3OXAA

Crystal structure of ketosteroid isomerase d40n/c69s/c81s/c97s/m116c-cn from p. putida
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
129
structure length
128
Chain Sequence
NLPTAQEVQGLMARYIELVDVGDIEAIVQMYADDATVENPFGQPPIHGREQIAAFYRQGLGGGKVRASLTGPVRASHNGSGAMPFRVEMVWNGQPSALDVIDVMRFDEHGRIQTQAYWSEVNLSVREP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Quantitative, directional measurement of electric field heterogeneity in the active site of ketosteroid isomerase.
pubmed doi rcsb
source organism Pseudomonas putida
molecule tags Isomerase
molecule keywords Steroid Delta-isomerase
total genus 35
structure length 128
sequence length 129
chains with identical sequence B, C, D
ec nomenclature ec 5.3.3.1: Steroid Delta-isomerase.
pdb deposition date 2010-09-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12680 SnoaL_2 SnoaL-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3oxaA00
5BXQA 2YFJB 2F99A 1EA2A 3NV0A 3GZYB 3A76A 3EF8A 3GZRA 3STDA 3E99A 3HZPA 4FCJA 5STDA 1ZO2A 1DMNA 2QIYA 2UX0A 3DZLA 3RGAA 2GBWB 1NU3A 3GWRA 3DMCA 4PEJA 3B8LA 3DXOA 3FLJA 3KSPA 3OWSA 3CNXA 1E97A 3OV4A 4HM2B 4J8TA 4L8PA 2BMOB 5AIGA 1OHPA 2CKFB 3K7CA 4X2OA 2PZVA 5HGRA 1GYBA 2W2CA 3EX9A 1JKGB 3LYGA 4OUQA 4WYKA 4GB5A 3ECFA 3FZWA 1STDA 3CU3A 4STDA 3SOAA 1ASKA 4WYKB 1GS3A 3I0YA 4HM3B 3WMDA 2XRXB 5KP3A 4KVHA 4FCMA 2XSOB 5IG3A 3MYTA 3Q90A 3G16A 3F7SA 5IG4A 1GY7A 3NUVA 3UNLA 2GEXA 3B4PA 3H3HA 1OHSA 3RGRA 3F8XA 2JQ5A 4RZMA 5KP4A 2XR8B 4HKVB 1NWWA 3NXJA 5CXOA 2Z76A 3OX9A 4HZ9B 1O7GB 1JN5A 5DREA 3EQQB 3OWYA 3FKAA 3SOYA 2IMJA 3D9RA 3JUQA 4J9AA 4LMIA 1C7HA 3K0ZA 3H51A 2YFLB 3LZAA 3F7XA 1VZZA 1U5OA 2F86B 3HX8A 3G8ZA 4XBXA 5AEUB 3BLZA 1O7HB 2A15A 4HZBB 5CK6A 4K1VA 3MG2A 3F40A 2BMRB 3NBRA 5IEPA 1OH0A 1GY6A 3MG1A 4X2HA 1SJWA 2F98A 1JKGA 1JB4A 1TP6A 2HMOB 3F9SA 1ISKA 5IENA 5IG0A 5BVBA 1IDPA 3SEDA 2B1XB 1EG9B 3DUKA 3B4OA 3HK4A 3VGNA 4K1UA 3CNMA 2HMMB 1O7WB 1DMQA 5AI1A 2HMJB 4HM6B 5D82A 4HVNA 4CDLA 1ZX2A 1E3RA 3EBYA 1W6YA 4XB5A 4XBTA 5CLKA 3NV0B 4HM1B 4N3VA 1UUWB 2HMLB 4Q53A 2GBXB 1TUHA 3S5CA 2GXFA 2CHCA 2Z77A 4XDVA 3KKGA 4HM0B 4HM4B 3DM8A 3F8HA 3B7CA 4XDWA 4R9LA 3M8CA 8CHOA 2GEYA 6STDA 3NHXA 4HM7B 1O7PB 5AEWB 1NDOB 3JUMA 4I4KA 5D81A 3F14A 3EBTA 1Q40A 3JUPA 3KZTA 4IIAA 1CQSA 1WQLB 2INXA 2RGQA 2RCDA 5JPPA 4WWUC 1QJGA 3EN8A 3OWUA 1O7MB 2HMNB 4MJDA 5IERA 1E3VA 3GZXB 3GRDA 4U13A 1OCVA 4LEHA 3MKIA 5AIIA 1JB2A 5IEOA 3BB9A 3FF2A 4HJLB 1W01A 5JPUA 1O7NB 3KE7A 3FF0A 4OVMA 4R9KA 4R1KA 1BUQA 3UJMA 5G2GA 3T8NA 1DMMA 1OF5A 1OF5B 2K54A 3NM2A 1OGXA 1S5AA 1QMAA 4L8OA 1ULJB 3T8UA 1JN5B 4H3UA 1W00A 5EVHA 1HKXA 3GZBA 2Z7AA 4HM5B 3MHEA 5KP1A 5IF6A 1K41A 3FH1A 2HMKB 3ER7A 1OGZA 2B24B 2YFIB 1OHOA 2R4IA 1Q42A 3FGYA 3G0KA 5DRVA 1UUVB 4XBYA 7STDA 1Z1SA 3CPOA 2XSHB 5D83A 3JUNA 5AIFA 5FW5A 5CF1A 3MG3A 1Q40B 2STDA 4ORLA 4XM4A 4LGQA 2QGUA 2BNGA 3MSOA 1JB5A 2BMQB 3EJVA 3IPTA 1OUNA 3FSDA 1ULIB 5IG5A 2I9WA 3VSYA 3JUOA 2OWPA 3EC9A 3OXAA 4WP5A 4HM8B 2RFRA 5TGNA 1OPYA 5CF2A 1W02A 4L7KA 1A2KA 3EN1B 5AIHA 1GY5A 3ROBA 3EHCA 1AR0A
chains in the Genus database with same CATH superfamily
2F99A 5IW9A 4R4KA 3HZPA 3RGAA 1YJN3 2UX0A 4FR9A 2QIYA 1U8CB 2AAEA 2W0QA 1D6ZA 4KFDA 5M18A 4PEJA 3DH2A 3B8LA 3FLJA 3KSPA 3CNXA 1E97A 1K28A 2QEX3 2V1LA 1Q864 3CC23 2CWVA 4N6LA 2ML6A 3X3XA 2HOHA 2OQEC 2KF6A 3ECFA 1LNHA 1K734 4QWTA 4WYKB 5AYRB 1X1YA 1VQ43 3WMDA 2XRXB 4KVHA 4FCMA 4N6V0 2SBLA 3D79A 1GMQA 3CMA3 1BNRA 1CYUA 3G16A 4G1MB 1LNIA 3PS8A 3CCE3 2W9PA 3Q2PA 2JQ5A 1B27A 3NQYA 3ZFZA 5RNTA 1R4YA 1NWWA 3NXJA 5CXOA 1HYFA 1M1K4 3OX9A 5M19A 5DREA 1PY3A 3HOHA 1OACA 1RGCA 3D9RA 1AVKA 1RGEA 2CG0A 2FNQA 4LMIA 3SX1A 1T2HA 1B2SA 1VZZA 1U5OA 4XBXA 1O7HB 2A15A 2L4VA 1RLSA 5IEPA 3AGOA 1MOLA 2CFKA 3AHSA 3MG1A 1TIJA 1QVG2 2J8XB 3CC73 1V58A 1W7CA 1RNTA 1JB4A 3F9SA 3G713 5IENA 1IVUA 5GSPA 1WTHA 5IG0A 3SVAA 5BVBA 1UW1A 3CNMA 1VQ93 1O7WB 1IVVA 3LTCA 1IVWA 1N5PA 1KSIA 5AI1A 2HMJB 5D82A 1TFKA 1DVCA 2H0HA 3DGYA 2W04A 1W2B2 3AHWA 2FXTA 4FMCA 4HM1B 3DGOA 1UUWB 2H0IA 2P05A 2CHCA 2Z77A 2BHMA 3KKGA 4HM0B 3O8YA 4GHOA 3WOFB 2K0MA 1YJW3 1BNGA 1SARA 2KCDA 2UGIA 2GEYA 4R9LA 6STDA 3NHXA 9RNTA 4O8SA 1MGRA 1W5ZA 3EBTA 3JUPA 3FG4A 4IIAA 1B3SA 2XGNA 1Q7HA 3K5TA 2ZDJA 4O02B 1BRGA 3URPA 1QJGA 3ZG0A 3EN8A 1G0TA 2D1WA 5IERA 2GU1A 1YIJ3 4BTWA 3GRDA 1MWUA 5AIIA 1JB2A 1YGEA 2OOVA 1W01A 3KE7A 4N6OB 3DGMA 4N6TA 3UJMA 1BRHA 2Y73A 4J5KA 3SXXA 1NB3I 2W56A 4L8OA 2P0XA 2CFGA 4K90B 1NB5I 1QAFA 1PYLA 3V98A 1LOXA 4OK0A 1YI23 3X41A 1BRNL 1OGZA 1VQ63 2YFIB 1OHOA 3WR2A 1WNHA 3ZG5A 1Z1SA 5CF1A 2ZA4A 3JUNA 3MG3A 1Q40B 2STDA 4XM4A 4MMYB 1JB5A 3IPTA 3I563 1FUSA 3D5IA 2OTL3 3AMOB 2W9QA 1VQ83 3UL6A 1GY5A 3ROBA 2KXGA 3EHCA 5JPPA 3CCU3 2YFJB 2XEPA 3GZYB 3STDA 3GZRA 1JBTA 3E99A 5STDA 2CWUA 2GBWB 3GWRA 3DMCA 3DXOA 1YVBI 1GOVA 2IUKA 3BU4A 3DGLA 1JNQA 4O2HA 3CCR3 3UL5A 3BNCA 2AADA 4RNTA 2W2CA 1EQKA 1JKGB 4WYKA 4OUQA 1GSPA 2K3DA 3K9MC 1STDA 1EEJA 1GOUA 1KQS2 2KF4A 4HM3B 1FGQA 3CXC2 5IG3A 2XSOB 2KRTA 2UUGC 3X42A 1KWIA 3F7SA 5IG4A 1BNJA 1Q7Y4 2GEXA 3B4PA 1T5YA 3H3HA 1IV9A 2IY2A 4RZMA 1ZS7A 2IA7A 1TFOA 1YJ93 1CH0A 4O3VA 1GMPA 3X3YA 1JJ22 1JN5A 2RNTA 1J2BA 3FKAA 4BTXA 2IMJA 3JUQA 4J9AA 3X40A 1BSEA 3ALAA 1I0VA 3K0ZA 2F56A 3QK9A 2F5WA 2YFLB 2C11A 3LZAA 3DGNA 3EB8A 3K63A 3HIGA 3KIIA 1JZDA 2GU3A 3N8BA 1K9M4 1GMRA 3MG2A 3F40A 4K1VA 1L5GB 1OH0A 1UUGB 4EC6A 5ELJA 3UB1A 4ZM8A 4FMDA 1JKGA 3FG1A 1K8A4 5G1KA 3LXUX 1TP6A 1ISKA 1BU4A 1IDPA 3SEDA 3RDEA 3B4OA 3EE1A 1RN4A 1TJDA 1BOXA 1GOYA 3KCHA 1DMQA 1N5HA 1W2ZA 2KF5A 1E3RA 1B20A 3NBJA 4HAAA 3WA2X 1JBRA 1RSNA 1Q9EA 2HMLB 3RNTA 3DY5A 1BSBA 2RSXA 1Q824 1UDII 2XFSA 3CCQ3 2W6JH 1N9JA 1ROVA 3DM8A 3F8HA 3KFQC 4XDWA 4MMXB 8CHOA 1O7PB 2BT3A 2JDIH 2KF3A 1NDOB 3U1WA 1LRAA 4I4KA 3CPW2 1YGWA 3U97A 1T3BA 1AVLA 1WQLB 4KZ1A 2INXA 1X1WA 1RCLA 1JRQA 3OWUA 2HMNB 4GSPA 3VF1A 4MMZB 3GZXB 2ZL8A 4U13A 2OQEA 1EKMA 1LOVA 3WDGB 1IQYA 1AY7A 2Q07A 3BB9A 1R4CA 4BTYA 1V57A 4R9KA 1UCKA 1I0XA 1B21A 1I2EA 2XF3A 1QVF2 5G2GA 2W56B 1LVNA 1OF5B 2K54A 3NM2A 1RN1A 2F5MA 1S5AA 4EYCA 1BVIA 1ULJB 3CC43 1IYYA 3Q3FA 5EVHA 4HM5B 1RRLA 5IF6A 1K41A 2HMKB 4NREA 3N54B 1X1UA 1I3FA 2R4IA 1Q42A 3G0KA 1UUVB 3KN4A 4XBYA 3CPOA 2XSHB 1A2PA 1SIIA 3BNBA 1BRSA 1VQM3 4K61A 4LGQA 2QGUA 3TDGA 3NQZA 1BGSA 2BMQB 4JF8A 2XFTA 3CCL3 1OUNA 1RRHA 1MWSA 3FSDA 1TTOA 3SYUA 5IG5A 1EUIC 4HM8B 5TGNA 1OPYA 1A2KA 7GSPA 1Q814 2CFWA 1N8R4 1AR0A 1KD14 5BXQA 3NV0A 3A76A 3EF8A 1IU7A 4CJNA 1YIT3 1ZO2A 1DMNA 3DZLA 1I2GA 1I8VA 1BSDA 3OWSA 1VQL3 4HM2B 4LYLB 2CKFB 3K7CA 4X2OA 2PZVA 5HGRA 1GYBA 3LYGA 4GB5A 2R41A 4STDA 3LTBA 3KSED 1WMOA 1UCJA 1AQZA 3I0YA 1MNLA 5KP3A 3LTAA 2CX1A 3Q90A 1IV7A 1GY7A 1B2ZA 1OHSA 3RGRA 1UI7A 2XR8B 4HKVB 1FGRA 1QALA 2Z76A 4HZ9B 4DKIA 4FCZA 1FUTA 2Y74A 1LOYA 3OWYA 6RNTA 1D6UA 1TRPA 2BIRA 3H51A 1RDSA 2P0MA 3F7XA 2F86B 4KFEA 1RGAA 1BSAA 2E2UA 2L1SA 3G8ZA 3BLZA 4HZBB 1BNEA 4ILFA 5CK6A 5AEUB 4AEQA 2BO9B 1GY6A 2MF7A 1VQ73 3MWZA 3BNEA 1SJWA 3AGNA 2LQVA 5FGOA 1G02A 4HYZA 4WHAA 2HMOB 3NX0A 5ELUA 2B1XB 1EG9B 3HK4A 4J5GA 3VGNA 4K1UA 2F4YA 2HMMB 3L0RA 4BU4A 2IUJA 4HM6B 2PNCA 4CDLA 1ZX2A 4RNZA 1VQP3 1W6YA 4XB5A 4XBTA 1NO3A 3NV0B 4N6UA 1D6YA 4Q53A 2GBXB 3CCM3 1ROAA 4NHFA 3S5CA 1IK3A 2GXFA 3D5GA 1JV2B 4EV5A 4XDVA 1ZGXA 3G6E3 4HM4B 3S27A 2C4BA 4WFOA 3X3ZA 4EBGA 4HM7B 5AEWB 3JUMA 1DE3A 4AKZA 2ZHXB 3CCS3 3LT8A 3KZTA 1LQMB 3LH4A 4FMBA 3WODG 2CFDA 2RGQA 2RCDA 1B2UA 4LSOA 1RTUA 2WOHA 3S67A 4MJDA 1O7MB 1KC84 1JBSA 1AV4A 1BSCA 1CYVA 1RGHA 1C54A 1OCVA 1Y4KA 3MKIA 3SLUA 5IEOA 1FGOA 3FF2A 4R80A 2O9UX 1O7NB 1BANA 4RBNA 8RNTA 1X1XA 1VQN3 1BUQA 3FG3A 1DMMA 1OF5A 1OGXA 3PYJA 1BRJA 1HZ1A 1JN5B 2RBIA 4H3UA 1W00A 3IMAB 1GD3A 5EEOA 3MHEA 5KP1A 2OCTA 3ER7A 1IVXA 1DETA 2B24B 5BIRA 3MPHA 4EXRA 2E2VA 1DYUA 7STDA 3PXMA 1STFI 5AIFA 1F8NA 1S723 4RNYA 1G96A 2BNGA 1LOWA 1TU5A 3V99A 1ULIB 3GAXA 3JUOA 2OWPA 3OXAA 4WP5A 5CF2A 3WOEB 2RFRA 3WA3A 2MC8A 4L7KA 4FMAA 3BIRA 3PGBA 4EV2A 1IT7A 1EA2A 3V92A 3HI7A 4FCJA 3NBBA 5A0OB 5BU4A 1BRIA 2BU4A 1NU3A 2KAAA 1RCKA 3JVCA 5AIGA 4L8PA 1RGGA 1W6CA 3OV4A 4J8TA 1RGLA 2BMOB 1B2MA 1OHPA 1T2IA 1SQWA 3AMOA 3EX9A 1PFPA 2QA43 3FZWA 3CU3A 3OW22 2CH9A 3SOAA 1ASKA 1FA3A 1GS3A 3PCSA 4BL2A 1VQO3 4HBRA 3HIIA 3MYTA 1M904 2E2TA 2OOVC 2W03A 4H61A 5M1AA 3NUVA 3UNLA 1W6GA 4JRFA 1UGHI 3F8XA 5KP4A 1I2FA 4BL3A 1IQXA 5JBSA 1RGFA 4KT3B 1RNBA 3PZWA 5G1LA 1O7GB 1RJOA 3D4AA 2O3OA 3EQQB 3N9HA 1RN7A 4IPBA 1RKYA 3SOYA 4AKYA 2Z6BA 3FCSB 1C7HA 1RMSA 2CWTA 3S28A 1GD4A 1M1XB 3HX8A 4HOHA 1I70A 6GSPA 3CD63 3NBRA 2BMRB 4IT7A 1V74A 1YVSA 3IJEB 4X2HA 1BUJA 1MWTA 5LC7A 2F98A 1DVDA 1US1A 1WMNA 4N6NB 2WGQA 4MEIA 3DUKA 4NPBA 3LT9A 1I3IA 3LOYA 5AYSC 2CK3H 1SIHA 2YX9A 3I553 1N9EA 1FUWA 3CCV3 4HVNA 3EBYA 1LQGC 4GL6A 1VQ53 5CLKA 2LYXA 3J7Yd 4N3VA 2C10A 2M7OA 1BNIA 1FW7A 1YHQ3 1TUHA 4LZIA 4CCVA 1PU4A 2XGLA 2SARA 2CFLA 3GSPA 1YNVX 2CX0A 1BIRA 1FZUA 1RHLA 3B7CA 3D3LA 2CIUA 1MGWA 3M8CA 3NM7A 1SPUA 1WMPA 3BNDA 2XH9A 1IT8A 1LXEA 3A5EA 3F14A 1Q40A 2P09A 4TX4A 1CQSA 2OTJ3 1FGTA 1JZOA 3S29A 4WWUC 4BIRA 5I97A 2ML5A 2FGTA 3T0UA 5LC6A 7RNTA 1A2VA 1E3VA 1A90A 1HU9A 4CPKA 4LEHA 1UCLA 4HJLB 5JPUA 4OVMA 3FF0A 4R1KA 1UI8A 1TRQA 2WOFA 1VQQA 3T8NA 1CEWI 4N6MA 1BNFA 1QMAA 1MWRA 1UGIA 2IYJA 3Q1CA 4KFFA 3T8UA 4EW5A 3G4S3 1HKXA 3GZBA 3PCRA 2CG1A 3WHOA 2Z7AA 3CME3 2WGOA 1FGMA 3QRDA 1BRKA 1VQK3 3FH1A 3LTDA 3LMLA 1N8QA 2CW9A 1M9GA 3FGYA 2CC3A 5DRVA 5EQLA 1NNVA 5D83A 1BNSA 5FW5A 1B2XA 1IQ8A 5HOHA 4ORLA 1FYSA 2GSPA 4I5QA 2D42A 3MSOA 3EJVA 1BAOA 1W4NA 3CCJ3 2I9WA 3VSYA 1A67A 1RGKA 1UCIA 3EC9A 1QAKA 2WO0A 1W02A 2H0GA 3EN1B 5AIHA 1NJI4 2P38A 5D81A
chains in the Genus database with same CATH topology
2F99A 5IW9A 4R4KA 3HZPA 3RGAA 1YJN3 2UX0A 4FR9A 2QIYA 1U8CB 2W0QA 1D6ZA 4KFDA 4PEJA 3B8LA 3FLJA 3KSPA 3CNXA 1E97A 1K28A 2QEX3 2V1LA 1Q864 3CC23 2CWVA 4N6LA 2ML6A 3X3XA 2OQEC 3ECFA 1LNHA 1K734 4QWTA 4WYKB 5AYRB 1VQ43 3WMDA 2XRXB 4KVHA 4FCMA 4N6V0 2SBLA 3CMA3 1CYUA 3G16A 4G1MB 3PS8A 3CCE3 2W9PA 3Q2PA 2JQ5A 3NQYA 1NWWA 3NXJA 5CXOA 1M1K4 3OX9A 5DREA 1OACA 3D9RA 1AVKA 2CG0A 2FNQA 4LMIA 3SX1A 1VZZA 1U5OA 4XBXA 1O7HB 2A15A 2L4VA 5IEPA 1MOLA 2CFKA 3MG1A 1TIJA 1QVG2 3CC73 1W7CA 1JB4A 3F9SA 3G713 5IENA 1IVUA 1WTHA 5IG0A 3SVAA 5BVBA 1UW1A 3CNMA 1VQ93 1O7WB 1IVVA 3LTCA 1IVWA 1N5PA 1KSIA 5AI1A 2HMJB 5D82A 1TFKA 1DVCA 2W04A 2FXTA 4FMCA 4HM1B 3DGOA 1UUWB 2P05A 2CHCA 2Z77A 2BHMA 3KKGA 4HM0B 3O8YA 3WOFB 2K0MA 1YJW3 4R9LA 2KCDA 2GEYA 6STDA 3NHXA 4O8SA 1W5ZA 3EBTA 3JUPA 3FG4A 4IIAA 2XGNA 3K5TA 4O02B 2ZDJA 1QJGA 3EN8A 2D1WA 5IERA 2GU1A 1YIJ3 4BTWA 3GRDA 5AIIA 1JB2A 1YGEA 2OOVA 1W01A 3KE7A 4N6OB 3DGMA 4N6TA 3UJMA 3SXXA 2Y73A 1NB3I 2W56A 4L8OA 2P0XA 2CFGA 4K90B 1NB5I 1QAFA 3V98A 1LOXA 4OK0A 1YI23 3X41A 1OGZA 1VQ63 2YFIB 1OHOA 1WNHA 1Z1SA 5CF1A 3JUNA 3MG3A 1Q40B 2STDA 4XM4A 4MMYB 1JB5A 3IPTA 3I563 2OTL3 3AMOB 2W9QA 1VQ83 3UL6A 1GY5A 3ROBA 2KXGA 3EHCA 5JPPA 3CCU3 2YFJB 2XEPA 3GZYB 3STDA 3GZRA 3E99A 5STDA 2CWUA 2GBWB 3GWRA 3DMCA 3DXOA 1YVBI 2IUKA 3DGLA 4O2HA 1JNQA 3CCR3 3UL5A 3BNCA 2W2CA 1EQKA 1JKGB 4WYKA 4OUQA 3K9MC 1STDA 1KQS2 4HM3B 1FGQA 3CXC2 5IG3A 2XSOB 2KRTA 3X42A 1KWIA 3F7SA 5IG4A 1Q7Y4 2GEXA 3B4PA 1T5YA 3H3HA 1IV9A 4RZMA 2IA7A 1TFOA 1YJ93 3X3YA 4O3VA 1JJ22 1JN5A 1J2BA 3FKAA 4BTXA 2IMJA 3JUQA 4J9AA 3X40A 3ALAA 3K0ZA 3QK9A 2YFLB 2C11A 3LZAA 3EB8A 3DGNA 3K63A 3HIGA 3KIIA 2GU3A 3N8BA 1K9M4 4K1VA 3MG2A 3F40A 1L5GB 1OH0A 4EC6A 5ELJA 3UB1A 4ZM8A 4FMDA 1JKGA 3FG1A 1K8A4 3LXUX 1TP6A 1ISKA 1IDPA 3SEDA 3RDEA 3B4OA 3EE1A 1DMQA 1N5HA 1W2ZA 1E3RA 3NBJA 3WA2X 2HMLB 3DY5A 2RSXA 1Q824 2XFSA 3CCQ3 2W6JH 1N9JA 1ROVA 3DM8A 3F8HA 3KFQC 4XDWA 4MMXB 8CHOA 1O7PB 2BT3A 2JDIH 3U1WA 1NDOB 4I4KA 3CPW2 3U97A 1AVLA 1WQLB 4KZ1A 2INXA 1JRQA 3OWUA 2HMNB 3VF1A 4MMZB 3GZXB 2ZL8A 4U13A 2OQEA 1EKMA 3WDGB 1IQYA 2Q07A 3BB9A 1R4CA 4BTYA 4R9KA 2XF3A 1QVF2 5G2GA 2W56B 1LVNA 1OF5B 2K54A 3NM2A 4EYCA 1S5AA 1ULJB 3CC43 5EVHA 4HM5B 1RRLA 5IF6A 1K41A 2HMKB 4NREA 3N54B 2R4IA 1Q42A 3G0KA 1UUVB 3KN4A 4XBYA 3CPOA 2XSHB 1SIIA 3BNBA 1VQM3 4K61A 4LGQA 2QGUA 3TDGA 3NQZA 2BMQB 4JF8A 2XFTA 3CCL3 1OUNA 1RRHA 3FSDA 5IG5A 4HM8B 5TGNA 1OPYA 1A2KA 1Q814 2CFWA 1N8R4 1AR0A 1KD14 5BXQA 3NV0A 3A76A 3EF8A 1IU7A 1YIT3 1ZO2A 1DMNA 3DZLA 3OWSA 1VQL3 4HM2B 2CKFB 3K7CA 4X2OA 2PZVA 5HGRA 1GYBA 3LYGA 4GB5A 4STDA 3LTBA 3KSED 1WMOA 3I0YA 1MNLA 5KP3A 3LTAA 3Q90A 1IV7A 1GY7A 1OHSA 3RGRA 1UI7A 2XR8B 4HKVB 1FGRA 1QALA 2Z76A 4HZ9B 4FCZA 2Y74A 3OWYA 1D6UA 3H51A 2P0MA 3F7XA 2F86B 4KFEA 2E2UA 3G8ZA 5AEUB 1W2B2 3BLZA 4HZBB 5CK6A 4AEQA 2BO9B 1GY6A 2MF7A 1VQ73 3MWZA 3BNEA 1SJWA 5FGOA 2LQVA 4HYZA 4WHAA 2HMOB 3NX0A 5ELUA 2B1XB 1EG9B 3HK4A 3VGNA 4K1UA 2HMMB 3L0RA 2IUJA 4HM6B 2PNCA 4CDLA 1ZX2A 4RNZA 1VQP3 1W6YA 4XB5A 4XBTA 1NO3A 3NV0B 4N6UA 1D6YA 4Q53A 2GBXB 3CCM3 1ROAA 4NHFA 3S5CA 1IK3A 2GXFA 1JV2B 4EV5A 4XDVA 3G6E3 4HM4B 3S27A 4WFOA 3X3ZA 4EBGA 4HM7B 5AEWB 3JUMA 4AKZA 3CCS3 3LT8A 3KZTA 3LH4A 4FMBA 3WODG 2CFDA 2RGQA 2RCDA 4LSOA 3S67A 2WOHA 4MJDA 1O7MB 1KC84 1AV4A 1CYVA 1OCVA 1Y4KA 3MKIA 3SLUA 5IEOA 1FGOA 3FF2A 4R80A 2O9UX 1O7NB 1VQN3 4RBNA 1BUQA 3FG3A 1DMMA 1OF5A 1OGXA 3PYJA 1JN5B 4H3UA 1W00A 3IMAB 1GD3A 5EEOA 3MHEA 5KP1A 2OCTA 3ER7A 1IVXA 2B24B 3MPHA 4EXRA 2E2VA 1DYUA 7STDA 3PXMA 1STFI 5AIFA 1F8NA 1S723 4RNYA 1G96A 2BNGA 1TU5A 3V99A 1ULIB 3GAXA 3JUOA 2OWPA 3OXAA 4WP5A 5CF2A 3WOEB 2RFRA 3WA3A 2MC8A 4L7KA 4FMAA 3PGBA 4EV2A 1IT7A 1EA2A 3V92A 3HI7A 4FCJA 3NBBA 5A0OB 1NU3A 3JVCA 5AIGA 4L8PA 1W6CA 3OV4A 4J8TA 2BMOB 1OHPA 1SQWA 3AMOA 3EX9A 1PFPA 2QA43 3FZWA 3CU3A 3OW22 2CH9A 3SOAA 1ASKA 1FA3A 1GS3A 3PCSA 1VQO3 4HBRA 3HIIA 3MYTA 1M904 2E2TA 2OOVC 2W03A 4H61A 3NUVA 3UNLA 1W6GA 4JRFA 3F8XA 5KP4A 1IQXA 5JBSA 3PZWA 1O7GB 1RJOA 3N9HA 2O3OA 3EQQB 4IPBA 1RN7A 1RKYA 3SOYA 4AKYA 2Z6BA 3FCSB 1C7HA 2CWTA 3S28A 1GD4A 1M1XB 3HX8A 3CD63 3NBRA 2BMRB 4IT7A 1V74A 3IJEB 4X2HA 5LC7A 2F98A 1DVDA 1US1A 1WMNA 4N6NB 2WGQA 4MEIA 3DUKA 3LT9A 3LOYA 5AYSC 1SIHA 2CK3H 2YX9A 3I553 1N9EA 1FUWA 3CCV3 4HVNA 3EBYA 4GL6A 1VQ53 5CLKA 2LYXA 3J7Yd 4N3VA 2C10A 2M7OA 1YHQ3 1TUHA 4LZIA 4CCVA 1PU4A 2XGLA 2CFLA 3B7CA 3D3LA 2CIUA 3M8CA 3NM7A 1SPUA 1WMPA 3BNDA 2XH9A 1IT8A 1LXEA 3F14A 1Q40A 2P09A 4TX4A 1CQSA 2OTJ3 1FGTA 5I97A 3S29A 4WWUC 2ML5A 2FGTA 3T0UA 5LC6A 1A2VA 1E3VA 1A90A 1HU9A 4LEHA 4HJLB 5JPUA 4OVMA 3FF0A 4R1KA 1UI8A 2WOFA 3T8NA 1CEWI 4N6MA 1QMAA 3T8UA 3Q1CA 4KFFA 3G4S3 1HKXA 3GZBA 3PCRA 2CG1A 2Z7AA 3CME3 2WGOA 1FGMA 3QRDA 1VQK3 3FH1A 3LTDA 3LMLA 1N8QA 2CW9A 1M9GA 3FGYA 2CC3A 5DRVA 5EQLA 5D83A 5FW5A 1IQ8A 4ORLA 2D42A 3MSOA 3EJVA 1W4NA 3CCJ3 2I9WA 3VSYA 1A67A 3EC9A 1QAKA 2WO0A 1W02A 3EN1B 5AIHA 1NJI4 2P38A 5D81A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5BXQ A;  2YFJ B;  2F99 A;  1EA2 A;  3NV0 A;  3GZY B;  3A76 A;  3EF8 A;  3GZR A;  3STD A;  3E99 A;  3HZP A;  4FCJ A;  5STD A;  1ZO2 A;  1DMN A;  2QIY A;  2UX0 A;  3DZL A;  3RGA A;  2GBW B;  1NU3 A;  3GWR A;  3DMC A;  4PEJ A;  3B8L A;  3DXO A;  3FLJ A;  3KSP A;  3OWS A;  3CNX A;  1E97 A;  3OV4 A;  4HM2 B;  4J8T A;  4L8P A;  2BMO B;  5AIG A;  1OHP A;  2CKF B;  3K7C A;  4X2O A;  2PZV A;  5HGR A;  1GYB A;  2W2C A;  3EX9 A;  1JKG B;  3LYG A;  4OUQ A;  4WYK A;  4GB5 A;  3ECF A;  3FZW A;  1STD A;  3CU3 A;  4STD A;  3SOA A;  1ASK A;  4WYK B;  1GS3 A;  3I0Y A;  4HM3 B;  3WMD A;  2XRX B;  5KP3 A;  4KVH A;  4FCM A;  2XSO B;  5IG3 A;  3MYT A;  3Q90 A;  3G16 A;  3F7S A;  5IG4 A;  1GY7 A;  3NUV A;  3UNL A;  2GEX A;  3B4P A;  3H3H A;  1OHS A;  3RGR A;  3F8X A;  2JQ5 A;  4RZM A;  5KP4 A;  2XR8 B;  4HKV B;  1NWW A;  3NXJ A;  5CXO A;  2Z76 A;  3OX9 A;  4HZ9 B;  1O7G B;  1JN5 A;  5DRE A;  3EQQ B;  3OWY A;  3FKA A;  3SOY A;  2IMJ A;  3D9R A;  3JUQ A;  4J9A A;  4LMI A;  1C7H A;  3K0Z A;  3H51 A;  2YFL B;  3LZA A;  3F7X A;  1VZZ A;  1U5O A;  2F86 B;  3HX8 A;  3G8Z A;  4XBX A;  5AEU B;  3BLZ A;  1O7H B;  2A15 A;  4HZB B;  5CK6 A;  4K1V A;  3MG2 A;  3F40 A;  2BMR B;  3NBR A;  5IEP A;  1OH0 A;  1GY6 A;  3MG1 A;  4X2H A;  1SJW A;  2F98 A;  1JKG A;  1JB4 A;  1TP6 A;  2HMO B;  3F9S A;  1ISK A;  5IEN A;  5IG0 A;  5BVB A;  1IDP A;  3SED A;  2B1X B;  1EG9 B;  3DUK A;  3B4O A;  3HK4 A;  3VGN A;  4K1U A;  3CNM A;  2HMM B;  1O7W B;  1DMQ A;  5AI1 A;  2HMJ B;  4HM6 B;  5D82 A;  4HVN A;  4CDL A;  1ZX2 A;  1E3R A;  3EBY A;  1W6Y A;  4XB5 A;  4XBT A;  5CLK A;  3NV0 B;  4HM1 B;  4N3V A;  1UUW B;  2HML B;  4Q53 A;  2GBX B;  1TUH A;  3S5C A;  2GXF A;  2CHC A;  2Z77 A;  4XDV A;  3KKG A;  4HM0 B;  4HM4 B;  3DM8 A;  3F8H A;  3B7C A;  4XDW A;  4R9L A;  3M8C A;  8CHO A;  2GEY A;  6STD A;  3NHX A;  4HM7 B;  1O7P B;  5AEW B;  1NDO B;  3JUM A;  4I4K A;  5D81 A;  3F14 A;  3EBT A;  1Q40 A;  3JUP A;  3KZT A;  4IIA A;  1CQS A;  1WQL B;  2INX A;  2RGQ A;  2RCD A;  5JPP A;  4WWU C;  1QJG A;  3EN8 A;  3OWU A;  1O7M B;  2HMN B;  4MJD A;  5IER A;  1E3V A;  3GZX B;  3GRD A;  4U13 A;  1OCV A;  4LEH A;  3MKI A;  5AII A;  1JB2 A;  5IEO A;  3BB9 A;  3FF2 A;  4HJL B;  1W01 A;  5JPU A;  1O7N B;  3KE7 A;  3FF0 A;  4OVM A;  4R9K A;  4R1K A;  1BUQ A;  3UJM A;  5G2G A;  3T8N A;  1DMM A;  1OF5 A;  1OF5 B;  2K54 A;  3NM2 A;  1OGX A;  1S5A A;  1QMA A;  4L8O A;  1ULJ B;  3T8U A;  1JN5 B;  4H3U A;  1W00 A;  5EVH A;  1HKX A;  3GZB A;  2Z7A A;  4HM5 B;  3MHE A;  5KP1 A;  5IF6 A;  1K41 A;  3FH1 A;  2HMK B;  3ER7 A;  1OGZ A;  2B24 B;  2YFI B;  1OHO A;  2R4I A;  1Q42 A;  3FGY A;  3G0K A;  5DRV A;  1UUV B;  4XBY A;  7STD A;  1Z1S A;  3CPO A;  2XSH B;  5D83 A;  3JUN A;  5AIF A;  5FW5 A;  5CF1 A;  3MG3 A;  1Q40 B;  2STD A;  4ORL A;  4XM4 A;  4LGQ A;  2QGU A;  2BNG A;  3MSO A;  1JB5 A;  2BMQ B;  3EJV A;  3IPT A;  1OUN A;  3FSD A;  1ULI B;  5IG5 A;  2I9W A;  3VSY A;  3JUO A;  2OWP A;  3EC9 A;  3OXA A;  4WP5 A;  4HM8 B;  2RFR A;  5TGN A;  1OPY A;  5CF2 A;  1W02 A;  4L7K A;  1A2K A;  3EN1 B;  5AIH A;  1GY5 A;  3ROB A;  3EHC A;  1AR0 A; 
#chains in the Genus database with same CATH topology
 2F99 A;  5IW9 A;  4R4K A;  3HZP A;  3RGA A;  1YJN 3;  2UX0 A;  4FR9 A;  2QIY A;  1U8C B;  2AAE A;  2W0Q A;  1D6Z A;  4KFD A;  5M18 A;  4PEJ A;  3DH2 A;  3B8L A;  3FLJ A;  3KSP A;  3CNX A;  1E97 A;  1K28 A;  2QEX 3;  2V1L A;  1Q86 4;  3CC2 3;  2CWV A;  4N6L A;  2ML6 A;  3X3X A;  2HOH A;  2OQE C;  2KF6 A;  3ECF A;  1LNH A;  1K73 4;  4QWT A;  4WYK B;  5AYR B;  1X1Y A;  1VQ4 3;  3WMD A;  2XRX B;  4KVH A;  4FCM A;  4N6V 0;  2SBL A;  3D79 A;  1GMQ A;  3CMA 3;  1BNR A;  1CYU A;  3G16 A;  4G1M B;  1LNI A;  3PS8 A;  3CCE 3;  2W9P A;  3Q2P A;  2JQ5 A;  1B27 A;  3NQY A;  3ZFZ A;  5RNT A;  1R4Y A;  1NWW A;  3NXJ A;  5CXO A;  1HYF A;  1M1K 4;  3OX9 A;  5M19 A;  5DRE A;  1PY3 A;  3HOH A;  1OAC A;  1RGC A;  3D9R A;  1AVK A;  1RGE A;  2CG0 A;  2FNQ A;  4LMI A;  3SX1 A;  1T2H A;  1B2S A;  1VZZ A;  1U5O A;  4XBX A;  1O7H B;  2A15 A;  2L4V A;  1RLS A;  5IEP A;  3AGO A;  1MOL A;  2CFK A;  3AHS A;  3MG1 A;  1TIJ A;  1QVG 2;  2J8X B;  3CC7 3;  1V58 A;  1W7C A;  1RNT A;  1JB4 A;  3F9S A;  3G71 3;  5IEN A;  1IVU A;  5GSP A;  1WTH A;  5IG0 A;  3SVA A;  5BVB A;  1UW1 A;  3CNM A;  1VQ9 3;  1O7W B;  1IVV A;  3LTC A;  1IVW A;  1N5P A;  1KSI A;  5AI1 A;  2HMJ B;  5D82 A;  1TFK A;  1DVC A;  2H0H A;  3DGY A;  2W04 A;  1W2B 2;  3AHW A;  2FXT A;  4FMC A;  4HM1 B;  3DGO A;  1UUW B;  2H0I A;  2P05 A;  2CHC A;  2Z77 A;  2BHM A;  3KKG A;  4HM0 B;  3O8Y A;  4GHO A;  3WOF B;  2K0M A;  1YJW 3;  1BNG A;  1SAR A;  2KCD A;  2UGI A;  2GEY A;  4R9L A;  6STD A;  3NHX A;  9RNT A;  4O8S A;  1MGR A;  1W5Z A;  3EBT A;  3JUP A;  3FG4 A;  4IIA A;  1B3S A;  2XGN A;  1Q7H A;  3K5T A;  2ZDJ A;  4O02 B;  1BRG A;  3URP A;  1QJG A;  3ZG0 A;  3EN8 A;  1G0T A;  2D1W A;  5IER A;  2GU1 A;  1YIJ 3;  4BTW A;  3GRD A;  1MWU A;  5AII A;  1JB2 A;  1YGE A;  2OOV A;  1W01 A;  3KE7 A;  4N6O B;  3DGM A;  4N6T A;  3UJM A;  1BRH A;  2Y73 A;  4J5K A;  3SXX A;  1NB3 I;  2W56 A;  4L8O A;  2P0X A;  2CFG A;  4K90 B;  1NB5 I;  1QAF A;  1PYL A;  3V98 A;  1LOX A;  4OK0 A;  1YI2 3;  3X41 A;  1BRN L;  1OGZ A;  1VQ6 3;  2YFI B;  1OHO A;  3WR2 A;  1WNH A;  3ZG5 A;  1Z1S A;  5CF1 A;  2ZA4 A;  3JUN A;  3MG3 A;  1Q40 B;  2STD A;  4XM4 A;  4MMY B;  1JB5 A;  3IPT A;  3I56 3;  1FUS A;  3D5I A;  2OTL 3;  3AMO B;  2W9Q A;  1VQ8 3;  3UL6 A;  1GY5 A;  3ROB A;  2KXG A;  3EHC A;  5JPP A;  3CCU 3;  2YFJ B;  2XEP A;  3GZY B;  3STD A;  3GZR A;  1JBT A;  3E99 A;  5STD A;  2CWU A;  2GBW B;  3GWR A;  3DMC A;  3DXO A;  1YVB I;  1GOV A;  2IUK A;  3BU4 A;  3DGL A;  1JNQ A;  4O2H A;  3CCR 3;  3UL5 A;  3BNC A;  2AAD A;  4RNT A;  2W2C A;  1EQK A;  1JKG B;  4WYK A;  4OUQ A;  1GSP A;  2K3D A;  3K9M C;  1STD A;  1EEJ A;  1GOU A;  1KQS 2;  2KF4 A;  4HM3 B;  1FGQ A;  3CXC 2;  5IG3 A;  2XSO B;  2KRT A;  2UUG C;  3X42 A;  1KWI A;  3F7S A;  5IG4 A;  1BNJ A;  1Q7Y 4;  2GEX A;  3B4P A;  1T5Y A;  3H3H A;  1IV9 A;  2IY2 A;  4RZM A;  1ZS7 A;  2IA7 A;  1TFO A;  1YJ9 3;  1CH0 A;  4O3V A;  1GMP A;  3X3Y A;  1JJ2 2;  1JN5 A;  2RNT A;  1J2B A;  3FKA A;  4BTX A;  2IMJ A;  3JUQ A;  4J9A A;  3X40 A;  1BSE A;  3ALA A;  1I0V A;  3K0Z A;  2F56 A;  3QK9 A;  2F5W A;  2YFL B;  2C11 A;  3LZA A;  3DGN A;  3EB8 A;  3K63 A;  3HIG A;  3KII A;  1JZD A;  2GU3 A;  3N8B A;  1K9M 4;  1GMR A;  3MG2 A;  3F40 A;  4K1V A;  1L5G B;  1OH0 A;  1UUG B;  4EC6 A;  5ELJ A;  3UB1 A;  4ZM8 A;  4FMD A;  1JKG A;  3FG1 A;  1K8A 4;  5G1K A;  3LXU X;  1TP6 A;  1ISK A;  1BU4 A;  1IDP A;  3SED A;  3RDE A;  3B4O A;  3EE1 A;  1RN4 A;  1TJD A;  1BOX A;  1GOY A;  3KCH A;  1DMQ A;  1N5H A;  1W2Z A;  2KF5 A;  1E3R A;  1B20 A;  3NBJ A;  4HAA A;  3WA2 X;  1JBR A;  1RSN A;  1Q9E A;  2HML B;  3RNT A;  3DY5 A;  1BSB A;  2RSX A;  1Q82 4;  1UDI I;  2XFS A;  3CCQ 3;  2W6J H;  1N9J A;  1ROV A;  3DM8 A;  3F8H A;  3KFQ C;  4XDW A;  4MMX B;  8CHO A;  1O7P B;  2BT3 A;  2JDI H;  2KF3 A;  1NDO B;  3U1W A;  1LRA A;  4I4K A;  3CPW 2;  1YGW A;  3U97 A;  1T3B A;  1AVL A;  1WQL B;  4KZ1 A;  2INX A;  1X1W A;  1RCL A;  1JRQ A;  3OWU A;  2HMN B;  4GSP A;  3VF1 A;  4MMZ B;  3GZX B;  2ZL8 A;  4U13 A;  2OQE A;  1EKM A;  1LOV A;  3WDG B;  1IQY A;  1AY7 A;  2Q07 A;  3BB9 A;  1R4C A;  4BTY A;  1V57 A;  4R9K A;  1UCK A;  1I0X A;  1B21 A;  1I2E A;  2XF3 A;  1QVF 2;  5G2G A;  2W56 B;  1LVN A;  1OF5 B;  2K54 A;  3NM2 A;  1RN1 A;  2F5M A;  1S5A A;  4EYC A;  1BVI A;  1ULJ B;  3CC4 3;  1IYY A;  3Q3F A;  5EVH A;  4HM5 B;  1RRL A;  5IF6 A;  1K41 A;  2HMK B;  4NRE A;  3N54 B;  1X1U A;  1I3F A;  2R4I A;  1Q42 A;  3G0K A;  1UUV B;  3KN4 A;  4XBY A;  3CPO A;  2XSH B;  1A2P A;  1SII A;  3BNB A;  1BRS A;  1VQM 3;  4K61 A;  4LGQ A;  2QGU A;  3TDG A;  3NQZ A;  1BGS A;  2BMQ B;  4JF8 A;  2XFT A;  3CCL 3;  1OUN A;  1RRH A;  1MWS A;  3FSD A;  1TTO A;  3SYU A;  5IG5 A;  1EUI C;  4HM8 B;  5TGN A;  1OPY A;  1A2K A;  7GSP A;  1Q81 4;  2CFW A;  1N8R 4;  1AR0 A;  1KD1 4;  5BXQ A;  3NV0 A;  3A76 A;  3EF8 A;  1IU7 A;  4CJN A;  1YIT 3;  1ZO2 A;  1DMN A;  3DZL A;  1I2G A;  1I8V A;  1BSD A;  3OWS A;  1VQL 3;  4HM2 B;  4LYL B;  2CKF B;  3K7C A;  4X2O A;  2PZV A;  5HGR A;  1GYB A;  3LYG A;  4GB5 A;  2R41 A;  4STD A;  3LTB A;  3KSE D;  1WMO A;  1UCJ A;  1AQZ A;  3I0Y A;  1MNL A;  5KP3 A;  3LTA A;  2CX1 A;  3Q90 A;  1IV7 A;  1GY7 A;  1B2Z A;  1OHS A;  3RGR A;  1UI7 A;  2XR8 B;  4HKV B;  1FGR A;  1QAL A;  2Z76 A;  4HZ9 B;  4DKI A;  4FCZ A;  1FUT A;  2Y74 A;  1LOY A;  3OWY A;  6RNT A;  1D6U A;  1TRP A;  2BIR A;  3H51 A;  1RDS A;  2P0M A;  3F7X A;  2F86 B;  4KFE A;  1RGA A;  1BSA A;  2E2U A;  2L1S A;  3G8Z A;  3BLZ A;  4HZB B;  1BNE A;  4ILF A;  5CK6 A;  5AEU B;  4AEQ A;  2BO9 B;  1GY6 A;  2MF7 A;  1VQ7 3;  3MWZ A;  3BNE A;  1SJW A;  3AGN A;  2LQV A;  5FGO A;  1G02 A;  4HYZ A;  4WHA A;  2HMO B;  3NX0 A;  5ELU A;  2B1X B;  1EG9 B;  3HK4 A;  4J5G A;  3VGN A;  4K1U A;  2F4Y A;  2HMM B;  3L0R A;  4BU4 A;  2IUJ A;  4HM6 B;  2PNC A;  4CDL A;  1ZX2 A;  4RNZ A;  1VQP 3;  1W6Y A;  4XB5 A;  4XBT A;  1NO3 A;  3NV0 B;  4N6U A;  1D6Y A;  4Q53 A;  2GBX B;  3CCM 3;  1ROA A;  4NHF A;  3S5C A;  1IK3 A;  2GXF A;  3D5G A;  1JV2 B;  4EV5 A;  4XDV A;  1ZGX A;  3G6E 3;  4HM4 B;  3S27 A;  2C4B A;  4WFO A;  3X3Z A;  4EBG A;  4HM7 B;  5AEW B;  3JUM A;  1DE3 A;  4AKZ A;  2ZHX B;  3CCS 3;  3LT8 A;  3KZT A;  1LQM B;  3LH4 A;  4FMB A;  3WOD G;  2CFD A;  2RGQ A;  2RCD A;  1B2U A;  4LSO A;  1RTU A;  2WOH A;  3S67 A;  4MJD A;  1O7M B;  1KC8 4;  1JBS A;  1AV4 A;  1BSC A;  1CYV A;  1RGH A;  1C54 A;  1OCV A;  1Y4K A;  3MKI A;  3SLU A;  5IEO A;  1FGO A;  3FF2 A;  4R80 A;  2O9U X;  1O7N B;  1BAN A;  4RBN A;  8RNT A;  1X1X A;  1VQN 3;  1BUQ A;  3FG3 A;  1DMM A;  1OF5 A;  1OGX A;  3PYJ A;  1BRJ A;  1HZ1 A;  1JN5 B;  2RBI A;  4H3U A;  1W00 A;  3IMA B;  1GD3 A;  5EEO A;  3MHE A;  5KP1 A;  2OCT A;  3ER7 A;  1IVX A;  1DET A;  2B24 B;  5BIR A;  3MPH A;  4EXR A;  2E2V A;  1DYU A;  7STD A;  3PXM A;  1STF I;  5AIF A;  1F8N A;  1S72 3;  4RNY A;  1G96 A;  2BNG A;  1LOW A;  1TU5 A;  3V99 A;  1ULI B;  3GAX A;  3JUO A;  2OWP A;  3OXA A;  4WP5 A;  5CF2 A;  3WOE B;  2RFR A;  3WA3 A;  2MC8 A;  4L7K A;  4FMA A;  3BIR A;  3PGB A;  4EV2 A;  1IT7 A;  1EA2 A;  3V92 A;  3HI7 A;  4FCJ A;  3NBB A;  5A0O B;  5BU4 A;  1BRI A;  2BU4 A;  1NU3 A;  2KAA A;  1RCK A;  3JVC A;  5AIG A;  4L8P A;  1RGG A;  1W6C A;  3OV4 A;  4J8T A;  1RGL A;  2BMO B;  1B2M A;  1OHP A;  1T2I A;  1SQW A;  3AMO A;  3EX9 A;  1PFP A;  2QA4 3;  3FZW A;  3CU3 A;  3OW2 2;  2CH9 A;  3SOA A;  1ASK A;  1FA3 A;  1GS3 A;  3PCS A;  4BL2 A;  1VQO 3;  4HBR A;  3HII A;  3MYT A;  1M90 4;  2E2T A;  2OOV C;  2W03 A;  4H61 A;  5M1A A;  3NUV A;  3UNL A;  1W6G A;  4JRF A;  1UGH I;  3F8X A;  5KP4 A;  1I2F A;  4BL3 A;  1IQX A;  5JBS A;  1RGF A;  4KT3 B;  1RNB A;  3PZW A;  5G1L A;  1O7G B;  1RJO A;  3D4A A;  2O3O A;  3EQQ B;  3N9H A;  1RN7 A;  4IPB A;  1RKY A;  3SOY A;  4AKY A;  2Z6B A;  3FCS B;  1C7H A;  1RMS A;  2CWT A;  3S28 A;  1GD4 A;  1M1X B;  3HX8 A;  4HOH A;  1I70 A;  6GSP A;  3CD6 3;  3NBR A;  2BMR B;  4IT7 A;  1V74 A;  1YVS A;  3IJE B;  4X2H A;  1BUJ A;  1MWT A;  5LC7 A;  2F98 A;  1DVD A;  1US1 A;  1WMN A;  4N6N B;  2WGQ A;  4MEI A;  3DUK A;  4NPB A;  3LT9 A;  1I3I A;  3LOY A;  5AYS C;  2CK3 H;  1SIH A;  2YX9 A;  3I55 3;  1N9E A;  1FUW A;  3CCV 3;  4HVN A;  3EBY A;  1LQG C;  4GL6 A;  1VQ5 3;  5CLK A;  2LYX A;  3J7Y d;  4N3V A;  2C10 A;  2M7O A;  1BNI A;  1FW7 A;  1YHQ 3;  1TUH A;  4LZI A;  4CCV A;  1PU4 A;  2XGL A;  2SAR A;  2CFL A;  3GSP A;  1YNV X;  2CX0 A;  1BIR A;  1FZU A;  1RHL A;  3B7C A;  3D3L A;  2CIU A;  1MGW A;  3M8C A;  3NM7 A;  1SPU A;  1WMP A;  3BND A;  2XH9 A;  1IT8 A;  1LXE A;  3A5E A;  3F14 A;  1Q40 A;  2P09 A;  4TX4 A;  1CQS A;  2OTJ 3;  1FGT A;  1JZO A;  3S29 A;  4WWU C;  4BIR A;  5I97 A;  2ML5 A;  2FGT A;  3T0U A;  5LC6 A;  7RNT A;  1A2V A;  1E3V A;  1A90 A;  1HU9 A;  4CPK A;  4LEH A;  1UCL A;  4HJL B;  5JPU A;  4OVM A;  3FF0 A;  4R1K A;  1UI8 A;  1TRQ A;  2WOF A;  1VQQ A;  3T8N A;  1CEW I;  4N6M A;  1BNF A;  1QMA A;  1MWR A;  1UGI A;  2IYJ A;  3Q1C A;  4KFF A;  3T8U A;  4EW5 A;  3G4S 3;  1HKX A;  3GZB A;  3PCR A;  2CG1 A;  3WHO A;  2Z7A A;  3CME 3;  2WGO A;  1FGM A;  3QRD A;  1BRK A;  1VQK 3;  3FH1 A;  3LTD A;  3LML A;  1N8Q A;  2CW9 A;  1M9G A;  3FGY A;  2CC3 A;  5DRV A;  5EQL A;  1NNV A;  5D83 A;  1BNS A;  5FW5 A;  1B2X A;  1IQ8 A;  5HOH A;  4ORL A;  1FYS A;  2GSP A;  4I5Q A;  2D42 A;  3MSO A;  3EJV A;  1BAO A;  1W4N A;  3CCJ 3;  2I9W A;  3VSY A;  1A67 A;  1RGK A;  1UCI A;  3EC9 A;  1QAK A;  2WO0 A;  1W02 A;  2H0G A;  3EN1 B;  5AIH A;  1NJI 4;  2P38 A;  5D81 A; 
#chains in the Genus database with same CATH homology
 2F99 A;  5IW9 A;  4R4K A;  3HZP A;  3RGA A;  1YJN 3;  2UX0 A;  4FR9 A;  2QIY A;  1U8C B;  2W0Q A;  1D6Z A;  4KFD A;  4PEJ A;  3B8L A;  3FLJ A;  3KSP A;  3CNX A;  1E97 A;  1K28 A;  2QEX 3;  2V1L A;  1Q86 4;  3CC2 3;  2CWV A;  4N6L A;  2ML6 A;  3X3X A;  2OQE C;  3ECF A;  1LNH A;  1K73 4;  4QWT A;  4WYK B;  5AYR B;  1VQ4 3;  3WMD A;  2XRX B;  4KVH A;  4FCM A;  4N6V 0;  2SBL A;  3CMA 3;  1CYU A;  3G16 A;  4G1M B;  3PS8 A;  3CCE 3;  2W9P A;  3Q2P A;  2JQ5 A;  3NQY A;  1NWW A;  3NXJ A;  5CXO A;  1M1K 4;  3OX9 A;  5DRE A;  1OAC A;  3D9R A;  1AVK A;  2CG0 A;  2FNQ A;  4LMI A;  3SX1 A;  1VZZ A;  1U5O A;  4XBX A;  1O7H B;  2A15 A;  2L4V A;  5IEP A;  1MOL A;  2CFK A;  3MG1 A;  1TIJ A;  1QVG 2;  3CC7 3;  1W7C A;  1JB4 A;  3F9S A;  3G71 3;  5IEN A;  1IVU A;  1WTH A;  5IG0 A;  3SVA A;  5BVB A;  1UW1 A;  3CNM A;  1VQ9 3;  1O7W B;  1IVV A;  3LTC A;  1IVW A;  1N5P A;  1KSI A;  5AI1 A;  2HMJ B;  5D82 A;  1TFK A;  1DVC A;  2W04 A;  2FXT A;  4FMC A;  4HM1 B;  3DGO A;  1UUW B;  2P05 A;  2CHC A;  2Z77 A;  2BHM A;  3KKG A;  4HM0 B;  3O8Y A;  3WOF B;  2K0M A;  1YJW 3;  4R9L A;  2KCD A;  2GEY A;  6STD A;  3NHX A;  4O8S A;  1W5Z A;  3EBT A;  3JUP A;  3FG4 A;  4IIA A;  2XGN A;  3K5T A;  4O02 B;  2ZDJ A;  1QJG A;  3EN8 A;  2D1W A;  5IER A;  2GU1 A;  1YIJ 3;  4BTW A;  3GRD A;  5AII A;  1JB2 A;  1YGE A;  2OOV A;  1W01 A;  3KE7 A;  4N6O B;  3DGM A;  4N6T A;  3UJM A;  3SXX A;  2Y73 A;  1NB3 I;  2W56 A;  4L8O A;  2P0X A;  2CFG A;  4K90 B;  1NB5 I;  1QAF A;  3V98 A;  1LOX A;  4OK0 A;  1YI2 3;  3X41 A;  1OGZ A;  1VQ6 3;  2YFI B;  1OHO A;  1WNH A;  1Z1S A;  5CF1 A;  3JUN A;  3MG3 A;  1Q40 B;  2STD A;  4XM4 A;  4MMY B;  1JB5 A;  3IPT A;  3I56 3;  2OTL 3;  3AMO B;  2W9Q A;  1VQ8 3;  3UL6 A;  1GY5 A;  3ROB A;  2KXG A;  3EHC A;  5JPP A;  3CCU 3;  2YFJ B;  2XEP A;  3GZY B;  3STD A;  3GZR A;  3E99 A;  5STD A;  2CWU A;  2GBW B;  3GWR A;  3DMC A;  3DXO A;  1YVB I;  2IUK A;  3DGL A;  4O2H A;  1JNQ A;  3CCR 3;  3UL5 A;  3BNC A;  2W2C A;  1EQK A;  1JKG B;  4WYK A;  4OUQ A;  3K9M C;  1STD A;  1KQS 2;  4HM3 B;  1FGQ A;  3CXC 2;  5IG3 A;  2XSO B;  2KRT A;  3X42 A;  1KWI A;  3F7S A;  5IG4 A;  1Q7Y 4;  2GEX A;  3B4P A;  1T5Y A;  3H3H A;  1IV9 A;  4RZM A;  2IA7 A;  1TFO A;  1YJ9 3;  3X3Y A;  4O3V A;  1JJ2 2;  1JN5 A;  1J2B A;  3FKA A;  4BTX A;  2IMJ A;  3JUQ A;  4J9A A;  3X40 A;  3ALA A;  3K0Z A;  3QK9 A;  2YFL B;  2C11 A;  3LZA A;  3EB8 A;  3DGN A;  3K63 A;  3HIG A;  3KII A;  2GU3 A;  3N8B A;  1K9M 4;  4K1V A;  3MG2 A;  3F40 A;  1L5G B;  1OH0 A;  4EC6 A;  5ELJ A;  3UB1 A;  4ZM8 A;  4FMD A;  1JKG A;  3FG1 A;  1K8A 4;  3LXU X;  1TP6 A;  1ISK A;  1IDP A;  3SED A;  3RDE A;  3B4O A;  3EE1 A;  1DMQ A;  1N5H A;  1W2Z A;  1E3R A;  3NBJ A;  3WA2 X;  2HML B;  3DY5 A;  2RSX A;  1Q82 4;  2XFS A;  3CCQ 3;  2W6J H;  1N9J A;  1ROV A;  3DM8 A;  3F8H A;  3KFQ C;  4XDW A;  4MMX B;  8CHO A;  1O7P B;  2BT3 A;  2JDI H;  3U1W A;  1NDO B;  4I4K A;  3CPW 2;  3U97 A;  1AVL A;  1WQL B;  4KZ1 A;  2INX A;  1JRQ A;  3OWU A;  2HMN B;  3VF1 A;  4MMZ B;  3GZX B;  2ZL8 A;  4U13 A;  2OQE A;  1EKM A;  3WDG B;  1IQY A;  2Q07 A;  3BB9 A;  1R4C A;  4BTY A;  4R9K A;  2XF3 A;  1QVF 2;  5G2G A;  2W56 B;  1LVN A;  1OF5 B;  2K54 A;  3NM2 A;  4EYC A;  1S5A A;  1ULJ B;  3CC4 3;  5EVH A;  4HM5 B;  1RRL A;  5IF6 A;  1K41 A;  2HMK B;  4NRE A;  3N54 B;  2R4I A;  1Q42 A;  3G0K A;  1UUV B;  3KN4 A;  4XBY A;  3CPO A;  2XSH B;  1SII A;  3BNB A;  1VQM 3;  4K61 A;  4LGQ A;  2QGU A;  3TDG A;  3NQZ A;  2BMQ B;  4JF8 A;  2XFT A;  3CCL 3;  1OUN A;  1RRH A;  3FSD A;  5IG5 A;  4HM8 B;  5TGN A;  1OPY A;  1A2K A;  1Q81 4;  2CFW A;  1N8R 4;  1AR0 A;  1KD1 4;  5BXQ A;  3NV0 A;  3A76 A;  3EF8 A;  1IU7 A;  1YIT 3;  1ZO2 A;  1DMN A;  3DZL A;  3OWS A;  1VQL 3;  4HM2 B;  2CKF B;  3K7C A;  4X2O A;  2PZV A;  5HGR A;  1GYB A;  3LYG A;  4GB5 A;  4STD A;  3LTB A;  3KSE D;  1WMO A;  3I0Y A;  1MNL A;  5KP3 A;  3LTA A;  3Q90 A;  1IV7 A;  1GY7 A;  1OHS A;  3RGR A;  1UI7 A;  2XR8 B;  4HKV B;  1FGR A;  1QAL A;  2Z76 A;  4HZ9 B;  4FCZ A;  2Y74 A;  3OWY A;  1D6U A;  3H51 A;  2P0M A;  3F7X A;  2F86 B;  4KFE A;  2E2U A;  3G8Z A;  5AEU B;  1W2B 2;  3BLZ A;  4HZB B;  5CK6 A;  4AEQ A;  2BO9 B;  1GY6 A;  2MF7 A;  1VQ7 3;  3MWZ A;  3BNE A;  1SJW A;  5FGO A;  2LQV A;  4HYZ A;  4WHA A;  2HMO B;  3NX0 A;  5ELU A;  2B1X B;  1EG9 B;  3HK4 A;  3VGN A;  4K1U A;  2HMM B;  3L0R A;  2IUJ A;  4HM6 B;  2PNC A;  4CDL A;  1ZX2 A;  4RNZ A;  1VQP 3;  1W6Y A;  4XB5 A;  4XBT A;  1NO3 A;  3NV0 B;  4N6U A;  1D6Y A;  4Q53 A;  2GBX B;  3CCM 3;  1ROA A;  4NHF A;  3S5C A;  1IK3 A;  2GXF A;  1JV2 B;  4EV5 A;  4XDV A;  3G6E 3;  4HM4 B;  3S27 A;  4WFO A;  3X3Z A;  4EBG A;  4HM7 B;  5AEW B;  3JUM A;  4AKZ A;  3CCS 3;  3LT8 A;  3KZT A;  3LH4 A;  4FMB A;  3WOD G;  2CFD A;  2RGQ A;  2RCD A;  4LSO A;  3S67 A;  2WOH A;  4MJD A;  1O7M B;  1KC8 4;  1AV4 A;  1CYV A;  1OCV A;  1Y4K A;  3MKI A;  3SLU A;  5IEO A;  1FGO A;  3FF2 A;  4R80 A;  2O9U X;  1O7N B;  1VQN 3;  4RBN A;  1BUQ A;  3FG3 A;  1DMM A;  1OF5 A;  1OGX A;  3PYJ A;  1JN5 B;  4H3U A;  1W00 A;  3IMA B;  1GD3 A;  5EEO A;  3MHE A;  5KP1 A;  2OCT A;  3ER7 A;  1IVX A;  2B24 B;  3MPH A;  4EXR A;  2E2V A;  1DYU A;  7STD A;  3PXM A;  1STF I;  5AIF A;  1F8N A;  1S72 3;  4RNY A;  1G96 A;  2BNG A;  1TU5 A;  3V99 A;  1ULI B;  3GAX A;  3JUO A;  2OWP A;  3OXA A;  4WP5 A;  5CF2 A;  3WOE B;  2RFR A;  3WA3 A;  2MC8 A;  4L7K A;  4FMA A;  3PGB A;  4EV2 A;  1IT7 A;  1EA2 A;  3V92 A;  3HI7 A;  4FCJ A;  3NBB A;  5A0O B;  1NU3 A;  3JVC A;  5AIG A;  4L8P A;  1W6C A;  3OV4 A;  4J8T A;  2BMO B;  1OHP A;  1SQW A;  3AMO A;  3EX9 A;  1PFP A;  2QA4 3;  3FZW A;  3CU3 A;  3OW2 2;  2CH9 A;  3SOA A;  1ASK A;  1FA3 A;  1GS3 A;  3PCS A;  1VQO 3;  4HBR A;  3HII A;  3MYT A;  1M90 4;  2E2T A;  2OOV C;  2W03 A;  4H61 A;  3NUV A;  3UNL A;  1W6G A;  4JRF A;  3F8X A;  5KP4 A;  1IQX A;  5JBS A;  3PZW A;  1O7G B;  1RJO A;  3N9H A;  2O3O A;  3EQQ B;  4IPB A;  1RN7 A;  1RKY A;  3SOY A;  4AKY A;  2Z6B A;  3FCS B;  1C7H A;  2CWT A;  3S28 A;  1GD4 A;  1M1X B;  3HX8 A;  3CD6 3;  3NBR A;  2BMR B;  4IT7 A;  1V74 A;  3IJE B;  4X2H A;  5LC7 A;  2F98 A;  1DVD A;  1US1 A;  1WMN A;  4N6N B;  2WGQ A;  4MEI A;  3DUK A;  3LT9 A;  3LOY A;  5AYS C;  1SIH A;  2CK3 H;  2YX9 A;  3I55 3;  1N9E A;  1FUW A;  3CCV 3;  4HVN A;  3EBY A;  4GL6 A;  1VQ5 3;  5CLK A;  2LYX A;  3J7Y d;  4N3V A;  2C10 A;  2M7O A;  1YHQ 3;  1TUH A;  4LZI A;  4CCV A;  1PU4 A;  2XGL A;  2CFL A;  3B7C A;  3D3L A;  2CIU A;  3M8C A;  3NM7 A;  1SPU A;  1WMP A;  3BND A;  2XH9 A;  1IT8 A;  1LXE A;  3F14 A;  1Q40 A;  2P09 A;  4TX4 A;  1CQS A;  2OTJ 3;  1FGT A;  5I97 A;  3S29 A;  4WWU C;  2ML5 A;  2FGT A;  3T0U A;  5LC6 A;  1A2V A;  1E3V A;  1A90 A;  1HU9 A;  4LEH A;  4HJL B;  5JPU A;  4OVM A;  3FF0 A;  4R1K A;  1UI8 A;  2WOF A;  3T8N A;  1CEW I;  4N6M A;  1QMA A;  3T8U A;  3Q1C A;  4KFF A;  3G4S 3;  1HKX A;  3GZB A;  3PCR A;  2CG1 A;  2Z7A A;  3CME 3;  2WGO A;  1FGM A;  3QRD A;  1VQK 3;  3FH1 A;  3LTD A;  3LML A;  1N8Q A;  2CW9 A;  1M9G A;  3FGY A;  2CC3 A;  5DRV A;  5EQL A;  5D83 A;  5FW5 A;  1IQ8 A;  4ORL A;  2D42 A;  3MSO A;  3EJV A;  1W4N A;  3CCJ 3;  2I9W A;  3VSY A;  1A67 A;  3EC9 A;  1QAK A;  2WO0 A;  1W02 A;  3EN1 B;  5AIH A;  1NJI 4;  2P38 A;  5D81 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...