3OWGA

Crystal structure of vaccinia virus polyadenylate polymerase(vp55)
Total Genus 133
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
133
sequence length
468
structure length
457
Chain Sequence
NITLKIIETYLGRVPSVNEYHMLKSQARNIQKITVFNKDIFVSLVKKNKKRFFSDVNTSASEIKDRILSYFSKQTQTYNIGKLFTIIELQSVLVTTYTDILGVLTIKAPNVISSKISYNVTSMEELARDMLNSMNVAVVSSLVKNVNKLMEEYLRRHNKSCICYGSYSLYLINPNIRYGDIDILQTNSRTFLIDLAFLIKFITGNNIILSKIPYLRNYMVIKDENDNHIIDSFNIRQDTMNVVPKIFIDNIYIVDPTFQLLNMIKMFSQIDRLEDLSKDPEKFNARMATMLEYVRYTHGIVFDGKRNNMPMKCIIDENNRIVTVTTKDYFSFKKCLVYLDENVLSSDILDLNADTSCDFESVTNSVYLIHDNIMYTYFSNTILLSDKGKVHEISARGLCAHILLYQMLTSGEYKQCLSDLLNSMMNRDKIPIYSHTERDKKPGRHGFINIEKDIIVF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Domain-level rocking motion within a polymerase that translocates on single-stranded nucleic acid.
pubmed doi rcsb
source organism Vaccinia virus wr
molecule tags Transferase
molecule keywords Poly(A) polymerase catalytic subunit
total genus 133
structure length 457
sequence length 468
chains with identical sequence B
ec nomenclature ec 2.7.7.19: Polynucleotide adenylyltransferase.
pdb deposition date 2010-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03296 Pox_polyA_pol Poxvirus poly(A) polymerase nucleotidyltransferase domain
A PF12629 Pox_polyA_pol_C Poxvirus poly(A) polymerase C-terminal domain
A PF12630 Pox_polyA_pol_N Poxvirus poly(A) polymerase N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.320 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Substrate Binding Domain Of Dnak; Chain:A; Domain 2 3owgA01
3.30.460.60 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase; domain 2 3owgA03
3ERCC 3ER8C 3ER9B 2GA9D 2GAFD 3OWGA
chains in the Genus database with same CATH superfamily
8ICFA 4HR1A 4O67A 1GN9A 4OAIZ 4MF8A 4R66A 3H3AA 3C66A 1NO5A 5HRHA 5D46A 4RPYA 3D51A 2ZH7A 4EP7A 3AQLA 2YIAA 4WBYA 4FO1A 5CP2A 3WFQE 2ID1A 8ICLA 3T47A 4O9MA 4PHAA 4O68A 4EBJA 4M0AA 5CHEA 7ICQA 9ICVA 4PGQA 4XA5A 4QZFA 4QZ9A 4RQ7A 1O7DB 2OW7A 4F5NA 3UQ2A 3RH6A 3Q84A 1ZQAA 4X4NA 3I39X 1ZYLA 2OBMA 3UXPA 2DR8A 4KLLA 4PGYA 1XSLA 4I2EA 3KAWA 1PX5A 4OAGA 4R5KA 1XSPA 3BVWA 4FZOA 4MFCA 1ZQCA 4I29A 4RWNA 4AT8A 2ZHBA 3BUIA 3OVBA 2PBEA 5DB9A 4JWMA 3MGHA 1I4LA 2Z8YA 1KEJA 1Q78A 4P2HA 3H37A 4UDXX 4UDYX 2BCVA 1TVAA 1RPLA 4RPZA 5CA7A 4B9QA 3I04A 2RT6A 4PHPA 2FMPA 2BBJA 2Z0OA 2YL6A 4K99A 4YMMA 5JTGA 2DVIA 1ZQFA 2X5CA 4X0BA 1ZQHA 2Z0VA 4UB4A 2PFNA 2F18A 3BUQA 4P4MA 1ZQVA 9ICBA 2WYHA 4GXKA 5J2IA 1BPDA 5IIKA 1VJ7A 4RQ8A 3AU2A 4O69A 5HHHA 3DX4A 8ICKA 3JPOA 3DDGA 4E7XA 5DBAA 4EZZA 1F5AA 4I2BA 4X4VA 2ZH3A 7ICFA 4UBCA 1TV9A 4XJEA 5J0TA 9ICTA 2W9MA 1ZQQA 5D4BA 2BPGA 1ZWWA 3PMNA 1XSNA 4MFAA 5J2JA 5J0QA 8ICIA 3BVXA 3PLTA 1ZQTA 3ACOA 2IHMA 9ICQA 8ICHA 4AZHA 4F01A 4NKTA 2ZXQA 8ICPA 4LEWA 3WFOA 2PY6A 4E80A 1MQ3A 3BUPA 5C5BA 1HWWA 1ZQIA 1QWNA 3HAJA 4LVSA 4XUSA 3CVRA 2F7RA 5HRFA 1TQTA 1UEVA 2RFFA 5J0PA 3RJIA 4QZ8A 1W9MA 4R63A 1ZQBA 4JWCA 4O5KA 9ICGA 1PS3A 5J0XA 4P4PA 4K8VA 1ZQGA 2YL9A 1R33A 4FHPA 3EJPA 5HREA 7ICIA 9ICUA 4AZ7A 3VKHA 4OAFA 2DRAA 2DR7A 1OAOA 2OW6A 3LMFA 4IWOA 3MGIA 3A98A 2RAIA 3CV5A 4F5QA 4FZSA 4RQ3A 4DOAA 1KDHA 3D4YA 4JLXA 4QZDA 2VANA 3OK8A 4TUPA 2BPFA 3JYYA 3DYTA 3DX2A 4E8FA 3C2KA 2LXYA 1X03A 4IQTA 1BPXA 5HR9A 1ZQRA 1GPJA 3AUOA 3OVSA 4XRHA 1BPBA 4DYLA 5FLEX 4JLZA 3V7KA 1DKZA 4O5CA 2GWSA 8ICTA 4XQ8A 1MIYA 3D4ZA 4I28A 4EZUA 3HJ1A 5CFSA 3B52X 1O7DC 2PFQA 4WH5A 5DBBA 1ZQEA 2YLLA 4HYBA 5CWRA 1TFWA 3Q0KA 4ATMA 4EZVA 2DR5A 2BCRA 4Z6DA 2B4VA 3MCRA 4EZRA 1ZQLA 1WDZA 5DEDA 3RPMA 5HC9A 4M9HA 4RWPA 4RQ0A 3DPOA 2BCQA 3T46A 4FHVA 9ICFA 4AT8B 1ZQPA 3D50A 3NYBA 1I4DA 2IHOA 4QZCA 2V0OA 4WC2A 3C18A 3FD9A 4UB1A 4K9BA 1R8BA 3EJUA 5HRIA 5J0YA 3ZEDA 4UAZA 3KAVA 2M2WA 4JN4A 4NSWA 1HTYA 4NXZA 4NPHA 7ICNA 2X3VA 2WINM 4I2IA 2OBLA 3K7DA 7ICMA 5F2VO 4I27A 4AZCA 3H38A 2QXLA 4PGXA 5IINA 4EEDA 3HX0A 2PFPA 4RWQA 4N7RA 4NXXA 3SOGA 2Z0NA 2ELBA 3RJHA 4NY8A 3D52A 3T48A 7ICHA 3VEBA 5HRDA 9ICRA 1RZTA 2OO2A 2QKWA 4M04A 3MDCA 1FA0A 3RH5A 2DRBA 7ICSA 4FM3A 4EV6A 4WC4A 4RQ6A 4IM3A 3MBYA 5CFUA 4ATBB 1BPYA 3AU6A 4KLFA 5J0UA 9ICXA 9ICPA 5DB7A 1E2UA 4R5IA 4UB2A 4M9JA 1KNYA 4QZAA 8ICCA 2ZH8A 4KLIA 9ICCA 1JQRA 2GF4A 1UEUA 1Y2OA 1URUA 3QA8A 3F7WA 4NLNA 1BPEA 4GXJA 4I0UA 9ICEA 1TQWA 4JWNA 1TQVA 2ZH6A 3DX3A 5KBPA 4EZYA 2D1LA 3OUYA 4NXUA 3EJTA 4M9GA 2M2TA 4I2FA 4NM2A 4NLKA 2YLAA 3DX1A 4AZ6A 4F5OA 4DOBA 2FYVA 2ISPA 4AT9A 3HW8A 2JNSA 4IM2A 3GI7A 2ZH1A 2ND0A 2KHOA 4WC0A 4TURA 2EWFA 2I9GA 4LT6A 8ICZA 5E84A 1ZQSA 3QNJA 1SUFA 4MKPA 4WQKA 4YN4A 9ICHA 1JQKA 4KB6A 5HRBA 7ICOA 3LQCB 4IQUA 4M9NA 2F7PA 4R65A 4GXIA 9ICMA 4EEBA 4M5DA 4Z6CA 5J2FA 1WOTA 4KLQA 4X4UA 3WFPA 3C7NA 4YCXA 4E3CA 1Q79A 4LZDA 2JNKA 4HY9A 3NVOA 1OA1A 8ICMA 9ICKA 1UPXA 4UB3A 3DPQA 5D63A 3C5GA 2PFOA 5J29A 4LEZA 4AZGA 5CFTA 4M9LA 2RAJA 1NOMA 1DKYA 3OV7A 1MIWA 3V7LA 4JNEA 3UXNA 4O5EA 4X4OA 1BPZA 7ICGA 4QZBA 4WC3A 4UBBA 3ER8C 4RQ2A 3ABHA 5IIOA 8ICGA 4EZTA 4NXTA 3RJJA 5HRLA 5DKWA 2ZHAA 2RAKA 3JCFA 4FZPA 5DDMA 4IWQA 4I2GA 4I1QA 4S3NA 4X5VA 2YI9A 2BBHA 4KIKB 4EZPA 5J0RA 4K98A 4PO2A 3UXOA 3AQMA 4O6AA 2BCUA 4K4IA 2NRKA 4AT7B 4RT2A 4UAYA 2Q66A 3C2MA 4FH5A 4TUSA 4WC6A 9ICSA 7ICKA 2WYIA 4XQ7A 3RJKA 2BE3A 2M2UA 4HR1B 1VFGA 8ICUA 4AZCB 4EGWA 1HUZA 4EZOA 3ER9B 4KLGA 3T4AG 3TFRA 4K96A 3NKUA 3QE6A 3DDFA 1UETA 4WOYA 4OAHA 1ZQKA 3B53X 1MIVA 4X4TA 3WFRE 5J2KA 3HWTA 4KLJA 3O3NB 2LM0A 4Z6EA 3ISBA 8ICXA 8ICAA 1TQUA 1JAJA 3UQ0A 2YKTA 2F1BA 3BLBA 4NXWA 5DB6A 1ZQZA 2GA9D 3EF2A 4YMNA 4KLDA 1ZQYA 4QZEA 4F00A 3WFSC 3CZSA 9ICIA 1ZQUA 3UPQA 3SYVA 5EOZA 7ICVA 4R5LA 4NXVA 1YLQA 4F5RA 3QNIA 3V72A 2EFLA 4P4OA 8ICVA 4BNEA 3LK9A 3O3MB 3K75D 4EBKA 8ICWA 8ICBA 7ICEA 1E9VA 9ICWA 5B3PA 4D8JA 3ERCC 4WBZA 4FHXA 2DR9A 4RT3A 3PMLA 4H6HA 3JPRA 3L9DA 4EZWA 9ICJA 2Q12A 4E81A 4R5GA 2ISOA 3RJFA 3AQKA 5IIIA 1ZQWA 1LQ7A 3DX0A 1JN3A 4YD2A 4TUQA 1R89A 1U00A 3EJQA 3HAHA 4IM0A 3JPQA 4FHYA 1MJGA 3KDRA 2ALWA 1ZQOA 5BPCA 4WC1A 5J0WA 4M47A 4X4QA 3BUDA 2YIBA 2FMQA 4LEVA 2D4CA 5CR0A 4AKVA 1X04A 5FIGA 4X4PA 4IQWA 3V7JA 3C5FA 7ICLA 2P66A 2B56A 3BVTA 9ICOA 1ZJNA 1SU6A 2ZH4A 2EFKA 2IUBA 1GNLA 1HUOA 1OA0A 2MI7A 5J2DA 4DOCA 4KLHA 2O1PA 7ICRA 4RQ1A 5TKYA 2O5AA 4IW0A 2BPCA 2PMRA 1ZQJA 4WC7A 4WC5A 5D62A 4AZBA 2FICA 1OU5A 3RV1A 3B0YA 3HJ4A 4PH5A 2EWRA 4WQLA 2FMSA 4PHDA 4EZXA 4IQVA 4FO6A 2ZH5A 2FCLA 3CKDA 4EZSA 1V4AA 4HX0A 3I2WA 3O3OB 3QWEA 4WPEA 8ICJA 4JWIA 4AZ5A 4RQ5A 5J0OA 4NQIA 4QZGA 3JZ0A 3OHXM 4I2DA 4X4SA 4JL9A 8ICEA 3B51X 4FH3A 5DDYA 4X4RA 4PHEA 3B0XA 3OWGA 5CJ7A 1I4TA 3OUYB 3GDXA 2PXIA 2YL8A 4R64A 2M2VA 4M0MA 4LEYA 4JNFA 3UITA 3HIYA 5DECA 2NCZA 2C08A 4KLMA 3VEAA 4AZIA 5J2AA 2HN1A 3C2LA 3BVVA 3PHZA 5DB8A 3EJRA 3AQNA 4QZHA 3ISDA 8ICNA 1GNTA 5J0SA 3RJEA 5D61A 1R8CA 4UD5A 5DBCA 8ICRA 4RWOA 4Z6FA 5BOMA 3CK6A 3TFSA 2QFFA 4ATBA 9ICNA 3RJGA 1JMSA 3BUBA 5J2EA 2X3WA 1ZJMA 2ND1A 3LVTA 2BCSA 4I2HA 4AT7A 5TZVA 4NM1A 4QZIA 2YIVX 5CHGA 3OVAA 5B3QA 4KLOA 3HAIA 1R5EA 2F7OA 3I01A 4UAWA 2ZH2A 4JWEA 7ICTA 3BVUA 2Q13A 4K4HA 2N3KA 2B51A 4DCNC 3LLLA 4K9AA 2ZH9A 4I2JA 4YD1A 1I49A 5HRKA 1MQ2A 2O0I1 1QX1A 8ICSA 4NLZA 5HHIA 1ZQDA 4EZQA 1ZQMA 8ICYA 3T49A 7ICUA 4KLTA 3CAZA 4KM5A 4FHWA 4I2AA 3JPSA 4H8SA 4LZGA 4UB5A 3M3WA 4RQ4A 3JPPA 3CZNA 4IG8A 5CB1A 3MDAA 1DKXA 4JWDA 4YMOA 1R8AA 1QWUA 3RH4A 3OGUA 3RV0A 3L3PA 4R5JA 3PNCA 5D49A 2EX3B 3G9GA 4JLCA 4MFFA 8ICOA 4NKUA 5C5BB 4K4GA 2OZNB 5BOLA 4X0AA 3L3OM 4WPCA 1ZQNA 4AVMA 4G6QA 7ICJA 1R34A 1YWMA 4IWPA 3UPSA 1E1DA 1TQSA 8ICQA 7ICPA 5J2GA 4RPXA 4M2YA 1TFYA 3JPTA 4K97A 4AT9B 5HRGA 1ZQXA 2HN2A 1SU7A 2YL5A 4DO9A 2HHPA 1HXKA 1SU8A 2F7QA 2X3XA 5J2BA 3D2EA 4MF2A 4F5PA 4H6IA 3H39A 5J2CA 4KLSA 4EZNA 4PPXA 3DPPA 3EJSA 4WCWA 5IIJA 3NWIA 3D2FA 5IIMA 5J2HA 4KLEA 4KLUA 3JPNA 5IILA 2F1AA 9ICLA 4UD4A 2GAFD 4I2CA 9ICAA 2YI8A 4KIKA 3ISCA
chains in the Genus database with same CATH topology
4HYBA 4HR1A 3ER8C 2FCLA 4EZSA 1GN9A 4EZVA 4HX0A 4O67A 4OAIZ 4EZTA 3O3OB 4NXTA 2B4VA 2YIAA 4JWIA 4EZRA 3MCRA 4FO1A 3T47A 4IWQA 4O68A 5CHEA 3OHXM 3DPOA 4JL9A 2YI9A 3T46A 4KIKB 4EZPA 4K98A 4PO2A 3B51X 4O6AA 2IHOA 3OWGA 3FD9A 3I39X 1ZYLA 2OBMA 4K9BA 3ZEDA 4M0MA 4LEYA 3KAVA 4JNFA 4JN4A 3KAWA 3UITA 4OAGA 4R5KA 2NCZA 4NPHA 4HR1B 3VEAA 2WINM 4EZOA 3ER9B 2OBLA 3K7DA 3T4AG 3PHZA 4K96A 3NKUA 2QXLA 1GNTA 4WOYA 4OAHA 3B53X 5D61A 2Z8YA 4N7RA 4NXXA 3O3NB 4UDXX 2LM0A 4UDYX 3T48A 4B9QA 3I04A 2RT6A 3VEBA 2QFFA 4NXWA 4K99A 2GA9D 3EF2A 2ND1A 2X5CA 4F00A 4FM3A 2YIVX 5B3QA 4IM3A 3I01A 5CFUA 4JWEA 2N3KA 2B51A 4O69A 4K9AA 4R5LA 4NXVA 1E2UA 4R5IA 4EZZA 3O3MB 4EZQA 1E9VA 3T49A 5B3PA 4D8JA 3QA8A 3F7WA 3ERCC 4XJEA 4KM5A 4H6HA 4EZWA 4EZYA 1DKXA 4JWDA 4NXUA 4E81A 4F01A 4R5GA 4LEWA 2PY6A 3RV0A 4R5JA 2EX3B 1U00A 2JNSA 4IM2A 3GI7A 4IM0A 4JLCA 2ND0A 1MJGA 2KHOA 3KDRA 2EWFA 3L3OM 1W9MA 4JWCA 5E84A 3QNJA 1SUFA 2YIBA 4G6QA 4MKPA 4LEVA 4WQKA 1JQKA 4IWPA 5FIGA 4K8VA 4KB6A 1E1DA 3VKHA 4OAFA 2B56A 1OAOA 3LMFA 4IWOA 4K97A 3A98A 1SU6A 1SU7A 1GNLA 3C7NA 4JLXA 4E3CA 1SU8A 1OA0A 3D2EA 4H6IA 4HY9A 1OA1A 4EZNA 1GPJA 5TKYA 4IW0A 1UPXA 3DPPA 3DPQA 5D63A 5FLEX 4JLZA 4LEZA 3D2FA 5D62A 1DKZA 5CFTA 1DKYA 3RV1A 2EWRA 4WQLA 4JNEA 4EZXA 4EZUA 2GAFD 5CFSA 3B52X 2YI8A 4WH5A 4KIKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ERC C;  3ER8 C;  3ER9 B;  2GA9 D;  2GAF D;  3OWG A; 
#chains in the Genus database with same CATH topology
 8ICF A;  4HR1 A;  4O67 A;  1GN9 A;  4OAI Z;  4MF8 A;  4R66 A;  3H3A A;  3C66 A;  1NO5 A;  5HRH A;  5D46 A;  4RPY A;  3D51 A;  2ZH7 A;  4EP7 A;  3AQL A;  2YIA A;  4WBY A;  4FO1 A;  5CP2 A;  3WFQ E;  2ID1 A;  8ICL A;  3T47 A;  4O9M A;  4PHA A;  4O68 A;  4EBJ A;  4M0A A;  5CHE A;  7ICQ A;  9ICV A;  4PGQ A;  4XA5 A;  4QZF A;  4QZ9 A;  4RQ7 A;  1O7D B;  2OW7 A;  4F5N A;  3UQ2 A;  3RH6 A;  3Q84 A;  1ZQA A;  4X4N A;  3I39 X;  1ZYL A;  2OBM A;  3UXP A;  2DR8 A;  4KLL A;  4PGY A;  1XSL A;  4I2E A;  3KAW A;  1PX5 A;  4OAG A;  4R5K A;  1XSP A;  3BVW A;  4FZO A;  4MFC A;  1ZQC A;  4I29 A;  4RWN A;  4AT8 A;  2ZHB A;  3BUI A;  3OVB A;  2PBE A;  5DB9 A;  4JWM A;  3MGH A;  1I4L A;  2Z8Y A;  1KEJ A;  1Q78 A;  4P2H A;  3H37 A;  4UDX X;  4UDY X;  2BCV A;  1TVA A;  1RPL A;  4RPZ A;  5CA7 A;  4B9Q A;  3I04 A;  2RT6 A;  4PHP A;  2FMP A;  2BBJ A;  2Z0O A;  2YL6 A;  4K99 A;  4YMM A;  5JTG A;  2DVI A;  1ZQF A;  2X5C A;  4X0B A;  1ZQH A;  2Z0V A;  4UB4 A;  2PFN A;  2F18 A;  3BUQ A;  4P4M A;  1ZQV A;  9ICB A;  2WYH A;  4GXK A;  5J2I A;  1BPD A;  5IIK A;  1VJ7 A;  4RQ8 A;  3AU2 A;  4O69 A;  5HHH A;  3DX4 A;  8ICK A;  3JPO A;  3DDG A;  4E7X A;  5DBA A;  4EZZ A;  1F5A A;  4I2B A;  4X4V A;  2ZH3 A;  7ICF A;  4UBC A;  1TV9 A;  4XJE A;  5J0T A;  9ICT A;  2W9M A;  1ZQQ A;  5D4B A;  2BPG A;  1ZWW A;  3PMN A;  1XSN A;  4MFA A;  5J2J A;  5J0Q A;  8ICI A;  3BVX A;  3PLT A;  1ZQT A;  3ACO A;  2IHM A;  9ICQ A;  8ICH A;  4AZH A;  4F01 A;  4NKT A;  2ZXQ A;  8ICP A;  4LEW A;  3WFO A;  2PY6 A;  4E80 A;  1MQ3 A;  3BUP A;  5C5B A;  1HWW A;  1ZQI A;  1QWN A;  3HAJ A;  4LVS A;  4XUS A;  3CVR A;  2F7R A;  5HRF A;  1TQT A;  1UEV A;  2RFF A;  5J0P A;  3RJI A;  4QZ8 A;  1W9M A;  4R63 A;  1ZQB A;  4JWC A;  4O5K A;  9ICG A;  1PS3 A;  5J0X A;  4P4P A;  4K8V A;  1ZQG A;  2YL9 A;  1R33 A;  4FHP A;  3EJP A;  5HRE A;  7ICI A;  9ICU A;  4AZ7 A;  3VKH A;  4OAF A;  2DRA A;  2DR7 A;  1OAO A;  2OW6 A;  3LMF A;  4IWO A;  3MGI A;  3A98 A;  2RAI A;  3CV5 A;  4F5Q A;  4FZS A;  4RQ3 A;  4DOA A;  1KDH A;  3D4Y A;  4JLX A;  4QZD A;  2VAN A;  3OK8 A;  4TUP A;  2BPF A;  3JYY A;  3DYT A;  3DX2 A;  4E8F A;  3C2K A;  2LXY A;  1X03 A;  4IQT A;  1BPX A;  5HR9 A;  1ZQR A;  1GPJ A;  3AUO A;  3OVS A;  4XRH A;  1BPB A;  4DYL A;  5FLE X;  4JLZ A;  3V7K A;  1DKZ A;  4O5C A;  2GWS A;  8ICT A;  4XQ8 A;  1MIY A;  3D4Z A;  4I28 A;  4EZU A;  3HJ1 A;  5CFS A;  3B52 X;  1O7D C;  2PFQ A;  4WH5 A;  5DBB A;  1ZQE A;  2YLL A;  4HYB A;  5CWR A;  1TFW A;  3Q0K A;  4ATM A;  4EZV A;  2DR5 A;  2BCR A;  4Z6D A;  2B4V A;  3MCR A;  4EZR A;  1ZQL A;  1WDZ A;  5DED A;  3RPM A;  5HC9 A;  4M9H A;  4RWP A;  4RQ0 A;  3DPO A;  2BCQ A;  3T46 A;  4FHV A;  9ICF A;  4AT8 B;  1ZQP A;  3D50 A;  3NYB A;  1I4D A;  2IHO A;  4QZC A;  2V0O A;  4WC2 A;  3C18 A;  3FD9 A;  4UB1 A;  4K9B A;  1R8B A;  3EJU A;  5HRI A;  5J0Y A;  3ZED A;  4UAZ A;  3KAV A;  2M2W A;  4JN4 A;  4NSW A;  1HTY A;  4NXZ A;  4NPH A;  7ICN A;  2X3V A;  2WIN M;  4I2I A;  2OBL A;  3K7D A;  7ICM A;  5F2V O;  4I27 A;  4AZC A;  3H38 A;  2QXL A;  4PGX A;  5IIN A;  4EED A;  3HX0 A;  2PFP A;  4RWQ A;  4N7R A;  4NXX A;  3SOG A;  2Z0N A;  2ELB A;  3RJH A;  4NY8 A;  3D52 A;  3T48 A;  7ICH A;  3VEB A;  5HRD A;  9ICR A;  1RZT A;  2OO2 A;  2QKW A;  4M04 A;  3MDC A;  1FA0 A;  3RH5 A;  2DRB A;  7ICS A;  4FM3 A;  4EV6 A;  4WC4 A;  4RQ6 A;  4IM3 A;  3MBY A;  5CFU A;  4ATB B;  1BPY A;  3AU6 A;  4KLF A;  5J0U A;  9ICX A;  9ICP A;  5DB7 A;  1E2U A;  4R5I A;  4UB2 A;  4M9J A;  1KNY A;  4QZA A;  8ICC A;  2ZH8 A;  4KLI A;  9ICC A;  1JQR A;  2GF4 A;  1UEU A;  1Y2O A;  1URU A;  3QA8 A;  3F7W A;  4NLN A;  1BPE A;  4GXJ A;  4I0U A;  9ICE A;  1TQW A;  4JWN A;  1TQV A;  2ZH6 A;  3DX3 A;  5KBP A;  4EZY A;  2D1L A;  3OUY A;  4NXU A;  3EJT A;  4M9G A;  2M2T A;  4I2F A;  4NM2 A;  4NLK A;  2YLA A;  3DX1 A;  4AZ6 A;  4F5O A;  4DOB A;  2FYV A;  2ISP A;  4AT9 A;  3HW8 A;  2JNS A;  4IM2 A;  3GI7 A;  2ZH1 A;  2ND0 A;  2KHO A;  4WC0 A;  4TUR A;  2EWF A;  2I9G A;  4LT6 A;  8ICZ A;  5E84 A;  1ZQS A;  3QNJ A;  1SUF A;  4MKP A;  4WQK A;  4YN4 A;  9ICH A;  1JQK A;  4KB6 A;  5HRB A;  7ICO A;  3LQC B;  4IQU A;  4M9N A;  2F7P A;  4R65 A;  4GXI A;  9ICM A;  4EEB A;  4M5D A;  4Z6C A;  5J2F A;  1WOT A;  4KLQ A;  4X4U A;  3WFP A;  3C7N A;  4YCX A;  4E3C A;  1Q79 A;  4LZD A;  2JNK A;  4HY9 A;  3NVO A;  1OA1 A;  8ICM A;  9ICK A;  1UPX A;  4UB3 A;  3DPQ A;  5D63 A;  3C5G A;  2PFO A;  5J29 A;  4LEZ A;  4AZG A;  5CFT A;  4M9L A;  2RAJ A;  1NOM A;  1DKY A;  3OV7 A;  1MIW A;  3V7L A;  4JNE A;  3UXN A;  4O5E A;  4X4O A;  1BPZ A;  7ICG A;  4QZB A;  4WC3 A;  4UBB A;  3ER8 C;  4RQ2 A;  3ABH A;  5IIO A;  8ICG A;  4EZT A;  4NXT A;  3RJJ A;  5HRL A;  5DKW A;  2ZHA A;  2RAK A;  3JCF A;  4FZP A;  5DDM A;  4IWQ A;  4I2G A;  4I1Q A;  4S3N A;  4X5V A;  2YI9 A;  2BBH A;  4KIK B;  4EZP A;  5J0R A;  4K98 A;  4PO2 A;  3UXO A;  3AQM A;  4O6A A;  2BCU A;  4K4I A;  2NRK A;  4AT7 B;  4RT2 A;  4UAY A;  2Q66 A;  3C2M A;  4FH5 A;  4TUS A;  4WC6 A;  9ICS A;  7ICK A;  2WYI A;  4XQ7 A;  3RJK A;  2BE3 A;  2M2U A;  4HR1 B;  1VFG A;  8ICU A;  4AZC B;  4EGW A;  1HUZ A;  4EZO A;  3ER9 B;  4KLG A;  3T4A G;  3TFR A;  4K96 A;  3NKU A;  3QE6 A;  3DDF A;  1UET A;  4WOY A;  4OAH A;  1ZQK A;  3B53 X;  1MIV A;  4X4T A;  3WFR E;  5J2K A;  3HWT A;  4KLJ A;  3O3N B;  2LM0 A;  4Z6E A;  3ISB A;  8ICX A;  8ICA A;  1TQU A;  1JAJ A;  3UQ0 A;  2YKT A;  2F1B A;  3BLB A;  4NXW A;  5DB6 A;  1ZQZ A;  2GA9 D;  3EF2 A;  4YMN A;  4KLD A;  1ZQY A;  4QZE A;  4F00 A;  3WFS C;  3CZS A;  9ICI A;  1ZQU A;  3UPQ A;  3SYV A;  5EOZ A;  7ICV A;  4R5L A;  4NXV A;  1YLQ A;  4F5R A;  3QNI A;  3V72 A;  2EFL A;  4P4O A;  8ICV A;  4BNE A;  3LK9 A;  3O3M B;  3K75 D;  4EBK A;  8ICW A;  8ICB A;  7ICE A;  1E9V A;  9ICW A;  5B3P A;  4D8J A;  3ERC C;  4WBZ A;  4FHX A;  2DR9 A;  4RT3 A;  3PML A;  4H6H A;  3JPR A;  3L9D A;  4EZW A;  9ICJ A;  2Q12 A;  4E81 A;  4R5G A;  2ISO A;  3RJF A;  3AQK A;  5III A;  1ZQW A;  1LQ7 A;  3DX0 A;  1JN3 A;  4YD2 A;  4TUQ A;  1R89 A;  1U00 A;  3EJQ A;  3HAH A;  4IM0 A;  3JPQ A;  4FHY A;  1MJG A;  3KDR A;  2ALW A;  1ZQO A;  5BPC A;  4WC1 A;  5J0W A;  4M47 A;  4X4Q A;  3BUD A;  2YIB A;  2FMQ A;  4LEV A;  2D4C A;  5CR0 A;  4AKV A;  1X04 A;  5FIG A;  4X4P A;  4IQW A;  3V7J A;  3C5F A;  7ICL A;  2P66 A;  2B56 A;  3BVT A;  9ICO A;  1ZJN A;  1SU6 A;  2ZH4 A;  2EFK A;  2IUB A;  1GNL A;  1HUO A;  1OA0 A;  2MI7 A;  5J2D A;  4DOC A;  4KLH A;  2O1P A;  7ICR A;  4RQ1 A;  5TKY A;  2O5A A;  4IW0 A;  2BPC A;  2PMR A;  1ZQJ A;  4WC7 A;  4WC5 A;  5D62 A;  4AZB A;  2FIC A;  1OU5 A;  3RV1 A;  3B0Y A;  3HJ4 A;  4PH5 A;  2EWR A;  4WQL A;  2FMS A;  4PHD A;  4EZX A;  4IQV A;  4FO6 A;  2ZH5 A;  2FCL A;  3CKD A;  4EZS A;  1V4A A;  4HX0 A;  3I2W A;  3O3O B;  3QWE A;  4WPE A;  8ICJ A;  4JWI A;  4AZ5 A;  4RQ5 A;  5J0O A;  4NQI A;  4QZG A;  3JZ0 A;  3OHX M;  4I2D A;  4X4S A;  4JL9 A;  8ICE A;  3B51 X;  4FH3 A;  5DDY A;  4X4R A;  4PHE A;  3B0X A;  3OWG A;  5CJ7 A;  1I4T A;  3OUY B;  3GDX A;  2PXI A;  2YL8 A;  4R64 A;  2M2V A;  4M0M A;  4LEY A;  4JNF A;  3UIT A;  3HIY A;  5DEC A;  2NCZ A;  2C08 A;  4KLM A;  3VEA A;  4AZI A;  5J2A A;  2HN1 A;  3C2L A;  3BVV A;  3PHZ A;  5DB8 A;  3EJR A;  3AQN A;  4QZH A;  3ISD A;  8ICN A;  1GNT A;  5J0S A;  3RJE A;  5D61 A;  1R8C A;  4UD5 A;  5DBC A;  8ICR A;  4RWO A;  4Z6F A;  5BOM A;  3CK6 A;  3TFS A;  2QFF A;  4ATB A;  9ICN A;  3RJG A;  1JMS A;  3BUB A;  5J2E A;  2X3W A;  1ZJM A;  2ND1 A;  3LVT A;  2BCS A;  4I2H A;  4AT7 A;  5TZV A;  4NM1 A;  4QZI A;  2YIV X;  5CHG A;  3OVA A;  5B3Q A;  4KLO A;  3HAI A;  1R5E A;  2F7O A;  3I01 A;  4UAW A;  2ZH2 A;  4JWE A;  7ICT A;  3BVU A;  2Q13 A;  4K4H A;  2N3K A;  2B51 A;  4DCN C;  3LLL A;  4K9A A;  2ZH9 A;  4I2J A;  4YD1 A;  1I49 A;  5HRK A;  1MQ2 A;  2O0I 1;  1QX1 A;  8ICS A;  4NLZ A;  5HHI A;  1ZQD A;  4EZQ A;  1ZQM A;  8ICY A;  3T49 A;  7ICU A;  4KLT A;  3CAZ A;  4KM5 A;  4FHW A;  4I2A A;  3JPS A;  4H8S A;  4LZG A;  4UB5 A;  3M3W A;  4RQ4 A;  3JPP A;  3CZN A;  4IG8 A;  5CB1 A;  3MDA A;  1DKX A;  4JWD A;  4YMO A;  1R8A A;  1QWU A;  3RH4 A;  3OGU A;  3RV0 A;  3L3P A;  4R5J A;  3PNC A;  5D49 A;  2EX3 B;  3G9G A;  4JLC A;  4MFF A;  8ICO A;  4NKU A;  5C5B B;  4K4G A;  2OZN B;  5BOL A;  4X0A A;  3L3O M;  4WPC A;  1ZQN A;  4AVM A;  4G6Q A;  7ICJ A;  1R34 A;  1YWM A;  4IWP A;  3UPS A;  1E1D A;  1TQS A;  8ICQ A;  7ICP A;  5J2G A;  4RPX A;  4M2Y A;  1TFY A;  3JPT A;  4K97 A;  4AT9 B;  5HRG A;  1ZQX A;  2HN2 A;  1SU7 A;  2YL5 A;  4DO9 A;  2HHP A;  1HXK A;  1SU8 A;  2F7Q A;  2X3X A;  5J2B A;  3D2E A;  4MF2 A;  4F5P A;  4H6I A;  3H39 A;  5J2C A;  4KLS A;  4EZN A;  4PPX A;  3DPP A;  3EJS A;  4WCW A;  5IIJ A;  3NWI A;  3D2F A;  5IIM A;  5J2H A;  4KLE A;  4KLU A;  3JPN A;  5IIL A;  2F1A A;  9ICL A;  4UD4 A;  2GAF D;  4I2C A;  9ICA A;  2YI8 A;  4KIK A;  3ISC A; 
#chains in the Genus database with same CATH homology
 4HYB A;  4HR1 A;  3ER8 C;  2FCL A;  4EZS A;  1GN9 A;  4EZV A;  4HX0 A;  4O67 A;  4OAI Z;  4EZT A;  3O3O B;  4NXT A;  2B4V A;  2YIA A;  4JWI A;  4EZR A;  3MCR A;  4FO1 A;  3T47 A;  4IWQ A;  4O68 A;  5CHE A;  3OHX M;  3DPO A;  4JL9 A;  2YI9 A;  3T46 A;  4KIK B;  4EZP A;  4K98 A;  4PO2 A;  3B51 X;  4O6A A;  2IHO A;  3OWG A;  3FD9 A;  3I39 X;  1ZYL A;  2OBM A;  4K9B A;  3ZED A;  4M0M A;  4LEY A;  3KAV A;  4JNF A;  4JN4 A;  3KAW A;  3UIT A;  4OAG A;  4R5K A;  2NCZ A;  4NPH A;  4HR1 B;  3VEA A;  2WIN M;  4EZO A;  3ER9 B;  2OBL A;  3K7D A;  3T4A G;  3PHZ A;  4K96 A;  3NKU A;  2QXL A;  1GNT A;  4WOY A;  4OAH A;  3B53 X;  5D61 A;  2Z8Y A;  4N7R A;  4NXX A;  3O3N B;  4UDX X;  2LM0 A;  4UDY X;  3T48 A;  4B9Q A;  3I04 A;  2RT6 A;  3VEB A;  2QFF A;  4NXW A;  4K99 A;  2GA9 D;  3EF2 A;  2ND1 A;  2X5C A;  4F00 A;  4FM3 A;  2YIV X;  5B3Q A;  4IM3 A;  3I01 A;  5CFU A;  4JWE A;  2N3K A;  2B51 A;  4O69 A;  4K9A A;  4R5L A;  4NXV A;  1E2U A;  4R5I A;  4EZZ A;  3O3M B;  4EZQ A;  1E9V A;  3T49 A;  5B3P A;  4D8J A;  3QA8 A;  3F7W A;  3ERC C;  4XJE A;  4KM5 A;  4H6H A;  4EZW A;  4EZY A;  1DKX A;  4JWD A;  4NXU A;  4E81 A;  4F01 A;  4R5G A;  4LEW A;  2PY6 A;  3RV0 A;  4R5J A;  2EX3 B;  1U00 A;  2JNS A;  4IM2 A;  3GI7 A;  4IM0 A;  4JLC A;  2ND0 A;  1MJG A;  2KHO A;  3KDR A;  2EWF A;  3L3O M;  1W9M A;  4JWC A;  5E84 A;  3QNJ A;  1SUF A;  2YIB A;  4G6Q A;  4MKP A;  4LEV A;  4WQK A;  1JQK A;  4IWP A;  5FIG A;  4K8V A;  4KB6 A;  1E1D A;  3VKH A;  4OAF A;  2B56 A;  1OAO A;  3LMF A;  4IWO A;  4K97 A;  3A98 A;  1SU6 A;  1SU7 A;  1GNL A;  3C7N A;  4JLX A;  4E3C A;  1SU8 A;  1OA0 A;  3D2E A;  4H6I A;  4HY9 A;  1OA1 A;  4EZN A;  1GPJ A;  5TKY A;  4IW0 A;  1UPX A;  3DPP A;  3DPQ A;  5D63 A;  5FLE X;  4JLZ A;  4LEZ A;  3D2F A;  5D62 A;  1DKZ A;  5CFT A;  1DKY A;  3RV1 A;  2EWR A;  4WQL A;  4JNE A;  4EZX A;  4EZU A;  2GAF D;  5CFS A;  3B52 X;  2YI8 A;  4WH5 A;  4KIK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...