3OY7A

Crystal structure of a virus encoded glycosyltransferase in complex with gdp-mannose
Total Genus 138
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
138
sequence length
392
structure length
392
Chain Sequence
MKLIIVGAHSSVPSGYGRVMRAIVPRISKAHEVIVFGIHAFGRSVHANIEEFDAQTAEHVRGLNEQGFYYSGLSEFIDVHKPDIVMIYNDPIVIGNYLLAMGKCSHRTKIVLYVDLVSKNIRENLWWIFSHPKVVGVMAMSKCWISDICNYGCKVPINIVSHFVDTKTIYDARKLVGLSEYNDDVLFLNMNRNTARKRLDIYVLAAARFISKYPDAKVRFLCNSHHESKFDLHSIALRELVASGVDNVFTHLNKIMINRTVLTDERVDMMYNACDVIVNCSSGEGFGLCSAEGAVLGKPLIISAVGGADDYFSGDCVYKIKPSAWISVDDRDGIGGIEGIIDVDDLVEAFTFFKDEKNRKEYGKRVQDFVKTKPTWDDISSDIIDFFNSLLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein,transferase
molecule keywords Glycosyltransferase B736L
publication title Crystal structure of a virus-encoded putative glycosyltransferase.
pubmed doi rcsb
source organism Paramecium bursaria chlorella virus ny2a
total genus 138
structure length 392
sequence length 392
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-09-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 3oy7A02
3.40.50.11930 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3oy7A01
2IEIA 2F9FA 1L7XA 1Z6PA 2ZB2A 5IKPA 3CUVA 4X7PA 3CUUA 2QLMA 1A8IA 3NP9A 3WAGA 2XA9A 4YUAA 3ZCRA 2GPAA 1Y8ZA 4X6LA 1WW2A 2QLNA 3RSCA 2GT1A 4MHSA 1SXQA 1IIRA 3DD1A 1FC0A 3C48A 3BD7A 1V4VA 1WUTA 3T3DA 1L5QA 4MI9A 1L5SA 2ATIA 2H1HA 4MI3A 3BCSA 4AMBA 3QHPA 1WW3A 1NLMA 1L5WA 3C4QA 3T7DA 3CUYA 3MT8A 3OTIA 1XL0A 3GUHA 3T3IA 2IV7A 4AMGA 1L5RA 4XIFA 3T3GA 3T3EA 2JLBA 2YJNA 3AMVA 1Z8DA 1LWNA 1GPBA 2G9VA 3CEMA 3ZCQA 2F3QA 2QN7A 3D0QA 2PRJA 2X6RA 3WC4A 1WV1A 3CUWA 3C4VA 1XC7A 3MT9A 1C3JA 3H4IA 5DXFA 1WUYA 4PQGA 3S28A 3IA7A 2QRMA 3TAXA 4F96A 4N3CA 3ZCTA 3G2NA 3D1JA 4LEIA 1FU4A 2F3PA 2QN9A 2GEKA 3CX4A 3L7DA 4RIHA 2FETA 1PYGA 3MS2A 3BCRA 2GPNA 4REMA 4CDRA 3COPA 3RT1A 3TOVA 2QRGA 1EXVA 2XGSA 3MBOA 4G2TA 1HLFA 2IUYA 3HBMA 3ZCUA 5DLDA 3MSCA 1C8KA 4WADA 3NPAA 2C1ZA 4EJ2A 2R66A 2ACVA 1RZVA 2R4TA 1F0KA 3E3NA 4GZ5A 2BGUA 2XA2A 3L7CA 3MRTA 4L22A 3L7BA 1C8LA 2XGMA 1QKJA 4N39A 1XV5A 2IEGA 3L79A 3DDWA 2WTXA 3D0RA 4MICA 4RIFA 1Y6GA 3OT5A 2R68A 3MT7A 1H5UA 1PSWA 1IXYA 3VDNB 5C1DA 2Q6VA 1BX3A 3DDSA 2VCHA 1WV0A 2BGTA 3WADA 5D00A 4GZ3A 2QNBA 3NC4A 5I45A 5LQDA 3UYLA 4NEQA 2G9RA 4BQFA 1SXPA 3BD8A 3ZCVA 2GM9A 9GPBA 1XKXA 5ENZA 2QZSA 2PYIA 2SKCA 4GYYA 4N3BA 3T5TA 1RRVA 3MTDA 3OY7A 4QLBA 6GPBA 4CTOA 2IV3A 3PE3A 3E3LA 2AZDA 1JIXA 4FZRA 5DU2A 1P2GA 4GYWA 1JIVA 1C50A 1FTYA 5D01A 1Y6FA 1M5RA 3VUEA 4NESA 4HWGA 5JTTA 1FTQA 2F3SA 3MS7A 1UZUA 1EM6A 3O3CA 1B4DA 3S27A 1LWOA 1JG7A 1AXRA 2FFRA 4EL0A 3HBJA 1GPYA 1JIUA 3RSZA 4N9WA 4YI5A 4AY5A 2R4UA 2R60A 2XA1A 4MRAA 2VSYA 2QN8A 5HXAA 4RIGA 1UQTA 3CUTA 4FKZA 5TMDA 1QM5A 2PQ6A 4Z5XA 2SKEA 4RENA 3VUFA 7GPBA 2O6LA 2X0FA 1K08A 1NVKA 1RZUA 2QN2A 3G2HA 4BQIA 3ZCSA 1NZFA 2QLLA 1NZDA 2X6QA 1GFZA 2QRPA 3UYKA 5IKOA 1L5VA 4X7RA 4W6QA 3G2JA 4CTNA 3FROA 2C9ZA 3T3HA 2PRIA 2H1FA 3SYMA 1Z62A 1E1YA 3S2UA 3S0JA 1PN3A 3MQFA 1UQUA 3G2LA 4EKEA 3G2IA 8GPBA 2SKDA 4EL5A 1K06A 3BDAA 2HY7A 2IW1A 3OKAA 3SYRA 1NOIA 1P29A 4YI3A 5BNWA 4BFCA 1P2DA 5GPBA 1GZ5A 2G9UA 5JTUA 1AHPA 2F3UA 2C4MA 2JZCA 4WACA 2BISA 3CEHA 3NAZA 4GZ6A 3ZCPA 3NP7A 4MHOA 2ECPA 3MTAA 3EBPA 5TMBA 2PYDA 1YGPA 2C1XA 4M60A 4EKYA 4LDPA 3VDMA 4NC9A 4KQMA 2VCEA 1NOKA 3OTHA 4HLNA 2IYFA 4M83A 1VGVA 2KS6A 3EBOA 3OKCA 1XOIA 2QRHA 1FU8A 2ASVA 1P2BA 4M7PA 4KQ1A 1JEJA 3HBNA 2VSNA 3GPBA 3Q3HA 3S29A 3MS4A 1GG8A 1FA9A 3OY2A 1Z6QA 4MI6A 1KTIA 3CV3A 3MRVA 4AN4A 1GGNA 2AW3A 1J39A 2GEJA 2OFFA 3MTBA 2X0DA 4KQ2A 2ACWA 2FF5A 3IAAA 1GPAA 3PE4A 1P4GA 3OTGA 1E4OA 1PNVA 2QRQA 4GPBA 3OKPA 4RBNA 2GPBA 1ABBA 3L7AA 2GJ4A 4N3AA 3MRXA 4F9FA 4WHMA 3HBFA 2X0EA 2P6PA 3H4TA 3L01A 4BQEA 2VG8A 2XCIA 4XI9A 1P4JA 4AY6A 4RIIA 4RIEA 2BFWA 3BEOA 3TSAA 2QN3A 3NB0A 3G2KA 1P4HA 2JJMA 3QKWA 1FS4A 1YA6A 4RELA 1FU7A 3NCHA 3CEJA 1L6IA 1FTWA 3E3OA 4F97A 3BD6A 1JG6A 2QN1A 5TVGA 3Q3IA 2AMVA 3Q3EA 4X7MA 1XL1A 3RHZA 2AV6A 1NOJA 3BCUA 1F6DA 4CTMA 2IYAA 2XCUA 2XMPA 2XGOA 5TMEA 2G9QA 3DZCA 1O6CA
chains in the Genus database with same CATH superfamily
3B9RA 2F9FA 4OXXA 4P4SA 5AOVA 4RY9A 3ZVLA 4OOEA 3VJKA 4MS3B 5DI9A 2L69A 4FHGA 4R81A 1E2PA 5IYZF 4F4DA 1GN9A 4CE6A 2ENUA 2FR0A 1TVCA 2TMKA 3BFKA 2GD1O 5LD2B 4LRWA 1WM1A 3FPCA 3RW9A 4MKZA 4FW9A 2E9SA 4NFYA 5EGNA 3DLPX 3REOA 1Q2XA 1OBOA 4J3FA 4LDRA 2WU4A 1DRWA 1RPAA 3FAZA 2AJ8A 5DZSA 1NE2A 1PAUA 5LMUB 1IIRA 2OCPA 4ZVMA 2XKKA 5K3FB 2PS3A 1U3FA 1VL5A 1NRJB 3CU5A 3T52A 2ZIFA 1PZEA 2YUIA 3WNCA 4I1PA 1T2VA 4HRYA 2A3NA 1TQ6A 1W0KA 3DPIA 3ICWA 1KJJA 2QX7A 2C83A 3DGFC 4NMLA 2XMBA 1NLMA 4HRXA 4KXFB 4Q3DA 4WZ6A 5LA6A 5J4YA 4FFSA 5CMLA 4N82A 1GTG1 3CUYA 3EXIA 1UXHA 3MT8A 1ZAYA 1NPYA 2I2AA 2M32A 2DY0A 3MUEA 4L7QA 2ZB7A 1K6IA 4Q4AB 4B74A 3RRYA 5TRTA 2ZYDA 5DLYA 4BGIA 1GT6A 2YXDA 3WBBA 2O7VA 1P1CA 3L77A 2DHQA 2O6HA 1XZKA 3C7DB 5BYJA 4EYOA 2JLBA 1F2VA 3FZGA 4JHLA 3CUSA 2WINI 4FNAA 4R41A 3T9EA 4PCLA 5G2OA 4YRAA 1O58A 1HK7A 5FPPA 3VSEA 3ZWMA 3R6WA 2H92A 2XQJA 3OCCA 4L5BA 1TEHA 1Z4IA 4QNMA 4OPMA 3JZIA 2JGKA 3KB6A 3LX5A 4YEDA 3WC4A 3ZYZA 2M6KA 2A59A 4ZT2A 4IXTA 4F11A 3KQOA 1AS2A 1Q22A 1SKBA 3KYJB 1NHGA 4LX8A 5ALLA 2WY2D 4YUYA 3HTXA 3RU9A 4R9UC 1BRMA 2RKWA 3EQ9A 2R0QC 2ZYWX 1QH0A 3RAFC 2V7QA 4HBGA 4PQYA 3WYGA 1Y5IA 3S28A 5EZYB 1WCYA 4XQ0A 3T5BA 5JSZA 3RAPR 4UTVA 5HQ3B 1WB9A 5HG0A 2QD4A 2DWPA 4X45A 4DIFA 1CUVA 1U28A 1P72A 4PYOA 3P9XA 4KUHA 4LCJA 4EG1A 5JJIA 4FMDF 4IG4A 2F9MA 3N9IA 2AX3A 2X40A 4FTWA 2ZJ3A 4W1PA 3UJ6A 5IBCA 1N6OA 1WB5A 4B6SA 1YJAA 5ANRB 4TLBA 4CHGA 5LL6P 2GN1A 3PITA 3S2IA 2FK7A 4TTPA 3A36A 4AKEA 3R7BA 4UVIA 3ZIUA 2P11A 4OLAA 1I7DA 1LNSA 5LQSA 3ORYA 2ZJ8A 1X42A 1XWWA 4AF7A 4B3IA 3MS2A 4G0PA 1CRPA 1EXNA 1W8DA 1H5NA 3JAKA 4UZEA 1X1RA 3IXLA 1G38A 4X7BA 1XVUA 4PNZA 2W7TA 5CT9A 5IJAA 1X1DA 4I9GA 3TUZC 1IZ8A 3AF3A 2Y71A 2VJKA 4REMA 4CDRA 4EBBA 5K9ZA 5CA0B 1PGPA 2OLJA 2R2GA 2PGLA 3COPA 3SZUA 4UUBA 4LZNA 1Z4MA 3GH1A 4RHEA 2PGOA 3UGKA 5K09A 1W46A 1UDBA 3ZDRA 1OREA 4YCDA 4ZAZA 1GN8A 4CNBA 3MBKA 3NORA 1XZHA 2WNHA 3B6JA 3SIXA 1F5SA 3SQNA 2XGSA 3E22B 3T1HB 1W35A 2ADMA 1W1IA 2P68A 1M5TA 1G8JA 4WJZA 4UBOA 5FI3A 4WNCA 1E9FA 3JAWA 4B2IA 1M1YE 2EZTA 3JVEA 1G1MA 1RPTA 4REOA 2ISQA 3E53A 1D1QA 1WBJB 3F4LA 4TTVA 3VJMA 3COJA 5FUVA 3O8OA 4JBXA 3PBKA 4CTJA 3AEUB 1Y4ZA 3C3AA 5BPFA 4QBKA 2AJDA 3H84A 2C1ZA 2IVFA 1D8AA 3CY6A 1GQSA 4R84A 2Z58A 4YJHA 5BSWA 1T3ZA 1OWPA 4H1UA 2I8CA 3E9QA 4MCHA 1EK6A 4CKCA 2QTGA 1ND6A 1KGSA 1MA3A 1M6NA 1ZGCA 4JJKA 2QGFA 9ATCA 1KSGA 5F5LA 4E94A 5F3RA 1TYDE 4IG9A 4KN8A 2OA0A 1C0LA 5A5EA 1BMDA 5IKMA 4OQ4A 1O3YA 1A9RA 1ISRA 1QGUB 2I80A 1S6YA 2KI5A 4QNRA 1FW8A 1RE0A 1WZNA 2P41A 1YR2A 2QUJA 2ZIXA 3C5CA 3CLHA 3G9XA 2IIPA 5REQB 4BUCA 3F46A 3ED1A 3FFXA 8ADHA 3HACA 3OJ0A 4CQJA 1A4XA 1W93A 2VIIA 3D8TA 3L79A 5TF0A 1MABA 2V9PA 1VE9A 2ZR7A 4WFQA 4O4JF 2GXAA 3BULA 1HM5A 3B5JA 3LH5A 1XTTA 1TAGA 3EAGA 4N5IX 2WE8A 4RIFA 3REQA 2FFAA 4Q12A 1J0EA 1HFJA 2CXUA 3FJYA 3FZEA 3HCRA 1XWIA 4IRXA 1RD4A 3L8CA 4R1LA 1WDTA 3RH0A 2E4WA 1BKDR 1CYDA 2H4YA 4ASUD 3QVVA 3UMJA 3EGEA 2NYAA 3LU1A 3DDCA 4MR7A 3JVUA 3CH6A 4IP0A 1V7CA 4NE9A 4WN3A 5CJ2A 1F8GA 4EEKA 2WWXA 3EODA 2C2OA 2VPIA 4IF4A 4DWOA 5EJ5A 3X1DA 1ZI8A 3SS7X 2B1RA 4E0BA 3M4NA 4J6EA 2R25B 1SM4A 3R24A 1YRBA 4K03A 4KJZA 4KX5A 1WABA 3OQ6A 4O4HB 1W36C 4QDTA 4R40A 3GAMA 4NS4A 3ZHTA 3JYLA 5J2TB 4AXXA 5F2EA 2P40A 3SHVA 5F9HA 4B6GA 4Y7DA 4QAQA 2HF8A 3LCUA 3LRTA 4MWOA 2H4XA 1IBLB 2RFLA 1UXGA 4GXTA 2X9NA 2Z4RA 1XDBA 1NBEA 2E55A 4TM7A 4GI2A 2J4DA 5E95A 3KUXA 1CV2A 9GPBA 3WZ2A 5BWMA 1D2HA 4ED9A 1JFSA 3FX2A 2JS7A 4U7FA 4QOHA 5ESXA 4YRNA 1LTKA 2J6BA 3M1YA 1VMKA 3CIOA 3C6YA 3GL9A 2XKJE 3HKDA 3PUZA 5DWVA 5H7XA 2IV3A 1QX4A 3H2SA 4XVCA 1N5KA 1PEDA 4PXSA 3GGCA 2HCFA 1VE1A 1UFRA 4C4TA 4TQ9A 2HMVA 3SQLA 1CJVC 1NXQA 3NT2A 3QX9A 3BQ9A 1PJ8A 2ILTA 2XYPA 3HI4A 1M34E 1AK9A 3ZHCA 3KZ1E 4AL4A 3LIPA 4EARA 3WBJA 5BWOA 4HB3A 1IY0A 2IUSA 2ZBDA 1TU0A 4XGQA 2PUVA 5PGMA 1VJTA 3ZWKA 3H8JA 4YX9A 1RHRA 4WNAB 3ZE2B 4U5QA 1ZCAA 2DM6A 3IQFA 5H80A 3W7VA 3UGJA 4R7GA 1W29A 5DM2A 1ADFA 1THGA 1JBQA 1PX2A 3GH3A 4IVNA 2AUTA 1FTQA 1UBUS 1I33A 2HJSA 2O5RA 3ANXA 3DBOB 4G09A 4IMIB 5EJ7A 4AX8A 2F3SA 5ALFA 4B43A 1P5RA 4ZOAA 3AYXB 1XQ9A 3M4ZA 4IIFA 5AK4A 1Q7BA 5FHQA 4A26A 1E2HA 4RULA 1YS4A 1REQB 1W59A 2VBGA 1DJNA 4LE1A 1GPYA 3AF4A 2H5EA 4B6QA 4D3DA 4V0MA 3DVRX 2YN4A 2YTZA 2BFEB 2XZDA 3EIQA 1Q1BA 1VLHA 4N9WA 3TJMA 4BNKA 1ODFA 4BZWA 4AY5A 4N5MA 3WO0A 4J9VA 1DPGA 1NQOA 1WRBA 4YJGA 1RYEA 2H1LA 3GLQA 3RHTA 2AN1A 4EUKA 2G72A 3PC8A 3HV0A 2IU0A 3LHIA 3IAM1 2JAWA 2ODPA 3OT1B 1KZ7B 1MQSA 3OBIA 4J3NA 3WHLA 2PKEA 3BA1A 1G5FA 4F9GA 1X7XB 4G07A 3AUUA 1NMSA 5IJXA 4WGFA 1G3IA 1SR8A 1DRUA 1SA0B 1CJUC 3RU3A 2IZOA 2SKEA 3PFHA 4LXGA 4M9UA 4IFEA 3TLJA 3TFWA 2XNHA 1N5JA 4ZQFA 4PZYA 3GI1A 2HMSA 4WGGA 5ADVA 4PO9A 3CVVA 4PLVA 2GCEA 4FHCA 2G3YA 4JBLA 4TLDA 4U7DA 4EPVA 1K3UB 1TAQA 2OY0A 1TXGA 3ITEA 3NH9A 5TEWA 3SC2A 3P2JA 3VV2A 3WGNA 5BMVA 4IKOA 4N3NA 1USWA 1L7AA 1RPJA 1KMMA 5C5CA 4Y6LA 1LC3A 4BVJA 2NU8A 4FOOA 4UFNA 2J9GA 1W52X 5IKOA 1W36B 2A9PA 4A27A 5F78A 4Q4DA 2R6DA 5LQNA 4FOSA 1I0ZA 1GEGA 3L1KA 3P9KA 3TQQA 2QAGA 4HDMB 4CTNA 2QTCA 1DCFA 4MGEA 3VYSB 5IVDA 3N7TA 5DTEA 4XA8A 1VSQA 4AY4A 1N36B 3DL2A 4E88A 4PG8A 4ITUA 4YBZA 1DKQA 3IPXA 4KN6A 1ML3A 3NWBA 4LRQA 5EMNA 3EA5A 3RK0A 5JC1A 4QNNA 4WTOA 4M9CA 1O57A 1V96A 3AY6A 2YHSA 1YNSA 3ZQJA 2D0IA 4GKBA 2GM3A 3AUKA 2H17A 2I7TA 4YV7A 3DVLA 1D2CA 1VYUA 2IF0A 1TKCA 1P0IA 1TI7A 2HRQA 4MKRA 2AXQA 3GEEA 1ONNA 4P4SB 3KVVA 4X94A 1I0LA 4XVRA 5ILQA 1SZPA 4DR3B 3SN6A 5AI6A 2CYBA 3FA2A 4TKVB 4QBFA 2BTOA 2CLMB 2GXSA 5BT9A 3HJUA 4RH0A 3T34A 4BKMA 2AX4A 4A8TA 1VKNA 4OG2A 4BVGA 2AC7A 2HIHA 4W1SA 4AULA 4Q9KA 5I5EA 2QRNA 2YNMA 2FSHA 1A77A 3TBKA 2NVWA 4K9KA 1UKZA 4WFJA 3O9ZA 4N8DA 5JZMA 4MKIA 4U2DA 2JIOA 2DPXA 3HB5X 4R7ZA 1ENYA 1HWYA 2OCDA 2N1BA 5LKRA 2PTGA 1WPGA 3GCXA 5EVJA 1Z5PA 3W5BA 1JKXA 2ECPA 3TE6A 5JD4A 3G8BA 1UJ6A 1RRPA 5LA6B 1N32B 2JIPA 5EPEA 4D45A 5ALIA 3GGDA 4QEKA 4LDPA 4WUTA 4EI7A 1JKFA 3SEQA 2CVZA 4B75A 2V9ZA 3B89A 2O0KA 4BNXA 4CN8A 4EPYA 5A5VA 1EK1A 2GCOA 3M6FA 2GQ0A 1K2VN 2QQFA 1F5NA 3HGQA 4A10A 4X1KB 3NAMA 4QPJC 3WISA 3ZE0B 2ZVQX 2IYFA 4UDOA 3KQNA 1C3OA 2GJSA 3ODGA 1HEIA 4JS0A 5CFNA 2B92A 2ZRIA 2XXBA 4DPMA 6ADHA 3BOSA 3I9V1 3LLSA 1EJ2A 2Q9UA 2V3VA 3DEYX 4GQIA 2H5JA 1GSAA 4MP6A 2UZ3A 3NRCA 4I0WB 4WFIA 3VHRA 1RADA 1YFZA 1FJHA 2QVCA 3QY9A 3HV2A 4K1XA 2CC2A 4Q16A 5G3ZA 3WBKA 3NYIA 3NHSA 4DCUA 1RAEA 5FTWA 1R0CA 3ZBQA 3UWMA 1LW7A 1NWCA 5BSFA 4B73A 3WGOA 4UMFA 1VI6A 3LCJA 2RHGB 2R7AA 4NU5A 2Z2ZA 4PM4A 3ZIDA 4TXJA 3KIPA 4QELA 3LC1O 3CV3A 3K31A 1JB1A 1PBTA 3X3HA 1TZMA 3HG7A 5F1OA 4C6TA 5EXSA 1VBFA 4BY9E 1OXSC 2J85A 1ODSA 2GESA 3FFAA 5ICEA 4QO7A 5KWSA 3B1YA 5JSZB 5COBA 2CXOA 3TVYA 4YAIA 2CKMA 1SBNE 3ULKA 1U94A 5CFOA 5DCWA 1Y63A 4EGCB 4A6XA 1EP9A 2X7JA 2DPHA 2PT5A 3EE6A 1R9GA 3TR0A 1A0OA 2X8BA 2BR3A 2WHXA 3R7SA 3PR2B 1QV7A 1NSFA 3EEQA 4PQFA 3RPEA 1J97A 3Q6IA 4EDFA 1ABBA 3OOWA 2X5JO 3O4FA 3UJAA 7REQA 1GKIA 1E62A 4MITA 4P80A 4RLHA 1EBUA 5L3RA 3X0DA 1Q15A 1SBQA 3W6UA 4ESVA 3PD1A 3UG6A 4LDJA 2ZCVA 5FO0A 1ZVVA 1NUQA 1UBKS 1CRLA 3ONNA 3ROKA 1CUFA 3JAKB 4U2GA 2C2MA 2OXCA 4RFVA 3X1XA 3MCZA 1KEKA 1WNTA 1QPBA 3ZWXA 4B2LA 1JYFA 1MX1A 3RR2A 3TTTA 3FOAA 3B60A 3WYDA 4Q15A 5KKCA 3TLMA 5C81A 1W36D 2GLUA 2HBQA 3U5TA 4YO7A 1OXKB 2XEDA 3OZGA 3E9NA 4I5GA 5CLIA 5DYNA 2ISSD 3AUSA 4H7KA 3SSAA 1LVGA 3HKBA 3HH8A 4MRPA 2QRJA 3FCCA 2WJWA 1J6UA 1VQ1A 2NTNA 3WFZA 1NSTA 2WBLC 4BLTA 5BUZA 4KHZA 2A0YA 5JCPA 3BKXA 3JAWB 2X19A 1Y5MA 2WW8A 4E5NA 3FZQA 1RXCA 4HQFA 1LCIA 5D1NA 1H1LA 4N5HX 4L08A 3AKZA 4L9AA 3MT0A 4HJRA 4Y2QA 3DLHA 5KINB 5J4HA 5FEMA 4G8BA 4YJHB 2I29A 2GPTA 2D62A 1C41A 4BJ5A 1Q0SA 2VT6A 1S4MA 4BFSA 1G2PA 1QLJA 1NOJA 5CYFA 4CKCB 4Q1VA 1A2KC 1VE7A 2B1QA 1JV2B 3CZ5A 5GINE 3W04A 3WDKA 1XQ6A 2HA2A 1TOAA 4IKPA 4AO6A 5H82A 1Z6PA 2V7WA 1OT3A 1V45E 1K88A 2FW6A 3DNMA 3FSJX 3JWJA 3NIWA 4JP1A 4X7PA 4B71A 1U6JA 2ZIXB 3NNSA 4G37A 1OT5A 2CMDA 3ABSB 4KH1A 4CIWA 5LLSA 1BSVA 3I42A 1FZQA 4Y2TA 3O3OB 2FSGA 4KAFA 3NAQA 1JQAA 3PC8C 4NOKA 3ZCRA 1MABB 1ISIA 2JGMA 2P6MA 1IHXA 3PRKE 5DIFA 1YRYE 1VE3A 1XCBA 3NGMA 1IVSA 1LNQA 2QU8A 3QWIA 4MK4A 1JHRA 1QH8A 1E2GA 1W0KD 3REQB 2O23A 2OM2A 1QV6A 3I53A 1DAHA 3GCGA 2WB4A 3N8IA 3GV0A 3R6LA 3FUWA 5FOQA 1JHVA 3M3DA 1E3MA 2SBTA 1FNSA 3ZVNA 1T36A 1EFRA 3M6WA 1CZKA 5LQUA 4IQ0A 4MR7B 3AI1A 1XJQA 1EVYA 4OIMA 3KOXA 2XRYA 4US1R 1ZRHA 4RCZA 3B1JA 4YCNA 1AUPA 4AKTA 3EW7A 2OYSA 1Y7TA 3HUUA 3ZHSA 3K70D 1Q77A 3CN7A 3UJ8A 2I6QA 3P52A 4TYNA 2P4EA 1HDOA 1U3UA 1GIAA 3FPKA 1X39A 4QVGA 2XCSB 5KYUA 2X9LA 1I6MA 4WBNA 4XM1A 3MAJA 3LDAA 3AHCA 5FLKA 3RC2A 1FFWA 1QORA 2G7MC 2GN0A 3OEHA 5FKJA 2WC1A 3HO8A 4KNVA 4PO8A 5E7MA 2E4AA 4QQKA 4B3DA 2QRLA 3EIEA 4NBLA 5LOVF 2FZLA 4F2DA 3BE4A 4MEAA 3UAGA 1C0PA 2H65A 2QTZA 4IIUA 1YSCA 4RKFA 3V8VA 4FFBA 2FZWA 3JXEA 5EHGA 2JGFA 1P18A 2KLBA 2J3HA 2WIJA 3B53X 5ALOA 3V9AA 4IYRA 2CJYA 2R6ZA 3KLOA 1QXSA 1KSHA 1R5OA 3UAVA 3E9EA 2V7QD 3GRVA 3HKDB 2EKDA 4KBGA 4MLPA 5BN4B 3U3MA 2H9AA 2OSVA 1RJDA 2J3DA 3T12A 3ZW8A 1QONA 2IE0A 3N8HA 1C3JA 3IUMA 3ZV3A 3DF9A 4YIKA 2AT1A 1HLDA 2ZJ4A 1Q0QA 1DWPA 4TMKA 1DC3A 2REQA 4TUYF 3RVNA 4DNQA 4PN3A 3G7SA 3E05A 4S3MA 1KY5A 3VH2A 4U63A 2XE6A 2AUMA 3PC7A 3ESDA 4FGKA 4KXYA 1JT9A 4J1NA 5AW5A 2LNDA 4E09A 1XLVA 2YNMC 4UULA 5CDFA 4IDBA 5ICGA 1TYCA 3BB1A 3OWOA 2VH2A 3FRIA 2EBFX 2HSGA 3QKIA 3W7BA 5H5JA 5C18A 5TB5A 3QE9Y 1QU2A 1ELOA 5E7QA 5EP3A 5K0EA 3FWPA 4DJJA 5C5IA 4FW8A 4LI3X 4MV0A 3GLUA 2FPSA 2WKWA 4LPSA 4AW9A 1FQWA 4GMFA 5DK6A 3HLTA 4UTPA 1JA9A 2OV3A 1SULA 3BB4A 4V24A 1CY1A 3DVAA 4F5YA 1UOPA 4Z4IA 2B3TA 1X1CA 1B73A 1MOQA 3MJHA 5DPMA 1NN3A 4YJGB 1RKVA 4QRDA 2B35A 4W7SA 1I2BA 2R00A 2E87A 1O95A 5B3AA 4UTZA 2N9UA 2IYNA 2IDMA 2WZCA 4KLCA 3HUDA 2JVKA 2ON6A 3K20A 4E4YA 4V1CI 1PLJA 2DX7A 2W8BA 4BU0A 3KKOA 1Z5ZA 1B3BA 2O2ZA 1BDJA 1ECBA 2OCGA 1GG2A 1SNYA 5CA1A 2B2NA 4D42A 5G0SA 1AGYA 5B3LA 1WVGA 1CUDA 3NZEA 3PQEA 1K6JA 5JO9A 1AGRA 3KE8A 1KVRA 1UPBA 3OIWA 4XLLA 2FOXA 3FWYA 2Q5LA 4IHJF 3SC2B 3EPPA 3C3BA 4ZEXA 4YRKA 1P0FA 1DIRA 5BMVB 1YQEA 3C1TA 4Q03A 1N9GB 4LNHA 2R9VA 4HPWA 3R3HA 2WKQA 2NU8B 4B1FA 2GEVA 2OYCA 3BTVA 1RLJA 4DABA 4I1SA 2OMKA 4UZFA 3ZWCA 5AVSA 5EZ5A 4NBUA 5F3DA 1E66A 1R66A 2QAGB 4O2BA 1LPBB 1UQRA 2I8LA 4AS2A 3BM5A 5ULLA 3WDMA 1K75A 2CLFB 3U7FB 4DDHA 4IGFA 2J41A 4BLPA 1IXSB 5J2UF 3QKTA 4YJKA 5CVJA 1QVRA 3L0CA 3MRTA 2G28A 1C7ZA 2IYVA 1O9HA 2OFPA 1QKJA 4P7KA 3I9JA 2E1PA 2J3MA 5CHEA 4NKRA 3VZBA 5KB3A 5F9MA 1WMFA 4M76B 4JV5B 2C9MA 3B5EA 2OHVA 1M7HA 2OHIA 1WJGA 2VHVA 1N7HA 4G67A 2AKEA 3AI3A 3L0ZA 5DYTA 5C8ZA 1YI1A 4HNHA 4RU1A 4YC7A 5L6LB 3P1JA 3CCFA 5TSDA 3L4JA 4LZOA 2D7JA 4R8MA 5I4KA 3PIDA 5JXIA 4KGVA 2ZXFA 3IFSA 2HNKA 1TM7E 1H9CA 3W2GA 1KYTA 1E0JA 3QNUA 2PUWA 2XUKA 3MT7A 4G81A 3ZKWA 5AK5A 2D1QA 5JZOA 3AY3A 1I1OA 4YB8A 4F46A 1YU9A 5JUWA 3ZD7A 3L0OA 2W4QA 3A27A 1M2OB 3U0VA 4M46A 4N76A 3LY8A 1RKXA 2HA7A 2QMHA 3A1NA 2MR5A 3MLAA 4C5BA 1L3CA 1S0UA 5D00A 4JGIA 3PI6A 3TUIC 2RGRA 3CURA 1DE0A 1SXGA 3PGJA 5IS2A 2IOYA 1Y8AA 1YS1X 1X2BA 1X7GA 3T0FA 3WZLA 4FVTA 2JF0A 5AJVB 3PGXA 3DYIA 1JYEA 3HI6A 3ONEA 5KJ1A 3T15A 5LQDA 1S4QA 3SCZA 3WWDA 2C5EA 3N74A 5CVVA 4LFAB 4PZLA 4WESA 4QPZA 4RPIA 2FW0A 4H7HA 4QYMA 3R6GA 3ROFA 2NXJA 2GCOB 4TWAA 5JSYA 2I7XA 4BQPA 4NS1A 5IVPA 1WO8A 4ZCTA 3BXFA 3EWSA 1AZSC 3NIDB 3E9RA 3W3ZB 2XDYA 3ZLUA 1MKYA 4BB9A 2QTVA 3IPYA 1H0KA 4B81A 5FOVA 5LR6A 3LO8A 4B7XA 1Z15A 5JMTA 1OOEA 4IX1A 4MVJG 3DZDA 4I4TF 2XNDD 4HWSA 1YZFA 3RADC 1AF4A 3TM4A 5U1PA 2ATEA 4QXOA 3H7IA 8LDHA 1U65A 4D74A 2PO7A 1B41A 1M2NA 1JIIA 1MPTA 1E7YA 1IOLA 2AQIA 4DV0B 3LMKA 1DGQA 1GUZA 3P9CA 2OSBA 2XMGA 1M2VA 4NPCA 4QAJA 4I55F 4DXDA 1V4BA 2FP3A 5ELXA 2Z6QA 3SOPA 4BEBA 2J45A 1QG4A 2VCYA 3R3ZA 4LJAA 4E7PA 3F49S 3PZRA 4UEKA 4GP7A 3UICA 4C6TB 4CLHA 1ZIDA 2EJWA 5EXDA 2H4HA 1FUYB 3B6KA 1KWKA 2H8KA 1TU4A 1ZJ5A 3R4CA 4EF4A 3FDZA 4PY2A 2VPTA 1Z5VA 2YCBA 1OA1A 5BNZA 3WQQA 1P8JA 1FNNA 2Q41A 3S27A 1LH0A 5JATA 5IT5A 1XNHA 3G1UA 4YMLA 1NQXA 3KRTA 1YQTA 4RSMA 2R60A 4IDDA 1OIWA 4XM0A 1N8KA 3TTVA 3C3XA 1R0XA 7REQB 4KQGA 3L0IB 4IILA 2FYTA 1JJIA 3UW3A 3LUDA 1I6LA 2P1RA 3ZDAA 3OZUA 4LWQA 2WRZA 4FKZA 1E5DA 4I2NA 4OYHA 3DBLA 4PLPA 5CURA 3ZQ6A 1U7DA 5DHRA 1KKMA 3L6EA 2Y1OA 3MB8A 3KZCA 4FYWA 5CW2A 3VC3A 4G8DA 4IAOA 1JEYA 3D7SA 3N7AA 3JATA 3O94A 4XE5A 3ZWOA 2X15A 3GFPA 4G0YA 3EAQA 1G60A 1GCGA 1K08A 3FN4A 5LKAA 4L8FA 3F5SA 3VNUA 1KZYC 3M33A 5FP0A 1Y3AA 4OXYA 4BFLA 4HWRA 3T35A 3C5HA 1I7LA 1ULAA 2IZ0A 3IPAA 2NG1A 4JU8A 1Q11A 3NATA 4KAAA 3HKBB 3ID6C 1H0HA 4CIXA 4E08A 4CL0A 3UJCA 3CLUD 5K8UA 5DYYA 3UAYA 2FZ4A 2W4IA 4HNRA 2QLTA 1PF7E 4L4RA 1E6UA 1MT3A 3Q4GA 1TADA 3V4FA 2VLIA 4FFPA 1BDMA 1H1LB 1XCPA 1TQDA 2FQXA 4OAQA 2C07A 3QPVA 4IIDA 2ALJA 1Z62A 3ZR4B 5K3BA 1WOMA 2I7CA 3R7DA 2A88A 1H2YA 3EH2A 3C6BA 1RPZA 2OMEA 3NGLA 4CKXA 4AJEA 3FMIA 3AVXA 4MO9A 2D8AA 1WXHA 1VCNA 4E5DA 4PCVA 3CKKA 3HM2A 4AUEA 1M2JA 3DLIA 4YXFA 4ZJUA 3BXPA 3MERA 3BDAA 4XVUA 2CMKA 4MDFA 5SY4A 1V0JA 5EQTA 3KJNA 2REOA 2BKUA 2XDQB 1EBBA 4HT3B 5KTRA 3AF1A 2GN2A 1R0YA 2VPZA 1B00A 3OMWA 3A04A 3ED5A 2NQTA 4JEUA 4TGLA 1D9XA 4UTOA 4W99A 1U0BB 2YZ2A 1X8JA 2YNMD 1RI3A 3TDNA 3G0OA 2Z43A 2EZUA 3QKRA 2GZRA 2Z3ZA 1UK9A 4W8HA 2W2XA 3NS7A 3R77A 1XALA 2R00C 2G9UA 1O95C 1L5HA 2I2DA 1HPLA 3MWEA 3L46A 4UCWA 2O2DA 1QH8B 2AA3A 3DT8A 1QF9A 4WQMA 4NZPA 4OBEA 1OFVA 1GKYA 5KCZA 1XF9A 1U7HA 4UD6A 1ULBA 3VR3D 1V7QA 2ZBEA 1TA0A 1TVEA 1L7OA 1UWCA 2YOGA 3HO1A 1SHUX 1T36B 1TMOA 3FPAA 3NMUF 3QVGA 1X9GA 2GVDC 3KUKA 1KXJA 3RABA 4F1KA 4KQ6A 4WCFA 3RHFA 1SRQA 3JYQA 2QVXX 5EQDA 1AO3A 1RTKA 1SJ9A 2C84A 2W2NA 4CIBA 3HJCA 4B32A 1KQFA 5F35A 1JXMA 2QVBA 2VN8A 3PSAA 4FDMA 2V03A 4WBNB 1PV2A 2ZT5A 4U00A 3KQUA 1TUGA 1ZNYA 3M3HA 2IV2X 2RJOA 4HLNA 3G1WA 3AVOA 3B9BA 3GEGA 3N7UA 1WPXA 2FN3A 2WKPA 6AT1A 2G25A 3AP2A 3OWHA 4FYIA 3KT3A 4HMOA 1ODLA 4OJKA 2D1TA 4NXMB 2A2ZA 3JYHA 1A5ZA 3WIVA 2D7CA 2H5IA 1T0BA 2QG6A 3V8RA 5EMLA 4DBLC 5K7SA 4F7DA 1KARA 1SCUA 4FFBB 3HS3A 3RJMA 3IEXA 5HJ5A 1DEXA 2BGNA 3U81A 3V8MA 5JXHA 4P4TA 3IP7A 1X1EA 4MW1A 1HLPA 4MUNA 4OFBA 3H1FA 3R9IA 3UW1A 2J07A 2X0KA 1V39A 1XMQB 4DCNA 4Z9FA 4HI0E 1QZZA 2GAIA 2XCTB 1BTOA 3NTOA 5CLJA 3O73A 4G0QA 4J2OA 3CBQA 4R8LA 1KEPA 5DT9A 1DC8A 2HHLA 5PNTA 3WGTA 3GLVA 5FPHA 3AR9A 3OLVA 1QK4A 4OQYA 5CRIA 4YHHB 3V34A 3KSMA 2DHDA 2REQB 2IBTA 5K0FA 5KHOC 4IH9A 1BFUA 3OCVA 4R2IA 4AUKA 3BMXA 2FEXA 4UTXA 1U8UA 3KOOA 3LNTA 4HVLA 1PWYE 4YCSA 5I3ZA 3RD5A 4Q0MA 4FI3F 1O87A 1B2LA 4J0IA 4DGSA 1YO6A 4YRGA 2LZ0A 2W2KA 2J3IA 1M10A 3K5HA 3WL3A 1J9ZA 1WHSA 3JQ9A 2UYQA 2YV5A 2GPSA 2CL5A 2UV8A 1XLUA 1C1YA 2H11A 2ZRMA 4DY6A 4R9RA 4C4OA 1GZUA 3KWLA 4WY5A 4A2QA 1Z0DA 5IF9A 4P84A 1N34B 4LY6A 4N6NA 2VA9A 2Z2JA 4WHMA 3DVAB 4EO4A 1QVVA 1SQ6A 4OQXA 1TM4E 2X0EA 1YOVA 4LBWA 5DMHA 2RGCA 3C8UA 3BGWA 1U8YA 4RSHA 1LPMA 5ITZA 4ZK2A 1JDNA 1ZRMA 3NGXA 3ZDEA 2IXAA 4YVFA 1P4JA 4FOLA 4CU2A 2QYHA 3UMCA 2FEOA 1ORRA 1QGDA 4YGYA 4BVKA 2FZGA 4EH1A 4CEHA 3LC0A 1YMUA 2W8BB 1D4ZA 1W75A 1VGQA 2EARA 3OEYA 1M7BA 3IVAA 4I8XA 1CUXA 1ZSNA 4Q47A 2DYKA 4D8TA 5CA1B 3DC7A 5EXTA 4V3CA 2E6KA 3CCCA 5LJLA 2BJHA 4MVJF 5EJFA 1B43A 4OJQA 2CE7A 3NBZC 3TTYA 3OWXA 4AURA 2YYYA 4MS1B 3LZCA 4WPGA 4ALLA 1T2NA 4Y9RA 2HV9A 4RL6A 2M1ZA 4EDHA 4JLKA 2QTMA 4BASA 3ER9A 3G0DA 1AKRA 2X41A 3FUUA 2A8YA 3CF4G 3KXDA 4BV2A 4XUGB 5LQKA 3SVLA 2P65A 3KOUA 3UHFA 5BOSA 1RXSA 3IE0A 3S7ZA 5A6SA 4Y1GA 3ADBA 1E3JA 4Q7EA 2WTEA 3OPYI 2BM1A 1AV7A 4AJPA 16PKA 4YP1A 3MBIA 2B2XA 2WLSA 5CEFA 3R4VA 5FJIA 5JYDA 1MG0A 2XMPA 4WDQA 4O2BB 5CIYA 4CM3A 3TLZA 3RWOA 5IANA 2P2ZA 3QEMA 4A4DA 5IZCC 3CLTC 3IRVA 1N2CE 1H1TA 3BIJA 3HYLA 2M6SA 1G9XA 2XOXA 2REBA 3FKSA 3G1TA 3CUVA 3KZXA 4IKEA 4L27A 2FOIA 4B4WA 4ZEVA 1GKUB 3MAGA 4W9RA 4PSVA 1Z0JA 1HDEA 5TT0A 3BE6A 4BNLA 1CRQA 1GU7A 3RFFA 2P3SA 3EXFA 1HURA 2VBCA 2V58A 4UDYX 3Q3GE 4C6RA 5LDDC 2AN9A 3FTEA 2DQYA 2J87A 2O8DA 1CZRA 4MINA 4DN6A 1L1QA 4EKNB 3KYDA 1WW2A 5AW9A 5TQ0A 1T6XA 4HATA 4H3SA 2JH8A 3PGLA 5DTMA 2NLOA 2NV6A 3EGDA 4X8HA 1VFNA 3T3OA 4EG4A 5AVXA 3PDWA 4R2KA 4OB8A 4B83A 2UZAA 2WD8A 3ZKWB 4PIPA 4Q3OA 1NYLA 1UH5A 2XE7A 1B6TA 5EEHA 1HDXA 2RK6A 2Z3VA 2ZBVA 4XWTA 2WJAA 4XQEA 1UKVY 4YUWA 3QOXA 4E1BA 2YWCA 3OEHD 2NAFA 1X14A 2H06A 4TV9A 4HF7A 5I7UA 5LMZA 4MYCA 1A1VA 3BH6A 2W2PA 2RGBA 3L7OA 4BB5A 5LP6B 2PG3A 1QMGA 5JHHB 4F2WA 3NWOA 4X8OA 4F2GA 2AFIE 4BAGA 1XTRA 2J6HA 3RFCA 1UDWA 2VDMB 3GUHA 1ZMBA 2Y27A 3O8DA 3CPEA 5DBGA 5DSZA 3DNPA 4IOLA 2V4MA 3HLKA 2GZHA 1OBCA 2W6NA 1ODJA 1Y1SA 2P2DA 2VK4A 3KELA 1JDVA 3D4LA 3QVMA 2QYTA 4UBJA 3UNXA 3UUFA 3MJVA 1HQKA 1U3TA 2G70A 3DQQA 3AG5A 1HT2E 5JE8A 2NACA 2PFSA 4MEJA 1USKA 1F20A 1DXYA 1ZOPA 5LVAA 2ORWA 4JL8A 2QTVB 2EEPA 2Z2KA 4KG7A 4M4SA 4Q3EA 3CC8A 4OHZA 5K03A 2X6RA 1BWSA 1MTZA 4UVHA 1WV1A 2FWJA 2IDZA 3D8HA 2UXDB 4C3VA 1XU9A 1DMSA 1Q50A 2WMNB 3QEKA 4I14A 3P9RA 4RLQA 5G41A 1XC7A 1XMJA 2XKBA 3QFHA 3TTWA 5E4JA 4LX0A 3DO6A 1I36A 1Q0HA 3DEZA 1B6RA 2C97A 2ZQZA 2VTBA 3EDOA 4MS4A 4IGEA 4JEIA 3W4JA 1THMA 5I7RA 3IIEA 1LDEA 3T0IA 5MFZA 3SLGA 1P7VA 2FWMX 3IA7A 4II2A 2OE2A 2WTAA 1TO6A 4AG6A 5I8PA 2FEKA 1M2VB 3DB2A 4WXRA 1GQ2A 2MSDB 3ZN2A 2OL4A 1N9KA 4O4IF 1CU1A 3OLYA 2G09A 1SIOA 4KGDA 1OZAA 3K05A 1YZNA 1U8CB 2R8XA 3O21A 3W1WA 1PX0A 5KX5F 2V7TA 3MWKA 5DHFA 2CXTA 3U09A 2D1YA 3FDZB 3IVCA 3HP1A 3K9HA 1SUPA 4XFKA 2ZAGA 1Y1RA 2B8JA 4U7WA 2QEQA 3WJAA 3D7MA 1D09A 4KQKA 1TA4A 4JKOA 4IXDA 2JVJA 2X86A 4RTQA 1RLTA 3JYPA 1ZK1A 2C5HA 1O95D 5K8JB 4MJLA 5KDDA 5CDTA 4XDHA 2QW0X 2FETA 1W88A 1Z0ZA 3BA6A 1PYGA 1WMDA 3EYAA 4C1NA 4BQNA 4FFMA 2QHXA 1GSIA 4X44A 1H0SA 5AJWA 5DFAA 4IHAA 4XW2A 2W2LA 3TLEA 5HRAA 1JHXA 1Q1NA 1WQ3A 2NIPA 1E2BA 2P6OA 1A82A 2F43A 3TVDA 2ZIZA 5I9IA 3PEYA 1GUFA 1OWNA 1RRKA 1JIJA 5G1PA 1NN0A 1CZOA 4X3PA 2CGEA 3DBLB 5JCJA 2BBOA 3RYTC 3CN9A 3F0TA 4K28A 2IOFA 1QGZA 3FHOA 3HY6A 1UBJS 1V26A 3PJFA 4G36A 3JATB 1JEYB 3MBOA 5D8DA 1LSJA 3JQQA 3ZHBA 4TVKA 2B82A 1K5HA 2W2TA 2QRUA 2B21A 1YFJA 4DEXA 5I7HA 3AUJB 3AM3A 3PXXA 4ND4A 4XD7A 4EHBA 3W5DA 4NXNB 4F4FA 1Z2DA 3IH5A 4C21A 4KXNA 5LBUA 1FRZA 2D54A 3F1KA 4XQCA 3ICQB 4G0XA 4PAMA 1NP6A 2CKDA 5ALPA 5LYJF 2QMUA 4FYHA 4HFNA 2RHDA 1DEKA 1J7JA 1NF8A 2GTIA 2HA0A 2PXHA 2WF9A 3FD8A 3IKJA 2WUEA 1RZVA 4H15A 4JC5A 3SZRA 1UJ4A 2UZIR 3O8NA 4JDPA 4L3OA 1NJ2A 1WCXA 5AW3A 1MFPA 4P36A 2C94A 1E3TA 4ZYWA 3VZCA 5KVSA 4OV6B 1UOOA 5IN5A 5HKBA 5L6MB 4D8YA 1JPVA 1PDVA 5FUYA 3IVXA 4OIFA 5LZ7A 2C42A 5LWQA 2PH3A 3I05A 1E6WA 1JSCA 2IS4A 5J5AA 1FDRA 1A04A 3GB9A 4MWBA 1HTWA 4OHUA 4C07A 4H3VA 2AL7A 3K2EA 2JLCA 5DM70 3B2QA 3NYRA 1XD2A 1KEUA 3DOIA 1SQFA 3G5AA 3LDUA 3OURA 2PSFA 3OE4A 3QI2A 1E2IA 4O1IA 2XR1A 1KYWA 4UQLA 2FSUA 1KI2A 2RH8A 3FNBA 2FQWA 2A1IA 3AZOA 4GZMA 1QIKA 5I9TA 4YCBA 5LNK1 2WUFA 3IAS6 4W5OA 4JYPA 3IMKA 4G89A 1BFDA 4IRMA 4WKCA 4LQDA 5DM4A 1L8OA 1PJQA 2A0KA 2XD4A 3L5KA 2B8EA 3QKRB 4HQKA 1MV8A 1R3UA 4LJ8A 4RH3A 4WIAA 3JQEA 4NPHA 1Y9JA 1L5HB 1NJ5A 2G80A 1XROA 1DCKA 3MWEB 1P9NA 1NTOA 4Q01A 1BX3A 2O7NA 1CBUA 4O2AF 2VCHA 3NIBA 4UJ3A 1KJZA 4D1YA 4WZBA 3WADA 1FTGA 5I9LA 3ILYA 2GRAA 2DLDA 5IASA 3MJCA 4LGMA 1OGIA 1IVYA 3GT7A 3CINA 1R10A 4J29A 2PL9A 3F5FA 3IEPA 4JJZA 5JRZA 1XXLA 3UXMA 3QVGB 1A7AA 1OFUA 4WCFB 4JI5B 1PZHA 3USZA 1U31A 3IP8A 4WK0B 3QYFA 4UHFA 1I2DA 3KEQA 3QTLA 3BD8A 1NTRA 4N5LA 3SZGA 3A3OA 3UY4A 1GL3A 1QCYA 4W82A 1TUIA 5F51A 4DS3A 1Z4JA 2XX3A 3CRZA 3U3ZA 2QZSA 3TQIA 3EZGA 2WJYA 1JEQA 3L6CA 3MW8A 1JNXX 4CTOA 2HSZA 3AM1A 3E3LA 3TK1A 1RJ9A 2J48A 4E33A 1ZG3A 4CIVA 2F8LA 2PQ2A 1C8VB 5EJMA 1SCUB 3FGOA 2F7SA 3LWZA 4G0WA 2QJTA 1UC8A 1J09A 4XSGA 1N6NA 3IIMA 4RLFA 5A4IS 4LOJA 1NY6A 1S2NA 5JNWA 2G6TA 5EC8A 3CZ4A 1TQ4A 2AI2A 1JHAA 2PX3A 1JIVA 2V6GA 3FY4A 3N0TA 4K05A 4HJXA 3KB2A 1FTYA 4DILA 3RK4A 3I34X 4OMUA 3VZSA 4B0PA 4OHFA 1PQUA 4DJEC 4UXIA 2VJBA 3V2GA 3HYRA 1NL3A 4QJ4A 1KVSA 3LL4A 2VBIA 4MAMA 4C4PA 3BHMA 1NR1A 1U99A 2JKVA 1UP4A 4XEUA 2B99A 2ZQ5A 4UTNA 4BFUA 3Q1KA 4MLDA 1RXUA 4FM9A 4JJ6A 3SIRA 2W2KB 1WHSB 1Z6XA 2EP8A 4Q37A 1L2TA 1A5BB 5DMXA 3C16C 3OLQA 3CW8X 5HEKA 1BDBA 4W5WA 3KJIA 3UAXA 2FUG1 4MRAA 2B4AA 1E1QA 1E2NA 2Q2OA 3L8YA 4K40A 4P32A 5THQA 4EW6A 4TKZA 1Q92A 1X77A 5A2QA 4XVQA 5E2BA 1UQTA 3CUTA 4BRSA 3HB1A 1YOVB 2JFFA 4BE9A 3OF3A 5TMDA 5B12A 1HDYA 2BFNA 4NU8X 4XUDA 4DVJA 5ES4B 4LE2A 5ITZB 5J3JA 4RENA 3VU9A 5EE3A 5C9ZA 5B7GA 5CITA 1JHOA 4QATA 7GPBA 3F9IA 5AVZA 1KY4A 1NVKA 3UK6A 5B3JC 4CEHB 1BZYA 4RZ3A 4G1VA 4NF2A 4TV8F 3VZRA 3Q8MA 2PKQO 4KRYA 2QZ4A 3IR7A 5C1OA 4B4OA 3IQDB 2DR2A 2VJPA 2LV8A 1DQPA 2C8KA 1YASA 1O0CA 3BTUA 1IC6A 3DAPA 1I30A 2D2IA 2JFZA 1QRUA 3QW4B 3UA4A 5HJ7A 3KFXA 1B2RA 2IXEA 3PXAA 3QNWA 5DSTA 2P2NA 3HL4A 3WWZA 5KVVA 1D5CA 2OCXA 5F7JA 3JQ6A 4Z2AA 1K9VF 4M1ZA 4TTIA 3ETEA 1QK5A 1QHIA 6PFKA 3ZTWA 3KBOA 1UBOS 4R5MA 3W9BA 1BVHA 1PN3A 2IXDA 5CP8A 5BOSB 2W42A 5A6SB 3R9WA 3IB6A 4BGDA 1WNFA 2JKZA 5J63A 1W6RA 2ODBA 2R11A 2VVTA 4TMTA 4RMIA 4ARVA 8GPBA 1XNJA 1S8FA 2X9VA 5EOVA 1E0SA 1UC5B 1XZCA 2AR9A 5E2AA 2A5YB 4JT2A 2JCYA 1YQQA 3T5AA 1BAPA 3QEMB 4S0XA 3GLTA 2E3JA 3TOCA 5DTIA 1EVKA 1QZUA 3EC2A 3G82C 1V5WA 2JLWA 4J0DA 3JD1A 3RAEC 3U1VA 1P2DA 2ZJBA 1GLGA 1Y1QA 2AK3A 1SOWA 4KNWA 5DWDA 3HFRA 4LVNA 4RHUA 3EXFB 4EYQA 2NUBA 1L7NA 1T4GA 1Z28A 5DHUA 3WIUA 3R3YA 3OE7A 2O8DB 1NLYA 1Y6QA 3INGA 1Q7GA 3DHEA 3UZUA 3WLMA 2IS6A 3I2FA 2EDAA 3KYDB 4L5YA 5TQ0B 1O0SA 1LRJA 3ZXYA 3QLEA 3EGDB 4WWHA 3W9UA 1H8EA 5DGHA 4GNRA 2OPBA 1YHNA 2X0NA 1KFJB 3GMIA 3UGTA 3BT7A 3H5VA 4MI1A 4D56A 5AOAA 1JDJA 1M2EA 1X15A 1ZMRA 4HN4B 4G1BA 4MHOA 2P6RA 3OM9A 4N18A 3LT2A 4DVGA 3PU6A 3AJ8A 1WL8A 2B1IA 3G02A 3H1BA 4DSUA 1WCWA 4H60A 5H3CA 2PYDA 4TV9B 4Q3KA 2WUWE 5JZVA 3LFUA 1FPQA 3GFOA 4QJ5A 3QKSA 2C7GA 4FSXA 1ZQ1A 2WP8J 1EGMB 2QT1A 1T2DA 4HWPA 1NKSA 4OJTA 5G4KB 2DWQA 4L0QA 4LWPA 1ZD5A 3CG4A 1ZHFA 5JY1A 1FQKA 2DP4E 2AKAB 4JMPA 4AECA 1GQOA 2WYVA 1PUXA 3EBOA 2A1UA 5A0TA 1YQDA 2QRHA 4JLWA 1GNQA 4OAPA 2LCFA 3TQOA 2FNAA 2C2KA 2WAOA 3KAJA 5KQGA 1TEZA 5K0SA 3LPDA 2J3LA 2RI6A 1JEJA 4Q19A 1S3SA 2VSNA 3C4JA 5CDSA 2FW8A 4Z3DA 3EFEA 5CLFA 1QFXA 3FLBA 2BFAA 4H3HB 2GUGA 2XEXA 3EWIA 3BXEA 4MZXA 4KFUA 1PLLA 3P2IA 2J5QA 1FX1A 1Z3CA 2JW5A 1TMYA 5KIAA 2AW3A 1UJMA 2OBMA 2PX5A 4YCMA 2AOTA 1XTBA 2GEJA 1ZRNA 3DP9A 4MS4B 5AP9A 3E5HA 2OFFA 3CVXA 1MO6A 2DTEA 3UT0A 4JAVC 4JLJA 4EUSA 1T4MA 2B98A 3BN3A 3D7RA 3OO1A 3PUJA 4W4TA 4FUQA 4HC4A 3VC7A 3T3NA 1IN8A 1MAHA 3ZXSA 2MYUA 2RGYA 4F6CA 2IHUA 1YZQA 4MW4A 3NHLA 3OQNA 1CNFA 1PI3A 4NL4H 5FOSA 1VJCA 2NZJA 2QPLA 3HC7A 1NMYA 1QHHA 1XPJA 1XVAA 2AF3C 3FGPA 3ZD8A 3RM3A 2O59A 2NXEA 1IJEA 5COAA 2OXIA 2BT4A 3HYNA 3NEJA 1KDRA 1UKBA 4FXPA 1IUPA 4GOOD 4B3MB 4P5EA 2QV7A 4WKOA 4FNOA 2HIMA 2Q5EA 4LXQA 2GK4A 2O1EA 2OESA 2PXXA 2RCNA 4D4MA 4FWIB 3F8SA 3RLIA 4H27A 4WUVA 5E1MA 1MLDA 4O4LF 1DAIA 3ZDQA 4BQEA 1S3FA 4RETA 4LXUA 4DMLA 1O2DA 4BL5A 5CDUA 4DCOA 3OJXA 4XI9A 3VFDA 1ZHOA 3QX3A 1Z34A 1Z4KA 1OFGA 1SUBA 2F43B 1R0BA 1NUUA 1Q7EA 4DAOA 2M98A 2X7HA 1FBTA 3CVUA 3LUBA 2XWSA 2HW8A 1AZTA 1QB7A 5ICCA 1HZJA 3C1OA 2GZSA 4R6WA 1VB3A 3WS7A 1C9JA 4CUKA 4XKJA 2VNSA 4XOUA 3A1VA 3BGOS 4I8IA 1MG5A 2E85A 4CKZA 1I1NA 2GD6A 2XRMA 5B58T 2OLKA 2VOEA 4FDAA 4REQA 3RIEA 2IODA 3WB9A 5ABPA 1EX6A 2PE5A 3NBMA 3TSOA 2RB5A 3D6FA 4QU0A 4U9UA 4PE5B 2JIQA 5ILGA 3I6ZA 3T7AA 2EV9A 2MIIA 4KACA 1WWKA 3OAAA 4S1NA 3TGPA 3QVSA 1DXOA 2GPYA 5F21A 4EPTA 2EG9A 3A6KA 4DY4A 2C95A 1TQ2A 3D6UA 4K0KB 3GZ4A 2CNNA 2AV6A 1POXA 3FKSD 4KIJA 1K8XB 1ZR2A 1R5JA 2IH5A 3T0GA 3ROPA 2WF8A 3CX7A 3COWA 3RGWS 2Z0MA 4KFCA 1KEVA 1LSUA 3DZCA 1MF7A 2Z2IA 1E6CA 5H68A 1GQYA 5BW8A 1JAHA 3T61A 5DHAA 5AUPB 4JP5A 1P0MA 4QD3A 1XEWX 4Q4JA 5SY9A 4UU1A 3I1IA 3JU3A 4L3WA 1JR3A 2WYUA 2C0CA 1SZDA 2YRXA 4G8CA 3WLJA 1U2PA 4WJLA 5T67A 3RNLA 4YCLA 3U61B 2XA9A 5IM4F 4Q21A 5D51S 5ED4A 1QVAA 1XD2B 2JFVA 1JFFA 4NCNA 7ABPA 1ENPA 4HGQA 2JAXA 1HRKA 4M8LA 2R8ZA 4GPIB 1NW4A 1TGVA 2ZRLA 3HXTA 4MVWA 2F1HA 2R8BA 4X6LA 3AC0A 1NVXQ 4FYXA 4PSAA 4RCVA 3PCTA 4FGLA 4BN0A 5C7OO 4N48A 4AJ4A 4ILEA 5DYIA 1GUAA 3TRFA 3QW2A 4OXQA 1Q5PA 3L6RA 3CNBA 4Q7LA 1SOUA 2O8FA 1A7JA 4IGAA 1NJ8A 3T3DA 1ST2A 4INPA 4A6DA 4DMHA 1RM3A 2PUBA 4NH4A 1WSWA 4YMWA 3TOXA 4MI3A 3L40A 1YNOA 4QGAA 1EK5A 5K0ZA 2WWGA 3BL8A 4PRKA 4WZBB 1QTRA 3C4QA 5EE1A 1PGJA 4Z9YA 3HZRA 1J06A 3AKEA 3VXKA 3T7DA 3P7MA 3EAFA 1KMQA 4S1OA 2V4UA 5A71A 4QXQA 2HMWA 3G68A 3AB7A 4I5IA 2Q6TA 2OB2A 2C4NA 5CUQA 5EUBA 1R7RA 2AG1A 1XRNA 2WMYA 1L4YA 5LM3A 2PMDA 1JFLA 5FWNA 1FEZA 3W7AA 3T3GA 5CLHA 3DPUA 3TM5A 2O3RA 4ALMA 4WESB 2H2FA 1GTJ1 2GEDA 2AEMA 4MA5A 4PTZA 5B4VA 1W5FA 4QZVA 4DIEA 2JLZA 1GAQA 4XX0A 5THXA 4C2UA 2J5KA 2A1TS 3SSOA 1XMSA 1UOQA 1P5FA 4M1OA 4PYRA 3W06A 4LF9B 1FZTA 1JEQB 1KOJA 1D8TA 4OA8A 1IM8A 1MXHA 5DDIP 1FYVA 4KQCA 3S40A 3QA9A 3TX6A 1YDHA 1RJ9B 3DYBA 4D2IA 2IHBA 4MULA 3D8NA 4AQYB 1KIAA 1UBRS 1UM8A 4A2WA 3EUEA 2Y4NA 3NVAA 4ISBA 3VVLA 3U3DA 5JAZA 5L7TA 4X00A 3ORHA 2Y6UA 5JC8A 4JXZA 3WLFA 2OAGA 3WWEA 2NGRA 4QFCA 2QRMA 4QOEA 5HFNA 4X1YA 4MWGA 4XEHA 2BEVB 3CB4A 4TWJA 5DXJA 1Q0ZA 4N3CA 3WLOA 5KNBA 1E9AA 2JIBA 1DO2A 4KGXA 2XPCA 2IPOA 4HYYA 4Y1EA 1ISJA 4ADSG 1WU8A 3NHRA 3ONFA 3BYZA 4GGOA 5AKJA 5BN5A 4KREA 4NH0A 4BMCA 1ZINA 2Y67A 4YROA 4D4JA 5AKGA 3LBAA 1KAEA 3CS3A 5ALYA 1A9XB 1Z33A 2W2LD 1G6OA 2A3RA 2X1HA 3WA6A 3NHPA 1GRNA 1VMDA 5BQPA 5GOZA 3F2IA 3STVA 2P90A 3HBAA 5JCJD 3RVBA 3H9EO 2CNLA 2A9RA 5INTA 1SHZA 4M7WA 4IZ6A 2DG2A 1Q14A 4RHCA 2IU4A 5H02A 3D9QX 4JVOA 2YJ3A 3ZWQA 4AMZA 4CDMA 4DA9A 3ICCA 2CUKA 2NOAA 3FUTA 4DLRA 1GNLA 5K3EA 2RGDA 3NI2A 1EXVA 2VJYA 1YD7A 1XA0A 2CCJA 2D5LA 2PRZA 4KXQA 4NV3A 2NZ8A 4OFXA 4XD7D 4KPGA 5HJEA 4IXWA 3N3BC 1K7FB 3VU9B 5KBYA 2HEIA 2RKOA 2PBLA 4L76A 3TXXA 1I5RA 2Q2QA 4OH7A 2VDVE 2QQEA 3KFLA 2VHZA 3GC6A 1EB9A 3UF0A 5L3VA 4RDXA 2WWFA 4U2CA 3H65A 3FOFC 4MGHA 1UMBA 3LP8A 2XNCA 3EY4A 4OX9B 4BTEA 2BH2A 1N7JA 3MOGA 4ZVKA 3ZTYA 3SQXA 2FMFA 3Q2OA 2ZRDA 5KOYA 3U16A 2IKSA 4IX9A 1J5EB 1CUGA 1ZH8A 1VCOA 4ODIA 1ISMA 3G8AA 3ILXA 4OB6A 4B79A 2GBLA 4ER0A 4HH3C 4EYSA 5FBVB 2BWJA 4H7IA 2C5GA 3DEIA 5JY6A 1PEYA 3TL2A 2FWRA 3RSQA 2FEAA 2VK8A 4RK7A 4G0VA 5GGXA 1WEKA 2J7PD 1VOTA 3KXPA 3BMOA 3PDCA 4FDVA 2YMQA 2XHEA 1M6WA 3SQDA 3H9GA 5DI3A 2WG1A 3VISA 2OG2A 4CYMA 3UA3A 2G07A 3R7FA 1GDDA 1SOAA 1H8HA 3H19A 3U17A 1SOVA 5TR9A 5MFPA 1PR9A 2A9QA 3ELDA 2Q8PA 3HSSA 1N6HA 2A94A 1YACA 4YMGA 3HCFA 1K1EA 1ZHHA 3D8BA 4PPYA 2QMYA 5LPNA 3H6KA 1T5LA 3FTQA 4S1WA 1VLVA 3ADKA 1DX6A 1OU4A 1PFQA 2CLOB 4HNUA 5IU6A 1UJNA 4Q9IA 3TCKA 3QG5A 1H94A 2QUIA 4IS3A 4BNMA 1RNLA 4DIKA 1GM5A 3AU8A 1QO0A 3FNHA 5CT8A 3QY0A 4LYDA 1GNTA 5DGIA 2EWVA 3R6DA 5GADl 1VFPA 2HADA 1KO4A 3ES9A 2CYCA 4HZGA 4LPKA 5DW3A 1YJQA 2O50A 1UMDA 2DBYA 3D31A 4R01A 3V48A 4V02A 5E3IA 5H0IA 3AFOA 4BLUA 3T7SA 4GHWA 5A3JA 5FB3A 4CBVA 6YASA 2UUAB 4QM6A 1GL9B 4J0EA 3ZDDA 1BS1A 3IQXA 2ASEA 3OHMA 4OSOA 3NWPA 3LZDA 2ZR0A 3DL0A 4G23A 1D1SA 1UDRA 1PK9A 4HWOA 3A7DA 4PANA 3ZCVA 5CG1A 1KORA 3ZJYA 4F1WA 1UPXA 3H5OA 3ESZA 3QKSB 3RV4A 2WM2A 3S4YA 5JWRA 3MIZA 3BGSA 5AVTA 4LIPD 3KD2A 3LPMA 4M53A 5A6VA 2HRDA 2H3EA 2IY8A 3DZ8A 4K87A 3W0LB 5JAHA 4JOQA 4PCUA 5JDIA 4TQGA 1B42A 1Q0LA 3ON5A 1PCXA 2A1UB 3W9SA 3K71B 5EIBC 2XXAA 2GBFA 3DOEA 4DYDA 2D0DA 2RIPA 2YQZA 4HYTA 5AHOA 1XKQA 1ZNQO 3OJEA 4YMHA 2V55B 4CM8A 1SVMA 4JLAA 3VM6A 5BR7A 4HDSA 3CM0A 3HVKA 5LQCA 4R51A 5IABA 4KR7A 1WXFA 1MRNA 3ASZA 5KUTA 2C8JA 1R8YA 2YUTA 2IL1A 4EPWA 2DWCA 3UM9A 1SU6A 1XTSA 1ZMXA 5C32A 3IBYA 1FY2A 1E1CA 2W6QA 1G5PA 2AOTB 5HK9A 4AZTA 2ERXA 3N2GA 2WI8A 4ZVNA 1XQYA 4NULA 5KAMA 1VP3A 1U0LA 2R6R1 3V4ZA 1PL6A 1KK3A 1EFDN 1J0BA 2V7GA 3OE5A 3WSTA 4B35A 2H7CA 3BXXA 3OE1A 1GYPA 2AZ4A 4HDCA 1E1QD 3G8DA 7ADHA 4WCVA 2ZUUA 3L04A 3RFVA 3CXRA 1JBEA 3CRQA 1GVNB 1QHHB 2R4UA 2PHZA 4EY8A 4CKWB 3IERA 4KWIA 3ZI4A 3DV9A 4CF7A 2EU8A 3TD2A 3CNNA 1MMFB 3TNFA 2OV4A 5AD1A 4M2LA 3RSLA 5C8YB 1IVNA 4Q1EA 3GLIE 1O94A 5K6AA 1KGDA 2NAPA 3D6VA 2GJKA 4DZZA 1JU9A 1UZNA 2OUIA 4D43A 2OK7A 4MUJA 4V2UA 2B8NA 2BR5A 4Q9JA 5DJ5A 3UV7A 2PRSA 4A3SA 1E98A 3WJ7A 4RDCA 5CYPA 2VDPB 1T4DA 4RE6A 1GSOA 5ER6A 1A5AB 3QGMA 1DRKA 1E6LA 1NW6A 4FLEA 3HVRA 4ZU6X 2IYRA 4I4NA 4LXHA 2NYRA 2GCIA 3O8RA 3L4BA 1E60A 2Q50A 3P2YA 3TEFA 3NTRA 4GH5A 4YP7A 3T3MB 4REQB 4YCCA 4HZIA 1D0SA 2IKQA 2MYNA 1XAHA 3F7TA 1QR6A 1W4ZA 3RYHA 3ZY2A 1C2TA 4JLDA 2XYRA 1W2WB 2Y66A 1C29B 3BMNA 4FD3A 5T4EA 5JSUA 2JBAA 3GLGE 3IHTA 1TB4A 4QKQA 3H87A 1WPQA 4M0MA 1UQUA 2QTWB 3RAJA 1YT5A 1ZITA 3C3WA 2AG0A 3DS8A 3WFJA 4IOMA 4CKYA 3ZW9A 4FT4A 3DXXA 3JZAA 1C14A 1WKBA 4NV1A 10MHA 4EL5A 4XR9A 2V0CA 1P9RA 3CWQA 2DFTA 2YZGA 5DTQA 2YC2C 2OKGA 2VPXA 4IL5A 2L19A 1DQYA 1BD4A 4MQEA 4GSYA 3ORSA 1U9IA 3OE7D 1GLNA 1KI3A 1YS9A 4Q4JB 3RKRA 4FFOA 2FG7C 3H11A 4UARA 4AZVA 4QX6A 2GX6A 4P2GA 5C0OE 2HK6A 2MYPA 5CT6A 1PKXA 5JFGA 1H8ED 1QE5A 4W6ZA 1CZUA 1JFFB 2ZSBA 3L5OA 2JLYA 3MFQA 5DGTA 5JQGA 1FNCA 4M0KA 1VP9A 3PXGA 3E4DA 1NG9A 1YJXA 1UWKA 2OBNA 2XB2A 1JH8A 2JZCA 5JLAA 3G8YA 4P3OA 5JLJA 2GSWA 3JQPA 1M8FA 3BIFA 3ZY3A 5MGBA 4DJTA 3SKVA 4GZ6A 3HSYA 3PG5A 4GRDA 3TVTA 5KTTA 5BP7A 1ADYA 4JK3A 3E7FA 4FB4A 2L0XA 4Z7QB 2I03A 2QX6A 2PVPA 3CPSA 4RD4A 5TQVA 2YJGA 1DFGA 2C1XA 3DNFA 3E84A 2DKOA 2X76A 5U9CA 1ID8A 2I3DA 2RHRA 1SK8A 3NBYC 4F4IA 3T5MA 1M1NA 1TZ2A 1OXBB 4XUCA 2NUPA 3LX6A 4EVRA 3EUAA 4OBWA 2BFMA 4RORA 3GVCA 1KVQA 2LBPA 4KI0A 4R8RA 3QTBA 3GDHA 4JB3A 1OMOA 5DLEA 3H1EA 2GBLC 4AJHA 4QTXA 3GMTA 4KV7A 2O8NA 5A7FA 4QUBA 3G2PA 1KAOA 4HMPA 5JD3A 4PW0A 2GNPA 1XCJA 2DQKA 2O3QA 3FHLA 2OXTA 1WZEA 1R15A 4EAAA 1IK6A 3F6YA 4XX0B 4OQDA 3FUVA 4PTLA 5L95A 4C0AC 4JZYA 1FMLA 3HBNA 4LGCA 2RD2A 3VYTB 1G4AE 3IBFA 4KSCA 3M5CA 1Q21A 1UOEA 4KAXA 2PD3A 4KI7A 3BXOA 5KREA 1ZRSA 4JENA 1BOOA 2YJ6A 4DA7A 4M1QA 1KTIA 1NRXA 1SQSA 2ZPUA 3EUFA 3AVQA 5EP1A 2X8LA 2QY6A 4JLSA 4ZVQA 4HDNA 1Y9DA 2RGWA 3QVTA 3KSAC 4HG2A 3KK0A 1QUEA 4MXDA 5CNKA 1PS9A 3BC1A 3ENVA 1KR2A 5SY6A 1E2DA 5TGTA 1FLVA 3N6XA 1PT5A 3OFKA 4GT1A 1CRZA 1TJ3A 3O90A 3AFGA 4X1YB 2K2WA 2R1UA 4JOSA 3WWOA 2ZTUA 5M34A 1SXJA 4RTSA 1EWRA 3BH0A 1GPAA 1D2EA 3RREA 2PGAA 3WGMA 1Y4AE 4HNAA 4TXLA 3PE4A 1HE5A 2IGBA 3DMGA 4MROA 1CUWA 4NQZA 4UPVA 5BN5B 1M0SA 4MYUA 3HP7A 5LZ8A 4D3YA 4DPLA 5A04A 1SC6A 2BDEA 3TLYA 3L7AA 1AHIA 3NV9A 5EZYF 4N47A 4RD6A 5KZMB 1QDUA 4QPCA 3A1CA 5KYKA 3EBLA 1KAHA 4AMUA 4HSGA 3TR5A 2ZJ0A 3LDFA 1E94E 3QFFA 1B74A 3KJEA 4R98A 1RXWA 2PUTA 2UYHA 3ZU5A 1I4TD 2ZIGA 2MINB 4BC0A 2LWIA 3E27A 3QXCA 3E9MA 4TTJA 1J8DA 2J9RA 1SXIA 3I45A 1OUMA 2DT5A 3MSXA 2WZQA 1O08A 2JL1A 3B48A 2QX8A 2BFWA 4QQFA 3RC3A 3UXEA 1M8PA 3BEOA 5ALHA 3FPHA 4FBGA 3S1AA 3RJ9A 3VR4A 4BVAA 4EF5A 3ZTTA 3UJBA 1DX4A 1NT2A 3LUPA 1MJGA 1NV9A 4ZPJA 5HBGA 4XPIA 3QSYA 5C7LO 4YT8A 1AURA 2PFGA 2V1UA 3A3PA 2FQ1A 4D25A 4GWGA 3OAAD 1G17A 5J5VA 1KP3A 4F3YA 2ZFUA 1PR3A 2O4CA 2QMZA 4OQLA 4UU8A 3U7QA 1E69A 1O8CA 5ALGA 4BATA 4QYSA 1ZISA 2NSLA 3GW8A 5HGJA 4FGJA 1JMKC 1UMBB 3SC3A 3K09A 4F97A 1HG0A 1GCAA 1QGOA 2GI4A 4AM8A 4S2EA 5HQ3A 4A36A 1Y4DE 3NEPX 1NVVQ 3H5WA 2ZJ7A 1NN5A 3V00A 2YXLA 3TS1A 2PSSA 3E3MA 1CUHA 2PX4A 1NGSA 3I8SA 3ZZMA 3OUZA 5DLPA 3RC9A 4P22A 1HE8B 5CDHA 1TTTA 1W47A 2FPLA 5K0JA 3N07A 1YVPA 2P0YA 1UCFA 1FVXA 1JR3D 3E7DA 3LOUA 3SP1A 5A02A 2K87A 5KNLA 2AXEA 3V55A 4ARBA 3LG2A 1RBMA 4TL8A 3RF6A 3SKXA 3IE2A 1MEOA 2IDJA 1DQNA 2C9OA 2ZB2A 4KK4A 1T6NA 2WKRA 4QDKA 3BMOB 4HUTA 5CPBA 4ZJZA 1DBWA 4AN1A 3A3KA 1ZOSA 2H2HA 1IUKA 2J5RA 2J6IA 2WM9B 2DRIA 2JDID 2Y3IA 3NP9A 3GUUA 5DI3B 5AICA 5FV7A 4FCTA 4OAOA 1F4VA 2A5DA 3E2PA 3VPCA 1D2GA 5JPIA 2PMFA 1YTLA 2DCMA 1DRVA 3SYLA 5K6AC 4FIZA 2B4RO 1KZ4A 3OFJA 4I4CA 1Y8ZA 1P1KA 1PL8A 2GEUA 3H0EA 3K1YA 4OREX 1CS4C 4TLLB 2V3CC 1OGYA 1A95A 4W9MC 2WT9A 5H16A 3TF5A 9MHTA 4DCPA 2FFBA 2GYYA 2P9JA 3I2KA 4FGZA 1RQPA 4EZBA 3MWYW 1TFRA 3AL3A 3FZNA 5LZ4A 3DL7A 1UJCA 1LQ2A 4A03A 4G5XA 3UJDA 1XMOB 3NFYA 2PA3A 1JSRA 3UAOA 2Q6OA 4MP3A 5FD8A 4HN2A 4QIHA 4TL6A 3HY4A 1C9YA 3BL5A 1E2JA 3WRXA 1L5WA 1UMDB 1KZ1A 2EX4A 3L4BC 2WK1A 2IPLA 3DZFA 4TRNA 4OKNA 3FIUA 1WZUA 3U4IA 4JQCA 4UM5A 3WL7A 4B4DA 5BUCA 3WE7A 3FTFA 1QR2A 1JDSA 3C1AA 3EVFA 3WQSB 3IT2A 4HDRA 4QXPA 4WOBA 4EG5A 1A50B 2L2QA 3IUNA 4EGAA 1MN6A 2ZYHA 4C14A 4GI5A 3GLRA 2AC4A 1UKCA 5MN4A 1SBYA 2C0QA 3R75A 4D97A 2RJ3A 2ZTLA 3DLBA 3QQPA 1YB6A 1KFKB 2H31A 2G9VA 3H0CA 4OJMX 1P3JA 4OXNA 3ZCQA 4DQ0A 4RHYA 1ZS9A 4O4HF 2QN7A 2ZANA 2OD2A 4WKGA 4ZT7A 3M34A 3QG1A 1V5GA 4WAUA 5J2TF 2WIBA 4YR7A 4HXYA 4ZEWA 4ENRA 1OR8A 4XWKA 3LBIA 4AO7A 4C4XA 1JPNA 2Z8XA 3IKVA 4GPZA 2XXAB 3V1YA 2LTAA 3MQ4A 1KRWA 4OXIA 1WVMA 4EQ6A 3K3PA 1VA5A 4CM8B 4H77A 4DMRA 1WUYA 2J9XB 4HDSB 4GOND 5KNBD 2FZCA 5M2QA 3A3YA 4IIEA 3U6KA 2MSNA 2LE0A 1TRKA 3HWWA 3ISJA 4WLFA 4ZARA 1Y8QA 5C4IA 5HZGA 1EAYA 5AVWA 3VA7A 3KT8A 4J0GA 3CUKA 1U1GA 2CLDX 1UZAA 3NVKI 4N0QA 5KTNA 1TJ4A 3EULA 2PLFA 4LBYA 4ZVSA 1Y1LA 1E1CB 4KRXA 1GZ7A 3EDCA 3W2IA 5JJ5A 3PV0A 2PGXA 3RFXA 4BNTA 4QC2A 2B37A 3QEOA 3N2GB 4FPXA 4RS3A 2EP7A 3I6BA 3ZNNA 1FQJA 5YASA 2ZIAA 3IBCA 1CFJA 1RVDA 3A9UA 2UUBB 2F00A 4IJ5A 1IN6A 1M2HA 3QUAA 3TW8A 3KC2A 4A0QA 4DQVA 3OD1A 2Z3WA 1SXJE 3TRIA 4YJ3F 3RBVA 3O91A 4M87A 1SG9A 1J33A 2LKDA 3MXOA 3O8QA 4NAHA 2BVNA 2HBYA 2YIVX 1ACLA 3T1NA 1BIFA 2Y99A 4TMZA 2PK3A 2QM8A 5AWFC 1XELA 4O6VA 4KPUA 4UM9B 3CZCA 3GFFA 4RYLA 4YP0A 1MFZA 4L5IA 2Z4SA 2QRGA 3HCCA 3ICVA 4B40A 3PGA1 3B1FA 3G17A 3GXBA 3ST7A 4NOMA 4BQRA 2JD2A 4KPEC 2R6AA 5JROA 5ILOA 1G6KA 2XD9A 2EIXA 2ZBQA 1YR9A 1CKEA 2AMJA 4C0WA 3KLBA 2UYOA 1ISGA 3GU3A 5T3UA 3BJIC 3H2IA 5LXTA 1C8KA 1WXQA 4C22A 2WSLA 4WXPA 2OCYC 3H2KA 1G64A 4KOAA 3HMKA 2G83A 3M1LA 4YYEA 1VL8A 1K8YB 1SCNE 3DLTA 1YUNA 2JFQA 4EPRA 2ACVA 2GASA 4JQSA 3X2SA 3GCWA 4AZSA 3BMNB 1PT9A 2OQRA 3HO6A 5E7JA 4ETMA 2EFDB 2IBMA 4FYJA 2JBAB 1MUUA 3A8TA 2AIRA 3PX3A 1HYQA 1RBQA 2BGUA 4RL4A 5AOCA 4DR4B 5EZSA 1H8HD 1SXJC 4F60A 3EA4A 3R8FA 2R1ZA 1JDBC 1NXTA 4A73A 4OKIA 4XWWA 3EEYA 2HJRA 4AIIA 1TT7A 4OP1A 4DAEA 4ARUA 4P2BA 2HPZA 2YOHA 4M54A 5FPSA 3PYMA 4PX5A 1QB8A 3SG0A 1FIUA 1T9BA 3NYQA 3M81A 1FUKA 3SJUA 3CUEF 4MQEB 4NCHA 1USUA 4NATA 1QO0D 2VP9A 3PQ6A 4R1UA 4UOQA 1WR8A 1YRAA 4F85A 2DFPA 5K6TA 2H4ZA 4UAUA 1KFCB 1Y80A 3H11B 1F1JA 1R8XA 1P2UA 1DJPA 2G1UA 5HIIA 4B4UA 4C06A 3SQWA 2G1AA 1VYTA 3KVYA 5BV1A 1H5UA 1EFVA 2P1ZA 1UBLS 1HG1A 1Z2NX 2WQ6A 2BJVA 4IR7A 4OHVA 5H59A 5JQGB 3PDHA 3WQBA 3TNYA 5FAKA 2H59A 3AHDA 3JZMA 3IX7A 2ZRJA 2P9EA 3CA8A 2ZT6A 4OQQA 1PO7A 2I76A 4TLMB 4OQNA 4GZ3A 3F2VA 4PLFA 5ERXA 1V5EA 3ML1A 2PMWB 1GGEA 3ELBA 1BROA 3U3KA 3ADOA 1RXIA 3QU4A 2EBUA 1Z6AA 3TBHA 4ZN6A 2QTBA 4V0NA 4K26A 2R7LA 3NG1A 4YRPA 4BQFA 2IIBA 4Z0PA 3K09C 4ZZIA 2Z08A 3DWIA 5FWAA 2GYVA 1CJMA 5AO9A 5FUBA 5HZMA 3L8ZA 1I8TA 3G13A 2R65A 2CV1A 1R6BX 1T26A 3IESA 4BMPB 1M1NB 3HHEA 2YVUA 2ZSAA 2NUPB 3ELWA 3JWEA 1HNNA 4N54A 3DONA 4KYIB 5L4SA 3NOOA 2O3SA 3O4JA 5HCIA 1JHYA 1HLGA 3OJCA 4HQRA 1SMKA 1LK5A 2Q9BA 1Z6ZA 2Z30A 2GN6A 2J3EA 2C4HA 2R96A 3VR1A 4P7JA 4U7TB 5LA6F 4RQUA 3F3YA 5EWJA 3NCTA 4F8EA 1VMAA 3IPRA 1JIXA 4LF8B 3ZD9A 1QP8A 1JVBA 2VH1A 2ZXUA 2W6CX 3QVWA 1OD6A 4ARIA 3NRJA 3I6MA 1RYFA 4MCAA 3P45A 2NO0A 3Q5EA 2P0AA 4K6FA 3OX3A 3PEEA 4DCSA 1Y6FA 1PFUA 1TO1E 3DE0X 1CNMA 2GXQA 3AWDA 4X54A 1O4VA 1J7KA 5EJEA 1EM8A 4HDNB 5JTTA 3K9GA 3NM6B 4MUXA 4WMLA 4GE3A 3NIGB 5FULA 3OICA 3KDSE 3A9CA 2Y93A 4X92A 4BNGA 4Z51A 2HRCA 1OXTA 2RAFA 2MCFA 3U4AA 3ICEA 3RTEA 4BMYA 2F4VB 1EX7A 2IEYA 3QOWA 1CHDA 4XFJA 1GZVA 1JDBB 1LPSA 1VHWA 3AGPA 4HEJA 3ROTA 5CFLA 4HNAB 4B3SB 2ZRAA 2DZDA 4JYMA 3ECSA 3RIMA 1O94D 2OYRA 3RUPA 3V4PB 4Q4CA 5J47A 1G8FA 1QP4A 4LJRA 1T6BY 1IJKA 2GCGA 2XIJA 3OOHA 4PPGA 3VNAA 4IUBS 5HFAA 4U5XA 1ECPA 2DJIA 1ZMTA 1PR0A 4PFQA 721PA 1MC1A 2O8BA 4K9SA 1HH4A 4QQRA 5I3CA 2VKTA 4DV2B 2XYHA 4RIGA 2JFHA 4CJXA 3L8DA 2QTTA 3UCEA 2AXNA 4RPCA 4BPRA 4QWWA 2I3GA 2FFJA 1QFSA 1B7GO 4FFDA 2O1SA 5FO1A 4OVKA 3SQMA 1B76A 4MVYA 5EHXA 3K1JA 1EFTA 2QB5A 3ZPXA 2F17A 1IN1A 3LXXA 2NU9B 1A76A 4MVJE 3EVTA 1BHQ1 5KSZA 4B3TB 2V8BA 3HCAA 4QSMA 3S1AB 5G0VA 1QJCA 1F12A 2OK8A 5H9VA 3VVMA 3AY7A 4H59A 1NBAA 1NZFA 4XPIB 3GUVA 3I32A 2JB9A 3HGTA 5CXXA 1F9EA 4D81A 4DF3A 3Q87B 3D6MA 3LDGA 4BFVA 2ZR8A 3HFSA 3H2BA 4FI3C 3A14A 4BLVA 1SXHA 1Z7BA 2PKWA 3TGWA 3TJZA 4X7RA 3PX7A 2YWJA 5BQOA 3DXFA 3F6EX 5E3HA 4D9FA 2W6PA 2C2GA 3F4KA 3QJGA 4M1YA 1G4HA 2C9ZA 2JEYA 2PRIA 1MB0A 1TDJA 2I4LA 2W11A 3T95A 1B0PA 2JGLA 3MAAC 4AYWA 1XZDA 4TMWA 1L5GB 3E82A 1KMHA 4TLCA 3S55A 2GPJA 3PDJA 2IZ1A 3V4LA 3Q7QA 4F21A 2XIQA 1QRDA 3OOYA 3EPHA 3FZYA 2AHOA 3SF0A 4URXR 3G5TA 4DV7B 1U0NA 3SYRA 3C7TA 3R5KA 3RS8A 1D6NA 2NPOA 3S1LA 4YI3A 4BE4A 4MMXB 1VHQA 2E0IA 5E9AA 4D41A 4RAOA 4BIIA 2VQ3A 5CW1A 3WG9A 4Z7NB 5AIAA 3FMPB 3MJFA 1Y7HA 2B0CA 5GQSA 3ZK9A 4WLEA 3AJEA 1AMOA 1EA7A 2XH8A 3O1IC 1VHDA 2PZLA 1GZ5A 4HLCA 5TLSA 4HXEB 1T1IA 5ALKA 5IWCA 3U31A 2MMCA 1Z7WA 5D3ZA 5JTUA 4DADA 1N0IA 4UUNA 4EY6A 3L7LA 3FB1A 2HT6A 3AP3A 2HEGA 1QHGA 4MGYR 5HF6A 4EHJA 3LL7A 4UPEA 4DMMA 5NLLA 2O2XA 3LVFO 1Q3HA 5TGDA 5AKLA 5KYVA 2DPYA 3O93A 2Q5FA 3GF4A 5IWAB 4TL7A 1W96A 1OPXA 3TI9A 4JUDX 1JXQA 3WHPA 1ESDA 3LQ1A 5HOQA 2NO4A 1NXPA 3OQVA 3GRUA 4YRIA 3ZVMA 5FDFA 1ZH6A 4P7FA 4DSOA 3G59A 3O75A 3ND8A 1UFQA 4A0RA 3FYHA 4LYJA 2EP5A 3TDMA 1FJGB 1YGPA 1IRIA 1HDRA 1J49A 4RTLA 5HF8A 1L4MA 4DR7B 3K5WA 5LB2A 3FM9A 5TS3A 3VPGA 3AIMA 1B0ZA 5EQFA 2WPDA 4HDRB 2C88A 4CMJA 4WXEA 4R71A 1NFFA 1QGAA 4FILA 1HE4A 3W6PA 1XPOA 5F2KA 3H5RA 1IONA 3WIOA 4CMEA 3GRCA 5LCXA 3SFTA 3T9DA 3NIFB 1NXOA 3BICA 2XT9A 5D86A 5AK0A 2HXGA 4MIYA 4OHKA 4UXJA 1V8DA 4CMCA 2I62A 4FKMA 1O9BA 3CLSC 3GQBA 4MH0R 2Q3BA 3IOCA 2VTDA 3RRZA 1GLVA 4KYVA 5TARA 1T91A 1P6QA 1SKUA 2WKSA 2Z8ZA 1A8PA 3LUCA 1N2GA 5FHRA 2HA3A 4BVFA 1A3CA 4EQ6B 1NUPA 2ORYA 4L0DA 4LISA 2FRVA 1ABEA 5IHPA 1IY1A 3A28A 4AJLA 1R74A 4IQ8A 4ZYLA 2VJLA 1GO2A 3DFMA 2CVQA 3IE1A 1UBCA 1Y8QB 3VU3A 2QQGA 3X1WA 3I73A 4ENWA 4ZV4A 1WY7A 2BHSA 4IICA 2ZS7A 4B4KA 3SDSA 1MC4A 3WYNA 4EUHA 3C3JA 2P5YA 1Y6ZA 1RWOA <