3OWGA

Crystal structure of vaccinia virus polyadenylate polymerase(vp55)
Total Genus 133
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
133
sequence length
468
structure length
457
Chain Sequence
b'NITLKIIETYLGRVPSVNEYHMLKSQARNIQKITVFNKDIFVSLVKKNKKRFFSDVNTSASEIKDRILSYFSKQTQTYNIGKLFTIIELQSVLVTTYTDILGVLTIKAPNVISSKISYNVTSMEELARDMLNSMNVAVVSSLVKNVNKLMEEYLRRHNKSCICYGSYSLYLINPNIRYGDIDILQTNSRTFLIDLAFLIKFITGNNIILSKIPYLRNYMVIKDENDNHIIDSFNIRQDTMNVVPKIFIDNIYIVDPTFQLLNMIKMFSQIDRLEDLSKDPEKFNARMATMLEYVRYTHGIVFDGKRNNMPMKCIIDENNRIVTVTTKDYFSFKKCLVYLDENVLSSDILDLNADTSCDFESVTNSVYLIHDNIMYTYFSNTILLSDKGKVHEISARGLCAHILLYQMLTSGEYKQCLSDLLNSMMNRDKIPIYSHTERDKKPGRHGFINIEKDIIVF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Poly(A) polymerase catalytic subunit
publication title Domain-level rocking motion within a polymerase that translocates on single-stranded nucleic acid.
pubmed doi rcsb
source organism Vaccinia virus wr
molecule tags Transferase
total genus 133
structure length 457
sequence length 468
chains with identical sequence B
ec nomenclature ec 2.7.7.19: Polynucleotide adenylyltransferase.
pdb deposition date 2010-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03296 Pox_polyA_pol Poxvirus poly(A) polymerase nucleotidyltransferase domain
A PF12629 Pox_polyA_pol_C Poxvirus poly(A) polymerase C-terminal domain
A PF12630 Pox_polyA_pol_N Poxvirus poly(A) polymerase N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.320 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Substrate Binding Domain Of Dnak; Chain:A; Domain 2 3owgA01
3.30.460.60 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase; domain 2 3owgA03
2GAFD 3ER9B 3ERCC 3ER8C 3OWGA 2GA9D
chains in the Genus database with same CATH superfamily
1BPYA 2OZNB 3SOGA 1R8AA 4KB6A 4UD5A 4KIKB 5F2VO 4DOCA 4IQUA 4AT8A 4JL9A 3UQ2A 1KDHA 2EWFA 3LLLA 4WH5A 2OO2A 4GXIA 3B0YA 3L9DA 4ATMA 4WC3A 1U00A 3RPMA 9ICJA 3C5GA 3OVBA 4YMNA 3UPQA 4O9MA 1TQUA 4XUSA 4N7RA 4RPZA 5J0PA 2PFNA 2F1BA 1WOTA 3H3AA 4HYBA 1MQ2A 2DRBA 4K9BA 2ELBA 1Y2OA 4FH3A 1ZQUA 3DYTA 1HUOA 2YLLA 2BCQA 3RJFA 5J2DA 4ATBB 4QZCA 1GNLA 4HR1A 2ZH6A 4PO2A 1ZQZA 8ICTA 5JTGA 1E9VA 3ER8C 2IUBA 4I2CA 4K8VA 2BCRA 1HXKA 4LVSA 5CR0A 3HWTA 2HHPA 8ICAA 4NM2A 3OVAA 1BPZA 2Z0OA 1R5EA 1SUFA 1ZQWA 1HUZA 2NCZA 4YCXA 5DBAA 4X4TA 2FMQA 1TQTA 4Z6DA 4MFFA 2F7RA 5D62A 2PFPA 4UB1A 4M9HA 4MF2A 4F01A 9ICIA 4LEWA 4KM5A 2F1AA 3C2KA 4KLSA 4LT6A 3OGUA 8ICHA 5IIIA 4GXJA 2PFQA 1HWWA 1ZQAA 7ICEA 4AZIA 2C08A 8ICGA 5HRDA 3EJPA 2EFLA 2F18A 1SU7A 4K4HA 3ZEDA 4X4RA 2BCSA 4AZCB 7ICHA 4RPXA 4RT3A 1ZQBA 2N3KA 1ZQCA 4LZGA 7ICGA 2Q66A 2B4VA 1R33A 4M0AA 2M2VA 5CB1A 5C5BA 4P4PA 4H8SA 4UDYX 4M9NA 1PX5A 2X5CA 5BOLA 4RQ7A 4QZIA 3JPSA 3WFRE 2HN2A 3AQLA 1JQRA 3RH4A 1GPJA 2BCVA 4WC7A 3JPQA 4WC0A 5J0WA 4UAWA 4AKVA 2RAIA 4F5PA 8ICKA 8ICOA 8ICNA 5CFSA 3OUYA 5J0UA 4IG8A 3UXNA 1OA0A 4F5RA 3JCFA 2YIAA 4EP7A 3JPOA 4F00A 4FZOA 5J2KA 2ND0A 1GNTA 4LEVA 3KAWA 4EBKA 4EV6A 2D1LA 2ISPA 1VJ7A 2LM0A 2NRKA 2GF4A 2X3VA 4DYLA 1F5AA 2OW7A 4IWOA 1BPXA 2F7PA 4WOYA 5DB9A 1ZJMA 4M9LA 4I2JA 4AZ6A 4FZPA 4EZWA 8ICPA 1ZQDA 1O7DC 3HAHA 3OK8A 4KLLA 2Q13A 1BPEA 2ZH5A 4XQ7A 1TQSA 2WINM 5J0OA 4IQWA 2FCLA 3D2EA 4NXZA 3C7NA 1UEUA 2OW6A 1NOMA 2JNSA 5J0SA 4K96A 8ICLA 3BVVA 3MCRA 4WC5A 4GXKA 1Q78A 3KDRA 1R8CA 2ZH1A 1ZQEA 4LEZA 4RWOA 3CK6A 1BPBA 2MI7A 2DR8A 2ID1A 2D4CA 2M2TA 4Z6FA 4UAZA 4UBBA 3T46A 4KLGA 4LZDA 4I2EA 2F7OA 2DR5A 3FD9A 8ICFA 5J0QA 1JN3A 4EZOA 5CWRA 2ZXQA 2ZHBA 2ZH3A 8ICWA 4QZDA 4AZGA 4WBYA 3RH5A 4FHYA 3CV5A 4BNEA 4KLHA 2W9MA 4M9JA 7ICRA 4UD4A 4WPCA 4EZUA 4FHWA 4IQVA 3MGHA 7ICUA 4EZPA 4TUSA 3LVTA 4UBCA 2GA9D 4FHXA 3B52X 4NXUA 4KLEA 2V0OA 4P4OA 4AT7B 4O5CA 4RWNA 9ICSA 4RQ8A 4RT2A 3PMNA 2O1PA 2DR7A 5HRLA 2RAKA 5HR9A 9ICCA 3MGIA 3WFPA 9ICOA 4JNFA 4I1QA 3JPNA 4KLOA 3AU6A 2YL6A 3D2FA 4M2YA 4OAGA 4O68A 4AZHA 5DKWA 3EJQA 1DKYA 4RQ3A 4RWQA 4WBZA 3T49A 4X4VA 1ZQKA 2BPGA 4O5KA 1PS3A 4NSWA 3RJEA 1Q79A 3JYYA 1E1DA 7ICFA 3ISCA 3TFRA 4QZHA 2ZH4A 4UAYA 3RJKA 4JLCA 3CZNA 2I9GA 2RAJA 1X04A 4I0UA 5J2CA 5HRFA 2ZHAA 4KLQA 1SU8A 4X4UA 8ICRA 4YMOA 3OV7A 4KLUA 2DRAA 4JNEA 4WQKA 3BVWA 9ICQA 3EJSA 2KHOA 2B51A 5B3QA 4I2DA 1DKZA 1MJGA 3EJTA 2YI8A 7ICSA 4YD1A 9ICXA 9ICEA 3HJ4A 2BPFA 4AT9B 3V72A 5CFUA 4X4SA 4I2IA 5J2AA 2EFKA 5J2EA 5FIGA 4E8FA 4YD2A 8ICVA 9ICTA 9ICKA 4IM0A 4AT7A 3I01A 7ICQA 9ICRA 5HREA 4RQ2A 4PGQA 4FHPA 3JPRA 2PXIA 3T48A 4YN4A 2ZH8A 4EZRA 4KIKA 3RH6A 1JMSA 4EZSA 4IM3A 4UB2A 1TVAA 1OA1A 3DPOA 9ICBA 1E2UA 4IWQA 3EJRA 2RT6A 5CP2A 4OAHA 1TQWA 4XRHA 5J2JA 3HJ1A 2FYVA 3CAZA 4X4OA 1I4TA 3M3WA 3GDXA 8ICMA 3K75D 4F5NA 4FM3A 8ICQA 3V7LA 3I39X 1QX1A 4ATBA 5TZVA 4XA5A 2FMSA 5DBCA 4F5OA 4KLDA 4R64A 4AVMA 3DX3A 4H6HA 5HRGA 4WC1A 2GWSA 5DEDA 4WQLA 3HAJA 1XSPA 4WC6A 9ICWA 3NYBA 2X3WA 5HHIA 7ICPA 4TURA 3LK9A 3VKHA 4IQTA 5IIMA 4NQIA 2P66A 4I2HA 4M47A 1UETA 5EOZA 5J0RA 4PHPA 2YL8A 4G6QA 4AZ7A 4R5GA 2QXLA 4AZ5A 3ERCC 3AQNA 4EEDA 7ICTA 8ICIA 5TKYA 3Q84A 3O3OB 1ZQYA 4X4QA 1KNYA 5IIJA 4K97A 3MDAA 1VFGA 8ICXA 4OAFA 2ISOA 1MQ3A 2GAFD 3NVOA 2O5AA 3AU2A 1TV9A 2FMPA 1JQKA 4AZCA 3BUBA 4FO1A 3HW8A 5D61A 2M2WA 3AQKA 5D49A 4NLZA 3BUPA 4XQ8A 2Z0NA 3DX1A 3UPSA 3ISDA 9ICAA 4R5KA 3C66A 4QZ8A 5D63A 1OAOA 4KLFA 1XSLA 5J2IA 4S3NA 3PHZA 3NWIA 4QZ9A 3AUOA 4NXWA 2Z0VA 7ICKA 3RJIA 1ZQSA 4EEBA 3AQMA 3DPPA 2M2UA 8ICUA 4IWPA 4O5EA 3RV0A 1DKXA 3GI7A 5DDMA 4RQ5A 4NPHA 3C2LA 4R66A 3QWEA 4D8JA 3H37A 4RQ6A 4P4MA 4R65A 1ZQPA 2ALWA 3ACOA 4M04A 2DVIA 3WFOA 4K9AA 4PPXA 9ICNA 4PH5A 4KLJA 4IM2A 4HR1B 3UXPA 4EBJA 3B51X 1MIWA 5CJ7A 5J2BA 4RPYA 1ZJNA 9ICPA 2ZH2A 4JWDA 4JN4A 4I2AA 2X3XA 3BUQA 7ICNA 4PHEA 3BVXA 5J2GA 4X4PA 5B3PA 2EWRA 4JWEA 4QZAA 5D46A 4K99A 1TQVA 4UB3A 1JAJA 4H6IA 4JLXA 1HTYA 2BE3A 3I04A 1MIVA 4O67A 4UB5A 3RV1A 3HX0A 1ZQHA 2JNKA 1ZQQA 1ZQFA 4KLTA 4WC2A 2F7QA 3EF2A 4TUPA 4TUQA 3JPTA 2FICA 3D4ZA 4R63A 9ICGA 2OBMA 5HRHA 4E3CA 1QWNA 4E81A 3HIYA 4I29A 4M9GA 2ND1A 4R5LA 3B53X 5J2HA 4K98A 1KEJA 4LEYA 2BPCA 5DDYA 4PGXA 4R5IA 5DECA 1V4AA 3ISBA 3F7WA 3BUDA 5C5BB 2OBLA 1URUA 4EZXA 4Z6CA 5DBBA 4WCWA 3PLTA 4F5QA 4E7XA 4NLNA 5J29A 4JWNA 3RJHA 2YIVX 4EZVA 9ICFA 1UEVA 5DB7A 4I2GA 1SU6A 1YWMA 3BVUA 4K4IA 3OUYB 4X0AA 3ER9B 3C2MA 1ZQXA 1W9MA 1TFWA 2RFFA 2EX3B 4QZEA 3CVRA 3C5FA 4AZBA 4O6AA 2ZH9A 4JWCA 9ICUA 5D4BA 2YIBA 5BPCA 1LQ7A 5KBPA 1ZQJA 3UITA 3BLBA 2YLAA 3DDGA 3T4AG 3JZ0A 3D50A 3C18A 4QZBA 4X0BA 4UDXX 3T47A 1ZQGA 4I2FA 3O3NB 1ZQIA 1ZQMA 4NY8A 3O3MB 2WYHA 9ICMA 2PBEA 1WDZA 3V7JA 3RJJA 3D4YA 4MFAA 4QZGA 1NO5A 2LXYA 3ABHA 3CKDA 5HRBA 1TFYA 4DCNC 3B0XA 5IILA 2PY6A 2ZH7A 2IHMA 4FHVA 4I28A 4MKPA 3HAIA 5HRKA 5IINA 1ZQTA 2WYIA 3UXOA 3DX2A 3VEBA 7ICOA 5BOMA 3H39A 5CHEA 5J0XA 3LMFA 3PMLA 7ICLA 2YKTA 4B9QA 4WC4A 4NXXA 4DO9A 2BBJA 2Z8YA 4Z6EA 4HX0A 4AT9A 3UQ0A 2B56A 7ICVA 2QFFA 3OVSA 3V7KA 3SYVA 4FH5A 5HC9A 8ICEA 3G9GA 8ICSA 3KAVA 1ZQVA 1MIYA 3QE6A 4NKUA 3Q0KA 3JPPA 4JWMA 4NKTA 4EGWA 4PGYA 4UB4A 4EZTA 4EZQA 3D51A 3PNCA 7ICJA 3QNIA 3QNJA 2BBHA 5DB6A 4IW0A 2O0I1 4KLIA 4NXTA 3K7DA 7ICIA 3I2WA 3L3OM 3QA8A 4HY9A 4R5JA 3BUIA 3LQCB 4K4GA 4P2HA 5FLEX 3MBYA 5IIKA 7ICMA 3DX4A 5CFTA 4DOBA 4FO6A 4AT8B 3TFSA 4XJEA 5J0TA 4OAIZ 2YL5A 3BVTA 1R8BA 1YLQA 1I4LA 3RJGA 5E84A 4EZNA 1ZWWA 3A98A 2PFOA 2YL9A 4NLKA 3OWGA 1R89A 1QWUA 5J2FA 2PMRA 3WFQE 8ICJA 9ICLA 2Q12A 4JWIA 5HHHA 8ICCA 4MF8A 8ICZA 2YI9A 1ZQOA 3WFSC 1I4DA 5DB8A 1X03A 3D52A 3DPQA 3VEAA 4E80A 3MDCA 1ZQNA 1ZQRA 8ICBA 5CHGA 3L3PA 1GN9A 3CZSA 4WPEA 3OHXM 4I27A 1RPLA 1XSNA 4PHDA 4KLMA 4MFCA 1OU5A 5IIOA 4I2BA 4EZZA 4X5VA 2BCUA 8ICYA 2HN1A 4RQ1A 9ICHA 2DR9A 4QZFA 1UPXA 3DX0A 2VANA 4O69A 4NM1A 3DDFA 2QKWA 4FZSA 1O7DB 3H38A 5HRIA 4M0MA 4EZYA 2IHOA 4JLZA 4YMMA 4DOAA 5J0YA 1RZTA 4X4NA 1BPDA 4RWPA 9ICVA 3NKUA 4RQ4A 4NXVA 1I49A 4RQ0A 1R34A 4PHAA 3EJUA 4M5DA 1ZQLA 5CA7A 1ZYLA 1FA0A
chains in the Genus database with same CATH topology
4KB6A 3FD9A 4WQLA 4KIKB 2YIBA 4JL9A 4EZOA 3UITA 2EWFA 4WH5A 3T4AG 1U00A 4UDXX 3T47A 3VKHA 3O3NB 3O3MB 4N7RA 4HYBA 4EZUA 4G6QA 4K9BA 4R5GA 2QXLA 3ERCC 5TKYA 4EZPA 3O3OB 4K97A 2PY6A 2GA9D 3B52X 4NXUA 4OAFA 2GAFD 1GNLA 4HR1A 4MKPA 4PO2A 1JQKA 1E9VA 3VEBA 3ER8C 4FO1A 4K8VA 5CHEA 5D61A 3LMFA 4B9QA 4JNFA 4R5KA 4NXXA 2Z8YA 3D2FA 4HX0A 5D63A 1OAOA 4OAGA 1SUFA 4O68A 2B56A 2QFFA 2NCZA 3PHZA 1DKYA 4NXWA 3T49A 5D62A 3DPPA 4IWPA 4F01A 3KAVA 1E1DA 3RV0A 1DKXA 3GI7A 4KM5A 4LEWA 4NPHA 4D8JA 4EZTA 4JLCA 4EZQA 3QNJA 4IW0A 4K9AA 1SU7A 1SU8A 4NXTA 3K7DA 3ZEDA 4IM2A 4HR1B 3L3OM 3QA8A 4HY9A 4JNEA 4R5JA 4WQKA 3B51X 2KHOA 2B51A 2N3KA 5B3QA 5FLEX 1DKZA 1MJGA 2B4VA 4JWDA 2YI8A 4JN4A 5CFTA 4UDYX 4XJEA 5CFUA 2X5CA 4OAIZ 5B3PA 2EWRA 4JWEA 4K99A 1GPJA 5FIGA 4H6IA 4JLXA 5E84A 4EZNA 3I04A 3A98A 4IM0A 4O67A 3RV1A 3I01A 5CFSA 1OA0A 3OWGA 2YIAA 3EF2A 4F00A 4JWIA 3T48A 2ND0A 1GNTA 2OBMA 3KAWA 4EZRA 4LEVA 4KIKA 2YI9A 4E3CA 4EZSA 2LM0A 4IM3A 3DPQA 3VEAA 4E81A 1OA1A 2ND1A 3DPOA 4R5LA 1E2UA 3B53X 4IWOA 1GN9A 4K98A 4IWQA 4WOYA 3OHXM 4LEYA 4O6AA 2RT6A 4EZWA 4R5IA 4OAHA 4EZZA 3F7WA 4EZXA 2OBLA 2WINM 1UPXA 2FCLA 3D2EA 4O69A 3C7NA 2JNSA 4FM3A 2YIVX 4EZVA 3I39X 4M0MA 4EZYA 2IHOA 3MCRA 4JLZA 4K96A 1SU6A 3KDRA 4LEZA 3NKUA 4NXVA 3ER9B 1W9MA 2EX3B 3T46A 1ZYLA 4JWCA 4H6HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GAF D;  3ER9 B;  3ERC C;  3ER8 C;  3OWG A;  2GA9 D; 
#chains in the Genus database with same CATH topology
 1BPY A;  2OZN B;  3SOG A;  1R8A A;  4KB6 A;  4UD5 A;  4KIK B;  5F2V O;  4DOC A;  4IQU A;  4AT8 A;  4JL9 A;  3UQ2 A;  1KDH A;  2EWF A;  3LLL A;  4WH5 A;  2OO2 A;  4GXI A;  3B0Y A;  3L9D A;  4ATM A;  4WC3 A;  1U00 A;  3RPM A;  9ICJ A;  3C5G A;  3OVB A;  4YMN A;  3UPQ A;  4O9M A;  1TQU A;  4XUS A;  4N7R A;  4RPZ A;  5J0P A;  2PFN A;  2F1B A;  1WOT A;  3H3A A;  4HYB A;  1MQ2 A;  2DRB A;  4K9B A;  2ELB A;  1Y2O A;  4FH3 A;  1ZQU A;  3DYT A;  1HUO A;  2YLL A;  2BCQ A;  3RJF A;  5J2D A;  4ATB B;  4QZC A;  1GNL A;  4HR1 A;  2ZH6 A;  4PO2 A;  1ZQZ A;  8ICT A;  5JTG A;  1E9V A;  3ER8 C;  2IUB A;  4I2C A;  4K8V A;  2BCR A;  1HXK A;  4LVS A;  5CR0 A;  3HWT A;  2HHP A;  8ICA A;  4NM2 A;  3OVA A;  1BPZ A;  2Z0O A;  1R5E A;  1SUF A;  1ZQW A;  1HUZ A;  2NCZ A;  4YCX A;  5DBA A;  4X4T A;  2FMQ A;  1TQT A;  4Z6D A;  4MFF A;  2F7R A;  5D62 A;  2PFP A;  4UB1 A;  4M9H A;  4MF2 A;  4F01 A;  9ICI A;  4LEW A;  4KM5 A;  2F1A A;  3C2K A;  4KLS A;  4LT6 A;  3OGU A;  8ICH A;  5III A;  4GXJ A;  2PFQ A;  1HWW A;  1ZQA A;  7ICE A;  4AZI A;  2C08 A;  8ICG A;  5HRD A;  3EJP A;  2EFL A;  2F18 A;  1SU7 A;  4K4H A;  3ZED A;  4X4R A;  2BCS A;  4AZC B;  7ICH A;  4RPX A;  4RT3 A;  1ZQB A;  2N3K A;  1ZQC A;  4LZG A;  7ICG A;  2Q66 A;  2B4V A;  1R33 A;  4M0A A;  2M2V A;  5CB1 A;  5C5B A;  4P4P A;  4H8S A;  4UDY X;  4M9N A;  1PX5 A;  2X5C A;  5BOL A;  4RQ7 A;  4QZI A;  3JPS A;  3WFR E;  2HN2 A;  3AQL A;  1JQR A;  3RH4 A;  1GPJ A;  2BCV A;  4WC7 A;  3JPQ A;  4WC0 A;  5J0W A;  4UAW A;  4AKV A;  2RAI A;  4F5P A;  8ICK A;  8ICO A;  8ICN A;  5CFS A;  3OUY A;  5J0U A;  4IG8 A;  3UXN A;  1OA0 A;  4F5R A;  3JCF A;  2YIA A;  4EP7 A;  3JPO A;  4F00 A;  4FZO A;  5J2K A;  2ND0 A;  1GNT A;  4LEV A;  3KAW A;  4EBK A;  4EV6 A;  2D1L A;  2ISP A;  1VJ7 A;  2LM0 A;  2NRK A;  2GF4 A;  2X3V A;  4DYL A;  1F5A A;  2OW7 A;  4IWO A;  1BPX A;  2F7P A;  4WOY A;  5DB9 A;  1ZJM A;  4M9L A;  4I2J A;  4AZ6 A;  4FZP A;  4EZW A;  8ICP A;  1ZQD A;  1O7D C;  3HAH A;  3OK8 A;  4KLL A;  2Q13 A;  1BPE A;  2ZH5 A;  4XQ7 A;  1TQS A;  2WIN M;  5J0O A;  4IQW A;  2FCL A;  3D2E A;  4NXZ A;  3C7N A;  1UEU A;  2OW6 A;  1NOM A;  2JNS A;  5J0S A;  4K96 A;  8ICL A;  3BVV A;  3MCR A;  4WC5 A;  4GXK A;  1Q78 A;  3KDR A;  1R8C A;  2ZH1 A;  1ZQE A;  4LEZ A;  4RWO A;  3CK6 A;  1BPB A;  2MI7 A;  2DR8 A;  2ID1 A;  2D4C A;  2M2T A;  4Z6F A;  4UAZ A;  4UBB A;  3T46 A;  4KLG A;  4LZD A;  4I2E A;  2F7O A;  2DR5 A;  3FD9 A;  8ICF A;  5J0Q A;  1JN3 A;  4EZO A;  5CWR A;  2ZXQ A;  2ZHB A;  2ZH3 A;  8ICW A;  4QZD A;  4AZG A;  4WBY A;  3RH5 A;  4FHY A;  3CV5 A;  4BNE A;  4KLH A;  2W9M A;  4M9J A;  7ICR A;  4UD4 A;  4WPC A;  4EZU A;  4FHW A;  4IQV A;  3MGH A;  7ICU A;  4EZP A;  4TUS A;  3LVT A;  4UBC A;  2GA9 D;  4FHX A;  3B52 X;  4NXU A;  4KLE A;  2V0O A;  4P4O A;  4AT7 B;  4O5C A;  4RWN A;  9ICS A;  4RQ8 A;  4RT2 A;  3PMN A;  2O1P A;  2DR7 A;  5HRL A;  2RAK A;  5HR9 A;  9ICC A;  3MGI A;  3WFP A;  9ICO A;  4JNF A;  4I1Q A;  3JPN A;  4KLO A;  3AU6 A;  2YL6 A;  3D2F A;  4M2Y A;  4OAG A;  4O68 A;  4AZH A;  5DKW A;  3EJQ A;  1DKY A;  4RQ3 A;  4RWQ A;  4WBZ A;  3T49 A;  4X4V A;  1ZQK A;  2BPG A;  4O5K A;  1PS3 A;  4NSW A;  3RJE A;  1Q79 A;  3JYY A;  1E1D A;  7ICF A;  3ISC A;  3TFR A;  4QZH A;  2ZH4 A;  4UAY A;  3RJK A;  4JLC A;  3CZN A;  2I9G A;  2RAJ A;  1X04 A;  4I0U A;  5J2C A;  5HRF A;  2ZHA A;  4KLQ A;  1SU8 A;  4X4U A;  8ICR A;  4YMO A;  3OV7 A;  4KLU A;  2DRA A;  4JNE A;  4WQK A;  3BVW A;  9ICQ A;  3EJS A;  2KHO A;  2B51 A;  5B3Q A;  4I2D A;  1DKZ A;  1MJG A;  3EJT A;  2YI8 A;  7ICS A;  4YD1 A;  9ICX A;  9ICE A;  3HJ4 A;  2BPF A;  4AT9 B;  3V72 A;  5CFU A;  4X4S A;  4I2I A;  5J2A A;  2EFK A;  5J2E A;  5FIG A;  4E8F A;  4YD2 A;  8ICV A;  9ICT A;  9ICK A;  4IM0 A;  4AT7 A;  3I01 A;  7ICQ A;  9ICR A;  5HRE A;  4RQ2 A;  4PGQ A;  4FHP A;  3JPR A;  2PXI A;  3T48 A;  4YN4 A;  2ZH8 A;  4EZR A;  4KIK A;  3RH6 A;  1JMS A;  4EZS A;  4IM3 A;  4UB2 A;  1TVA A;  1OA1 A;  3DPO A;  9ICB A;  1E2U A;  4IWQ A;  3EJR A;  2RT6 A;  5CP2 A;  4OAH A;  1TQW A;  4XRH A;  5J2J A;  3HJ1 A;  2FYV A;  3CAZ A;  4X4O A;  1I4T A;  3M3W A;  3GDX A;  8ICM A;  3K75 D;  4F5N A;  4FM3 A;  8ICQ A;  3V7L A;  3I39 X;  1QX1 A;  4ATB A;  5TZV A;  4XA5 A;  2FMS A;  5DBC A;  4F5O A;  4KLD A;  4R64 A;  4AVM A;  3DX3 A;  4H6H A;  5HRG A;  4WC1 A;  2GWS A;  5DED A;  4WQL A;  3HAJ A;  1XSP A;  4WC6 A;  9ICW A;  3NYB A;  2X3W A;  5HHI A;  7ICP A;  4TUR A;  3LK9 A;  3VKH A;  4IQT A;  5IIM A;  4NQI A;  2P66 A;  4I2H A;  4M47 A;  1UET A;  5EOZ A;  5J0R A;  4PHP A;  2YL8 A;  4G6Q A;  4AZ7 A;  4R5G A;  2QXL A;  4AZ5 A;  3ERC C;  3AQN A;  4EED A;  7ICT A;  8ICI A;  5TKY A;  3Q84 A;  3O3O B;  1ZQY A;  4X4Q A;  1KNY A;  5IIJ A;  4K97 A;  3MDA A;  1VFG A;  8ICX A;  4OAF A;  2ISO A;  1MQ3 A;  2GAF D;  3NVO A;  2O5A A;  3AU2 A;  1TV9 A;  2FMP A;  1JQK A;  4AZC A;  3BUB A;  4FO1 A;  3HW8 A;  5D61 A;  2M2W A;  3AQK A;  5D49 A;  4NLZ A;  3BUP A;  4XQ8 A;  2Z0N A;  3DX1 A;  3UPS A;  3ISD A;  9ICA A;  4R5K A;  3C66 A;  4QZ8 A;  5D63 A;  1OAO A;  4KLF A;  1XSL A;  5J2I A;  4S3N A;  3PHZ A;  3NWI A;  4QZ9 A;  3AUO A;  4NXW A;  2Z0V A;  7ICK A;  3RJI A;  1ZQS A;  4EEB A;  3AQM A;  3DPP A;  2M2U A;  8ICU A;  4IWP A;  4O5E A;  3RV0 A;  1DKX A;  3GI7 A;  5DDM A;  4RQ5 A;  4NPH A;  3C2L A;  4R66 A;  3QWE A;  4D8J A;  3H37 A;  4RQ6 A;  4P4M A;  4R65 A;  1ZQP A;  2ALW A;  3ACO A;  4M04 A;  2DVI A;  3WFO A;  4K9A A;  4PPX A;  9ICN A;  4PH5 A;  4KLJ A;  4IM2 A;  4HR1 B;  3UXP A;  4EBJ A;  3B51 X;  1MIW A;  5CJ7 A;  5J2B A;  4RPY A;  1ZJN A;  9ICP A;  2ZH2 A;  4JWD A;  4JN4 A;  4I2A A;  2X3X A;  3BUQ A;  7ICN A;  4PHE A;  3BVX A;  5J2G A;  4X4P A;  5B3P A;  2EWR A;  4JWE A;  4QZA A;  5D46 A;  4K99 A;  1TQV A;  4UB3 A;  1JAJ A;  4H6I A;  4JLX A;  1HTY A;  2BE3 A;  3I04 A;  1MIV A;  4O67 A;  4UB5 A;  3RV1 A;  3HX0 A;  1ZQH A;  2JNK A;  1ZQQ A;  1ZQF A;  4KLT A;  4WC2 A;  2F7Q A;  3EF2 A;  4TUP A;  4TUQ A;  3JPT A;  2FIC A;  3D4Z A;  4R63 A;  9ICG A;  2OBM A;  5HRH A;  4E3C A;  1QWN A;  4E81 A;  3HIY A;  4I29 A;  4M9G A;  2ND1 A;  4R5L A;  3B53 X;  5J2H A;  4K98 A;  1KEJ A;  4LEY A;  2BPC A;  5DDY A;  4PGX A;  4R5I A;  5DEC A;  1V4A A;  3ISB A;  3F7W A;  3BUD A;  5C5B B;  2OBL A;  1URU A;  4EZX A;  4Z6C A;  5DBB A;  4WCW A;  3PLT A;  4F5Q A;  4E7X A;  4NLN A;  5J29 A;  4JWN A;  3RJH A;  2YIV X;  4EZV A;  9ICF A;  1UEV A;  5DB7 A;  4I2G A;  1SU6 A;  1YWM A;  3BVU A;  4K4I A;  3OUY B;  4X0A A;  3ER9 B;  3C2M A;  1ZQX A;  1W9M A;  1TFW A;  2RFF A;  2EX3 B;  4QZE A;  3CVR A;  3C5F A;  4AZB A;  4O6A A;  2ZH9 A;  4JWC A;  9ICU A;  5D4B A;  2YIB A;  5BPC A;  1LQ7 A;  5KBP A;  1ZQJ A;  3UIT A;  3BLB A;  2YLA A;  3DDG A;  3T4A G;  3JZ0 A;  3D50 A;  3C18 A;  4QZB A;  4X0B A;  4UDX X;  3T47 A;  1ZQG A;  4I2F A;  3O3N B;  1ZQI A;  1ZQM A;  4NY8 A;  3O3M B;  2WYH A;  9ICM A;  2PBE A;  1WDZ A;  3V7J A;  3RJJ A;  3D4Y A;  4MFA A;  4QZG A;  1NO5 A;  2LXY A;  3ABH A;  3CKD A;  5HRB A;  1TFY A;  4DCN C;  3B0X A;  5IIL A;  2PY6 A;  2ZH7 A;  2IHM A;  4FHV A;  4I28 A;  4MKP A;  3HAI A;  5HRK A;  5IIN A;  1ZQT A;  2WYI A;  3UXO A;  3DX2 A;  3VEB A;  7ICO A;  5BOM A;  3H39 A;  5CHE A;  5J0X A;  3LMF A;  3PML A;  7ICL A;  2YKT A;  4B9Q A;  4WC4 A;  4NXX A;  4DO9 A;  2BBJ A;  2Z8Y A;  4Z6E A;  4HX0 A;  4AT9 A;  3UQ0 A;  2B56 A;  7ICV A;  2QFF A;  3OVS A;  3V7K A;  3SYV A;  4FH5 A;  5HC9 A;  8ICE A;  3G9G A;  8ICS A;  3KAV A;  1ZQV A;  1MIY A;  3QE6 A;  4NKU A;  3Q0K A;  3JPP A;  4JWM A;  4NKT A;  4EGW A;  4PGY A;  4UB4 A;  4EZT A;  4EZQ A;  3D51 A;  3PNC A;  7ICJ A;  3QNI A;  3QNJ A;  2BBH A;  5DB6 A;  4IW0 A;  2O0I 1;  4KLI A;  4NXT A;  3K7D A;  7ICI A;  3I2W A;  3L3O M;  3QA8 A;  4HY9 A;  4R5J A;  3BUI A;  3LQC B;  4K4G A;  4P2H A;  5FLE X;  3MBY A;  5IIK A;  7ICM A;  3DX4 A;  5CFT A;  4DOB A;  4FO6 A;  4AT8 B;  3TFS A;  4XJE A;  5J0T A;  4OAI Z;  2YL5 A;  3BVT A;  1R8B A;  1YLQ A;  1I4L A;  3RJG A;  5E84 A;  4EZN A;  1ZWW A;  3A98 A;  2PFO A;  2YL9 A;  4NLK A;  3OWG A;  1R89 A;  1QWU A;  5J2F A;  2PMR A;  3WFQ E;  8ICJ A;  9ICL A;  2Q12 A;  4JWI A;  5HHH A;  8ICC A;  4MF8 A;  8ICZ A;  2YI9 A;  1ZQO A;  3WFS C;  1I4D A;  5DB8 A;  1X03 A;  3D52 A;  3DPQ A;  3VEA A;  4E80 A;  3MDC A;  1ZQN A;  1ZQR A;  8ICB A;  5CHG A;  3L3P A;  1GN9 A;  3CZS A;  4WPE A;  3OHX M;  4I27 A;  1RPL A;  1XSN A;  4PHD A;  4KLM A;  4MFC A;  1OU5 A;  5IIO A;  4I2B A;  4EZZ A;  4X5V A;  2BCU A;  8ICY A;  2HN1 A;  4RQ1 A;  9ICH A;  2DR9 A;  4QZF A;  1UPX A;  3DX0 A;  2VAN A;  4O69 A;  4NM1 A;  3DDF A;  2QKW A;  4FZS A;  1O7D B;  3H38 A;  5HRI A;  4M0M A;  4EZY A;  2IHO A;  4JLZ A;  4YMM A;  4DOA A;  5J0Y A;  1RZT A;  4X4N A;  1BPD A;  4RWP A;  9ICV A;  3NKU A;  4RQ4 A;  4NXV A;  1I49 A;  4RQ0 A;  1R34 A;  4PHA A;  3EJU A;  4M5D A;  1ZQL A;  5CA7 A;  1ZYL A;  1FA0 A; 
#chains in the Genus database with same CATH homology
 4KB6 A;  3FD9 A;  4WQL A;  4KIK B;  2YIB A;  4JL9 A;  4EZO A;  3UIT A;  2EWF A;  4WH5 A;  3T4A G;  1U00 A;  4UDX X;  3T47 A;  3VKH A;  3O3N B;  3O3M B;  4N7R A;  4HYB A;  4EZU A;  4G6Q A;  4K9B A;  4R5G A;  2QXL A;  3ERC C;  5TKY A;  4EZP A;  3O3O B;  4K97 A;  2PY6 A;  2GA9 D;  3B52 X;  4NXU A;  4OAF A;  2GAF D;  1GNL A;  4HR1 A;  4MKP A;  4PO2 A;  1JQK A;  1E9V A;  3VEB A;  3ER8 C;  4FO1 A;  4K8V A;  5CHE A;  5D61 A;  3LMF A;  4B9Q A;  4JNF A;  4R5K A;  4NXX A;  2Z8Y A;  3D2F A;  4HX0 A;  5D63 A;  1OAO A;  4OAG A;  1SUF A;  4O68 A;  2B56 A;  2QFF A;  2NCZ A;  3PHZ A;  1DKY A;  4NXW A;  3T49 A;  5D62 A;  3DPP A;  4IWP A;  4F01 A;  3KAV A;  1E1D A;  3RV0 A;  1DKX A;  3GI7 A;  4KM5 A;  4LEW A;  4NPH A;  4D8J A;  4EZT A;  4JLC A;  4EZQ A;  3QNJ A;  4IW0 A;  4K9A A;  1SU7 A;  1SU8 A;  4NXT A;  3K7D A;  3ZED A;  4IM2 A;  4HR1 B;  3L3O M;  3QA8 A;  4HY9 A;  4JNE A;  4R5J A;  4WQK A;  3B51 X;  2KHO A;  2B51 A;  2N3K A;  5B3Q A;  5FLE X;  1DKZ A;  1MJG A;  2B4V A;  4JWD A;  2YI8 A;  4JN4 A;  5CFT A;  4UDY X;  4XJE A;  5CFU A;  2X5C A;  4OAI Z;  5B3P A;  2EWR A;  4JWE A;  4K99 A;  1GPJ A;  5FIG A;  4H6I A;  4JLX A;  5E84 A;  4EZN A;  3I04 A;  3A98 A;  4IM0 A;  4O67 A;  3RV1 A;  3I01 A;  5CFS A;  1OA0 A;  3OWG A;  2YIA A;  3EF2 A;  4F00 A;  4JWI A;  3T48 A;  2ND0 A;  1GNT A;  2OBM A;  3KAW A;  4EZR A;  4LEV A;  4KIK A;  2YI9 A;  4E3C A;  4EZS A;  2LM0 A;  4IM3 A;  3DPQ A;  3VEA A;  4E81 A;  1OA1 A;  2ND1 A;  3DPO A;  4R5L A;  1E2U A;  3B53 X;  4IWO A;  1GN9 A;  4K98 A;  4IWQ A;  4WOY A;  3OHX M;  4LEY A;  4O6A A;  2RT6 A;  4EZW A;  4R5I A;  4OAH A;  4EZZ A;  3F7W A;  4EZX A;  2OBL A;  2WIN M;  1UPX A;  2FCL A;  3D2E A;  4O69 A;  3C7N A;  2JNS A;  4FM3 A;  2YIV X;  4EZV A;  3I39 X;  4M0M A;  4EZY A;  2IHO A;  3MCR A;  4JLZ A;  4K96 A;  1SU6 A;  3KDR A;  4LEZ A;  3NKU A;  4NXV A;  3ER9 B;  1W9M A;  2EX3 B;  3T46 A;  1ZYL A;  4JWC A;  4H6H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...