3OXZA

Crystal structure of abl kinase domain bound with a dfg-out inhibitor ap24534
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
284
structure length
268
Chain Sequence
GSPNYDKWEMERTDITMKHKLGGGQYGEVYEGVWKKYSLTVAVKTLVEEFLKEAAVMKEIKHPNLVQLLGVCTREPPFYIITEFMTYGNLLDYLRECNRQEVSAVVLLYMATQISSAMEYLEKKNFIHRDLAARNCLVGENHLVKVADFGLSYTGAKFPIKWTAPESLAYNKFSIKSDVWAFGVLLWEIATYGMSPYPGIDLSQVYELLEKDYRMERPEGCPEKVYELMRACWQWNPSDRPSFAEIHQAFETMFQESSISDEVEKELG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords Tyrosine-protein kinase ABL1
publication title Structural Mechanism of the Pan-BCR-ABL Inhibitor Ponatinib (AP24534): Lessons for Overcoming Kinase Inhibitor Resistance.
pubmed doi rcsb
source organism Mus musculus
total genus 89
structure length 268
sequence length 284
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2010-09-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3oxzA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3oxzA01
2GCDA 4IM2A 1OITA 1XBCA 1OM1A 1GIIA 3QTWA 3I81A 1H1WA 3HMNA 4QTCA 5JQ5A 4XP3A 3QRJA 1M7QA 1FMOE 4QMVA 4MNFA 4FSRA 4U80A 2W1GA 1YI4A 2BIYA 4GIIA 4FTKA 2XM8A 3RVGA 3S2PA 1NVQA 1R1WA 2ZV7A 2YIYA 3H0YA 3COKA 3LQ5A 3DOGA 4L6QA 3VBYA 1W98A 3KVWA 4AT5A 4AGDA 3DK6A 2ZM1A 4HPTE 5F4NA 4N70A 4XOYA 3A7JA 4Q5HA 5CU4A 4O2PA 3SV0A 3R63A 5I5ZA 3UMXA 1H08A 3V5WA 4RX8A 2PZRA 2IVTA 2B55A 4S30A 5AUZA 1NVRA 2YM8A 3DKOA 4E3CA 3PJ2A 3KRRA 5DR9A 3QAME 4FIEA 1PYXA 5E8XA 3I5NA 4V0GB 4KIPA 1OIUA 4YGAA 2O3PA 4UMPA 5DH3A 3QHRA 3MS9A 2FB8A 3QKMA 4K77A 4A06A 3SRVA 4IDVA 2F2CB 1GZKA 1OPJA 3P7AA 4FL2A 4B0GA 2XNMA 4PPCA 4IAYA 2OIQA 3EN9A 4UMRA 4RIXB 2XIZA 5KMJA 3UPXA 3WOWA 3BCEA 4ACHA 3IGGA 3VS6A 3JY0A 2UVXA 2QU5A 1NXKA 2WMUA 2WTCA 3E8CA 3R00A 4Y73A 2QOBA 1A48A 2Y6MA 3I6WA 2CLXA 2G2HA 1XO2B 2B4SB 4JAJA 4RPVA 3FSKA 4IC8A 3VQUA 5L2WA 3SA0A 2ZM3A 5IH4A 5HLNA 2JBOA 5FEDA 2JAVA 3TZ9A 4A4XA 4ID7A 1HOWA 2BMCA 2C0OA 3A61A 3F2RA 3D0EA 4TXCA 1WBNA 4HGTA 1IR3A 1WCCA 4USEA 4CKRA 4O0RA 1OPKA 3BX5A 2W1FA 4BCQA 3PIYA 1KOBA 2W1CA 4IM3A 4HCUA 4RC2A 5EHOA 1PKDA 1YKRA 2AUHA 3FKOA 1FOTA 2C5OA 2PZPA 4XYFA 2PZYA 3CY2A 3BHHA 4XP0A 3CTJA 5AV0A 1WVYA 2WTDA 2ZMCA 4IQ6A 4FI1A 2BRHA 3MVJA 1QPJA 3VUMA 3VAPA 3UO5A 1SVGA 4NTSA 4D2TA 2CDZA 5F1ZA 2OI4X 3V01A 4KRCA 3NCZA 4XV2A 3WZJA 2RFNA 3TJCA 2WMWA 4PRJA 2HWPA 4ZSAA 4EL9A 1XBBA 4EJNA 4YHTA 3UYTA 1OB3A 5GIOE 3C7QA 3HEGA 3KL8A 4U3ZA 3COMA 1U59A 4HZSA 2C6DA 5GHVA 5E1SA 1J1BA 4AFEA 4IAKA 4RVTA 3MGYA 3SXRA 3NZ0A 4XV1A 4MAOA 3PJ3A 2A1AB 2E9OA 3I5ZA 3QCSA 3TKIA 3ZBXA 3IQ7A 3G9LX 3AOXA 5C8KA 1P14A 4CRSA 3OOMA 4RWLA 5AV2A 4YJSA 2V0DA 5AX9A 4O7LA 3O7LD 3VVHA 2VTRA 3ORLA 4UXLA 3LFAA 5HNIX 2XCHA 3UC4A 3E8DA 4J7BA 3BV3A 3BLHA 3H9RA 4IVAA 2JBPA 4NW6A 4JBVA 4P7EA 4S34A 4TN6A 2W5AA 3R01A 1KSWA 1SM2A 3D15A 4M68A 4RVKA 1J3HA 2J0MB 2ZOQA 2UV2A 4PDSA 2X9EA 3TN8A 5M07A 3FC1X 4DHFA 1YXSA 2HXLA 3FLYA 4L9IA 4DFYA 4JIAA 1H01A 3ELJA 3HYHA 3ZZWA 5CEKA 5GJGA 4BIEA 5HCXA 2FSLX 3G2FA 3VBWA 1ZARA 5CT0A 3BQCA 3PWYA 3R30A 1M52A 2JDRA 3CTQA 3NWWA 2HZ4A 3V8WA 4FT7A 3LJ2A 3G15A 3G51A 3QYWA 4O0XA 3D83A 1HCLA 3FZRA 1H8FA 4TRLA 4D2WA 4F08A 2GNGA 4FSWA 5TF9A 4F63A 3F7WA 3QXPA 1SNXA 4C02A 2ONLA 3P5KA 4BGHA 4YJTA 2C69A 4PL5A 5AIRA 5AP0A 2B1PA 2O63A 2JLDA 4B9DA 5M4IA 4M69A 5C1QB 2UZLA 2WTKB 4K1BA 3UIUA 4DGMA 3OXZA 5M53A 1IAHA 3Q3BA 5FUTA 4RRVA 5T68A 3DAJA 3ZFXA 4C61A 4DGLC 3AC1A 5DI1A 4CV8A 4EOKA 3HP2A 5C4KA 4I6FA 4CG9A 4BDFA 2W1EA 4MD9E 2QLUA 4OT5A 3OC1A 2XH5A 2H9VA 4ZSGA 5JT2A 5DN3A 1P4OA 2YWVA 1PKGA 3R2BA 3KXZA 4O81A 1H1QA 4FV0A 4XBUA 4CSVA 1MQBA 2J50A 5BVFA 3IDBA 4YHFA 3QD0A 4U97A 4ALVA 3BBWA 5LVPA 4IX4A 2XEYA 4U45A 4UALA 4ZOGA 4GK4A 4OTDA 4QD6A 4UWCA 4FT5A 4L44A 5CF5A 4O7RA 1F5QA 2F57A 1QL6A 2DUVA 2GPHA 3QZHA 4XMOA 3ORPA 4QMXA 2OG8A 3TI1A 3GNIB 4XBRA 4O7YA 4B8MA 4O0SA 3Q2JA 4QP9A 3UDBA 5LWMA 3CY3A 5HU9A 3QCXA 3AG9A 1ZY5A 5AR4A 2YDJA 5CT7A 4K2RA 4RVMA 2ONLC 4IIRA 2OH4A 1JQHA 4OTQA 5JSMA 3F5GA 4QQJA 3ZLXA 2GNLA 4FT0A 3PJ8A 5IKWA 1BI8A 4YZBA 4QMZA 1OL6A 3O51A 5KCVA 4E5WA 2O65A 3WF5A 3LQ8A 2ITUA 4P5ZA 1RQQA 3MVMA 4EQCA 1Q99A 3Q6WA 4KS7A 5A4TA 5E8ZA 3IW5A 3RNYA 2O2UA 3QTSA 4CKJA 3R8PA 4EK4A 3U6HA 2BDJA 3OEFX 4X2KA 3TUCA 3N4VA 3UQCA 2V55A 5IF1A 5CU6A 5DT0A 5FEQA 5C01A 4EC9A 1Y6AA 3EWHA 2JFMA 4C4GA 4I93A 4DYMA 1XBAA 4FIJA 2C5NA 4IEBA 1A06A 3M2WA 1UWJA 3GQLA 5TT7A 4WA9A 4ZTMA 3QTZA 4BB4A 4LGGA 2R0UA 4BTMA 4O7TA 2SRCA 2BFYA 4YNOA 1UU7A 4NEUA 3CBLA 3K2LA 2C6LA 3LFDA 5IU2A 4ZEGA 4ASZA 4PMTA 3SQQA 4QMYA 4YPSA 1UKIA 4Y72A 3O71A 1GZOA 3PYYA 3GCVA 4JDKA 4I0SA 4IZ7A 2WZJA 4PDYA 3R0TA 4F6UA 5FQDC 4QMOA 2ZYBA 4JDHA 4JI9A 2RSVA 1YXUA 2WMBA 2BALA 2VWIA 1QPCA 1YHWA 3CJGA 3MTLA 3PPKA 3DKGA 3TCPA 4H36A 3CP9A 5M06A 4D9UA 3QRUA 2OO8X 4YLJA 4I41A 5HEZA 5M56A 3CEKA 3ITZA 3HRFA 4JNWA 4YBJA 4AF3A 3UQFA 2PZ5A 3DNDA 1JKKA 5JFWA 3C51A 1G8AA 4CZTA 4AZWA 1YRPA 2W4OA 1YDTE 4DLJA 4HCTA 3TUDA 3CLYA 2YLEA 2CGUA 4FKGA 4HGLA 5EYMA 5L2TA 3EHAA 3GCUA 2ITVA 5J5SA 4XHKB 4O0YA 4QYGA 4JIKA 4LG4A 3PSCA 5HNBA 3MVLA 4W9WA 1CDKA 1DM2A 3IECA 5EKOA 3BHUA 4NJDA 2UZBA 3ZLWA 2PMIA 3LLAA 5HE3A 4FKJA 4AN3A 4IVBA 1KE9A 1MRYA 2XNNA 2XK3A 4DEAA 4UBAA 3D9VA 4DG0E 5IQGA 1Q97A 3RAKA 3PJCA 2Z7RA 2OFVA 2X7FA 3LJ1A 3EZRA 3OUNB 4TWPA 2NO3A 1ZAOA 1PW2A 2OH0E 4ZIMA 4AXAA 5KMOA 3VIDA 4FZ6A 4QMWA 3W2SA 4ZJJA 3VW8A 4EEVA 3GOPA 3QRKA 4BDCA 1M14A 3CC6A 3R1SA 4J52A 4A07A 3MN3A 3DK3A 4QQ5A 1LUFA 2FSMX 3MFRA 4FTIA 5B2KA 3LMGA 4EH7A 1P4FA 4NKSA 4TKSA 1LEWA 4MNEA 4C0TA 3AMAA 4AZSA 3CTHA 3K3JA 5HLWA 2HCKA 4BICA 3AGLA 3GC7A 3GFWA 4TZRA 5EH0A 1UU3A 1H0WA 4DT9A 4C3RA 3R71A 3NNWA 4BKZA 4DFZE 3Q9ZA 2GTNA 3T8OA 2YZLA 4RIWA 3DCVA 3W18A 2VTSA 4BN1A 4CGAA 4O0WA 2QVSE 3O8PA 4MH7A 1AGWA 4KB8A 5M08A 3LAUA 1XH8A 4KD1A 2Y4IC 3LPBA 1STCE 3AGMA 5IA2A 3A99A 2YIWA 2P33A 4GK2A 4EC8A 4UXQA 3QA8A 4DFBA 4RT7A 4BIBA 2JDTA 2B9FA 2YJRA 4NH1A 5IQHA 2XYUA 4FNXA 4CT1A 2GMXA 4USFA 5CU0A 3GENA 5HBJA 4AG8A 2WQEA 2F2UA 2IW8A 2VUWA 4RGJA 5D41A 3HAMA 5HX6A 4TYHA 2KULA 4GJ3A 2A4LA 4YC8A 4QP8A 1V0BA 3DT1A 5DRDA 3O17A 4D28A 2UW0A 3BPRA 4C4JA 3VC4A 4L3LA 4Z3VA 3KRLA 4MVFA 3H0ZA 1VYZA 5AUVA 2Y4PA 3H10A 3ZRMA 1GZNA 3QQGA 4QMMA 1SNUA 1E1XA 2BAKA 4D2SA 3EQBA 1NA7A 1Q62A 1Y57A 1YOLA 3TJDA 1DAYA 3UODA 2DWBA 2BHHA 4P5QA 5TKDA 5HORA 2E9PA 2GSFA 3MW1A 3GU5A 3OCBA 5D10A 3GOKA 5EW3A 4AUAA 4ZAUA 5IA4A 3V5LA 5JZNA 4AQCA 2UW8A 5JK3A 3DBQA 4E8AA 2CN8A 2J6MA 3VRYA 4ORKA 5DEYA 4YU2A 4RQVA 2QOCA 2OIBA 4EZ5A 5J9LA 5IH5A 4G6OA 3P08A 4QTBA 4ZY6A 5ETIA 2BILB 3P86A 1XWSA 3HVCA 3MB6A 3NUSA 2BZJA 2VO7A 4J98A 4L8MA 1BI7A 1P2AA 3UYSA 4A9RA 4NK9A 4MXOA 1U46A 2J0LA 4ANQA 4M13A 2J0JA 4YO4A 3DAKA 5FDXA 5HKMA 1PY5A 3FZOA 4JX7A 5AM6A 3RBWA 3ZOSA 4EQMA 2HAKA 3BRBA 5JEBA 3PA5A 4O22A 3C4FA 4QP1A 4LFIA 4D5HA 1YI6A 4G3FA 5HLPA 2X9FA 3VRZA 4FIGA 4XX9A 2YFXA 3DNEA 5L8LA 5HZNA 4GT4A 3QD3A 4II5A 3IW8A 3Q5IA 4JR7A 3PXRA 3FSFA 5K5NA 3QXOA 4JAIA 4BIDA 2XF0A 2Y7JA 3HMOA 4GFGA 2XNBA 4GFOA 4U81A 5BVEA 3RPRA 4D2PA 3OW4A 1YWVA 5ITAA 5HGIA 4BDIA 5K4JA 2JIIA 3RK5A 2VTHA 3A7HA 3C4ZA 3FE3A 1LEZA 2OK1A 3ZH8A 4APPA 2PVHA 5M4UA 3RKBA 2GS7A 3OZ6A 2Z2WA 1WBWA 2X39A 5I9YA 3O96A 4HYSA 3RAWA 2J5EA 2WTVA 4XV9A 2BRGA 1Q3WA 2HW6A 4BC6A 1IRKA 3PXKA 2B9HA 3ORKA 5AR5A 3IW4A 3CE3A 2FA2A 4IX6A 5HICA 2UW4A 1OKWA 2QHMA 2IW6A 1EH4A 2UUEA 2LGCA 3LFNA 4MBLA 4CQGA 4R77A 1G8SA 4I4FA 3PDTA 4YC6A 3NRMA 3NUAA 1ZLTA 2R7BA 2BTSA 1H0VA 5BUIA 5CEPA 4XEYA 5L2QA 3MFTA 4NTTA 3OCTA 4MF1A 3UGCA 4GKIA 4KS8A 4CV9A 3NPCA 3Q4ZA 5IG1A 2QOOA 4YBKA 3OY1A 2VTTA 4A9UA 3QU0A 4E20A 1MQ4A 4I21A 4EK6A 5KMIA 4O1OA 2WIHA 2I0YA 1TQIA 4GSBA 4IZ5A 4OBOA 2PE2A 4RFZA 4XOZA 5AP6A 1WMKA 4BRXA 2C3IB 4NWMA 4C2VA 2UW5A 4RA4A 3SOAA 3ODZX 2JFLA 4UWYA 2WTWA 2WQMA 4R1VA 5A54A 2R3OA 4ASXA 4KIKA 5AUUA 3OT8A 2QO7A 5HVJA 3EQRA 2C6OA 2ETMA 2PMLX 3EQHA 2XRWA 4BDBA 2XKCA 3BBTB 3LFCA 3NDMA 3HV7A 3VNTA 3KCFA 4X2JA 3LLTA 2VWZA 2EB2A 4FVRA 2GHLA 2PVLA 3OBJA 3GCPA 1NW1A 2GQRA 4V0GA 1GJOA 4UYAA 4C36A 3UNKA 2PUPA 4W4YA 3CD3A 3HA8A 3EQPA 2XYNA 4AGCA 2UVYA 4A4LA 3Q60A 2C3JA 3CPCA 4G31A 3P7BA 1FVRA 1H24A 4Y5HA 3DXQA 4XG6A 3PZHA 1XH4A 2C3KA 4RIXA 5F20A 4W8DA 4U6RA 1JBPE 3QWKA 1OBDA 3PWDA 2Y9QA 4RX7A 3D14A 3LOKA 4AZFA 4Q9ZA 1CKJA 3SOCA 2VTQA 2C6IA 4FSMA 4RIWB 2PPQA 2R3JA 4BCOA 2XEZA 4R78A 4FG9A 3U6IA 2V5QA 4R5YA 4AT3A 4BDEA 5CF4A 2DQ7X 5EM6A 4Y46A 4C7TA 4QMUA 4FKVA 4CMTA 5IEVA 4DCAA 4PDOA 1H25A 4IB3A 2Q0BA 1YHSA 4ZXTA 1FVTA 5CF8A 4YURA 5E8YA 4FT9A 4ZTSA 3S0OA 2H34A 2EXEA 3NMUF 1K9AA 5HU3A 4U0IA 2PUIA 3ZC5A 4DCEA 4Y95A 1WFCA 3BELA 1ZYLA 3BU6A 2UZEA 3O0GA 4FV6A 4CFVA 3KY2A 3BQRA 3MIYA 4DITA 5HO6A 4EH2A 4YTCA 5M44A 5AUTA 2Y0AA 2ZJWA 3EKKA 4UZDA 3R7YA 2CPKE 1PXLA 4IDTA 2C5XA 3RK9A 3QUPA 5IQFA 4UMTA 1UU9A 3HUBA 4L68A 5CZIA 3FBVA 3ZEWA 4YPDA 5IEXA 3CKWA 5FP5A 4L52A 1YWNA 4RJ6A 3QRIA 5A9UA 4F9YA 3L9MA 3LW0A 4JLCA 5BX0A 3QQLA 2J51A 3HRCA 3LCTA 4FVPA 3QQFA 2QLQA 3NNXA 3OTVA 4I6QA 3DJ7A 4PMSA 4AOIA 1YHVA 2VGPA 4G17A 5HG8A 2VGOA 3F5PA 2GHMA 3NUYA 4Q2AA 5HQ0A 2PTKA 4GUBA 4I4EA 2ZDTA 3IK3A 4I6BA 1VEBA 4RZWA 1ERKA 4DLIA 1XR1A 4BI0A 1KE5A 4CZYB 2XJ0A 3WF6A 5AV4A 3OF0A 3KK9A 3BLRA 1K3AA 3MIAA 5CQWA 3SW7A 3V51A 3PVGA 4IW0A 2PVYA 4XJ0A 4DTAA 4TWOA 3IW6A 3T3UA 3NNVA 3W2PA 3LXKA 1M17A 4JBOA 4EQUA 3V5JA 4G9CA 4QMLA 4HNFA 3AMYA 5J1WA 3COIA 2BTRA 2EUFB 3UMWA 1Q8ZA 4USDA 3HX4A 5CAUA 4DH7A 2PYWA 3FYJX 2PZIA 3BV2A 5ANIA 2XKDA 4C4EA 3KEXA 3IOPA 1YVJA 3MSSA 5DLSA 2GTMA 1FBNA 4E6QA 4C8BA 2EWAA 3GUBA 2P4IA 2VTPA 4QRCA 2Z02A 4R8QA 4DGGA 3HKOA 3ZLYA 4EH3A 3ZZEA 5LOHA 3R28A 3DBDA 4RX5A 3V3VA 3HNGA 3QTRA 3KXMA 4UEUA 4WG5A 5CS6A 1CSNA 5BYZA 5AAEA 4HOKA 4X6QC 3U9CA 4TL0A 2ZV2A 2QO2A 2WOTA 4F1MA 5HX8A 5KMNA 4TYJA 3SHEA 3A4PA 2VTJA 2FO0A 2QOLA 3POOA 5EHLA 5IDNA 3R1YA 3NW6A 5E8WA 5D12A 4ANOA 3NUPA 5K5XA 2WMQA 2W1ZA 3M42A 2P0CA 5CQUA 5FP6A 3ANRA 2ITZA 4JDIA 2YJSA 1Z57A 4TW9A 4O7WA 3G6GA 4MXYA 4LGDA 3FLZA 3HL7A 3OEZA 3VUHA 5DVRA 4ZLZA 4PPAA 3ANQA 5D7VA 3IOKA 5EQYA 3MI9A 1AD5A 1AQ1A 5EI8A 4JX3A 3TEIA 5KO1A 4E5BA 3TNHA 2JKQA 4EOSA 2UW7A 1BMKA 4LI5A 4NZWB 3G0FA 3PRIA 3AQVA 4YLLA 1SZMA 4MXZA 1QCFA 4RZVA 5D11A 4R3RA 1O6YA 4J97A 5DA3A 3LQ3A 5HO8A 3ZHPC 4U5JA 4U8ZA 4IAZA 4FF8A 4IZYA 5AP2A 3IKAA 3M1SA 3ORXA 2BKZA 2CCHA 2EXMA 2JAMA 2YEXA 3BE2A 3E5AA 3NIEA 1MUOA 3D5WA 4X3JA 2F7ZE 5A46A 3WZUA 5LWNA 3OW3A 5KBQA 4KIKB 5HIBA 4FKWA 4XNEA 2R9SA 3F6XA 3LHJA 4LQMA 5CAOA 1ZOEA 3D5UA 4UYNA 3PP0A 4BY9E 1JLUE 4FBXA 2Z7LA 3GC8A 3BGPA 3EJ1A 2WTKC 5IMXA 2EVAA 3FMKA 3UP7A 4E6AA 2OXXA 2YITA 3DV3A 2QKWB 4QPSA 4ZTLA 2LAVA 4HJOA 4KBKA 3QGYA 5CI6A 1URWA 4QPAA 3R9NA 5FXSA 3NUNA 2R3PA 4EUUA 2YA9A 4O0UA 4ZTQA 3WZDA 4FIHA 2R3GA 3PA4A 3QHWA 4CVAA 3BHYA 4RA5A 5K3YA 2VRXA 3UTOA 3RAIA 4WNMA 4WNOA 1P5EA 3WZEA 2GU8A 3OT3A 4JXFA 2PUNA 5A4LA 4LV8A 1G5SA 3A4OX 4O7ZA 2OWBA 4YC3A 4A4OA 3ORIA 4RIOA 3O2MA 3L8PA 1OUKA 1B39A 4I94A 4RMZA 3TNQB 4BHZA 3TZMA 3EQCA 4IJPA 4PTCA 3TM0A 2EB3A 4H1MA 5L4QA 4ZSEA 3LXPA 5CI7A 5DYJA 1H00A 1B6CB 5IUIA 1ZYDA 2VD5A 4ZSJA 4YJNA 1JSVA 4F9CA 4O27B 5EYKA 2X8DA 5HVYA 3FMMA 2IWIA 2PE0A 4DEHA 5FG8A 5CEQA 5BNJA 4OLIA 3U55A 4IVCA 3NYVA 3A7FA 2VNYA 3BYUA 1J7UA 4RSSA 1XH6A 4RVLA 5GNKA 2G9XA 4QT1A 4TPTA 5HO7A 2X7GA 3FXZA 1U54B 2VWUA 4YO6A 2E2BA 4RC4A 3QZFA 3KMWA 5IA0A 2VU3A 5BPYA 2C6TA 3BYVA 3NYXA 3VN9A 3ZFYA 1PXIA 5FTOA 1H28A 1LR4A 3POZA 2ITNA 5IQDA 5AA9A 4E4LA 3DPKA 2IW9A 2VTAA 4LL0A 4ZZOA 4CCUA 3TIZA 3L1SA 3ID6C 4FE2A 1VJYA 4H3PA 4IE9A 4YJRA 4UZHA 3ZUVA 4BF2A 4V04A 4LMNA 2WD1A 5FGKA 3ZTXA 2QNJA 5CNNA 5I9VA 2C5VA 3FZPA 1VR2A 4I3ZA 3TKUA 4GJ2A 3OD6X 3F7ZA 5E8SA 5IPJA 1JKSA 2ZV9A 4BCGA 4DTBA 3SAYA 3VS2A 2C3LA 4KKHA 5DOSA 4BCFA 4K18A 2WEIA 1RDQE 3UE4A 2J4ZA 4IB5A 4UX9A 3EB0A 2IVUA 5CNOA 4X3FB 1K2PA 2J9MA 2QD9A 4PMPA 4ZSLA 3IPHA 4GMYA 4NIFA 3SC1A 2WTJA 2FSTX 5HNGA 2YM5A 3CIKA 3ET7A 2VO6A 3EFLA 5J87A 4OAUC 2ESMA 4FKPA 3GFEA 4H3BA 1YXXA 4J8MA 4P4CA 3AD5A 3ZUTA 4FGBA 1OKYA 2HWOA 3ATTA 1ZOGA 2BUJA 5AUYA 3SLSA 3VS0A 3KKVA 4J53A 5A4QA 1REJA 4O83A 1ZMWA 2CNQA 3VUTA 1PMNA 3BU5A 1XH9A 2W5HA 4UV0A 4Y85A 4TYIA 4IFGA 3MPMA 3QZGA 3VUDA 5AADA 1V0OA 4FIIA 1DI9A 4AA0A 5ANGA 3NYNA 3BE9A 4FSNA 4HGEA 2PL0A 2PY3A 2XRUA 4IAIA 4Q5EA 3DBFA 3ZFMA 2CGVA 2O8YA 4BKJA 5IA5A 4EBWA 5CSHA 3OG7A 3L8SA 5M4FA 3CCNA 4GG7A 4JBPA 4PMMA 4D1ZA 4KKGA 1KE8A 4K6ZA 3ZRKA 3F2NA 2R3KA 5EDQA 4MK0A 4FTCA 2BRBA 4L00A 3EQGA 2XK4A 4EYJA 1PMEA 2V7AA 1I09A 5DG5A 5CALA 4ZLOA 4L7FA 2VWVA 4CFFA 3A7GA 3RZFA 4BGGA 2ERKA 3MH1A 3PG1A 3B2TA 4HVGA 5ACBC 1H1PA 4EH4A 4AWIA 1OUYA 2B7AA 5L8KA 3U51A 3IS5A 4LUDA 4TWNA 3B8QA 3DB8A 5CENA 3RI1A 4DN5A 5DHJA 3ZO1A 4BZNA 3PSBA 4D2RA 3MESA 4C33A 2XS0A 2YDIA 4F65A 1U4DA 4MXAA 5JH6A 1H1SA 4FODA 4AW2A 1MRUA 3LFEA 4BCMA 2B52A 3PXQA 3E8NA 3P1AA 5L2SA 1OPLA 4X2FA 4DINA 2DYLA 5D9HA 4AX8A 2W9FB 1LPUA 3MDYA 4QP2A 5AP1A 3W2OA 3NEWA 3ZLSA 5CSVA 1H27A 5LMAA 3DA6A 4WG3A 5TOZA 4PL4A 2OBJA 3H3CA 3HZTA 4UMQA 4MBJA 2CKOA 3UOKA 4BI2A 5HTCA 2RF9A 2GNHA 3CQUA 2OJJA 4NYEA 4ASDA 3KK8A 1S9IA 3PPZA 5FLFA 4BWKA 4KINA 3MTFA 4QYFA 2YIQA 5AP4A 4S31A 3LCDA 3THBA 3TV6A 4BDGA 2YISA 4AU8A 4OBQA 1UNHA 4JDJA 3QZIA 4PV0A 2IO6A 5CU2A 4ZTRA 2QURA 3VBXA 2BROA 3KXNA 4LRJA 5GINE 1E1VA 1YOMA 5EK7A 3HV5A 4FV4A 5L6OA 4HZRA 1F0QA 3OWLA 5AV3A 5DPVA 2WHBA 3SX9A 4GU9A 2JIUA 2I0VA 2RGPA 3COHA 3QRTA 5KMMA 3W10A 5H3QA 1OZ1A 4QQCA 3V5TA 1YOJA 2VWBA 3S95A 5J5TA 3KC3A 5AAGA 5JFXA 2UW3A 3MPTA 2Z8CA 2BHEA 4QP4A 5FM3A 4AW0A 5EQPA 3QC4A 1WVWA 2FSOX 3KQ7A 4TY1A 2CCIA 3HUCA 2BZHB 3QUEA 4O38A 3DB6A 3EYGA 3WE4A 4HVIA 1QPEA 2B53A 3ZUUA 5L2IA 3O50A 4WO5A 3GP0A 4FL1A 3ATSA 5E91A 4DC2A 5K0XA 4YZMA 3U54A 4FV9A 1ZZLA 5HIDA 3KF7A 4O0VA 2UZTA 4W4VA 3WYYA 4S33A 3H4JA 2OF2A 3VHKA 3W55A 5K4IA 4BCKA 4AACA 2QG5A 3SGCA 1PF8A 4X0MA 3EFKA 3F82A 3LFFA 4LGHA 4Y5QA 4TYGA 4D1SA 3Q04A 5BQ0A 3FI8A 3M11A 3RP9A 3NNUA 2VZ6A 2G1TA 2XA4A 1X8BA 2QCSA 3VS4A 4PQNA 2OXYA 4M66A 4EHGA 3TT0A 1W7HA 5CAPA 2VTOA 4QO9A 3DDPA 2OIDA 5HCYA 2PMOX 4FKUA 5AM7A 2F9GA 3DU8A 4JQ7A 4ITIA 4LRKA 2G2IA 3W2CA 3UZPA 3R7VA 4AZVA 3KVXA 3K5VA 4MD7E 3OWPA 3AMBA 3GBZA 2XCKA 4YJOA 3OMVA 3T9IA 3TACA 3NW7A 1OKVA 2W05A 5BVOA 5J8IA 4XRLA 2WQBA 5H2UA 3SG9A 4IWDA 2QU6A 2IG7A 4M0YA 3PJ1A 3NAYA 3MBLA 4AP7A 3CPBA 5CVFA 3QUDA 3RK7A 3HAVA 4IH8A 2BIKB 3ZS5A 5EQEA 1PXMA 5IQEA 5ANDA 3PLAE 4FYNA 4NJ3A 3BI6A 4NIFB 3KRXA 4MYGA 4KA3A 4O21A 3FZSA 5A3XA 5I9XA 3RHKA 5D7AA 2BFXA 2WMAA 1ZRZA 1GAGA 2ZVAA 3ENHA 2XNGA 1ZXEA 5CSXA 3ULIA 4MCVA 2CKPA 4EHZA 3Q2MA 2PVRA 2X81A 5AMNA 1ZMUA 3CS9A 3TNPC 3CR0A 3L8XA 1WBPA 3R2YA 3RPOA 4F7SA 4NM0A 1GOLA 1VYWA 2FH9A 4BWPA 4CTBA 3FJQE 3WI6A 5C27A 3EQFA 2PMNX 1O6KA 4G3GA 5JGBA 2QOQA 4Z7GA 4N57A 4G6LA 2ZDUA 2Z60A 3QD2B 2NRUA 2XKFA 4K33A 2QODA 1YWRA 2NP8A 2CNVA 5AP5A 4KWPA 5ICPA 4ANNA 2A19B 2QOHA 3OXTA 1I44A 3JYAA 4AGWA 3D94A 2B9JA 3JUHA 4W8EA 2GNFA 1J7LA 1SYKA 3ZXZA 5GIPE 1XQZA 5JKGA 4XV3A 2PHKA 4PNIA 1JAMA 4FZFB 5J7HA 2RFEA 1JOWB 4YMJA 4FUXA 5BUJA 2RG6A 4JBQA 2X8EA 2WMRA 4I5MA 4KNBA 2JGZA 2OXDA 3CD8A 3HP5A 4YJVA 5CZHA 4FNYA 4UWBA 4M0ZA 4BDHA 5CX9A 3NW5A 3H30A 3UIBA 4TTHB 4W4XA 1OKZA 4HYIA 4R1YA 2XK7A 5EOLA 4A7CA 3I0QA 4F7JA 2UVZA 4BBFA 3B8RA 2C1BA 4D0WA 5J9YA 2J90A 3ZO3A 2VWXA 4G16A 2XMYA 2XP2A 4FGRA 2OJIA 3I0OA 4GV1A 3LMHA 3QTUA 3E7OA 2HELA 3BZ3A 3W8LA 5IUHA 1NY3A 4EUTA 5FBNC 3MB7A 4FVQA 2A0CX 4NSTA 1Y91A 3TWJA 5ANOA 4U9AA 2Q83A 5EFQA 2PUUA 2W9ZB 3DTCA 4FC0A 2X1NA 2JDSA 3A7IA 4EKLA 5AP3A 5B2LA 4YSJA 3G90X 4QP6A 3ENMA 4PTGA 3II5A 4XS2A 4EZ7A 1JPAA 2G15A 1A9UA 2YAAA 4FV5A 3JR1A 4R3PA 3E8EA 3SW4A 5FDPA 2WFYA 1MRVA 3ZM9A 2W4JA 3SDJA 4ZY5A 3K54A 5TR6A 4DAWA 1APME 2XIXA 4QTDA 5CLPA 4F6WA 3G33A 4M8TA 4XH6A 1YQJA 3FKLA 5HE0A 3V04A 5J7BA 5J95A 1T45A 3EFJA 4CCBA 3V5PA 2XIRA 2VTNA 1LP4A 3ERKA 5HHWA 4ARKA 4WG4A 5ACKA 2W96B 5BVDA 4AA4A 4GG5A 2P2HA 4MWIA 5CXHA 3FHIA 5HBEA 3VUGA 3A2CA 5KMKA 5CVHA 2YIRA 3Q6UA 5AR2A 1YXVA 3VF9A 2XZSA 4L3PA 4FTMA 1OL5A 4FTUA 4GYGA 4E5AX 4DH8A 1BKXA 3QQHA 2YACA 3KULB 3WIKA 2AC5A 4IANA 4OTHA 4C34A 3WBLA 3BKBA 2GS2A 3C50A 5EDRA 4JG8A 2X2KA 3E7VA 4D2VA 5IEYA 4XG8A 1BLXA 5E8VA 1KE6A 2BR1A 4KAOA 3ACKA 2OZAB 2OICA 3NUXA 2HZNA 4ERKA 3U6JA 2BDWA 3VJOA 5H9BA 2X2LA 3ALOA 4G5JA 4D4YA 4WOVA 4L42A 3D2IA 2H8HA 3VHEA 3OCSA 4DTKA 3KN6A 4GT5A 5BVWA 2QQ7A 2YCRA 5LJJA 3ZSGA 4R5SA 3E63A 2WO6A 4D4VA 5CSWA 3LCKA 4KSPA 4ANSA 2IZRA 4DH3A 1OIQA 1U5QA 4CFWA 4MQ2A 3QTIA 4HCVA 4D0XA 2I0EA 3E62A 3PVBA 5ANEA 2KTYA 3KN5A 4Q9SA 3NSZA 4NFNA 1SVHA 4LM5A 5L8JA 2YCQA 1IASA 3D5XA 3PY0A 3BIZA 4BDJA 3NGAA 1J91A 4PNKA 3I1AA 1ZZ2A 4D4SA 3UIMA 3UNZA 2P55A 3BLQA 1IA8A 4EWHA 3ZM4A 1GNGA 1Q8WA 2GFSA 2H96A 3ULZA 5CANA 1CKIA 3DGKA 5AA8A 3A8XA 4L01A 4G2FA 1FPUA 1Y8YA 1RJBA 2X4FA 1T46A 3GU7A 1KV2A 3P4KA 5FTQA 5AUWA 4EHVA 3JVSA 4FKQA 5BVNA 3IONA 4G3DA 2VX0A 2A2AA 2BVAA 2XM9A 2YHVA 4FTJA 4JVGA 4RLLA 4JJRA 5DEWA 1U5RA 2YLFA 3LCOA 1Y6BA 2HXQA 1OMWA 2AYPA 3F5XA 3O7LB 4M12A 3S3IA 3TL8A 4ZS0A 4LOPA 3QA0A 4ZTNA 2GNJA 3PIZA 4U3YA 5J1VA 2O0UA 3WARA 4W4WA 5EW8A 5K0KA 4CFMA 4WBBB 5IMEA 5AUXA 5HI2A 3CSVA 4L43A 3FZ1A 4XLVA 3Q32A 4RJ5A 2IZSA 4MD8E 1PMUA 4DFLA 1W0XC 5BMSA 1NT2A 4RWIA 2OJGA 4E4MA 4PUZA 4EK3A 3EL8A 4X2GA 4EI4A 3ZMMA 3K5UA 4I5CA 2WELA 4X6RA 4FKOA 4O6EA 1Q41A 3EFWA 3W2QA 2JD5A 3JPVA 3MJ1A 1PHKA 4NM3A 3FY0A 4TWCA 4CKIA 2R7IA 3TNWA 1JSTA 4PY1A 4LRMA 2XVDA 3KU2A 4MF0A 4TYEA 3IG7A 3QTQA 5GZ9A 1O6LA 5K9IA 4DA5A 1JVPP 5IQIA 1TKIA 1R0PA 2PVNA 3LFSA 2DS1A 3D5VA 4CZUA 1U54A 3DKCA 3V8SA 2ITTA 5I3OA 3ORMA 4XG4A 4X2NA 4OR5A 4C59A 2PVKA 3ZO2A 3EQIA 3RHXA 2BAQA 1GIJA 4JR3A 4OTWA 2G2FA 3VS5A 4EOPA 4L67A 3U87A 2C68A 4R7IA 2W1DA 4UMUA 2VTIA 1WBOA 4J1RA 3EN4A 1Q8TA 3MFUA 5AFVA 4NFMA 3FAAA 4BHNA 3DY7A 3FQHA 3JY9A 3KFAA 5H8EA 4BZOA 4MX9A 4X7QA 3EZVA 3ODYX 2YCFA 3PG3A 4C58A 4KIQA 3UOHA 4JG7A 3TIYA 3HV6A 3OROA 5J79A 2GQGA 4K9YA 4XCUA 2F4JA 1Q8UA 4E26A 4I5PA 2IVSA 2C0IA 4C57A 3AC5A 4J99A 5GZAA 3AT2A 2HK5A 3P7CA 3OBGA 4RJ3A 3CGFA 3UZRA 1JKLA 2YM7A 4FSUA 4X3FA 4ZP5A 4CFNA 3RNIA 3KGAA 5AEPA 4HVHA 4OT6A 4CYJA 5M4CA 4KIOA 2YIXA 5IQCA 2H6DA 4EORA 3DXPA 4C2WA 3R7UA 1REKA 3P78A 1YDSE 5IZFA 5DNRA 4O84A 3F9NA 3FV8A 2QKRA 4ZJIA 2VV9A 4C62A 4UB7A 4EK5A 3A62A 4EKKA 2R2PA 4LOQA 3U4UA 3LIJA 5DWRA 3MWUA 2HY81 4J96A 4EWQA 2WQNA 3VS1A 4GEOA 4GCJA 3C4CA 3LVPA 4L3JA 4U44A 4Y83A 3BWJA 4DFXE 4H58A 4IXPA 5BYYA 5KMLA 1PXJA 4FKRA 4L7SA 3GEQA 4BKYA 2FUMA 4GKHA 4G6NA 4LOOA 1H4LA 4F99A 5A6NA 2C6EA 2R3QA 4XG7A 3F3TA 2IJMA 4EJ7A 5KE0A 4FSZA 1Q4LA 2PK9A 4PP9A 4F7LA 5JQ8A 3N4UA 1UV5A 4J8NA 3LE6A 3C0GA 2Z7SA 4BBEA 4ZLYA 5CU3A 2OFUA 3TTIA 5M57A 4FV8A 4X3FC 1H1RA 3FMEA 4I22A 4M97A 3RCDA 2W1IA 2YCSA 5CY3A 4JOAA 3K3IA 3PIXA 4IAAA 4JT3A 2VTLA 2R4BA 4PWNA 1Q8YA 1SVEA 2HIWA 3FLSA 3LXNA 2WIPA 1FMKA 2XIKA 3QGWA 3QLGA 4OBPA 5C03A 3DJ5A 4N4SA 2ITOA 3UO4A 3E3PA 2VO0A 3EN5A 2RG5A 2R3RA 1W83A 2YM4A 3D2KA 4NM7A 5HCZA 2QC6A 3L8VA 4R6VA 1RE8A 4L45A 4M15A 3QX2A 3LMIA 5JMSA 5L6WL 3QKKA 3GGFA 4RWJA 3ZC6A 5FXQA 4AW1A 1Q5KA 5EYCA 3V6RA 5KZIA 2JDVA 5LARA 4F0IA 5EI2A 1M2PA 2JC6A 2RIOA 3BWFA 1BL6A 4BCPA 5BYLA 3DDQA 4CQEA 3NVKI 2HYYA 4S2ZA 1J7IA 3R7OA 3CQEA 3VO3A 2CN5A 4MEDA 4EK8A 4G3CA 3MH2A 1OBGA 3FI3A 3R21A 3DKFA 3FZTA 3RALA 3R7GA 5GJFA 3TNIA 4D55A 2ACXA 4M7IA 2BRNA 2EXCX 2P2IA 3E87A 3ORZA 2ETKA 4FNWA 1WBVA 2ZB0A 4I0TA 5DGZA 3UVPA 3VW6A 4YR8A 4FV7A 3QWJA 2VX1A 1R0EA 2QG7A 3KA0A 4BCJA 5M55A 4PX6A 4HNIA 5IQAA 5HTBA 4AN9A 4G3EA 3T9TA 3OS3A 4IACA 4LMUA 3D7TB 2JKOA 3FI4A 3NVMB 4FTQA 3DQWA 3F5UA 1XH7A 3P9JA 4XG2A 3TTJA 3VJNA 4F70A 2HENA 4KKEA 3A60A 1E9HA 2JEDA 2QR7A 3MY1A 2A27A 3ZO4A 1JNKA 4I20A 4FV2A 4QMPA 1JWHA 4RFYA 5ANKA 5CTPA 1Z9XA 3RPYA 3NR9A 4EH5A 1ZYJA 2J5FA 3Q4CA 3UG2A 2UZNA 3BEGA 4ANLA 1KOAA 3U8WA 3I60A 2FYSA 3Q52A 3EMGA 1GIHA 4Y8DA 3ZYAA 2F7XE 5AWMA 4ALUA 2CLQA 3F2AA 4OTPA 3BEAA 4FV3A 3RM6A 3A8WA 4ZTHA 5JGAA 2VWWA 5E8UA 3TG1A 4DEGA 4CEGA 3R8MA 4HW7A 5JGDA 3REPA 3FI2A 4GS6A 4TT7A 3HECA 3O23A 4XRJA 4C3FA 4IMYA 2OLCA 3DQXA 3G5DA 1G3NA 3F3UA 3I6UA 3KXHA 3ZDUA 3BYSA 1KE7A 4GIHA 3ZCLA 2I7QA 1TQPA 4WD5A 4OGRA 4CFUA 2OSCA 5CVGA 5DT3A 2I40A 4APCA 4ZY4A 5IDPA 5EHYA 1QMZA 5EG3A 4FOBA 5E7RA 4WSYA 4F09A 2WOUA 4GUEA 1UVRA 4FTOA 4QP3A 3PY1A 5HD7A 4BDDA 3BHVA 4DGOA 4ACGA 4ERWA 2WU6A 5LVNA 4OTRA 4GVAA 3ORNA 3LFBA 5BVKA 4FOCA 3DBEA 4YZ9A 5HG7A 5IQBA 1OL2A 4BWXA 4YP8A 2Y6OA 3EOCA 5IH6A 3S00A 4H39A 4RIYB 3QCQA 4ASEA 4C35A 5FTGA 3RJCA 4YTHA 5KHWA 3BYOA 4O86A 3E3BX 3OWJA 4M67A 2J7TA 3AD6A 5CSPA 5DT4A 3C13A 3OP5A 4KRDA 5GZ8A 4IFCA 3KREA 2FVDA 3GC0A 4O7SA 4DH1A 2WNTA 2R3MA 5B0XA 3BU3A 4H3QA 4A9YA 4XP2A 4RJ4A 5ETCA 4FA2A 3TKHA 1H26A 5F94A 5LXMA 4AOTA 3C0HA 1GY3A 4DEEA 3GU6A 3QF9A 3RCJA 4EOIA 4F9WA 1FGIA 2WMXA 4YLKA 4F64A 4BYJA 3I4BA 4OTIA 4WHZA 4E4NA 5C8NA 2QR8A 4DBXA 1R3CA 2BAJA 2VWYA 4DH5A 2UZUE 3QBNA 2GS6A 3PLSA 2HY0A 4WUNA 4XUFA 1RW8A 4L53A 3QALE 2X6EA 3QX4A 4ACMA 1F3MC 5DE2A 4GU6A 5LQFA 2YN8A 3GCSA 3C9WA 3AC2A 1S9JA 1TVOA 3PVUA 5AIKA 3R6XA 3ZONA 4AA5A 4E6CA 4R7HA 3OVVA 5FEEA 5I0BA 3FC2A 3FUPA 4E93A 4ACCA 4ITJA 5G1XA 3QC9A 1XJDA 2AC3A 4ANMA 5E1EA 2YDKA 4M84A 5LVOA 2GHGA 4LL5A 2Y8OA 3ORTA 1XHAA 2W7XA 1WZYA 2XKEA 1FVVA 3MH0A 1W8CA 3NX8A 3Q9YA 4IWPA 1UNLA 3IDCA 4O2ZA 5DR2A 4EOLA 4G34A 4QMQA 2CKQA 4FKIA 4B6LA 3N51A 5J9ZA 3RWQA 4ANBA 3TV4A 3F69A 3R9HA 4A9TA 5IA1A 3Q4UA 4CNHA 3KXXA 2FGIA 4PF4A 4MBIA 3ROYA 4BTJA 4U41A 2GDOA 3R9DA 3W2RA 3V8TA 5FWKK 3VS7A 3EQDA 4FX3A 5I9UA 5CASA 3MYGA 2ZM4A 4ALWA 3PXYA 4KBAA 4BCNA 3GXLA 5HVKA 3LM5A 4RBLA 5HE1A 2C6KA 2WMSA 1OL1A 2WMVA 3P0MA 4CRLA 3PTGA 3FMJA 3OY3A 4QNAA 4FZ7A 4IBMA 2BRMA 3BGQA 3MFSA 4WKQA 2W06A 2C5YA 5FD2A 3R8ZA 2VN9A 4FZAB 4JRVA 4FKTA 4BTKA 3FL4A 4HYUA 4EOJA 5HG5A 3FLNC 3HGKA 3EN7A 2X7OA 2XK9A 4P90A 5EM5A 3R9RA 3NAXA 3UNJA 2HOGA 3HMMA 3AT3A 2B9IA 5EM7A 2V7OA 2PU8A 2ITXA 1YXTA 1PRYA 2BCJA 4GL9A 4ZMEA 4AS0A 3HDNA 2R3FA 2WQOA 2YWPA 3CQWA 3IO7A 4RLKA 5D1JA 3RAHA 4H1JA 4BDKA 1V0PA 5EDPA 4GVJA 3OOGA 5AV1A 4TNBA 3RPVA 3QTXA 4LV5A 2GNIA 4NW5A 3CXWA 2C6MA 4F9BA 3E92A 4DGNA 2C4GA 5LCKA 5A4EA 3T3VA 2XNPA 3MPAA 2R3HA 3PXZA 5I9WA 4AT4A 4IB1A 3ALNA 2WU7A 3HLLA 1CTPE 1DS5A 3GVUA 5AX3A 4BZDA 4BVUA 4CD0A 3BHTA 3C1XA 5DRBA 5DR6A 4I6HA 4ENYA 1OI9A 2PVMA 1OVEA 3PXFA 1ZWSA 3KB7A 3PY3A 4YZNA 5L3AA 3UZTA 2F49A 3FMNA 3SRVB 2YAKA 4U43A 4RX9A 2WGJA 5A14A 4IZAA 3ZDIA 3R83A 3IDPA 3KULA 5EOBA 4AZTA 4FMQA 4E4XA 3ACJA 3N9XA 4PP7A 5B7VA 5HD4A 2ITQA 5FXRA 5L6PA 4FEVA 4AFJA 3SXFA 2OZAA 3ZSHA 5IISA 2RKUA 3ZXTA 3R9OA 3VWAA 4OTGA 1ZY4A 2RFSA 4M14A 2VX3A 4FTLA 2I0HA 4DG2E 3TDWA 2B0QA 3H9FA 3S4QA 4EOOA 2WB8A 5F9EA 4FSTA 3FMHA 5AJQA 1W84A 4QYHA 4CG8A 2W0JA 2OJFE 4CLIA 4YNEA 4H05A 2V22A 2WKMA 4PDPA 3C5IA 5HTIA 3P23A 4NU1A 4V05A 2IZUA 4FEQA 5I3RA 4BGQA 1Q3DA 3W1FA 2EU9A 4WRSA 4Z55A 2X8IA 5C4LA 4ZJVA 3FYKX 4BI1A 3PSDA 3I7BA 3DLSA 3AXWA 3FY2A 3U9NA 1UU8A 2XB7A 3R22A 3IW7A 3AD4A 3HDMA 4LYNA 5CEIA 1JSUA 4F0GA 3DS6A 3EKNA 4FL3A 5H8GA 2G01A 3O8UA 2PWLA 1ZYCA 4NT4A 5HBHA 5I4NA 1R78A 4AN2A 1YW2A 2ETRA 5KKRC 3GC9A 2XNEA 3F61A 4MQ1A 2C0TA 5FBOA 5CEOA 3R1QA 3UG1A 5JZJA 3FXXA 2RL5A 4QOXA 5AR3A 4CMOA 2X2MA 3FL5A 4XLIA 2UZOA 4NUSA 3C4XA 5HOAA 3C5UA 3MY0A 4DEDA 2CGXA 4FK3A 5LVLA 3I7CA 4WBOA 4BCHA 4FR4A 2GQSA 1ZOHA 4ZS4A 4HVSA 2J0KA 2WAJA 5F95A 4O82A 2OU7A 2E9VA 4B4LA 4ZZMA 2IN6A 3FHRA 4WRGA 3KRWA 3R7IA 2E9UA 3GU4A 4CXAA 3B2WA 3UOJA 4FK6A 5GJDA 4EH8A 3N4TA 1UWHA 5H8BA 3UVRA 4O7VA 3PE1A 3PZEA 3UP2A 2W1HA 3ZRLA 4KUJA 1URCA 3GI3A 4C4IA 4CTCA 4KSQA 3MVHA 1PYEA 2BPMA 4IB0A 5G6VA 4HVDA 1M2QA 4JQEA 3FWQA 2W5BA 4F0FA 2IPXA 5ANJA 3L9PA 3NUUA 4S32A 5DFPA 2I6LA 3UIXA 2XUUA 4UN0C 3E64A 5IUGA 4EZ3A 4G1WA 4MXCA 2JITA 5DIAA 4YZDA 5JFVA 4B7TA 3DTWA 4B8LA 4DEBA 3GCQA 2CJMA 4NL0A 4IX3A 3P79A 4ZK5A 4NCTA 3RWPA 2O5KA 3PRFA 4I24A 3RMFA 5CAQA 3TUBA 4M69B 4F1TA 1ZMVA 2C1AA 1UA2A 4K11A 4GK3A 4YJQA 3CKXA 4YHJA 3VULA 3OCGA 4QMTA 4OW8A 3UPZA 4D4RA 3PE2A 4A9SA 4OTFA 1BL7A 4AOJA 3FEGA 3LM0A 3AC8A 3PVWA 4B99A 4QQTA 4QYYA 3UQGA 4D58A 2CMWA 4GFMA 3PA3A 3W16A 4F7NA 3QFVA 5KX8A 4F9AA 2OKRA 2XBJA 3ETAA 2GFCA 3FMLA 3KMUA 4AGUA 4D1XA 3PUPA 3GT8A 4TNDA 1IA9A 2ITWA 5KUPA 4UY9A 3KF4A 3WE8A 1Z5MA 3UJGA 4GT3A 5ETFA 1B38A 1IEPA 1SMHA 2ITPA 4FTAA 4YUQA 3QL8A 5E8TA 3U4WA 4BR3A 4DE4A 4CT2A 3AC3A 2NPQA 2WXVA 2BZIB 4JL9A 4EYMA 5CF6A 3R8VA 3R02A 2CHLA 1BYGA 3LJ0A 4U40A 4D9TA 1JKTA 2VAGA 5KNJA 2RFDA 4ITHA 4X21A 1H07A 4K0YA 3FQSA 3QQJA 1BUHA 5ETAA 4RQKA 3LFQA 4E6DA 1KWPA 3I79A 4FT3A 4NCTC 3HMPA 4GRBA 4OAVB 3RZBA 4U79A 5FRIA 3R8UA 4DG3E 2R64A 1CKPA 4C38A 1GZ8A 3KMMA 3OFMA 4XG3A 3V6SA 3G9NA 2ZAZA 3HA6A 4RG0A 1MP8A 4BFMA 1DAWA 1XKKA 4IHPA 2R3NA 2XK8A 3HV3A 4FYOA 4U7ZA 5JRQA 2W99B 3QKLA 4QNYA 3JXWA 5KKRB 4MHAA 5LCJA 1Q24A 3MJ2A 4IAFA 2XNOA 4G9RA 3NLBA 3AT4A 4OUCA 2UZDA 5DBXA 2ERZE 3Q96A 4IADA 4W9XA 3NCGA 1CM8A 4R3CA 3Q9XA 2ZV8A 3E88A 5AR7A 3RGFA 5E9EA 4FKLA 4IM0A 2OW3A 3KRJA 4CMUA 4BYIA 5HG9A 1ZYSA 3HV4A 3DFCB 1XH5A 1PJKA 1UKHA 3VQHA 2R5TA 3WF8A 4ZZNA 2BKKA 3MA6A 4WSQA 4JQ8A 3LCSA 3QYZA 4HGSA 2OJ9A 3ZEPA 3TDVA 3SXSA 4FEXA 2HZIA 2YM3A 4O91A 1FINA 2PE1A 4LUEA 4IVDA 4IWQA 2Z7QA 4MWHA 4HYHA 2IVVA 4GYIA 4PPBA 3PP1A 4QMSA 3WF7A 2JKKA 3LZBA 4QP7A 4BBMA 4YSMA 3DLZA 3DK7A 4E73A 4JRNA 3F88A 3OHTA 4WUAA 1UNGA 2OF4A 3R04A 3O8TA 4NM5A 2YM6A 3RINA 2VTMA 1ATPE 5E92A 5M09A 3GQIA 5A4CA 4WIHA 4O6LA 4ONAA 2XBAA 3GU8A 4M3QA 3FLQA 3R7EA 2X4ZA 2HW7A 2WMTA 3VUKA 3RTPA 1OIYA 4QMNA 4DF3A 2Y4IB 1TQMA 4MKCA 3FXWA 4O0TA 2W17A 2YZAA 4EHEA 3PPJA 2NRYA 3CJFA 3D7TA 4I5HA 4FTTA 3SKCA 4AE9A 5CEMA 2CSNA 4I23A 3MA3A 1W82A 2F7EE 3Q5ZA 4FICA 4U42A 3Q53A 5EM8A 2P3GX 1KUTA 3F66A 4MTAA 3C4WA 3SD0A 4EOQA 3FPQA 3WILA 3VF8A 2UW9A 1Q61A 3L9LA 2VO3A 4FG8A 3DZOA 3ROCA 1WBSA 3WF9A 1WBTA 1IAJA 4F6SA 4F1OA 4KABA 5M51A 3LXLA 2CGWA 3OUKA 4CYIA 3VUIA 4QTEA 4E7WA 4L46A 3W32A 4IC7A 4MNEB 2CNUA 1O9UA 3FMDA 1CMKE 1DI8A 3MY5A 3EH9A 3Q9WA 4O96A 4V01A 4AAAA 5T3QA 3OTUA 5EKNA 4GH2A 2CKEA 4BDAA 5JFSA 2QI8A 2B54A 4ENXA 1IG1A 5HIEA 4C37A 4CLJA 1FGKA 2O64A 3W33A 4N6YA 4I0RA 4RWKA 4C4FA 4RC3A 3TV7A 2J0IA 2PSQA 5CWZA 3FLWA 3NIZA 2IZTA 5TO8A 3R73A 5AR8A 4WNKA 2X6DA 3ZSIA 3VBQA 2NNWB 2OGVA 1J1CA 2UZVA 1BX6A 4C4HA 1YI3A 4QPMA 5B2MA 1HCKA 3HMIA 3NYOA 4F4PA 2QOIA 4CFXA 4DT8A 3UVQA 4DFUA 3VS3A 4N6ZA 4RJ8A 4O1PA 2J2IB 4DBNA 2JDOA 3L9NA 3MH3A 4FUYA 3DJ6A 4RIYA 5HE2A 4TYHB 4IJ9A 5I9ZA 4DFNA 3EL7A 1WAKA 2QHNA 2I1MA 4K8AA 3EIDA 2C47A 3G0EA 4FSYA 4I92A 3OWKA 4AE6A 2XJ1A 2JKMA 1PXNA 3C0IA 4DEIA 4FSQA 2REIA 4YJPA 5BMMA 2ITYA 3DZQA 3RPSA 2Q0NA 2QOFA 2R0IA 5E90A 4Z16A 3WZKA 3QLFA 4QTAA 3KCKA 3EYHA 5CXZA 4EONA 3TZ7A 3W8QA 3DXNA 3WIGA 5LVMA 1OECA 3F3WA 1VZOA 5EW9A 4I1ZA 3GB2A 3BGZA 3FKNA 3WYXA 4FEWA 3D4QA 3UOLA 4EH6A 4YJUA 1PXKA 5JN2A 2WTIA 2X0GA 5FM2A 4C3PA 2JIVA 3VBTA 4E1ZA 4PTEA 2C30A 4N0SA 1L3RE 1M2RA 4JS8A 5KZ0A 4O7NA 5JRSA 1OL7A 2V62A 2PULA 3SG8A 4WT6A 1PXPA 2PVFA 5AP7A 1WVXA 5TE0A 1KV1A 5A6OA 4FEUA 1OGUA 3FPMA 2VNWA 3H9OA 4GW8A 4EOMA 2WEVA 2ZMDA 3JVRA 3D7ZA 3Q4TA 4G5PA 5HESA 1PXOA 2UZWE 3CGOA 3R1NA 5BUEA 1V1KA 5DMZA 3DBCA 3TZ8A 4ACDA 2WPAA 4MXXA 4FV1A 3RM7A 5LMKA 5C9CA 4YTIA 3QQKA 4EH9A 2R3IA 4J71A 1L8TA 4KBCA 2E9NA 3UO6A 4FZDB 2PVJA 4AW5A 3SVVA 1ND4A 2OZOA 5EYDA 3QQUA 3EN6A 3OXIA 4FG7A 3VBVA 1OIRA 3V5QA 1R39A 4JG6A 4FTNA 5CYIA 2QO9A 3QD4A 4FKSA 4WNPA 4XG9A 3UBDA 3UC3A 4FTRA 3NS9A 4NKAA 2XIYA 3JS2A 4D5KA 2QONA 4IWOA 4EBVA 3F3ZA 5IA3A 5KBRA 2XK6A 1FQ1B 4BCIA 3F3VA 2HZ0A 4ZMFA 2UW6A 1M7NA 3BYMA 5E4HA 4Z9LA 5C8MA 2W4KA 2YABA 2XJ2A 1NVSA 3PFQA 3S1HA 2ZB1A 1PMVA 4IX5A 4P2KA 4BL1A 1Y8GA 3C4EA 4PL3A 2YERA 3DAEA 3FDNA 2BZKB 4FIFA 3E93A 3G6HA 4YTFA 3AC4A 1QPDA 2QOKA 3QCYA 4Z7HA 5KHXA 2BDFA 2R3LA 4RFMA 3TXOA 4YZCA 5EI6A 3HRBA 5T6KA 3IGOA 4QYEA 3LKMA 4AZEA 1YDRE 3ZBFA 4RJ7A 5AAFA 3DFAA 4J95A 4HPUE 3ZU7A 5LMKC 4R7BA 4FNZA 5CAVA 3R8LA 5C26A 3FQEA 5LMBA 3KXGA 4BTFA 3MV5A
chains in the Genus database with same CATH superfamily
2GCDA 4IM2A 1OITA 1XBCA 1OM1A 1GIIA 3QTWA 3I81A 1H1WA 3HMNA 4QTCA 5JQ5A 4XP3A 3QRJA 1M7QA 1FMOE 4QMVA 4MNFA 4FSRA 4U80A 2W1GA 1YI4A 2BIYA 4GIIA 4FTKA 2XM8A 3RVGA 3S2PA 1NVQA 1R1WA 2ZV7A 2YIYA 3H0YA 3COKA 3LQ5A 3DOGA 4L6QA 3VBYA 1W98A 3KVWA 4AT5A 4AGDA 3DK6A 2ZM1A 4HPTE 5F4NA 4N70A 4XOYA 3A7JA 4Q5HA 5CU4A 4O2PA 3SV0A 3R63A 5I5ZA 3UMXA 1H08A 3V5WA 4RX8A 2PZRA 2IVTA 2B55A 4S30A 5AUZA 1NVRA 2YM8A 3DKOA 4E3CA 3PJ2A 3KRRA 5DR9A 3QAME 4FIEA 1PYXA 5E8XA 3I5NA 4V0GB 4KIPA 1OIUA 4YGAA 2O3PA 4UMPA 5DH3A 3QHRA 3O5AA 3MS9A 2FB8A 3QKMA 4K77A 4A06A 3SRVA 4IDVA 2F2CB 1GZKA 1OPJA 3P7AA 4FL2A 4B0GA 2XNMA 4PPCA 4IAYA 2OIQA 3EN9A 4UMRA 4RIXB 2XIZA 5KMJA 3UPXA 3WOWA 3BCEA 4ACHA 3IGGA 3VS6A 3JY0A 2UVXA 2QU5A 1NXKA 2WMUA 2WTCA 3E8CA 3R00A 4Y73A 2QOBA 1A48A 2Y6MA 3I6WA 2CLXA 2G2HA 1XO2B 2B4SB 4JAJA 4RPVA 3FSKA 4IC8A 3VQUA 5L2WA 3SA0A 2ZM3A 4FRFA 5IH4A 5HLNA 2JBOA 5FEDA 2JAVA 3TZ9A 4A4XA 4ID7A 1HOWA 2BMCA 2C0OA 3A61A 3F2RA 3D0EA 4TXCA 1WBNA 4HGTA 1IR3A 1WCCA 4USEA 4CKRA 4O0RA 1OPKA 3BX5A 2W1FA 4BCQA 3W0QA 3PIYA 1KOBA 2W1CA 4IM3A 4HCUA 4RC2A 5EHOA 1PKDA 1YKRA 2AUHA 3FKOA 1FOTA 2C5OA 2PZPA 4XYFA 2PZYA 3CY2A 3BHHA 4XP0A 3CTJA 5AV0A 1WVYA 2WTDA 2ZMCA 4IQ6A 4FI1A 2BRHA 3MVJA 1QPJA 3VUMA 3VAPA 3UO5A 1SVGA 4NTSA 4D2TA 2CDZA 5F1ZA 2OI4X 3V01A 4KRCA 3NCZA 4XV2A 3WZJA 2RFNA 3TJCA 2WMWA 4PRJA 2HWPA 4ZSAA 4EL9A 1XBBA 4EJNA 4YHTA 3UYTA 1OB3A 5GIOE 3C7QA 3HEGA 3KL8A 4U3ZA 3COMA 1U59A 4HZSA 2C6DA 5GHVA 5E1SA 1J1BA 4AFEA 4IAKA 4RVTA 3MGYA 3SXRA 3NZ0A 4XV1A 4MAOA 3PJ3A 2A1AB 2E9OA 3I5ZA 3QCSA 3TKIA 3ZBXA 3IQ7A 2XAOA 3G9LX 3AOXA 5C8KA 1P14A 4CRSA 3OOMA 4RWLA 5AV2A 4YJSA 2V0DA 5AX9A 4O7LA 3O7LD 3VVHA 2VTRA 3ORLA 4UXLA 3LFAA 5HNIX 2XCHA 3UC4A 3E8DA 4J7BA 3BV3A 3BLHA 3H9RA 4IVAA 2JBPA 4NW6A 4JBVA 4P7EA 4S34A 4TN6A 2W5AA 3R01A 1KSWA 1SM2A 3D15A 4M68A 4RVKA 1J3HA 2J0MB 2ZOQA 2UV2A 4PDSA 2X9EA 3TN8A 5M07A 3FC1X 4DHFA 1YXSA 2HXLA 3FLYA 4L9IA 4DFYA 4JIAA 1H01A 3ELJA 3HYHA 3ZZWA 5CEKA 5GJGA 4BIEA 5HCXA 2FSLX 3G2FA 3VBWA 1ZARA 5CT0A 3BQCA 3PWYA 3R30A 1M52A 2JDRA 3CTQA 3NWWA 2HZ4A 3V8WA 4FT7A 3LJ2A 3G15A 3G51A 3QYWA 4O0XA 3D83A 1HCLA 3FZRA 1H8FA 4TRLA 4D2WA 4F08A 2GNGA 4FSWA 5TF9A 4F63A 3F7WA 3QXPA 1SNXA 4C02A 2ONLA 3P5KA 4BGHA 4YJTA 2C69A 4PL5A 5AIRA 5AP0A 2B1PA 2O63A 2JLDA 4B9DA 5M4IA 4M69A 5C1QB 2UZLA 2WTKB 4K1BA 3UIUA 4DGMA 3OXZA 5M53A 1IAHA 3Q3BA 5FUTA 4RRVA 5T68A 3DAJA 3ZFXA 4C61A 4DGLC 3AC1A 5DI1A 4CV8A 4EOKA 3HP2A 5C4KA 4I6FA 4CG9A 4BDFA 2W1EA 4MD9E 2QLUA 4OT5A 3OC1A 2XH5A 2H9VA 4ZSGA 5JT2A 5DN3A 1P4OA 2YWVA 1PKGA 3R2BA 3KXZA 4O81A 1H1QA 4FV0A 4XBUA 4CSVA 4F78A 1MQBA 2J50A 5BVFA 3IDBA 4YHFA 3QD0A 4U97A 4ALVA 3BBWA 5LVPA 4IX4A 2XEYA 4U45A 4UALA 4ZOGA 4GK4A 4OTDA 4QD6A 4UWCA 4FT5A 4L44A 3KIOC 5CF5A 4O7RA 3W0PA 1F5QA 2F57A 1QL6A 2DUVA 2GPHA 3QZHA 4XMOA 3ORPA 4QMXA 2OG8A 3TI1A 3GNIB 4XBRA 4O7YA 4B8MA 4O0SA 3Q2JA 4QP9A 3UDBA 5LWMA 3CY3A 5HU9A 3QCXA 3AG9A 1ZY5A 5AR4A 2YDJA 5CT7A 4K2RA 4RVMA 2ONLC 4IIRA 2OH4A 1JQHA 4OTQA 5JSMA 3F5GA 4QQJA 3ZLXA 2GNLA 4FT0A 3PJ8A 5IKWA 1BI8A 4YZBA 4QMZA 1OL6A 3O51A 5KCVA 4E5WA 2O65A 3WF5A 3LQ8A 2ITUA 4P5ZA 1RQQA 3MVMA 4EQCA 1Q99A 3Q6WA 4KS7A 5A4TA 5E8ZA 3IW5A 3RNYA 2O2UA 3QTSA 4CKJA 3R8PA 4EK4A 3U6HA 2BDJA 3OEFX 4X2KA 3TUCA 3N4VA 3UQCA 2V55A 5IF1A 5CU6A 5DT0A 5FEQA 5C01A 4EC9A 1Y6AA 3EWHA 2JFMA 4C4GA 4I93A 4DYMA 1XBAA 4FIJA 2C5NA 4IEBA 1A06A 3M2WA 1UWJA 3GQLA 5TT7A 4WA9A 4ZTMA 3QTZA 4BB4A 4LGGA 2R0UA 4BTMA 4O7TA 2SRCA 2BFYA 4YNOA 1UU7A 4NEUA 3CBLA 3K2LA 2C6LA 3LFDA 5IU2A 4ZEGA 4ASZA 4PMTA 3SQQA 4QMYA 4YPSA 1UKIA 4Y72A 3O71A 1GZOA 3PYYA 3GCVA 4JDKA 4I0SA 4IZ7A 2WZJA 4PDYA 3R0TA 4F6UA 5FQDC 4QMOA 2ZYBA 4JDHA 4JI9A 2RSVA 1YXUA 2WMBA 2BALA 2VWIA 1QPCA 1YHWA 3CJGA 3MTLA 3PPKA 3DKGA 3P5JC 3TCPA 4H36A 3CP9A 5M06A 4D9UA 3QRUA 2OO8X 4YLJA 4I41A 5HEZA 5M56A 3CEKA 3ITZA 3HRFA 4JNWA 4YBJA 4AF3A 3UQFA 2PZ5A 3DNDA 1JKKA 5JFWA 3C51A 1G8AA 4CZTA 4AZWA 2X0PA 1YRPA 2W4OA 1YDTE 4DLJA 4HCTA 3TUDA 3CLYA 2YLEA 2CGUA 4FKGA 4HGLA 5EYMA 5L2TA 3EHAA 3GCUA 2ITVA 5J5SA 4XHKB 4O0YA 4QYGA 4JIKA 4LG4A 3PSCA 5HNBA 3MVLA 4W9WA 1CDKA 1DM2A 3IECA 5EKOA 3BHUA 4NJDA 2UZBA 3ZLWA 2PMIA 4BJJA 3LLAA 5HE3A 4FKJA 4AN3A 4IVBA 1KE9A 1MRYA 2XNNA 2XK3A 4DEAA 4UBAA 3D9VA 4DG0E 5IQGA 1Q97A 3RAKA 3PJCA 2Z7RA 2OFVA 2X7FA 3LJ1A 3EZRA 3OUNB 4TWPA 2NO3A 1ZAOA 1PW2A 2OH0E 4ZIMA 4AXAA 5KMOA 3VIDA 4FZ6A 4QMWA 3W2SA 4ZJJA 3VW8A 1W2FA 4EEVA 3GOPA 3QRKA 4BDCA 1M14A 3CC6A 3R1SA 4J52A 4A07A 3MN3A 3DK3A 4QQ5A 1LUFA 2FSMX 3MFRA 4FTIA 5B2KA 3LMGA 4EH7A 1P4FA 4NKSA 4TKSA 1LEWA 4MNEA 4C0TA 3AMAA 4AZSA 3CTHA 3K3JA 5HLWA 2HCKA 4BICA 3AGLA 3GC7A 3GFWA 4TZRA 5EH0A 1UU3A 1H0WA 4DT9A 4C3RA 3R71A 3NNWA 4BKZA 4DFZE 3Q9ZA 2GTNA 3T8OA 2YZLA 4RIWA 3DCVA 3W18A 2VTSA 4BN1A 4CGAA 4O0WA 2QVSE 3O8PA 4MH7A 1AGWA 4KB8A 5M08A 3LAUA 1XH8A 4KD1A 2Y4IC 3LPBA 1STCE 3AGMA 5IA2A 3A99A 2YIWA 2P33A 4GK2A 4EC8A 4UXQA 3QA8A 4DFBA 4RT7A 4BIBA 2JDTA 2B9FA 2YJRA 4NH1A 5IQHA 2XYUA 4FNXA 4CT1A 2GMXA 4USFA 5CU0A 3GENA 5HBJA 4AG8A 2WQEA 2F2UA 2IW8A 2VUWA 4RGJA 5D41A 3HAMA 5HX6A 4TYHA 2KULA 4GJ3A 2A4LA 4YC8A 4QP8A 1V0BA 3DT1A 5DRDA 3O17A 4D28A 2UW0A 3BPRA 4C4JA 3VC4A 4L3LA 4Z3VA 3KRLA 1ST0A 4MVFA 3H0ZA 1VYZA 5AUVA 2Y4PA 3H10A 3ZRMA 1GZNA 3QQGA 4QMMA 1SNUA 1E1XA 2BAKA 4D2SA 3EQBA 1NA7A 1Q62A 1Y57A 1YOLA 3TJDA 1DAYA 3UODA 2DWBA 2BHHA 4P5QA 5TKDA 2IF8A 5HORA 2E9PA 2GSFA 3MW1A 3GU5A 3OCBA 5D10A 3GOKA 5EW3A 4AUAA 4ZAUA 5IA4A 3V5LA 5JZNA 4AQCA 2UW8A 5JK3A 3DBQA 4QDVA 4E8AA 2CN8A 2J6MA 3VRYA 4ORKA 5DEYA 4YU2A 4RQVA 2QOCA 2OIBA 4EZ5A 5J9LA 5IH5A 4G6OA 3P08A 4QTBA 4ZY6A 5ETIA 2BILB 3P86A 1XWSA 3HVCA 3MB6A 3NUSA 2BZJA 2VO7A 4J98A 4O4EA 4L8MA 1BI7A 1P2AA 3UYSA 4A9RA 4NK9A 4MXOA 1U46A 2J0LA 4ANQA 4M13A 2J0JA 4YO4A 3DAKA 5FDXA 5HKMA 1PY5A 3FZOA 4JX7A 5AM6A 3RBWA 3ZOSA 4EQMA 2HAKA 3BRBA 5JEBA 3PA5A 4O22A 3C4FA 4QP1A 4LFIA 4D5HA 1YI6A 4G3FA 5HLPA 2X9FA 3VRZA 4FIGA 4XX9A 2YFXA 3DNEA 5L8LA 4DHIB 5HZNA 4GT4A 3QD3A 4II5A 3IW8A 3Q5IA 4JR7A 3PXRA 3FSFA 5K5NA 3QXOA 4QEBA 4JAIA 4BIDA 2XF0A 2Y7JA 3HMOA 4GFGA 2XNBA 4GFOA 4U81A 5BVEA 3RPRA 4D2PA 3OW4A 1YWVA 5ITAA 5HGIA 4BDIA 5K4JA 2JIIA 3RK5A 2VTHA 3A7HA 3C4ZA 3FE3A 1LEZA 2OK1A 3ZH8A 4APPA 2PVHA 5M4UA 3RKBA 2GS7A 3OZ6A 2Z2WA 4O4DA 1WBWA 2X39A 5I9YA 3O96A 4HYSA 3RAWA 2J5EA 2WTVA 4XV9A 2BRGA 1Q3WA 2HW6A 4BC6A 1IRKA 3PXKA 2B9HA 3ORKA 5AR5A 3IW4A 3CE3A 2FA2A 4IX6A 5HICA 2UW4A 1OKWA 2QHMA 2IW6A 1EH4A 2UUEA 2LGCA 3LFNA 4MBLA 4CQGA 4R77A 1G8SA 4I4FA 3PDTA 4YC6A 3NRMA 3NUAA 1ZLTA 2R7BA 2BTSA 1H0VA 5BUIA 5CEPA 4XEYA 5L2QA 3MFTA 4NTTA 3OCTA 4MF1A 3UGCA 4GKIA 4KS8A 4CV9A 3NPCA 3Q4ZA 5IG1A 2QOOA 4YBKA 3OY1A 2VTTA 4A9UA 3QU0A 4E20A 1MQ4A 4I21A 4EK6A 5KMIA 4O1OA 2WIHA 2I0YA 1TQIA 4GSBA 4IZ5A 4OBOA 2PE2A 4RFZA 4XOZA 5AP6A 1WMKA 4BRXA 2C3IB 4NWMA 4C2VA 2UW5A 4RA4A 3SOAA 3ODZX 2JFLA 4UWYA 2WTWA 2WQMA 4R1VA 5A54A 2R3OA 4ASXA 4KIKA 5AUUA 3OT8A 2QO7A 5HVJA 3EQRA 2C6OA 2ETMA 2PMLX 3EQHA 2XRWA 4BDBA 2XKCA 3BBTB 3LFCA 3NDMA 3HV7A 3BL9A 3VNTA 3KCFA 4X2JA 3LLTA 2VWZA 2EB2A 4FVRA 2GHLA 2PVLA 3OBJA 3GCPA 1NW1A 2GQRA 4V0GA 1GJOA 4UYAA 4C36A 3UNKA 2PUPA 4W4YA 3CD3A 3HA8A 3EQPA 2XYNA 4AGCA 2UVYA 4A4LA 3Q60A 2C3JA 3CPCA 4G31A 3P7BA 1FVRA 1H24A 4Y5HA 3DXQA 4XG6A 3PZHA 1XH4A 2C3KA 4RIXA 5F20A 4W8DA 4U6RA 1JBPE 3QWKA 1OBDA 3PWDA 2Y9QA 4RX7A 3D14A 3LOKA 4AZFA 4Q9ZA 4AQKA 1CKJA 3SOCA 2VTQA 2C6IA 4FSMA 4RIWB 2PPQA 2R3JA 4BCOA 2XEZA 4R78A 4FG9A 3U6IA 2V5QA 4R5YA 4AT3A 4BDEA 5CF4A 2DQ7X 5EM6A 4Y46A 4C7TA 4QMUA 4FKVA 4CMTA 4MUQA 5IEVA 4DCAA 4PDOA 1H25A 4IB3A 2Q0BA 1YHSA 4ZXTA 1FVTA 5CF8A 4YURA 5E8YA 4FT9A 4ZTSA 3S0OA 2H34A 2EXEA 3NMUF 1K9AA 5HU3A 4U0IA 2PUIA 3ZC5A 4DCEA 4Y95A 1WFCA 3BELA 1ZYLA 3BU6A 2UZEA 3O0GA 4FV6A 4CFVA 3KY2A 3BQRA 3MIYA 4DITA 5HO6A 4EH2A 4YTCA 5M44A 5AUTA 2Y0AA 2ZJWA 3EKKA 4UZDA 3R7YA 2CPKE 1PXLA 4IDTA 2C5XA 3RK9A 3QUPA 5IQFA 4UMTA 1UU9A 3HUBA 4L68A 5CZIA 3FBVA 3ZEWA 4YPDA 5IEXA 3CKWA 5FP5A 4L52A 1YWNA 4RJ6A 3QRIA 5A9UA 4F9YA 3L9MA 3LW0A 4JLCA 5BX0A 3QQLA 2J51A 3HRCA 3LCTA 4FVPA 3QQFA 2QLQA 3NNXA 3OTVA 4I6QA 3DJ7A 4PMSA 2AQXA 4AOIA 3TYKA 1YHVA 2VGPA 4G17A 5HG8A 2VGOA 3F5PA 2GHMA 3NUYA 4Q2AA 5HQ0A 2PTKA 4GUBA 4I4EA 2ZDTA 3IK3A 4I6BA 1VEBA 4RZWA 3AKKA 1ERKA 4DLIA 1XR1A 4BI0A 1KE5A 4CZYB 2XJ0A 3WF6A 5AV4A 3OF0A 3KK9A 3BLRA 1K3AA 3MIAA 5CQWA 3SW7A 3V51A 3PVGA 4IW0A 2PVYA 4XJ0A 4DTAA 4TWOA 3IW6A 3T3UA 3NNVA 3W2PA 3LXKA 1M17A 4JBOA 4EQUA 3V5JA 4G9CA 4QMLA 4HNFA 3AMYA 5J1WA 3COIA 2BTRA 2EUFB 3UMWA 1Q8ZA 4USDA 3HX4A 5CAUA 4DH7A 2PYWA 3FYJX 2PZIA 3BV2A 5ANIA 2XKDA 4C4EA 3KEXA 3IOPA 1YVJA 3MSSA 5DLSA 2GTMA 1FBNA 4E6QA 4C8BA 2EWAA 3GUBA 2P4IA 2VTPA 4QRCA 2Z02A 4R8QA 4DGGA 3HKOA 3ZLYA 4EH3A 3ZZEA 5LOHA 3R28A 3DBDA 4RX5A 3V3VA 3HNGA 3QTRA 3KXMA 4UEUA 4WG5A 5CS6A 1CSNA 5BYZA 5AAEA 4AXCA 4HOKA 4X6QC 3U9CA 4TL0A 2ZV2A 2QO2A 2WOTA 4F1MA 5HX8A 5KMNA 4TYJA 3SHEA 3A4PA 2VTJA 2FO0A 2QOLA 3POOA 5EHLA 5IDNA 3R1YA 3NW6A 5E8WA 5D12A 4ANOA 3NUPA 5K5XA 2WMQA 2W1ZA 3M42A 2P0CA 5CQUA 5FP6A 3ANRA 2ITZA 4JDIA 2YJSA 1Z57A 4TW9A 4O7WA 3BLAA 3G6GA 4MXYA 4LGDA 3FLZA 3HL7A 3OEZA 3VUHA 5DVRA 4ZLZA 4PPAA 3ANQA 5D7VA 3IOKA 5EQYA 3MI9A 1AD5A 1AQ1A 5EI8A 4JX3A 3TEIA 5KO1A 4E5BA 3TNHA 2JKQA 4EOSA 2UW7A 1BMKA 4LI5A 4NZWB 3G0FA 3PRIA 3AQVA 4YLLA 1SZMA 4MXZA 1QCFA 4RZVA 5D11A 4R3RA 1O6YA 4J97A 4O4CA 5DA3A 3LQ3A 5HO8A 3ZHPC 4U5JA 4U8ZA 4IAZA 4FF8A 4IZYA 5AP2A 3IKAA 3M1SA 3ORXA 2BKZA 2CCHA 2EXMA 2JAMA 2YEXA 3BE2A 3E5AA 3NIEA 1MUOA 3D5WA 4X3JA 2F7ZE 5A46A 3WZUA 5LWNA 3OW3A 5KBQA 2A98A 4KIKB 5HIBA 4FKWA 4XNEA 2R9SA 3F6XA 3LHJA 4LQMA 5CAOA 1ZOEA 3D5UA 4UYNA 3PP0A 4BY9E 1JLUE 4FBXA 2Z7LA 3GC8A 3BGPA 3EJ1A 2WTKC 5IMXA 2EVAA 3FMKA 3UP7A 4E6AA 2OXXA 2YITA 3DV3A 2QKWB 4QPSA 4ZTLA 2LAVA 4HJOA 4KBKA 3QGYA 5CI6A 1URWA 4QPAA 3R9NA 5FXSA 3NUNA 2R3PA 4EUUA 2YA9A 4O0UA 4ZTQA 3WZDA 4FIHA 2R3GA 3PA4A 3QHWA 4CVAA 3BHYA 4RA5A 5K3YA 2VRXA 3UTOA 3RAIA 4WNMA 4WNOA 1P5EA 3WZEA 2GU8A 3OT3A 4JXFA 2PUNA 5A4LA 4LV8A 1G5SA 3A4OX 4O7ZA 2OWBA 4YC3A 4A4OA 3ORIA 4RIOA 3O2MA 3L8PA 1OUKA 1B39A 4I94A 4RMZA 3TNQB 4BHZA 3TZMA 3EQCA 4IJPA 4PTCA 3TM0A 2EB3A 4H1MA 5L4QA 4ZSEA 3LXPA 5CI7A 5DYJA 1H00A 1B6CB 5IUIA 1ZYDA 2VD5A 4ZSJA 4YJNA 1JSVA 4F9CA 4O27B 5EYKA 2X8DA 5HVYA 3FMMA 2IWIA 2PE0A 4DEHA 5FG8A 5CEQA 5BNJA 4OLIA 3U55A 4IVCA 3NYVA 3A7FA 2VNYA 3BYUA 1J7UA 4RSSA 1XH6A 4RVLA 5GNKA 2G9XA 4QT1A 4TPTA 5HO7A 2X7GA 3FXZA 1U54B 2VWUA 4YO6A 2E2BA 4RC4A 3QZFA 3KMWA 5IA0A 2VU3A 5BPYA 2C6TA 3BYVA 3NYXA 3VN9A 3ZFYA 1PXIA 5FTOA 1H28A 1LR4A 3POZA 2ITNA 5IQDA 3PFYA 5AA9A 4E4LA 3DPKA 2IW9A 2VTAA 4LL0A 4ZZOA 4CCUA 3TIZA 3L1SA 3ID6C 4FE2A 1VJYA 4H3PA 4IE9A 4YJRA 4UZHA 3ZUVA 4BF2A 4V04A 4LMNA 2WD1A 5FGKA 3ZTXA 2QNJA 5CNNA 5I9VA 2C5VA 3FZPA 1VR2A 4I3ZA 3TKUA 4GJ2A 3OD6X 3F7ZA 5E8SA 5IPJA 1JKSA 2ZV9A 4BCGA 4DTBA 3SAYA 3VS2A 4LV7A 2C3LA 4KKHA 5DOSA 4BCFA 4K18A 2WEIA 1RDQE 3UE4A 2J4ZA 4IB5A 4UX9A 3EB0A 2IVUA 5CNOA 4X3FB 1K2PA 2J9MA 2QD9A 4PMPA 4ZSLA 3IPHA 4GMYA 4NIFA 3SC1A 2WTJA 2FSTX 5HNGA 2YM5A 3CIKA 3ET7A 2VO6A 3EFLA 5J87A 4OAUC 2ESMA 1XMMA 4FKPA 3GFEA 4H3BA 1YXXA 4J8MA 4P4CA 3AD5A 3ZUTA 4FGBA 1OKYA 2HWOA 3ATTA 1ZOGA 2BUJA 4QDEA 5AUYA 3SLSA 3VS0A 3KKVA 4J53A 5A4QA 1REJA 4O83A 1ZMWA 2CNQA 3VUTA 1PMNA 3BU5A 1XH9A 2W5HA 4UV0A 4Y85A 4DDGA 4TYIA 4IFGA 3MPMA 3QZGA 3VUDA 5AADA 1V0OA 4FIIA 1DI9A 4AA0A 5ANGA 3NYNA 3BE9A 4FSNA 4HGEA 2PL0A 2PY3A 2XRUA 4IAIA 4Q5EA 3DBFA 3ZFMA 2CGVA 2O8YA 4BKJA 5IA5A 4EBWA 5CSHA 3OG7A 3L8SA 5M4FA 3CCNA 4GG7A 4JBPA 4PMMA 4D1ZA 4KKGA 1KE8A 4K6ZA 3ZRKA 3F2NA 2R3KA 5EDQA 4MK0A 4FTCA 2BRBA 4L00A 3EQGA 2XK4A 4EYJA 1PMEA 2V7AA 1I09A 5DG5A 5CALA 4ZLOA 4L7FA 2VWVA 4CFFA 3A7GA 3RZFA 4BGGA 2ERKA 3MH1A 3PG1A 3B2TA 4HVGA 5ACBC 1H1PA 4EH4A 4AWIA 1OUYA 2B7AA 5L8KA 3U51A 3IS5A 4LUDA 4TWNA 3B8QA 3DB8A 5CENA 3RI1A 4DN5A 5DHJA 3ZO1A 4BZNA 3PSBA 4D2RA 3MESA 4C33A 2XS0A 2YDIA 4F65A 1U4DA 4MXAA 5JH6A 1H1SA 4FODA 4AXEA 4AW2A 1MRUA 3LFEA 4BCMA 2B52A 3PXQA 3E8NA 3P1AA 5L2SA 1OPLA 4X2FA 4DINA 2DYLA 5D9HA 4AX8A 2W9FB 1LPUA 3MDYA 4QP2A 5AP1A 3W2OA 3NEWA 3ZLSA 5CSVA 1H27A 5LMAA 3DA6A 4WG3A 5TOZA 4PL4A 2OBJA 3H3CA 3HZTA 4UMQA 4MBJA 2CKOA 3UOKA 4BI2A 5HTCA 2RF9A 2GNHA 3CQUA 2OJJA 4NYEA 4ASDA 3NFGB 3KK8A 1S9IA 3PPZA 5FLFA 4BWKA 4KINA 3MTFA 4QYFA 2YIQA 5AP4A 4S31A 3LCDA 3THBA 3TV6A 4BDGA 2YISA 4AU8A 4OBQA 1UNHA 4JDJA 3QZIA 4PV0A 2IO6A 5CU2A 4ZTRA 3BL7A 2QURA 3VBXA 2BROA 3KXNA 4LRJA 5GINE 1E1VA 1YOMA 5EK7A 3HV5A 4FV4A 5L6OA 4HZRA 1F0QA 3OWLA 5AV3A 5DPVA 2WHBA 3SX9A 4GU9A 2JIUA 2I0VA 2RGPA 3COHA 3QRTA 5KMMA 3W10A 5H3QA 1OZ1A 4QQCA 3V5TA 1YOJA 2VWBA 3S95A 5J5TA 3KC3A 5AAGA 5JFXA 2UW3A 3MPTA 2Z8CA 2BHEA 4QP4A 5FM3A 4AW0A 5EQPA 3QC4A 1WVWA 2FSOX 3KQ7A 4TY1A 2CCIA 3HUCA 2BZHB 3QUEA 4O38A 3DB6A 3EYGA 3WE4A 4HVIA 1QPEA 2B53A 3ZUUA 5L2IA 3AKLA 3O50A 4WO5A 3GP0A 4FL1A 3ATSA 5E91A 4DC2A 5K0XA 4YZMA 3U54A 4FV9A 1ZZLA 5HIDA 3KF7A 4O0VA 2UZTA 4W4VA 3WYYA 4S33A 3H4JA 2OF2A 3VHKA 3W55A 5K4IA 4BCKA 4AACA 2QG5A 1G8JA 1PF8A 3SGCA 4X0MA 3EFKA 3F82A 3LFFA 4LGHA 4Y5QA 4TYGA 4D1SA 3Q04A 5BQ0A 3FI8A 3M11A 3RP9A 3NNUA 2VZ6A 2G1TA 2XA4A 1X8BA 2QCSA 3VS4A 4PQNA 2OXYA 4M66A 4EHGA 3TT0A 1W7HA 5CAPA 2VTOA 4QO9A 3DDPA 2OIDA 5HCYA 2PMOX 4FKUA 5AM7A 2F9GA 3DU8A 4JQ7A 4ITIA 4LRKA 2G2IA 3W2CA 3UZPA 3R7VA 4AZVA 3KVXA 3K5VA 4MD7E 3OWPA 3AMBA 3GBZA 2XCKA 4YJOA 3OMVA 3T9IA 1OGYA 3TACA 3NW7A 1OKVA 2W05A 5BVOA 5J8IA 4XRLA 2WQBA 5H2UA 3SG9A 4IWDA 2QU6A 2IG7A 4M0YA 3PJ1A 3NAYA 3MBLA 4AP7A 3CPBA 5CVFA 3QUDA 3RK7A 3HAVA 4IH8A 2BIKB 3ZS5A 5EQEA 1PXMA 5IQEA 5ANDA 3PLAE 4FYNA 4NJ3A 3BI6A 4NIFB 3KRXA 4MYGA 4KA3A 4O21A 3FZSA 5A3XA 5I9XA 3RHKA 5D7AA 2BFXA 2WMAA 1ZRZA 1GAGA 2ZVAA 3ENHA 2XNGA 1ZXEA 5CSXA 3ULIA 4MCVA 2CKPA 4EHZA 3Q2MA 2PVRA 2X81A 5AMNA 1ZMUA 3CS9A 3TNPC 3CR0A 3L8XA 1WBPA 3R2YA 3RPOA 4F7SA 4NM0A 1GOLA 1VYWA 2FH9A 4BWPA 4CTBA 3FJQE 3WI6A 5C27A 3EQFA 2PMNX 1O6KA 4G3GA 5JGBA