4KLM A;  1MJG A;  2EWR A;  4KLF A;  4M04 A;  1GNL A;  1TQV A;  4QZI A;  1ZQS A;  4I28 A;  9ICB A;  2OBM A;  3RV0 A;  4X4T A;  8ICY A;  4O67 A;  2PFQ A;  5D49 A;  3K75 D;  7ICN A;  4PHA A;  3VEB A;  3RJK A;  4HYB A;  4KLL A;  2F18 A;  3H38 A;  3JPN A;  3QE6 A;  1I4D A;  2N3K A;  4NM1 A;  4RWN A;  5J0R A;  3ACO A;  4IM2 A;  4ATB B;  4WBY A;  3NYB A;  4PGQ A;  2DVI A;  1R8A A;  3OHX M;  2ZH6 A;  3EJR A;  3V7L A;  9ICC A;  2ID1 A;  3B52 X;  3OUY B;  4KM5 A;  4M5D A;  2RFF A;  4R65 A;  3L3P A;  1KNY A;  4F5P A;  1ZQK A;  2ZH4 A;  4FZS A;  4AT8 A;  2YI9 A;  3BVX A;  1ZQR A;  1JQK A;  2Z0N A;  4MF8 A;  1OU5 A;  8ICP A;  5JTG A;  3HW8 A;  2PFN A;  5HRL A;  4K96 A;  5J2I A;  4MFC A;  2Z8Y A;  2PMR A;  8ICX A;  3I2W A;  1ZQT A;  2D1L A;  2DRA A;  8ICR A;  3A98 A;  5E84 A;  4AZ6 A;  3RV1 A;  5HRB A;  5HRG A;  3RJH A;  2BCV A;  4P4P A;  9ICM A;  5J2C A;  1HXK A;  4M9H A;  4R5K A;  3DPO A;  4EBJ A;  2Q13 A;  4R63 A;  2ZHB A;  2JNK A;  4JL9 A;  5TZV A;  4M9L A;  2ZXQ A;  4DO9 A;  2YIB A;  1MIW A;  4DOA A;  3FD9 A;  4NXT A;  4O9M A;  4AZC B;  4KLE A;  3UXN A;  3B0X A;  4R66 A;  2EX3 B;  4PHD A;  2O1P A;  1SU7 A;  3T47 A;  1SU8 A;  2M2T A;  1ZQO A;  3EF2 A;  1QWU A;  5HR9 A;  4TUR A;  2BPG A;  1ZYL A;  5B3Q A;  5HRD A;  4R64 A;  5J0X A;  2YL6 A;  4E8F A;  2ZH9 A;  2MI7 A;  5DBA A;  2M2W A;  4I2A A;  4P4M A;  4AZB A;  3I04 A;  4ATB A;  4LVS A;  3HAI A;  4YMM A;  4KB6 A;  2ND0 A;  4MKP A;  2HN2 A;  1ZQN A;  3MDA A;  2DR8 A;  2FMQ A;  3T46 A;  2I9G A;  3ERC C;  3NWI A;  8ICL A;  3DDG A;  4D8J A;  2OW6 A;  1ZQX A;  7ICK A;  5TKY A;  4K99 A;  2Z0O A;  3PLT A;  2IUB A;  3D2F A;  3ISB A;  1VJ7 A;  1ZQL A;  2WIN M;  4AZ5 A;  4AZI A;  3T49 A;  4AT9 B;  4X4O A;  1JAJ A;  3PHZ A;  3EJQ A;  2B4V A;  5D61 A;  1F5A A;  3HJ4 A;  3EJP A;  1I4T A;  3VKH A;  3RH4 A;  1HUO A;  3BVW A;  9ICL A;  3HJ1 A;  4EZV A;  5CJ7 A;  3DPP A;  3ISC A;  2ZH7 A;  5BOM A;  3BUB A;  4KIK B;  3JZ0 A;  3L3O M;  7ICE A;  4EZO A;  4JWN A;  4AZC A;  5J2J A;  3CZN A; 
#chains in the Genus database with same CATH homology
 2LM0 A;  4K97 A;  2NCZ A;  4E81 A;  5D63 A;  4JLX A;  3T48 A;  4HX0 A;  4G6Q A;  4E3C A;  4IWP A;  4O6A A;  2PY6 A;  4HR1 A;  4JWD A;  4N7R A;  4EZN A;  5CFS A;  3OWG A;  1MJG A;  2EWR A;  3UIT A;  1GNL A;  4OAF A;  4EZS A;  4M0M A;  4JNF A;  4O68 A;  2OBM A;  3RV0 A;  1OA1 A;  2YIA A;  3MCR A;  2OBL A;  2B51 A;  4O67 A;  4FM3 A;  4FO1 A;  4LEV A;  4WOY A;  5FIG A;  5CHE A;  4JWI A;  3B51 X;  3ZED A;  3VEB A;  4HYB A;  3B53 X;  2N3K A;  3I01 A;  3O3O B;  4IM2 A;  1GNT A;  4OAG A;  3OHX M;  3NKU A;  2X5C A;  4IWQ A;  3KAV A;  3O3M B;  4KIK A;  3B52 X;  4R5I A;  1UPX A;  4OAH A;  4KM5 A;  1E9V A;  4UDY X;  4XJE A;  4HR1 B;  2EWF A;  4LEY A;  2YI9 A;  1JQK A;  4EZR A;  1GN9 A;  3F7W A;  4WQL A;  4EZZ A;  2RT6 A;  4EZY A;  4K96 A;  3KDR A;  5B3P A;  3DPQ A;  3LMF A;  2IHO A;  2Z8Y A;  1OA0 A;  2JNS A;  3A98 A;  5E84 A;  4O69 A;  3RV1 A;  4PO2 A;  4JN4 A;  4EZQ A;  4R5K A;  3DPO A;  5FLE X;  4JLZ A;  4EZU A;  2ND1 A;  2YI8 A;  1U00 A;  4EZT A;  1DKX A;  4JL9 A;  1SU6 A;  4H6H A;  4F00 A;  2YIB A;  3ER9 B;  3I39 X;  3FD9 A;  4NXT A;  4K9A A;  4WQK A;  2QXL A;  4R5L A;  4JNE A;  4EZW A;  3O3N B;  4H6I A;  4K9B A;  2EX3 B;  4UDX X;  1SU7 A;  3T47 A;  1SU8 A;  3T4A G;  3EF2 A;  1ZYL A;  5B3Q A;  5CFU A;  3GI7 A;  3ER8 C;  4R5G A;  3QNJ A;  4NXX A;  4JLC A;  1DKZ A;  3VEA A;  1GPJ A;  3K7D A;  3I04 A;  4IM3 A;  1DKY A;  4NXV A;  4KB6 A;  2ND0 A;  4MKP A;  1OAO A;  2FCL A;  1W9M A;  3KAW A;  3T46 A;  3ERC C;  5CFT A;  1E2U A;  4NXW A;  4D8J A;  4WH5 A;  2GA9 D;  4OAI Z;  5TKY A;  4K99 A;  4EZP A;  4IM0 A;  4JWC A;  4R5J A;  4NXU A;  1SUF A;  3D2F A;  2KHO A;  4HY9 A;  5D62 A;  2WIN M;  4IW0 A;  4JWE A;  3T49 A;  2YIV X;  4F01 A;  3PHZ A;  4B9Q A;  3D2E A;  2B4V A;  2B56 A;  4NPH A;  5D61 A;  4IWO A;  3VKH A;  2QFF A;  2GAF D;  3QA8 A;  4LEW A;  4EZV A;  3DPP A;  4K98 A;  3C7N A;  4K8V A;  4KIK B;  4EZX A;  3L3O M;  4EZO A;  1E1D A;  4LEZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...