3OWUA

Crystal structure of ketosteroid isomerase d40n/c69s/c81s/c97s/f86c-cn from p. putida with bound equilenin
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
129
structure length
128
Chain Sequence
b'NLPTAQEVQGLMARYIELVDVGDIEAIVQMYADDATVENPFGQPPIHGREQIAAFYRQGLGGGKVRASLTGPVRASHNGSGAMPRVEMVWNGQPSALDVIDVMRFDEHGRIQTMQAYWSEVNLSVREP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Steroid Delta-isomerase
publication title Quantitative, directional measurement of electric field heterogeneity in the active site of ketosteroid isomerase.
pubmed doi rcsb
source organism Pseudomonas putida
molecule tags Isomerase
total genus 35
structure length 128
sequence length 129
chains with identical sequence B, C, D
ec nomenclature ec 5.3.3.1: Steroid Delta-isomerase.
pdb deposition date 2010-09-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12680 SnoaL_2 SnoaL-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3owuA00
3EC9A 5IEOA 1S5AA 2GEYA 2BMOB 1W6YA 3EQQB 1SJWA 1A2KA 4CDLA 3ROBA 4L8OA 2XSOB 1OH0A 3NUVA 2BNGA 3CNMA 1BUQA 4HM2B 4XDVA 4K1VA 3F40A 4ORLA 1JKGA 1O7NB 4H3UA 3EN1B 4X2HA 3MG1A 6STDA 3RGAA 1O7GB 3FF2A 1Q42A 1OF5A 3F9SA 1O7PB 3MKIA 5KP1A 2I9WA 3BB9A 4XM4A 3DM8A 2GBXB 1HKXA 1OGXA 4HM3B 1ASKA 1U5OA 4Q53A 3B4PA 3JUOA 4L8PA 4WYKB 4FCJA 1ZX2A 5IERA 1ULIB 2QIYA 5CLKA 3JUMA 2RFRA 2RGQA 1GY5A 5D82A 1NU3A 1W01A 1CQSA 4XBXA 5D81A 4OUQA 2RCDA 4OVMA 1Z1SA 1W00A 1K41A 5JPUA 3NHXA 3OWSA 4RZMA 2F86B 3NM2A 1C7HA 1OCVA 3OWYA 1E97A 5FW5A 1STDA 4GB5A 3GWRA 3EJVA 1ULJB 3MSOA 3HZPA 4XB5A 4X2OA 3K0ZA 3FH1A 3I0YA 3F7SA 1IDPA 2INXA 2HMKB 5IG5A 2B1XB 2CHCA 4WWUC 2UX0A 5AI1A 1GY7A 5CF1A 1OHSA 1DMNA 3T8NA 1ISKA 1GY6A 5CK6A 5BXQA 3EBTA 3VGNA 3NV0A 4R9LA 3FZWA 3EX9A 2F98A 2GXFA 4HM7B 4I4KA 2R4IA 2XRXB 4PEJA 3GRDA 4HM0B 1O7MB 3M8CA 2CKFB 1O7WB 4HKVB 4MJDA 3IPTA 3H51A 5IG3A 5TGNA 3MG3A 1UUWB 2GEXA 3F7XA 5IG0A 3DUKA 4XDWA 1TUHA 1QJGA 5DRVA 3E99A 5STDA 5JPPA 1Q40A 3NBRA 4LMIA 5AEUB 5CXOA 5KP4A 3KE7A 4L7KA 2HMMB 2F99A 3GZBA 3DXOA 5DREA 2HMOB 2W2CA 2K54A 3F14A 5IENA 1O7HB 5AIGA 1OPYA 3DMCA 4R1KA 1W02A 1JKGB 3F8HA 1NDOB 4LGQA 1OHPA 2YFJB 3G0KA 5EVHA 3KKGA 3JUNA 3G8ZA 1OF5B 5IG4A 3HK4A 1JN5A 1E3VA 5IF6A 5AIHA 1EA2A 3T8UA 2BMRB 2BMQB 4HM1B 4HM6B 4HM4B 3RGRA 3ECFA 2HMNB 2XSHB 3B7CA 3G16A 3NXJA 5CF2A 1QMAA 3UJMA 1DMMA 3EN8A 2B24B 2PZVA 1NWWA 4K1UA 3EF8A 3SEDA 3BLZA 5G2GA 2XR8B 3LZAA 3D9RA 3GZRA 2GBWB 5IEPA 3OWUA 4XBYA 3SOYA 5AIIA 3CNXA 4KVHA 2OWPA 4HZBB 4WYKA 4R9KA 1JB4A 4HZ9B 3A76A 3SOAA 1JB5A 1AR0A 1EG9B 5BVBA 2Z7AA 1WQLB 3OXAA 3OX9A 3JUQA 2JQ5A 1ZO2A 1JB2A 3NV0B 3UNLA 2YFIB 5AIFA 3MHEA 3KZTA 5AEWB 3FSDA 4LEHA 3B4OA 3JUPA 3Q90A 1GYBA 5KP3A 3CPOA 2Z76A 4J8TA 3ER7A 2QGUA 3FGYA 4HM5B 4WP5A 3B8LA 4N3VA 3K7CA 1OGZA 2HMLB 8CHOA 3EBYA 7STDA 3WMDA 2Z77A 1E3RA 3MYTA 3GZXB 1Q40B 1GS3A 1OUNA 1DMQA 1VZZA 3HX8A 5HGRA 2HMJB 3EHCA 3S5CA 3STDA 4HVNA 1UUVB 3FKAA 3KSPA 3LYGA 1TP6A 3F8XA 3FF0A 5D83A 4STDA 4J9AA 3MG2A 3CU3A 4FCMA 3OV4A 3FLJA 3GZYB 3VSYA 2A15A 4XBTA 2YFLB 1OHOA 4HJLB 3H3HA 3DZLA 4U13A 1JN5B 4IIAA 2IMJA 4HM8B 2STDA
chains in the Genus database with same CATH superfamily
3X3XA 1M1K4 3AMOB 3ZFZA 5LC6A 3EC9A 5IEOA 1S5AA 1BRHA 2GEYA 3CC23 1JBSA 3WODG 2P0XA 3LT9A 1LXEA 2BMOB 4NREA 1IT7A 1X1UA 4HAAA 1W6YA 2LYXA 4N6TA 9RNTA 1Q824 3EQQB 4KFEA 1SJWA 1CYVA 1A2KA 2KF5A 2WOFA 3FG3A 4CDLA 3PGBA 1LNHA 1V58A 2CH9A 3FCSB 1KSIA 3ROBA 4L8OA 2XSOB 1OH0A 1GMQA 3NUVA 2BNGA 2W6JH 1T2HA 2YX9A 3GSPA 3Q3FA 3CNMA 1BUQA 4QWTA 1CH0A 1LQGC 1YNVX 4HM2B 4XDVA 1MNLA 4HBRA 4K1VA 3EE1A 3F40A 2XEPA 1JKGA 2Y74A 1Q7HA 1UCIA 4ORLA 1GOUA 1I3IA 1O7NB 4H3UA 2FGTA 1B2XA 1B2ZA 3IJEB 1LQMB 3I563 1LOXA 3LXUX 3TDGA 3EN1B 4I5QA 4X2HA 2CFKA 3MG1A 2CG0A 6STDA 3RGAA 1O7GB 3FF2A 1Q42A 3KIIA 1OF5A 1RGKA 1YGWA 3F9SA 3BNEA 1G0TA 1O7PB 2CX0A 3MKIA 5KP1A 1UGHI 2I9WA 3HIIA 1RKYA 1GOYA 4EC6A 3ZG5A 3BB9A 4XM4A 3DM8A 1QALA 4J5KA 2GBXB 1KQS2 1HKXA 5ELUA 1OGXA 3X41A 4FMDA 1NB5I 1JJ22 4HM3B 2KF4A 1ASKA 2BIRA 3X3YA 3DGLA 1LRAA 1I2FA 1BSAA 1U5OA 3SX1A 3CCQ3 4Q53A 1WTHA 4O02B 3B4PA 3JUOA 3WOFB 3DGYA 4OK0A 1X1XA 1BNGA 2CIUA 4L8PA 5G1KA 1A90A 3A5EA 4WYKB 2CFDA 4FCJA 3X42A 1D6UA 1ZX2A 7RNTA 1ULIB 3NBBA 2QIYA 1SARA 5CLKA 5IERA 1N5HA 4HOHA 1RN4A 3JUMA 1RNTA 3NX0A 3PZWA 2RFRA 2BT3A 2RGQA 4FMBA 1GY5A 5D82A 3K9MC 1NU3A 1W01A 1VQM3 1CQSA 1TRQA 1FGOA 3D79A 1IVVA 4XBXA 5D81A 1RLSA 4J5GA 1T3BA 4OUQA 3D5IA 4MMZB 2RCDA 4OVMA 1Z1SA 1I3FA 2OTJ3 1W00A 2IUKA 1K41A 3LTCA 5JPUA 1UCLA 3NHXA 1ROVA 2F86B 3NM2A 3OWSA 1C7HA 1OCVA 3OWYA 4RZMA 1BRSA 1GOVA 1B2SA 4BTWA 1E97A 1J2BA 5FW5A 3NM7A 1G96A 1UDII 2UGIA 1BNFA 1STDA 1YI23 2KF6A 1YIJ3 1UI8A 1FGTA 1W5ZA 2HOHA 3SYUA 3V99A 4GB5A 5M19A 1MGWA 1YJ93 1BAOA 1BU4A 3GWRA 3LTBA 5GSPA 4DKIA 1I70A 1ULJB 3EJVA 4MMYB 4O2HA 3MSOA 1B27A 3BNBA 1FUWA 1LVNA 3HZPA 1IU7A 1F8NA 4X2OA 3K0ZA 4XB5A 1YJN3 1QVG2 4K61A 1MGRA 3FH1A 3I0YA 3EB8A 1D6ZA 5LC7A 2CWUA 3F7SA 1ZGXA 4R80A 3VF1A 1IDPA 1GMRA 1L5GB 2INXA 1T2IA 2CFWA 2HMKB 1D6YA 1GSPA 1FA3A 2CX1A 3DY5A 2LQVA 5IG5A 2B1XB 2D42A 2CHCA 2RBIA 4WWUC 2UX0A 1LOWA 5AI1A 1GY7A 3SVAA 1BNJA 3WHOA 1RGCA 4EW5A 5CF1A 1OHSA 4NHFA 3CCU3 1JZOA 1DMNA 3T8NA 3DH2A 2OOVA 1ISKA 1HU9A 1YVSA 4GSPA 3CCR3 1GY6A 5CK6A 2BHMA 2F5MA 2OQEA 3RDEA 1AQZA 5BXQA 3ALAA 2XFTA 1K734 3EBTA 3VGNA 3NV0A 4R9LA 2IY2A 3WOEB 3FZWA 1LOVA 3EX9A 2C10A 1BRJA 5ELJA 2F98A 7GSPA 4IT7A 2GXFA 3LTAA 4HM7B 3NQYA 1KWIA 1V74A 4I4KA 1CYUA 1TFOA 2R4IA 1IVXA 2XRXB 2Z6BA 1WMNA 2R41A 4PEJA 3GRDA 4HM8B 3Q1CA 1JNQA 4HM0B 1O7MB 3U97A 1EQKA 4BTYA 3M8CA 1JZDA 2CKFB 1O7WB 2W56A 4HKVB 4CPKA 1V57A 4MJDA 3CC43 1PU4A 1HZ1A 1I2EA 1NB3I 3N8BA 3CCJ3 1RRHA 3H51A 3IPTA 3WA3A 5IG3A 1MWTA 5TGNA 2CWTA 8RNTA 2CFLA 3MG3A 1YJW3 1UUWB 2GEXA 2Q07A 3BU4A 3O8YA 1VQQA 2QA43 3VSYA 3F7XA 4TX4A 5IG0A 2WGOA 1I8VA 1PFPA 3DUKA 4XDWA 1TUHA 1QJGA 5A0OB 2W9QA 3KFQC 3AHWA 3X40A 1BSEA 1A67A 4BIRA 4RNZA 5DRVA 3E99A 1R4CA 3CCE3 2P0MA 5EEOA 3CD63 5STDA 5EQLA 3KSED 1AVKA 1FUTA 3LTDA 2GU3A 4EV5A 1K8A4 1MOLA 3T0UA 1JBRA 1TIJA 4KFDA 1IT8A 1PYLA 2KCDA 5JPPA 1RN7A 1Q40A 3NBRA 3MWZA 4LMIA 4RNTA 5AYSC 5AEUB 5CXOA 5HOHA 5KP4A 1Q864 3KE7A 1FGMA 4L7KA 4N6LA 4NPBA 4CJNA 1TTOA 1BOXA 1S723 3PS8A 2CG1A 3IMAB 1SQWA 2HMMB 1B2MA 2F99A 2UUGC 3GZBA 3L0RA 3DXOA 5DREA 2HMOB 2W2CA 1MWRA 1WMOA 2K54A 1UCJA 1VQ63 2KRTA 3S27A 1BSDA 3F14A 1QAKA 5IENA 1O7HB 2H0IA 1OPYA 3DMCA 1RGAA 4G1MB 5AIGA 6RNTA 2QEX3 3AGNA 2CC3A 4R1KA 1W02A 2JDIH 1JKGB 1US1A 3F8HA 1Q7Y4 1NDOB 5I97A 3DGOA 4LGQA 3URPA 1OHPA 2YFJB 2XFSA 2ZHXB 3G0KA 4N6OB 5EVHA 1DE3A 1SPUA 1R4YA 3KKGA 3JUNA 3G8ZA 3D5GA 3K5TA 3PYJA 1X1YA 1OF5B 5IG4A 3G713 2FXTA 1BSBA 2D1WA 3HK4A 1I2GA 1AY7A 1RN1A 3K63A 2RNTA 1KD14 1LNIA 2O3OA 4BTXA 1RMSA 4LZIA 1N8R4 1JN5A 1E3VA 2CW9A 2P09A 2Y73A 4MMXB 5IF6A 1M904 1DVCA 5AIHA 1EA2A 3T8UA 2BMRB 4JRFA 4EYCA 2BMQB 3BNDA 1Q9EA 3S28A 1B3SA 3AMOA 3J7Yd 4HM1B 1IV9A 1JBTA 4ZM8A 3PCSA 4HM6B 4HM4B 3RGRA 1QVF2 3ZG0A 1VQ53 2CFGA 1W6GA 3ECFA 2W03A 3V92A 2HMNB 3NQZA 3BIRA 2XSHB 1FZUA 2RSXA 2IYJA 3B7CA 1IVWA 1DETA 3G16A 3NXJA 3FG1A 2AAEA 4KZ1A 2ML6A 5CF2A 1DYUA 4EBGA 1QMAA 3UJMA 2MC8A 2MF7A 1GMPA 1VQO3 1C54A 2V1LA 1DMMA 1M9GA 4H61A 3HOHA 2SARA 1B2UA 4CCVA 1KC84 3EN8A 1W2B2 2B24B 2PZVA 2BO9B 4K1UA 5AYRB 3EF8A 2CK3H 1I0VA 3Q2PA 3SEDA 5M18A 1FW7A 4JF8A 3BLZA 3DGMA 5G2GA 2XR8B 2K3DA 1I0XA 1OACA 1YIT3 4O8SA 1RGEA 2H0HA 1SIIA 2E2TA 1RJOA 2J8XB 1GD3A 3V98A 1UCKA 1QAFA 1EUIC 3AGOA 3LZAA 3D9RA 4BU4A 4RNYA 3D4AA 4LSOA 2ZA4A 5BIRA 3KN4A 2GU1A 1VQL3 1TJDA 1IV7A 2XF3A 3GZRA 1JV2B 2GBWB 5IEPA 3OWUA 1BRGA 4XBYA 1G02A 3SOYA 1IVUA 2XGLA 1IQYA 1N8QA 4N6NB 4N6UA 5AIIA 3GAXA 2L1SA 1MWUA 1CEWI 3CNXA 2OWPA 4KVHA 4HZBB 3WDGB 2CWVA 1WMPA 4WYKA 1N9EA 1RDSA 1T5YA 4R9KA 2IA7A 1RGGA 1JB4A 1BNEA 4HZ9B 2XH9A 3A76A 2WGQA 3SOAA 4RBNA 1FGRA 1JB5A 3DGNA 1Q814 1AR0A 3SLUA 1TU5A 1EG9B 1BVIA 1N5PA 2Z7AA 1Y4KA 5BVBA 3CPW2 1K28A 1TRPA 1WQLB 1A2PA 3OXAA 1PY3A 1BRNL 2W0QA 3OX9A 4FMCA 4BL2A 1YVBI 3JUQA 2JQ5A 4FR9A 1ZO2A 1JB2A 2GSPA 3NV0B 1ROAA 2P05A 4HYZA 1BNRA 3UNLA 1NJI4 2YFIB 2ML5A 2XGNA 5AIFA 1RCKA 2E2VA 1VQK3 2PNCA 3MHEA 3X3ZA 4AKZA 3OW22 3JVCA 2F56A 3KZTA 1AV4A 1A2VA 2P38A 3RNTA 1JRQA 5AEWB 2ZDJA 1W6CA 1U8CB 2M7OA 1BRKA 2WOHA 3G6E3 1K9M4 1RHLA 3CCM3 3FSDA 2W56B 3N9HA 4LEHA 3B4OA 3G4S3 2KXGA 3JUPA 3PXMA 1IQXA 3I553 3Q90A 4GL6A 1B21A 1GYBA 5KP3A 2ZL8A 1LOYA 3CCL3 2SBLA 1BANA 1BIRA 3SXXA 1RSNA 3CPOA 2KF3A 2Z76A 1BGSA 3CME3 4J8TA 4WHAA 3S67A 3ER7A 1UGIA 5JBSA 3KCHA 2QGUA 4K90B 1VQP3 3CC73 3FGYA 3FG4A 4HM5B 1RGFA 4KT3B 4WP5A 3AHSA 3B8LA 4LYLB 1RGLA 4N3VA 1SIHA 1YHQ3 3K7CA 1STFI 1VQ43 1BSCA 4R4KA 1OGZA 4IPBA 1RNBA 2E2UA 1GD4A 2HMLB 1RTUA 3BNCA 4GHOA 3MPHA 2OTL3 8CHOA 3EBYA 7STDA 3WMDA 3WR2A 5G1LA 1IYYA 4AEQA 1FYSA 2Z77A 2F4YA 1FUSA 1E3RA 4MEIA 3MYTA 3GZXB 3HI7A 1X1WA 3WA2X 1BNSA 1YGEA 3LMLA 1AVLA 2FNQA 3LT8A 1Q40B 4BL3A 1MWSA 1GS3A 1OUNA 2WO0A 1DMQA 1VZZA 2W04A 3HX8A 1W7CA 3HIGA 4N6V0 5HGRA 1DVDA 4N6MA 2HMJB 1BUJA 3EHCA 4WFOA 1IK3A 1M1XB 4AKYA 3CMA3 1UW1A 1B20A 1VQ73 4FMAA 3CCS3 2IUJA 1BNIA 2K0MA 1EKMA 1RRLA 1W2ZA 3S5CA 5RNTA 3STDA 3CCV3 1VQ93 2O9UX 4HVNA 2L4VA 5FGOA 1UUVB 3UB1A 3FKAA 1RGHA 3KSPA 3LYGA 1TP6A 2AADA 3F8XA 3FF0A 5IW9A 5D83A 4STDA 3QRDA 5M1AA 4J9AA 3MG2A 3CU3A 2BU4A 1ZS7A 1RCLA 1W4NA 2OOVC 3NBJA 4FCMA 3QK9A 3UL5A 3OV4A 4EV2A 1VQ83 1FGQA 3CXC2 1UI7A 3FLJA 3PCRA 2OQEC 3U1WA 2C4BA 2C11A 1N9JA 4EXRA 1TFKA 3GZYB 1WNHA 2A15A 1UUGB 4XBTA 2YFLB 1NO3A 1OHOA 4O3VA 1HYFA 3UL6A 4HJLB 4ILFA 1VQN3 3H3HA 4KFFA 1NNVA 3S29A 6GSPA 3LH4A 3DZLA 4U13A 1JN5B 1EEJA 1BRIA 2KAAA 4IIAA 3N54B 2F5WA 3LOYA 5BU4A 1IQ8A 2W9PA 4FCZA 2IMJA 1NWWA 3D3LA 2OCTA 2STDA 2H0GA
chains in the Genus database with same CATH topology
3X3XA 1M1K4 3AMOB 5LC6A 3EC9A 5IEOA 1S5AA 2GEYA 3CC23 3WODG 2P0XA 3LT9A 1LXEA 2BMOB 4NREA 1IT7A 1Q824 1W6YA 2LYXA 4N6TA 3EQQB 4KFEA 1SJWA 1CYVA 1A2KA 2WOFA 3FG3A 4CDLA 3PGBA 1LNHA 2CH9A 3FCSB 1KSIA 3ROBA 4L8OA 2XSOB 1OH0A 3NUVA 2BNGA 2W6JH 2YX9A 3CNMA 1BUQA 4QWTA 4HM2B 4XDVA 1MNLA 4HBRA 4K1VA 3EE1A 3F40A 2XEPA 1JKGA 2Y74A 4ORLA 1O7NB 4H3UA 2FGTA 3I563 3IJEB 1LOXA 3LXUX 3TDGA 3EN1B 4X2HA 2CFKA 3MG1A 2CG0A 6STDA 3RGAA 1O7GB 3FF2A 1Q42A 3KIIA 1OF5A 3F9SA 3BNEA 1O7PB 3MKIA 5KP1A 2I9WA 3HIIA 1RKYA 4EC6A 3BB9A 4XM4A 3DM8A 1QALA 2GBXB 1KQS2 1HKXA 5ELUA 1OGXA 3X41A 4FMDA 1NB5I 1JJ22 4HM3B 1ASKA 3X3YA 3DGLA 1U5OA 3SX1A 3CCQ3 4Q53A 1WTHA 4O02B 3B4PA 3JUOA 3WOFB 4OK0A 2CIUA 4L8PA 1A90A 4WYKB 2CFDA 4FCJA 3X42A 1D6UA 1ZX2A 5IERA 1ULIB 3NBBA 2QIYA 5CLKA 1N5HA 3JUMA 3NX0A 3PZWA 2RFRA 2BT3A 2RGQA 4FMBA 1GY5A 5D82A 3K9MC 1NU3A 1W01A 1VQM3 1CQSA 1FGOA 1IVVA 4XBXA 5D81A 4OUQA 4MMZB 2RCDA 4OVMA 1Z1SA 2OTJ3 1W00A 2IUKA 1K41A 3LTCA 5JPUA 3NHXA 1ROVA 2F86B 3NM2A 3OWSA 1C7HA 1OCVA 3OWYA 4RZMA 4BTWA 1E97A 1J2BA 5FW5A 3NM7A 1G96A 1YI23 1STDA 1YIJ3 1UI8A 1FGTA 1W5ZA 3V99A 4GB5A 1YJ93 3GWRA 3LTBA 3EJVA 1ULJB 4MMYB 4O2HA 3MSOA 3BNBA 1FUWA 1LVNA 3HZPA 1IU7A 1F8NA 4X2OA 3K0ZA 4XB5A 1YJN3 1QVG2 4K61A 3FH1A 3I0YA 3EB8A 1D6ZA 5LC7A 2CWUA 3F7SA 4R80A 3VF1A 1IDPA 1L5GB 2INXA 2CFWA 2HMKB 1D6YA 1FA3A 3DY5A 2LQVA 5IG5A 2B1XB 2D42A 2CHCA 4WWUC 2UX0A 5AI1A 1GY7A 3SVAA 5CF1A 1OHSA 4NHFA 3CCU3 1DMNA 3T8NA 2OOVA 1ISKA 1HU9A 3CCR3 1GY6A 5CK6A 2BHMA 3RDEA 2OQEA 5BXQA 3ALAA 2XFTA 1K734 3EBTA 3VGNA 3NV0A 4R9LA 3WOEB 3FZWA 3EX9A 2C10A 5ELJA 2F98A 4IT7A 2GXFA 3LTAA 4HM7B 3NQYA 1KWIA 1V74A 4I4KA 1CYUA 1TFOA 2R4IA 1IVXA 2XRXB 2Z6BA 1WMNA 4PEJA 3GRDA 4HM8B 3Q1CA 1JNQA 4HM0B 1O7MB 3U97A 1EQKA 4BTYA 3M8CA 2CKFB 1O7WB 2W56A 4HKVB 3CC43 4MJDA 1PU4A 3CCJ3 3N8BA 1NB3I 1RRHA 3H51A 3IPTA 3WA3A 5IG3A 5TGNA 2CWTA 2CFLA 3MG3A 1YJW3 1UUWB 2GEXA 2Q07A 3O8YA 2QA43 3F7XA 4TX4A 5IG0A 2WGOA 1PFPA 3DUKA 4XDWA 1TUHA 1QJGA 5A0OB 2W9QA 3KFQC 3X40A 1A67A 4RNZA 5DRVA 3E99A 1R4CA 3CCE3 2P0MA 5EEOA 3CD63 5STDA 5EQLA 3KSED 1AVKA 3LTDA 2GU3A 4EV5A 1K8A4 1MOLA 3T0UA 1TIJA 4KFDA 1IT8A 2KCDA 5JPPA 1RN7A 1Q40A 3NBRA 3MWZA 4LMIA 5AYSC 5AEUB 5CXOA 5KP4A 1Q864 3KE7A 1FGMA 4L7KA 4N6LA 1S723 3PS8A 2CG1A 3IMAB 1SQWA 2HMMB 2F99A 3GZBA 3L0RA 3DXOA 5DREA 2HMOB 2W2CA 1WMOA 2K54A 1VQ63 2KRTA 3S27A 3F14A 1QAKA 5IENA 1O7HB 5AIGA 1OPYA 3DMCA 4G1MB 2QEX3 2CC3A 4R1KA 1W02A 2JDIH 1JKGB 1US1A 3F8HA 1Q7Y4 1NDOB 5I97A 3DGOA 4LGQA 1OHPA 2YFJB 2XFSA 3G0KA 4N6OB 5EVHA 1SPUA 3KKGA 3JUNA 3G8ZA 3K5TA 3PYJA 1OF5B 5IG4A 3G713 2FXTA 2D1WA 3HK4A 3K63A 1KD14 2O3OA 4BTXA 1N8R4 4LZIA 1JN5A 1E3VA 2CW9A 2P09A 2Y73A 4MMXB 5IF6A 1M904 1DVCA 5AIHA 1EA2A 3T8UA 2BMRB 4JRFA 4EYCA 2BMQB 3BNDA 3S28A 3AMOA 3J7Yd 4HM1B 1IV9A 4ZM8A 3PCSA 4HM6B 4HM4B 3RGRA 1QVF2 1VQ53 2CFGA 1W6GA 3ECFA 2W03A 3V92A 2HMNB 3NQZA 2XSHB 2RSXA 3B7CA 3G16A 1IVWA 3NXJA 3FG1A 4KZ1A 2ML6A 5CF2A 1DYUA 4EBGA 1QMAA 3UJMA 2MC8A 2MF7A 1VQO3 2V1LA 1DMMA 1M9GA 4H61A 4CCVA 1KC84 3EN8A 1W2B2 2B24B 2PZVA 2BO9B 4K1UA 5AYRB 3EF8A 2CK3H 3Q2PA 3SEDA 4JF8A 3BLZA 3DGMA 5G2GA 2XR8B 1YIT3 1OACA 4O8SA 1SIIA 2E2TA 1RJOA 1GD3A 3V98A 1QAFA 3LZAA 3D9RA 4RNYA 4LSOA 3KN4A 2GU1A 1VQL3 2XF3A 1IV7A 3GZRA 1JV2B 2GBWB 5IEPA 3OWUA 4XBYA 3SOYA 1IVUA 2XGLA 1IQYA 1N8QA 4N6NB 4N6UA 5AIIA 3GAXA 1CEWI 3CNXA 2OWPA 4KVHA 4HZBB 3WDGB 2CWVA 1WMPA 4WYKA 1N9EA 1T5YA 4R9KA 2IA7A 1JB4A 4HZ9B 2XH9A 3A76A 2WGQA 3SOAA 4RBNA 1FGRA 1JB5A 3DGNA 1Q814 1AR0A 3SLUA 1TU5A 1EG9B 5BVBA 2Z7AA 1N5PA 1Y4KA 3CPW2 1K28A 1WQLB 3OXAA 2W0QA 3OX9A 4FMCA 1YVBI 3JUQA 2JQ5A 4FR9A 1ZO2A 1JB2A 3NV0B 1ROAA 2P05A 4HYZA 3UNLA 1NJI4 2YFIB 2ML5A 2XGNA 5AIFA 1VQK3 2E2VA 2PNCA 3MHEA 3X3ZA 4AKZA 3OW22 3JVCA 3KZTA 1AV4A 1A2VA 2P38A 5AEWB 1JRQA 2ZDJA 1W6CA 1U8CB 2M7OA 3G6E3 2WOHA 1K9M4 3CCM3 3FSDA 2W56B 3N9HA 4LEHA 3B4OA 3G4S3 2KXGA 3JUPA 3PXMA 1IQXA 3I553 3Q90A 4GL6A 1GYBA 5KP3A 2ZL8A 3CCL3 2SBLA 3SXXA 3CPOA 2Z76A 3CME3 4J8TA 4WHAA 3S67A 3ER7A 5JBSA 2QGUA 4K90B 1VQP3 3CC73 3FGYA 3FG4A 4HM5B 4WP5A 3B8LA 4N3VA 1SIHA 1YHQ3 3K7CA 1STFI 1VQ43 4R4KA 1OGZA 4IPBA 2E2UA 1GD4A 2HMLB 3BNCA 3MPHA 2OTL3 8CHOA 3EBYA 7STDA 3WMDA 4AEQA 2Z77A 1E3RA 4MEIA 3MYTA 3GZXB 3HI7A 3WA2X 1YGEA 3LMLA 1AVLA 2FNQA 3LT8A 1Q40B 2WO0A 1GS3A 1OUNA 1DMQA 1VZZA 2W04A 3HX8A 1W7CA 3HIGA 4N6V0 5HGRA 1DVDA 4N6MA 2HMJB 3EHCA 4WFOA 1IK3A 1M1XB 4AKYA 3CMA3 1UW1A 1VQ73 4FMAA 3CCS3 2IUJA 2K0MA 1EKMA 1RRLA 1W2ZA 3S5CA 3CCV3 3STDA 1VQ93 2O9UX 4HVNA 2L4VA 5FGOA 1UUVB 3UB1A 3FKAA 3KSPA 3LYGA 1TP6A 3F8XA 3FF0A 5IW9A 5D83A 4STDA 3QRDA 4J9AA 3MG2A 3CU3A 2OOVC 4FCMA 1W4NA 3NBJA 4EV2A 3UL5A 3QK9A 1VQ83 3OV4A 1FGQA 3CXC2 1UI7A 3FLJA 3PCRA 2OQEC 3U1WA 2C11A 1N9JA 4EXRA 1TFKA 3GZYB 1WNHA 2A15A 4XBTA 3VSYA 2YFLB 1NO3A 1OHOA 4O3VA 3UL6A 4HJLB 1VQN3 3H3HA 4KFFA 3S29A 3LH4A 3DZLA 4U13A 1JN5B 4IIAA 3N54B 3LOYA 1IQ8A 2W9PA 4FCZA 2IMJA 1NWWA 3D3LA 2OCTA 2STDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EC9 A;  5IEO A;  1S5A A;  2GEY A;  2BMO B;  1W6Y A;  3EQQ B;  1SJW A;  1A2K A;  4CDL A;  3ROB A;  4L8O A;  2XSO B;  1OH0 A;  3NUV A;  2BNG A;  3CNM A;  1BUQ A;  4HM2 B;  4XDV A;  4K1V A;  3F40 A;  4ORL A;  1JKG A;  1O7N B;  4H3U A;  3EN1 B;  4X2H A;  3MG1 A;  6STD A;  3RGA A;  1O7G B;  3FF2 A;  1Q42 A;  1OF5 A;  3F9S A;  1O7P B;  3MKI A;  5KP1 A;  2I9W A;  3BB9 A;  4XM4 A;  3DM8 A;  2GBX B;  1HKX A;  1OGX A;  4HM3 B;  1ASK A;  1U5O A;  4Q53 A;  3B4P A;  3JUO A;  4L8P A;  4WYK B;  4FCJ A;  1ZX2 A;  5IER A;  1ULI B;  2QIY A;  5CLK A;  3JUM A;  2RFR A;  2RGQ A;  1GY5 A;  5D82 A;  1NU3 A;  1W01 A;  1CQS A;  4XBX A;  5D81 A;  4OUQ A;  2RCD A;  4OVM A;  1Z1S A;  1W00 A;  1K41 A;  5JPU A;  3NHX A;  3OWS A;  4RZM A;  2F86 B;  3NM2 A;  1C7H A;  1OCV A;  3OWY A;  1E97 A;  5FW5 A;  1STD A;  4GB5 A;  3GWR A;  3EJV A;  1ULJ B;  3MSO A;  3HZP A;  4XB5 A;  4X2O A;  3K0Z A;  3FH1 A;  3I0Y A;  3F7S A;  1IDP A;  2INX A;  2HMK B;  5IG5 A;  2B1X B;  2CHC A;  4WWU C;  2UX0 A;  5AI1 A;  1GY7 A;  5CF1 A;  1OHS A;  1DMN A;  3T8N A;  1ISK A;  1GY6 A;  5CK6 A;  5BXQ A;  3EBT A;  3VGN A;  3NV0 A;  4R9L A;  3FZW A;  3EX9 A;  2F98 A;  2GXF A;  4HM7 B;  4I4K A;  2R4I A;  2XRX B;  4PEJ A;  3GRD A;  4HM0 B;  1O7M B;  3M8C A;  2CKF B;  1O7W B;  4HKV B;  4MJD A;  3IPT A;  3H51 A;  5IG3 A;  5TGN A;  3MG3 A;  1UUW B;  2GEX A;  3F7X A;  5IG0 A;  3DUK A;  4XDW A;  1TUH A;  1QJG A;  5DRV A;  3E99 A;  5STD A;  5JPP A;  1Q40 A;  3NBR A;  4LMI A;  5AEU B;  5CXO A;  5KP4 A;  3KE7 A;  4L7K A;  2HMM B;  2F99 A;  3GZB A;  3DXO A;  5DRE A;  2HMO B;  2W2C A;  2K54 A;  3F14 A;  5IEN A;  1O7H B;  5AIG A;  1OPY A;  3DMC A;  4R1K A;  1W02 A;  1JKG B;  3F8H A;  1NDO B;  4LGQ A;  1OHP A;  2YFJ B;  3G0K A;  5EVH A;  3KKG A;  3JUN A;  3G8Z A;  1OF5 B;  5IG4 A;  3HK4 A;  1JN5 A;  1E3V A;  5IF6 A;  5AIH A;  1EA2 A;  3T8U A;  2BMR B;  2BMQ B;  4HM1 B;  4HM6 B;  4HM4 B;  3RGR A;  3ECF A;  2HMN B;  2XSH B;  3B7C A;  3G16 A;  3NXJ A;  5CF2 A;  1QMA A;  3UJM A;  1DMM A;  3EN8 A;  2B24 B;  2PZV A;  1NWW A;  4K1U A;  3EF8 A;  3SED A;  3BLZ A;  5G2G A;  2XR8 B;  3LZA A;  3D9R A;  3GZR A;  2GBW B;  5IEP A;  3OWU A;  4XBY A;  3SOY A;  5AII A;  3CNX A;  4KVH A;  2OWP A;  4HZB B;  4WYK A;  4R9K A;  1JB4 A;  4HZ9 B;  3A76 A;  3SOA A;  1JB5 A;  1AR0 A;  1EG9 B;  5BVB A;  2Z7A A;  1WQL B;  3OXA A;  3OX9 A;  3JUQ A;  2JQ5 A;  1ZO2 A;  1JB2 A;  3NV0 B;  3UNL A;  2YFI B;  5AIF A;  3MHE A;  3KZT A;  5AEW B;  3FSD A;  4LEH A;  3B4O A;  3JUP A;  3Q90 A;  1GYB A;  5KP3 A;  3CPO A;  2Z76 A;  4J8T A;  3ER7 A;  2QGU A;  3FGY A;  4HM5 B;  4WP5 A;  3B8L A;  4N3V A;  3K7C A;  1OGZ A;  2HML B;  8CHO A;  3EBY A;  7STD A;  3WMD A;  2Z77 A;  1E3R A;  3MYT A;  3GZX B;  1Q40 B;  1GS3 A;  1OUN A;  1DMQ A;  1VZZ A;  3HX8 A;  5HGR A;  2HMJ B;  3EHC A;  3S5C A;  3STD A;  4HVN A;  1UUV B;  3FKA A;  3KSP A;  3LYG A;  1TP6 A;  3F8X A;  3FF0 A;  5D83 A;  4STD A;  4J9A A;  3MG2 A;  3CU3 A;  4FCM A;  3OV4 A;  3FLJ A;  3GZY B;  3VSY A;  2A15 A;  4XBT A;  2YFL B;  1OHO A;  4HJL B;  3H3H A;  3DZL A;  4U13 A;  1JN5 B;  4IIA A;  2IMJ A;  4HM8 B;  2STD A; 
#chains in the Genus database with same CATH topology
 3X3X A;  1M1K 4;  3AMO B;  3ZFZ A;  5LC6 A;  3EC9 A;  5IEO A;  1S5A A;  1BRH A;  2GEY A;  3CC2 3;  1JBS A;  3WOD G;  2P0X A;  3LT9 A;  1LXE A;  2BMO B;  4NRE A;  1IT7 A;  1X1U A;  4HAA A;  1W6Y A;  2LYX A;  4N6T A;  9RNT A;  1Q82 4;  3EQQ B;  4KFE A;  1SJW A;  1CYV A;  1A2K A;  2KF5 A;  2WOF A;  3FG3 A;  4CDL A;  3PGB A;  1LNH A;  1V58 A;  2CH9 A;  3FCS B;  1KSI A;  3ROB A;  4L8O A;  2XSO B;  1OH0 A;  1GMQ A;  3NUV A;  2BNG A;  2W6J H;  1T2H A;  2YX9 A;  3GSP A;  3Q3F A;  3CNM A;  1BUQ A;  4QWT A;  1CH0 A;  1LQG C;  1YNV X;  4HM2 B;  4XDV A;  1MNL A;  4HBR A;  4K1V A;  3EE1 A;  3F40 A;  2XEP A;  1JKG A;  2Y74 A;  1Q7H A;  1UCI A;  4ORL A;  1GOU A;  1I3I A;  1O7N B;  4H3U A;  2FGT A;  1B2X A;  1B2Z A;  3IJE B;  1LQM B;  3I56 3;  1LOX A;  3LXU X;  3TDG A;  3EN1 B;  4I5Q A;  4X2H A;  2CFK A;  3MG1 A;  2CG0 A;  6STD A;  3RGA A;  1O7G B;  3FF2 A;  1Q42 A;  3KII A;  1OF5 A;  1RGK A;  1YGW A;  3F9S A;  3BNE A;  1G0T A;  1O7P B;  2CX0 A;  3MKI A;  5KP1 A;  1UGH I;  2I9W A;  3HII A;  1RKY A;  1GOY A;  4EC6 A;  3ZG5 A;  3BB9 A;  4XM4 A;  3DM8 A;  1QAL A;  4J5K A;  2GBX B;  1KQS 2;  1HKX A;  5ELU A;  1OGX A;  3X41 A;  4FMD A;  1NB5 I;  1JJ2 2;  4HM3 B;  2KF4 A;  1ASK A;  2BIR A;  3X3Y A;  3DGL A;  1LRA A;  1I2F A;  1BSA A;  1U5O A;  3SX1 A;  3CCQ 3;  4Q53 A;  1WTH A;  4O02 B;  3B4P A;  3JUO A;  3WOF B;  3DGY A;  4OK0 A;  1X1X A;  1BNG A;  2CIU A;  4L8P A;  5G1K A;  1A90 A;  3A5E A;  4WYK B;  2CFD A;  4FCJ A;  3X42 A;  1D6U A;  1ZX2 A;  7RNT A;  1ULI B;  3NBB A;  2QIY A;  1SAR A;  5CLK A;  5IER A;  1N5H A;  4HOH A;  1RN4 A;  3JUM A;  1RNT A;  3NX0 A;  3PZW A;  2RFR A;  2BT3 A;  2RGQ A;  4FMB A;  1GY5 A;  5D82 A;  3K9M C;  1NU3 A;  1W01 A;  1VQM 3;  1CQS A;  1TRQ A;  1FGO A;  3D79 A;  1IVV A;  4XBX A;  5D81 A;  1RLS A;  4J5G A;  1T3B A;  4OUQ A;  3D5I A;  4MMZ B;  2RCD A;  4OVM A;  1Z1S A;  1I3F A;  2OTJ 3;  1W00 A;  2IUK A;  1K41 A;  3LTC A;  5JPU A;  1UCL A;  3NHX A;  1ROV A;  2F86 B;  3NM2 A;  3OWS A;  1C7H A;  1OCV A;  3OWY A;  4RZM A;  1BRS A;  1GOV A;  1B2S A;  4BTW A;  1E97 A;  1J2B A;  5FW5 A;  3NM7 A;  1G96 A;  1UDI I;  2UGI A;  1BNF A;  1STD A;  1YI2 3;  2KF6 A;  1YIJ 3;  1UI8 A;  1FGT A;  1W5Z A;  2HOH A;  3SYU A;  3V99 A;  4GB5 A;  5M19 A;  1MGW A;  1YJ9 3;  1BAO A;  1BU4 A;  3GWR A;  3LTB A;  5GSP A;  4DKI A;  1I70 A;  1ULJ B;  3EJV A;  4MMY B;  4O2H A;  3MSO A;  1B27 A;  3BNB A;  1FUW A;  1LVN A;  3HZP A;  1IU7 A;  1F8N A;  4X2O A;  3K0Z A;  4XB5 A;  1YJN 3;  1QVG 2;  4K61 A;  1MGR A;  3FH1 A;  3I0Y A;  3EB8 A;  1D6Z A;  5LC7 A;  2CWU A;  3F7S A;  1ZGX A;  4R80 A;  3VF1 A;  1IDP A;  1GMR A;  1L5G B;  2INX A;  1T2I A;  2CFW A;  2HMK B;  1D6Y A;  1GSP A;  1FA3 A;  2CX1 A;  3DY5 A;  2LQV A;  5IG5 A;  2B1X B;  2D42 A;  2CHC A;  2RBI A;  4WWU C;  2UX0 A;  1LOW A;  5AI1 A;  1GY7 A;  3SVA A;  1BNJ A;  3WHO A;  1RGC A;  4EW5 A;  5CF1 A;  1OHS A;  4NHF A;  3CCU 3;  1JZO A;  1DMN A;  3T8N A;  3DH2 A;  2OOV A;  1ISK A;  1HU9 A;  1YVS A;  4GSP A;  3CCR 3;  1GY6 A;  5CK6 A;  2BHM A;  2F5M A;  2OQE A;  3RDE A;  1AQZ A;  5BXQ A;  3ALA A;  2XFT A;  1K73 4;  3EBT A;  3VGN A;  3NV0 A;  4R9L A;  2IY2 A;  3WOE B;  3FZW A;  1LOV A;  3EX9 A;  2C10 A;  1BRJ A;  5ELJ A;  2F98 A;  7GSP A;  4IT7 A;  2GXF A;  3LTA A;  4HM7 B;  3NQY A;  1KWI A;  1V74 A;  4I4K A;  1CYU A;  1TFO A;  2R4I A;  1IVX A;  2XRX B;  2Z6B A;  1WMN A;  2R41 A;  4PEJ A;  3GRD A;  4HM8 B;  3Q1C A;  1JNQ A;  4HM0 B;  1O7M B;  3U97 A;  1EQK A;  4BTY A;  3M8C A;  1JZD A;  2CKF B;  1O7W B;  2W56 A;  4HKV B;  4CPK A;  1V57 A;  4MJD A;  3CC4 3;  1PU4 A;  1HZ1 A;  1I2E A;  1NB3 I;  3N8B A;  3CCJ 3;  1RRH A;  3H51 A;  3IPT A;  3WA3 A;  5IG3 A;  1MWT A;  5TGN A;  2CWT A;  8RNT A;  2CFL A;  3MG3 A;  1YJW 3;  1UUW B;  2GEX A;  2Q07 A;  3BU4 A;  3O8Y A;  1VQQ A;  2QA4 3;  3VSY A;  3F7X A;  4TX4 A;  5IG0 A;  2WGO A;  1I8V A;  1PFP A;  3DUK A;  4XDW A;  1TUH A;  1QJG A;  5A0O B;  2W9Q A;  3KFQ C;  3AHW A;  3X40 A;  1BSE A;  1A67 A;  4BIR A;  4RNZ A;  5DRV A;  3E99 A;  1R4C A;  3CCE 3;  2P0M A;  5EEO A;  3CD6 3;  5STD A;  5EQL A;  3KSE D;  1AVK A;  1FUT A;  3LTD A;  2GU3 A;  4EV5 A;  1K8A 4;  1MOL A;  3T0U A;  1JBR A;  1TIJ A;  4KFD A;  1IT8 A;  1PYL A;  2KCD A;  5JPP A;  1RN7 A;  1Q40 A;  3NBR A;  3MWZ A;  4LMI A;  4RNT A;  5AYS C;  5AEU B;  5CXO A;  5HOH A;  5KP4 A;  1Q86 4;  3KE7 A;  1FGM A;  4L7K A;  4N6L A;  4NPB A;  4CJN A;  1TTO A;  1BOX A;  1S72 3;  3PS8 A;  2CG1 A;  3IMA B;  1SQW A;  2HMM B;  1B2M A;  2F99 A;  2UUG C;  3GZB A;  3L0R A;  3DXO A;  5DRE A;  2HMO B;  2W2C A;  1MWR A;  1WMO A;  2K54 A;  1UCJ A;  1VQ6 3;  2KRT A;  3S27 A;  1BSD A;  3F14 A;  1QAK A;  5IEN A;  1O7H B;  2H0I A;  1OPY A;  3DMC A;  1RGA A;  4G1M B;  5AIG A;  6RNT A;  2QEX 3;  3AGN A;  2CC3 A;  4R1K A;  1W02 A;  2JDI H;  1JKG B;  1US1 A;  3F8H A;  1Q7Y 4;  1NDO B;  5I97 A;  3DGO A;  4LGQ A;  3URP A;  1OHP A;  2YFJ B;  2XFS A;  2ZHX B;  3G0K A;  4N6O B;  5EVH A;  1DE3 A;  1SPU A;  1R4Y A;  3KKG A;  3JUN A;  3G8Z A;  3D5G A;  3K5T A;  3PYJ A;  1X1Y A;  1OF5 B;  5IG4 A;  3G71 3;  2FXT A;  1BSB A;  2D1W A;  3HK4 A;  1I2G A;  1AY7 A;  1RN1 A;  3K63 A;  2RNT A;  1KD1 4;  1LNI A;  2O3O A;  4BTX A;  1RMS A;  4LZI A;  1N8R 4;  1JN5 A;  1E3V A;  2CW9 A;  2P09 A;  2Y73 A;  4MMX B;  5IF6 A;  1M90 4;  1DVC A;  5AIH A;  1EA2 A;  3T8U A;  2BMR B;  4JRF A;  4EYC A;  2BMQ B;  3BND A;  1Q9E A;  3S28 A;  1B3S A;  3AMO A;  3J7Y d;  4HM1 B;  1IV9 A;  1JBT A;  4ZM8 A;  3PCS A;  4HM6 B;  4HM4 B;  3RGR A;  1QVF 2;  3ZG0 A;  1VQ5 3;  2CFG A;  1W6G A;  3ECF A;  2W03 A;  3V92 A;  2HMN B;  3NQZ A;  3BIR A;  2XSH B;  1FZU A;  2RSX A;  2IYJ A;  3B7C A;  1IVW A;  1DET A;  3G16 A;  3NXJ A;  3FG1 A;  2AAE A;  4KZ1 A;  2ML6 A;  5CF2 A;  1DYU A;  4EBG A;  1QMA A;  3UJM A;  2MC8 A;  2MF7 A;  1GMP A;  1VQO 3;  1C54 A;  2V1L A;  1DMM A;  1M9G A;  4H61 A;  3HOH A;  2SAR A;  1B2U A;  4CCV A;  1KC8 4;  3EN8 A;  1W2B 2;  2B24 B;  2PZV A;  2BO9 B;  4K1U A;  5AYR B;  3EF8 A;  2CK3 H;  1I0V A;  3Q2P A;  3SED A;  5M18 A;  1FW7 A;  4JF8 A;  3BLZ A;  3DGM A;  5G2G A;  2XR8 B;  2K3D A;  1I0X A;  1OAC A;  1YIT 3;  4O8S A;  1RGE A;  2H0H A;  1SII A;  2E2T A;  1RJO A;  2J8X B;  1GD3 A;  3V98 A;  1UCK A;  1QAF A;  1EUI C;  3AGO A;  3LZA A;  3D9R A;  4BU4 A;  4RNY A;  3D4A A;  4LSO A;  2ZA4 A;  5BIR A;  3KN4 A;  2GU1 A;  1VQL 3;  1TJD A;  1IV7 A;  2XF3 A;  3GZR A;  1JV2 B;  2GBW B;  5IEP A;  3OWU A;  1BRG A;  4XBY A;  1G02 A;  3SOY A;  1IVU A;  2XGL A;  1IQY A;  1N8Q A;  4N6N B;  4N6U A;  5AII A;  3GAX A;  2L1S A;  1MWU A;  1CEW I;  3CNX A;  2OWP A;  4KVH A;  4HZB B;  3WDG B;  2CWV A;  1WMP A;  4WYK A;  1N9E A;  1RDS A;  1T5Y A;  4R9K A;  2IA7 A;  1RGG A;  1JB4 A;  1BNE A;  4HZ9 B;  2XH9 A;  3A76 A;  2WGQ A;  3SOA A;  4RBN A;  1FGR A;  1JB5 A;  3DGN A;  1Q81 4;  1AR0 A;  3SLU A;  1TU5 A;  1EG9 B;  1BVI A;  1N5P A;  2Z7A A;  1Y4K A;  5BVB A;  3CPW 2;  1K28 A;  1TRP A;  1WQL B;  1A2P A;  3OXA A;  1PY3 A;  1BRN L;  2W0Q A;  3OX9 A;  4FMC A;  4BL2 A;  1YVB I;  3JUQ A;  2JQ5 A;  4FR9 A;  1ZO2 A;  1JB2 A;  2GSP A;  3NV0 B;  1ROA A;  2P05 A;  4HYZ A;  1BNR A;  3UNL A;  1NJI 4;  2YFI B;  2ML5 A;  2XGN A;  5AIF A;  1RCK A;  2E2V A;  1VQK 3;  2PNC A;  3MHE A;  3X3Z A;  4AKZ A;  3OW2 2;  3JVC A;  2F56 A;  3KZT A;  1AV4 A;  1A2V A;  2P38 A;  3RNT A;  1JRQ A;  5AEW B;  2ZDJ A;  1W6C A;  1U8C B;  2M7O A;  1BRK A;  2WOH A;  3G6E 3;  1K9M 4;  1RHL A;  3CCM 3;  3FSD A;  2W56 B;  3N9H A;  4LEH A;  3B4O A;  3G4S 3;  2KXG A;  3JUP A;  3PXM A;  1IQX A;  3I55 3;  3Q90 A;  4GL6 A;  1B21 A;  1GYB A;  5KP3 A;  2ZL8 A;  1LOY A;  3CCL 3;  2SBL A;  1BAN A;  1BIR A;  3SXX A;  1RSN A;  3CPO A;  2KF3 A;  2Z76 A;  1BGS A;  3CME 3;  4J8T A;  4WHA A;  3S67 A;  3ER7 A;  1UGI A;  5JBS A;  3KCH A;  2QGU A;  4K90 B;  1VQP 3;  3CC7 3;  3FGY A;  3FG4 A;  4HM5 B;  1RGF A;  4KT3 B;  4WP5 A;  3AHS A;  3B8L A;  4LYL B;  1RGL A;  4N3V A;  1SIH A;  1YHQ 3;  3K7C A;  1STF I;  1VQ4 3;  1BSC A;  4R4K A;  1OGZ A;  4IPB A;  1RNB A;  2E2U A;  1GD4 A;  2HML B;  1RTU A;  3BNC A;  4GHO A;  3MPH A;  2OTL 3;  8CHO A;  3EBY A;  7STD A;  3WMD A;  3WR2 A;  5G1L A;  1IYY A;  4AEQ A;  1FYS A;  2Z77 A;  2F4Y A;  1FUS A;  1E3R A;  4MEI A;  3MYT A;  3GZX B;  3HI7 A;  1X1W A;  3WA2 X;  1BNS A;  1YGE A;  3LML A;  1AVL A;  2FNQ A;  3LT8 A;  1Q40 B;  4BL3 A;  1MWS A;  1GS3 A;  1OUN A;  2WO0 A;  1DMQ A;  1VZZ A;  2W04 A;  3HX8 A;  1W7C A;  3HIG A;  4N6V 0;  5HGR A;  1DVD A;  4N6M A;  2HMJ B;  1BUJ A;  3EHC A;  4WFO A;  1IK3 A;  1M1X B;  4AKY A;  3CMA 3;  1UW1 A;  1B20 A;  1VQ7 3;  4FMA A;  3CCS 3;  2IUJ A;  1BNI A;  2K0M A;  1EKM A;  1RRL A;  1W2Z A;  3S5C A;  5RNT A;  3STD A;  3CCV 3;  1VQ9 3;  2O9U X;  4HVN A;  2L4V A;  5FGO A;  1UUV B;  3UB1 A;  3FKA A;  1RGH A;  3KSP A;  3LYG A;  1TP6 A;  2AAD A;  3F8X A;  3FF0 A;  5IW9 A;  5D83 A;  4STD A;  3QRD A;  5M1A A;  4J9A A;  3MG2 A;  3CU3 A;  2BU4 A;  1ZS7 A;  1RCL A;  1W4N A;  2OOV C;  3NBJ A;  4FCM A;  3QK9 A;  3UL5 A;  3OV4 A;  4EV2 A;  1VQ8 3;  1FGQ A;  3CXC 2;  1UI7 A;  3FLJ A;  3PCR A;  2OQE C;  3U1W A;  2C4B A;  2C11 A;  1N9J A;  4EXR A;  1TFK A;  3GZY B;  1WNH A;  2A15 A;  1UUG B;  4XBT A;  2YFL B;  1NO3 A;  1OHO A;  4O3V A;  1HYF A;  3UL6 A;  4HJL B;  4ILF A;  1VQN 3;  3H3H A;  4KFF A;  1NNV A;  3S29 A;  6GSP A;  3LH4 A;  3DZL A;  4U13 A;  1JN5 B;  1EEJ A;  1BRI A;  2KAA A;  4IIA A;  3N54 B;  2F5W A;  3LOY A;  5BU4 A;  1IQ8 A;  2W9P A;  4FCZ A;  2IMJ A;  1NWW A;  3D3L A;  2OCT A;  2STD A;  2H0G A; 
#chains in the Genus database with same CATH homology
 3X3X A;  1M1K 4;  3AMO B;  5LC6 A;  3EC9 A;  5IEO A;  1S5A A;  2GEY A;  3CC2 3;  3WOD G;  2P0X A;  3LT9 A;  1LXE A;  2BMO B;  4NRE A;  1IT7 A;  1Q82 4;  1W6Y A;  2LYX A;  4N6T A;  3EQQ B;  4KFE A;  1SJW A;  1CYV A;  1A2K A;  2WOF A;  3FG3 A;  4CDL A;  3PGB A;  1LNH A;  2CH9 A;  3FCS B;  1KSI A;  3ROB A;  4L8O A;  2XSO B;  1OH0 A;  3NUV A;  2BNG A;  2W6J H;  2YX9 A;  3CNM A;  1BUQ A;  4QWT A;  4HM2 B;  4XDV A;  1MNL A;  4HBR A;  4K1V A;  3EE1 A;  3F40 A;  2XEP A;  1JKG A;  2Y74 A;  4ORL A;  1O7N B;  4H3U A;  2FGT A;  3I56 3;  3IJE B;  1LOX A;  3LXU X;  3TDG A;  3EN1 B;  4X2H A;  2CFK A;  3MG1 A;  2CG0 A;  6STD A;  3RGA A;  1O7G B;  3FF2 A;  1Q42 A;  3KII A;  1OF5 A;  3F9S A;  3BNE A;  1O7P B;  3MKI A;  5KP1 A;  2I9W A;  3HII A;  1RKY A;  4EC6 A;  3BB9 A;  4XM4 A;  3DM8 A;  1QAL A;  2GBX B;  1KQS 2;  1HKX A;  5ELU A;  1OGX A;  3X41 A;  4FMD A;  1NB5 I;  1JJ2 2;  4HM3 B;  1ASK A;  3X3Y A;  3DGL A;  1U5O A;  3SX1 A;  3CCQ 3;  4Q53 A;  1WTH A;  4O02 B;  3B4P A;  3JUO A;  3WOF B;  4OK0 A;  2CIU A;  4L8P A;  1A90 A;  4WYK B;  2CFD A;  4FCJ A;  3X42 A;  1D6U A;  1ZX2 A;  5IER A;  1ULI B;  3NBB A;  2QIY A;  5CLK A;  1N5H A;  3JUM A;  3NX0 A;  3PZW A;  2RFR A;  2BT3 A;  2RGQ A;  4FMB A;  1GY5 A;  5D82 A;  3K9M C;  1NU3 A;  1W01 A;  1VQM 3;  1CQS A;  1FGO A;  1IVV A;  4XBX A;  5D81 A;  4OUQ A;  4MMZ B;  2RCD A;  4OVM A;  1Z1S A;  2OTJ 3;  1W00 A;  2IUK A;  1K41 A;  3LTC A;  5JPU A;  3NHX A;  1ROV A;  2F86 B;  3NM2 A;  3OWS A;  1C7H A;  1OCV A;  3OWY A;  4RZM A;  4BTW A;  1E97 A;  1J2B A;  5FW5 A;  3NM7 A;  1G96 A;  1YI2 3;  1STD A;  1YIJ 3;  1UI8 A;  1FGT A;  1W5Z A;  3V99 A;  4GB5 A;  1YJ9 3;  3GWR A;  3LTB A;  3EJV A;  1ULJ B;  4MMY B;  4O2H A;  3MSO A;  3BNB A;  1FUW A;  1LVN A;  3HZP A;  1IU7 A;  1F8N A;  4X2O A;  3K0Z A;  4XB5 A;  1YJN 3;  1QVG 2;  4K61 A;  3FH1 A;  3I0Y A;  3EB8 A;  1D6Z A;  5LC7 A;  2CWU A;  3F7S A;  4R80 A;  3VF1 A;  1IDP A;  1L5G B;  2INX A;  2CFW A;  2HMK B;  1D6Y A;  1FA3 A;  3DY5 A;  2LQV A;  5IG5 A;  2B1X B;  2D42 A;  2CHC A;  4WWU C;  2UX0 A;  5AI1 A;  1GY7 A;  3SVA A;  5CF1 A;  1OHS A;  4NHF A;  3CCU 3;  1DMN A;  3T8N A;  2OOV A;  1ISK A;  1HU9 A;  3CCR 3;  1GY6 A;  5CK6 A;  2BHM A;  3RDE A;  2OQE A;  5BXQ A;  3ALA A;  2XFT A;  1K73 4;  3EBT A;  3VGN A;  3NV0 A;  4R9L A;  3WOE B;  3FZW A;  3EX9 A;  2C10 A;  5ELJ A;  2F98 A;  4IT7 A;  2GXF A;  3LTA A;  4HM7 B;  3NQY A;  1KWI A;  1V74 A;  4I4K A;  1CYU A;  1TFO A;  2R4I A;  1IVX A;  2XRX B;  2Z6B A;  1WMN A;  4PEJ A;  3GRD A;  4HM8 B;  3Q1C A;  1JNQ A;  4HM0 B;  1O7M B;  3U97 A;  1EQK A;  4BTY A;  3M8C A;  2CKF B;  1O7W B;  2W56 A;  4HKV B;  3CC4 3;  4MJD A;  1PU4 A;  3CCJ 3;  3N8B A;  1NB3 I;  1RRH A;  3H51 A;  3IPT A;  3WA3 A;  5IG3 A;  5TGN A;  2CWT A;  2CFL A;  3MG3 A;  1YJW 3;  1UUW B;  2GEX A;  2Q07 A;  3O8Y A;  2QA4 3;  3F7X A;  4TX4 A;  5IG0 A;  2WGO A;  1PFP A;  3DUK A;  4XDW A;  1TUH A;  1QJG A;  5A0O B;  2W9Q A;  3KFQ C;  3X40 A;  1A67 A;  4RNZ A;  5DRV A;  3E99 A;  1R4C A;  3CCE 3;  2P0M A;  5EEO A;  3CD6 3;  5STD A;  5EQL A;  3KSE D;  1AVK A;  3LTD A;  2GU3 A;  4EV5 A;  1K8A 4;  1MOL A;  3T0U A;  1TIJ A;  4KFD A;  1IT8 A;  2KCD A;  5JPP A;  1RN7 A;  1Q40 A;  3NBR A;  3MWZ A;  4LMI A;  5AYS C;  5AEU B;  5CXO A;  5KP4 A;  1Q86 4;  3KE7 A;  1FGM A;  4L7K A;  4N6L A;  1S72 3;  3PS8 A;  2CG1 A;  3IMA B;  1SQW A;  2HMM B;  2F99 A;  3GZB A;  3L0R A;  3DXO A;  5DRE A;  2HMO B;  2W2C A;  1WMO A;  2K54 A;  1VQ6 3;  2KRT A;  3S27 A;  3F14 A;  1QAK A;  5IEN A;  1O7H B;  5AIG A;  1OPY A;  3DMC A;  4G1M B;  2QEX 3;  2CC3 A;  4R1K A;  1W02 A;  2JDI H;  1JKG B;  1US1 A;  3F8H A;  1Q7Y 4;  1NDO B;  5I97 A;  3DGO A;  4LGQ A;  1OHP A;  2YFJ B;  2XFS A;  3G0K A;  4N6O B;  5EVH A;  1SPU A;  3KKG A;  3JUN A;  3G8Z A;  3K5T A;  3PYJ A;  1OF5 B;  5IG4 A;  3G71 3;  2FXT A;  2D1W A;  3HK4 A;  3K63 A;  1KD1 4;  2O3O A;  4BTX A;  1N8R 4;  4LZI A;  1JN5 A;  1E3V A;  2CW9 A;  2P09 A;  2Y73 A;  4MMX B;  5IF6 A;  1M90 4;  1DVC A;  5AIH A;  1EA2 A;  3T8U A;  2BMR B;  4JRF A;  4EYC A;  2BMQ B;  3BND A;  3S28 A;  3AMO A;  3J7Y d;  4HM1 B;  1IV9 A;  4ZM8 A;  3PCS A;  4HM6 B;  4HM4 B;  3RGR A;  1QVF 2;  1VQ5 3;  2CFG A;  1W6G A;  3ECF A;  2W03 A;  3V92 A;  2HMN B;  3NQZ A;  2XSH B;  2RSX A;  3B7C A;  3G16 A;  1IVW A;  3NXJ A;  3FG1 A;  4KZ1 A;  2ML6 A;  5CF2 A;  1DYU A;  4EBG A;  1QMA A;  3UJM A;  2MC8 A;  2MF7 A;  1VQO 3;  2V1L A;  1DMM A;  1M9G A;  4H61 A;  4CCV A;  1KC8 4;  3EN8 A;  1W2B 2;  2B24 B;  2PZV A;  2BO9 B;  4K1U A;  5AYR B;  3EF8 A;  2CK3 H;  3Q2P A;  3SED A;  4JF8 A;  3BLZ A;  3DGM A;  5G2G A;  2XR8 B;  1YIT 3;  1OAC A;  4O8S A;  1SII A;  2E2T A;  1RJO A;  1GD3 A;  3V98 A;  1QAF A;  3LZA A;  3D9R A;  4RNY A;  4LSO A;  3KN4 A;  2GU1 A;  1VQL 3;  2XF3 A;  1IV7 A;  3GZR A;  1JV2 B;  2GBW B;  5IEP A;  3OWU A;  4XBY A;  3SOY A;  1IVU A;  2XGL A;  1IQY A;  1N8Q A;  4N6N B;  4N6U A;  5AII A;  3GAX A;  1CEW I;  3CNX A;  2OWP A;  4KVH A;  4HZB B;  3WDG B;  2CWV A;  1WMP A;  4WYK A;  1N9E A;  1T5Y A;  4R9K A;  2IA7 A;  1JB4 A;  4HZ9 B;  2XH9 A;  3A76 A;  2WGQ A;  3SOA A;  4RBN A;  1FGR A;  1JB5 A;  3DGN A;  1Q81 4;  1AR0 A;  3SLU A;  1TU5 A;  1EG9 B;  5BVB A;  2Z7A A;  1N5P A;  1Y4K A;  3CPW 2;  1K28 A;  1WQL B;  3OXA A;  2W0Q A;  3OX9 A;  4FMC A;  1YVB I;  3JUQ A;  2JQ5 A;  4FR9 A;  1ZO2 A;  1JB2 A;  3NV0 B;  1ROA A;  2P05 A;  4HYZ A;  3UNL A;  1NJI 4;  2YFI B;  2ML5 A;  2XGN A;  5AIF A;  1VQK 3;  2E2V A;  2PNC A;  3MHE A;  3X3Z A;  4AKZ A;  3OW2 2;  3JVC A;  3KZT A;  1AV4 A;  1A2V A;  2P38 A;  5AEW B;  1JRQ A;  2ZDJ A;  1W6C A;  1U8C B;  2M7O A;  3G6E 3;  2WOH A;  1K9M 4;  3CCM 3;  3FSD A;  2W56 B;  3N9H A;  4LEH A;  3B4O A;  3G4S 3;  2KXG A;  3JUP A;  3PXM A;  1IQX A;  3I55 3;  3Q90 A;  4GL6 A;  1GYB A;  5KP3 A;  2ZL8 A;  3CCL 3;  2SBL A;  3SXX A;  3CPO A;  2Z76 A;  3CME 3;  4J8T A;  4WHA A;  3S67 A;  3ER7 A;  5JBS A;  2QGU A;  4K90 B;  1VQP 3;  3CC7 3;  3FGY A;  3FG4 A;  4HM5 B;  4WP5 A;  3B8L A;  4N3V A;  1SIH A;  1YHQ 3;  3K7C A;  1STF I;  1VQ4 3;  4R4K A;  1OGZ A;  4IPB A;  2E2U A;  1GD4 A;  2HML B;  3BNC A;  3MPH A;  2OTL 3;  8CHO A;  3EBY A;  7STD A;  3WMD A;  4AEQ A;  2Z77 A;  1E3R A;  4MEI A;  3MYT A;  3GZX B;  3HI7 A;  3WA2 X;  1YGE A;  3LML A;  1AVL A;  2FNQ A;  3LT8 A;  1Q40 B;  2WO0 A;  1GS3 A;  1OUN A;  1DMQ A;  1VZZ A;  2W04 A;  3HX8 A;  1W7C A;  3HIG A;  4N6V 0;  5HGR A;  1DVD A;  4N6M A;  2HMJ B;  3EHC A;  4WFO A;  1IK3 A;  1M1X B;  4AKY A;  3CMA 3;  1UW1 A;  1VQ7 3;  4FMA A;  3CCS 3;  2IUJ A;  2K0M A;  1EKM A;  1RRL A;  1W2Z A;  3S5C A;  3CCV 3;  3STD A;  1VQ9 3;  2O9U X;  4HVN A;  2L4V A;  5FGO A;  1UUV B;  3UB1 A;  3FKA A;  3KSP A;  3LYG A;  1TP6 A;  3F8X A;  3FF0 A;  5IW9 A;  5D83 A;  4STD A;  3QRD A;  4J9A A;  3MG2 A;  3CU3 A;  2OOV C;  4FCM A;  1W4N A;  3NBJ A;  4EV2 A;  3UL5 A;  3QK9 A;  1VQ8 3;  3OV4 A;  1FGQ A;  3CXC 2;  1UI7 A;  3FLJ A;  3PCR A;  2OQE C;  3U1W A;  2C11 A;  1N9J A;  4EXR A;  1TFK A;  3GZY B;  1WNH A;  2A15 A;  4XBT A;  3VSY A;  2YFL B;  1NO3 A;  1OHO A;  4O3V A;  3UL6 A;  4HJL B;  1VQN 3;  3H3H A;  4KFF A;  3S29 A;  3LH4 A;  3DZL A;  4U13 A;  1JN5 B;  4IIA A;  3N54 B;  3LOY A;  1IQ8 A;  2W9P A;  4FCZ A;  2IMJ A;  1NWW A;  3D3L A;  2OCT A;  2STD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...