3OWUA

Crystal structure of ketosteroid isomerase d40n/c69s/c81s/c97s/f86c-cn from p. putida with bound equilenin
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
129
structure length
128
Chain Sequence
NLPTAQEVQGLMARYIELVDVGDIEAIVQMYADDATVENPFGQPPIHGREQIAAFYRQGLGGGKVRASLTGPVRASHNGSGAMPRVEMVWNGQPSALDVIDVMRFDEHGRIQTMQAYWSEVNLSVREP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Steroid Delta-isomerase
publication title Quantitative, directional measurement of electric field heterogeneity in the active site of ketosteroid isomerase.
pubmed doi rcsb
source organism Pseudomonas putida
molecule tags Isomerase
total genus 35
structure length 128
sequence length 129
chains with identical sequence B, C, D
ec nomenclature ec 5.3.3.1: Steroid Delta-isomerase.
pdb deposition date 2010-09-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12680 SnoaL_2 SnoaL-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3owuA00
5KP1A 5IEOA 4U13A 4J8TA 4FCMA 3CNMA 3KKGA 3LZAA 3F9SA 3S5CA 4LEHA 2B24B 5AEWB 2YFJB 3EHCA 3MG3A 5DREA 4HM3B 3F7XA 1GY5A 5BVBA 2RFRA 3FSDA 5KP3A 3SOAA 3EBTA 3EBYA 2F86B 2BNGA 3ECFA 4I4KA 4X2HA 4IIAA 3OX9A 4XBYA 1JB2A 4HM7B 1NDOB 1E97A 2F98A 1NWWA 2HMOB 3FF2A 3JUOA 1O7WB 2XR8B 3JUNA 3T8UA 1W01A 1OH0A 4XM4A 4RZMA 1OHPA 2BMOB 3A76A 5IERA 3OWYA 3I0YA 1O7NB 2W2CA 3HK4A 3HZPA 2GEXA 1JKGA 3EF8A 1ULJB 3EN1B 3GRDA 1JB5A 3CPOA 2GBXB 1CQSA 3KE7A 2UX0A 5KP4A 2JQ5A 3MG1A 3JUQA 3ROBA 5AI1A 4ORLA 3GZBA 3DMCA 5IG5A 1JB4A 4XBXA 1K41A 3B7CA 4XBTA 6STDA 3DUKA 4STDA 5JPPA 3B4PA 1ASKA 4HZ9B 5IG3A 1BUQA 3GZRA 1GS3A 2F99A 3FZWA 1EA2A 1Z1SA 5JPUA 3EJVA 3F8HA 1E3VA 4FCJA 3NUVA 5CK6A 5AIIA 4J9AA 1JN5A 3FGYA 3HX8A 3MYTA 4WWUC 2A15A 1SJWA 3E99A 5BXQA 2OWPA 1GY6A 8CHOA 4R9KA 3EX9A 4X2OA 3FKAA 3Q90A 4H3UA 3KSPA 1UUVB 2BMRB 3EQQB 2Z76A 4R9LA 2XSHB 4HM5B 4Q53A 2B1XB 2GBWB 3FF0A 1W00A 4WYKA 1OHSA 4N3VA 3DM8A 3MKIA 1ZX2A 1ISKA 1IDPA 4HJLB 4OUQA 1DMMA 1JN5B 2BMQB 4HM4B 1UUWB 1OHOA 5DRVA 2XSOB 3T8NA 5IENA 1A2KA 2STDA 3NM2A 1U5OA 4HZBB 3BB9A 5CLKA 3RGAA 3DZLA 3STDA 4LMIA 1OPYA 2I9WA 3MHEA 5G2GA 1QJGA 3F14A 4CDLA 2CHCA 3UNLA 1O7HB 3B4OA 2PZVA 3RGRA 3EN8A 2YFLB 3F8XA 3NBRA 3GZYB 3WMDA 3M8CA 2R4IA 4HKVB 3BLZA 1EG9B 3IPTA 7STDA 1DMQA 3CU3A 4L7KA 3D9RA 3NXJA 4XDVA 5D83A 1Q42A 2GEYA 2QGUA 1GY7A 2Z7AA 1TP6A 3G8ZA 1O7GB 1ULIB 3OWSA 5CXOA 1JKGB 3KZTA 4PEJA 3SEDA 1OF5A 1Q40A 1STDA 4OVMA 3K0ZA 5IG4A 3DXOA 4HM8B 4K1VA 1NU3A 3MG2A 4L8OA 2QIYA 5HGRA 1ZO2A 2CKFB 1DMNA 3K7CA 5TGNA 1QMAA 1TUHA 1OCVA 4HM6B 3EC9A 1W02A 4MJDA 3OV4A 4HM0B 3F40A 4HVNA 4XDWA 3H51A 1HKXA 3GZXB 3NV0A 5FW5A 1OF5B 1Q40B 1W6YA 4HM1B 5IG0A 4L8PA 4R1KA 4XB5A 3G0KA 4GB5A 2HMJB 1C7HA 3CNXA 5IEPA 3ER7A 2INXA 3VSYA 4WP5A 1O7PB 3VGNA 5EVHA 2Z77A 3FLJA 5D81A 1S5AA 3F7SA 4K1UA 2HMKB 2YFIB 3SOYA 4WYKB 3MSOA 3UJMA 5AIGA 2K54A 2RCDA 3B8LA 2HMMB 3NV0B 1WQLB 2HMNB 1OUNA 3H3HA 4LGQA 3GWRA 3G16A 3JUMA 2HMLB 1VZZA 1OGXA 2RGQA 1GYBA 1E3RA 3NHXA 2XRXB 5CF1A 2IMJA 3OWUA 2GXFA 3FH1A 3OXAA 5D82A 5AIFA 3LYGA 1OGZA 5AIHA 1AR0A 5IF6A 4KVHA 5CF2A 1O7MB 4HM2B 5AEUB 3JUPA 5STDA
chains in the Genus database with same CATH superfamily
1D6ZA 5KP1A 5IEOA 3HOHA 3V99A 4U13A 2CWUA 4J8TA 3V92A 1RGAA 4N6LA 2CG0A 3EB8A 2CWTA 4FCMA 4BIRA 3CNMA 2ZDJA 1QALA 3KKGA 1STFI 3L0RA 3LZAA 5GSPA 3SXXA 3F9SA 3S5CA 4LEHA 2B24B 4WFOA 5AEWB 2YFJB 4IPBA 3EHCA 1EEJA 1RN1A 1WMPA 5RNTA 3MG3A 5DREA 1KQS2 1W2ZA 2E2UA 4KZ1A 1FW7A 2D1WA 4HM3B 2IYJA 1RNTA 3ALAA 2KF3A 3LT9A 4LYLB 3CCV3 1VQ43 3F7XA 1MWRA 1GY5A 2LYXA 3DGYA 4N6TA 1RHLA 2WOFA 3WOFB 4N6UA 1LRAA 1RGHA 5BVBA 1FGMA 4R4KA 2RFRA 3FSDA 3CCJ3 2H0IA 1M1XB 1BOXA 3AMOA 3CCU3 2KF4A 1TFOA 5KP3A 1BIRA 3SOAA 1X1XA 2W56B 3LMLA 3EBTA 1FGOA 4BL3A 1S723 1V58A 3EBYA 2F86B 4O02B 4MEIA 4MMXB 2J8XB 1F8NA 2BNGA 3CCR3 1Q7Y4 3N8BA 4JF8A 1US1A 3BNBA 1YJN3 3CMA3 3ECFA 4I4KA 1V57A 4X2HA 2OOVC 4BTXA 4IIAA 3MWZA 1X1YA 3OX9A 1R4YA 4FMDA 4XBYA 5AYSC 1JB2A 1AV4A 2P09A 4HM7B 1NDOB 1GMPA 1M1K4 1E97A 1FUTA 2F98A 1NWWA 2HMOB 3Q2PA 3FF2A 3JUOA 5BU4A 1O7WB 3KFQC 2XR8B 3JUNA 2WGOA 1A2PA 2F5MA 1OACA 4BTWA 3T8UA 1W01A 1RSNA 2Z6BA 1OH0A 1B2XA 1RN4A 1LOWA 1CH0A 3O8YA 4XM4A 1IVXA 1IYYA 4RZMA 1OHPA 2BMOB 1K28A 2IY2A 2OCTA 4EV5A 1TIJA 3A76A 3D5GA 3I553 4AEQA 1CYUA 5IERA 1KWIA 2XEPA 3OWYA 1GD4A 2C4BA 1N9JA 3I0YA 1T5YA 4FMAA 1BUJA 1O7NB 1G96A 2W2CA 3LTAA 1MOLA 3PCRA 3HK4A 1QAKA 1RLSA 4K90B 4ZM8A 1YIJ3 1YJ93 1I3FA 1BNGA 2CFLA 1BANA 3D3LA 1KSIA 3HZPA 2GEXA 1B21A 1JKGA 3EF8A 1ULJB 2L1SA 3EE1A 3EN1B 1GOYA 3GRDA 1JB5A 1MGRA 1I2EA 2HOHA 4CCVA 3CC23 7GSPA 9RNTA 1GMQA 3CPOA 1JBSA 1K9M4 2FXTA 2GBXB 3UL5A 1CQSA 1DYUA 2UX0A 3KE7A 1GD3A 5KP4A 1RKYA 1K734 3S29A 4RNZA 3G713 1JNQA 2JQ5A 3MG1A 1WTHA 3JUQA 2XGLA 1PY3A 3ROBA 4BU4A 1VQL3 1LQMB 5AI1A 5ELUA 1N9EA 4ORLA 5A0OB 3GZBA 2P05A 4GL6A 2AADA 1LVNA 1SPUA 1TTOA 3DMCA 3URPA 5IG5A 1RGCA 1JB4A 4FR9A 3BIRA 4XBXA 4N6V0 3WA3A 1K41A 1MWSA 3B7CA 1NNVA 4XBTA 3FG4A 6STDA 3DUKA 1PFPA 2CK3H 3HIIA 4STDA 2W0QA 3X40A 1W5ZA 2RNTA 1IT8A 4EXRA 3B4PA 3WA2X 3S28A 2P0XA 5JPPA 1VQ73 1ASKA 1BNIA 3LT8A 1B2UA 2K3DA 4HZ9B 3SLUA 5IG3A 1BUQA 1ROVA 3N54B 3BNCA 1HYFA 1JRQA 2XGNA 2UUGC 1BRIA 1RGFA 4GSPA 1BAOA 3X3YA 1AQZA 4O2HA 3GZRA 2KXGA 4NPBA 1RGGA 1GS3A 1JJ22 2F99A 3FZWA 1A90A 1TU5A 3CD63 1BSCA 1EA2A 2E2TA 2ML5A 1Z1SA 4K61A 5JPUA 1T2IA 3EJVA 3F8HA 1E3VA 4FCJA 3NUVA 5CK6A 5AIIA 4J9AA 1GOVA 1SIIA 1JN5A 3FGYA 3QRDA 1I0VA 2KCDA 1CEWI 1T3BA 3HX8A 3MYTA 4J5KA 4WWUC 1LXEA 2CW9A 1BSAA 1R4CA 2A15A 1SJWA 3ZG0A 2W9PA 1VQQA 2CX0A 2IUKA 3E99A 5BXQA 1PYLA 3RDEA 2FNQA 1VQN3 2OWPA 1GY6A 3PYJA 4OK0A 8CHOA 1ROAA 4R9KA 3EX9A 4X2OA 1L5GB 1SIHA 4H61A 2CH9A 1NB5I 1A2VA 2QEX3 3D79A 3FKAA 2MC8A 3Q90A 1X1WA 2O9UX 4H3UA 1D6YA 3Q1CA 3KCHA 3KSPA 1N5PA 1UUVB 1RN7A 1RNBA 2BMRB 1DVCA 1I70A 1EUIC 3A5EA 4N6MA 3SVAA 3EQQB 1C54A 2Z76A 1QVG2 1LNHA 4WHAA 4R9LA 2XSHB 3KIIA 2BT3A 4HM5B 4Q53A 2BU4A 2B1XB 2GBWB 1BRSA 1BVIA 2ML6A 3FF0A 1BNFA 4O8SA 5FGOA 1W00A 1W7CA 1MWUA 1UI8A 4WYKA 1OHSA 3PZWA 3QK9A 1BRHA 1JZOA 4N3VA 2WO0A 3DM8A 4IT7A 1VQM3 3MKIA 1BSEA 2CIUA 4EC6A 2M7OA 1B27A 3J7Yd 2WGQA 2E2VA 3MPHA 1ZX2A 3LH4A 1BRJA 3PS8A 3U1WA 3G4S3 1ISKA 1IDPA 2W04A 4I5QA 1RCKA 2H0GA 4HJLB 4OUQA 1M904 1DMMA 1JN5B 4QWTA 2BMQB 1UW1A 1QVF2 3HI7A 4HM4B 1UUWB 1OHOA 1HZ1A 4NHFA 5DRVA 1GSPA 2XSOB 1W6CA 3T8NA 5IENA 1A2KA 2STDA 3NM2A 4G1MB 1U5OA 4RNYA 4EBGA 4HZBB 3BB9A 5CLKA 3RGAA 4HOHA 1M9GA 1RGKA 1DETA 3DZLA 3STDA 1B2MA 1LOXA 1Q864 4LMIA 1VQ83 2O3OA 1TRQA 1OPYA 2I9WA 1FGTA 1TFKA 3MHEA 5G2GA 4KFEA 5IW9A 1QJGA 1UUGB 3AMOB 3F14A 3HIGA 1RJOA 2CHCA 3KN4A 2F5WA 3UNLA 3DY5A 4CDLA 1BSBA 5EEOA 1BNRA 1V74A 2RSXA 1O7HB 3NBBA 3X41A 1G0TA 2Y73A 3B4OA 2XFTA 1FZUA 3X42A 2PZVA 3G6E3 1FGQA 3RGRA 3V98A 3EN8A 2YFLB 6GSPA 3X3XA 1RCLA 1LNIA 3F8XA 1YNVX 3NBRA 1QAFA 3CXC2 1B3SA 2L4VA 3GZYB 4KFDA 1RGEA 3WMDA 3M8CA 1Q824 1KC84 3CPW2 3I563 3FG1A 1RGLA 3ZFZA 3DGLA 1ZS7A 2CFDA 2P38A 1YVBI 4N6NB 2CFKA 2R4IA 1B20A 4HKVB 5EQLA 1CYVA 2JDIH 3BLZA 3PXMA 1EG9B 3IPTA 3SEDA 4MMZB 7STDA 1DMQA 3CU3A 1G02A 1YGWA 1IVWA 2Y74A 3D9RA 4L7KA 1NJI4 2OTJ3 1UCLA 1HU9A 3KSED 3NXJA 1PU4A 4XDVA 1B2ZA 3X3ZA 1KD14 5D83A 1Q42A 2GEYA 2QGUA 1GY7A 2Z7AA 3NBJA 1VQ53 3NQZA 1TP6A 3G8ZA 4TX4A 1LQGC 3WR2A 3IMAB 2AAEA 4FMBA 1JV2B 1O7GB 2KAAA 2OTL3 2KF6A 1ULIB 1BU4A 1BNJA 2C11A 2MF7A 4FMCA 3OWSA 3WODG 2F56A 3BU4A 1I2GA 1JKGB 1WNHA 2CWVA 2W56A 5CXOA 3UL6A 1N8R4 1JBTA 3K63A 3NM7A 1TRPA 2KRTA 3DGMA 3KZTA 2W9QA 4PEJA 3D4AA 1OF5A 1Q40A 1IV7A 2KF5A 3LOYA 1Q7HA 1GMRA 1STDA 4KT3B 3T0UA 1SQWA 4OVMA 5ELJA 3CCS3 1VQ63 1W4NA 1K8A4 3K0ZA 1EKMA 4HYZA 5IG4A 1YHQ3 3DXOA 4HM8B 1IVVA 4K1VA 6RNTA 8RNTA 2K0MA 1D6UA 1U8CB 3AHSA 4HBRA 1NU3A 3MG2A 1YI23 1FUWA 1IT7A 1JZDA 5AYRB 1IVUA 3K9MC 1UCJA 4L8OA 1DE3A 1VQO3 3CME3 2QIYA 3PCSA 1RRLA 3VF1A 4DKIA 5LC7A 3FG3A 1ZO2A 2CKFB 5HGRA 1DMNA 2OQEA 3K7CA 5TGNA 1QMAA 2BO9B 2D42A 2BIRA 1IQYA 1BRKA 1VQ93 1TUHA 4KFFA 1OCVA 5M18A 4HM6B 3EC9A 1LOYA 1EQKA 3N9HA 3CCE3 1W02A 1VQK3 4MJDA 3OV4A 2ZHXB 4HM0B 3UB1A 3F40A 4HVNA 4XDWA 2CC3A 3H51A 4MMYB 5G1KA 1YJW3 4RNTA 1FGRA 1IQ8A 2ZL8A 1HKXA 2UGIA 2GU1A 2XH9A 1AY7A 1FA3A 3NQYA 5LC6A 1NO3A 3RNTA 1IK3A 4O3VA 1RDSA 1Q9EA 2CFWA 3WOEB 3GZXB 3DH2A 1I2FA 5I97A 3NV0A 5FW5A 1UDII 4BTYA 5M1AA 1A67A 1OF5B 1Q40B 2PNCA 1W6YA 1W6GA 4AKYA 1Q814 2XF3A 4HM1B 2P0MA 3AHWA 5IG0A 4CPKA 1B2SA 3D5IA 4L8PA 4R1KA 1JBRA 4J5GA 4XB5A 4EYCA 4FCZA 3ZG5A 2Q07A 4R80A 5G1LA 3G0KA 4RBNA 1NB3I 3LXUX 5HOHA 4GB5A 2HMJB 1C7HA 1TJDA 3CNXA 2OOVA 5IEPA 3ER7A 1BSDA 2INXA 1IV9A 1MGWA 3WDGB 2F4YA 3WHOA 3GSPA 3NX0A 1GOUA 3FCSB 1I0XA 3CC43 3VSYA 2SBLA 3U97A 1Y4KA 1BNSA 2W6JH 2IUJA 1I3IA 2W03A 4WP5A 3S67A 5JBSA 2IA7A 1O7PB 1T2HA 1J2BA 1IQXA 1LOVA 3VGNA 1WMOA 1RRHA 5EVHA 2BHMA 2R41A 2GSPA 3TDGA 2Z77A 3FLJA 5D81A 1AVKA 2SARA 1S5AA 3F7SA 3LTDA 2V1LA 1FUSA 4K1UA 2HMKB 4AKZA 2YFIB 3SOYA 3DGOA 4WYKB 3CCM3 1RMSA 1ZGXA 1WMNA 2CX1A 3MSOA 3UJMA 5AIGA 2K54A 2RCDA 4GHOA 4CJNA 5M19A 1UGHI 3B8LA 2LQVA 2HMMB 3NV0B 3SX1A 1WQLB 2HMNB 4N6OB 1BNEA 4JRFA 2CG1A 2YX9A 1OUNA 4ILFA 3H3HA 1UCIA 4LGQA 3GWRA 5BIRA 3G16A 1AVLA 2HMLB 2XFSA 3JUMA 3S27A 4BL2A 3CCQ3 1VQP3 4NREA 1N8QA 4LSOA 1VZZA 1OGXA 2WOHA 3Q3FA 1X1UA 1BGSA 2RGQA 1GYBA 1UGIA 1N5HA 1YGEA 1BRGA 3LTCA 4EV2A 1E3RA 3NHXA 2XRXB 5CF1A 1FYSA 2RBIA 1MNLA 1RTUA 2H0HA 2C10A 2FGTA 2IMJA 3JVCA 3OW22 3OWUA 3LTBA 1IU7A 3BNEA 2GXFA 3FH1A 3AGNA 2QA43 3OXAA 5D82A 1I8VA 3K5TA 2GU3A 1SARA 5AIFA 3CC73 3CCL3 3LYGA 4LZIA 1OGZA 1YVSA 1UI7A 5AIHA 1AR0A 2CFGA 3AGOA 3IJEB 7RNTA 1DVDA 3PGBA 4HAAA 3GAXA 4EW5A 3SYUA 3DGNA 3BNDA 5IF6A 4KVHA 5CF2A 1UCKA 2OQEC 1YIT3 1W2B2 1BRNL 1O7MB 4HM2B 5AEUB 3JUPA 2ZA4A 1MWTA 5STDA
chains in the Genus database with same CATH topology
1D6ZA 5KP1A 5IEOA 3V99A 4U13A 2CWUA 4J8TA 3V92A 4N6LA 2CG0A 3EB8A 2CWTA 4FCMA 3CNMA 2ZDJA 1QALA 3KKGA 1STFI 3L0RA 3LZAA 3SXXA 1S723 3F9SA 3S5CA 4LEHA 2B24B 4WFOA 5AEWB 2YFJB 4IPBA 3EHCA 1WMPA 3MG3A 5DREA 1KQS2 1W2ZA 2E2UA 4KZ1A 2D1WA 4HM3B 3ALAA 3LT9A 3CCV3 1VQ43 3F7XA 1GY5A 2LYXA 4N6TA 3WOFB 2WOFA 4N6UA 5BVBA 1FGMA 4R4KA 2RFRA 3FSDA 3CCJ3 1M1XB 3AMOA 3CCU3 5KP3A 1TFOA 3SOAA 2W56B 3LMLA 3EBTA 1FGOA 3EBYA 2F86B 4O02B 4MEIA 4MMXB 1F8NA 2BNGA 3CCR3 1Q7Y4 3N8BA 4JF8A 1US1A 3BNBA 1YJN3 3CMA3 3ECFA 4I4KA 4X2HA 2OOVC 4BTXA 4IIAA 3MWZA 3OX9A 4FMDA 4XBYA 5AYSC 1JB2A 1AV4A 2P09A 4HM7B 1NDOB 1M1K4 1E97A 2F98A 1NWWA 2HMOB 3Q2PA 3FF2A 3JUOA 1O7WB 3KFQC 2XR8B 3JUNA 2WGOA 1OACA 4BTWA 3T8UA 1W01A 2Z6BA 1OH0A 3O8YA 4XM4A 1IVXA 4RZMA 1OHPA 2BMOB 1K28A 2OCTA 4EV5A 1TIJA 3A76A 3I553 4AEQA 1CYUA 5IERA 1KWIA 2XEPA 3OWYA 1GD4A 1N9JA 3I0YA 1T5YA 4FMAA 1O7NB 1G96A 2W2CA 3LTAA 1MOLA 3PCRA 3HK4A 1QAKA 4K90B 4ZM8A 1YIJ3 1YJ93 2CFLA 3D3LA 1KSIA 3HZPA 2GEXA 1JKGA 3EF8A 1ULJB 3EE1A 3EN1B 3GRDA 1JB5A 4CCVA 3CC23 3CPOA 1K9M4 2FXTA 2GBXB 3UL5A 1CQSA 1DYUA 2UX0A 3KE7A 1GD3A 5KP4A 1RKYA 1K734 3S29A 4RNZA 3G713 1JNQA 2JQ5A 3MG1A 1WTHA 3JUQA 2XGLA 3ROBA 1VQL3 5AI1A 5ELUA 1N9EA 4ORLA 5A0OB 3GZBA 2P05A 4GL6A 1LVNA 1SPUA 3DMCA 5IG5A 1JB4A 4FR9A 4XBXA 4N6V0 3WA3A 1K41A 3B7CA 4XBTA 3FG4A 6STDA 3DUKA 1PFPA 2CK3H 3HIIA 4STDA 2W0QA 3X40A 1W5ZA 4EXRA 1IT8A 5JPPA 3B4PA 3WA2X 3S28A 2P0XA 1VQ73 1ASKA 3LT8A 3SLUA 4HZ9B 5IG3A 1BUQA 1ROVA 3N54B 3BNCA 1JRQA 2XGNA 3X3YA 4O2HA 3GZRA 2KXGA 1GS3A 1JJ22 2F99A 3FZWA 1A90A 1TU5A 3CD63 2E2TA 1EA2A 2ML5A 1Z1SA 4K61A 5JPUA 3EJVA 3F8HA 1E3VA 4FCJA 3NUVA 5CK6A 5AIIA 4J9AA 1SIIA 1JN5A 3FGYA 3QRDA 2KCDA 1CEWI 3HX8A 3MYTA 4WWUC 1LXEA 2CW9A 1R4CA 2A15A 1SJWA 2W9PA 2IUKA 3E99A 5BXQA 1VQN3 3RDEA 2FNQA 2OWPA 1GY6A 3PYJA 4OK0A 8CHOA 1ROAA 4R9KA 3EX9A 4X2OA 1L5GB 1SIHA 4H61A 2CH9A 1NB5I 1A2VA 2QEX3 3FKAA 2MC8A 3Q90A 2O9UX 4H3UA 1D6YA 3Q1CA 3KSPA 1N5PA 1UUVB 1RN7A 2BMRB 1DVCA 4N6MA 3SVAA 3EQQB 2Z76A 1QVG2 1LNHA 4WHAA 4R9LA 2XSHB 3KIIA 2BT3A 4HM5B 4Q53A 2B1XB 2GBWB 2ML6A 3FF0A 4O8SA 5FGOA 1W00A 1W7CA 1UI8A 4WYKA 1OHSA 3PZWA 3QK9A 4N3VA 2WO0A 3DM8A 4IT7A 1VQM3 3MKIA 2CIUA 4EC6A 2M7OA 3J7Yd 2WGQA 2E2VA 3MPHA 1ZX2A 3LH4A 3PS8A 3U1WA 3G4S3 1ISKA 1IDPA 2W04A 4HJLB 4OUQA 1M904 1DMMA 1JN5B 4QWTA 2BMQB 1UW1A 1QVF2 3HI7A 4HM4B 1UUWB 1OHOA 4NHFA 5DRVA 2XSOB 3T8NA 1W6CA 5IENA 1A2KA 2STDA 3NM2A 4G1MB 1U5OA 4RNYA 4EBGA 4HZBB 3BB9A 5CLKA 3RGAA 1M9GA 3DZLA 3STDA 1LOXA 1Q864 4LMIA 1VQ83 2O3OA 1OPYA 2I9WA 1FGTA 1TFKA 3MHEA 5G2GA 4KFEA 5IW9A 1QJGA 3AMOB 3F14A 3HIGA 3KN4A 1RJOA 2CHCA 3UNLA 4CDLA 3DY5A 5EEOA 1V74A 2RSXA 1O7HB 3NBBA 3X41A 2Y73A 3B4OA 2XFTA 3X42A 2PZVA 3G6E3 1FGQA 3RGRA 3V98A 3EN8A 2YFLB 3X3XA 3F8XA 3NBRA 1QAFA 3CXC2 2L4VA 4KFDA 3GZYB 1Q824 3WMDA 3M8CA 1KC84 3CPW2 3I563 3FG1A 3DGLA 2CFDA 2P38A 1YVBI 4N6NB 2CFKA 2R4IA 5EQLA 4HKVB 1CYVA 2JDIH 3BLZA 3PXMA 1EG9B 3IPTA 4MMZB 7STDA 1DMQA 3CU3A 1IVWA 2Y74A 3D9RA 4L7KA 1NJI4 2OTJ3 3KSED 1HU9A 3NXJA 1PU4A 4XDVA 3X3ZA 1KD14 5D83A 2Z7AA 1Q42A 2GEYA 1GY7A 2QGUA 3NBJA 1VQ53 3NQZA 1TP6A 3G8ZA 4TX4A 3IMAB 4FMBA 1JV2B 1O7GB 2OTL3 1ULIB 2C11A 2MF7A 4FMCA 3OWSA 3WODG 2CWVA 1JKGB 1WNHA 2W56A 5CXOA 3UL6A 1N8R4 3K63A 3NM7A 2KRTA 3DGMA 3KZTA 2W9QA 4PEJA 3SEDA 1OF5A 1Q40A 1IV7A 3LOYA 1STDA 3T0UA 1SQWA 4OVMA 5ELJA 3CCS3 1VQ63 1W4NA 1K8A4 3K0ZA 1EKMA 4HYZA 5IG4A 1YHQ3 3DXOA 4HM8B 1IVVA 4K1VA 2K0MA 1D6UA 1U8CB 4HBRA 1YI23 1NU3A 3MG2A 1FUWA 1IT7A 5AYRB 1IVUA 3K9MC 4L8OA 1VQO3 3CME3 2QIYA 3PCSA 1RRLA 3VF1A 5LC7A 3FG3A 1ZO2A 2CKFB 5HGRA 1DMNA 2OQEA 3K7CA 5TGNA 1QMAA 2BO9B 2D42A 1IQYA 1VQ93 1TUHA 4KFFA 1OCVA 4HM6B 3EC9A 1EQKA 3N9HA 3CCE3 1W02A 1VQK3 4MJDA 3OV4A 4HM0B 3UB1A 3F40A 4HVNA 4XDWA 2CC3A 3H51A 4MMYB 1YJW3 1FGRA 1IQ8A 2ZL8A 1HKXA 2GU1A 2XH9A 1FA3A 3NQYA 5LC6A 1NO3A 1IK3A 4O3VA 2CFWA 3WOEB 3GZXB 5I97A 3NV0A 5FW5A 4BTYA 1A67A 1OF5B 1Q40B 2PNCA 1W6YA 1W6GA 4AKYA 1Q814 2XF3A 4HM1B 2P0MA 5IG0A 4L8PA 4R1KA 4XB5A 4EYCA 4FCZA 2Q07A 4R80A 3G0KA 4RBNA 1NB3I 3LXUX 4GB5A 2HMJB 1C7HA 3CNXA 2OOVA 5IEPA 3ER7A 2INXA 1IV9A 3WDGB 3NX0A 3FCSB 3CC43 3VSYA 2SBLA 3U97A 1Y4KA 2IUJA 2W6JH 2W03A 4WP5A 3S67A 5JBSA 2IA7A 1O7PB 1J2BA 1IQXA 3VGNA 1WMOA 1RRHA 5EVHA 2BHMA 3TDGA 2Z77A 3FLJA 5D81A 1AVKA 1S5AA 3F7SA 3LTDA 2V1LA 4K1UA 4AKZA 2HMKB 3CCM3 2YFIB 3SOYA 3DGOA 4WYKB 1WMNA 3MSOA 3UJMA 5AIGA 2K54A 2RCDA 3B8LA 2LQVA 2HMMB 3NV0B 3SX1A 1WQLB 2HMNB 4N6OB 4JRFA 2CG1A 2YX9A 1OUNA 3H3HA 4LGQA 3GWRA 3G16A 2XFSA 1AVLA 2HMLB 3JUMA 3S27A 3CCQ3 1VQP3 4NREA 1N8QA 4LSOA 1VZZA 1OGXA 2WOHA 2RGQA 1GYBA 1YGEA 1N5HA 3LTCA 4EV2A 1E3RA 3NHXA 2XRXB 5CF1A 3OW22 1MNLA 2C10A 2FGTA 2IMJA 3JVCA 3OWUA 3LTBA 1IU7A 3BNEA 2GXFA 3FH1A 2QA43 3OXAA 5D82A 3K5TA 2GU3A 5AIFA 3CC73 3CCL3 3LYGA 4LZIA 1OGZA 5AIHA 1UI7A 1AR0A 2CFGA 3IJEB 1DVDA 3PGBA 3GAXA 3DGNA 3BNDA 5IF6A 4KVHA 5CF2A 2OQEC 1YIT3 1W2B2 1O7MB 4HM2B 5AEUB 3JUPA 5STDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5KP1 A;  5IEO A;  4U13 A;  4J8T A;  4FCM A;  3CNM A;  3KKG A;  3LZA A;  3F9S A;  3S5C A;  4LEH A;  2B24 B;  5AEW B;  2YFJ B;  3EHC A;  3MG3 A;  5DRE A;  4HM3 B;  3F7X A;  1GY5 A;  5BVB A;  2RFR A;  3FSD A;  5KP3 A;  3SOA A;  3EBT A;  3EBY A;  2F86 B;  2BNG A;  3ECF A;  4I4K A;  4X2H A;  4IIA A;  3OX9 A;  4XBY A;  1JB2 A;  4HM7 B;  1NDO B;  1E97 A;  2F98 A;  1NWW A;  2HMO B;  3FF2 A;  3JUO A;  1O7W B;  2XR8 B;  3JUN A;  3T8U A;  1W01 A;  1OH0 A;  4XM4 A;  4RZM A;  1OHP A;  2BMO B;  3A76 A;  5IER A;  3OWY A;  3I0Y A;  1O7N B;  2W2C A;  3HK4 A;  3HZP A;  2GEX A;  1JKG A;  3EF8 A;  1ULJ B;  3EN1 B;  3GRD A;  1JB5 A;  3CPO A;  2GBX B;  1CQS A;  3KE7 A;  2UX0 A;  5KP4 A;  2JQ5 A;  3MG1 A;  3JUQ A;  3ROB A;  5AI1 A;  4ORL A;  3GZB A;  3DMC A;  5IG5 A;  1JB4 A;  4XBX A;  1K41 A;  3B7C A;  4XBT A;  6STD A;  3DUK A;  4STD A;  5JPP A;  3B4P A;  1ASK A;  4HZ9 B;  5IG3 A;  1BUQ A;  3GZR A;  1GS3 A;  2F99 A;  3FZW A;  1EA2 A;  1Z1S A;  5JPU A;  3EJV A;  3F8H A;  1E3V A;  4FCJ A;  3NUV A;  5CK6 A;  5AII A;  4J9A A;  1JN5 A;  3FGY A;  3HX8 A;  3MYT A;  4WWU C;  2A15 A;  1SJW A;  3E99 A;  5BXQ A;  2OWP A;  1GY6 A;  8CHO A;  4R9K A;  3EX9 A;  4X2O A;  3FKA A;  3Q90 A;  4H3U A;  3KSP A;  1UUV B;  2BMR B;  3EQQ B;  2Z76 A;  4R9L A;  2XSH B;  4HM5 B;  4Q53 A;  2B1X B;  2GBW B;  3FF0 A;  1W00 A;  4WYK A;  1OHS A;  4N3V A;  3DM8 A;  3MKI A;  1ZX2 A;  1ISK A;  1IDP A;  4HJL B;  4OUQ A;  1DMM A;  1JN5 B;  2BMQ B;  4HM4 B;  1UUW B;  1OHO A;  5DRV A;  2XSO B;  3T8N A;  5IEN A;  1A2K A;  2STD A;  3NM2 A;  1U5O A;  4HZB B;  3BB9 A;  5CLK A;  3RGA A;  3DZL A;  3STD A;  4LMI A;  1OPY A;  2I9W A;  3MHE A;  5G2G A;  1QJG A;  3F14 A;  4CDL A;  2CHC A;  3UNL A;  1O7H B;  3B4O A;  2PZV A;  3RGR A;  3EN8 A;  2YFL B;  3F8X A;  3NBR A;  3GZY B;  3WMD A;  3M8C A;  2R4I A;  4HKV B;  3BLZ A;  1EG9 B;  3IPT A;  7STD A;  1DMQ A;  3CU3 A;  4L7K A;  3D9R A;  3NXJ A;  4XDV A;  5D83 A;  1Q42 A;  2GEY A;  2QGU A;  1GY7 A;  2Z7A A;  1TP6 A;  3G8Z A;  1O7G B;  1ULI B;  3OWS A;  5CXO A;  1JKG B;  3KZT A;  4PEJ A;  3SED A;  1OF5 A;  1Q40 A;  1STD A;  4OVM A;  3K0Z A;  5IG4 A;  3DXO A;  4HM8 B;  4K1V A;  1NU3 A;  3MG2 A;  4L8O A;  2QIY A;  5HGR A;  1ZO2 A;  2CKF B;  1DMN A;  3K7C A;  5TGN A;  1QMA A;  1TUH A;  1OCV A;  4HM6 B;  3EC9 A;  1W02 A;  4MJD A;  3OV4 A;  4HM0 B;  3F40 A;  4HVN A;  4XDW A;  3H51 A;  1HKX A;  3GZX B;  3NV0 A;  5FW5 A;  1OF5 B;  1Q40 B;  1W6Y A;  4HM1 B;  5IG0 A;  4L8P A;  4R1K A;  4XB5 A;  3G0K A;  4GB5 A;  2HMJ B;  1C7H A;  3CNX A;  5IEP A;  3ER7 A;  2INX A;  3VSY A;  4WP5 A;  1O7P B;  3VGN A;  5EVH A;  2Z77 A;  3FLJ A;  5D81 A;  1S5A A;  3F7S A;  4K1U A;  2HMK B;  2YFI B;  3SOY A;  4WYK B;  3MSO A;  3UJM A;  5AIG A;  2K54 A;  2RCD A;  3B8L A;  2HMM B;  3NV0 B;  1WQL B;  2HMN B;  1OUN A;  3H3H A;  4LGQ A;  3GWR A;  3G16 A;  3JUM A;  2HML B;  1VZZ A;  1OGX A;  2RGQ A;  1GYB A;  1E3R A;  3NHX A;  2XRX B;  5CF1 A;  2IMJ A;  3OWU A;  2GXF A;  3FH1 A;  3OXA A;  5D82 A;  5AIF A;  3LYG A;  1OGZ A;  5AIH A;  1AR0 A;  5IF6 A;  4KVH A;  5CF2 A;  1O7M B;  4HM2 B;  5AEU B;  3JUP A;  5STD A; 
#chains in the Genus database with same CATH topology
 1D6Z A;  5KP1 A;  5IEO A;  3HOH A;  3V99 A;  4U13 A;  2CWU A;  4J8T A;  3V92 A;  1RGA A;  4N6L A;  2CG0 A;  3EB8 A;  2CWT A;  4FCM A;  4BIR A;  3CNM A;  2ZDJ A;  1QAL A;  3KKG A;  1STF I;  3L0R A;  3LZA A;  5GSP A;  3SXX A;  3F9S A;  3S5C A;  4LEH A;  2B24 B;  4WFO A;  5AEW B;  2YFJ B;  4IPB A;  3EHC A;  1EEJ A;  1RN1 A;  1WMP A;  5RNT A;  3MG3 A;  5DRE A;  1KQS 2;  1W2Z A;  2E2U A;  4KZ1 A;  1FW7 A;  2D1W A;  4HM3 B;  2IYJ A;  1RNT A;  3ALA A;  2KF3 A;  3LT9 A;  4LYL B;  3CCV 3;  1VQ4 3;  3F7X A;  1MWR A;  1GY5 A;  2LYX A;  3DGY A;  4N6T A;  1RHL A;  2WOF A;  3WOF B;  4N6U A;  1LRA A;  1RGH A;  5BVB A;  1FGM A;  4R4K A;  2RFR A;  3FSD A;  3CCJ 3;  2H0I A;  1M1X B;  1BOX A;  3AMO A;  3CCU 3;  2KF4 A;  1TFO A;  5KP3 A;  1BIR A;  3SOA A;  1X1X A;  2W56 B;  3LML A;  3EBT A;  1FGO A;  4BL3 A;  1S72 3;  1V58 A;  3EBY A;  2F86 B;  4O02 B;  4MEI A;  4MMX B;  2J8X B;  1F8N A;  2BNG A;  3CCR 3;  1Q7Y 4;  3N8B A;  4JF8 A;  1US1 A;  3BNB A;  1YJN 3;  3CMA 3;  3ECF A;  4I4K A;  1V57 A;  4X2H A;  2OOV C;  4BTX A;  4IIA A;  3MWZ A;  1X1Y A;  3OX9 A;  1R4Y A;  4FMD A;  4XBY A;  5AYS C;  1JB2 A;  1AV4 A;  2P09 A;  4HM7 B;  1NDO B;  1GMP A;  1M1K 4;  1E97 A;  1FUT A;  2F98 A;  1NWW A;  2HMO B;  3Q2P A;  3FF2 A;  3JUO A;  5BU4 A;  1O7W B;  3KFQ C;  2XR8 B;  3JUN A;  2WGO A;  1A2P A;  2F5M A;  1OAC A;  4BTW A;  3T8U A;  1W01 A;  1RSN A;  2Z6B A;  1OH0 A;  1B2X A;  1RN4 A;  1LOW A;  1CH0 A;  3O8Y A;  4XM4 A;  1IVX A;  1IYY A;  4RZM A;  1OHP A;  2BMO B;  1K28 A;  2IY2 A;  2OCT A;  4EV5 A;  1TIJ A;  3A76 A;  3D5G A;  3I55 3;  4AEQ A;  1CYU A;  5IER A;  1KWI A;  2XEP A;  3OWY A;  1GD4 A;  2C4B A;  1N9J A;  3I0Y A;  1T5Y A;  4FMA A;  1BUJ A;  1O7N B;  1G96 A;  2W2C A;  3LTA A;  1MOL A;  3PCR A;  3HK4 A;  1QAK A;  1RLS A;  4K90 B;  4ZM8 A;  1YIJ 3;  1YJ9 3;  1I3F A;  1BNG A;  2CFL A;  1BAN A;  3D3L A;  1KSI A;  3HZP A;  2GEX A;  1B21 A;  1JKG A;  3EF8 A;  1ULJ B;  2L1S A;  3EE1 A;  3EN1 B;  1GOY A;  3GRD A;  1JB5 A;  1MGR A;  1I2E A;  2HOH A;  4CCV A;  3CC2 3;  7GSP A;  9RNT A;  1GMQ A;  3CPO A;  1JBS A;  1K9M 4;  2FXT A;  2GBX B;  3UL5 A;  1CQS A;  1DYU A;  2UX0 A;  3KE7 A;  1GD3 A;  5KP4 A;  1RKY A;  1K73 4;  3S29 A;  4RNZ A;  3G71 3;  1JNQ A;  2JQ5 A;  3MG1 A;  1WTH A;  3JUQ A;  2XGL A;  1PY3 A;  3ROB A;  4BU4 A;  1VQL 3;  1LQM B;  5AI1 A;  5ELU A;  1N9E A;  4ORL A;  5A0O B;  3GZB A;  2P05 A;  4GL6 A;  2AAD A;  1LVN A;  1SPU A;  1TTO A;  3DMC A;  3URP A;  5IG5 A;  1RGC A;  1JB4 A;  4FR9 A;  3BIR A;  4XBX A;  4N6V 0;  3WA3 A;  1K41 A;  1MWS A;  3B7C A;  1NNV A;  4XBT A;  3FG4 A;  6STD A;  3DUK A;  1PFP A;  2CK3 H;  3HII A;  4STD A;  2W0Q A;  3X40 A;  1W5Z A;  2RNT A;  1IT8 A;  4EXR A;  3B4P A;  3WA2 X;  3S28 A;  2P0X A;  5JPP A;  1VQ7 3;  1ASK A;  1BNI A;  3LT8 A;  1B2U A;  2K3D A;  4HZ9 B;  3SLU A;  5IG3 A;  1BUQ A;  1ROV A;  3N54 B;  3BNC A;  1HYF A;  1JRQ A;  2XGN A;  2UUG C;  1BRI A;  1RGF A;  4GSP A;  1BAO A;  3X3Y A;  1AQZ A;  4O2H A;  3GZR A;  2KXG A;  4NPB A;  1RGG A;  1GS3 A;  1JJ2 2;  2F99 A;  3FZW A;  1A90 A;  1TU5 A;  3CD6 3;  1BSC A;  1EA2 A;  2E2T A;  2ML5 A;  1Z1S A;  4K61 A;  5JPU A;  1T2I A;  3EJV A;  3F8H A;  1E3V A;  4FCJ A;  3NUV A;  5CK6 A;  5AII A;  4J9A A;  1GOV A;  1SII A;  1JN5 A;  3FGY A;  3QRD A;  1I0V A;  2KCD A;  1CEW I;  1T3B A;  3HX8 A;  3MYT A;  4J5K A;  4WWU C;  1LXE A;  2CW9 A;  1BSA A;  1R4C A;  2A15 A;  1SJW A;  3ZG0 A;  2W9P A;  1VQQ A;  2CX0 A;  2IUK A;  3E99 A;  5BXQ A;  1PYL A;  3RDE A;  2FNQ A;  1VQN 3;  2OWP A;  1GY6 A;  3PYJ A;  4OK0 A;  8CHO A;  1ROA A;  4R9K A;  3EX9 A;  4X2O A;  1L5G B;  1SIH A;  4H61 A;  2CH9 A;  1NB5 I;  1A2V A;  2QEX 3;  3D79 A;  3FKA A;  2MC8 A;  3Q90 A;  1X1W A;  2O9U X;  4H3U A;  1D6Y A;  3Q1C A;  3KCH A;  3KSP A;  1N5P A;  1UUV B;  1RN7 A;  1RNB A;  2BMR B;  1DVC A;  1I70 A;  1EUI C;  3A5E A;  4N6M A;  3SVA A;  3EQQ B;  1C54 A;  2Z76 A;  1QVG 2;  1LNH A;  4WHA A;  4R9L A;  2XSH B;  3KII A;  2BT3 A;  4HM5 B;  4Q53 A;  2BU4 A;  2B1X B;  2GBW B;  1BRS A;  1BVI A;  2ML6 A;  3FF0 A;  1BNF A;  4O8S A;  5FGO A;  1W00 A;  1W7C A;  1MWU A;  1UI8 A;  4WYK A;  1OHS A;  3PZW A;  3QK9 A;  1BRH A;  1JZO A;  4N3V A;  2WO0 A;  3DM8 A;  4IT7 A;  1VQM 3;  3MKI A;  1BSE A;  2CIU A;  4EC6 A;  2M7O A;  1B27 A;  3J7Y d;  2WGQ A;  2E2V A;  3MPH A;  1ZX2 A;  3LH4 A;  1BRJ A;  3PS8 A;  3U1W A;  3G4S 3;  1ISK A;  1IDP A;  2W04 A;  4I5Q A;  1RCK A;  2H0G A;  4HJL B;  4OUQ A;  1M90 4;  1DMM A;  1JN5 B;  4QWT A;  2BMQ B;  1UW1 A;  1QVF 2;  3HI7 A;  4HM4 B;  1UUW B;  1OHO A;  1HZ1 A;  4NHF A;  5DRV A;  1GSP A;  2XSO B;  1W6C A;  3T8N A;  5IEN A;  1A2K A;  2STD A;  3NM2 A;  4G1M B;  1U5O A;  4RNY A;  4EBG A;  4HZB B;  3BB9 A;  5CLK A;  3RGA A;  4HOH A;  1M9G A;  1RGK A;  1DET A;  3DZL A;  3STD A;  1B2M A;  1LOX A;  1Q86 4;  4LMI A;  1VQ8 3;  2O3O A;  1TRQ A;  1OPY A;  2I9W A;  1FGT A;  1TFK A;  3MHE A;  5G2G A;  4KFE A;  5IW9 A;  1QJG A;  1UUG B;  3AMO B;  3F14 A;  3HIG A;  1RJO A;  2CHC A;  3KN4 A;  2F5W A;  3UNL A;  3DY5 A;  4CDL A;  1BSB A;  5EEO A;  1BNR A;  1V74 A;  2RSX A;  1O7H B;  3NBB A;  3X41 A;  1G0T A;  2Y73 A;  3B4O A;  2XFT A;  1FZU A;  3X42 A;  2PZV A;  3G6E 3;  1FGQ A;  3RGR A;  3V98 A;  3EN8 A;  2YFL B;  6GSP A;  3X3X A;  1RCL A;  1LNI A;  3F8X A;  1YNV X;  3NBR A;  1QAF A;  3CXC 2;  1B3S A;  2L4V A;  3GZY B;  4KFD A;  1RGE A;  3WMD A;  3M8C A;  1Q82 4;  1KC8 4;  3CPW 2;  3I56 3;  3FG1 A;  1RGL A;  3ZFZ A;  3DGL A;  1ZS7 A;  2CFD A;  2P38 A;  1YVB I;  4N6N B;  2CFK A;  2R4I A;  1B20 A;  4HKV B;  5EQL A;  1CYV A;  2JDI H;  3BLZ A;  3PXM A;  1EG9 B;  3IPT A;  3SED A;  4MMZ B;  7STD A;  1DMQ A;  3CU3 A;  1G02 A;  1YGW A;  1IVW A;  2Y74 A;  3D9R A;  4L7K A;  1NJI 4;  2OTJ 3;  1UCL A;  1HU9 A;  3KSE D;  3NXJ A;  1PU4 A;  4XDV A;  1B2Z A;  3X3Z A;  1KD1 4;  5D83 A;  1Q42 A;  2GEY A;  2QGU A;  1GY7 A;  2Z7A A;  3NBJ A;  1VQ5 3;  3NQZ A;  1TP6 A;  3G8Z A;  4TX4 A;  1LQG C;  3WR2 A;  3IMA B;  2AAE A;  4FMB A;  1JV2 B;  1O7G B;  2KAA A;  2OTL 3;  2KF6 A;  1ULI B;  1BU4 A;  1BNJ A;  2C11 A;  2MF7 A;  4FMC A;  3OWS A;  3WOD G;  2F56 A;  3BU4 A;  1I2G A;  1JKG B;  1WNH A;  2CWV A;  2W56 A;  5CXO A;  3UL6 A;  1N8R 4;  1JBT A;  3K63 A;  3NM7 A;  1TRP A;  2KRT A;  3DGM A;  3KZT A;  2W9Q A;  4PEJ A;  3D4A A;  1OF5 A;  1Q40 A;  1IV7 A;  2KF5 A;  3LOY A;  1Q7H A;  1GMR A;  1STD A;  4KT3 B;  3T0U A;  1SQW A;  4OVM A;  5ELJ A;  3CCS 3;  1VQ6 3;  1W4N A;  1K8A 4;  3K0Z A;  1EKM A;  4HYZ A;  5IG4 A;  1YHQ 3;  3DXO A;  4HM8 B;  1IVV A;  4K1V A;  6RNT A;  8RNT A;  2K0M A;  1D6U A;  1U8C B;  3AHS A;  4HBR A;  1NU3 A;  3MG2 A;  1YI2 3;  1FUW A;  1IT7 A;  1JZD A;  5AYR B;  1IVU A;  3K9M C;  1UCJ A;  4L8O A;  1DE3 A;  1VQO 3;  3CME 3;  2QIY A;  3PCS A;  1RRL A;  3VF1 A;  4DKI A;  5LC7 A;  3FG3 A;  1ZO2 A;  2CKF B;  5HGR A;  1DMN A;  2OQE A;  3K7C A;  5TGN A;  1QMA A;  2BO9 B;  2D42 A;  2BIR A;  1IQY A;  1BRK A;  1VQ9 3;  1TUH A;  4KFF A;  1OCV A;  5M18 A;  4HM6 B;  3EC9 A;  1LOY A;  1EQK A;  3N9H A;  3CCE 3;  1W02 A;  1VQK 3;  4MJD A;  3OV4 A;  2ZHX B;  4HM0 B;  3UB1 A;  3F40 A;  4HVN A;  4XDW A;  2CC3 A;  3H51 A;  4MMY B;  5G1K A;  1YJW 3;  4RNT A;  1FGR A;  1IQ8 A;  2ZL8 A;  1HKX A;  2UGI A;  2GU1 A;  2XH9 A;  1AY7 A;  1FA3 A;  3NQY A;  5LC6 A;  1NO3 A;  3RNT A;  1IK3 A;  4O3V A;  1RDS A;  1Q9E A;  2CFW A;  3WOE B;  3GZX B;  3DH2 A;  1I2F A;  5I97 A;  3NV0 A;  5FW5 A;  1UDI I;  4BTY A;  5M1A A;  1A67 A;  1OF5 B;  1Q40 B;  2PNC A;  1W6Y A;  1W6G A;  4AKY A;  1Q81 4;  2XF3 A;  4HM1 B;  2P0M A;  3AHW A;  5IG0 A;  4CPK A;  1B2S A;  3D5I A;  4L8P A;  4R1K A;  1JBR A;  4J5G A;  4XB5 A;  4EYC A;  4FCZ A;  3ZG5 A;  2Q07 A;  4R80 A;  5G1L A;  3G0K A;  4RBN A;  1NB3 I;  3LXU X;  5HOH A;  4GB5 A;  2HMJ B;  1C7H A;  1TJD A;  3CNX A;  2OOV A;  5IEP A;  3ER7 A;  1BSD A;  2INX A;  1IV9 A;  1MGW A;  3WDG B;  2F4Y A;  3WHO A;  3GSP A;  3NX0 A;  1GOU A;  3FCS B;  1I0X A;  3CC4 3;  3VSY A;  2SBL A;  3U97 A;  1Y4K A;  1BNS A;  2W6J H;  2IUJ A;  1I3I A;  2W03 A;  4WP5 A;  3S67 A;  5JBS A;  2IA7 A;  1O7P B;  1T2H A;  1J2B A;  1IQX A;  1LOV A;  3VGN A;  1WMO A;  1RRH A;  5EVH A;  2BHM A;  2R41 A;  2GSP A;  3TDG A;  2Z77 A;  3FLJ A;  5D81 A;  1AVK A;  2SAR A;  1S5A A;  3F7S A;  3LTD A;  2V1L A;  1FUS A;  4K1U A;  2HMK B;  4AKZ A;  2YFI B;  3SOY A;  3DGO A;  4WYK B;  3CCM 3;  1RMS A;  1ZGX A;  1WMN A;  2CX1 A;  3MSO A;  3UJM A;  5AIG A;  2K54 A;  2RCD A;  4GHO A;  4CJN A;  5M19 A;  1UGH I;  3B8L A;  2LQV A;  2HMM B;  3NV0 B;  3SX1 A;  1WQL B;  2HMN B;  4N6O B;  1BNE A;  4JRF A;  2CG1 A;  2YX9 A;  1OUN A;  4ILF A;  3H3H A;  1UCI A;  4LGQ A;  3GWR A;  5BIR A;  3G16 A;  1AVL A;  2HML B;  2XFS A;  3JUM A;  3S27 A;  4BL2 A;  3CCQ 3;  1VQP 3;  4NRE A;  1N8Q A;  4LSO A;  1VZZ A;  1OGX A;  2WOH A;  3Q3F A;  1X1U A;  1BGS A;  2RGQ A;  1GYB A;  1UGI A;  1N5H A;  1YGE A;  1BRG A;  3LTC A;  4EV2 A;  1E3R A;  3NHX A;  2XRX B;  5CF1 A;  1FYS A;  2RBI A;  1MNL A;  1RTU A;  2H0H A;  2C10 A;  2FGT A;  2IMJ A;  3JVC A;  3OW2 2;  3OWU A;  3LTB A;  1IU7 A;  3BNE A;  2GXF A;  3FH1 A;  3AGN A;  2QA4 3;  3OXA A;  5D82 A;  1I8V A;  3K5T A;  2GU3 A;  1SAR A;  5AIF A;  3CC7 3;  3CCL 3;  3LYG A;  4LZI A;  1OGZ A;  1YVS A;  1UI7 A;  5AIH A;  1AR0 A;  2CFG A;  3AGO A;  3IJE B;  7RNT A;  1DVD A;  3PGB A;  4HAA A;  3GAX A;  4EW5 A;  3SYU A;  3DGN A;  3BND A;  5IF6 A;  4KVH A;  5CF2 A;  1UCK A;  2OQE C;  1YIT 3;  1W2B 2;  1BRN L;  1O7M B;  4HM2 B;  5AEU B;  3JUP A;  2ZA4 A;  1MWT A;  5STD A; 
#chains in the Genus database with same CATH homology
 1D6Z A;  5KP1 A;  5IEO A;  3V99 A;  4U13 A;  2CWU A;  4J8T A;  3V92 A;  4N6L A;  2CG0 A;  3EB8 A;  2CWT A;  4FCM A;  3CNM A;  2ZDJ A;  1QAL A;  3KKG A;  1STF I;  3L0R A;  3LZA A;  3SXX A;  1S72 3;  3F9S A;  3S5C A;  4LEH A;  2B24 B;  4WFO A;  5AEW B;  2YFJ B;  4IPB A;  3EHC A;  1WMP A;  3MG3 A;  5DRE A;  1KQS 2;  1W2Z A;  2E2U A;  4KZ1 A;  2D1W A;  4HM3 B;  3ALA A;  3LT9 A;  3CCV 3;  1VQ4 3;  3F7X A;  1GY5 A;  2LYX A;  4N6T A;  3WOF B;  2WOF A;  4N6U A;  5BVB A;  1FGM A;  4R4K A;  2RFR A;  3FSD A;  3CCJ 3;  1M1X B;  3AMO A;  3CCU 3;  5KP3 A;  1TFO A;  3SOA A;  2W56 B;  3LML A;  3EBT A;  1FGO A;  3EBY A;  2F86 B;  4O02 B;  4MEI A;  4MMX B;  1F8N A;  2BNG A;  3CCR 3;  1Q7Y 4;  3N8B A;  4JF8 A;  1US1 A;  3BNB A;  1YJN 3;  3CMA 3;  3ECF A;  4I4K A;  4X2H A;  2OOV C;  4BTX A;  4IIA A;  3MWZ A;  3OX9 A;  4FMD A;  4XBY A;  5AYS C;  1JB2 A;  1AV4 A;  2P09 A;  4HM7 B;  1NDO B;  1M1K 4;  1E97 A;  2F98 A;  1NWW A;  2HMO B;  3Q2P A;  3FF2 A;  3JUO A;  1O7W B;  3KFQ C;  2XR8 B;  3JUN A;  2WGO A;  1OAC A;  4BTW A;  3T8U A;  1W01 A;  2Z6B A;  1OH0 A;  3O8Y A;  4XM4 A;  1IVX A;  4RZM A;  1OHP A;  2BMO B;  1K28 A;  2OCT A;  4EV5 A;  1TIJ A;  3A76 A;  3I55 3;  4AEQ A;  1CYU A;  5IER A;  1KWI A;  2XEP A;  3OWY A;  1GD4 A;  1N9J A;  3I0Y A;  1T5Y A;  4FMA A;  1O7N B;  1G96 A;  2W2C A;  3LTA A;  1MOL A;  3PCR A;  3HK4 A;  1QAK A;  4K90 B;  4ZM8 A;  1YIJ 3;  1YJ9 3;  2CFL A;  3D3L A;  1KSI A;  3HZP A;  2GEX A;  1JKG A;  3EF8 A;  1ULJ B;  3EE1 A;  3EN1 B;  3GRD A;  1JB5 A;  4CCV A;  3CC2 3;  3CPO A;  1K9M 4;  2FXT A;  2GBX B;  3UL5 A;  1CQS A;  1DYU A;  2UX0 A;  3KE7 A;  1GD3 A;  5KP4 A;  1RKY A;  1K73 4;  3S29 A;  4RNZ A;  3G71 3;  1JNQ A;  2JQ5 A;  3MG1 A;  1WTH A;  3JUQ A;  2XGL A;  3ROB A;  1VQL 3;  5AI1 A;  5ELU A;  1N9E A;  4ORL A;  5A0O B;  3GZB A;  2P05 A;  4GL6 A;  1LVN A;  1SPU A;  3DMC A;  5IG5 A;  1JB4 A;  4FR9 A;  4XBX A;  4N6V 0;  3WA3 A;  1K41 A;  3B7C A;  4XBT A;  3FG4 A;  6STD A;  3DUK A;  1PFP A;  2CK3 H;  3HII A;  4STD A;  2W0Q A;  3X40 A;  1W5Z A;  4EXR A;  1IT8 A;  5JPP A;  3B4P A;  3WA2 X;  3S28 A;  2P0X A;  1VQ7 3;  1ASK A;  3LT8 A;  3SLU A;  4HZ9 B;  5IG3 A;  1BUQ A;  1ROV A;  3N54 B;  3BNC A;  1JRQ A;  2XGN A;  3X3Y A;  4O2H A;  3GZR A;  2KXG A;  1GS3 A;  1JJ2 2;  2F99 A;  3FZW A;  1A90 A;  1TU5 A;  3CD6 3;  2E2T A;  1EA2 A;  2ML5 A;  1Z1S A;  4K61 A;  5JPU A;  3EJV A;  3F8H A;  1E3V A;  4FCJ A;  3NUV A;  5CK6 A;  5AII A;  4J9A A;  1SII A;  1JN5 A;  3FGY A;  3QRD A;  2KCD A;  1CEW I;  3HX8 A;  3MYT A;  4WWU C;  1LXE A;  2CW9 A;  1R4C A;  2A15 A;  1SJW A;  2W9P A;  2IUK A;  3E99 A;  5BXQ A;  1VQN 3;  3RDE A;  2FNQ A;  2OWP A;  1GY6 A;  3PYJ A;  4OK0 A;  8CHO A;  1ROA A;  4R9K A;  3EX9 A;  4X2O A;  1L5G B;  1SIH A;  4H61 A;  2CH9 A;  1NB5 I;  1A2V A;  2QEX 3;  3FKA A;  2MC8 A;  3Q90 A;  2O9U X;  4H3U A;  1D6Y A;  3Q1C A;  3KSP A;  1N5P A;  1UUV B;  1RN7 A;  2BMR B;  1DVC A;  4N6M A;  3SVA A;  3EQQ B;  2Z76 A;  1QVG 2;  1LNH A;  4WHA A;  4R9L A;  2XSH B;  3KII A;  2BT3 A;  4HM5 B;  4Q53 A;  2B1X B;  2GBW B;  2ML6 A;  3FF0 A;  4O8S A;  5FGO A;  1W00 A;  1W7C A;  1UI8 A;  4WYK A;  1OHS A;  3PZW A;  3QK9 A;  4N3V A;  2WO0 A;  3DM8 A;  4IT7 A;  1VQM 3;  3MKI A;  2CIU A;  4EC6 A;  2M7O A;  3J7Y d;  2WGQ A;  2E2V A;  3MPH A;  1ZX2 A;  3LH4 A;  3PS8 A;  3U1W A;  3G4S 3;  1ISK A;  1IDP A;  2W04 A;  4HJL B;  4OUQ A;  1M90 4;  1DMM A;  1JN5 B;  4QWT A;  2BMQ B;  1UW1 A;  1QVF 2;  3HI7 A;  4HM4 B;  1UUW B;  1OHO A;  4NHF A;  5DRV A;  2XSO B;  3T8N A;  1W6C A;  5IEN A;  1A2K A;  2STD A;  3NM2 A;  4G1M B;  1U5O A;  4RNY A;  4EBG A;  4HZB B;  3BB9 A;  5CLK A;  3RGA A;  1M9G A;  3DZL A;  3STD A;  1LOX A;  1Q86 4;  4LMI A;  1VQ8 3;  2O3O A;  1OPY A;  2I9W A;  1FGT A;  1TFK A;  3MHE A;  5G2G A;  4KFE A;  5IW9 A;  1QJG A;  3AMO B;  3F14 A;  3HIG A;  3KN4 A;  1RJO A;  2CHC A;  3UNL A;  4CDL A;  3DY5 A;  5EEO A;  1V74 A;  2RSX A;  1O7H B;  3NBB A;  3X41 A;  2Y73 A;  3B4O A;  2XFT A;  3X42 A;  2PZV A;  3G6E 3;  1FGQ A;  3RGR A;  3V98 A;  3EN8 A;  2YFL B;  3X3X A;  3F8X A;  3NBR A;  1QAF A;  3CXC 2;  2L4V A;  4KFD A;  3GZY B;  1Q82 4;  3WMD A;  3M8C A;  1KC8 4;  3CPW 2;  3I56 3;  3FG1 A;  3DGL A;  2CFD A;  2P38 A;  1YVB I;  4N6N B;  2CFK A;  2R4I A;  5EQL A;  4HKV B;  1CYV A;  2JDI H;  3BLZ A;  3PXM A;  1EG9 B;  3IPT A;  4MMZ B;  7STD A;  1DMQ A;  3CU3 A;  1IVW A;  2Y74 A;  3D9R A;  4L7K A;  1NJI 4;  2OTJ 3;  3KSE D;  1HU9 A;  3NXJ A;  1PU4 A;  4XDV A;  3X3Z A;  1KD1 4;  5D83 A;  2Z7A A;  1Q42 A;  2GEY A;  1GY7 A;  2QGU A;  3NBJ A;  1VQ5 3;  3NQZ A;  1TP6 A;  3G8Z A;  4TX4 A;  3IMA B;  4FMB A;  1JV2 B;  1O7G B;  2OTL 3;  1ULI B;  2C11 A;  2MF7 A;  4FMC A;  3OWS A;  3WOD G;  2CWV A;  1JKG B;  1WNH A;  2W56 A;  5CXO A;  3UL6 A;  1N8R 4;  3K63 A;  3NM7 A;  2KRT A;  3DGM A;  3KZT A;  2W9Q A;  4PEJ A;  3SED A;  1OF5 A;  1Q40 A;  1IV7 A;  3LOY A;  1STD A;  3T0U A;  1SQW A;  4OVM A;  5ELJ A;  3CCS 3;  1VQ6 3;  1W4N A;  1K8A 4;  3K0Z A;  1EKM A;  4HYZ A;  5IG4 A;  1YHQ 3;  3DXO A;  4HM8 B;  1IVV A;  4K1V A;  2K0M A;  1D6U A;  1U8C B;  4HBR A;  1YI2 3;  1NU3 A;  3MG2 A;  1FUW A;  1IT7 A;  5AYR B;  1IVU A;  3K9M C;  4L8O A;  1VQO 3;  3CME 3;  2QIY A;  3PCS A;  1RRL A;  3VF1 A;  5LC7 A;  3FG3 A;  1ZO2 A;  2CKF B;  5HGR A;  1DMN A;  2OQE A;  3K7C A;  5TGN A;  1QMA A;  2BO9 B;  2D42 A;  1IQY A;  1VQ9 3;  1TUH A;  4KFF A;  1OCV A;  4HM6 B;  3EC9 A;  1EQK A;  3N9H A;  3CCE 3;  1W02 A;  1VQK 3;  4MJD A;  3OV4 A;  4HM0 B;  3UB1 A;  3F40 A;  4HVN A;  4XDW A;  2CC3 A;  3H51 A;  4MMY B;  1YJW 3;  1FGR A;  1IQ8 A;  2ZL8 A;  1HKX A;  2GU1 A;  2XH9 A;  1FA3 A;  3NQY A;  5LC6 A;  1NO3 A;  1IK3 A;  4O3V A;  2CFW A;  3WOE B;  3GZX B;  5I97 A;  3NV0 A;  5FW5 A;  4BTY A;  1A67 A;  1OF5 B;  1Q40 B;  2PNC A;  1W6Y A;  1W6G A;  4AKY A;  1Q81 4;  2XF3 A;  4HM1 B;  2P0M A;  5IG0 A;  4L8P A;  4R1K A;  4XB5 A;  4EYC A;  4FCZ A;  2Q07 A;  4R80 A;  3G0K A;  4RBN A;  1NB3 I;  3LXU X;  4GB5 A;  2HMJ B;  1C7H A;  3CNX A;  2OOV A;  5IEP A;  3ER7 A;  2INX A;  1IV9 A;  3WDG B;  3NX0 A;  3FCS B;  3CC4 3;  3VSY A;  2SBL A;  3U97 A;  1Y4K A;  2IUJ A;  2W6J H;  2W03 A;  4WP5 A;  3S67 A;  5JBS A;  2IA7 A;  1O7P B;  1J2B A;  1IQX A;  3VGN A;  1WMO A;  1RRH A;  5EVH A;  2BHM A;  3TDG A;  2Z77 A;  3FLJ A;  5D81 A;  1AVK A;  1S5A A;  3F7S A;  3LTD A;  2V1L A;  4K1U A;  4AKZ A;  2HMK B;  3CCM 3;  2YFI B;  3SOY A;  3DGO A;  4WYK B;  1WMN A;  3MSO A;  3UJM A;  5AIG A;  2K54 A;  2RCD A;  3B8L A;  2LQV A;  2HMM B;  3NV0 B;  3SX1 A;  1WQL B;  2HMN B;  4N6O B;  4JRF A;  2CG1 A;  2YX9 A;  1OUN A;  3H3H A;  4LGQ A;  3GWR A;  3G16 A;  2XFS A;  1AVL A;  2HML B;  3JUM A;  3S27 A;  3CCQ 3;  1VQP 3;  4NRE A;  1N8Q A;  4LSO A;  1VZZ A;  1OGX A;  2WOH A;  2RGQ A;  1GYB A;  1YGE A;  1N5H A;  3LTC A;  4EV2 A;  1E3R A;  3NHX A;  2XRX B;  5CF1 A;  3OW2 2;  1MNL A;  2C10 A;  2FGT A;  2IMJ A;  3JVC A;  3OWU A;  3LTB A;  1IU7 A;  3BNE A;  2GXF A;  3FH1 A;  2QA4 3;  3OXA A;  5D82 A;  3K5T A;  2GU3 A;  5AIF A;  3CC7 3;  3CCL 3;  3LYG A;  4LZI A;  1OGZ A;  5AIH A;  1UI7 A;  1AR0 A;  2CFG A;  3IJE B;  1DVD A;  3PGB A;  3GAX A;  3DGN A;  3BND A;  5IF6 A;  4KVH A;  5CF2 A;  2OQE C;  1YIT 3;  1W2B 2;  1O7M B;  4HM2 B;  5AEU B;  3JUP A;  5STD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...