3OXUD

Complement components factor h ccp19-20 and c3d in complex
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
125
structure length
125
Chain Sequence
GKCGPPPPIDNGDITSFPLSVYAPASSVEYQCQNLYQLEGNKRITCRNGQWSEPPKCLHPCVISREIMENYNIALRWTAKQKLYSRTGESVEFVCKRGYRLSSRSHTLRTTCWDGKLEYPTCAKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Complement C3
publication title Structural basis for engagement by complement factor H of C3b on a self surface.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 24
structure length 125
sequence length 125
chains with identical sequence E, F
ec nomenclature
pdb deposition date 2010-09-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00084 Sushi Sushi repeat (SCR repeat)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.70.10 Mainly Beta Ribbon Complement Module; domain 1 Complement Module, domain 1 3oxuD01
2.10.70.10 Mainly Beta Ribbon Complement Module; domain 1 Complement Module, domain 1 3oxuD02
1U5MA 1NWVA 2IZ4A 1H2QP 2MCZA 1E8BA 3MQLA 2W80A 2KRIA 3KXVA 5HZPB 3T5OA 2BZMA 1GKNA 1E5GA 4J38B 2XRDA 4B2SA 3NFPI 2LOJA 3OP8A 4AYDA 4A5WB 4AYMA 3ZD2A 1HCCA 2XWJI 1TPNA 2B5ID 2IZ3A 1SS2A 2CKUA 2A55A 4AYIA 4ONTD 2JRAA 2RKZA 5HYUB 4CSYA 5FO8C 3IU3I 4FXGG 2RL0A 5JPMG 1OK2A 1H04P 1OJYA 1UOTP 4KKDA 3OXUD 4YNXA 3TVJA 4B2RA 1O9AA 4DJZA 5I0QB 1OK9A 3M7PA 1CKLA 1QUBA 5HYPA 2V8EA 2RLPA 1OK3A 3ZD1A 2EHFA 3O8EB 4IGDA 3R62A 2G7IA 3IX0A 1H03P 2XRBA 3EJHA 1MD8A 4LOTA 3RJ3D 2JGXA 2YRAA 3SW0X 1TPMA 1VVDA 2RKYA 1Z92B 1ELVA 2UWNA 4WJG2 3GOVA 2JGWA 2EC3A 1GKGA 4ZH1D 4F4OC 1C1ZA 1GPZA 1PPQA 2KMSA 4JHSA 1MD7A 1OK1A 3L89M 3OEDC 1E88A 1G4FA 2ERJA 1LY2A 1HFIA 4PZ5A 4AYEA 2W81A 2CG6A 2RLQA 1Q3XA 2XWBF 3CALA 1GHQB 3ZRZA 1H2PP 5HYTB 1FBRA 3ERBA 1OJVA 4C16A 1SRZA 1OJWA 2YBYA 2WIIC 2MCYA 1VVCA 2CG7A 1QO6A 3GXEA 4MUCA 1TPGA 1QGBA 2O39C 4K12A 2QY0A 3INBC 4LOSA 1ZJKA 1HFHA 3KZJA 2XQWC 1G4GA
chains in the Genus database with same CATH superfamily
1U5MA 1NWVA 2IZ4A 1H2QP 2MCZA 1E8BA 3ZLEA 3FGRA 3MQLA 2W80A 2KRIA 3KXVA 5HZPB 3T5OA 2BZMA 1GKNA 1E5GA 4J38B 2XRDA 4B2SA 3NFPI 2ZYCA 2LOJA 3OP8A 4AYDA 4A5WB 4AYMA 3ZD2A 1HCCA 1RLHA 2XWJI 1TPNA 2B5ID 5DN4A 2IZ3A 1SS2A 2CKUA 2A55A 2I2LA 4AYIA 4ONTD 2JRAA 2RKZA 5HYUB 4CSYA 5FO8C 3IU3I 4FXGG 2RL0A 5JPMG 1OK2A 1H04P 1OJYA 1UOTP 5DN5A 4KKDA 3OXUD 4YNXA 3TVJA 4B2RA 4YIZA 3NJAA 1O9AA 4DJZA 5I0QB 1OK9A 3WSYA 3M7PA 1CKLA 1QUBA 5HYPA 2V8EA 2RLPA 1OK3A 4MSLA 3ZD1A 2EHFA 3O8EB 4IGDA 3R62A 2G7IA 3IX0A 1H03P 2XRBA 3EJHA 1MD8A 4LOTA 2Y8RA 3RJ3D 2JGXA 2YRAA 3WSXA 3SW0X 1TPMA 1VVDA 2RKYA 1Z92B 1ELVA 2UWNA 4WJG2 3GOVA 2JGWA 2EC3A 1GKGA 4ZH1D 4F4OC 4APLA 1C1ZA 1GPZA 1PPQA 2KMSA 4JHSA 4BWCA 1MD7A 1OK1A 3L89M 3OEDC 1E88A 1G4FA 3CI0J 2ERJA 3K3TA 1LY2A 4N7EA 4PO7A 2Y8TA 3FGTA 1HFIA 4PZ5A 4AYEA 2W81A 2CG6A 2RLQA 2X2ZA 1Q3XA 2XWBF 3CALA 1GHQB 3ZLDA 3ZRZA 1H2PP 5HYTB 1FBRA 3ERBA 3F6KA 1OJVA 4C16A 1SRZA 1OJWA 2YBYA 2WIIC 2MCYA 1VVCA 2Y8SA 2CG7A 3VWOA 1QO6A 3GXEA 4MUCA 1TPGA 1QGBA 2O39C 4K12A 2QY0A 3INBC 4LOSA 1ZJKA 1HFHA 3KZJA 2XQWC 1G4GA
chains in the Genus database with same CATH topology
1U5MA 1NWVA 2IZ4A 1H2QP 2MCZA 1E8BA 3MQLA 2W80A 2KRIA 3KXVA 5HZPB 3T5OA 2BZMA 1GKNA 1E5GA 4J38B 2XRDA 4B2SA 3NFPI 2LOJA 3OP8A 4AYDA 4A5WB 4AYMA 3ZD2A 1HCCA 2XWJI 1TPNA 2B5ID 2IZ3A 1SS2A 2CKUA 2A55A 4AYIA 4ONTD 2JRAA 2RKZA 5HYUB 4CSYA 5FO8C 3IU3I 4FXGG 2RL0A 5JPMG 1OK2A 1H04P 1OJYA 1UOTP 4KKDA 3OXUD 4YNXA 3TVJA 4B2RA 1O9AA 4DJZA 5I0QB 1OK9A 3M7PA 1CKLA 1QUBA 5HYPA 2V8EA 2RLPA 1OK3A 3ZD1A 2EHFA 3O8EB 4IGDA 3R62A 2G7IA 3IX0A 1H03P 2XRBA 3EJHA 1MD8A 4LOTA 3RJ3D 2JGXA 2YRAA 3SW0X 1TPMA 1VVDA 2RKYA 1Z92B 1ELVA 2UWNA 4WJG2 3GOVA 2JGWA 2EC3A 1GKGA 4ZH1D 4F4OC 1C1ZA 1GPZA 1PPQA 2KMSA 4JHSA 1MD7A 1OK1A 3L89M 3OEDC 1E88A 1G4FA 2ERJA 1LY2A 1HFIA 4PZ5A 4AYEA 2W81A 2CG6A 2RLQA 1Q3XA 2XWBF 3CALA 1GHQB 3ZRZA 1H2PP 5HYTB 1FBRA 3ERBA 1OJVA 4C16A 1SRZA 1OJWA 2YBYA 2WIIC 2MCYA 1VVCA 2CG7A 1QO6A 3GXEA 4MUCA 1TPGA 1QGBA 2O39C 4K12A 2QY0A 3INBC 4LOSA 1ZJKA 1HFHA 3KZJA 2XQWC 1G4GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1U5M A;  1NWV A;  2IZ4 A;  1H2Q P;  2MCZ A;  1E8B A;  3MQL A;  2W80 A;  2KRI A;  3KXV A;  5HZP B;  3T5O A;  2BZM A;  1GKN A;  1E5G A;  4J38 B;  2XRD A;  4B2S A;  3NFP I;  2LOJ A;  3OP8 A;  4AYD A;  4A5W B;  4AYM A;  3ZD2 A;  1HCC A;  2XWJ I;  1TPN A;  2B5I D;  2IZ3 A;  1SS2 A;  2CKU A;  2A55 A;  4AYI A;  4ONT D;  2JRA A;  2RKZ A;  5HYU B;  4CSY A;  5FO8 C;  3IU3 I;  4FXG G;  2RL0 A;  5JPM G;  1OK2 A;  1H04 P;  1OJY A;  1UOT P;  4KKD A;  3OXU D;  4YNX A;  3TVJ A;  4B2R A;  1O9A A;  4DJZ A;  5I0Q B;  1OK9 A;  3M7P A;  1CKL A;  1QUB A;  5HYP A;  2V8E A;  2RLP A;  1OK3 A;  3ZD1 A;  2EHF A;  3O8E B;  4IGD A;  3R62 A;  2G7I A;  3IX0 A;  1H03 P;  2XRB A;  3EJH A;  1MD8 A;  4LOT A;  3RJ3 D;  2JGX A;  2YRA A;  3SW0 X;  1TPM A;  1VVD A;  2RKY A;  1Z92 B;  1ELV A;  2UWN A;  4WJG 2;  3GOV A;  2JGW A;  2EC3 A;  1GKG A;  4ZH1 D;  4F4O C;  1C1Z A;  1GPZ A;  1PPQ A;  2KMS A;  4JHS A;  1MD7 A;  1OK1 A;  3L89 M;  3OED C;  1E88 A;  1G4F A;  2ERJ A;  1LY2 A;  1HFI A;  4PZ5 A;  4AYE A;  2W81 A;  2CG6 A;  2RLQ A;  1Q3X A;  2XWB F;  3CAL A;  1GHQ B;  3ZRZ A;  1H2P P;  5HYT B;  1FBR A;  3ERB A;  1OJV A;  4C16 A;  1SRZ A;  1OJW A;  2YBY A;  2WII C;  2MCY A;  1VVC A;  2CG7 A;  1QO6 A;  3GXE A;  4MUC A;  1TPG A;  1QGB A;  2O39 C;  4K12 A;  2QY0 A;  3INB C;  4LOS A;  1ZJK A;  1HFH A;  3KZJ A;  2XQW C;  1G4G A; 
#chains in the Genus database with same CATH topology
 1U5M A;  1NWV A;  2IZ4 A;  1H2Q P;  2MCZ A;  1E8B A;  3ZLE A;  3FGR A;  3MQL A;  2W80 A;  2KRI A;  3KXV A;  5HZP B;  3T5O A;  2BZM A;  1GKN A;  1E5G A;  4J38 B;  2XRD A;  4B2S A;  3NFP I;  2ZYC A;  2LOJ A;  3OP8 A;  4AYD A;  4A5W B;  4AYM A;  3ZD2 A;  1HCC A;  1RLH A;  2XWJ I;  1TPN A;  2B5I D;  5DN4 A;  2IZ3 A;  1SS2 A;  2CKU A;  2A55 A;  2I2L A;  4AYI A;  4ONT D;  2JRA A;  2RKZ A;  5HYU B;  4CSY A;  5FO8 C;  3IU3 I;  4FXG G;  2RL0 A;  5JPM G;  1OK2 A;  1H04 P;  1OJY A;  1UOT P;  5DN5 A;  4KKD A;  3OXU D;  4YNX A;  3TVJ A;  4B2R A;  4YIZ A;  3NJA A;  1O9A A;  4DJZ A;  5I0Q B;  1OK9 A;  3WSY A;  3M7P A;  1CKL A;  1QUB A;  5HYP A;  2V8E A;  2RLP A;  1OK3 A;  4MSL A;  3ZD1 A;  2EHF A;  3O8E B;  4IGD A;  3R62 A;  2G7I A;  3IX0 A;  1H03 P;  2XRB A;  3EJH A;  1MD8 A;  4LOT A;  2Y8R A;  3RJ3 D;  2JGX A;  2YRA A;  3WSX A;  3SW0 X;  1TPM A;  1VVD A;  2RKY A;  1Z92 B;  1ELV A;  2UWN A;  4WJG 2;  3GOV A;  2JGW A;  2EC3 A;  1GKG A;  4ZH1 D;  4F4O C;  4APL A;  1C1Z A;  1GPZ A;  1PPQ A;  2KMS A;  4JHS A;  4BWC A;  1MD7 A;  1OK1 A;  3L89 M;  3OED C;  1E88 A;  1G4F A;  3CI0 J;  2ERJ A;  3K3T A;  1LY2 A;  4N7E A;  4PO7 A;  2Y8T A;  3FGT A;  1HFI A;  4PZ5 A;  4AYE A;  2W81 A;  2CG6 A;  2RLQ A;  2X2Z A;  1Q3X A;  2XWB F;  3CAL A;  1GHQ B;  3ZLD A;  3ZRZ A;  1H2P P;  5HYT B;  1FBR A;  3ERB A;  3F6K A;  1OJV A;  4C16 A;  1SRZ A;  1OJW A;  2YBY A;  2WII C;  2MCY A;  1VVC A;  2Y8S A;  2CG7 A;  3VWO A;  1QO6 A;  3GXE A;  4MUC A;  1TPG A;  1QGB A;  2O39 C;  4K12 A;  2QY0 A;  3INB C;  4LOS A;  1ZJK A;  1HFH A;  3KZJ A;  2XQW C;  1G4G A; 
#chains in the Genus database with same CATH homology
 1U5M A;  1NWV A;  2IZ4 A;  1H2Q P;  2MCZ A;  1E8B A;  3MQL A;  2W80 A;  2KRI A;  3KXV A;  5HZP B;  3T5O A;  2BZM A;  1GKN A;  1E5G A;  4J38 B;  2XRD A;  4B2S A;  3NFP I;  2LOJ A;  3OP8 A;  4AYD A;  4A5W B;  4AYM A;  3ZD2 A;  1HCC A;  2XWJ I;  1TPN A;  2B5I D;  2IZ3 A;  1SS2 A;  2CKU A;  2A55 A;  4AYI A;  4ONT D;  2JRA A;  2RKZ A;  5HYU B;  4CSY A;  5FO8 C;  3IU3 I;  4FXG G;  2RL0 A;  5JPM G;  1OK2 A;  1H04 P;  1OJY A;  1UOT P;  4KKD A;  3OXU D;  4YNX A;  3TVJ A;  4B2R A;  1O9A A;  4DJZ A;  5I0Q B;  1OK9 A;  3M7P A;  1CKL A;  1QUB A;  5HYP A;  2V8E A;  2RLP A;  1OK3 A;  3ZD1 A;  2EHF A;  3O8E B;  4IGD A;  3R62 A;  2G7I A;  3IX0 A;  1H03 P;  2XRB A;  3EJH A;  1MD8 A;  4LOT A;  3RJ3 D;  2JGX A;  2YRA A;  3SW0 X;  1TPM A;  1VVD A;  2RKY A;  1Z92 B;  1ELV A;  2UWN A;  4WJG 2;  3GOV A;  2JGW A;  2EC3 A;  1GKG A;  4ZH1 D;  4F4O C;  1C1Z A;  1GPZ A;  1PPQ A;  2KMS A;  4JHS A;  1MD7 A;  1OK1 A;  3L89 M;  3OED C;  1E88 A;  1G4F A;  2ERJ A;  1LY2 A;  1HFI A;  4PZ5 A;  4AYE A;  2W81 A;  2CG6 A;  2RLQ A;  1Q3X A;  2XWB F;  3CAL A;  1GHQ B;  3ZRZ A;  1H2P P;  5HYT B;  1FBR A;  3ERB A;  1OJV A;  4C16 A;  1SRZ A;  1OJW A;  2YBY A;  2WII C;  2MCY A;  1VVC A;  2CG7 A;  1QO6 A;  3GXE A;  4MUC A;  1TPG A;  1QGB A;  2O39 C;  4K12 A;  2QY0 A;  3INB C;  4LOS A;  1ZJK A;  1HFH A;  3KZJ A;  2XQW C;  1G4G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...