3OY7A

Crystal structure of a virus encoded glycosyltransferase in complex with gdp-mannose
Total Genus 138
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
138
sequence length
392
structure length
392
Chain Sequence
b'MKLIIVGAHSSVPSGYGRVMRAIVPRISKAHEVIVFGIHAFGRSVHANIEEFDAQTAEHVRGLNEQGFYYSGLSEFIDVHKPDIVMIYNDPIVIGNYLLAMGKCSHRTKIVLYVDLVSKNIRENLWWIFSHPKVVGVMAMSKCWISDICNYGCKVPINIVSHFVDTKTIYDARKLVGLSEYNDDVLFLNMNRNTARKRLDIYVLAAARFISKYPDAKVRFLCNSHHESKFDLHSIALRELVASGVDNVFTHLNKIMINRTVLTDERVDMMYNACDVIVNCSSGEGFGLCSAEGAVLGKPLIISAVGGADDYFSGDCVYKIKPSAWISVDDRDGIGGIEGIIDVDDLVEAFTFFKDEKNRKEYGKRVQDFVKTKPTWDDISSDIIDFFNSLLR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glycosyltransferase B736L
publication title Crystal structure of a virus-encoded putative glycosyltransferase.
pubmed doi rcsb
source organism Paramecium bursaria chlorella virus ny2a
molecule tags Viral protein,transferase
total genus 138
structure length 392
sequence length 392
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-09-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 3oy7A02
3.40.50.11930 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3oy7A01
5GPBA 3DZCA 4MHSA 3L7BA 4MRAA 2QN8A 1PYGA 3CUUA 2QN1A 3DDSA 4YUAA 1E1YA 2IV3A 4AY5A 4KQMA 3OT5A 3TOVA 1AHPA 5BNWA 1V4VA 2QN7A 1QKJA 4LDPA 2VCHA 4GYWA 1XC7A 2C1XA 3MTDA 3T3DA 1Y8ZA 3BEOA 4FKZA 3ZCTA 1UQUA 1VGVA 3E3LA 2SKCA 1UZUA 2XCUA 2QN9A 3G2IA 1IXYA 2QN2A 2QRHA 3T3IA 1NOKA 4MICA 1EM6A 3OTIA 3VUFA 2IW1A 4Z5XA 2ASVA 1FC0A 3GUHA 4GZ3A 2XA9A 2G9UA 1M5RA 5IKPA 3FROA 3DDWA 2X6QA 3H4TA 1FU8A 1FU7A 2G9VA 4X6LA 4CDRA 3CEJA 2R66A 2ECPA 1GPAA 2Q6VA 2QLLA 4HWGA 5ENZA 4YI5A 5HXAA 1P4HA 4BQFA 2YJNA 3NP9A 3T3HA 3G2NA 1RZUA 1C50A 2BISA 4RBNA 4CTMA 3ZCRA 3MT7A 2PYIA 3S27A 2R68A 2XGOA 1WW3A 4NEQA 4KQ2A 1H5UA 3CEHA 2IYAA 3CUWA 3CX4A 1JG7A 3BDAA 5DXFA 4QLBA 2R4UA 1J39A 1JIVA 2BGUA 5JTTA 2BGTA 3OKPA 2IUYA 1GG8A 3QHPA 2O6LA 3NPAA 1AXRA 2AV6A 3AMVA 2X0DA 2WTXA 3L7DA 2GEKA 2AZDA 4F97A 3VDMA 1NOIA 3QKWA 4BFCA 4GYYA 4WACA 2ATIA 2GJ4A 2QRGA 3BD7A 3MTAA 1Z62A 3SYMA 1GFZA 1P4GA 3HBJA 1Z6QA 5D00A 3L79A 3NC4A 4X7PA 3ZCUA 2PQ6A 1O6CA 1XL1A 3Q3HA 3RT1A 4AY6A 2PRJA 1WUYA 4F9FA 2F3QA 3S0JA 4N3CA 1FS4A 2BFWA 2F3UA 3OY2A 1FTWA 4X7RA 1YGPA 1SXQA 3Q3IA 3ZCSA 3PE3A 4N39A 2GM9A 2X0FA 3MSCA 3Q3EA 4RIFA 1JG6A 3EBOA 1JIXA 3NCHA 1KTIA 2SKDA 4WADA 1L6IA 2HY7A 1JEJA 1K06A 5DLDA 4EKEA 3T3EA 1C8KA 1FA9A 1K08A 3EBPA 2XA1A 3OKAA 3UYLA 4RIHA 3COPA 3ZCVA 1XKXA 3O3CA 2QZSA 3T5TA 1GGNA 3L7CA 2GPAA 1E4OA 4RIGA 1GPYA 2ACWA 2JLBA 2C4MA 1BX3A 8GPBA 1XOIA 1Y6FA 2X6RA 1NOJA 4W6QA 2ZB2A 1PSWA 3NB0A 1WW2A 3T3GA 3RHZA 2JZCA 3MBOA 2PYDA 3MT8A 3BD6A 1L5WA 3C4QA 2XMPA 2XA2A 1L5SA 3PE4A 1L7XA 3HBFA 3G2KA 4M60A 5LQDA 5C1DA 1FTQA 2AW3A 3RSZA 3MS4A 5I45A 4N3BA 4MHOA 1FTYA 3E3NA 4WHMA 4REMA 1UQTA 3MRVA 3RSCA 3MS2A 3G2JA 3SYRA 3TSAA 2F3SA 3WADA 3DD1A 4KQ1A 1L5QA 2F3PA 3MTBA 3CUTA 1QM5A 2R60A 3MT9A 2VG8A 3ZCPA 3T7DA 4EJ2A 3S28A 2VSYA 2QRMA 4M83A 4MI3A 1EXVA 3E3OA 3CEMA 2P6PA 2H1HA 2IV7A 2FF5A 3D0RA 2ACVA 2IYFA 1XL0A 1LWOA 2GT1A 3L7AA 2H1FA 4N3AA 3HBMA 3NAZA 4NC9A 4XI9A 3BD8A 5IKOA 3S2UA 2C1ZA 1P2BA 3MRTA 4EL0A 7GPBA 3UYKA 3IAAA 4GPBA 4F96A 4CTOA 3D0QA 1SXPA 1NZFA 2QLNA 4L22A 4AMGA 3OY7A 1GZ5A 3MQFA 5TVGA 4FZRA 5DU2A 2QLMA 4RENA 2JJMA 3NP7A 3S29A 4LEIA 1F6DA 2FETA 2SKEA 1HLFA 1P29A 1YA6A 1NZDA 1WV1A 4RIEA 2GPNA 1IIRA 3G2LA 2KS6A 3C4VA 4RIIA 4XIFA 3ZCQA 3VDNB 1JIUA 1P2GA 3BCSA 4BQEA 3MS7A 2VCEA 3WC4A 4CTNA 3HBNA 4MI9A 4GZ6A 2XGSA 1WV0A 3MRXA 3L01A 2G9RA 4YI3A 1A8IA 3IA7A 1Z6PA 1F0KA 3TAXA 1P2DA 2GEJA 3OKCA 4GZ5A 1C8LA 4RELA 2R4TA 2QRQA 2X0EA 4N9WA 2PRIA 1RRVA 1RZVA 9GPBA 4PQGA 4X7MA 1FU4A 3BCRA 2XGMA 3GPBA 3H4IA 2AMVA 2QRPA 1Y6GA 2G9QA 4M7PA 3OTGA 3OTHA 2IEGA 4NESA 2GPBA 2IEIA 4HLNA 1L5VA 2VSNA 1PNVA 1Z8DA 1NLMA 2C9ZA 2FFRA 1P4JA 2XCIA 3CUYA 4AN4A 1PN3A 4MI6A 1NVKA 3CV3A 3VUEA 5TMDA 4EKYA 4AMBA 5TMEA 1ABBA 6GPBA 1B4DA 2F9FA 5TMBA 3BCUA 4EL5A 5JTUA 1GPBA 3G2HA 2QN3A 5D01A 2QNBA 1XV5A 1L5RA 3C48A 3D1JA 4BQIA 3CUVA 4G2TA 1WUTA 3WAGA 2OFFA 1LWNA 1C3JA
chains in the Genus database with same CATH superfamily
4V0MA 1Z7EA 3E27A 4HX9A 3SJZA 3S2SA 3PI6A 4L4ZA 5CG1A 2G0NA 4RMJA 4D41A 4WNAA 5JALA 1BH2A 5EJ4A 4GL2A 1RCTE 2R84A 2C88A 3AIMA 3QEMA 4GP9A 3I64A 4GQIA 5KKAA 5AUNB 3OT5A 3BXOA 4KB5A 3NONA 4OFBA 5FWXB 1B8PA 1BX1A 3BHJA 1ENZA 4BIIA 3GJTA 3JQGB 4H4EA 4XX0B 3LFTA 5EIOA 3RADC 1PUIA 4K0RA 1YWGO 2D5LA 4HT3B 2H54A 4HQFA 1EJ6A 2R8EA 1M6NA 2O05A 3F2VA 3PT5A 4Y9SA 3WKDA 2GXAA 4BGIA 3JTMA 3MMSA 2R6FA 4WN9A 2GRAA 2JF0A 2R25B 1JMVA 1IQUA 2GAAA 2V5AA 4G0UA 3R09A 4IILA 4MS3A 5JS6A 1FDOA 4MI1A 1NLYA 5TQ0A 2ZR9A 3D1VA 5FPYA 4HY3A 3RSSA 4PSVA 1QYVA 2H08A 3FUTA 4LMPA 4OHCA 3WO1A 4TTQA 1A9TA 2Z58A 4E21A 5AVYA 3EDOA 3GFRA 4J3NA 3GLIE 1DXOA 1J0CA 1J2EA 3LC1O 4LCJA 4PSDA 5HDQA 1VKHA 4KOEC 3S4YA 2RGNA 4QDTA 1VE7A 3ILHA 1ESDA 3QP9A 3V3KA 4DGSA 3E9ZA 1MJGA 2O1EA 1K8RA 1G8MA 2WIDA 4F9GA 2CD9A 2D7JA 3PYLA 4B4OA 4OJNA 4CEIA 2XRYA 3C98A 1HDCA 3A1TA 4KODA 5CCEA 3RRYA 4RVUA 4W6ZA 2PVSA 4JXJA 2XVXA 1CXZA 1QH1B 1H42A 1FZTA 4OAOA 1W4RA 2C0PA 3N53A 4IH4A 2OO5C 3RIGA 3S55A 4RTNA 2CE2X 3C3JA 1Y48E 5M3BA 3CVOA 5EQDA 2CLKB 4FYHA 3AW8A 1ND6A 3W6UA 1O5TA 1S89A 3FROA 3FKQA 5MN5A 1RMTA 1WDMA 1P5ZB 3GCDA 4D46A 2QMOA 2A9QA 4MJXA 1JECA 4NU5A 1DBQA 1CW2B 1Q16A 1I30A 4CDRA 2IHKA 2CK3A 2R66A 2H0RA 2RGBA 2NVUA 3SX2A 2Q6VA 4MV3A 3GOHA 2WOJA 2LKCA 1G9TA 1QWOA 2I4TA 3V34A 1MT3A 3BIFA 4S0XA 4R6WA 4G1FA 1A9QA 3D3WB 1YONA 3EQ2A 3JALA 3MJEA 3OOSA 3TIIA 1RAAA 4F8YA 4M8IA 1TLFA 1DWPA 3U44B 4JOQA 1T9CA 3EDMA 3TBFA 2BUAA 1EVIA 2JD0A 1AJEA 1YXMA 4JFAA 4NEQA 4BV3A 3WTBA 5AVZA 4R40A 4YT4A 4U9IS 1RKUA 1JKFA 2VK4A 3BMCB 3L7OA 3NT5A 2P35A 4FX5A 3MD9A 4HH3C 4OQLA 4FB5A 2GKOA 3FGNA 1TA0A 3TL2A 3BDAA 4LJRA 4EW3A 1EFLA 1Q0QA 3RC7A 2HQSA 2FCRA 3G0BA 2OV3A 4RPCA 4C29A 4YHHB 1JLRA 1WQ1R 5AJUA 1TPZA 1J07A 3FNGA 4GBED 5EXTA 3AJ9A 2IUYA 2VTBB 3IURA 1Q0TA 4HJRA 4ZCIA 3WYDA 2JS7A 4TWBA 3WMRA 5E2IA 3DEFA 1AXRA 1RJ9B 1XLUA 1ZCBA 4N5NA 1XDDA 3AEZA 1CTQA 3HWWA 3ONWA 4Q7EA 4YUXA 2WMDA 2MCFA 3N8IA 2HA4A 1IZ8A 3T9CA 1H05A 5F35A 1DZIA 3ILVA 4F1WA 4HFRA 3Q9UA 3UGQA 4LX8A 3DD5A 4B8WA 4F97A 1LDGA 3O7WA 2VT6A 1P62B 3OURA 3SSNA 5KQSA 1DADA 3LVQE 4TL6A 4Q7QA 1LRJA 5BNFA 4H1WA 1K6XA 4RVSA 1YSCA 1R4ZA 3X0DA 4FBMA 1IXSB 1JQEA 4OBBA 5FPHA 5BOSA 2HHHB 2UU9B 1XB2A 2I3BA 5IUKC 3UPDA 4JU8A 1PJLA 3DPIA 4CM4A 1MUUA 3V55A 3COSA 5FR2A 1JG4A 3H3JA 3RVDA 3LT0A 2YBDA 1AZLA 3R7NA 2FMTA 1L4FA 3KSZO 4OYLA 2AS0A 2J0EA 3MQ4A 1FYXA 2WJVA 2NADA 4M0DA 4LPKA 2ZU6A 4RH1A 4J9VA 1L7VC 4LHXA 3SMQA 5E3IA 2O3QA 4EI2A 5LU9A 3THWB 2A9KA 4X8HA 1KI1A 5BO5A 3GZNB 2JGJA 2C94A 4REOA 1PJ2A 2BFWA 2O52A 4LOLA 4RLSA 1HURA 1UIMA 3HDGA 2H6EA 3VR2A 4II7A 3ZW9A 4JLAA 3ZCSA 4X65B 1JE1A 4PANA 4C30A 1ISGA 3A6KA 4M8SA 4YAEA 1YCDA 4B6RA 4DS3A 4OQNA 2XZPA 4C4XA 2AVNA 3NM5A 4FDTA 4QSMA 2GM9A 2QAIA 2W6CX 1RM5A 1Z0ZA 3H18A 1SCKA 3VMMA 4ALLA 5JXGA 2XVMA 4RMGA 4BIMA 3NXSA 4TL7A 3O94A 4AS3A 2QW1A 4OH7A 1MOSA 1ZM9A 1LPOA 3AB8A 4G84A 3UGTA 4CU5A 1HQCA 1ML4A 2AI2A 4FYVA 4MUAA 4D0LB 1CY7A 1NUUA 1PL7A 2BFEB 2NPOA 2OG2A 1NBOA 5A1TA 3QF4A 1DEOA 4J0GA 1QSGA 1GPJA 4NBVA 5EG5A 2PGLA 2Y1XA 4KXYA 3RVOA 3ZX4A 2IE8A 4AJOA 5LLDA 4RTJA 1NZJA 2GOYA 1OI2A 2C54A 1U1IA 6NULA 4CIBA 5EE0A 3JARA 2A92A 5HIMA 2AKYA 5CEFA 3VPXA 4OXNA 1BCSA 2WSYB 1I10A 3E3AA 4YRGA 4P4GA 4RX1A 1DC7A 3I8OA 3D43A 5D87A 3JAKA 4EDHA 1CZUA 4FN4A 3CNLA 2OA0A 1O5OA 3UWOA 3VR5A 2JIDA 4LK2A 4BFWA 3CMMA 2X0JA 2X19A 5E6SB 1TCBA 2AN9A 2J9GA 3K9HA 1O96B 4HYYA 3RYTC 2GPAA 2PKQO 3TINA 5I7EA 5KTOA 4D9KA 3L93A 1O2DA 4BPRA 4MGYR 3S8YA 5K0CA 3K70D 4YRJA 3ECSA 3GRUA 1WBBA 3ICEA 5B1EA 3EC7A 4I9UA 5E4FA 1LPMA 1I0IA 2H4JA 2N9UA 3A0UA 4W6QA 3GEGA 4C2UA 4JLPA 5REQB 2AR7A 3ETJA 1M2EA 3RARA 1JAZA 1ZYUA 4ITVA 3IQFA 4R0NA 4BWVA 5KOHB 4K88A 3CRVA 1PL6A 2XAUA 4GGMX 1QJ4A 1NC3A 2WUGA 3SLRA 4KPUA 4ZAFA 4QSHA 4Q4HA 3JQPA 3EEQA 1E0DA 1Q0LA 1QMGA 3DCNA 5DI9A 4MTCA 5IMBA 4XWWA 2FUG1 4G63A 4XEHA 3MCWA 3WS7A 4D8TA 3QKSB 3EZ6A 3TS1A 1UADA 3IFSA 4JSRA 3VC7A 4DADA 3E9DA 1FB5A 3WLSA 1X1BA 4MYSA 3WE7A 4F21A 2RJOA 2KE5A 4I3HA 3RRBA 1E1NA 1Q11A 4FNMA 3HO8A 3PUJA 4YT2A 1HZZC 2ZRJA 4I8IA 5FPTA 1FLNA 3CF4G 4S2EA 2Z08A 1E4VA 1HY3A 2JH8A 1R00A 4REMA 1PL0A 2FZCA 4WOBA 4YBRA 3SS9X 2J9FB 3K94A 5M2QA 4F04A 3FVQA 3OFVA 4J9UE 4C4ZA 3HXPA 3BC1A 1IG0A 3SYRA 2FU5C 4BLVA 1D0VA 1JNYA 4JFRA 5GJCA 1NMZA 3ZWOA 1GNTA 4J2OA 4KN6A 2VA9A 4Q3KA 2NU9A 1CEYA 2GEFA 4J75A 2WHXA 3LHKA 4E5YA 3AUYA 2DGDA 1JR3A 4UHKA 3PDWA 3ZU6A 3BK1A 2PXAA 5CXQA 3TW8B 1RXCA 1W4ZA 2QB5A 2YHUA 3ABZA 3ENKA 3GT0A 1N2OA 3RUAA 4JBLA 2CLIB 4B4UA 1DIHA 2WEKA 2XDYA 3UG7A 3ZOKA 2R8XA 5CFPA 5KI6A 2Q5HA 2ZWMA 3I30X 4L2IA 4NYMQ 1NAIA 4URYR 2X2FA 3QW2A 2V7BA 2OLKA 2YIJA 4QYIA 5K6AC 5C9ZA 3IAXA 1P91A 3L4BC 4JXZA 2XKBA 4YQZA 5LR6A 1N7HA 1QF9A 1W76A 4UARA 1JAHA 5CTAA 4PC7A 2H2FA 2GN6A 2IPNA 4D02A 2WAMA 1M1XB 2PT9A 1QHIA 4RCYA 1TEZA 1NJFA 1IHPA 2GF2A 3BD8A 4IIHA 2OC9A 5CA0A 1R0KA 4A6DA 1ONPA 4Y98A 4H15A 1TO1E 9LDTA 2ODPA 5IT5A 2I67A 2P7IA 4INAA 4LGMA 3UHFA 2D1TA 2YUIA 3ITDA 4E1AA 8OHMA 2NSJA 1W49A 4HDRA 3SAJA 1IHYA 4J0HA 3OZFA 1LDEA 2OCLA 2QNIA 2OY0A 3CY6A 4JJIA 4YA6A 4YJ2F 3UFBA 3B52X 4F96A 5ABPA 1U9IA 3OCXA 4OX9B 2P9ZA 1P1IA 1XD8A 1IE3A 1UKYA 2AD1A 2OV8A 2X3YA 3ESCA 4JP1A 2XE8A 1NN5A 1NZFA 4QQ8A 3U3MA 1JG3A 1AO3A 3S1AA 1LY1A 5JYDA 1CVIA 3IXLA 4YPOA 3COZA 1EHCA 5LLTA 5JXIA 4X60A 1GPKA 1YZLA 4QULA 1L1FA 3SY8A 3U49A 5JO0A 4KGZA 2HGZA 3GCZA 6REQA 1Q0ZA 4P4TA 5KNBA 2P4QA 1ZOLA 1P0QA 5DU2A 2GAJA 4I1YA 2QLMA 1PSDA 1WD5A 2D2XA 2Q2QA 3PVSA 5AO9A 3LP5A 5A06A 3VH4A 2YWHA 4MVWA 2ZAIA 4Q47A 3GBSA 1M2OA 1YBHA 5DLPA 4QJ5A 5KOJB 2YMMA 3SX0A 3WGTA 2WKSA 5J2TB 4KPEC 3L77A 5LL6P 2Q4RA 4XB6B 2H1OA 1ESCA 2IZOA 5CNMA 1L5HB 3WZLA 2ZE7A 2XTNA 4RK0A 1NXWA 4G0OA 1PR0A 4MKZA 1J8QA 3RC2A 3NG1A 5JISA 1Z08A 3FFTA 4RV5A 3WZMA 3L8GA 5LQAA 1F48A 1G20A 2ET6A 1M34E 1YUBA 3WI7A 3WC4A 2NP7A 1NQAO 1QE3A 5J2TF 4G1MB 1B8OA 3PZRA 2JAPA 4I5FA 5LNK1 2QPAA 4FGKA 2QTVA 2IYQA 2Y0PA 3DL0A 3HI6A 4QXRA 3T5GA 5KWIA 1V16A 2D1RA 4AP6A 2CMHA 2I7TA 1DTSA 1COWA 2MYPA 3M1YA 2RI6A 1MABA 4ZQEA 5B4TA 3FOWA 2JVKA 2XHZA 2OBMA 2GESA 1OIWA 1TOAA 2YWFA 4QQKA 4AC9A 3VNBA 5LYYA 2IF0A 2RH5A 1B3RA 1WOMA 5I7UA 2QVYX 4XARA 3EVGA 4Q4CA 1RWQA 5IT4A 3W7AA 5C46F 1ETUA 2X8WA 2H3EA 1JP7A 3V7WA 5IF9A 3WYGA 3VHXB 2FV8A 3K1AB 3RAPR 5BPFA 5HF6A 4CETA 3OUTA 1GTVA 1L2TA 1XQ6A 1PGPA 2RDMA 1F5SA 3B60A 3PUYA 3KAJA 3Q1LA 4JSYA 2CF6A 3B36A 3QPCA 4MAFA 4R8SA 3SG0A 1MZVA 5GMOA 3FTFA 4UDYX 3EGCA 3K4PA 1YCGA 3NBMA 1N6IA 1TYEB 3SXPA 1KYVA 1IN8A 5A2GA 4JQCA 4JJEA 4NESA 3EMBA 4MQUA 1TVKB 5BNIA 1QC5A 1OLUA 4Q03A 4YACA 3PHGA 1JQLB 5B6PA 2ZYWX 3K6KA 1IM2A 1LVGA 4V0QA 2HCJB 2VSNA 1OYVA 2X9VA 3D59A 4LSWA 3B1KA 3H19A 1FDRA 4JQOA 5AHXA 4YR9A 2FZ5A 2QUHA 1WETA 2YJ3A 3DVLA 5CW2A 3T99A 4ARSA 2AIRA 4O3MA 2H1CA 2W2KB 1V1MB 3PR1A 3KX2A 3ASYA 4IJUA 4OHUA 2CYAA 4TMXA 4ZT2A 1RQNA 1RZRA 1NNEA 1D0IA 2I78A 4R4JA 2H52A 1VKNA 4MUEA 1TAUA 1FMJA 3HCOA 4A23A 4ID9A 1N5IA 3G79A 3QMVA 3IBTA 4U1RA 1IOZA 5BSWA 4H7HA 1QQ7A 1JLLA 5L95A 1M6HA 1P80A 2B7CA 3LYUA 2GARA 1R4AA 4R1MA 1FFBA 1Y3HA 1RQXA 1OILA 3AESB 1RC0A 4POOA 1ORWA 2O5VA 3ZNOA 4KXVA 1IATA 4JYMA 3V4OA 2I7DA 1HQDA 5U1PA 3DVAB 1RPJA 3GYBA 4KRFA 2OGUA 5IX8A 5IAGA 3CUSA 5IULC 4DV0B 4AUEA 4IUYA 1E1RA 2NV6A 5CLIA 2G3YA 4B6JA 2GJSA 1V39A 3LCRA 4KAXA 3BMNB 4MP6A 1TM3E 4E51A 2RGEA 4OYYA 2EL7A 2WMYA 2H1VA 5A3VA 4D96A 2B8NA 4E2ZA 1PWXA 1KPHA 4MYCA 5D1NA 1PZEA 1XZKA 2PGDA 3GLTA 3QXHA 4QD3A 4WBXC 3U4HA 5ILOA 3IAHA 5DCLA 3CB2A 2YVUA 4A0HA 4X8LA 1N9GB 1E99A 3PK0A 2BFMA 1NW4A 2H51A 2V4MA 1KETA 2JFYA 2YFYA 3MJVA 4KE6A 3SKYA 2BGGA 1FRFS 5JSZA 4LDAA 4RNCA 4WOKA 3K0HA 4WRRA 4AKGA 1JSXA 1HX7A 1H6DA 2ZXUA 3F46A 3HFGA 1B76A 5CDUA 3MMPA 2VSFA 5ALUA 2IWRA 3VRHA 1MC4A 2NYVA 4FTWA 4EHJA 5HKKD 1XHFA 3U0BA 1QTIA 2YH2A 2R6R1 2HCTA 3IMKA 4I9GA 4QGAA 1LJ8A 4D4JA 1HL3A 4B79A 2BMJA 4YXWA 4B40A 1CK4A 1JEYB 3QNMA 4IIUA 3R7SA 5AK5A 2ZRDA 3AIIA 4CR8A 1LA2A 2WD7B 4Y1EA 3SXJA 1M72A 3IQHX 3TO5A 3CZ9A 1ICEA 2H4FA 3ORYA 3L7IA 4FBGA 4LSGA 5FBQB 4CMEA 1E77A 3A6GA 4ZGGA 5J58A 2FVXA 1NJ2A 4MYDA 3HS3A 3KOMA 3W4IA 2ZVPX 5TR9A 3ZY6A 1U31A 4YMIA 4H59A 1XCMA 3RVSA 2WABA 3DBHB 3EEBA 3IB6A 3N6VA 1K98A 3GPDG 5A5EA 4DSUA 3GLGE 1VCNA 3HLTA 5EJMA 4MLCA 3PC8A 4R9UC 1FQOA 2Z2YA 1X9IA 3FLMA 4E2WA 2Y92A 4R0VA 4XB2A 2VKQA 1EK1A 1FVHA 4FFLA 2IY7A 4DMGA 3A9VA 1B0UA 4TYQA 3LY8A 2ZITA 1E1QA 1XZHA 1RHJA 3PD0A 4LRUA 4R7GA 4QUDA 3TIFA 5ICMA 2G9UA 2F1JA 4EPRA 3NI2A 3E7DA 4X85A 4ABYA 4ZICA 4B82A 4EY6A 3DDWA 2BMEA 4M0FA 3FCUB 3PITA 1DOZA 4NICA 1FU8A 4KHZA 4HZUA 1K7XB 1N8TA 4P9NA 2JA1A 1W5EA 2QVGA 4EZEA 2H9IA 3FJYA 4PY2A 5K3AA 4EO9A 1CYEA 5J4YA 1H2EA 3NHWA 1VHQA 4M8NE 2NZUG 2RGWA 1DC6A 3WGMA 1CUAA 1O97D 3B9PA 4WL0A 2Q5QA 3G9TA 3I4LA 4W7HA 4YMLA 4TVBA 1ECCA 2PRZA 2WG0A 4FMPA 4CLHA 2Q1YA 2VT3A 4C5AA 1O4VA 2P8SA 2PZKA 4KE7A 4RJJA 2EBWA 1ZWKA 3IQGX 4FMDB 5LQUA 4R7ZA 2C2BA 1QANA 4AFNA 3U5TA 3ZE1B 2RHRA 3PFKA 3QWHA 1I3KA 1SM4A 1UL1X 2WZDA 2X7XA 5I7VA 2Q8QA 3OEYA 1OX4B 1E3WA 1NN0A 3WLQA 2XGOA 2RGNC 3PL1A 3GZ4A 3STVA 5HHTA 4YMGA 4C4YA 2C9BA 3EQ8A 4KFSA 3WJAA 1JQDA 2QBYB 3MWKA 5FAXA 5DHPA 4Y1RB 1QG6A 3NWBA 3CLTC 4U3JA 3SQNA 2J31A 2CJWB 3AF1A 4Y1FA 2NU8A 5C81A 1QVRA 1H1DA 2BGUA 2V58A 2EX4A 4GDMA 3RWBA 4BATA 4D82A 4UCQA 3M5WA 3V4PB 5JOQA 4BFTA 2VQEB 1WE2A 2A5JA 2BBOA 2DX7A 4UE6A 2G6BA 5TF4A 4AP5A 1Y3AA 3EISA 1B6GA 4XB1A 1TZKA 4UUQA 3O91A 4ZTBA 1FX1A 2AG1A 1OZFA 3KJGA 5DKFA 4A16A 2WTXA 3K0EA 1KPIA 3VJLA 1SH7A 4NFHA 5LYJB 1DKPA 3SQXA 2DUMA 5L7YA 3RT9A 4LFCB 5KSOA 1SIBE 3OCZA 1R0RE 4MKHA 3VXKA 4UM5A 1G42A 5F2KA 1W8IA 1W73A 4JASB 4Q00A 3RYHA 3TCNA 2BL4A 4EM6A 4CU2A 5JJLA 3SFTA 1W6RA 5KNDH 2H00A 2PYZA 3LYHA 4YCAA 3KQHA 1CD5A 1YMVA 4LNAA 3GFTA 1QUFA 2JIOA 3VU3A 1XVLA 2XUJA 4YLGA 4JC5A 1DLIA 1GSOA 3BD7A 1JFLA 4F4FA 1Q21A 2WHPA 3AJDA 1BMFD 4M76B 1S9DA 4LGCA 1LPSA 5LQKA 1LTHR 2WV7A 3SZUA 2VUSA 4JLVA 1KO7A 3AJEA 1HI9A 3NVAA 2QV0A 2J09A 1SCUB 3IEUA 2WU1A 3KEFA 4AJEA 4WECA 4JY7A 3UWMA 5FO1A 4NDAA 4F9FA 2VJBA 3PA6A 2R751 5JW6A 1G8FA 3ND6A 4OTZA 4P5PA 1JJ7A 1OZGA 3HCNA 2PX5A 2Y05A 1DPFA 1QQ5A 1WSAA 3MLBA 1F2TA 5IVDA 5JZOA 1JE0A 1XU4A 4L6AA 1C3XA 1I13A 1T13A 1VTKA 1Z5NA 4N6OA 4OD0A 4F4DA 1WMAA 4ZEMA 4F7DA 2DHCA 2ORED 4OSPA 3TQRA 1XNHA 5BMOA 1CR1A 1YI1A 2ZJ5A 4Q7JB 5BSHA 3DAOA 5ERXA 1M33A 1BEEA 4D5GA 1QF6A 5J4VA 4ND7A 2P68A 1T0HB 4RIFA 5F21A 2FK8A 3SQOA 5B4UA 1NYTA 1JG6A 1NVAA 4XWTA 3EBOA 5HTKA 1KTIA 3K72B 2VSQA 5ARCA 2H07A 1IB6A 4FVTA 4ZAYA 4W5TA 1ZL2A 1LX6A 2BRUA 1XRSB 2IU4A 3HJCA 4MWBA 1FFSA 1W75A 3VVBA 4PAGA 2ZCJA 4FOPA 3KEMA 2VP3A 1JEQA 3EMKA 1OTHA 5DYIA 1DV1A 3FETA 3J7TA 4ZCQA 3U80A 1K08A 3UJ8A 4A3SA 1N36B 3HO1A 5KQRA 5DYTA 3F74A 3O21A 3QE3A 4FU0A 5B64A 5KTPA 2WMNB 2FQXA 2AG6A 4KLRA 4DSZA 3ZX5A 4QLOA 2NXWA 4CMCA 1E98A 4LRYA 2LDBA 3H16A 4KDCA 4LJYA 1ACJA 2GZSA 1S9HA 2WNHA 2LVBA 5TPZA 4R05A 2HQOA 1SXJB 3P0IA 4ZZ2A 4OUDB 3RB8A 3L7JA 3IQDB 3EAFA 4EB8A 1M7HA 3KNZA 2XCLA 1OFHA 5KO2A 2O0LA 3FF4A 2Q5IA 4HXFB 4AYXA 1ZNQO 1HF3A 2G09A 2QUAA 3CJQA 3ME5A 4I9NA 4UUNA 1II8B 4AMVA 1PAUA 2C07A 3LS2A 4GKKB 4ON9A 3I32A 3T7KA 3VNUA 3OE5A 5THXA 4URZR 4HNVA 2ZIUB 3DC2A 1J9EA 3WQBA 5HWSA 3MB5A 3NB0A 2WYWA 3UNXA 1OB2A 1I6LA 1Z83A 1A72A 2W5UA 1Q14A 1WZ2A 2V98A 3I9KA 3UN1A 3WWPA 2CLCX 4WTOA 1NW3A 2DFKB 3OZBA 1DX4A 5GY7A 1KVSA 2YDYA 3WK6A 3P0FA 1U7OA 3L7NA 8ATCA 4U2KA 3ZTWA 1N7JA 4MIEA 2C3PA 1H5NA 1L5WA 4PC3A 1XQYA 3EJ6A 5FA6A 4FFDA 1Z28A 5HJ7A 2M9MA 5KHOC 2OFWA 3QKUA 4P53A 3OJLA 3GRVA 4WOCA 1FIUA 1LRKA 5AM2A 3QWAA 2WHRA 3RC1A 2GJ9A 1H3NA 1GKYA 4Y6QA 5EAIA 4A8TA 1QE5A 3GJ5A 4I6JA 5C1DA 3RANA 1J2JA 3ID6C 4O2LA 3OIUA 3JQAA 4DQXA 3HWRA 2ZUTA 4MHOA 5K3BA 2DWOA 4M2LA 4I08A 3EQ6A 1UFVA 4CM8A 1QNFA 3P5SA 4IIFA 4ZQIA 2P6NA 3LPCA 3R3VA 4NFYA 3WNCA 3ZDBA 2UZ1A 2RHDA 2HA5A 2ZJ2A 3NV9A 4I55A 1H2XA 4IH1A 5HCUA 1FXSA 3BJRA 3STTA 1KAEA 3ABQB 3AX6A 1C0IA 1K3FA 1MB0A 2C9DA 2WBLC 3K7EA 1PDOA 2LP4Y 3KOUA 3CE9A 2FWIA 4N7BA 3DD1A 4QUGA 4WKGA 1NM5A 4RA6A 5FQNA 4FKBA 5D1HA 3BGIA 2VQDA 3K0FA 1T2UA 1A1SA 3IQIX 3RV3A 4QXMA 4ALIA 1QM5A 1JUDA 1K3TA 3OCUA 5DTEA 4YP0A 4YX9A 4E12A 5EJ6A 2R87A 3LUBA 3L0OA 1ULZA 1EBFA 2P69A 2CBXA 4PC6A 3ZCPA 2XXAA 2IS4A 5CDTA 4UE3S 2MMCA 3JQCA 2GF9A 1K8YB 4JKOA 1P81A 2QRMA 3LRPA 2HF8A 1VB5A 3G2PA 4J2TA 4M83A 3OLVA 3QBVA 5ISMA 3E3OA 1OAKA 3DC7A 5LOVB 1N5KA 4HDNA 4JJ6A 3WLTA 1DC8A 4DSTA 3K53A 4EFKA 1EUDB 4IRMA 4TZ0A 2YVQA 1UF9A 3D0RA 1MO5A 2VN8A 2ZG6A 1V0JA 1H5QA 1EFVA 1F2VA 3LKBA 4LDNA 3TD6A 3A32A 2QTGA 3WL3A 4P3KA 4D9MA 4IDFA 5HW0A 1U5BB 5MN6A 2IS6A 1DZ3A 2HLNA 4HH1A 4ZGWA 5DBHX 1JPVA 4NATA 3X1ZA 3I2GA 3NAZA 3WGOA 1T34A 3DDNA 1HFEL 1CY6A 3ZK9A 4GI7A 5KIAA 5L53A 3DAHA 3OPYI 2RHBA 4I19A 2EEZA 3CWCA 3VYRB 5JJ5A 3NW9A 721PA 1NX6A 1ODIA 4AJPA 1LC3A 2GUWA 4PLHA 2WZQA 2C7VA 1L4LA 4X66B 4QPCA 3UYKA 3NIBA 4PLZA 3E81A 3E2MA 1PQYA 3UJDA 5AW7A 3R5FA 2IQIA 1UJBA 2OP1A 3EZXA 5DM1A 4CR7A 1UWKA 3AUXA 3BE5A 3IP9A 3L43A 4L22A 2L18A 3HWX1 4DWOA 1DFHA 1LPAB 2RHWA 5BV2P 3K32A 4PHGA 4TWIA 3T0FA 5LCXA 3SR0A 4MR7A 1BDBA 1FNMA 2W11A 2VRCA 4WJKB 4GWLA 2HRRA 3WSWA 1H0RA 1KC3A 1S7GA 1XRLA 3NTOA 1E9DA 2F8MA 1TYZA 1HDGO 1B3BA 2IOFA 1XRPA 1EFUA 2P40A 4QA9A 1HH4A 5FI0B 4BUJA 3ZYCA 1FE8A 1Z8NA 5CB0A 3D9QX 4NU8X 4ESVA 3WL5A 3KSAC 1RJGA 2JEYA 2FLWA 4R83A 1XEWY 3KIPA 1GSIA 2DWUA 1N6KA 1YVDA 1NRIA 5LB4A 1BKYA 3ESXA 4BO7A 3Q8KA 6AT1A 1N5MA 1V4BA 4F3TA 2RH4A 2XWBF 5IU6A 1M6VB 3HHEA 4CM5A 1Z5VA 4PW0A 5ED4A 2AZ4A 2QUIA 1NI4B 2AOTA 1L4EA 4GP7A 4N8EA 3LBIA 4KVGA 1G63A 4X3CA 4UUMA 3W8EA 4L78A 1URPA 4YTEA 5EP3A 3MS7A 1TUIA 2CNNA 4K05A 1CHDA 2VP5A 2JDIA 2ST1A 1VSQA 2FPIA 4FMCF 4MQ4A 4NY1A 4ARVA 4ETMA 1I2ZA 3CSSA 4WESA 3UXEA 4BAZA 2FWBA 4N40A 4ARIA 4XGIA 3FPLA 1YOVB 3NGMA 3TB6A 4GPAA 1CIJA 2G9RA 1UJCA 4OREX 2J5BA 1U9IC 3IP6A 2CWDA 2JCVA 3ZQKA 4DV1B 4BNGA 1IXRC 1NKTA 4ZT7A 1CRWG 4LI0A 1ADJA 2HHJA 5MGBA 2FB9A 4HMOA 2GEJA 4H60A 3WISA 4DLWA 3G7NA 4M38A 4US0R 3STWA 5EMNA 2X1VA 3BE6A 2RH8A 2IZ5A 1E5XA 4ENVA 3DF9A 1NBME 2O14A 2W2OA 4R1UA 4DR3B 4WX2B 5LKAA 3U5ZB 4PLTA 1A27A 5CYPA 1BRTA 1VL2A 3KZXA 2X4IA 3PC4A 2D13A 1XEXA 2VP4A 4Z0HO 1ZD5A 2CDNA 1G8SA 5CXXA 2C59A 2AJDA 3V8BA 5LQMA 4A0QA 4WNCA 1YVEI 2VAMA 2O2EA 1TZMA 3L8YA 4LSMA 4EF5A 2B0JA 4RTMA 3TUJC 2XVAA 1SQFA 1D6NA 4AG5A 3LYAA 2MDTA 3VO1A 1EJ0A 1O5IA 2BF7A 5AOCA 3RVKA 2WKWA 3UMSA 1CUBA 1OBFO 3M6MD 2JAXA 3TSWA 1M74A 4ZODA 3EDRA 1Z2OX 3PC6A 2BBWA 1KU0A 3FIJA 3GYGA 1HOXA 2ZYDA 2ZKLA 4JA2A 4KHPB 4ZAXA 1CS4C 1QYCA 4RANA 3ROQA 3UC9A 2W43A 3DV9A 3KD2A 4OB8A 3FPAA 1V5WA 4MQ5A 1NIPA 1WHTA 1TIBA 4J07A 4MP8A 4MROA 5KC9A 3NYRA 4FPXA 3VPDA 2IW3A 4DEVA 1UT6A 1K86A 4IUBS 4MWTA 3FB4A 3LV8A 1U0NA 3E2IA 3IKJA 5GZ3A 4R5HA 4O2BB 4OJKA 1X1RA 3FYUA 1DB3A 3VHQA 2OB1A 3DTVA 4I1PA 4Q4LA 4ZVOA 4LMAA 5H16A 3VYSB 3PXGA 3DZBA 5F78A 2F9FA 1PK7A 1D09A 4GM0A 2GAIA 1SUEA 1G5PA 2QWXA 4R2LA 2ODNA 3NGLA 4EL5A 4DHWA 3A6LA 5ADHA 2B3TA 4K9MA 5TLSA 1QHYA 2QG4A 3OZRA 4H3HB 1IEVA 1EFRA 1N3IA 3LWZA 5K4HA 4O2BF 2HWUA 5TQ2A 2HDNB 2YFKA 3RBAA 1UODA 4WPGA 4BBAA 2EZ4A 4RSMA 3KE8A 3HKCA 3MUNA 4BO1A 1H6AA 3F6PA 2XMSA 3GAFA 3AHCA 4IJ6A 5I7SA 2I2FA 4FNOA 3N0RA 4WK2B 2QXYA 4GKJB 9LDBA 2J4DA 3BK7A 4IFBA 4DYHA 1QOZA 4TVKA 1Z4MA 4IDNA 4L4XA 3R3XA 2P4UA 2FEOA 4WK0B 1SGWA 4TWRA 4UEJA 3FCYA 3DHYA 2BKEA 2YZ2A 4NMXB 5T5QA 2HMWA 5BR4A 2FEKA 3PR2B 2F90A 3I5YA 2PBFA 5T64A 2GLTA 3C1TA 4EW2A 4CMGA 2ZBFA 2VHVA 3GGDA 3H2IA 5IBRA 3V4VB 1GPDG 3WGHA 5BNWA 1L0BA 3DAYA 2XKJE 1KMQA 4QDXA 5CURA 3LL7A 4AWAA 2JIZD 4G5GA 3N07A 3RJ5A 3ZJ4A 1MB9A 1P5JA 1NVFA 5HF5A 4LDPA 5HS4A 4Y2PA 3IOYA 3MM4A 2NZYA 2OYCA 3RJTA 2PIAA 3NHRA 3RVPA 3T0IA 2FOXA 3RVQA 4EJ6A 3QMWA 4W63A 3GJ4A 1VPEA 3KT8A 3WLLA 4H3KB 1BHSA 1K8XB 4ZZIA 4P54A 3VR1A 4UC0A 3FUUA 5CDYA 1CY0A 5LIRA 1RCUA 1JWLA 1Q0UA 2NQ2C 1FX0A 3GA5A 4HQ6A 1UBRS 4HAYA 1GTMA 4O2AA 1HE2A 5H4HA 4BE4A 4D3SA 2V3CC 5G1PA 4ZDIA 3FCAA 3WJ2A 2TRSB 3TUIC 3HVHA 4YJ3A 4Z51A 1ZJZA 1BSVA 4HQRA 1VI2A 4ZJYA 1ZX1A 4S2UA 5BV8A 2PD3A 2ZUDA 3NYWA 4DDVA 4CIYA 1F5NA 1Y1SA 2P9CA 4B3GA 2IUSA 3OUUA 1AK2A 4P5EA 1XSEA 3SIRA 4W8HA 4BE7B 5TV2A 1E9BA 1EWVA 4OY3A 1VCMA 3H05A 4LVCA 4MPJA 4O4LA 4EFMA 3GFVA 2LTAA 1UMKA 1EWTA 3SMVA 3V7FA 4JWTA 4TKUA 3EG9B 4JJFA 5GONB 4CTKA 4KCGA 1KH3A 2R1TA 2TYSB 3H8WA 4DE5A 2NUPA 2FF7A 4GKVA 3SLGA 4KR7A 1MX3A 4QJBA 2D5CA 3I8XA 2QRNA 4L0CA 3RG2A 3ZY5A 1T2VA 3GIWA 2Z5VA 3VTZA 2G04A 1E5QA 1O6ZA 1E64A 1OBOA 1V8BA 4R1SA 3EXFA 5AXBA 1ISHA 2GA9A 3KZNA 3MIIA 4YUVA 2F67A 2DTXA 2JLAA 1T91A 3TPFA 5C18A 1ODTC 3FOEC 1FU7A 1TEXA 3SF0A 3ACBA 2OFXA 3GCGA 1Z39A 3UUWA 2AEEA 4RHCA 3ZV7A 2AZMA 2J3JA 2D2EA 5C7LO 2JFVA 4G1UC 4K6MA 2IEAA 3NOOA 5J9FA 1JPUA 2JGAA 3M5PA 4TYMA 4C0KA 3IBFA 4V2IA 2ERXA 2O8FB 3P2KA 1ZR2A 4BLOA 2WFZA 4TZKA 4XJVA 3URMA 4WCFB 4CMEC 2D0IA 4IY1A 2I8CA 1P75A 2GZ2A 1IIBA 3IVXA 3P2YA 1Z6AA 4BRUA 4B3TB 2DM6A 2ZIVB 1T1RA 3NDIA 3FJ1A 4MZDA 5FPPA 3TI7A 2OECA 4PQEA 4XFJA 1WNFA 2R44A 4MIKA 4S1VA 3UAZA 2RFLA 5K8UA 1VI5A 3FTNA 4M87A 4MO2A 1P6XA 1KJJA 4A5SA 1XMIA 2C29D 3HQ4O 3HYNA 4OBEA 3SR4A 4LF4B 1CS0A 4JOBA 3TZBA 2MSCB 2X4GA 5IAJA 5DXFA 2VPQA 3PC8C 3G1TA 1EZ1A 2JCXA 4UZFA 4WY2A 4XYMA 4XPIB 1ECGA 3BGSA 1JT2A 3BGOS 2HT1A 5GOTA 1AGYA 2PZJA 3CPJB 3AM4A 4WNIA 5EUCA 1CUVA 3CSDA 3KAQA 4G85A 3WHIA 3ZIAD 1CUFA 2E48A 2BIFA 2O6LA 4S24A 4CEIB 3F90A 1TZBA 3N05A 3LCCA 4L8FA 4MS1A 4KKXB 4G4JA 4EG6A 2J5RA 5SZIA 3ZTTA 1U8YA 4JBHA 1VHTA 5GZ1A 1AGXA 1QCYA 3MCZA 1R8JA 3A1EA 3H2KA 4KITB 2ODQA 3DE4X 3TR6A 1IZZA 3OLCX 4PRYA 3MWJA 2BGJA 3O9VA 2HB6A 4LZZA 4CBVA 1K2WA 1AY0A 4OHKA 4RLFA 1RFLA 4RTLA 2J46A 1OAOA 2X5KO 3I2FA 2JB9A 1PR4A 3VPCA 5K45A 5DYYA 2YMLA 2IUFA 2JAQA 1R9GA 3ESZA 3D6NB 3R3UA 5L40A 2ANBA 5F1YA 4RXTA 4JB3A 4AULA 1AKTA 3DSRA 2FQQA 4FYMA 3ZCUA 2XXJA 5BNZA 4BMXA 3O84A 1T3TA 1FUUA 3Q3HA 5KKCA 2OCBA 4HVTA 3PHCA 1M7BA 2QHXA 3TJZA 3JVVA 3REFA 4YRZA 3ISTA 1FMCA 3UA3A 2BZSA 5BMVA 3JALB 3KWLA 2R5WA 3V4LA 3TLGB 3MZ0A 4PBSA 1EEHA 4MMZB 4QTUB 2J5QA 3SBXA 2WU3A 1JHOA 1N3YA 3ZV3A 1J7KA 1E7WA 5K03A 4TYYA 4M1MA 4EY3A 1WEKA 2FPLA 2Z04A 3LSTA 2BBSA 4NOJA 2X4LA 3L6BA 1R5NA 3V6LA 3A2NA 1M2NA 1A7JA 3PR3A 5CEEA 4C7OA 1RSZA 4OHWA 1KDZA 2EFCB 4QVIA 4NJEB 4TTPA 4C7XA 4JR2A 4H4DA 1BDHA 3QIAA 4O4IB 2YQ5A 2ZSBA 1RKQA 4P7FA 3BH7A 3G1UA 2K87A 2IP4A 3G2OA 3G9ZA 3L6EA 4L4UA 4Q05A 2F59A 3GGPA 3OMLA 4F4IA 2GEUA 4A1OA 1W46A 2WG1A 5FH9A 4O8CA 4QUBA 4P36A 2Z6AA 1LRLA 2O2GA 1WPXA 4IOJA 5A4FS 1YBMA 2NPFA 4NWIA 3INYA 2AOUA 2G77B 4JLNA 4EI8A 1J70A 1W36B 4G5YA 2VXBA 4RFLA 2ZRNA 3UB4A 4E3WA 1IPHA 4M89A 4ADSG 4E5MA 2JBWA 2XA1A 2C2ZA 2E18A 1KDPA 1ZJJA 2BELA 1IY2A 3ZDAA 1X8XA 4KI7A 3A1VA 3FDJA 3O8OB 1B74A 1WUIS 2R79A 5BOSB 2XMCA 5CG2A 1X7HA 2FH5B 4M4SA 1R5JA 3AF4A 2Y71A 4LWOA 4MMXB 4Q3BA 4XFKA 1X7ZB 8GPBA 1KZ6A 3TL6A 5K6TA 3MWEB 1VXRA 2FKAA 4RQAA 5AWFC 5ELXA 2UYQA 4J2HA 5ESXA 3VHLB 4JLJA 3H5AA 2P6OA 4JR1A 2KPOA 4NYMR 4TVOA 2VCYA 4Z7JA 2P2CA 2PMCA 4LZAA 1PSWA 2NWQA 4NOLA 4PV7A 1WQ3A 4DV6B 3ZNNA 4IXMA 5DE3A 1M75A 4GM4A 4ZU6X 5FTLA 4P0QB 1FNSA 2VWHA 1SKAA 2JZCA 2HZ7A 4HGQA 2PYDA 1CJTC 1OV4A 5IXYA 3D6UA 4A8JB 4MR9A 3X43A 1QPZA 4ZQFA 5C8ZA 2WJWA 1KJWA 1HPLA 3AL3A 2ATCA 3C7AA 4D99A 4TUYA 3PD1A 1FMTA 1I3MA 4EH1A 3TLZA 1YTUA 4KREA 1RIFA 5F73A 2BRUC 2IP2A 2RKOA 5FFFA 2GHQA 3WGJA 2YXPX 1W9HA 1QV9A 1YDGA 4Q37A 5AKGA 1XU9A 2QMEA 1PYOA 4M60A 4L5CA 4O25A 4W1SA 4NYJQ 3FB1A 1I0LA 3UUEA 3ONVA 3ITEA 4NX2A 1L5LA 1V7ZA 1EWYA 2C95A 1OLXA 1JPNA 3OEWA 2Z5FA 4WFQA 5INTA 3ZWPA 1QG0A 4AUMA 3IPCA 3PX2A 3VZCA 5JNRA 2IXEA 2XOEA 1RYBA 4IDHA 1IH8A 2JFXA 2WT9A 4F2GA 1BCSB 1FFEA 1ST2A 2GPWA 3RH0A 1GKIA 5CA1B 1XEFA 1E60A 4V1CA 3GVCA 4MA4A 4X97A 4Q3OA 3TM5A 4EPYA 2Z4SA 3OVMA 4TYPA 2QRVB 3UA4A 1D9XA 3ZWMA 4CJXA 3VKHA 1PFWA 1H22A 2QMYA 3VC3A 1Z34A 3VR4D 5AJTA 1S1CA 3KDAA 3W5JA 4RK5A 3R9XB 1UQRA 1M9NA 2PR7A 2M1XA 2J0QA 2B1RA 1T4MA 3BIXA 5GGXA 5HBGA 3RK4A 3B1WA 1X80A 3ZZMA 4HAZA 5DP2A 5BR1A 1F8YA 1WVGA 2OMEA 1JL3A 2Y6VA 1CZRA 3DZJA 4MQLA 1SCDA 4E5UA 1X2EA 4M3NA 2XQIA 2JLXA 1T1IA 4C14A 1WBDA 2ZSDA 3ABSB 4H27A 4E2YA 3O82A 1BE6A 4K46A 4BB9A 4NK5A 2HQ1A 1Q7RA 4KPUB 2CV1A 4EB6A 3QF7A 3S2UA 2ZETA 4NZ9A 1GPLA 2ZUWA 1TT5A 1E9EA 2HSEA 4IYRA 3Q98A 1W581 4QT4A 2BI8A 1VPLA 1BMQA 4BASA 5EE3A 1H65A 1XU7A 2HXYA 1U9ZA 4KQEA 5AH0A 3KSDO 3QM1A 4GC5A 2RGXA 3TR0A 3B6MA 4MGZR 2XW6A 4HNSA 4YWHA 3A3KA 1LV8A 2W22A 4IW3B 4PO3X 4YCDA 3TX6A 2YWXA 1M1UA 2R6ZA 3GAMA 1I6KA 2Q0HA 5F98A 1L3BA 1NM5C 2AFRA 2AJBA 2JK1A 2V6JA 3C3BA 5ENVA 2PX2A 4E6EA 5AM3A 2PANA 2EOAA 5D51S 3MJ4A 2J41A 3EIUA 1T0UA 3DVQX 4REQA 4BL5A 2NUTB 2YYZA 3BMXA 5LBIA 4KP7A 1TQ4A 1GA4A 2IUTA 1DX6A 3QSYA 1SKBA 1EQAA 1C1XB 2JJMA 4MUYA 3NP7A 2FPMA 1AQ6A 3IT3A 4FW8A 1GR1A 4PYOA 3ZKWB 4M7RA 4DMMA 4YJGA 1NXQA 1SCQA 1NUTA 1YR6A 2G08A 3TIVA 2EKBA 5IDQA 1DDIA 1HDRA 2J0UA 1G8YA 1U9CA 3BAZA 1WV1A 1GCUA 3DW1X 4U00A 1RLMA 2J3IA 4YMWA 4ZARA 5KYWB 3T3PB 4BUCA 4CKEA 2IYVA 4RTPA 3W6PA 4EUSA 2YWCA 2CCJA 2XOXA 2I3AA 2HUNA 2XY4A 1QG4A 2VDNB 2ADOA 4QPDA 1F7UA 4P6VF 5A3RA 2L2QA 2WVHA 4G1CA 4G4IA 1J00A 4G41A 1PJBA 4PC2A 3WMGA 4E7PA 4ZYLA 4R68A 1DINA 1LTQA 3LW8A 3SE7A 3JWHA 5A9SB 4OGKA 2A1TS 2ZUBA 4H7IA 1WCYA 2DAPA 3HJUA 3LO5A 1YE8A 2X3FA 4JLMA 3VNSA 1IXKA 3OCYA 3QA9A 3QVMA 2I7VA 2HMVA 4GZ6A 4ZVVA 4UTOA 1P73A 1JU3A 1AXEA 4Q4JB 1USUA 2LCFA 3FNFA 3QHQA 3EZ2A 2A9JA 1LQUA 2G9ZA 3ELYA 1GADO 4I50B 4KPGA 1NI5A 2PGIA 1G6KA 1OI7A 3GNSA 2XITA 1GL3A 1VXOA 4RKRA 5KVQA 4KLZA 2O2IA 4ZA2A 3AHDA 3JSXA 2XCOA 2ZBPA 5DJ5A 3NKLA 2R4TA 2ZRAA 5HILA 5T57A 4IDBA 1OFTA 2GN9A 2QYTA 5A5FA 1T8WA 2EFDB 3ZDXB 2NYRA 5AVTA 4ED9A 2W93A 5BXQC 4YCJA 2HREA 2YVAA 3V2UA 2ZTSA 1PQWA 2WWRA 1OXUA 4ZVKA 4DA4A 5CA0F 3UATA 4BNUA 4ZIRB 4RKQA 1YZQA 4UVDA 3FVRA 1ZMTA 1QH0A 1W8DA 2OBNA 1BNCA 1FU4A 3L18A 1VCHA 5ED0A 1DS6A 1CLEA 3SQLA 4GSKA 4JVMA 3H4IA 2UVPA 4MPPA 4IDOA 3SHTA 1OI3A 4R71A 3LY7A 3LBFA 4GI1A 3NBKA 1NW5A 4C7JA 1TJYA 1IBMB 5HMLA 1WUHS 3K31A 2ODEA 4M8KA 1GQRA 4QYWA 2F55A 3ZWVA 1I9GA 5TE9A 5CJ2A 1R6UA 1RWNA 3KFXA 3R0JA 4C21A 3JU3A 4UUPA 4BRSA 5GP1A 3OJ0A 2XTAA 4QGGA 3IGFA 2Q49A 4B74A 3IPXA 5IEJA 2A1UB 1F9AA 2P2NA 1PNVA 1TAQA 3UK6A 1BDIA 3IKMB 3VC2A 1FFGA 2PSJA 4KUHA 2V7TA 2QMZA 5FP0A 3TRKA 2VWPA 4URWR 4BP8A 2F00A 4D3YA 3JQBA 1Q3TA 4MKRA 5KTMA 2XECA 3S5JA 2B6HA 5JS1A 4GQAA 1OFUX 5FNVB 4AKTA 4NE2A 3TLAA 3DAGA 1UPTA 4JCOA 4RFSB 1EINA 1NF2A 3VO9A 4WI1A 3DZIA 2G80A 2X86A 1G41A 4J7CA 3MINB 5AKZA 4J4TA 5L4SA 3F97A 5TMEA 4R0MA 2LUOA 3KQYA 4LYEA 3O1LA 1SHUX 1G16A 5LSAA 1FDUA 1KJ9A 3PPXA 4P92A 1HNXB 2QNBA 1V16B 5I51A 3VTAA 4EZIA 1B43A 5HK9A 1DIRA 4OFWA 5IP5A 1PWZA 1U7UA 1QS0B 2PWPA 4A82A 2OCXA 1Z4JA 2ZI6A 2N0SA 3AI7A 3GQVA 1WKVA 1YBAA 3I28A 4Z9AA 3HXKA 3UGKA 2FSHA 4D8XA 1THTA 3KR1A 2PJRA 4IDDA 1ZOOA 4OI2A 4AD8A 4DNXA 4V38A 4F84A 4IG9A 5EIFA 3UCEA 3RVMA 5JD4A 4HF7A 2P5UA 5EP4A 1LWNA 3HKDB 3NC1C 3UJBA 5KJFA 3E9QA 1MORA 1QP8A 4QWWA 5GM1A 4F60A 1LK7A 4PRLA 5BUCA 7REQA 1VIMA 1UDAA 2QN8A 3OESA 3IPLA 4E4RA 5DEOA 3UHAA 2D4AA 3T9BA 3H1BA 2FPSA 2O54A 4QTZA 4AG3A 2FQYA 2XUFA 1QCCA 1S96A 3KQTA 3CZPA 1W48A 1GCGA 2PX3A 4K9OA 5BP7A 2JLUA 2VBIA 3HJTA 3EC1A 3QX7A 1O54A 4PQFA 4TPKA 1AHPA 1JPJA 2HSZA 2O7QA 1QYXA 2W42A 1I7PA 1OLOA 1DC4A 1YTLA 5ALYA 4BMCA 1THGA 3FYUC 3THRA 1T0BA 3IALA 2VCHA 4H0FA 1H4SA 4KE8A 4CF5A 4EA7A 3L2OB 3TSCA 3UAXA 1P2VA 5KYGA 3HJBA 2OE2A 2YZNA 3MTDA 1Y0BA 3I8SA 1WPGA 2J32A 2BMWA 4FKZA 3C8DA 5DBFA 1W25A 1EFPB 3R6WA 4A6XA 3K8OE 4ZT3A 4MGKR 3RTBA 3DONA 3W5AA 4B0OA 4K8RB 4W5JA 3GRYA 4KIWA 3A37A 4AY4A 1PZMA 3E03A 1N2CB 2ONYA 2Q1UA 3DFUA 5C8DA 2YW2A 2ZTVA 4CMAA 2VJNA 4WLOA 5DV9A 1HDZA 4ARAA 3I52A 1KYYA 1Y6RA 1Z07A 2OGWA 1PUJA 1BHJA 4WGFA 1YRQA 1P3Y1 5AW3A 4PXYA 1N2SA 3WYCA 1JDTA 1CY4A 3EZYA 5EMJA 2JJ8A 3NHJA 3CCCA 4M46A 1PR2A 1L1RA 2JRLA 2WPDD 3O83A 2JFHA 2QQ0A 3UUGA 1L5GB 1OV6A 1H6CA 2ZI4A 1R74A 1XZDA 5IANA 2IBMA 2PZAA 4PS1A 3O8DA 4I9HA 4S0ZA 4Z8XA 5LZ5A 2ZRLA 2IE0A 4GZ3A 4I2NA 5JD3A 5K2MA 2MHCA 2FZEA 4KXLA 2BSAA 2J48A 2OESA 3VZSA 4DXAA 3KT3A 4M1TA 1Q77A 2FHPA 4H16A 3WNQA 4B83A 1SG6A 3AONB 1XWIA 1AKWA 1FS5A 2WFMA 4YAKA 2CXRA 2I1QA 1KK3A 1EM8A 5AKXA 2OCDA 3GH3A 2WSSD 2IH5A 2WI8A 2AFVA 4DN6A 4Q82A 4G0QA 4O4JA 4YALA 3W2EA 1G1MA 4MWCA 1Q84A 2PH7A 5TMPA 3BZWA 1EUZA 5HKKA 1ZIDA 3JATB 1DGQA 4IQ8A 2BISA 2B8WA 2IIQA 3TR5A 1PX2A 2B8JA 2EQBA 4MRVA 5B6JA 1UDXA 4TXHA 2IYZA 4LY0A 4AO6A 2CXUA 3G8YA 2W6NA 3DDZX 1UP7A 3N76A 5ITSA 4HYEA 1R8XA 2QZJA 1UEXC 2WJ3A 4GKBA 4LTNA 4R7TA 1WW3A 5DYGA 1QWSA 1S8FA 5MGNA 4M1KA 1YZNA 1GPUA 1N6NA 2ADMA 2ACKA 2CHUA 3Q2KA 3CUWA 3GJ7A 1I7SB 1YBFA 2JLZA 4R1PA 2G5TA 1N5OX 1WNTA 5KYYA 3TW6A 3AIOA 1XDWA 3H1GA 5T4HA 2XUQA 4DJTA 3BULA 3IR5A 4QEDA 3W5SA 3ZIDA 1WY7A 2A4KA 2M2IA 2WIGA 4QU0A 3VZQA 3EIOA 4ZPJA 4B45A 1E92A 2C5BA 2HK7A 2Q5JA 4RZIA 4NCIA 3RT7A 4BQPA 1DFGA 2I87A 3L8HA 2D1SA 5E6UB 3H42B 2HIAA 1VKZA 1E0KA 4A36A 1S7CA 3K1JA 3UV7A 2QA5A 1JKXA 1MDBA 3NEPX 1NN3A 4QU5A 2ZT6A 4HWKA 4B35A 1UOPA 3C3KA 3L1IA 2CXOA 4ZREA 3IEKA 4R3WA 1Z4PX 3VDMA 3ZBQA 1K7EB 5TEVA 1FDVA 2XIJA 3ZHTA 4BFCA 4URXR 4DSAA 1GYPA 3FHLA 1XEAA 2DCUA 4FYWA 3N6XA 4Y30A 2ATIA 4P7JA 4A27A 1M6YA 3V1LA 1W1UA 1P5FA 4XSVA 2JATA 2ZXEA 2B2NA 1QRTA 1UBOS 3H5OA 1M2HA 1WU7A 4R84A 4HSEA 4CKXA 4GZLA 2DUWA 4PU0A 4N49A 1KARA 2BEJA 3S3TA 1V1JA 1RLOA 2EFEB 4JB0A 4O33A 2H16A 1GLGA 1C5KA 4HOYA 4D8UA 3S2EA 2CDCA 3CF2A 4GVLA 3KELA 4PNPA 2HWXA 1PL8A 1N2XA 1U02A 1BO6A 3E22B 2PRJA 5G4LA 1XF9A 3WTCA 4UBNA 3IUEA 4JJAA 2WSIA 2R8ZA 2ZWOA 4IDEA 2PSFA 3NAGA 3D4OA 3T9AA 5FLYA 3QFCA 3Q5DA 3PHIA 3SHVA 2ZYVX 1LBTA 2C4VA 3KVVA 3WDSA 3SQWA 2YNMD 2VA8A 3CJRA 4F4HA 5AOVA 4LOKA 3KDSE 1ENOA 5DNWA 2C3MA 4MYTA 1X7GA 1HGXA 2EIXA 3K09A 2RC5A 4JOCA 1J21A 3OLWA 4LWPA 1AQIA 4MEJA 1YFJA 2CXHA 1XTVA 1JI3A 1B6SA 1A5SB 1UT8A 1WDWB 1XLVA 2GTHA 5CPBA 3N2YA 3SXUA 1NR5A 5BRAA 3H99A 4OAPA 3SZ3A 1FRQA 4ARZB 3OE1A 2B36A 1NLFA 4LOAA 4QG3A 3PQ7A 5JSKA 2W2XA 1PD1A 1OOEA 1QQTA 3V32A 2WZCA 3PLRA 2CNOA 2XE4A 1NATA 3IPYA 2OAP1 1OAOC 1CDOA 4NEHB 1H0KA 1NQTA 1VDZA 3B1JA 1GGEA 4XRGA 2FGKA 3LRTA 3RYHB 2O59A 1OIVA 1EHIA 2D7CA 3GFBA 3QX8A 1BMFA 1RU3A 1FUYB 3L7CA 1IAVA 4KQFA 1KFKB 1VJRA 3G9QA 4G1EB 3QELA 3LGXA 4XJSA 2IEBA 4FYIA 5EWMA 3EPPA 1LXCA 1E89A 1PU2A 4L5IA 2OLEA 3ZWAA 1M5UA 1C14A 2Z0MA 1ONOA 4JNCA 4I5IA 5CFMA 5BSGA 3H9EO 1HA3A 2BONA 1E2HA 1S02A 2FW1A 3KKKA 4V2UA 1LK5A 3B3QA 3R3HA 2IIBA 3AU9A 2A6PA 2FMIA 3ELBA 1W1WA 2A1IA 3NTQA 5F3DA 3RF7A 4AJ4A 3I2KA 2UZ3A 3HV0A 3DT6A 1O9HA 5D3MB 1ANKA 3QEJA 3O1HB 3EVAA 3QTLA 1T0PA 3HVIA 3GLFA 3STHA 3GJZA 4J7UA 2EL9A 2GKSA 1X1CA 1X39A 1T4BA 4IZIA 2HN9A 3QMPA 5LQNA 1GUFA 4FFBB 5KTSA 3N8GA 5F1KA 4QQNA 4EYQA 2P27A 3PCTA 1Y3CE 2UYGA 3BB3A 3O26A 3Q10A 2DUNA 2Q46A 1LVUA 1ZH8A 2V6MA 4JP2A 3HKBB 3I9V1 4G0YA 4J0EA 3AR9A 5GVRA 1NVDA 4MR8B 1VLHA 4NTZA 4V0ME 3TTUA 4BNWA 4OYRA 1XVTA 3C6KA 3H7IA 3ESDA 4QO7A 5KKNB 4NEGA 3WMEA 4IGIA 1QK4A 4EAAA 1EJBA 1M1ZA 2IDMA 4LZNA 4M1YA 4BBPA 1M0WA 3GEBA 3RGWS 4D6PA 1KBQA 3MTIA 3H65A 1DG3A 2F3SA 3NJRA 4HNGA 2QD1A 2OQRA 4OHZA 1H93A 1WS6A 4C1NA 4KQ1A 1FRNA 1IQ0A 1CQIB 3WNDA 5DEIA 4BZPA 4K3UA 4MV0A 2A84A 3N75A 3R5KA 3CZ4A 4CI0B 3AR7A 1YQXA 1Z0UA 3L3BA 3TQQA 1YS9A 1Z75A 2VG8A 5CBKA 2ATEA 5CJJA 2AI1A 2W6PA 4OKIA 2IY8A 2OUKA 3EW7A 2QS9A 4TLCA 5B7PA 1W0JD 5H83A 2ZW9A 3TTWA 2I91A 2RJNA 2NUAB 3IP5A 4NHEA 1NI3A 1R18A 1YCFA 5ULLA 3WWDA 1H3FA 4CRWB 5JD6A 1XA4A 3ANLA 2FF5A 3FTDA 1R0ZA 4JEMA 1ONSA 2FMFA 4NENA 3MLAA 1W96A 4BDSA 4V03A 1HE3A 2C04A 1QXSA 4CODB 4DJ5X 4JC4A 5EKTA 2P62A 1F3LA 1LTKA 1Y8AA 3R0IA 5LQSA 1KO8A 1XTIA 3Q15C 1FDIA 4AUKA 3ITKA 1R1DA 4GNRA 2W90A 3QVVA 4AMYA 5CP8A 1D04A 5IKOA 4L73A 1VKOA 3WR5A 1VLLA 1YDFA 3GMSA 4MVJD 4QU9A 2BTOA 4DCUA 1G8AA 3MRTA 3K15A 1CJMA 1IBCA 2ZYSA 2GYWA 4I4NA 2DJ5A 5J47A 3AKEA 3I0ZA 2VJDA 4CR6A 1K4MA 3QPAA 4KLCA 4S05A 2F8LA 5F64A 4JJ8A 3UPTA 1U2EA 3HABA 1ZIOA 2WDPA 4DGQA 4XQCA 4J4HA 2RMKA 4AYTA 3RRZA 3T7SA 1CIVA 1E1CB 1NHGA 3ELUA 1I4DD 2PT7A 2A59A 3KPWA 3NEYA 3GELA 3PL5A 4D4LA 3DAPA 3K70C 1MAUA 2QUBA 1YL7A 2CLHB 3AQ4A 5CCBA 4ZPXA 1OX5A 1GQSA 3T38A 5JPCA 2V59A 3C39A 5EHIA 2Y76A 3A58B 4TLMB 1ACMA 3K0FB 3L6DA 4F2WA 3B51X 5JNLA 3EBLA 2BF4A 3IMCA 1ICIA 4R2JA 2L19A 2I4OA 3WQQA 1KHTA 3OCVA 5JG7A 4I55F 2EHDA 2HCRA 3F5FA 2JASA 3UENA 1UANA 2F3RA 5F12A 1JXAA 4F86A 4TV9A 1MIOB 3ND9A 3NUZA 1P8JA 4QYMA 4UHEA 1YR2A 2M1ZA 5B1DA 4Z3DA 4JI3B 4EQ6B 1KZ1A 1NC1A 3Q9LA 3KSBC 4WLFA 2ONZA 5ALMA 1IZ9A 1UWCA 2O3TA 3GLHB 4U6SA 3EXHA 5C51B 4JI4B 4G89A 4GI2A 5KX5A 4C3VA 4BGUA 4LDRA 2VSOA 1Z06A 3UWDA 5JYCA 3KOOA 3HBNA 2B61A 2ZUEA 2AL7A 3ACCA 3DNMA 1S4QA 3HEBA 3NH6A 5FNZA 2JJ2D 3LHIA 1NW9B 5IZCA 1IN5A 4JYCA 1ZCAA 2AN3A 3DXXA 5COBA 2R1VA 1PRYA 2DBRA 1AX9A 1H6BA 3T7JA 1GTSA 1MEOA 3KYCA 4BV9A 1RPZA 1N9KA 1U1GA 3N59A 3KKEA 3WSVA 3OKCA 1QIIA 2C03A 1QV6A 4MVJH 4PLVA 5BPHA 1N5RA 2AXPA 2PMDA 3MWDA 5K0JA 4M6WB 1T2CA 4HNAB 4MCJA 1BN7A 4G8JA 1YKFA 2P4SA 5JNWA 2BGKA 1XVIA 4JL6A 1SXJD 1G3QA 2ZSAA 3MK31 1HKUA 5U4QA 1P6QA 2ZDQA 5JJBA 2WA2A 3BTOA 3UJ6A 3DMHA 3DEHA 3PSAA 4CMIA 4Q15A 5D3KA 4N8SA 1GGVA 3L02A 3MN1A 4YV1A 2X5JO 2WVGA 2XGMA 4GRDA 1PWHA 4LYJA 1R27A 5BQ5A 4Z4CA 1IN4A 4TYWA 2C7QA 3WLNA 5FADA 2R8PA 1HLGA 1YF3A 4HQLA 2B34A 3R6DA 1IOLA 3ENVA 1A82A 1GU7A 1SB9A 4MQFA 2WNSA 3DBRA 4G3XA 2K7ZA 5TX7A 1EGHA 1NVTA 1RQLA 3VNAA 1Z88A 3AR8A 4WZBE 3TVTA 3VAYA 2DPXA 3BL5A 1XTQA 3INNA 1K66A 4DLBA 1ZPDA 2JCYA 1LLCA 1F9EA 3RU7A 3QVXA 5CLGA 3DL4A 3O74A 4OH1A 3FPSA 4OM8A 3U3ZA 4BOYA 3WKEA 5JFOA 1GIAA 4X63A 3R7DA 1CLUA 4ER6A 5HOEA 3SJAA 2XIQA 1XTTA 3G0HA 4PFQA 2H5EA 2O8BA 3B48A 2DQKA 5LQJA 3C5WP 1QMPA 4ZCRA 1JQAA 1OC2A 1D6MA 2VNHA 4NBNA 4Y2XA 2WU8A 5HEKA 1M83A 1DAKA 1MJFA 1RXYA 3ETHA 4H08A 4OXQA 5E1DA 1NVKA 1XZFA 1XZPA 2FXIA 4F6CA 1ZK0A 3NBZC 4ESEA 4P4SB 1L4UA 2K7FA 1T5BA 3O1JC 2AN1A 4LX0A 4YCSA 5A1JA 4Z99A 3RBVA 2ORWA 4CMKA 1ABBA 1OY1A 4I1UA 3DGFC 3LE8A 3QV1A 1G59A 4EY4A 3BCUA 1L5NA 1KMHB 2DBZA 4QHSA 1S3FA 3X1YA 1X7XB 3PDUA 2WK1A 4IX1A 4MUXA 1FJ2A 1PNRA 4NCAA 2IKSA 2VPYA 1ZIXA 3NBQA 1KEUA 5EJ7A 4Q19A 5AI5A 1L4KA 2QXUA 3L6RA 2A0YA 4DRYA 3GCWA 2W70A 1PIWA 1PQUA 1Y9DA 4QBGB 1P1RA 5AW5A 3BWYA 4TXLA 4BVJA 4C4RA 4YCLA 5JZMA 4MUIA 3PE6A 2XEXA 2FFAA 3OZVA 4ZOCA 5K3FB 3N2GA 5FCDA 1R3UA 4EHLA 1NE2A 1UPAA 3DQQA 2PO7A 2NTEA 3DXZA 1XX6A 2CUNA 3K9QO 3Q11A 4WZ6A 5E8JA 4ZEOA 1VBMA 4HGZA 2JHAA 1AG9A 3MMXA 3HXOA 1PBTA 1EDZA 1ZU4A 3RYCB 5IHPA 3K73O 3QEBZ 4MHSA 1Z33A 1OCEA 3L7BA 1YR9A 3IV6A 3HUUA 2EYUA 4X00A 1YD7A 4UBOA 3BHNA 2GN1A 3N5CA 1FYWA 2F62A 2OV2A 4E11A 4ZEWA 3WL7A 3F96A 3TOXA 2FFBA 3BQ9A 5C7IO 3CTPA 2Q7DA 1FP2A 2PHZA 1UFOA 3H5RA 5IAAA 1RAIA 2A8YA 1DEXA 3ETDA 1XVAA 1TIPA 3DOUA 3HY3A 3JQBC 4MTLA 2XZLA 3P9XA 1CRPA 4F9EA 4YCMA 5DNUA 1QAQA 3EXG1 2IXTA 2A1TR 3IUMA 4QQFA 5D6OA 5SYMA 1C9KA 3SSAA 4MQEA 4ZV7A 3V8RA 3PYMA 2FP4A 3WGUA 3NDPA 2ZYGA 2ILTA 1RKXA 5JWHA 1NVBA 4KQCA 3A6ZA 1OTYA 2XDQB 3OOHA 4G5SA 5LP6B 4K7JA 3NKFA 2QVCA 4LYHA 3FVWA 1X8JA 3UXYA 1XR3A 1ZNYA 5EYPB 4DLUA 3A4VA 3W8FA 2WFLB 5KVSA 4JOSA 1EYZA 2QR5A 4HPWA 4CL8A 2VNSA 3RUDA 3ZWQA 1H1LB 1GRQA 3IEIA 4LVNA 4M1OA 4OK6A 1K9SA 2GWHA 1CC1S 1CUZA 3NQ41 3O8QB 1N0VC 2AC2A 2W2TA 4A03A 3W79A 4BQNA 3KDPA 2YN2A 2YJ5A 4JKIA 3TCKA 3SWWA 3P2JA 3OZUA 3P45A 1QLHA 3DCYA 2X58A 1EM6A 2IDKA 3L8ZA 4FILA 4MLPA 5JPDA 4LF6B 3C87A 2IW1A 1M1YA 3IE2A 3QLJA 2OYRA 1JR3E 1VL8A 2FQ1A 2RHOA 4X84A 5P8WA 3AFIA 5IARA 3OZ7A 4HCJA 4N0EA 1ADYA 3EOZA 2WP0A 4MNTA 3O90A 1P72A 3PPVA 4IIJA 3BXGA 3ZGOA 5KDDA 2QG9A 4IX9A 3VC1A 2WTEA 4ID3A 2WJJA 3PNVA 1NE7A 1QFJA 1UFKA 4CZ2A 4BO8A 2B99A 3E8XA 2DFVA 3SDSA 3ZLTA 4HDSA 3PPYA 3I34X 3UUFA 4ETWA 2R4QA 2AR9A 1S8NA 2IIVA 3SC3A 1E2PA 1EQUA 1F51E 2PLNA 3R7FA 2IWHA 4ZO8A 2E4AA 3FZNA 1QX3A 1E20A 3DTNA 3IIIA 4TOIA 4YI5A 1T8SA 1U7PA 2EJTA 2JIZA 2WUFA 3PU6A 3B13B 1XYYA 4L28A 4PQRA 3VH3A 5KUTA 5IABA 3G2NA 1TU0A 2G0TA 3A6EA 3F9CA 3A4NA 3KHKA 4LY9A 4PLPA 4YGXB 3KUKA 1X7YA 2P7HA 1WW8A 1F06A 2IHUA 3MRSA 3OWHA 3PRYA 4OOEA 2HV9A 2QD5A 2DE0X 4MIYA 1D07A 3ETEA 1U0SY 2YMQA 4K81B 2UV8A 2RJ3A 4Z0NA 1U4NA 3K2IA 2WHEA 1D2CA 4D4HA 2FSUA 2ZREA 2XWPA 5KAPA 3NIDB 1GARA 3RS9A 3CEHA 3W04A 5BN1A 3KQOA 4L0DA 3JASA 3REQB 3PUWA 4Q9NA 4QLBA 3HY6A 3KAKA 4O2AB 1BFDA 5KTKA 1KGDA 2M6SA 3P2IA 1T24A 4G8BA 4IDGA 3BJMA 2V55B 5HOQA 3K0SA 5KDOA 3GEDA 2OCYC 3AKDA 3KUUA 3ZCXA 4MPDA 1LVHA 5EUMA 1O0SA 4ES6A 4EY8A 3G82C 1GG8A 4I4TB 1XQXA 3IO3A 1GD1O 2OL4A 4IIGA 4EY5A 4C0SA 1U2SA 2QX8A 5F4ZA 1RRMA 1F2UA 3CO5A 3EF1A 2DEUA 2CUTA 3ENWA 3EYWA 2PCJA 4GYJA 4O2AF 3J80A 3VYUB 4F4JA 3IS3A 4D42A 4MVYA 4FWBA 1DAFA 4YJ3F 3W0LB 2BHRA 3OG9A 3G9XA 2JIQA 3IELA 1E62A 4NZOA 4PFJA 2G9NA 5EHQA 3MBIA 4FCCA 4WACA 2ZQZA 1GHTA 3FWZA 2Q9AA 5JBQA 3WAKA 2CLMB 3T7AA 4O4LF 4EMTA 1RT9A 3O73A 2GBCA 4F85A 1UKVY 2VDUE 1JAIA 2YQZA 2AUNA 3LL4A 4LXYA 1VSVA 3HXLA 1EGVB 5A6SA 1G20E 2C5SA 4HV4A 1F17A 2EIHA 1KI9A 1XQ9A 5EKSA 4N18A 4G0WA 2I2AA 3G9UA 3AT1A 4RMHA 5KYTA 4HP8A 4JT2A 4OBXA 4RY9A 3U2QA 3HJHA 2AMLA 3TLEA 1LF0A 1T3LA 3HSSA 3R9KA 3FM9A 1RJFA 2HSJA 2WW8A 2Y9MB 3EMDA 2AXQA 2FE4A 1MENA 3WY9A 4RKWA 2B21A 4CI9A 2BEUA 4DA7A 4DCSA 1JLSA 2VH1A 3B82A 4D92A 4Z54A 4K6CA 2GCPA 3FA2A 3R1IA 3FPBA 3WMFA 1JB9A 3O03A 1WM1A 4Z53A 2MINB 5SICE 4D9FA 3RASA 1Z29A 3KQKA 3HPQA 1VPTA 4DDMA 5G0SA 1UXKA 5L3SA 3E0QA 3EN0A 2C3UA 2IYOA 1NVEA 5SY4A 4OHRA 4UDXX 2V65A 3SIWA 3IEPA 1A69A 4QT0A 3B12A 4DB2A 3R7AA 3AXSA 1R9JA 2Q4BA 2VATA 4MW4A 2E4ZA 1UZMA 1ZNXA 2JFFA 4NYJR 2JHPA 3CT4A 2PWYA 2KLHA 3PYXA 3KEGA 1V35A 4LBYA 4TWJA 1QHNA 5K0TA 4P0TA 3PRKE 4X1OA 5ENDA 1KE1A 2NOAA 2VRBA 2HDWA 3C15C 3OX4A 1ZOPA 2MSEB 3GG9A 1LBIA 1OKKD 1M10A 2QAGB 4RJ2A 1HDYA 4BFVA 2DR0A 3CS3A 3NAQA 4M1EA 4EB0A 3H0CA 2TMYA 1MOPA 4IR7A 4Q12A 1CETA 3OJCA 4FR2A 4GPD1 4N5DA 4BVKA 4CLOB 4YCNA 4PVCA 4YMTA 4RVDA 1O97C 4R9VA 4RIHA 5DDIP 3V7NA 4F1KA 1LZKA 1KAHA 1JDUA 1UM9B 2PUGA 4TTTS 3SNHA 2GZ1A 1IBRA 2C9CA 4PSKA 4DCMA 4CEHB 3TB4A 4FBLA 5TS2A 4DF3A 2X0RA 4BKUA 3SICE 2EDCA 3WFZA 1PJ3A 5CEJA 1A88A 1JDZA 2BW0A 3GFFA 1MV5A 2FJPA 3INGA 4L5AA 5FLEX 4EW6A 3BXEA 3OP4A 3W2TA 2MWMA 5J2UF 1SN7A 2Q5FA 2AQHA 2XTMA 3EY4A 1Z13A 3PFHA 3P9PA 3NBFA 4O59O 3TVDA 4KAFA 4EYSA 3GWGA 3RAFC 3O3OB 1A2KC 1IOWA 3DEYX 2GO7A 3L7YA 2RD2A 1NUSA 4C04A 2BFBB 4MEBA 1IK6A 3K09C 1J25A 3PWTA 4RPJA 3KTAB 3SDZA 1U7XA 3UKDA 4UM8B 2DQYA 3LHFA 1O03A 4NR0A 1SMKA 1Y1RA 3MPUA 2NAFA 1VOTA 2WRZA 4GGPA 3G5AA 2NO0A 2H5JA 4RZ2A 2NSLA 1VIDA 3ZY4A 1PZGA 4QOJA 2WJIA 4C7OB 4JN6B 3LUPA 2VJPA 4PYLA 5BMVF 3D6JA 2LGJA 1I4LD 2CL6X 2ZAYA 3A2LA 3F3SA 3O9MA 4FUTA 4W1QA 3KHSA 5EXEA 3NHAA 5K09A 3H5NA 3HUFA 1R4NB 1XTBA 2PD4A 3JD0A 1Z5WA 4LPSA 3ZR4B 4PYRA 3SP1A 2MSKA 1E3DA 1JV2B 3QG5A 3B6ZA 3ONNA 1SC3A 4C0QC 2Q9UA 3SVZA 1BOOA 3AVQA 3KB2A 4R98A 5I9NA 2CBGA 3CZCA 4TRMA 5I5GA 1NY5A 1I32A 2J5XA 1CY2A 1U6IA 1W4AA 1W4LA 2VBCA 3KUXA 4PG4A 5FWXA 3N74A 1AF7A 3LCMA 3JR7A 2PIDA 1ESZA 2PKWA 4EG4A 4CGZA 2N75A 1R3DA 3PHJA 4F6RB 1NY6A 2C8LA 2BEVA 1YB1A 1T10A 1XNJA 3H9QA 3NT4A 1E1MA 1KS2A 2IC5A 5ILGA 4Q1BA 1AUPA 1QLWA 1DQSA 3OOWA 3PS9A 4JHLA 2B7LA 3I4FA 4O63O 1U8CB 3TLCA 2XYPA 4Z2AA 5G1NA 3U7GA 4JI2B 1E2BA 1KJNA 4DCTA 1EFHA 1O08A 1IQRA 3K8YA 4DRXA 1KOGA 4E7OA 2PV0A 4TMYA 2UZIR 4W1RA 2DR2A 5GOZA 2WAOA 1ZHHA 4IPTA 1QPBA 1RM4A 2ZS9A 3G8AA 5AKIA 3V4ZA 4FGLA 3WJ7A 1UDRA 2HRBA 2R8RA 5AKKA 1LC0A 4JI0B 4HGYA 3L8EA 4CHTA 1ZCJA 2G4LA 1M8KA 2GCGA 3WLEA 5KTNA 3TFOA 4BNJA 4TTVA 4MWSA 3HBMA 1YH3A 2PUJA 3KS9A 1P19A 4F5DA 3QBJA 1JXMA 1JRLA 4RZ3A 4EWLA 1OU0A 2HBYA 1Z56C 2PSSA 4KU4A 2H2DA 4EG3A 3EXIB 3KCQA 1SEPA 4UHCA 4AIIA 1DBIA 3D6AA 2I8AA 4GPZA 4KW7A 2W83A 1TIKA 1V5GA 3RODA 1EZZA 4E5DA 4EL0A 3BWMA 5ESWA 4TTIA 1PSZA 2P9TA 5HZGA 1EVEA 4ZHQB 1YS4A 3AHGA 3EY9A 1BE8A 2OOKA 1BQEA 3MF4A 1SHZA 3TRDA 1YZ3A 2Z9BA 3AZQA 5EJ8A 5GTDA 3COJA 3G68A 2OGTA 1HETA 3I5MA 3VZPA 3H3FA 1JB1A 3P27A 3C4JA 3IJRA 3R7BA 2M6KA 1RAHA 3RFXA 3WIDA 1FP7A 3OY7A 3NJ8A 1ZUIA 1GUBA 2CY0A 3K4QA 4TUYF 4UTZA 1U90A 1O58A 1QIMA 2B20A 4BNDA 2GCIA 1NJ1A 4CF3A 1P7VA 4ISCA 1Z2PX 2J7KA 5C31A 2FW0A 2ZJAA 3FCXA 2FXVA 4N65A 4Q02A 2RI0A 3D3WA 3RRNA 3M4JA 3O5AA 4H7PA 1NVGA 5FJIA 3IUQA 2ESRA 1RTTA 5K3DA 3W7BA 3WQRA 2AA3A 1JX6A 2VXYA 3SYNA 4V1CB 4FWTA 5BW8A 4DZZA 2CXTA 1SG0A 2JLQA 2C4HA 2PL5A 4FI3C 3U44A 2H2WA 3VR4A 5ITZA 4R2XA 1PTKA 1G8JA 5FFNA 1NUHA 1E7MA 5AI8A 3FD8A 3SS7X 3IE1A 3PIRA 3EFBA 2QRLA 2ZQYA 2OEPA 3PNKA 4W8OA 3HDYA 4L4SA 1ODCA 4JB2A 1NPDA 5A4MS 2IXFA 3KVRA 1H2ZA 4UAGA 3F6YA 3WK8A 5EWLA 2DHQA 3M1IA 3M6LA 4WIAA 4YK7A 3A1DA 2VTBA 3RTGA 2XCSB 1GVHA 1LUAA 1FXWA 1PT7A 1WEHA 2EFJA 4UCFA 5E9QA 4NE7A 4LKRA 1RJ9A 2G82A 3FHJA 3VH1A 4BKMA 2YL2A 1P2TA 1Y5NA 4HWRA 2FKNA 4RSHA 4U7GA 3SN6A 1OPRA 5COQA 1EA7A 3PIDA 5HGXA 1HNWB 3CLRD 3RTDA 1Z6PA 2G25A 3AHIA 4QELA 4EB6B 1SUFA 5AYVA 1HOTA 1DVRA 2HJ9A 1CR6A 3T9EA 1W36D 3KD3A 3WXMA 1RXVA 1WULS 2W9XA 2YWBA 1O4WA 4TS3A 1CZHA 3M8KA 1WTAA 4HFJA 2G36A 4GZ5A 3T1VA 2R48A 2VHWA 5J4HA 2P91A 3HZRA 3NH9A 4D9GA 1CUIA 2H4HA 5FEMA 4L08A 2C2YA 2IBTA 1H9BA 3HP1A 3MCAA 2GDJA 3ZEAA 1SQGA 2ZIAA 3FPFA 3CLSD 2VP9A 3HB0A 1RRVA 1VE1A 3NTUA 2WUDA 4KWEA 4NBTA 4PG8A 1BVYF 1UAAA 3WGLA 3GJXC 5B58C 4Q93A 4X7MA 5BSMA 3GXBA 2V0NA 1YNOA 5FI5A 9MHTA 1VJ1A 1HTTA 3MWLA 3B6IA 3BDIA 3P2OA 4HTFB 4PAOA 4QPZA 4AURA 1WX1A 1QTQA 1P31A 2P2ZA 2PWBA 3THWA 5C8VA 2G9QA 3NBAA 2ZIFA 4CDGA 4ZCMA 1P0FA 2RHTA 3U4IA 3GZNA 4BE9A 3RNOA 2CGEA 3WWOA 2O7VA 5FEUA 1WABA 5LWQA 4HGNA 3QXGA 3T6KA 3MJRA 3BH0A 3EHEA 2Z8YM 3TW0A 2WWYA 2Z2ZA 2J0UB 3EXHC 4UBKA 1DOHA 1K63A 4U7WA 2Y27A 1JQKA 4TM7A 5DX8A 3MUEA 2ZJ6A 4AY2A 3RG8A 1E2JA 1I1QB 1N25A 4G24A 3IAS6 1E59A 5I9MA 1NLMA 2QSYA 1D4OA 3MOSA 5AHOA 3WOVA 5IZCC 4CTJA 2C99A 3C2QA 2BFEA 1PN3A 3B1ZA 2QL6A 3EPKA 3RBXA 4XH9B 3WK9A 3HFSA 3USES 3KHTA 2XUAA 1U5CA 2PE5A 3PENA 2PRSA 1EB8A 2XT6A 2V9ZA 3R44A 2WKRA 3RU2A 3ZI0A 5B53A 3TQIA 4BP1A 3AUTA 3DM9B 3UB3A 1E2FA 1P0IA 4V0LA 4MWZA 5IH3A 4J91A 4KFTA 5JFGA 5C35A 1WB5A 1E0JA 3W06A