3OY7A

Crystal structure of a virus encoded glycosyltransferase in complex with gdp-mannose
Total Genus 138
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
138
sequence length
392
structure length
392
Chain Sequence
MKLIIVGAHSSVPSGYGRVMRAIVPRISKAHEVIVFGIHAFGRSVHANIEEFDAQTAEHVRGLNEQGFYYSGLSEFIDVHKPDIVMIYNDPIVIGNYLLAMGKCSHRTKIVLYVDLVSKNIRENLWWIFSHPKVVGVMAMSKCWISDICNYGCKVPINIVSHFVDTKTIYDARKLVGLSEYNDDVLFLNMNRNTARKRLDIYVLAAARFISKYPDAKVRFLCNSHHESKFDLHSIALRELVASGVDNVFTHLNKIMINRTVLTDERVDMMYNACDVIVNCSSGEGFGLCSAEGAVLGKPLIISAVGGADDYFSGDCVYKIKPSAWISVDDRDGIGGIEGIIDVDDLVEAFTFFKDEKNRKEYGKRVQDFVKTKPTWDDISSDIIDFFNSLLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glycosyltransferase B736L
publication title Crystal structure of a virus-encoded putative glycosyltransferase.
pubmed doi rcsb
source organism Paramecium bursaria chlorella virus ny2a
molecule tags Viral protein,transferase
total genus 138
structure length 392
sequence length 392
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-09-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 3oy7A02
3.40.50.11930 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3oy7A01
4WADA 1XL0A 4HWGA 3ZCUA 4W6QA 2R4TA 3NCHA 4EL5A 1NOIA 1FTYA 3CUYA 3L7DA 1K08A 3CUVA 4HLNA 3HBNA 4RBNA 2XCIA 1Y8ZA 3IAAA 2C4MA 1PNVA 2R66A 4BQIA 4RIIA 4MRAA 4F97A 1L5RA 4KQ1A 3ZCTA 1EM6A 1O6CA 4CDRA 5D01A 2G9UA 2IYAA 2FETA 3AMVA 3Q3EA 4MICA 5IKPA 3T3IA 3G2HA 2VCEA 5IKOA 4L22A 3Q3IA 3BD6A 2XA1A 3E3NA 4X7RA 2PRJA 3ZCVA 4GZ5A 4X6LA 3ZCRA 7GPBA 3OKAA 3S29A 4CTOA 4RIEA 1WV1A 4NEQA 2QNBA 3MT7A 3GPBA 3T3EA 3CUTA 4EKEA 1RZVA 3NP7A 3VUFA 3NAZA 3MRTA 4RIFA 1GGNA 1Y6FA 3G2JA 2QRMA 4X7MA 4GPBA 1L5SA 2F3QA 2F3SA 3T5TA 3SYRA 5BNWA 4BQEA 3RT1A 3RHZA 2QRHA 1JIVA 2XGMA 1KTIA 1Z62A 3S2UA 4EJ2A 4NESA 3TAXA 1JG6A 2VSNA 1XOIA 4GZ3A 5LQDA 1FC0A 1L6IA 1GFZA 1XL1A 3DD1A 4CTMA 1QKJA 1E4OA 1K06A 4AN4A 3DDWA 3WAGA 1J39A 3WC4A 3CUUA 1P4GA 3ZCPA 2AW3A 4YI5A 4N39A 3CV3A 3TSAA 2ECPA 3OY7A 2BGUA 5DXFA 4CTNA 1PSWA 2ATIA 1M5RA 2QRPA 2BGTA 3CEHA 2QZSA 3VDNB 4N3AA 3MT8A 3CEJA 4BFCA 3S28A 5DU2A 1FTWA 2JZCA 3D0QA 3MBOA 3G2IA 2JLBA 1E1YA 1NVKA 3QKWA 1P2DA 4N3BA 2KS6A 3PE3A 2GEKA 3MRXA 3G2LA 5D00A 1GPYA 2G9RA 4MI9A 2QN7A 4EL0A 2IEGA 3SYMA 2IV7A 1FS4A 2PRIA 4RIHA 3G2KA 5TMEA 3MTAA 1FU4A 1WUTA 2WTXA 2XCUA 3HBJA 3QHPA 3L7AA 3WADA 2QN1A 5TMDA 2GM9A 4WACA 1QM5A 3BCUA 3BCSA 1P4HA 3D1JA 4LDPA 1Z6PA 3EBOA 3MTDA 3EBPA 2QN3A 3E3OA 1LWOA 2QLNA 3BDAA 1WUYA 3OTHA 1UQUA 4M83A 1SXPA 4MI6A 4AMGA 1Z6QA 2IV3A 4AY6A 4PQGA 4KQ2A 2SKDA 3O3CA 4LEIA 4F9FA 1RRVA 2F3UA 4XI9A 1IIRA 3MTBA 2GPNA 2PQ6A 4FZRA 2GPAA 3OTIA 3CX4A 5JTUA 4MHSA 3IA7A 4RENA 3T3GA 2F9FA 2R60A 4MI3A 2VSYA 3E3LA 3MQFA 1NZFA 1FU7A 2F3PA 2IUYA 3BEOA 1NOKA 4MHOA 1P2GA 1FTQA 2X0FA 5GPBA 3MS2A 8GPBA 3OT5A 4GYWA 3S27A 5C1DA 1GZ5A 4NC9A 2PYDA 3UYLA 4GYYA 4M7PA 2BISA 1WV0A 2QRQA 2VCHA 2X0DA 4X7PA 3COPA 1GPAA 1HLFA 1A8IA 2C1XA 2X6QA 2QRGA 2XA2A 3NPAA 3RSZA 6GPBA 1P4JA 2PYIA 1XV5A 3L7CA 1VGVA 3DZCA 1WW3A 3G2NA 3CEMA 3BD8A 1V4VA 3DDSA 3S0JA 3CUWA 2G9QA 2X6RA 3ZCSA 9GPBA 1FA9A 2P6PA 3H4IA 2FFRA 1SXQA 2G9VA 1L5QA 1NOJA 3C4QA 3GUHA 4F96A 3NP9A 3BD7A 2X0EA 2FF5A 1Y6GA 2AZDA 4AMBA 4GZ6A 4FKZA 5I45A 3OKCA 3MS7A 2QN8A 1GPBA 2HY7A 2ACWA 3PE4A 1AHPA 2AMVA 2VG8A 4RELA 2QN9A 2IEIA 3NB0A 1IXYA 1JIUA 3C48A 2QLMA 2XGOA 5JTTA 3L79A 4BQFA 1BX3A 2O6LA 3FROA 2IYFA 3OKPA 4RIGA 1JG7A 3VDMA 4Z5XA 4YI3A 3D0RA 1F0KA 2R4UA 3L01A 5HXAA 2YJNA 2H1FA 3T7DA 3TOVA 2C1ZA 1UQTA 2QLLA 1RZUA 4N9WA 2GJ4A 4KQMA 3L7BA 1FU8A 5TMBA 1JIXA 2AV6A 3NC4A 3ZCQA 1P2BA 1C8KA 1YGPA 1EXVA 2ACVA 5TVGA 2XMPA 1WW2A 1C8LA 3UYKA 5ENZA 5DLDA 1NLMA 2QN2A 1XC7A 1PN3A 2GT1A 3RSCA 1L7XA 3VUEA 2Q6VA 1JEJA 3MS4A 1B4DA 2R68A 1LWNA 4XIFA 1YA6A 2C9ZA 3BCRA 3HBFA 1ABBA 2H1HA 3OTGA 1UZUA 2GPBA 2ASVA 2GEJA 2JJMA 3T3DA 1Z8DA 1L5WA 3Q3HA 3MT9A 4QLBA 4WHMA 3T3HA 1XKXA 1C50A 3HBMA 2XA9A 4G2TA 3MSCA 1AXRA 4M60A 3MRVA 1C3JA 4N3CA 4EKYA 3OY2A 3H4TA 2SKCA 2IW1A 4YUAA 2ZB2A 2BFWA 2OFFA 4AY5A 1H5UA 1P29A 2XGSA 1F6DA 1GG8A 4REMA 1L5VA 2SKEA 1NZDA 1PYGA 3C4VA
chains in the Genus database with same CATH superfamily
5JECA 5KQGA 2CB9A 3L46A 5TXGA 3VXKA 5KI6A 4MV8A 3FR7A 2CFCA 3RGWS 3BBLA 3DWGA 3I39X 5TGDA 2DBVO 1CQWA 3A32A 4MW4A 1M2OA 4EL5A 5I4KA 1Q22A 2H1IA 1HY3A 1BMFA 1QIHA 1R9MA 2GAJA 1G4AE 2VHTA 3QUBA 4C7VA 4PYIA 1WZNA 1WXFA 1YXMA 4RH0A 4F46A 1JKIA 1MAWA 2ZIAA 3L6DA 1HYGA 1M34B 1U1EA 3H11B 3IXMA 2OWDA 3NX4A 1VECA 3RREA 1JMVA 4YV7A 2I3AA 4U3JB 1ZU4A 3EC7A 3VJMA 2DHCA 5J5AA 1TO2E 2H18A 4OV6B 1A76A 3R7WB 1E3SA 3HXLA 4D9HA 1ND5A 5FTWA 3CVVA 3IOEA 2A33A 3U4GA 4OHMA 2YWDA 1ZKMA 1Z8HA 4MARA 4JFRA 2JKZA 4PG4A 3H2KA 4RTLA 3HXMA 1XVAA 2JLAA 1PZHA 3DNPA 3O4FA 5DWDA 4MGHA 2GJ9A 5I5GA 1T29A 2NU8A 4AC9A 2OZLB 2QD5A 3B6MA 4AAYA 2OBBA 1DAGA 3AEUA 1GILA 1NN0A 1O6CA 4JJGA 2LW7A 4TKVB 1SPBS 1XF9A 3UH1A 5JCOC 2B7BA 1UXIA 2IYAA 5AVWA 4HPJB 1GQ2A 1RQ2A 3KHTA 3TJRA 1NVMB 4MULA 4DQKA 1CQIA 1YVUA 1BROA 4PSCA 4TTVA 2ZRQA 4N0EA 5B2FA 2C2OA 2QTZA 2BEVA 1MDFA 4C2BA 4RF3A 3UXYA 1C1DB 1AY0A 2BTOA 1L5HB 4QLOA 4GYJA 4L0CA 1G9XA 5DBEX 3RFCA 1X3SA 4L22A 1OFGA 2B5VA 3GHHA 1L5FA 5ECGC 2C0PA 2O54A 1P17A 1ZA2A 3QZUA 3U4QA 1E1LA 1UIMA 3IHKA 1AZTA 1L3CA 4CM9A 2OAEA 4OGLA 3LOUA 3PXDA 4X64B 3Q8LA 3BXXA 1D4FA 1SH7A 2FQ1A 2PJDA 4HEA1 4B7XA 3GL9A 3WRXC 5A5DA 1WWKA 1JA1A 3MUFA 1U4NA 1YMQA 3TNYA 3FLBA 1DDOA 2IYOA 1LBHA 3LUGA 5J2TF 1B0AA 2XNCA 3A1DA 4OJTA 1VYVA 3CUTA 3H75A 4MQEA 5B57C 5ICMA 3ZZ0A 1AQ6A 3Q8KA 3HXOA 5CT5A 1LBQA 4AYWA 3U7FB 3N7TA 4YBZA 1JQDA 3VYSB 1E5QA 1AQJA 1AMOA 5BV0A 1N2ZA 2ZRKA 4UASA 4ZAFA 2GBPA 2ZT8A 3GVXA 3QVJA 1Z56C 4HQKA 3NOVA 1PR6A 3AR9A 3PD0A 4L15A 4MPJA 2K2WA 4BVFA 4C22A 5H4GA 4I9NA 2ET6A 2ZR7A 3WLAA 3WQBA 1Z18A 3TZEA 5HMLA 4FBGA 4I4TB 4AUMA 2F3QA 1TVKA 1VE5A 3PK0A 5I4CA 5CFRA 2W4IA 1XVVA 4FI3C 3RVLA 2PK3A 4MK4A 4RWEA 1QAOA 3MCAA 1WD5A 4JJKA 4K40A 1T36A 3DMGA 4OHRA 4KK4A 1BXZA 2PBRA 3OWHA 3IVAA 4L5JA 1W8IA 3INRA 3N8DA 3ZE9A 5CX1A 3GP5A 5IJ9A 5BMVA 2XDWA 1HNWB 1O57A 1G5IA 1RRPA 2BM1A 2GJ8A 3KYCA 4IUBS 3OUZA 1ND6A 4D74A 2DZDA 3EUWA 3P1JA 2BFAA 3HCNA 4UFNA 4GZ3A 2H3HA 5D87A 4IJUA 3LYAA 4HH4A 3H87A 2FP4B 1IDOA 1TCBA 1XL1A 1K68A 2GX6A 2ZB7A 3FPGA 4Q3AA 5JVDA 2O8CB 2NXEA 2UYYA 5FI0B 1R0SA 4AKEA 4CTMA 4F6LA 1R5BA 3E9NA 4ER5A 1YIOA 4IV5A 4H31A 1OHHD 1ULUA 2WAXA 1ORHA 2Z2IA 3G0OA 2GN1A 3G3EA 3W1EA 4U8HA 3ZX4A 2RHRA 4R8SA 3RS4A 2JRLA 3MELA 5C31A 3WLSA 4RFSA 4CFZA 1RD4A 1VLVA 1ZSYA 2VRNA 5KOJB 3GA0A 1UM9A 2F00A 4WJLA 4ISCA 1F7UA 4AY3A 4JJFA 2OO3A 3ETJA 3G1TA 3P26A 4YI5A 2NTYC 2RC6A 1ADYA 4L16A 9ABPA 5DN6D 2G8LA 1X9HA 3B1FA 3WLNA 3EDYA 1JB1A 1OT3A 1PSWA 2A1IA 3GOHA 3QMVA 3QTTA 5EY5B 1YB6A 1MEEA 4I9GA 1C9EA 3RUFA 5HYVA 2JASA 3HVKA 4ZKEA 4R0VA 1Z0UA 2FOLA 1ZOSA 3VKVA 4NX2A 5EIBC 2VNKA 5HQ3A 5DNEA 2JVIA 3F2VA 3Q8MA 3S28A 1MVOA 3HSSA 3AF2A 5SY6A 3CZ5A 2E0IA 2FGKA 2Q5JA 4YV1A 1ZBDA 5HUHA 1RPZA 3LFUA 1R4NA 4YMVA 2JFVA 4P7KA 1J0EA 2WMNB 4FKBA 3LTNC 3B3FA 5C7IO 3CXRA 3HE3A 3PHHA 1C41A 1KQNA 3TLCA 4RETA 5SY4A 1Y8AA 2ZDHA 3TQSA 3NBMA 2W22A 3TKYA 4KSBA 4A91A 1EB9A 4UNQA 5EZ5A 3P20A 3IEIA 5CP8A 3M4YA 4WZBB 1T9ZA 3VR6D 4PNHA 1U8ZA 4WSOA 1DO2A 2ZIXB 3NEYA 1FZTA 4GU5A 5BNTA 3OE5A 1PEAA 4IOKA 5AKLA 4G1VA 5UKDA 2QY9A 5A02A 1R4AA 4BIMA 5BVHB 2ZRIA 1YBFA 1HF3A 2VJKA 1I7QB 4PIPA 2XYPA 4DA7A 4A6PA 3OEED 4CQLA 1PNOA 2AYZA 5EJGA 4BZXA 3BM5A 3U7JA 3L1UA 1UDWA 3MTAA 3VTZA 1BOFA 2H7CA 2V58A 2BHTA 3PEUA 4G1EB 4ZYLA 1OA1A 3QM1A 4OB8A 5EJ6A 4ZV9A 2F17A 1KKUA 1SO8A 2NT3A 1MKYA 2GN9A 3CCFA 1VPVA 2JGFA 1PZFA 1KETA 4OQDA 5FPKA 3VKUA 1Z63A 4NCAA 3GEIA 4JUCA 1QC5A 2X4GA 3E03A 1OUMA 4B0OA 3B1WA 4Z8XA 4UQLA 5IVPA 2BKXA 2E21A 2JS7A 3ILVA 4HQOA 1GSHA 2VVTA 2EQ5A 3IVRA 4QUJA 2QN3A 3E3OA 3MBIA 1E3EA 3FCUB 3AYZB 5IT9A 2NYUA 1W93A 4KB5A 4KRYA 4AI6A 4I1PA 2RJ3A 1C3VA 2BBTA 5DDIP 4EBFA 4F8EA 4M83A 4EATA 4FHCA 1XEXB 1YR2A 1SR8A 2JFPA 1P5RA 1GQOA 4L8FA 3TAUA 2Q9AA 3AESA 3FGZA 3PFKA 4N0MA 4GOXA 4PX2A 4MQFA 2J6CA 1S3IA 5J2UF 4E2WA 3DVSX 5SV2A 2B25A 1N2BA 3JASB 4PM4A 4Q21A 3STXA 1DVRA 1Q7GA 4EI7A 5BN4A 3DBOB 1KPGA 1XLWA 3FGNA 1E5VA 1TLFA 2B4YA 1IBRA 4MR7B 2DHEA 3U49A 1EFHA 4C06A 5IJ0B 5JRDS 4C0SA 2DBYA 1BKSB 2OFWA 4QX6A 2XZDA 1YUMA 4HGOA 1H8HD 4ZGGA 4V0NA 2O48X 4HH3C 1UK6A 5JAOA 2HMYB 4YUXA 5F33A 3U81A 4DMHA 4K9SA 1I4WA 5BURA 1CIJA 2Q1UA 1XMVA 3IAHA 1J8QA 2NNWB 1YZTA 2Q5HA 4ZEOA 3KL4A 4AWXA 1QG6A 3FSGA 1EFKA 2UVPB 2XPCA 4TQUS 4KN9S 2JAPA 4D8XA 3OQPA 3PT5A 1RHQA 3AVXA 3BA1A 3K30A 3EFEA 3SC6A 5EXDA 1GR0A 2VEOA 3L7KA 4TTAA 4C2UA 1G8GA 2RH4A 3C7AA 3CYFA 3LPCA 3UPDA 4HB3A 2YCBA 4XWAA 3G0BA 4X20B 2EZ9A 3LUHA 3V9AA 3KDAA 4JR2A 2HK9A 5CG2A 2X40A 4XB1A 1KJYA 3UHAA 4A23A 3WVNA 3PDWA 4ZVPA 4JC5A 2HLPA 4LIPD 1X70A 4KOAA 2XAAA 4AY4A 1BDIA 1WKVA 4RVNA 3ZHSA 2VDWA 3W8RA 1ZGAA 1MVNA 3N2LA 3UJ3X 3EZYA 3U56A 1DGQA 4NC9A 1F8XA 2E4YA 3GELA 5ER6A 5HUJA 5TIIA 5I48A 4GPIB 3B51X 3L7LA 4EBBA 2C4WA 4O3MA 3HEAA 1BWRA 1G8KA 1WV0A 2YNMD 1TB4A 4HATA 1E4EB 4KZPA 4OK3A 4YH1A 4CKEB 2O3UA 2ATEA 5HTOA 2F3RA 3CUKA 3RRYA 4G9EA 3RABA 1RNLA 2WPDD 2FK8A 2XUGA 4IHJF 3KEGA 2WIDA 3KUCA 4PPFA 3W78A 1UFOA 4KPUA 1F0PA 3QOXA 4MMZB 3A3YA 1V1JA 2MINA 2AJCA 1PR4A 3F6RA 3DM9B 4WCDA 1QCDA 2VWQA 3P9KA 5KDLA 3T6KA 5DBGA 1ADCA 4L02A 5HTKA 4BFVA 2NVWA 5EQDA 3TK1A 1BEEA 3DF9A 3UOAB 4LAFA 2BHLA 3WMGA 1XVUA 5EKXA 2AOUB 3OLZA 1U2PA 1OFUX 2C1EA 3GA7A 5EEHA 3DWIA 3SF0A 2R65A 3B7PA 1CE8B 4FZ3A 1E60A 3QPCA 5DW3A 4CR6A 5HJ5A 2HR1A 5TQ0A 3A28A 4JT4A 1XTJA 5AHXA 9LDTA 4AKHA 2RAUA 1KI3A 2RAVA 4F60A 3CR3C 3S0JA 3HCWA 4NH0A 1SCIA 1NW4A 5ICSA 2GPJA 1XWFA 1JIJA 2GN2A 2G9QA 2Q5FA 2QV0A 2W6NA 2P6PA 2RAFA 3FG9A 3IB3A 4J1TC 4PW0A 1LX6A 2UYGA 4ZO8A 3QMPA 1D09A 4YJHB 5J2TB 4B8ZA 1M0SA 1COZA 2BBWA 3AR4A 2F59A 4TXHA 4J07A 5F3WB 4J90A 2G4LA 5ALJA 5TQVA 4LVNA 4V0LA 1DLIA 5C8XA 4C6TA 2E49A 2ZYTX 2H8KA 2VDRB 1SWWA 3N8NA 5EWLB 3TIXB 8ABPA 4OSEA 1B00A 2ORWA 4GKJB 4P93A 4CIAA 3P0EA 4MRRA 5I45A 3PQCA 2A1TS 2JA1A 4WFQA 4Q3BA 2LIVA 3Q7QA 1KC1A 1DUIA 1YE5A 1F51E 1N0HA 1YGYA 2QMYA 3H5LA 2OYSA 4JQOA 4OPMA 4IEEA 4E7PA 1QDUA 2DFDA 3A2LA 2XF2A 3E84A 3BK2A 1MIHA 2YHIA 3Q7IA 3TTYA 3HCEA 2FB9A 2RG1A 2NQTA 2QN9A 3Q2IA 4MV0A 4QOEA 4BZZA 5K6RA 2NZ2A 3CNOA 1BTOA 2D1YA 4OXNA 3C48A 1E7SA 2FWNA 4G07A 2L42A 3JATA 5EJ7A 1AKUA 1AA6A 5JHHB 3IT0A 4COOA 3A4IA 1G38A 3PKZA 1TCVA 3QE0A 3VPFA 3CLRC 1JHDA 5EL0A 4YB8A 1XZKA 4WLEA 2EXXA 2X13A 1W29A 1V3VA 1UMBA 2WUVA 1M83A 2IODA 2O59A 2ORYA 3OOJA 2NIPA 4J0KA 3H4MA 4YRKA 1XRPA 3UW3A 3QI2A 3T7DA 2FMIA 2CBZA 2BL4A 3D4NA 4GL4A 3PR1A 5AKJA 3ZI0A 2JLUA 1SY7A 2YX1A 1XRLA 1POWA 1R8XA 4P3NA 1L8XA 4B3SB 3TDMA 5EKTA 2OAP1 3J81A 2XZPA 3CLVA 3EXFA 4ETNA 2XDAA 4ZARA 1QFYA 2CHEA 3V48A 1POXA 2TECE 3LX5A 4LVOA 4U7GA 4MKIA 2OFXA 2J85A 2VK4A 5B3JA 3PI6A 1EH5A 2HSZA 2WB4A 2VQEB 1A2KC 4D25A 5IH3A 3PXXA 4BNDA 4G01B 1PAUA 1W9MA 4L0MA 5BYAA 3PYMA 1FZQA 2VT3A 3ZHUA 3OSUA 3F5QA 4D56A 4GVXA 2FWAA 2VZLA 4FIZA 4QQNA 2P68A 2YC4C 4J1SA 3B1ZA 3L0ZA 5ALMA 4ZK2A 1NUUA 1LLCA 1C9NA 2JEYA 1JEQA 2HRBA 3LQYA 4B46A 4BBJA 5CDYA 5F51A 5H3LA 4OATA 3GRPA 1FYDA 4NU5A 4QSMA 3KVRA 4JIMA 2QAGB 5E3HA 2XOXA 4M89A 1KEPA 1U8TA 1W2WB 1QX4A 3AP1A 2OA0A 3HL0A 5IZCA 1GTRA 2ZANA 1PNRA 1UOOA 1N6NA 4UM8B 5DNUA 3G7UA 2GPBA 2Q4EA 2EW8A 4HRAA 3G2OA 5AK6A 4MYSA 2YWCA 4U02A 1M6VA 4MINA 4I55F 5HF8A 4DNQA 1M2VB 4C0WA 1Z0KA 4HO1X 2ACEA 4NOLA 2EHDA 3Q3HA 3ZHRA 4J16C 1L8OA 4H7JA 3S99A 4QLBA 3QUAA 4HRYA 4PCAA 4XJVA 1IM8A 1WB6A 1KGDA 4EHIA 1LDMA 4MV4A 1E1DA 2CFOA 2MIIA 3MHPA 3ZI4A 4DV5B 3ESBA 5FL7A 4C5CA 5AVKA 2QA5A 3CN9A 3L6UA 1LPOA 5C7LO 2I2AA 3UIEA 2J08A 2HWKA 3LCMA 3S8EA 4CV2A 2F64A 3B53X 3ZHCA 4NMHA 1QDLB 1J23A 2VPZA 3JVIA 3NNDA 4M53A 2X9VA 5DM60 1HX7A 3AL2A 3RGGA 1YRAA 2XNJA 1OMOA 2HRCA 2XJ9A 3BF7A 4L4YA 5FUVA 1PVDA 4YPVA 1WDKA 3DQQA 1IAVA 4P83A 1MW8X 3PEFA 2J3HA 3PHBE 3FLMA 1PJ4A 1WW8A 2J0QA 1ZVKA 4O08A 4A10A 2PMDA 1EBFA 2ISSD 1KRHA 1WMFA 2X1LA 4CHGA 3L4SO 1BRTA 1QJCA 5DGTA 4YFVA 5P21A 1QE5A 4BFYA 3GZNB 5EINA 1NAHA 1SBHA 2WJHA 3AF4A 4LYHA 1JJFA 3P9XA 1YZFA 4DIEA 2Z95A 3GU3A 1L4GA 1YHYA 2BEUA 2I7TA 2BKLA 1AGPA 1NYRA 3DXYA 1ES9A 5BUSA 3NCTA 1B16A 1P5ZB 2QMOA 4ZO9A 2YOFA 2YZNA 5LC1A 2R4TA 2FZLA 1Z4NA 3QOYA 4OM7A 3PCTA 4YMSA 1XZJA 5J2UB 2B8WA 4B40A 3DHNA 1BX1A 1QHFA 3W9YA 1DO0A 1OXTA 1VE9A 1RIFA 2ID8A 4IH4A 1DCFA 4IIYA 1K08A 5KNBH 1A9OA 4JS0A 3D4OA 4PR0A 4EHJA 3JD3A 4JOSA 5E7JA 2AMFA 2FTKE 3H99A 4TKMA 3PC8C 2P27A 4Y6OA 3BT7A 3R4VA 3SZMA 4E03A 4KPYA 2Y9MB 4G41A 2ZP1A 2YV4A 1FNSA 1UWCA 3P2MA 5TF0A 2HDNB 4PX5A 2O5EA 1EX1A 2W6ID 1GP2A 1XZIA 4ZXFA 2ADMA 5AH0A 3ELBA 1MIOA 3TIIA 1TEXA 1DAOA 4IDBA 2B1JA 3U4MA 3A9SA 4ZV7A 1E8DA 2IYXA 4YAJA 1OREA 2Q0SA 4C3VA 4DYHA 4YCDA 4OI4A 3ZW9A 1SCDA 5IT0A 1Y1LA 2GN8A 3AKCA 5K4HA 3OOWA 1DEKA 4YMLA 1BWPA 2Y77A 5FAKA 5GINE 5TVKA 4LDQA 4WK6A 1W87A 1VSQA 1P1FA 2NSLA 2P5SA 3U3OA 5BY2A 1G3QA 4D4GA 1V16A 1CZUA 4MWOA 1AN9A 2BFOA 2W6JA 1B93A 3Q5EA 2WD8A 4R1NA 5EZ6B 2FXIA 3RKUA 4EELA 4MW1A 4X1OA 2ZAMA 2ZE6A 2DPMA 3HHEA 1H0KA 1SU4A 2I99A 3PIIA 2HEIA 1E9CA 4PPGA 1TA9A 5KREA 4ZQIA 3IKLA 5LIRA 1ODCA 2WHPB 2GK6A 4QBGB 2V5VA 4OAPA 1GPH1 4HEA6 2E6UX 3ZCRA 4M49A 2YWBA 4NZNA 5ED4A 4GIBA 3VZBA 2HRQA 3A1VA 4YJ3B 5I7SA 3DBHA 2FZCA 1DG1G 2CMKA 2Q1YA 3DPIA 1VG8A 4RULA 1SPXA 1F5SA 1PBNA 4OQXA 3WIOA 1OC2A 2CNWD 4I1OA 1L0BA 1TAGA 1WV1A 5IJWA 3D1VA 2XQVA 5H70A 2B4AA 2HRDA 3A25A 3DL2A 3NP7A 1Q2XA 1I0ZA 2OYRA 2ZUUA 1DOHA 3C45A 4MAAA 1CS0A 4P31A 4PBTA 4XWYA 3ZPXA 2XEDA 4TM8A 3Q85A 1VHLA 3QBVA 4C4OA 1CY6A 3N58A 2OGWA 4M0UA 4C29A 3ADBA 4KO8A 5C37A 1HFEL 1UFRA 2NU9A 2ATXA 1NBWB 3CNBA 3MB8A 2RIPA 1L8QA 1XNGA 4FUTA 4K0RA 3L18A 4U39A 3OECA 3LOQA 4WJZA 3VU8A 4LQCA 1YCDA 4BVGA 4D3DA 1DCTA 2C3UA 2CJFA 3KB8A 1CR0A 4LBYA 1J06A 3FYDA 3LU1A 4EUFA 1T4BA 2KBFA 4KR3A 4LY9A 2XLBA 3QMWA 4DDUA 1QPGA 5I8PA 2QRHA 3VR5D 4UNIA 4AWBA 4HZUB 3QV2A 3WICA 2P4HX 1OT5A 4JDPA 1OTYA 1YQTA 2O0LA 2X1VA 1T2UA 3BX1A 1Y8CA 3PIDA 1J8VA 3DE0X 2R3SA 3NT4A 5LKAA 2DM6A 2OORC 2ZJ7A 4MIKA 3W6UA 1EINA 1I30A 1V3QE 1C7EA 4NZZA 1J0BA 4F4JA 1E2BA 1AO3A 3ER6A 1SD1A 3F8TA 3DD1A 1YQ9A 2JGNA 2CJXA 5DTQA 3H5RA 1Y81A 2ZPAA 1HDZA 3T15A 4KN8A 1B6RA 2I66A 3ZQKA 4CMCA 4ZV4A 4J0FA 3K72B 2C88A 3WJ1A 2E5LB 1I4EB 3OZWA 3F6SA 5ADHA 4O59O 1NVWQ 3WAGA 2ESRA 2DLDA 3TQFA 5JNWA 4HX2A 3PHCA 2D1QA 2QX8A 2WABA 3LXMA 5TF4A 3C74A 1F7VA 1JQ5A 4ZAVA 1XZAA 1NF9A 1KOLA 2QPTA 4IMPA 1Z6XA 5AM1A 2Q2OA 2WSBA 1U2DA 3DVAA 3JQGA 4W9RA 4ZOBA 4ZALA 5LZ8A 2ECPA 3OQIA 4IIVA 1G5QA 2CJPA 1E62A 3IEPA 1FUKA 3OY7A 4LJ4A 4KUGA 5EIWA 5AR1A 5FUBA 1DXYA 5KCMA 1E0KA 3FYUC 1E2UA 4QEDA 2EBUA 4BN5A 3UTCA 3J7TA 1OI4A 5HFAA 5JZBA 1IQ0A 4RY8A 1GUDA 4HN2A 3D6NB 2ZSHA 3WJAA 5JQGF 1FFHA 1MA0A 1ZNXA 2ZSAA 5I9BA 1U04A 4XDGA 4E1VA 3DEZA 4GI3A 2Y1CA 3KAJA 1DPFA 1IM2A 2J0VA 2FZGA 2QP4A 4R83A 3RD5A 4BGEA 5E2AA 1ZMOA 3QF7A 2FSFA 4I2VA 4WNAA 2Q3JA 1DOAA 2OG2A 2FJ0A 2Z43A 5AFSA 3NHKA 1PGNA 5MN5A 4OQMA 2AOTB 2FPGA 1RDFA 3HCRA 3DAPA 3TUZC 3IODA 4DR1B 1Y9AA 4K6HA 4F1JA 4F93B 3RVSA 4YRMA 1JMKC 2GA9A 1NVKA 1RWMA 5COBA 1RLJA 3VJRA 1IOZA 4G85A 2NPOA 1KY5A 1ECJA 4K5QA 5DV9A 3OBBA 2O0JA 2REXB 5EXTA 2O8FB 3LUAA 4IR7A 4TMKA 4R8LA 4Y2SA 3VZDA 3UV3A 3HCAA 3BH0A 3KLOA 2OLEA 2WSSD 2D6FA 1JU3A 3OQ1A 3QE3A 4M8LA 1QDEA 2F7SA 2FU5C 1WNFA 4OI0A 4K26A 1MC8A 5IH7A 4O5OA 4LJ6A 2HPVA 4JOBA 4R9VA 4GOLD 3IRVA 5CGQB 3U1TA 4CF5A 2O8DB 2G4VA 1J97A 2Y93A 2DVMA 4ZOLB 5DTIA 2XAUA 3NIFB 2DPXA 2MYUA 4J03A 1OHHA 2ZVPX 3QHPA 3UWSA 3V4RA 1ZH4A 2W7TA 4XLLA 2Z8ZA 4NHEA 1QRSA 2DKNA 5EUQB 4DQLA 3I6ZA 1QM5A 2EBHX 1MDBA 2YQ5A 2ANBA 1SM4A 5EUCA 4DQDA 4ETIA 2Q5CA 3QPAA 1Y6RA 4HV4A 3S7TA 1JAIA 3CVJA 1OH5A 1ZMBA 1IHDA 4S0XA 5EE9A 4WECA 1NONA 3HI6A 1V11A 1TD9A 4BQPA 4OXXA 3SR4A 4EJMA 3KIPA 1YASA 5DN6A 2J4FA 1IXZA 4RJIA 4PC3A 4OLAA 2MSKA 2PRZA 4GC5A 2HSWA 3O4JA 4WWHA 1EBBA 3ICOA 2QDKA 3BWXA 3PPIA 3QX9A 5CDFE 2FMFA 4JXKA 1NBME 1DTWB 2ZE5A 1GZ3A 1VA5A 4ETMA 4FFPA 4IQGA 3SXPA 3T9AA 2GZ1A 1SVUA 1OR8A 4JEIA 2GEUA 1XU4A 3IP8A 3JZAA 3K0CC 4R41A 3RVBA 1K5DA 1T6NA 1C4KA 4CCWA 1U2GA 4YTEA 2W5UA 3PTZA 5EG5A 1E9VA 1VJ5A 1TA0A 2GCIA 1ZI8A 1HA3A 1KJNA 4V1CI 4OGWA 4QDTA 4TRNA 3ZNPA 4W1RA 3ZVKA 2COUA 3TL2A 4EAAA 5LVAA 3K0HA 1G8HA 3AI7A 3UQYS 4G0ZA 2B0JA 3W6ZA 3P9SA 3NHSA 2D59A 4E13A 3VR6A 1ZGCA 3NRCA 4L57A 4WT7A 1W6RA 3ZQ6A 3NEPX 5ALRA 1MT0A 4OU4A 4LF9B 5HWSA 4UM5A 5HP4A 3B20A 3F0TA 1KPIA 3HKDA 3OF2A 3OEEA 2IDMA 2P78A 3OT1A 4MI3A 5BN3B 3AB7A 3RVDA 2IHKA 4RACA 3T1VA 3BXFA 1K66A 3L9WA 1CUSA 3FWYA 4PR3A 3S5JA 4FFNA 3R4CA 4E5YA 4DANA 1N2JA 4WW0A 2GEBA 3G8AA 1DUVG 1JHZA 1NJFA 4F5EA 2ZJ3A 2DSNA 1E2KA 3F3YA 4J4BA 4N0DA 1G5RA 5G4KB 3DBVO 2W2MA 3SZUA 4GP6A 2FP3A 1M1NB 2CL6X 3DMPA 1T4GA 4JLMA 3CKMA 4NYJQ 3THOA 4EEZA 4CF6A 1REQB 5AW0A 1GZ5A 1AH2A 5KU7A 4I9HA 4WL0A 1PQPA 2OGSA 4DSOA 3F67A 3EH2A 4YT8A 3G5TA 1N6PA 2BISA 1VJCA 4QE3A 3TOZA 3ZD9A 3U13A 1OWMA 2WJVA 3ZE1B 2JGRA 4AQYB 1A5AB 4EQ6A 4HB4A 1WY7A 3G7SA 1YR9A 5HMMA 4NQZA 2H5JA 2D06A 2NN3C 1CS4C 1F8YA 1FL9A 1G20B 1NURA 1C9YA 1JDJA 2QYOA 3R5KA 4GNRA 4X93A 2QL7A 4QSHA 3HY3A 4BWFB 1O03A 2PY6A 3KTDA 9MHTA 3HNPA 1ZESA 1F12A 1M0TA 1WSAA 1J7KA 3ER9A 2CNNA 5ICCA 4EG1A 1TD1A 1N77A 3TMAA 3ENQA 4I6GA 3NPAA 3THWB 5B1DA 3K2QA 1G64A 4BO6A 1HH4A 4WBSA 3OCUA 3GEBA 1HTWA 4GOND 4JU8A 3BGOS 4H1TA 4IJQA 1QZUA 1H8HA 3DZCA 4B9EA 1KJJA 4UBMA 1JKJA 4BXOB 4I1VA 1UBRS 4ML3A 4ZDJA 2HQOA 3CZ4A 4RPKA 5FOXA 3RVOA 3T7TA 16PKA 4ZJUA 1C1HA 3NFRA 1EX7A 2XVYA 2OCDA 3KVOA 3O31A 4BVAA 4HVLA 4WIAA 5G4LA 2CYBA 2FJPA 3CEAA 5ESDA 4QGAA 4RMNA 5KB3A 1T9GR 3CZMA 1CR1A 3QLUC 1ZCZA 2GCPA 3G85A 5C80A 4G0WA 4OHWA 2B6NA 4OVKA 5IP5A 1MJHA 1M67A 1YMVA 3ZHBA 3GGGA 2X0EA 1QU2A 1QP4A 4G1FA 3QNUA 4EI8A 5K3EA 4YYEA 1I3NA 5I7OA 2WJGA 4QARA 1W48A 1KO8A 2IIBA 4KI7A 3DKPA 5I6DA 2ZUDA 4YRBA 4P4SB 1RHUA 3VNBA 4QNNA 4YACA 1AD2A 5JS7A 2WRZA 3DOHA 3DZJA 2QN8A 2HMWA 2V6IA 1E2NA 2HY7A 3AR7A 3IPYA 3ORYA 1EM8B 3PC3A 4GR5A 1FBTA 4D42A 5JBNA 1QFMA 1SIOA 4QXPA 5JZVA 3CVYA 3NUQA 5H68A 1XFAA 2YNMA 3RVMA 3U7HB 3K70B 4DA9A 1IULA 1OFTA 2Z4SA 4UBJA 2BSQA 3ZD7A 1F4VA 1P2VA 5AQEA 1SC6A 4QYIA 3WLPA 1UPFA 2QV7A 4FGKA 5D6OA 1QZTA 1EFRA 5F4BA 4GLLA 3U3RA 3I4FA 4EMBA 4RD6A 1G3MA 2ZJ1A 4D8YA 4UKDA 4ZJYA 1AQYA 3M5PA 4X66B 5F77A 2ZOSA 4LQ4A 1S7CA 3R7SA 1TT5B 4IKPA 2Y9PB 1RYZA 3AKDA 3C3XA 3R9IA 1CHDA 3RBZA 1NJSA 5HXAA 3DXXA 2H1FA 1A1SA 2UAGA 2Z9DA 4ETWA 3FTFA 2I67A 3C1TA 3UG6A 2AD5A 5HCNA 2X76A 4DLWA 4FM9A 5DNAA 2FFJA 1RI3A 2P11A 3DV0B 3G8BA 3ISVA 4TRMA 3D5EA 1M8GA 1MG0A 3C6XA 2XCSB 3RADC 1KYQA 4C9BA 1XQYA 2IIVA 2PUHA 1O1YA 1OQAA 1I1OA 4LHZA 3BJMA 4Q3CA 4PIVA 4EAQA 5HIAA 2QM0A 1OLXA 1R15A 3VSBA 4DA6A 2OV2A 4TXJA 3TEFA 1DT3A 4YRCA 1NUSA 5LD2B 2FW6A 2Q6OA 3HXKA 4F45A 1IBMB 1TM2A 1T1IA 3ND7A 4YASA 3EFOA 3TPFA 3OEYA 5JQGB 1AF7A 3DT6A 1JYFA 5AHKA 2QR5A 4LSGA 3V2GA 2HFKA 2GXAA 2IWRA 4WZ6A 2FFHA 4DSTA 5CB6A 4INOA 4TSRA 3IEUA 3F96A 2ON6A 2X6TA 1PJ3A 4UXIA 3B8EA 1HDGO 4GX1A 3FZEA 2ACKA 2P35A 4YRRA 1FTNA 4AKIA 4FSDA 4FOSA 5DGHA 1QAQA 3PGVA 1ZVQA 1CEXA 1S6YA 2JIQA 2OM2A 3CJQA 3SJCA 2BP7B 3MBKA 3RC3A 2XQJA 1KF0A 3EGWA 1H2FA 3QKRA 4DC0A 2Q6IA 5FWYB 3SX4A 4H1UA 1KARA 5I4BA 1DBIA 4X3CA 1EWYA 3JZMA 3WWPA 4V02A 3QBDA 2EOAA 3Q8XB 4MAMA 4O2AF 4BV3A 3TFWA 4DM7A 3JQ9C 4QXQA 3GC6A 5FUXA 2VFAA 2LCQA 1XZGA 4IOMA 5B7GA 4BIIA 2PPVA 3DH0A 3S1AA 4PNEA 5BVGB 1SUBA 5E9QA 4RCVA 5KKAA 5REQA 1TYCA 2I6GA 4XKJA 1WCIB 1NP7A 3IQWA 3OQJA 5JC1A 1U9YA 4UNSA 2V6MA 2WQ6A 1ZFNA 4ZVLA 2OMEA 1JDBB 3R77A 5A4AA 1SVMA 3LHSA 1DKRA 3LZDA 4YLEA 1GTSA 2JI4A 4K3UA 3CF6R 5I7HA 1UC4B 2FSHA 2PM8A 2XE4A 3C3KA 1YQGA 4U7PB 5EAIA 4FX5A 3KZ1E 1PFYA 2ZM5A 1XX6A 1VGRA 4DSUA 1PQ4A 3D7SA 2YY6A 5DBHX 4DY4A 1ZGBA 1XNQB 4YV2A 2DY0A 3FNFA 4G8DA 4EPWA 5LP6A 3W3ZB 1I3KA 2EYUA 1YRBA 5CVTA 4YRAA 1A5BB 5E7IA 5LZ5A 1R74A 1H3EA 1ZVMA 1N2CB 1YC5A 4RVUA 2G63A 1X19A 5ECDA 2FRXA 4INPA 3G82C 4CN9A 4DRXB 4K1LA 1KAQA 1LV7A 1R7RA 2BW0A 2QL9A 3GGOA 3SYTA 2ZETA 1X80A 4F3RA 5L3QB 1EUDB 4DDVA 3NV7A 2GSDA 2DPHA 3I72A 1TVEA 1AK1A 3ZVLA 5J9FA 4YHHB 1WP4A 1MXHA 2RHGB 1FX1A 3C70A 3K4HA 1CUEA 3CF4A 4UUOA 1XGKA 1ZK1A 5AVVA 3FVQA 2CVOA 2VPYA 2C3YA 3HB5X 2HJHA 3SFTA 5FOTA 1E9BA 3HBNA 3SHQA 3NTQA 4RBNA 1E6LA 2ALJA 2J41A 2GF2A 1ENYA 4JYCA 3JQBC 4U1RA 2FUEA 3DJYA 4RF5A 4A8JB 1FUUA 4E94A 1ZW6A 3QE9Y 4BX3A 1H8ED 1R0CA 3KD2A 3M5CA 1AB5A 4H3HB 4KGVA 1FY2A 2JF0A 2ZI7A 3KYJB 2WD7A 4W1SA 4C08A 4R1LA 4CV1A 5C7YA 1L5MA 2FPPB 4D5EA 5K8UA 1RJGA 5TQ2B 1CF9A 3ZVMA 1S4QA 4KQ1A 5BSMA 3OPQA 2HLNA 2O3SA 3WNBA 4TOIA 1EWRA 3ABOB 4C78A 3TQIA 2P3SA 1MA3A 4M55A 4ROSA 3IURA 3HUUA 1CDDA 5B3AA 1P18A 3TTUA 3W1WA 2QAGC 3AB3A 5LPNA 3U7GA 2DB3A 1USGA 4LGMA 2KBEA 3DEKA 1U9JA 1MB4A 1Z4PX 4QYMA 4WQMA 5CK5A 2HCTA 2YN0A 4OBBA 1OBHA 1H2WA 4RLFA 3VZQA 5L4NA 1OGIA 4U7TB 4MLZA 1LJUA 4B3CA 1CX9B 3EG9B 2Y1DA 3SM9A 4MS3B 5AW3A 3EGDA 4KLRA 3VJLA 1OYWA 3SMVA 3BWBA 1S02A 2PRJA 1NF3A 2WLTA 3AERA 2ZYUX 3IO3A 4G9BA 5JS2A 2WJZB 1Q0PA 3I9OA 5FDFA 4BP9A 2PR7A 2RHDA 4QVKA 7GPBA 3EB9A 4TMXA 2ZR0A 5KQSA 3QSYA 1MUUA 3C85A 5AVQA 2BELA 5CFLA 3QHQA 3OG9A 1PJRA 4MW2A 3KB2A 4PV7A 4DLRA 4M1EA 4BMCA 2IYNA 3UK2A 4B6SA 2JD0A 3IR7A 3DHYA 5CJPA 1QZZA 4C0AC 2HHAA 2P8JA 2CV2A 1Z06A 4IS3A 4YONB 3VUFA 3ZZTA 4EUKA 4RCYA 2GM5A 3E05A 3VR3D 1K1EA 5THXA 2JBAA 1XN4A 1ADFA 5K3OA 2F8MA 2XZLA 3AJ8A 2BD0A 2OC4A 4HZIA 5T5QA 1Q83A 3BIJA 5CG1A 1THTA 3PA6A 4DWJA 1QF9A 2HRRA 3SYRA 3WO1A 2D2XA 2WWWA 1MEOA 2W6IA 4D46A 2PGXA 3T4UA 4NXMB 1J2JA 1V5GA 2DX7A 4KH1A 4O0MA 2O2DA 2ZSFA 1ZH2A 2C7BA 5FEMA 2C95A 5BQ5A 5DSZA 4XM0A 4RA6A 3EZ6A 1BQEA 4DEVA 3CURA 3FTCA 3GCWA 2XMCA 3PC2A 3BHIA 4OEHA 1LKZA 1RM0A 4N5MA 5GADl 4CG2A 3TAXA 3GPDG 1JT2A 5IUNC 1CYDA 1DQPA 3B85A 1A3CA 2YASA 4KYTA 4TUYA 5KSPA 2JJYA 4MYUA 2QR2A 3IXLA 3OLQA 4IRXA 3I8XA 2EZUA 1LPPA 2QPLA 3AUXA 2I1LA 2R7LA 2GXQA 3X1XA 2UUAB 2PZBA 4U7WA 1X92A 5AO9A 4PX9A 1AB6A 3X3HA 1Q0UA 3HP7A 2YXPX 3CF2A 1JZSA 2QSJA 521PA 1DKPA 2V96A 5CHYA 1DQNA 3ZWQA 4BGUA 1ZD1A 4V0KA 4N12A 4WMLA 1NG1A 2BI7A 2VH2A 3U61B 1IWPB 3M8KA 4D41A 1SCQA 1GAWA 4YMHA 1P4GA 1J4AA 1O97D 1G2IA 4ZAXA 3FYTA 1T9DA 5LYJA 2P7IA 4YJFA 1Z36A 3DZKA 2CNWA 2DFPA 3HABA 1G17A 1UCFA 3OX4A 4GOOD 2WJAA 4M1QA 4UEQA 1O95D 5GGYA 4BS9A 1RHRA 1JDPA 4PYJA 2CZGA 1NW6A 1C3XA 1DQRA 2I22A 1LTKA 3CEHA 1OWLA 1AS3A 4R2LA 2F62A 2OXTA 3TKAA 3GUVA 4C03A 1TKAA 5AT1A 3RIYA 1V6AA 2O2EA 4A16A 5JFGA 1JLLA 3RBAA 3OWOA 1S4MA 1MABB 3QTLA 5AI9A 2AJLI 4ZVOA 2ZM6B 1JE0A 4BB5A 4BFCA 4QFBA 3RS8A 5M3BA 4CQMB 3NTLA 1FFCA 1KI2A 2J5RA 2WNHA 3NS7A 2G5PA 5KOIA 3ER8A 2Z56A 1AKTA 2BMFA 4IDDA 1UIRA 5EIHA 3WNZA 1YDWA 4JC4A 5JZOA 4TX1A 2C4NA 4OYYA 3QEMA 3VQTA 3PZBA 3IQXA 4MVJD 2Z3VA 4TVSA 3JQFC 3KX2A 3QKWA 3VR5A 1P2DA 1JP7A 4R8RA 5AJWA 5IMBA 3I6YA 1EVQA 2KB0A 2GEKA 3RAEC 3WLLA 4KFCA 1DFHA 3ZWWA 1AQLA 3L7NA 3RUAA 1GPYA 3PNBA 1BW9A 1XKLA 3IFSA 1TU4A 2RHBA 3DKRA 3H2SA 4RORA 4PGAA 1K4YA 2AEFA 4PO3X 1FMFA 3P0IA 3GUZA 4AP6A 2PZJA 4WN9A 3Q9UA 3JWEA 4DR3B 2IU4A 1GQQA 4Q47A 4KJZA 5JNRA 3K1YA 2PL3A 3G2KA 1FDVA 1ZC4A 1MHTA 1PO7A 1CEYA 1SKUA 3JPWA 4D6XA 5KHOC 3R74A 3F49S 4HFNA 3IEMA 3TR6A 1Y4DE 3P9IA 3ZWXA 1CERA 4G36A 4DLZA 5EE0A 1U0RA 2HIGA 5D7BA 4QUAA 4REOA 7ABPA 4TWRA 2X8LA 5EZYA 3JRWA 3BGSA 1ICIA 3KVNA 1WY5A 1NZJA 2Q4DA 2I7CA 1IYZA 1N2XA 4YGXB 1Q95A 3CY6A 4ISBA 1KTVA 3E53A 3KLNA 3N0WA 2A4MA 2O1EA 1BC5A 4GX0A 4ND6A 4DCTA 2V74B 4LJ7A 3SVTA 3F98A 3H0EA 4B4OA 2ZJBA 2P9GA 5LDHA 1ZONA 1N34B 1JPJA 1M2FA 3BYZA 4YUZA 2GARA 1OZFA 4IIEA 4M9ZA 1MAHA 1CTQA 3NWJA 4PQEA 2PKQO 5U1PA 1R4MA 3ORSA 4QPZA 3FPSA 4HJXA 4RF2A 5FOWA 2OBLA 4G25A 1RRVA 4BJ3A 3T9EA 3WOHA 1MJGM 4Z4EA 4AZ3B 2O8EA 1W36C 4UU8A 3K09C 3KJIA 3MTBA 4R2JA 5THQA 4RSGA 4Q34A 3E70C 4DN6A 1ORWA 1ZNQO 1SG6A 2PUTA 1J9EA 1QYRA 2QYSA 3FHLA 4H0FA 4Q00A 3U4DA 2OXRA 1TVCA 4BB9A 1SU6A 1OBOA 1W96A 3N7UA 3MEQA 2CDNA 1ONBA 5IJZA 4D5GA 1ZXXA 4AURA 2WSSA 3K8OE 1CRQA 2QTMA 3RIGA 1EWVA 3G68A 1Y63A 1MOZA 1KYXA 4BFWA 2BF7A 3IA7A 5K3DA 3LUFA 1ZNZA 1Z7GA 4WKPA 4EGAA 2H31A 3RRNA 4HN9A 3AJRA 2DFKB 3RG2A 2IS2A 4X8LA 2VSYA 3LK6A 5FWXA 1KQOA 1R6TA 1XHLA 3BK7A 1TOAA 1GM5A 3V8BA 1T1SA 1DHTA 1Y5IA 1Q92A 2NQ2C 1Q16A 1HYEA 1WZCA 3DZ8A 1R0YA 2W8BA 3A6GA 3BMNB 3IQHX 3LHIA 4NMWA 1XZEA 1YQQA 5EP3A 2LTAA 1KI6B 3MA0A 3RTAA 3Q9LA 2I33A 1ESZA 3LBNA 3W6OA 2CJYA 1IY9A 3PC7A 4BVBA 1ZJYA 1CZRA 2Q3LA 1J2RA 4K6GA 1HDRA 1J2TA 2XRYA 1WMAA 3FB4A 3OT5A 1XP5A 2A5GA 4GXRA 3SQMA 1EUCB 3U48A 4A15A 4EEKA 1RAIA 3IUYA 4TLDA 2O7RA 3LO8A 2Q50A 4GAEA 3UJ7A 1N5OX 1W88B 4UCQA 3TXXA 4ZYXA 2IPAB 1ZSNA 1M8KA 3DYBA 1EWQA 3AHCA 2V3CC 1IZ8A 3AF6A 1WSWA 2AG6A 3GQBB 2X0DA 4Z49A 4OBWA 3PWSA 5KYUB 1SVOA 5JYBA 1OJ7A 5C1BA 5HQTA 4EWLA 3PNMA 3FWZA 4LC1A 2P2DA 4CHTA 1V9LA 2BCGY 2NYAA 3AWDA 3JD1A 5FB3A 4G1MB 1CT9A 2VCYA 4O4IB 2P3LA 1G6HA 1S1MA 2X6QA 3DCIA 4LF4B 1UBKS 1SXJE 1Z7WA 3RSZA 4LKRA 4EFMA 1WXXA 6GPBA 1Q20A 2V6GA 4GLFA 1QF6A 5HKAA 5JJLA 1LLFA 1RKBA 3EPLA 5M34A 1CK4A 1NJ5A 3TUIC 4RMJA 4ARSA 2SECE 4DRYA 2IDKA 1NVEA 1XMJA 1NUHA 2BZGA 2J3KA 4NYIQ 3V7NA 1PT9A 3X2EA 1UINA 3QLTA 1U28A 3IDQA 1V4VA 3ROMA 4LWZA 4PVDA 3LWZA 1ZD5A 4BLSA 2WT9A 2X6RA 3QEKA 1DAKA 1TTPB 1ENOA 4ON9A 3VHQA 4OLBA 1KI4A 1U8FO 3A14A 2FWPA 3QFRA 4DCGA 3OPVA 1OASA 3OURA 1QHIA 2G9VA 1KE2A 5A5GA 5F3RA 3BJZA 1FIUA 4INAA 1YVRA 1AK2A 2PXHA 4K6FA 1WUJS 4JGGA 4P22A 4AN1A 1BGWA 1GFSA 3KQTA 1E1QD 1PYDA 1LPAB 3INYA 2CL5A 5AMXA 1M54A 5C4IA 2J0UA 5JW6A 2GHRA 4H3VA 3SHFA 1UBSB 1G66A 1NLYA 4LSMA 5GV7A 1LVUA 4P34A 4AG5A 1I7DA 3M3HA 1NYLA 4BO0A 4U9HS 1NJ8A 2Y8EA 4PRZA 2FE1A 2BFEA 1DIGA 3MOGA 4A27A 1S2MA 4UHFA 2YN2A 4I6EA 4Q03A 5F1PA 1SXJD 3ECAA 4Q9HA 2CNLA 5HKLA 1SEPA 3AR8A 2OL4A 3IERA 3B1VA 4JB8A 5BSWA 5HOQA 2JIPA 3I3OA 3P96A 3AEXA 3GDOA 4X91A 3RNOA 2VYFA 4LI0A 4EHHA 3FKJA 4O0LA 2VNJA 4IINA 1TKCA 3F5FA 3LO5A 5JXIA 1PLKA 3PXBA 3NAMA 3G1WA 3ZU4A 4KWCA 3ED1A 3DKKA 1F0KA 2R4UA 2NPFA 1PTJA 4Z51A 4KG7A 4J2OA 2HXGA 4B2PA 4DMGA 1FNDA 3GOQA 1YR6A 4ER7A 2GZDA 2XKAA 4R0MA 1JHMA 4NK4A 5CB0A 1E2EA 3FUWA 3JS5A 4D6YA 3DVRX 5CW1A 1RZUA 1QZ3A 4DBVO 3Q98A 2WWHA 2YIJA 2FHPA 3X1DA 1OZAA 1WB5A 2QP3A 3I1YA 4JEMA 1X1BA 3D5QA 3W8NA 1JL3A 4BJ5A 5BNZA 1VZ2A 2HMSA 4Q12A 2H4JA 3K9WA 1P2BA 1ZMTA 3N87A 1C8KA 2XGGA 3SIXA 4EW1A 1NFQA 3F7NA 3G17A 1P1KA 2CC2A 1U4SA 1WW2A 3K35A 5FWAA 4OI2A 2WDPA 3PYXA 4TVKA 3IMCA 4HMOA 5BRJA 5F7ZA 1T8RA 4NZMA 1LTHR 2OLJA 1RQNA 1XCGB 2EZTA 4F8JA 4KP7A 1PN3A 2R7MA 3X0DA 5HX7A 2OBFA 4OHVA 2NO0A 4R1UA 2PZEA 4F2WA 5IAKA 2ZB4A 5KYTA 3NDRA 1YK1A 1E3TA 1GTVA 2Q6VA 2QJOA 4YQYA 3AY3A 1MMFB 1JI0A 2AD1A 4BJHB 4JLPA 4ZAZA 1K8XB 1E5XA 4C01A 4AB1A 1GTG1 4K6CA 1VKZA 1Z5OA 2C0QA 5IK2D 4KC0A 3N0XA 4BKMA 1O9BA 3R7FA 4B4KA 3SVLA 1ABBA 2A5DA 3BE8A 3OTGA 4WBXC 3I76A 3RH0A 4G5QA 3D6AA 2I0FA 3T7AA 4UJ5A 3NEJA 1JLHA 5DRYA 2Z6QA 1YZ3A 3HKEA 3IAUA 4ZRMA 2NZJA 1JKFA 2QI9F 4R4JA 2GLUA 2B7CA 1G7SA 1QF7A 2ZYGA 1OGYA 3JVDA 4RD2A 1VYHA 3ZE0B 1LPNA 1ARZA 1XKXA 1PIWA 4EG4A 1XDGA 3SKVA 2JLXA 1T26A 2X4IA 3PFFA 4REQB 4NFHA 3HBMA 1GGMA 1X1TA 5IVHA 2HXYA 2JFBA 3JWHA 3SXUA 5JXJA 3K6SB 4BRSA 1SBQA 3UICA 1P6XA 1OB5A 3UHPA 3LT5A 3ND6A 3O8QA 4NBVA 2VP9A 5BR1A 4EPRA 2RGNC 4FR2A 4ZVNA 2XYVA 3QPVA 2AYXA 1WVMA 2YKGA 1YB2A 5TPWB 1C0IA 2Q99A 1MFPA 2Q27A 1MC1A 2REBA 4EUHA 2H4XA 3ZIUA 3K70C 5I5EA 4UZFA 3QVGB 3DMYA 1HDCA 4KO4S 3IVMA 1GAJA 1OAOA 3O7MA 1RPAA 4KMOA 4KWTA 2C4VA 1TDJA 2GETA 1F6DA 1JEDA 3EASA 4D3ZA 3UUEA 3DC7A 1W19A 3HZOA 5FBRB 2DQ4A 4MPTA 2C7GA 5AK4A 1I0LA 1DC3A 2GR9A 4CM8A 1G8PA 3COSA 4Y98A 3C3CA 4DIKA 4B4VA 3FJ1A 4C7OA 2JCYA 4V2UA 5EYPB 4MVWA 3FIUA 1X1RA 5FJIA 3GLHB 4CF7A 2GN0A 1AKQA 2B35A 1EXNA 3ST7A 1QE0A 3W5DA 4MCIA 1F9EA 1WD7A 2VN8A 1H66A 4XEHA 3OC6A 1WX1A 3QBTA 2D1TA 4MYCA 3V2HA 2ZBEA 3LDFA 3Q15C 4EPYA 4IIGA 1MV8A 2XBLA 3KSBC 3GEMA 1GUBA 2WJIA 4E5SA 3EXG1 4KIWA 1XTSA 1XI2A 3CUVA 2P9EA 3E0QA 4DXDA 3PGMA 2XMRA 3LAWA 3NAQA 2ZIFA 4DR5B 4BLOA 5H80A 1H22A 1PT5A 2X7JA 2P6OA 1SC1A 3LKZA 3BFXA 4CXMA 3C3JA 2IJGX 2GEFA 5DM70 2A0YA 1UBEA 3N2YA 5A0VA 1L7BA 4H3KB 1P9WA 4OB6A 3QOWA 4TT3D 2GRUA 1CUJA 2WV7A 3L7OA 1WUKS 4R8KA 1JQBA 4B3DA 5D3MA 2CDRA 2HL6A 4UNPA 1N4AA 4CEJB 5GONF 1PWEA 2QVLA 2YVKA 3TQHA 3UJ6A 3FD8A 1NVGA 1JSLA 3NGMA 5AESA 2ZTVA 3HKBB 4AVYA 2WYWA 1GCAA 5B1IA 4B45A 1E2JA 4X61A 3C15C 3N53A 4O6VA 1ZP6A 2IRWA 2W98A 4RSHA 4G65A 1VJDA 3M6XA 1L4HA 3M6FA 2LVBA 4MH0R 4M1TA 4L0QA 3W5SA 1FVOA 1WOMA 3VO9A 2BUBA 2HTEA 4GX2A 1SQ5A 1U7OA 1DE0A 4I08A 5KNDH 4JAVC 4H1VA 3VNUA 3JARA 1M2OB 4QATA 3I5UA 4Q9KA 1BFKA 3LUBA 4FHDA 3IP5A 5FLYA 3KJNA 5HKOA 4FQ8A 4X7RA 4C1BA 2V65A 2XMQA 5F7JA 3HFGA 3RYIA 2VLBA 4JX8A 4DBLC 4ZYTA 1I5EA 2XI4A 1YWGO 4BO1A 2VYND 1SCNE 2X9GA 3HEBA 2CJWA 2HIHA 4PCVA 1E2HA 4JYAB 3U40A 3DFUA 4U0JA 1L7EA 2DTEA 4P0TA 4TV9F 1JDBC 2H1VA 2AH5A 1EFVA 2FCAA 5IZ4A 1TTHA 2R62A 4Z2YA 1NRIA 4ZI7F 2NU8B 3BORA 3F8SA 3K9BA 1FJHA 5ADVA 3KPVA 1ZU5A 3SC4A 3AEUB 2WP0A 2UYOA 4QQFA 4UCWA 1JXAA 3CPEA 1TX4B 1QLJA 2YQZA 1CR2A 1RWQA 2VHEA 1V95A 3CRNA 3ILXA 1CQIB 3IUQA 4URZR 4X7MA 1TCCA 3N0TA 3HV0A 4FJ0A 4B73A 1E5LA 2JFZA 2AEMA 2BEVB 1X7WA 3E1SA 4LW8A 4QU0A 4AMZA 3RT1A 1XZFA 1T6YA 5K9ZA 5CLQA 4H7PA 2F9LA 3UWKA 1R6DA 2RB5A 3N2GA 1OTHA 4PYOA 4EDFA 3U4QB 2R6FA 4XIJA 3ZE8A 5I47A 5KYWA 2R8ZA 1IZ7A 2XTMA 3UMCA 2DXIA 1DU4A 3MN1A 1HSOA 3DM5A 1I3OA 3G9UA 3LW7A 4JI1B 2WSLA 4W8HA 2C7VA 4CKBA 2V03A 4OB7A 4EI2A 3IDZA 3TS1A 3E7DA 2G70A 4MQEB 4JI5B 1YZQA 4A8JC 2LUOA 4MWEA 1VKNA 1Y4AE 1H05A 5FV7A 1WMDA 3ANNA 4IVNA 4PLPA 4Q9DA 2ZYDA 4FMBB 3QELB 3PWKA 4DZRA 2BR4A 2CF5A 3LPLA 4D0NA 4WESA 4ZTBA 1ZXLA 3TG8A 4WCFB 5AUOB 4BPRA 3KLBA 3OLYA 1TVKB 1XUOA 3MQ2A 1XAJA 1VRCA 4MVCA 6PFKA 3TLEA 1TKRA 1JBKA 1CJVC 2OQIA 2V7VA 3SSAA 4HDRB 4S1OA 3RRBA 5JSUA 4DNFA 1GKLA 3FUVA 4YR9A 5IJ9B 4RTMA 5CX1B 3TSOA 5BMVB 3GJ3A 1IZYA 3OZXA 1XMXA 2WZQA 4HKTA 3VDNB 3VR3A 1ECGA 4C7BA 2V55B 2ZDQA 4RY0A 3JYLA 2XDQA 3OZRA 5C8YA 4AJOA 2GD6A 1XXHE 3PU6A 4FS3A 1MH1A 4OJNA 4P4GA 4A6EA 3VOTA 3L0YA 4GRDA 3OM1A 5GVRA 4DIOA 1X77A 2FR0A 3HLTA 4DE5A 5KNCA 3R5HA 3F6YA 5JVDB 1D0SA 5G3YA 3VYUB 4MO9A 2WM2A 5HK8A 2W8ZA 4TL6A 2P2CA 1T5LA 2HO4A 3NTRA 4MDYA 3ZHTA 5KIAA 2VQ3A 1Q0QA 1HL3A 2WKSA 1A50B 2QQ5A 3HYTA 3ET5A 3A4TA 3K5PA 3D4LA 1BXRA 3A0UA 5D00A 3UWOA 4NE7A 3V4FA 3SQLA 2VHVA 2QNRA 1KOFA 3F8WA 3TLMA 3ROKA 1TRHA 5F2OA 1D1PA 4KKVA 2E4AA 1DIHA 1UM9B 3C7KA 3GDWA 4M7WA 5HG0A 2NP7A 2XRMA 4DDMA 2LGJA 5H9WA 4H4EA 4BP3A 3L43A 3I5YA 3I01A 4ABTA 3W8FA 3ABRB 3W3AH 2NTJA 1Y3HA 3ZDQA 3ELDA 4G89A 3MIIA 2VAMA 1QG4A 3HU2A 3MGAA 3RT9A 3BSWA 2CE7A 3W05A 5E6SA 4UATA 2BVNA 3ANLA 5LLSA 2I29A 5HQ3B 1EVJA 3BTSA 3SAJA 1HTTA 1HYBA 2O2CA 2DPYA 3FN4A 3GJXC 1WSDA 3H0CA 3EBOA 3LLUA 2GEVA 3I58A 3WYFA 3HXPA 2D7CA 3NW9A 4OOEA 1R4NB 4MUIA 4ALNA 5ALKA 5JYEA 4FLEA 4KQJA 1EZ1A 4Q7KA 4YROA 4MAFA 4TZTA 3C1UA 4ZT3A 2I4NA 4B3RB 5I7FA 5KYXB 3UANA 3Q3GE 4HGPA 3QXHA 2JRCA 2ZI5A 3TNJA 4PPYA 4L3OA 1WB9A 1KYIA 5IT4A 1OX5A 2FMXA 2PAFA 1LDEA 4X92A 3KOYA 1RXWA 2QZZA 2XD4A 3T7JA 1RJWA 3B70A 2WWVD 3ESZA 3HWRA 5TE9A 2GOYA 2AOWA 3O3CA 5HBRA 4KPFC 1ZOOA 1OXMA 1L7OA 4DGSA 3ZV5A 1Z5PA 4K9PA 2JZNA 1JECA 4XLTA 4D92A 4I1RA 3BXPA 2FW8A 4ILEA 4Y2UA 5BN5A 1AKNA 4MVJA 2FDXA 4XSVA 3R6WA 2C4HA 5CH3A 4BO5A 3T9FA 3OWXA 4RHCA 5JJBA 1OTXA 3OM0A 3DLHA 2CEAA 3Q1LA 1SVLA 1BCRA 3JR7A 4FWIB 3LUPA 4YRSA 1E3QA 2EJCA 4AY6A 4KX5A 4HNAA 1MPXA 2IEBA 2LE0A 4J0DA 4LSZA 4Y2HA 3TQQA 3AVPA 3GN2A 1NF2A 3P0RA 2RD2A 1PJAA 2GI4A 1QC5B 3OE4A 3P27A 5IRCD 4Q1EA 4MUNA 5ITSA 4AW9A 3PQ5A 4A0GA 4BEJA 2KE5A 1KK0A 5BSVA 3KQNA 3AXTA 1JVBA 2OXIA 3WXBA 3DAOA 3TDKA 1KR5A 3DZIA 4ZZ2A 4JVNA 5JSZA 4G5FA 1ZJ4A 3EW9A 4K03A 3WGQA 5CDSA 3Q3JB 2F3PA 2IUYA 2LKDA 3A9CA 1B74A 4QHTA 2FDCA 4JY7A 3T06B 2ZRNA 1IVNA 3AEZA 1LZLA 1SA0A 4KL8S 2JANA 3AESB 2VDUE 1T3HA 2P6MA 3EAGA 1ZL0A 3MWGA 4TTPA 4MQFB 3D8SA 3WBJA 1PUIA 3SVZA 1U7TA 2O20A 4HVAA 1WHSA 4IOLA 5C1DA 5AKHA 4NJEB 4MI1A 3VISA 3TZ6A 3LQ2A 2HV8A 4B82A 3C43A 3RB8A 5K8CA 1T3SA 4F3YA 3CT6A 4JBNA 3STWA 1PK8A 1LGYA 4LS3A 4UUMA 5IUKC 1IATA 1R0ZA 5KTMA 3I92A 3RE1A 3E18A 4R2MA 2C57A 3HYRA 4M1WA 5DCYA 2UVDA 4LQLA 1ORTA 1EK1A 3OLXA 4GKKB 2HCRA 3MOIA 4BNUA 2R1VA 1HFJA 1QO0A 5DEIA 3TNLA 4BDSA 3I6MA 3B60A 1W2GA 1WABA 1OKKD 3DDUA 4TV8A 4AMVA 1TADA 5DHFA 2A5FA 2PGNA 4ITVA 3NIGB 4EVSA 4IGFA 3TD2A 1XLVA 3TL6A 1I5RA 3SQOA 1OI2A 3L93A 3PPVA 3EK2A 1OH7A 4ZO4A 5G1NA 6ADHA 4D98A 1A5SB 1JF8A 2H4YA 2A4KA 4JROA 2IXAA 1ESDA 4RA9A 4H6VA 4RPHA 3NASA 3VGPA 4P3YA 1MRZA 2TS1A 2YV2A 2G1AA 5JNUA 3F9RA 3FETA 4CIYA 1Z0AA 1Q17A 4YRLA 3VPGA 2KYRA 2GZSA 4FQ5A 5BSGA 2HIMA 1ZZGA 2IPOA 4OQZA 4FGWA 4QVGA 4CM7A 4Q6BA 4OYLA 1URPA 1V1MA 3ELUA 4V03A 4TVOA 5CLIA 5FT9A 1I24A 4M8IA 1S2DA 2JIMA 2HGSA 3AQIA 3AR6A 3R44A 4OFWA 1NBAA 1NOJA 1UAAA 1NQAO 3SLRA 1JDTA 4ZI7B 1FNBA 1J2UA 3DAGA 3LY8A 1KAGA 3ROQA 2FF5A 1XWWA 2FEPA 2NO7A 1LPMA 3WL7A 3ZNNA 4D0GA 1GRRA 5FTNA 3WGMA 1H2RS 5HE9A 2JATA 4DUZB 1N0UA 1UEXC 2CL0X 4DF3A 4UMVA 1EEXB 4D80A 3ICQB 4BC0A 3FNRA 4CM4A 1L7NA 2BGGA 1ZL2A 2MINB 2AG1A 3ZJTA 3IMGA 4EEXA 2NLOA 1VGQA 4GMFA 1CQPA 1B15A 5FO1A 4XYEA 3ZU2A 2P2SA 5LWQA 4LN1A 1GO2A 2AEEA 4A7PA 4MQMA 2EIHA 1ZDMA 3K2IA 2H1OA 2IEIA 1UK7A 3IP7A 5K09A 4JJAA 1ONNA 2VPTA 1QLWA 2E82A 1AKYA 3I6IA 5TQ0B 4NYMQ 4XE5A 3VZRA 4PC6A 4E5UA 5ES4B 4J4TA 3K20A 3U44A 5T8KA 3KQMA 1Q7EA 2ENUA 4QTTB 3SICE 2F9MA 2P40A 3HJGA 1CB7A 1CC1S 1YQDA 4JUDX 3V33A 5K45A 4P8RA 1PU2A 1N0IA 3D0RA 4WKCA 2YOHA 2W90A 3BUSA 1M2WA 2GH1A 1UFVA 5JH7F 5LB2A 2WA2A 5J4LA 1IK4A 4K9QA 1KNXA 2G71A 3N2KB 2H4HA 3HN6A 2GN6A 2VUTA 4EJ6A 5C1PA 3H2GA 2VUHB 1VMIA 1TMYA 2QSZA 3IV9A 4HB0A 4KXNA 2EDAA 4OXRA 1P73A 5C8VA 4PRYA 1SCKA 2OT3B 4B34A 5A9RA 1OXVA 5EJ4A 2P91A 3F9IA 4EW6A 4HQ6A 5IXJA 1T25A 3WIDA 2ZIZA 3GJQA 4GE0A 4AECA 1WNTA 2BY4A 2AR0A 2GVNA 2WUEA 4EF5A 2YHIB 3UYKA 3FPLA 3P9QA 4A0FA 1VM6A 1CY8A 5E4FA 1PLLA 2ZKLA 5BW4A 2I6SA 5HKKA 1PZMA 1ZD4A 5K0BA 2XZTA 1S3FA 1K2WA 4QG3A 3JATB 3N6VA 5L45A 5JD3A 1ONOA 1E1QA 1R12A 4RDIA 1GA4A 1JJVA 1KOJA 4EHBA 3I45A 4AJ4A 2FUNB 3B1KA 4RSMA 4LF6B 1LWNA 1J07A 3PUXA 1UOEA 4HCJA 4M8SA 3HJUA 3B6KA 3DNMA 4UBOA 1UMBB 5IG2A 4Z7QB 3O0DA 4X63A 2IX3A 2PKCA 4P7JA 1PNTA 3G89A 5KYGA 1E3JA 2QW1A 3E2MA 5DM1A 1XA4A 1GZ7A 1SXJA 4OQYA 3AVQA 4KXQA 5CGZA 5HIMA 3SJBA 4I6JA 1U0BB 4JN6B 2AN5A 1BXGA 1W35A 3VFDA 3EXFB 3GUYA 4Q15A 4HDNA 2G1JA 2FXVA 3U3ZA 2FEKA 3GLRA 4QQKA 4BU0A 4ZDIA 1FP6A 1NMQA 2GPYA 2GPWA 3IS3A 3NDJA 4G4JA 3CZPA 4B7AA 2BJVA 3M6LA 4OMCA 3N39C 4BNDB 2IGTA 4ZT5A 4UC0A 4UHEA 1KAOA 4U2EA 3S55A 2IOFA 3WYAA 2AB0A 1CSEE 1NASA 4C0LA 1UC8A 2XUZA 3B8HA 1J5EB 1T9BA 2IS6A 2QUIA 3GFSA 2IW1A 2AZMA 2V1XA 1H5QA 4UTNA 4IWNA 1T0JB 2ZWOA 4FP9A 1U3TA 4OHZA 5C5EA 2OFFA 1NU6A 3K8ZA 2FR8C 4EHDA 1P44A 1ZOIA 4PTYA 4ENWA 1NRWA 4DJJA 1I7NA 4DCSA 1QHNA 3AFNA 1OLUA 1RXVA 1XP8A 1WLYA 4JC0A 2GCEA 4N01A 5TC4A 1N32B 3QG1A 5EXPA 1MAAA 2I7VA 3GFQA 3PP8A 1C9JA 5EGNA 2O3JA 3RV3A 1I4DD 2CLCX 4K28A 1O9HA 2GN4A 5TRTA 3RTGA 2RKBA 5B12A 5FQNA 1CP3A 4B83A 4IHKA 1M6VB 4HY3A 3GR6A 2PR2A 2BE7A 2Q2QA 1A5TA 2QG9A 4NCJA 4PG6A 2V6BA 4UPDA 3DZGA 3HK2A 1DZIA 3ZCUA 1D4AA 5NLLA 3D3JA 3D54D 3LT0A 3PEWA 4JI2B 2H59A 2XBUA 2ID4A 2A9FA 2P5YA 1J25A 2PXXA 3GXOA 3I62A 5JXGA 4LZJA 3LHFA 3IQIX 3C6MA 3HYNA 2PE5A 1R5NA 2HT6A 1C4XA 1UODA 3LFTA 4BQOA 2G1PA 4CMEA 1G0OA 1L4MA 3OF3A 5ELXA 4JHXA 1Q19A 2LIPA 5AI5A 5L40A 4Y6RA 3KUKA 1TXGA 4IKEA 3SE0A 3RK4A 2ARKA 5A3QA 1P62B 1BGXT 4UM9B 3CX7A 1F38A 3UHOA 1PNVA 4GGOA 3SY8A 1V5IA 1YJQA 1LF5A 5K0SA 4A5SA 4MVXA 1UDCA 4H9GA 4RIIA 5LQAA 4PWYA 3P2OA 4II7A 1RI5A 5CT8A 1NM5A 4CL2A 1KSJA 3CIOA 1XPRA 1BU5A 2FRDA 2H51A 3W3AD 5B37A 3ECCA 2N1BA 1DPGA 4QGSA 3SHVA 3QVLA 3OE1A 2AHRA 4QA9A 3WA7A 3DZBA 1E9EA 1FDUA 2OCKA 3IOMA 4NU6A 4QPDA 4BFUA 2ZJ5A 4HG2A 1L4YA 4RKQA 1GZSA 1X0VA 1IUPA 4DM4A 4N5DA 4NEGA 1EZZA 4MUAA 1CLEA 3H9CA 2PLRA 1T5TA 3OMXA 2YFKA 2VF2A 3B6EA 1O96A 2B9VA 2KW5A 2Q46A 3HCFA 4XX0A 4DREA 2OG1A 2Q4TA 2P9JA 4JUBA 4XH9B 3VR1A 3E3NA 1DT5A 1SD2A 1KP2A 3ONFA 4BNKA 2C0CA 2X0NA 5HIKA 3QMMA 5FV4A 3AVWA 1WCV1 2AW5A 2FFAA 3KXPA 4FCVA 1FQJA 1T8UA 3S29A 1OILA 4E2FA 3VAYA 4M88A 4WOJA 1UC5B 1F0YA 4ZQHA 3D6JA 3VHLB 1AO0A 1JR4A 2W48A 3WS7A 1ELOA 3GPBA 4BFTA 3RF7A 1CU1A 1MIOB 3FUUA 1S2GA 2VI5A 2A9QA 4V3CA 4A0RA 1BJRE 3PF8A 4LOIA 1KKLA 1PKEA 2W0MA 4WXYB 1DB3A 4D79A 4KAJA 3A2NA 3U3KA 1DARA 5B58C 1NVBA 1DFGA 3OQHA 2OHIA 1U0FA 1UDBA 3DHWC 4QYTA 3DF7A 4Y30A 1N33B 2ZUBA 5A3JA 4X1KB 5E7QA 2PQ2A 1TE2A 2OHHA 3HDGA 1CUYA 3Q4GA 1EQUA 3A6HA 3HRIA 1V16B 4DUPA 3OZFA 3EWAA 4E70A 1QHYA 2NO1A 4YIHA 2IXEA 4BQEA 1I3MA 1GGJA 4KMMA 1F2UA 4JYMA 4QXMA 4YJ2A 2BPOA 1LSJA 2QE7D 2X58A 2Y6UA 4TT3A 5KWIA 4Z7NB 1ECFA 3VX3A 1THGA 1JQKA 4ZU1X 4FTWA 4QQRA 2WJ6A 1E3WA 5B58T 3QIVA 4IIJF 2XE7A 2P2ZA 2RJOA 4IS2A 4CMHA 5BWMA 3NATA 1XOIA 2LWIA 3JYOA 2EZ8A 3LPNA 1SCAA 3S70A 3HR7A 3SCZA 2AG8A 1UBCA 1RADA 2BGIA 4TSFA 2JAUA 2Q4RA 3TCKA 1Q15A 1ILEA 1JR6A 1YZYA 3OD1A 3TOCA 3ZGOA 1SOWA 4ZTUB 4MQ4A 3EXHA 3ZZUA 4JASB 4XIYA 3T1OA 2RKOA 2HO5A 1ZRSA 1CS0B 2XWBF 3EQ9A 3GLFE 2J9FB 4L9AA 1ZR2A 1B2LA 2Q8NA 4QUGA 4XJTA 4Z4HA 3FMVA 3VX4A 1CQJA 3DVLA 2QUJA 5T4HA 5JMWA 1IHYA 3CNEA 4Q7EA 1D6JA 1RWPA 4QPPA 4IRUB 5DMXA 2NU9B 4AN0A 2ZT5A 2VYNA 3W5BA 3T1HB 3ADOA 2IUTA 3X1ZA 4BZQA 2PBLA 2ZR8A 4YT5A 5BUQA 5L3SB 5DM0A 4X95A 3X1KA 1NV8A 1GKKA 1FMCA 1E18A 3EVBA 1Q11A 3BRQA 2J59A 3OZIA 2QTVB 3V7UA 3OQVA 2UZIR 4Q4LA 4QJ5A 1N6HA 3EEFA 1N5DA 3ADPA 5BN1A 4M0KA 1PNQA 5IYZF 3GJTA 2IHJA 3LKVA 4DA4A 2JIRA 1UAYA 1NP6A 1WKCA 2WOJA 1WLSA 4A4DA 4DMLA 1NBOA 4JQCA 2PCLA 3CLKA 3QK7A 4QPNA 3HVRA 3TZCA 1IBLB 3ZKAA 1WB4A 4D9KA 1AUXA 2W2TA 4NOJA 5GJCA 2UYHA 1EMDA 4IO0A 1MRNA 2O2ZA 2HA3A 3B9BA 4UVGA 1U5BA 3D0QA 1SUFA 3I34X 3MBOA 3PV0A 5DI3A 1PZXA 4R31A 3B82A 3T5CA 4DMMA 5KDDA 4M1YA 1LBIA 2AJTA 1ZA1A 5TLSA 3D2BA 3G6KA 5F9MA 1UDRA 4MUMA 1IUKA 4KUHA 3ZKWB 4ENUA 1L7AA 5ENDA 2KS6A 1P77A 2B34A 2RH9B 4ER3A 1ZKDA 2IYZA 1PDVA 3AXSA 4CKWA 2WWFA 3PENA 3F73A 1J0CA 3ZVRA 8AT1A 2R6R1 3QYAA 4ESOA 3G7NA 5AHRA 1XYVA 3UT6A 2BHNA 3FSJX 2O7NA 2HHJA 3PB3A 3TWOA 1RWWA 1ZM7A 4AMUA 1I4TD 3DVAB 3JQGB 3QYJA 1CUZA 2G5GX 2QTCA 4CKCA 2IZ0A 1V5EA 1XZQA 4KE6A 2XH8A 1FU4A 4RIHA 4Y1EA 3T5AA 2WTXA 3QITA 1RI1A 2YHBA 1VKHA 2WIAA 3DLPX 4M86A 1NVVQ 3LW8A 2IPNA 1HKUA 1ZRNA 2OPHA 1JFVA 1CR4A 3KFVA 3OHMA 3Q7RA 3UFXA 1Y42X 4EMUA 5DBFA 3GRAA 1E92A 1V8FA 5KKCA 4WNAB 3KB6A 4LDPA 5K99A 4K9KA 4OBEA 1QPBA 1SN7A 3U4CA 2K4MA 3ZY5A 1T2AA 2EW1A 2I8LA 1TM5E 3MTDA 4HLUA 1L3IA 4RHFA 1QTNA 1U0GA 2QLNA 2OVBA 1WXEA 3IKVA 3RC1A 3LGSA 3LCVB 2UXCB 3G1UA 5ED0A 3KSMA 5JY6A 2WOOA 1U6JA 2I55A 1J7JA 4Q4HA 5B7QA 1DIRA 3A2KA 3GEEA 4PLTA 1WPQA 3ZV3A 3UKOA 4B79A 1A69A 4C1NA 4D0LB 3PX7A 2PX2A 2EF1A 1Z4LA 2ZZKA 2IA5A 3D8NA 2FA9A 3G0GA 1X3LA 3O4VA 4H1HA 4QXRA 4C6SA 4DV6B 3R2JA 3T0IA 2D5CA 3AQ4A 1U7DA 2K5UA 4LEIA 3RRZA 2EX4A 4F9FA 5FUQA 4JYZA 3ETDA 3D64A 4RTNA 3O75A 5E3IA 2PZGA 4PQFA 1F4PA 3NLLA 4B0PA 2JZOA 1Z2AA 2RBEA 2VDVE 1I01A 1FP1D 4ZVUA 5HJ2A 2VPPA 4WDRA 4XVCA 4MWCA 2R97A 3KKOA 2PLAA 3DZHA 3GJ0A 5EIEA 1DC4A 4WA8A 2AFHE 2WA1A 3WDMA 5KHLB 5FOQA 3L0OA 4KQKA 1SXIA 4BV9A 4KU4A 4G1BA 5BMOA 2DWQA 2QYHA 5JHGB 3U5TA 3FWPA 3UMGA 4NYMR 3IMEA 1AS0A 2ZBDA 3B36A 1HQKA 1G6KA 3R40A 4ZOCA 3DQZA 2Z83A 4C14A 4WZAA 1RLTA 1J90A 2L18A 1V11B 1IHUA 2QUKA 3AHHA 3ECSA 1EP1B 2FKNA 4IIHA 3KPWA 3E23A 3Q88A 5DVZA 3ZC3A 1H94A 3RHFA 3GBSA 1CIVA 1N2HA 3W1VA 4ZI7A 1BX0A 5ETJA 2HF8A 1Z3CA 2Q5OA 1LK5A 3SSOA 1FU7A 2PUJA 4UHCA 2FWMX 2PD6A 3S2ZA 2BGRA 3BEOA 3MB5A 2Q5IA 1BYIA 2XYQA 3UN1A 4OP3A 4N0PA 4UDNA 2JFYA 4MHOA 4ZAWA 1FSFA 1G5TA 1C9DB 1LI4A 4QWMA 3C1OA 1LZKA 2VK1A 2ABWA 3ABIA 1PR9A 3BFKA 3PZRA 4L9SA 4P32A 4ZU3A 2UUBB 2X5KO 2QZ4A 4DRZA 3GJ8A 4GYWA 4HFMA 5CW2A 1RRGA 2RB4A 4Y9DA 3INNA 3KJFA 1V45E 1P31A 2X3UA 3BCHA 1J22A 1X13A 1P0PA 2AA3A 3FWNA 3LM8A 5DP2A 3U2QA 3TGLA 1DC7A 1QVAA 1ZBQA 1LC3A 1W4AA 3LC2O 3DW1X 3O3OB 3OX1A 4WEOA 4POAA 5EWJA 3WK8A 3C6ZA 3HA2A 4E3WA 2EFJA 5KOHA 4JT8A 2JDID 3PUHA 3FVRA 5EHQA 1GT6A 4NZYA 4W7IA 1SELA 1PR1A 3QUSA 2BKAA 4G0QA 3V1LA 4CI9A 2WHYA 1N7JA 4YY3B 3D9QX 2AKEA 3BULA 3GROA 2V4UA 3AHEA 1USWA 3G9ZA 3CKYA 5T67A 1ZN2A 2R7KA 1B6GA 4KI0A 4O2RA 5G02A 4EX6A 4LWPA 3MXOA 2GLXA 2DYKA 1L5YA 2GCNA 2QTWB 3JZIA 4B87A 3C5EA 3OT1B 3LUCA 2PS1A 4R1TA 2AN3A 3A1CA 1BE8A 2ZUTA 5HZKA 1JDUA 3P9ZA 3DEJA 3L7CA 1DKQA 2QI9C 3NJ8A 3TPCA 4BNIA 4HNVA 2N1MA 4YWJA 2AWNA 2E4XA 2I4LA 2R2GA 3SZGA 3BTOA 3V9PA 3O8RA 2GASA 2UZ0A 1SFRA 4HB2A 3RPEA 1NNEA 2OAGA 4I4IA 4IBOA 4PXYA 4RH3A 3VR4D 4F38A 1RXEA 4NMXB 1PJZA 2XCTB 5BT8A 3QKIA 2PZ8A 2V5AA 1I33A 3FVTA 4Y1GA 4N0QA 4R8MA 4YT4A 1T8WA 3QKUA 2BM8A 3O21A 5CM8B 4ESVA 1L5QA 1TNDA 3MMZA 4F4FA 1LX7A 5HA5A 4GUDA 4F96A 2CN1A 2I71A 2EGUA 1TMGE 1VHDA 4EQ6B 3KT0A 1H2AS 4TQGA 1G98A 2XHZA 2BI8A 2FSPA 3H1GA 4KLZA 4M0DA 1KRXA 3URMA 4ME6A 2P5TB 2IU0A 5B36A 1SWVA 4ADSG 5AVTA 3CVWA 2V45A 1XTTA 4CEHA 3U37A 5BNIA 2GBIA 1ZG3A 5JJKA 3OQOA 2VJPA 4I46A 5K8TA 2BZ1A 4FMPA 4IHJA 4DIBA 3AG5A 3TJMA 2X5OA 3SKYA 5DM2A 3U9SA 3O1HB 5FEUA 4FOTA 4C7KA 4WY2A 2PKEA 4OG2A 1P7CA 4FFOA 5DIZA 4BPBA 4KREA 4UNNA 3NMUF 1JKJB 2GPSA 3W2TA 4H1WA 3PLAE 3VSCA 2NU6A 3SR3A 2P3OA 2ONJA 3U17A 3VHXA 5GTDA 4EGCB 3LQRA 2NX2A 1G8AA 1RYYA 2IELA 4W99A 4BQFA 1CEQA 3K5IA 3EODA 4RH1A 1BDHA 1OKKA 4RZQA 3VYTB 4YMTA 3QA3E 3I9JA 3G9QA 3PA8A 3WZ2A 4PLFA 4PXSA 3NBQA 2RONA 1EGHA 2WFZA 2YJNA 4IDGA 4A6XA 4TUYF 4XQCA 1AMUA 1LRKA 3UUWA 4QUBA 1Z28A 1PJLA 2NGRA 3COVA 5K3BA 1EGVB 1HGXA 2W4QA 3VKWA 1UQTA 2QLLA 2WG1A 4N3GA 5EJAA 4QRIA 4F2GA 3RF6A 2ZJ2A 4CG0A 4X5OA 4EH1A 4H6PA 1A4UA 2GJ4A 4B8WA 5BSEA 4J0IA 3KYBA 4LC9A 4FEEA 1EDEA 1FNMA 2X7XA 4L3VA 3NWOA 2PX4A 3A3PA 3ZHXA 5KSOA 2VZ0A 1RW4A 3P2KA 3QX3A 3N0VA 1Y34E 1E6EA 3O26A 3QYFA 4JU9A 2FH5B 1CCWA 1ORRA 2OCGA 4G0NA 4JC8A 4MS1A 4WRRA 2EU8A 2VXOA 3K5HA 3QVXA 1U5AA 2Z2JA 4YK7A 4TYNA 4MA5A 5JDCA 2C83A 4ZDKA 5HS4A 4XRGA 3OHPA 2BRUA 4GR9A 4QO7A 5A3RA 3NJRA 1NJ2A 2QN2A 3CONA 3PBKA 3WWYA 2OOSA 3Q11A 1T5BA 1NW7A 3LDUA 3EUFA 4QYIB 2CXQA 4QUEA 3RSCA 1DI0A 1D7AA 3THYA 1H9CA 1Z75A 1OIVA 3HV2A 3KE8A 3WY9A 1IOLA 2WWTA 4GM4A 2IYEA