3OWGA

Crystal structure of vaccinia virus polyadenylate polymerase(vp55)
Total Genus 133
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
133
sequence length
468
structure length
457
Chain Sequence
NITLKIIETYLGRVPSVNEYHMLKSQARNIQKITVFNKDIFVSLVKKNKKRFFSDVNTSASEIKDRILSYFSKQTQTYNIGKLFTIIELQSVLVTTYTDILGVLTIKAPNVISSKISYNVTSMEELARDMLNSMNVAVVSSLVKNVNKLMEEYLRRHNKSCICYGSYSLYLINPNIRYGDIDILQTNSRTFLIDLAFLIKFITGNNIILSKIPYLRNYMVIKDENDNHIIDSFNIRQDTMNVVPKIFIDNIYIVDPTFQLLNMIKMFSQIDRLEDLSKDPEKFNARMATMLEYVRYTHGIVFDGKRNNMPMKCIIDENNRIVTVTTKDYFSFKKCLVYLDENVLSSDILDLNADTSCDFESVTNSVYLIHDNIMYTYFSNTILLSDKGKVHEISARGLCAHILLYQMLTSGEYKQCLSDLLNSMMNRDKIPIYSHTERDKKPGRHGFINIEKDIIVF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Poly(A) polymerase catalytic subunit
publication title Domain-level rocking motion within a polymerase that translocates on single-stranded nucleic acid.
pubmed doi rcsb
source organism Vaccinia virus wr
molecule tags Transferase
total genus 133
structure length 457
sequence length 468
chains with identical sequence B
ec nomenclature ec 2.7.7.19: Polynucleotide adenylyltransferase.
pdb deposition date 2010-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03296 Pox_polyA_pol Poxvirus poly(A) polymerase nucleotidyltransferase domain
A PF12629 Pox_polyA_pol_C Poxvirus poly(A) polymerase C-terminal domain
A PF12630 Pox_polyA_pol_N Poxvirus poly(A) polymerase N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.320 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Substrate Binding Domain Of Dnak; Chain:A; Domain 2 3owgA01
3.30.460.60 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase; domain 2 3owgA03
2GAFD 3OWGA 3ER8C 3ER9B 2GA9D 3ERCC
chains in the Genus database with same CATH superfamily
4QZBA 2F1BA 1XSPA 1O7DB 4IW0A 2WINM 3VEAA 3RH4A 5CFSA 1KDHA 1ZQCA 4KLOA 2YKTA 4MFAA 3CV5A 3JPSA 4FO1A 4OAFA 4WC7A 5CHGA 8ICZA 3QWEA 4XQ8A 4R5LA 9ICMA 4AZCA 1ZQYA 4I2DA 4UBBA 3RJKA 4FM3A 5D62A 2HHPA 4EGWA 2FYVA 3RPMA 2PXIA 1YLQA 3C66A 1ZQAA 2DR7A 4WC1A 1OA1A 5DEDA 4AZ6A 4UAYA 2PFOA 3RJEA 8ICJA 3DPOA 1RPLA 4RQ8A 8ICBA 4RQ6A 2ZHAA 5J0YA 1R8AA 4S3NA 2BCRA 4Z6FA 5DDMA 4KLUA 2QFFA 4IQUA 4FHPA 4I2AA 4MF8A 4UD4A 4RT2A 4PGQA 2M2WA 1MQ3A 5D49A 1ZQSA 2M2TA 5J2CA 3OVBA 3L3OM 4YCXA 3SYVA 4EZSA 3BUBA 1TQTA 3CZSA 3I01A 4JWIA 2QXLA 3NVOA 4RQ2A 1R8BA 3DDFA 4K4GA 4M9LA 4P4PA 5HRHA 4XJEA 2FMPA 1MIYA 7ICHA 2YLAA 2BBHA 2Z0OA 4YMMA 1HUOA 3HX0A 4X4UA 3B53X 1JQKA 3ISDA 4KLTA 3MCRA 3O3MB 2ZH5A 4FH5A 4YN4A 5HREA 2F7QA 5E84A 4RQ5A 3MDAA 1JAJA 5HHHA 9ICFA 4IG8A 1F5AA 1DKXA 3HJ1A 4WC3A 1HWWA 2V0OA 1ZWWA 4E3CA 3QNIA 1ZQVA 3V7LA 5J2DA 2OW7A 4EZQA 4KM5A 1MIWA 2IHMA 1X03A 4O69A 2FCLA 1ZQOA 1TQVA 7ICGA 7ICPA 3D52A 4M9GA 2ZH1A 2FICA 5HRFA 5D46A 3OUYB 3UQ2A 4RWNA 3T4AG 5B3QA 4O68A 5HRIA 3LLLA 4ATMA 9ICCA 5BPCA 3PMLA 2YL8A 2X5CA 5J2GA 3T46A 3T49A 4I2IA 3WFRE 1JN3A 4R5JA 3L9DA 3PMNA 8ICSA 3EJUA 2B51A 5KBPA 4UAWA 7ICNA 1R5EA 1WOTA 2B4VA 4H8SA 4AZCB 4FHYA 9ICBA 3ISCA 3WFSC 4X4SA 1ZQZA 5TZVA 4HX0A 1ZQBA 3JPPA 3I39X 2RAJA 9ICAA 3RV1A 8ICCA 4R65A 2GA9D 3UPSA 4KLQA 1VJ7A 1PX5A 4HR1A 3C2LA 5HHIA 2QKWA 1BPEA 4M5DA 1BPZA 4I2FA 1ZQRA 1E1DA 3JYYA 7ICEA 8ICKA 3ERCC 2X3VA 2OBLA 3LMFA 4EV6A 4X4PA 3DX3A 1FA0A 3RJGA 9ICRA 1KNYA 1QWUA 4M9JA 9ICNA 4R64A 3AQNA 2PFNA 2DRAA 3MGIA 2PBEA 3EJQA 3K7DA 2W9MA 4QZGA 4K99A 4P4MA 5JTGA 4X4RA 2PFPA 4WC2A 2HN2A 4IQWA 8ICVA 1R34A 4TUSA 4JN4A 4JNEA 1ZQWA 3LQCB 8ICGA 4JWMA 2F18A 4I1QA 5D4BA 1BPYA 5DDYA 2ND0A 2DR8A 4NPHA 9ICJA 4F00A 4EZNA 4MFCA 7ICIA 4FO6A 5CP2A 4H6IA 3OK8A 4M9HA 2F1AA 1GPJA 3QE6A 1E2UA 3ABHA 1U00A 3CKDA 4EEDA 1UEUA 2ID1A 3HW8A 4UB2A 3O3OB 4JNFA 4K9BA 3AQMA 3H3AA 2GWSA 4NY8A 5DECA 4KLDA 3C2KA 3BVVA 5B3PA 3DX4A 4JLZA 1SU7A 4IM2A 7ICKA 1HXKA 3AU2A 3H37A 5J2FA 1TQWA 1XSLA 1E9VA 4FHXA 5HR9A 4X4NA 1YWMA 2EFLA 4NXXA 7ICJA 4E7XA 3B0YA 4DYLA 4WQLA 4UDXX 4R5GA 4K8VA 4NXWA 3C7NA 5TKYA 9ICPA 3ACOA 4OAGA 4K4HA 5J2IA 4UAZA 4DO9A 4NKTA 2ISPA 4F5QA 2YIVX 4UB4A 4KLEA 3RV0A 3I04A 9ICHA 3MDCA 4NXUA 1ZQUA 4FZOA 1ZJMA 1ZQDA 4R5IA 2FMQA 8ICLA 3HAHA 9ICGA 4KLHA 3C2MA 3V7JA 4EBKA 4I2HA 4B9QA 3JPQA 1ZQTA 3UQ0A 4RQ7A 2PFQA 2BCVA 3AUOA 4Z6EA 4NLKA 3GDXA 5BOMA 4PHEA 4M9NA 5J0QA 4R66A 2M2UA 2OO2A 2WYHA 2ZH8A 4EZXA 2BE3A 4HR1B 3CZNA 2EFKA 2BPCA 9ICLA 4E80A 3UITA 4BNEA 1ZQPA 4M0MA 4NXVA 3B52X 4HYBA 4AZ7A 3M3WA 5C5BB 5IIJA 4X4VA 4F5PA 5DB8A 2F7OA 5IIIA 3EF2A 1UPXA 1ZQQA 2GAFD 4XQ7A 4N7RA 3DPQA 2Q12A 9ICKA 2PMRA 1W9MA 4WOYA 8ICMA 4I2JA 2O1PA 2DR9A 4KLIA 4UD5A 3KAWA 4IM0A 4QZHA 3O3NB 4Z6CA 3JPNA 1JQRA 5IIKA 1ZQNA 4WCWA 4LEVA 3LK9A 5CWRA 3BVWA 2IHOA 4M0AA 3CVRA 3OGUA 1SU8A 2OZNB 2DRBA 4I2GA 7ICVA 2ND1A 4EZOA 4TUQA 4WC0A 4I2BA 4MKPA 2D1LA 4KLMA 3NWIA 8ICTA 5FLEX 4I28A 3DX2A 3DPPA 1VFGA 2FMSA 4RWOA 1MQ2A 9ICVA 3T48A 3VEBA 3TFRA 3HJ4A 2ZH3A 5D63A 4MFFA 4EZVA 1JMSA 4KB6A 2JNKA 4I27A 2WYIA 4WBZA 1DKZA 4LEWA 4QZIA 8ICIA 3RH6A 1ZQKA 4KLSA 3JCFA 4IQTA 3NKUA 4UB3A 9ICSA 2VANA 4QZ9A 2YLLA 2Z0VA 4Z6DA 5J0RA 7ICMA 1DKYA 4PHAA 5J0WA 2PY6A 1TVAA 4OAHA 4EZRA 4PHDA 3G9GA 3WFQE 3GI7A 1ZQMA 4RPYA 8ICFA 3DX1A 2HN1A 4IWOA 4R5KA 1NO5A 5J2HA 2DVIA 4EZPA 2BCSA 4K96A 5C5BA 4I2CA 4H6HA 1ZQIA 4LVSA 3OV7A 4G6QA 4NLZA 4WC6A 4AVMA 2EWFA 2NCZA 4KLLA 2YL5A 2YI9A 4EP7A 8ICYA 4FZSA 4JL9A 4QZCA 5HRDA 3B51X 8ICOA 2I9GA 4GXKA 4JLCA 3D4YA 3RH5A 2RFFA 7ICFA 8ICAA 1ZYLA 3DX0A 1OAOA 5J0PA 4FZPA 3RJFA 3BLBA 3WFPA 1PS3A 2Z0NA 4LZDA 1ZQGA 4QZFA 3AU6A 1R89A 2BCUA 4I0UA 5J2BA 4OAIZ 4XRHA 3KDRA 4X0BA 3K75D 4WC5A 4UB1A 4DCNC 4WQKA 1BPDA 4YMNA 4AT9A 8ICRA 3VKHA 3EJPA 1I4DA 2Z8YA 5BOLA 4QZEA 3PHZA 4XA5A 3D51A 8ICHA 4NLNA 3LVTA 2EX3B 3OWGA 3ISBA 1HUZA 4K9AA 4RQ4A 9ICWA 4WC4A 4PPXA 9ICUA 4IM3A 4NM2A 3BUQA 4JWDA 4P2HA 8ICEA 5DBBA 3DDGA 4EEBA 4WPCA 3BUIA 3EJTA 9ICXA 4JWCA 3BUPA 4P4OA 1ZJNA 2D4CA 1QWNA 4YD2A 3A98A 2EWRA 7ICOA 4O5EA 1BPBA 1ZQHA 2NRKA 4FHVA 1NOMA 5D61A 4DOAA 4GXIA 1SUFA 3OHXM 5J0SA 4TURA 1X04A 5J2JA 2ZH9A 4X5VA 1ZQEA 9ICOA 1SU6A 3D2EA 4JWNA 2ALWA 4UBCA 4AT7B 4EZWA 4TUPA 2ZH7A 4LEZA 4M04A 5HRKA 3EJRA 1TV9A 4NM1A 4PGXA 2MI7A 5CFUA 5DB9A 3H38A 5EOZA 1MJGA 5J0OA 3BUDA 4EZUA 2RT6A 3UXNA 4YD1A 2DR5A 4K4IA 4QZAA 3RJHA 2YL9A 5F2VO 8ICWA 2LXYA 4AKVA 4LEYA 4O9MA 2YI8A 1ZQJA 4EBJA 1OA0A 4NXTA 5DBAA 2C08A 1TQUA 3HAIA 3SOGA 4EZZA 3NYBA 2BCQA 1R33A 2ELBA 1I4LA 2ISOA 4M47A 4UDYX 1UETA 5IIOA 3UPQA 3HIYA 4AT8B 2M2VA 4FHWA 3TFSA 9ICQA 2Q66A 5J0TA 5FIGA 4JWEA 3C5GA 9ICIA 5J0XA 3ZEDA 4KIKA 2GF4A 3F7WA 4F5OA 3RJIA 5DKWA 4X4QA 4PHPA 2P66A 4E81A 1HTYA 3EJSA 3UXOA 4K98A 1TFYA 4AZBA 1LQ7A 3OVAA 1I4TA 4NQIA 3D50A 5J29A 8ICQA 4GXJA 4QZDA 1TQSA 3BVUA 2F7RA 1GN9A 2ZH4A 3ER9B 3CK6A 3FD9A 1TFWA 2LM0A 4QZ8A 3JPTA 4KLGA 4D8JA 8ICXA 4RQ0A 3DYTA 7ICLA 3Q84A 4YMOA 4AT9B 7ICQA 2YIAA 4KLJA 4WH5A 1Q78A 3UXPA 4IWPA 5HRGA 4HY9A 5HRLA 4PO2A 4DOBA 4EZYA 3HAJA 3PLTA 1KEJA 4I2EA 4ATBB 4AT7A 4AZHA 4EZTA 1ZQFA 4NKUA 1GNTA 5IINA 2YL6A 3AQKA 4E8FA 1R8CA 2IUBA 3C5FA 5IILA 4RQ1A 4O67A 3QNJA 5HRBA 2ZH2A 4AZGA 4RT3A 4PGYA 5DB6A 5CJ7A 4FH3A 4X4OA 4M2YA 2YIBA 3AQLA 4RPXA 3JPRA 1ZQXA 5HC9A 1XSNA 2ZXQA 2X3XA 2OW6A 4F5RA 2Q13A 1MIVA 1OU5A 3CAZA 4UB5A 4DOCA 8ICUA 4MF2A 8ICPA 7ICTA 4AT8A 9ICTA 3V72A 1URUA 4I29A 3WFOA 3JPOA 1WDZA 4IWQA 5J2EA 5J2AA 3KAVA 4IQVA 4LT6A 5DB7A 4NXZA 4RPZA 4X4TA 3PNCA 2BPFA 1GNLA 4KLFA 2N3KA 4PH5A 2RAIA 4O5CA 5CR0A 2O0I1 9ICEA 2BBJA 5CFTA 5CA7A 3HWTA 5J0UA 1UEVA 4F01A 4RWQA 3B0XA 5J2KA 4AZIA 4K97A 4X0AA 3OVSA 4RQ3A 7ICUA 4R63A 1RZTA 4RWPA 2OBMA 1Y2OA 2BPGA 4AZ5A 3MGHA 4O6AA 1O7DC 3V7KA 1QX1A 2ZH6A 1ZQLA 1BPXA 3I2WA 3RJJA 4LZGA 3T47A 5CHEA 2X3WA 4ATBA 3QA8A 8ICNA 3BVXA 7ICSA 2KHOA 4KIKB 1Q79A 3C18A 3JZ0A 5DBCA 4WPEA 3H39A 1V4AA 2ZHBA 1I49A 4NSWA 5CB1A 5IIMA 3D4ZA 3L3PA 3OUYA 4JLXA 2RAKA 3D2FA 3MBYA 4O5KA 2B56A 4XUSA 2O5AA 7ICRA 4F5NA 3BVTA 3Q0KA 3ER8C 4WBYA 2F7PA 2JNSA
chains in the Genus database with same CATH topology
4NXTA 2OBLA 3LMFA 4EZZA 5FLEX 4IW0A 2WINM 3DPPA 3VEAA 5CFSA 4UDYX 3T48A 3VEBA 5FIGA 4FO1A 4OAFA 4JWEA 5D63A 4EZVA 3K7DA 4R5LA 4KB6A 3ZEDA 4FM3A 4K99A 5D62A 2ND1A 4KIKA 1DKZA 3F7WA 4LEWA 4JN4A 4JNEA 4E81A 3NKUA 4K98A 1OA1A 2ND0A 4NPHA 1DKYA 4F00A 4EZNA 2PY6A 3DPOA 4OAHA 4EZRA 4H6IA 1GPJA 3GI7A 1E2UA 1GN9A 1U00A 3ER9B 3FD9A 2LM0A 3O3OB 4IWOA 2QFFA 4JNFA 4R5KA 4EZPA 4K9BA 4D8JA 4K96A 4H6HA 2YIAA 5B3PA 4WH5A 4JLZA 4G6QA 4IWPA 1SU7A 4HY9A 4IM2A 3L3OM 2EWFA 2NCZA 4PO2A 4EZYA 4EZSA 2YI9A 1E9VA 4JL9A 3B51X 4JWIA 3I01A 4EZTA 1GNTA 4NXXA 4JLCA 2QXLA 3ERCC 4WQLA 1ZYLA 4UDXX 1OAOA 4R5GA 3QNJA 4K8VA 3C7NA 4NXWA 4O67A 5TKYA 4XJEA 4OAGA 2YIBA 4OAIZ 3KDRA 2YIVX 3RV0A 3B53X 3I04A 1JQKA 4WQKA 4NXUA 3MCRA 3O3MB 3VKHA 2Z8YA 4R5IA 5E84A 3PHZA 4IWQA 1DKXA 2EX3B 3OWGA 3KAVA 4B9QA 4K9AA 4E3CA 1GNLA 4EZQA 4IM3A 4KM5A 2N3KA 4JWDA 4O69A 2FCLA 5CFTA 4EZXA 4JWCA 4HR1B 3T4AG 4F01A 5B3QA 4O68A 4K97A 3UITA 2X5CA 3A98A 2OBMA 2EWRA 4M0MA 3T46A 4NXVA 3B52X 4HYBA 3T49A 5D61A 4O6AA 4R5JA 1SUFA 1UPXA 3OHXM 3EF2A 2B51A 2GAFD 4N7RA 3DPQA 3T47A 2B4VA 5CHEA 1W9MA 4WOYA 1SU6A 3D2EA 3QA8A 2KHOA 4EZWA 4KIKB 4LEZA 4HX0A 3I39X 3KAWA 4IM0A 3RV1A 5CFUA 3O3NB 1MJGA 2GA9D 4EZUA 2RT6A 4JLXA 4HR1A 4LEVA 3D2FA 2IHOA 2B56A 1SU8A 3ER8C 4LEYA 1E1DA 2YI8A 4EZOA 1OA0A 2JNSA 4MKPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GAF D;  3OWG A;  3ER8 C;  3ER9 B;  2GA9 D;  3ERC C; 
#chains in the Genus database with same CATH topology
 4QZB A;  2F1B A;  1XSP A;  1O7D B;  4IW0 A;  2WIN M;  3VEA A;  3RH4 A;  5CFS A;  1KDH A;  1ZQC A;  4KLO A;  2YKT A;  4MFA A;  3CV5 A;  3JPS A;  4FO1 A;  4OAF A;  4WC7 A;  5CHG A;  8ICZ A;  3QWE A;  4XQ8 A;  4R5L A;  9ICM A;  4AZC A;  1ZQY A;  4I2D A;  4UBB A;  3RJK A;  4FM3 A;  5D62 A;  2HHP A;  4EGW A;  2FYV A;  3RPM A;  2PXI A;  1YLQ A;  3C66 A;  1ZQA A;  2DR7 A;  4WC1 A;  1OA1 A;  5DED A;  4AZ6 A;  4UAY A;  2PFO A;  3RJE A;  8ICJ A;  3DPO A;  1RPL A;  4RQ8 A;  8ICB A;  4RQ6 A;  2ZHA A;  5J0Y A;  1R8A A;  4S3N A;  2BCR A;  4Z6F A;  5DDM A;  4KLU A;  2QFF A;  4IQU A;  4FHP A;  4I2A A;  4MF8 A;  4UD4 A;  4RT2 A;  4PGQ A;  2M2W A;  1MQ3 A;  5D49 A;  1ZQS A;  2M2T A;  5J2C A;  3OVB A;  3L3O M;  4YCX A;  3SYV A;  4EZS A;  3BUB A;  1TQT A;  3CZS A;  3I01 A;  4JWI A;  2QXL A;  3NVO A;  4RQ2 A;  1R8B A;  3DDF A;  4K4G A;  4M9L A;  4P4P A;  5HRH A;  4XJE A;  2FMP A;  1MIY A;  7ICH A;  2YLA A;  2BBH A;  2Z0O A;  4YMM A;  1HUO A;  3HX0 A;  4X4U A;  3B53 X;  1JQK A;  3ISD A;  4KLT A;  3MCR A;  3O3M B;  2ZH5 A;  4FH5 A;  4YN4 A;  5HRE A;  2F7Q A;  5E84 A;  4RQ5 A;  3MDA A;  1JAJ A;  5HHH A;  9ICF A;  4IG8 A;  1F5A A;  1DKX A;  3HJ1 A;  4WC3 A;  1HWW A;  2V0O A;  1ZWW A;  4E3C A;  3QNI A;  1ZQV A;  3V7L A;  5J2D A;  2OW7 A;  4EZQ A;  4KM5 A;  1MIW A;  2IHM A;  1X03 A;  4O69 A;  2FCL A;  1ZQO A;  1TQV A;  7ICG A;  7ICP A;  3D52 A;  4M9G A;  2ZH1 A;  2FIC A;  5HRF A;  5D46 A;  3OUY B;  3UQ2 A;  4RWN A;  3T4A G;  5B3Q A;  4O68 A;  5HRI A;  3LLL A;  4ATM A;  9ICC A;  5BPC A;  3PML A;  2YL8 A;  2X5C A;  5J2G A;  3T46 A;  3T49 A;  4I2I A;  3WFR E;  1JN3 A;  4R5J A;  3L9D A;  3PMN A;  8ICS A;  3EJU A;  2B51 A;  5KBP A;  4UAW A;  7ICN A;  1R5E A;  1WOT A;  2B4V A;  4H8S A;  4AZC B;  4FHY A;  9ICB A;  3ISC A;  3WFS C;  4X4S A;  1ZQZ A;  5TZV A;  4HX0 A;  1ZQB A;  3JPP A;  3I39 X;  2RAJ A;  9ICA A;  3RV1 A;  8ICC A;  4R65 A;  2GA9 D;  3UPS A;  4KLQ A;  1VJ7 A;  1PX5 A;  4HR1 A;  3C2L A;  5HHI A;  2QKW A;  1BPE A;  4M5D A;  1BPZ A;  4I2F A;  1ZQR A;  1E1D A;  3JYY A;  7ICE A;  8ICK A;  3ERC C;  2X3V A;  2OBL A;  3LMF A;  4EV6 A;  4X4P A;  3DX3 A;  1FA0 A;  3RJG A;  9ICR A;  1KNY A;  1QWU A;  4M9J A;  9ICN A;  4R64 A;  3AQN A;  2PFN A;  2DRA A;  3MGI A;  2PBE A;  3EJQ A;  3K7D A;  2W9M A;  4QZG A;  4K99 A;  4P4M A;  5JTG A;  4X4R A;  2PFP A;  4WC2 A;  2HN2 A;  4IQW A;  8ICV A;  1R34 A;  4TUS A;  4JN4 A;  4JNE A;  1ZQW A;  3LQC B;  8ICG A;  4JWM A;  2F18 A;  4I1Q A;  5D4B A;  1BPY A;  5DDY A;  2ND0 A;  2DR8 A;  4NPH A;  9ICJ A;  4F00 A;  4EZN A;  4MFC A;  7ICI A;  4FO6 A;  5CP2 A;  4H6I A;  3OK8 A;  4M9H A;  2F1A A;  1GPJ A;  3QE6 A;  1E2U A;  3ABH A;  1U00 A;  3CKD A;  4EED A;  1UEU A;  2ID1 A;  3HW8 A;  4UB2 A;  3O3O B;  4JNF A;  4K9B A;  3AQM A;  3H3A A;  2GWS A;  4NY8 A;  5DEC A;  4KLD A;  3C2K A;  3BVV A;  5B3P A;  3DX4 A;  4JLZ A;  1SU7 A;  4IM2 A;  7ICK A;  1HXK A;  3AU2 A;  3H37 A;  5J2F A;  1TQW A;  1XSL A;  1E9V A;  4FHX A;  5HR9 A;  4X4N A;  1YWM A;  2EFL A;  4NXX A;  7ICJ A;  4E7X A;  3B0Y A;  4DYL A;  4WQL A;  4UDX X;  4R5G A;  4K8V A;  4NXW A;  3C7N A;  5TKY A;  9ICP A;  3ACO A;  4OAG A;  4K4H A;  5J2I A;  4UAZ A;  4DO9 A;  4NKT A;  2ISP A;  4F5Q A;  2YIV X;  4UB4 A;  4KLE A;  3RV0 A;  3I04 A;  9ICH A;  3MDC A;  4NXU A;  1ZQU A;  4FZO A;  1ZJM A;  1ZQD A;  4R5I A;  2FMQ A;  8ICL A;  3HAH A;  9ICG A;  4KLH A;  3C2M A;  3V7J A;  4EBK A;  4I2H A;  4B9Q A;  3JPQ A;  1ZQT A;  3UQ0 A;  4RQ7 A;  2PFQ A;  2BCV A;  3AUO A;  4Z6E A;  4NLK A;  3GDX A;  5BOM A;  4PHE A;  4M9N A;  5J0Q A;  4R66 A;  2M2U A;  2OO2 A;  2WYH A;  2ZH8 A;  4EZX A;  2BE3 A;  4HR1 B;  3CZN A;  2EFK A;  2BPC A;  9ICL A;  4E80 A;  3UIT A;  4BNE A;  1ZQP A;  4M0M A;  4NXV A;  3B52 X;  4HYB A;  4AZ7 A;  3M3W A;  5C5B B;  5IIJ A;  4X4V A;  4F5P A;  5DB8 A;  2F7O A;  5III A;  3EF2 A;  1UPX A;  1ZQQ A;  2GAF D;  4XQ7 A;  4N7R A;  3DPQ A;  2Q12 A;  9ICK A;  2PMR A;  1W9M A;  4WOY A;  8ICM A;  4I2J A;  2O1P A;  2DR9 A;  4KLI A;  4UD5 A;  3KAW A;  4IM0 A;  4QZH A;  3O3N B;  4Z6C A;  3JPN A;  1JQR A;  5IIK A;  1ZQN A;  4WCW A;  4LEV A;  3LK9 A;  5CWR A;  3BVW A;  2IHO A;  4M0A A;  3CVR A;  3OGU A;  1SU8 A;  2OZN B;  2DRB A;  4I2G A;  7ICV A;  2ND1 A;  4EZO A;  4TUQ A;  4WC0 A;  4I2B A;  4MKP A;  2D1L A;  4KLM A;  3NWI A;  8ICT A;  5FLE X;  4I28 A;  3DX2 A;  3DPP A;  1VFG A;  2FMS A;  4RWO A;  1MQ2 A;  9ICV A;  3T48 A;  3VEB A;  3TFR A;  3HJ4 A;  2ZH3 A;  5D63 A;  4MFF A;  4EZV A;  1JMS A;  4KB6 A;  2JNK A;  4I27 A;  2WYI A;  4WBZ A;  1DKZ A;  4LEW A;  4QZI A;  8ICI A;  3RH6 A;  1ZQK A;  4KLS A;  3JCF A;  4IQT A;  3NKU A;  4UB3 A;  9ICS A;  2VAN A;  4QZ9 A;  2YLL A;  2Z0V A;  4Z6D A;  5J0R A;  7ICM A;  1DKY A;  4PHA A;  5J0W A;  2PY6 A;  1TVA A;  4OAH A;  4EZR A;  4PHD A;  3G9G A;  3WFQ E;  3GI7 A;  1ZQM A;  4RPY A;  8ICF A;  3DX1 A;  2HN1 A;  4IWO A;  4R5K A;  1NO5 A;  5J2H A;  2DVI A;  4EZP A;  2BCS A;  4K96 A;  5C5B A;  4I2C A;  4H6H A;  1ZQI A;  4LVS A;  3OV7 A;  4G6Q A;  4NLZ A;  4WC6 A;  4AVM A;  2EWF A;  2NCZ A;  4KLL A;  2YL5 A;  2YI9 A;  4EP7 A;  8ICY A;  4FZS A;  4JL9 A;  4QZC A;  5HRD A;  3B51 X;  8ICO A;  2I9G A;  4GXK A;  4JLC A;  3D4Y A;  3RH5 A;  2RFF A;  7ICF A;  8ICA A;  1ZYL A;  3DX0 A;  1OAO A;  5J0P A;  4FZP A;  3RJF A;  3BLB A;  3WFP A;  1PS3 A;  2Z0N A;  4LZD A;  1ZQG A;  4QZF A;  3AU6 A;  1R89 A;  2BCU A;  4I0U A;  5J2B A;  4OAI Z;  4XRH A;  3KDR A;  4X0B A;  3K75 D;  4WC5 A;  4UB1 A;  4DCN C;  4WQK A;  1BPD A;  4YMN A;  4AT9 A;  8ICR A;  3VKH A;  3EJP A;  1I4D A;  2Z8Y A;  5BOL A;  4QZE A;  3PHZ A;  4XA5 A;  3D51 A;  8ICH A;  4NLN A;  3LVT A;  2EX3 B;  3OWG A;  3ISB A;  1HUZ A;  4K9A A;  4RQ4 A;  9ICW A;  4WC4 A;  4PPX A;  9ICU A;  4IM3 A;  4NM2 A;  3BUQ A;  4JWD A;  4P2H A;  8ICE A;  5DBB A;  3DDG A;  4EEB A;  4WPC A;  3BUI A;  3EJT A;  9ICX A;  4JWC A;  3BUP A;  4P4O A;  1ZJN A;  2D4C A;  1QWN A;  4YD2 A;  3A98 A;  2EWR A;  7ICO A;  4O5E A;  1BPB A;  1ZQH A;  2NRK A;  4FHV A;  1NOM A;  5D61 A;  4DOA A;  4GXI A;  1SUF A;  3OHX M;  5J0S A;  4TUR A;  1X04 A;  5J2J A;  2ZH9 A;  4X5V A;  1ZQE A;  9ICO A;  1SU6 A;  3D2E A;  4JWN A;  2ALW A;  4UBC A;  4AT7 B;  4EZW A;  4TUP A;  2ZH7 A;  4LEZ A;  4M04 A;  5HRK A;  3EJR A;  1TV9 A;  4NM1 A;  4PGX A;  2MI7 A;  5CFU A;  5DB9 A;  3H38 A;  5EOZ A;  1MJG A;  5J0O A;  3BUD A;  4EZU A;  2RT6 A;  3UXN A;  4YD1 A;  2DR5 A;  4K4I A;  4QZA A;  3RJH A;  2YL9 A;  5F2V O;  8ICW A;  2LXY A;  4AKV A;  4LEY A;  4O9M A;  2YI8 A;  1ZQJ A;  4EBJ A;  1OA0 A;  4NXT A;  5DBA A;  2C08 A;  1TQU A;  3HAI A;  3SOG A;  4EZZ A;  3NYB A;  2BCQ A;  1R33 A;  2ELB A;  1I4L A;  2ISO A;  4M47 A;  4UDY X;  1UET A;  5IIO A;  3UPQ A;  3HIY A;  4AT8 B;  2M2V A;  4FHW A;  3TFS A;  9ICQ A;  2Q66 A;  5J0T A;  5FIG A;  4JWE A;  3C5G A;  9ICI A;  5J0X A;  3ZED A;  4KIK A;  2GF4 A;  3F7W A;  4F5O A;  3RJI A;  5DKW A;  4X4Q A;  4PHP A;  2P66 A;  4E81 A;  1HTY A;  3EJS A;  3UXO A;  4K98 A;  1TFY A;  4AZB A;  1LQ7 A;  3OVA A;  1I4T A;  4NQI A;  3D50 A;  5J29 A;  8ICQ A;  4GXJ A;  4QZD A;  1TQS A;  3BVU A;  2F7R A;  1GN9 A;  2ZH4 A;  3ER9 B;  3CK6 A;  3FD9 A;  1TFW A;  2LM0 A;  4QZ8 A;  3JPT A;  4KLG A;  4D8J A;  8ICX A;  4RQ0 A;  3DYT A;  7ICL A;  3Q84 A;  4YMO A;  4AT9 B;  7ICQ A;  2YIA A;  4KLJ A;  4WH5 A;  1Q78 A;  3UXP A;  4IWP A;  5HRG A;  4HY9 A;  5HRL A;  4PO2 A;  4DOB A;  4EZY A;  3HAJ A;  3PLT A;  1KEJ A;  4I2E A;  4ATB B;  4AT7 A;  4AZH A;  4EZT A;  1ZQF A;  4NKU A;  1GNT A;  5IIN A;  2YL6 A;  3AQK A;  4E8F A;  1R8C A;  2IUB A;  3C5F A;  5IIL A;  4RQ1 A;  4O67 A;  3QNJ A;  5HRB A;  2ZH2 A;  4AZG A;  4RT3 A;  4PGY A;  5DB6 A;  5CJ7 A;  4FH3 A;  4X4O A;  4M2Y A;  2YIB A;  3AQL A;  4RPX A;  3JPR A;  1ZQX A;  5HC9 A;  1XSN A;  2ZXQ A;  2X3X A;  2OW6 A;  4F5R A;  2Q13 A;  1MIV A;  1OU5 A;  3CAZ A;  4UB5 A;  4DOC A;  8ICU A;  4MF2 A;  8ICP A;  7ICT A;  4AT8 A;  9ICT A;  3V72 A;  1URU A;  4I29 A;  3WFO A;  3JPO A;  1WDZ A;  4IWQ A;  5J2E A;  5J2A A;  3KAV A;  4IQV A;  4LT6 A;  5DB7 A;  4NXZ A;  4RPZ A;  4X4T A;  3PNC A;  2BPF A;  1GNL A;  4KLF A;  2N3K A;  4PH5 A;  2RAI A;  4O5C A;  5CR0 A;  2O0I 1;  9ICE A;  2BBJ A;  5CFT A;  5CA7 A;  3HWT A;  5J0U A;  1UEV A;  4F01 A;  4RWQ A;  3B0X A;  5J2K A;  4AZI A;  4K97 A;  4X0A A;  3OVS A;  4RQ3 A;  7ICU A;  4R63 A;  1RZT A;  4RWP A;  2OBM A;  1Y2O A;  2BPG A;  4AZ5 A;  3MGH A;  4O6A A;  1O7D C;  3V7K A;  1QX1 A;  2ZH6 A;  1ZQL A;  1BPX A;  3I2W A;  3RJJ A;  4LZG A;  3T47 A;  5CHE A;  2X3W A;  4ATB A;  3QA8 A;  8ICN A;  3BVX A;  7ICS A;  2KHO A;  4KIK B;  1Q79 A;  3C18 A;  3JZ0 A;  5DBC A;  4WPE A;  3H39 A;  1V4A A;  2ZHB A;  1I49 A;  4NSW A;  5CB1 A;  5IIM A;  3D4Z A;  3L3P A;  3OUY A;  4JLX A;  2RAK A;  3D2F A;  3MBY A;  4O5K A;  2B56 A;  4XUS A;  2O5A A;  7ICR A;  4F5N A;  3BVT A;  3Q0K A;  3ER8 C;  4WBY A;  2F7P A;  2JNS A; 
#chains in the Genus database with same CATH homology
 4NXT A;  2OBL A;  3LMF A;  4EZZ A;  5FLE X;  4IW0 A;  2WIN M;  3DPP A;  3VEA A;  5CFS A;  4UDY X;  3T48 A;  3VEB A;  5FIG A;  4FO1 A;  4OAF A;  4JWE A;  5D63 A;  4EZV A;  3K7D A;  4R5L A;  4KB6 A;  3ZED A;  4FM3 A;  4K99 A;  5D62 A;  2ND1 A;  4KIK A;  1DKZ A;  3F7W A;  4LEW A;  4JN4 A;  4JNE A;  4E81 A;  3NKU A;  4K98 A;  1OA1 A;  2ND0 A;  4NPH A;  1DKY A;  4F00 A;  4EZN A;  2PY6 A;  3DPO A;  4OAH A;  4EZR A;  4H6I A;  1GPJ A;  3GI7 A;  1E2U A;  1GN9 A;  1U00 A;  3ER9 B;  3FD9 A;  2LM0 A;  3O3O B;  4IWO A;  2QFF A;  4JNF A;  4R5K A;  4EZP A;  4K9B A;  4D8J A;  4K96 A;  4H6H A;  2YIA A;  5B3P A;  4WH5 A;  4JLZ A;  4G6Q A;  4IWP A;  1SU7 A;  4HY9 A;  4IM2 A;  3L3O M;  2EWF A;  2NCZ A;  4PO2 A;  4EZY A;  4EZS A;  2YI9 A;  1E9V A;  4JL9 A;  3B51 X;  4JWI A;  3I01 A;  4EZT A;  1GNT A;  4NXX A;  4JLC A;  2QXL A;  3ERC C;  4WQL A;  1ZYL A;  4UDX X;  1OAO A;  4R5G A;  3QNJ A;  4K8V A;  3C7N A;  4NXW A;  4O67 A;  5TKY A;  4XJE A;  4OAG A;  2YIB A;  4OAI Z;  3KDR A;  2YIV X;  3RV0 A;  3B53 X;  3I04 A;  1JQK A;  4WQK A;  4NXU A;  3MCR A;  3O3M B;  3VKH A;  2Z8Y A;  4R5I A;  5E84 A;  3PHZ A;  4IWQ A;  1DKX A;  2EX3 B;  3OWG A;  3KAV A;  4B9Q A;  4K9A A;  4E3C A;  1GNL A;  4EZQ A;  4IM3 A;  4KM5 A;  2N3K A;  4JWD A;  4O69 A;  2FCL A;  5CFT A;  4EZX A;  4JWC A;  4HR1 B;  3T4A G;  4F01 A;  5B3Q A;  4O68 A;  4K97 A;  3UIT A;  2X5C A;  3A98 A;  2OBM A;  2EWR A;  4M0M A;  3T46 A;  4NXV A;  3B52 X;  4HYB A;  3T49 A;  5D61 A;  4O6A A;  4R5J A;  1SUF A;  1UPX A;  3OHX M;  3EF2 A;  2B51 A;  2GAF D;  4N7R A;  3DPQ A;  3T47 A;  2B4V A;  5CHE A;  1W9M A;  4WOY A;  1SU6 A;  3D2E A;  3QA8 A;  2KHO A;  4EZW A;  4KIK B;  4LEZ A;  4HX0 A;  3I39 X;  3KAW A;  4IM0 A;  3RV1 A;  5CFU A;  3O3N B;  1MJG A;  2GA9 D;  4EZU A;  2RT6 A;  4JLX A;  4HR1 A;  4LEV A;  3D2F A;  2IHO A;  2B56 A;  1SU8 A;  3ER8 C;  4LEY A;  1E1D A;  2YI8 A;  4EZO A;  1OA0 A;  2JNS A;  4MKP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...