3OY7A

Crystal structure of a virus encoded glycosyltransferase in complex with gdp-mannose
Total Genus 138
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
138
sequence length
392
structure length
392
Chain Sequence
MKLIIVGAHSSVPSGYGRVMRAIVPRISKAHEVIVFGIHAFGRSVHANIEEFDAQTAEHVRGLNEQGFYYSGLSEFIDVHKPDIVMIYNDPIVIGNYLLAMGKCSHRTKIVLYVDLVSKNIRENLWWIFSHPKVVGVMAMSKCWISDICNYGCKVPINIVSHFVDTKTIYDARKLVGLSEYNDDVLFLNMNRNTARKRLDIYVLAAARFISKYPDAKVRFLCNSHHESKFDLHSIALRELVASGVDNVFTHLNKIMINRTVLTDERVDMMYNACDVIVNCSSGEGFGLCSAEGAVLGKPLIISAVGGADDYFSGDCVYKIKPSAWISVDDRDGIGGIEGIIDVDDLVEAFTFFKDEKNRKEYGKRVQDFVKTKPTWDDISSDIIDFFNSLLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a virus-encoded putative glycosyltransferase.
pubmed doi rcsb
source organism Paramecium bursaria chlorella virus ny2a
molecule tags Viral protein,transferase
molecule keywords Glycosyltransferase B736L
total genus 138
structure length 392
sequence length 392
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-09-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 3oy7A02
3.40.50.11930 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3oy7A01
4BQEA 1C8KA 4RELA 3CUVA 2GT1A 4XIFA 5TMDA 4WACA 1NVKA 4CTNA 2AW3A 4AN4A 1Z62A 2BGTA 1FTWA 2SKCA 2AV6A 1WUTA 3T3EA 3BD7A 1UQUA 4NC9A 4REMA 3O3CA 2GJ4A 3EBOA 1C3JA 2PRJA 3BCRA 3ZCPA 2QNBA 1K08A 3D1JA 2VCEA 4HWGA 1RZVA 2FFRA 3OKAA 3IA7A 3TAXA 1P2DA 2BISA 4L22A 1KTIA 1NLMA 3OTGA 2QN2A 3WADA 1GG8A 3QKWA 2VG8A 3DZCA 3MSCA 3NCHA 5IKPA 3ZCUA 3Q3IA 4EKEA 2R4TA 4MI6A 1RZUA 4XI9A 2X0DA 2IYAA 3CEMA 1FA9A 3E3OA 2ACVA 3ZCQA 3BCUA 3T3IA 2SKEA 4MICA 3COPA 2IEIA 1JIXA 3T5TA 3L7DA 5JTTA 1Y8ZA 4AMGA 2PQ6A 3AMVA 1C8LA 4RIIA 2AMVA 3SYMA 2IW1A 4EL0A 4RIEA 4AMBA 2FF5A 4N39A 2ATIA 4FZRA 1A8IA 1XL0A 3GUHA 4RIGA 4F9FA 2FETA 4MHOA 1K06A 3RT1A 1XL1A 2Q6VA 3CEJA 2ZB2A 3CUYA 1AXRA 3G2HA 3E3LA 2F9FA 7GPBA 2GEJA 3RSZA 1IXYA 2F3PA 4MRAA 3G2NA 2PYDA 3MRXA 2X6QA 3TOVA 2QRGA 4M83A 1P4GA 2R4UA 2QN3A 2XA2A 4N3AA 9GPBA 1HLFA 2QN8A 3G2IA 2R66A 3T3HA 3DD1A 1L5SA 1C50A 3CUUA 4WADA 4FKZA 2R60A 1EXVA 1L5WA 1F6DA 3SYRA 3MQFA 1WW2A 2PRIA 1ABBA 1P2BA 1NOKA 3ZCTA 4X7PA 5TVGA 5I45A 1O6CA 3D0QA 4KQ1A 4X7RA 2OFFA 3EBPA 4F97A 1Z6PA 1GZ5A 2IEGA 3S27A 2HY7A 4Z5XA 2P6PA 3D0RA 1XOIA 1B4DA 2IYFA 3BD6A 4GPBA 4RIFA 3T3DA 1GPYA 2C9ZA 1BX3A 1JG7A 3BCSA 5D01A 2GEKA 1NOJA 2XA1A 1WV1A 4NESA 2QLLA 1NOIA 1JIUA 1XV5A 1YA6A 3CUWA 3HBFA 1J39A 3PE3A 3ZCSA 2JLBA 3UYLA 1P29A 3NP7A 1F0KA 1YGPA 1L6IA 2QZSA 3OTIA 5IKOA 2G9VA 4MI9A 4N3CA 2O6LA 1GFZA 3OKCA 3RHZA 4N3BA 1IIRA 1EM6A 4BFCA 1FS4A 3L79A 5HXAA 1FU7A 3MTBA 5TMBA 4HLNA 1WUYA 3WAGA 3S29A 1UZUA 4EJ2A 2VSNA 4RENA 1L5QA 1H5UA 3HBNA 3CEHA 1P2GA 5DU2A 3MT7A 1RRVA 1LWOA 3H4TA 4M60A 4EL5A 1QM5A 2XMPA 3OKPA 5GPBA 2QRPA 1M5RA 2C4MA 3L01A 3C4VA 2YJNA 2VCHA 2G9QA 3IAAA 3MS2A 2AZDA 4BQIA 4YUAA 1GPAA 1PYGA 1WW3A 1SXPA 2PYIA 4CTMA 1E1YA 3H4IA 4RBNA 1SXQA 2QLMA 2R68A 4AY6A 3OY2A 1FTQA 3MTDA 2G9RA 4MI3A 2QRHA 3WC4A 5JTUA 2JZCA 3C4QA 1NZFA 2XCIA 2ASVA 3ZCRA 2C1XA 3BD8A 3OTHA 1PNVA 2C1ZA 1VGVA 5TMEA 2IV7A 4BQFA 2XCUA 2BFWA 4AY5A 3MBOA 4KQ2A 3NC4A 2H1HA 4F96A 1JG6A 3NAZA 4M7PA 3TSAA 1Y6GA 4W6QA 2X0FA 2GPBA 2XGOA 1P4JA 5BNWA 4EKYA 3L7AA 2QRQA 1Z8DA 2F3QA 1L5VA 5ENZA 3CV3A 2X0EA 1AHPA 4N9WA 1L7XA 3PE4A 4GZ5A 2GPNA 3VUFA 6GPBA 1GPBA 2ACWA 4X7MA 4LDPA 3MRVA 4RIHA 4YI3A 2GPAA 3HBJA 3OT5A 3MS7A 3CX4A 3DDWA 3S2UA 1FU4A 3CUTA 2QN1A 4QLBA 2QN9A 3L7BA 5C1DA 2XGSA 4KQMA 3T3GA 3HBMA 3E3NA 2XA9A 5DXFA 3QHPA 4X6LA 3RSCA 5D00A 2JJMA 1Y6FA 4CDRA 1FC0A 1V4VA 3C48A 2KS6A 1JEJA 1QKJA 2BGUA 2VSYA 2GM9A 3L7CA 1L5RA 2IUYA 3NP9A 4GYYA 3BDAA 4WHMA 3VDNB 1Z6QA 2SKDA 1XKXA 4CTOA 3NB0A 1FU8A 4LEIA 3UYKA 3MTAA 1FTYA 2XGMA 3DDSA 3VDMA 1WV0A 5DLDA 2F3UA 1XC7A 2WTXA 4NEQA 3BEOA 1NZDA 2QRMA 2ECPA 2G9UA 1JIVA 4YI5A 3MT8A 3G2LA 3GPBA 4GZ3A 8GPBA 4GZ6A 1LWNA 1PSWA 2QN7A 2F3SA 5LQDA 3MRTA 2QLNA 2X6RA 3MS4A 3ZCVA 3Q3EA 3FROA 3G2JA 3T7DA 3S0JA 3OY7A 1GGNA 3MT9A 1UQTA 4G2TA 1E4OA 1PN3A 3Q3HA 2H1FA 3S28A 4PQGA 3VUEA 4GYWA 1P4HA 2IV3A 3NPAA 3G2KA 4MHSA
chains in the Genus database with same CATH superfamily
5LQKA 1SQSA 4CF5A 4D45A 2FZKA 1AZSC 4MCAA 3VGJA 1BFDA 1QV7A 4D0RA 4C1BA 3BM5A 5ARBA 2KX7A 1OFTA 1XKQA 2O8FB 5GONB 3FOAA 1NVKA 1ZGCA 1XXLA 3RS3A 3F73A 1Y8QA 4FI3F 5DTQA 1HUQA 3SYRA 3O8RA 2QZZA 1ZL0A 4GS5A 1NE7A 1W4RA 1X1BA 2AV6A 3HYCA 3JAKA 4J2OA 2R65A 1T5DX 2REQB 1QONA 3BGVA 4IILA 1GQSA 1UBCA 2QUZA 3GBVA 1M67A 3T5DA 4DCVA 5AVYA 1B2RA 1IBMB 4KYIB 3FYUB 2OHOA 4I2VA 2ZSJA 4A1FA 3I9OA 2TMKA 3MAJA 1UKVY 2HF8A 1K8ZB 3TX6A 2BFCB 4YP5A 4IJVA 1XRNA 4EW6A 3GVXA 3VSEA 1E1QA 3VKGA 4LE0A 5ALMA 3B12A 2J33A 1JKMA 2Q9BA 3FPGA 3IVAA 3R5HA 4KK3A 4PSUA 4RU1A 2LVBA 4BO8A 4DA9A 1WG8A 2P30A 2WRZA 4ZYTA 2GF9A 4D96A 2I3GA 3E8SA 3GJZA 1JV2B 1C14A 1I6MA 3L7MA 1T29A 3TPCA 1FW6A 1RW4A 3TW8A 1IBCA 2CZCA 2ZI7A 3PQ8A 2JF0A 3OESA 1KBQA 1ZEMA 3A1FA 4TROA 5LQSA 4JJIA 4M8NE 4PZEA 4AFNA 2VHZA 1T8TA 5TXGA 5EIHA 3B9RA 3ABSB 2M6LA 2YWDA 1QGED 4NNPA 3AM5A 2NU6A 2CLKB 5FBWB 5IP5A 3DFIA 4N5NA 1RTKA 4PC7A 2KLHA 4YC7A 1OLSA 3BIJA 3HYRA 3LO8A 3DHYA 2QUJA 4MVXA 1M8FA 4PCVA 5AKZA 5GZ6A 1J0BA 1YBHA 3MCVA 5KOHA 3IQGX 3RK4A 4YJFB 4WKOA 1ACLA 1XNGA 3I9KA 5LQAA 3GI1A 2IYAA 4NFSA 1GV1A 5BRJA 5JT1A 4J07A 5E2BA 2ZT5A 4PICA 2IYTA 4LMRA 3EWIA 1KH3A 5AUQA 2P9TA 1MV8A 2WEKA 1QP4A 1Y8QB 4HJRA 2SKEA 1TGYA 3BL8A 4R2HA 5JROA 2VUHB 2J3EA 3PS9A 1PT8A 3AHJA 5E3IA 1IN4A 3FNHA 4GDMA 4K9PA 4HXYA 3ZV3A 1A9QA 2VO1A 2OQVA 1SHLA 3U9SA 2P6RA 2YV1A 5IW8A 1R8XA 2VJMB 1IM8A 4WOCA 1W36B 1U6KA 4D3YA 3D31A 1BHJA 1CNFA 5C1PA 4UUNA 5BSFA 2Q50A 2QLFA 3AIMA 1TUBB 2UKDA 5AVTA 4L72A 1W2WB 4MR9B 5KHOC 1BFUA 1FF9A 3LPLA 3SYMA 1Z88A 1YIDA 4AP5A 4DLTA 2OOKA 4OLJA 1PJQA 5KC9A 1V0JA 2O20A 1SKYB 1G2IA 3V7UA 3TL2A 1Y4SA 1T0JB 4G23A 3FJYA 1PJCA 3G2OA 3HWSA 4FFRA 3BMQB 4TXNA 2H1RA 2RGXA 3FKSA 4CM1A 3CEJA 2BEUB 3TRFA 5TLSA 4RTNA 1TUBA 1EWTA 4GWKA 3HR8A 3UHFA 3V2UA 4E11A 1REQB 3KNZA 2FE1A 1SVNA 3HLKA 4YRAA 1S4MA 3ORYA 4DLXA 3PL1A 3PFGA 5EIOA 1NLUA 3OZGA 5K8LA 2FG5A 4J4TA 2PUBA 2WF5A 3DV0A 4G0ZA 3LBAA 1DNPA 4UQLA 1GYRA 2E4VA 3BJMA 4X71A 5FQOA 4TYNA 1CFZA 4M6WA 4RVFA 1DFGA 4HF7A 5EE0A 2QD5A 5IF3A 3AY6A 1G20E 1IPEA 1FUUA 1O08A 2JGIA 3M82A 1O2DA 3SNKA 3BK2A 5DX8A 4GUAA 1PZGA 4IM7A 4BO7A 4MMZB 1COZA 4LDQA 3PNSA 1I36A 1NDUA 4O4HF 1NW9B 1NVFA 4L8GA 3HUEA 2AI3A 1PL8A 3IVRA 3RSHA 4DWOA 4TL8A 2VNJA 3O47A 4LGCA 3TMAA 5KINB 3DNMA 4DDMA 1CBUA 4D7AA 4XVRA 4RABA 5C7LO 1JFFB 3A27A 1STOA 3DYBA 2DUWA 4TQAA 2CXSA 3DE5X 4OM7A 4Z3DA 4CGZA 3WLEA 2PKXA 3MHPA 3D6UA 3MLAA 4MGZR 3UA4A 3KRTA 1IY0A 1Z7YA 2C61A 1KARA 1JJIA 3I92A 4H08A 2WJZB 4XYLA 5I45A 5AJVB 3TNFA 2R1VB 5FTLA 2HDOA 1ODLA 1DWUA 3QEOA 3IBTA 4Y9DA 2B1GA 4NYMQ 1A9OA 4O63O 3WTBA 3A04A 1A98A 1M0WA 2A1TS 2FEPA 3EBPA 4JZYA 1MXFA 3ZBPA 3DXFA 4KIFA 1TMKA 3E9NA 5KJCA 3MUOA 2PL1A 3A9SA 3FX2A 4CR8A 2QX8A 3EOBI 1NBMA 4JGIA 3RC1A 4EYSA 4FBLA 3AEYA 4BB5A 3N28A 5K8UA 4UUBA 3QEKA 1NRIA 3BC1A 1PR6A 1JQLB 4HH4A 3T4XA 1J5EB 4O02B 3KLNA 3IIJA 5ALOA 3WV5A 1HE1C 2H7YA 2Q3JA 2V98A 1Z0DA 3EUWA 4CKWA 2GCNA 1Q91A 1N6IA 4IZHA 4QGBA 3W4JA 4BMDA 4EYQA 3AF4A 1U28C 3BF7A 1GUYA 3GL9A 3CNHA 4BC0A 5FWYB 1K68A 2X7XA 4CHGA 1Y4UA 2LDBA 3R20A 3B36A 3HBFA 3PNKA 1W1IA 4MS3B 4LF8B 5JVDA 3PE3A 3CN9A 4QVIA 1HORA 3TIIA 3HXTA 1E1RD 1CJKC 5AK5A 3TXYA 1F0KA 4OQFA 4LA4A 3T3PB 2B5WA 2DFDA 3LPDA 4R5MA 3IUMA 3BG5A 4PAQA 1R3DA 2X7JA 3AF2A 1DS6A 3D5TA 3FLEA 1XB2A 4LJYA 4EUHA 1I4DD 2I4NA 2VNHA 5IXSA 3EQ8A 2DPHA 4EUNA 3OE4A 4I3GA 4B6JA 3BIXA 3DFZA 3F90A 4XDGA 1G8FA 1I0LA 4CKXA 3TBKA 1FS4A 3HGQA 4N40A 3NHLA 5LZ5A 2B82A 3VZQA 1H4VB 3BWYA 4UUAA 2CLEB 2KSQA 4FHDA 4MRRA 2HA4A 1I01A 2IZ1A 1UBTS 3W77A 3EGWA 1XVVA 3I6QA 3TLBA 2W9XA 3A37A 4EHDA 1U8XX 1UZUA 4FHCA 1GZUA 1MOSA 2XRZA 3K94A 3O2JA 3N0WA 4JOQA 2PXXA 2BZGA 4WNIA 2I2FA 4BE4A 3STHA 3FVQA 2FDXA 1FSGA 3NC1C 1VYVA 4GIBA 2P9ZA 4XZ3A 2BP7B 3QBEA 3O4RA 2PX3A 2PLRA 1THMA 4N6OA 4WK0B 3ESRA 3H2IA 2OK7A 4GOMD 5A3SA 4Y7DA 3INRA 1HSZA 5DGDA 1LDYA 2VZ8A 4RSMA 4LBWA 3ZVMA 3L1IA 4DIUA 4BS9A 1Y7LA 2OZVA 4E5VA 3EAGA 3LYAA 3PFBA 2CHEA 4RACA 4XJVA 5ALQA 4ABYA 4YYZA 1QTQA 2WM8A 1CIVA 3PQ7A 4YB8A 2XMSA 4TN1A 3MELA 4GMKA 6PFKA 4TYPA 4OBBA 3UY4A 2PLWA 3ILVA 1EJ2A 1N6RA 5ALLA 3SY8A 2PA3A 2E85A 5CVVA 1SXGA 2V6BA 3EVGA 3QELA 4MUAA 1RKXA 3PR1A 1V16A 4H7EA 2J5RA 3M4XA 4AIRA 1R5NA 1MDFA 4Q47A 3ET4A 4EKIA 2C7PA 4Z4GA 1LW6E 1ZM7A 2V6FA 3ADPA 3BQMB 4OKNA 2FR0A 1XGKA 2V0CA 5TJ9A 3UBTA 4LKOA 5A2QA 2FMHA 4QE3A 4D43A 4BXOB 3ZLJA 1GUZA 1C7ZA 5SY6A 1ORVA 3RUEA 2QLMA 2V7PA 3HKDB 1W5EA 5E7QA 3NGXA 1Z73A 1DAFA 3VR3A 2PNJA 2MHCA 2WV9A 4BX0A 1WB9A 2WAXA 1C9EA 3AZPA 1GADO 2PKEA 4IGFA 1HT1E 2GZMA 3B8HA 3DLCA 4IWXA 5B55A 4MRNA 2X2EA 2WSLA 3K71B 3JQPA 2FLKA 2HRQA 2NZJA 2OFWA 4C2BA 3G9UA 3ETCA 3ZCRA 4FFMA 4FJ0A 5ES4B 1U0FA 4U7TB 3VR6D 1A5TA 5K09A 2XUJA 3VKWA 2D5BA 2CUTA 4HDSB 4QGSA 2Y27A 2G4CA 3KKOA 1SJ9A 2E4XA 4TTIA 2WE7A 4ZYYA 4FFLA 1ZM3A 2BKUA 3SBXA 3CHYA 3KQLA 1V5EA 1ZC4A 1YMVA 3G8YA 1G3MA 4TSFD 1A3CA 3K8YA 4TX1A 1KRXA 1RXWA 2NADA 3ZH2A 1E1NA 3Q85A 2ZZNA 5AW3A 3HCFA 5DULA 3CGGA 5KCZA 2UYHA 1AGRA 1UDXA 1H1LA 1TI7A 1W1WA 2AOUB 2PYZA 3FY4A 3NAZA 3Q40A 3BTVA 4LYHA 1IL0A 1SQ0A 3CFYA 3OFND 5LNK1 2G06A 1W35A 2ADOA 1FSZA 3RTAA 3GEMA 4YJKA 5FO0A 3N6RA 3T0IA 2NUBA 3PFCA 1K8XB 2G71A 4CM3A 3C97A 3GPIA 4V0OA 4J0CA 2F4VB 3A26A 1XTIA 4TRMA 1SNYA 3BXGA 3CQ9A 2CFCA 3L7AA 4Z0PA 4A8JA 3RRJA 4WZAA 3ZGVA 3KZVA 5T4BA 1JLKA 1W87A 2W6IA 5J5CA 3BT7A 4HDQB 1QYVA 3ZPXA 5KJ1A 1RAGA 1P9NA 3PPIA 1N77A 2P90A 3QXHA 3P1JA 4W9MC 4URWR 2MSLA 1R0CA 3I4CA 5T7BA 1TUIA 2QPOA 3FPAA 3H05A 4KJZA 5C4MA 4D9CA 4IDAA 1H94A 1VHTA 5I3CA 2I65A 3LX6A 4BNZA 2B9VA 3GRUA 5KX5B 3QE4A 4Z1MD 4HDKA 1RYMA 3OJXA 4YI3A 4RD4A 4WUTA 2FJPA 4BAUA 3WGIA 3I39X 3MIIA 1KYWA 3QSYA 3KXIA 4DCOA 1R50A 2XMCA 1SVLA 3CLRD 5G3YA 3RFFA 3RS7A 5C4GB 3G9QA 1CUGA 1NIPA 1GGHA 1U9ZA 1ZK1A 3AEQB 3R5FA 4G1UC 4OHZA 3MGGA 1FU4A 1AO3A 3MWEA 1I9CA 4IHJF 5G0TA 2RHGB 3R7NA 3GLVA 5JI2E 3UMMA 2QJRA 4N7JA 3EPJA 1E2BA 2HFJA 5J2UB 2B0JA 1C9NA 2XGSA 4JSRA 2ZREA 4XPIA 1EFTA 1GZSA 1X8XA 3GAMA 2UZIR 3G9ZA 5DCLA 1DGQA 1Z28A 2BHLA 1P33A 2CXXA 2C78A 5SZHB 4U00A 2FXIA 1JJAA 5FBLB 1IEVA 5TGZA 2GZAA 1C9DB 4TQUS 4M86A 5ADUS 4QPNA 2MINA 4CE6A 4TSRA 1DRKA 3N58A 3TKYA 5JD4A 2NP7A 1G16A 5FT9A 1RC0A 3ND5A 3QKRB 3W4IA 4CDRA 1Z33A 521PA 1H22A 3UWSA 1UC4B 4JYPA 4O2AF 7MDHA 3U09A 3T34A 2QM8A 4DXAA 5JAPA 4UARA 2YWRA 2J4DA 3CSUA 2JJ8A 5FRDA 4IBOA 4NV3A 3SYKA 4NMHA 3T7AA 2X9LA 2LCIA 4QDOA 5G1NA 3MJHA 4YDHB 4DF3A 3NHJA 1VE6A 1ESDA 1ICIA 1GD1O 4DKXA 2FSPA 2EYUA 2XYQA 1KI8A 2IU0A 1C1XB 4M9XA 1KJ9A 1GPLA 4FE3A 1XKXA 4CTOA 2NTVA 4B71A 2TYSB 4LF7B 2XTNA 4JR2A 2VWQA 1OYVA 1QH0A 4W8GA 4JLUA 1VCMA 4YN3A 1FFYA 1I10A 4ZJYA 2A9FA 4AS2A 3KT6A 1CWUA 1ZX1A 3G5TA 2NUPA 3PDIB 4QGFA 3RAEC 4LSWA 1SCJA 3PKIA 4PHTA 3KLPX 2XNCA 7ABPA 3BMCA 1CCWA 1XDBA 4QJIA 5LQJA 5LVAA 2DE0X 1KORA 1CERA 3LZCA 2C07A 2OGUA 5AK6A 4YUYA 1LBQA 2I78A 1VHDA 1GNLA 2ZYDA 8LDHA 3I83A 4HFMA 1ISMA 1KJNA 1KI9A 1UBHS 1CE8B 1RC1A 4WN9B 4LYJA 4ENRA 3TSOA 2PGLA 4RX1A 2BGKA 4R7ZA 4RXTA 3TO5A 4X6XA 3LI2A 4RZSA 4LZAA 4BLTA 3L8EA 1LDMA 4JXXA 4AKEA 1LRJA 4OQXA 3E9DA 4C7OA 5KNDH 3QLVC 4GR5A 5B1IA 4PYKA 5CAEB 3WBJA 3WGQA 6YASA 1K63A 4U8GA 3DMTA 4Z6KA 5DOVA 3EH1A 5B3JC 3ESXA 1PFKA 4L4XA 5I7OA 1UMCA 5BN3B 3DNPA 4GOJA 4GVPA 2FSVA 4ENUA 4ZAVA 2HK9A 3P27A 5AKEA 3NJRA 1JWLA 5IEJA 2AC7A 1L4HA 1SUFA 2M6RA 3CW9A 4E5KA 3GU3A 1QYDA 4YJHA 4RK5A 5DHUA 1PNRA 4RVGA 4ZPXA 1VI6A 2C5AA 4I4NA 4QPDA 4F1WA 1EE1A 1NJ1A 1WU7A 3DFKA 2CV0A 1E2EA 3WGYA 3SFTA 4AZSA 3KSBC 4P6VF 1DI0A 3ZQ4A 5IYZF 2J7PD 4HZUA 3P0HA 1ODIA 2P1RA 3EIQA 2ZKIA 2ZSKA 4TV8B 2IITA 1GARA 3CRRA 3GZNB 2WIAA 3AFGA 4WN3A 5AKJA 1NPDA 3FFTA 1WPRA 2IEDA 3MTJA 4V2UA 4I4CA 2PS1A 1RCFA 3WR5A 3NM6B 1E98A 1WEHA 2G1JA 3KOYA 3W90A 5A2GA 2HRDA 1K4YA 1O8CA 5HDQA 5KTNA 2DHQA 4LWQA 3ZZTA 1UBNA 3D8TA 1JNYA 1QHHA 2H7VA 1J90A 5C5IA 1X1EA 2B2CA 1SELA 1N92A 4YJGB 2W7TA 3WA6A 2YFYA 2Q8NA 4TTPA 2VQ3A 3K0SA 3KLBA 1WSDA 4X64B 3O3CA 5JATA 1L5ZA 5LYJF 4F92B 3IT2A 4L02A 3GEIA 4CUJA 2O0MA 2VC2B 4LZWA 5KDLA 1RQXA 4UU8A 1DB3A 1XP8A 2HC9A 2O8FA 3AUSA 4WNAA 4R7TA 2XE7A 3H99A 1K08A 4IIUA 3W79A 3QU7A 3OC6A 1RZVA 5BSTA 4X00A 3U7RA 1P7PA 2O8BB 5AI6A 5F73A 3UN1A 1SUCA 1NG9A 3FPJA 3PTZA 4WV3A 2O5RA 1T2NA 1NN3A 5IT4A 3TAXA 2OZEA 3BULA 4FLFA 3JYHA 4X9XA 1IU9A 3NT5A 4EPTA 5JSFA 3AZQA 3EOAI 4DE5A 1KTIA 2RHJA 1Z63A 3BHMA 4W5NA 2R9VA 3OEWA 4KSYA 3W9UA 3WADA 2R86A 2PX5A 3GZ4A 4UDXX 2HGZA 3P97A 1QHNA 2GD0A 2Q3HA 3ADOA 4UHDA 3ICCA 4UTZA 4F5WA 2BDEA 3Q87B 3ZWMA 4CL0A 4NENB 3Q3IA 1CR4A 3L9XA 3ZTTA 1GTZA 2DLNA 3S70A 3MK31 2FPRA 4YMVA 2HBRA 1AM4D 4HDAA 3X1MA 4M1TA 5JMOA 3CKLA 3KB6A 3VVCA 4NCNA 4HFRA 5CD1A 1J8QA 4MI6A 3TQTA 3EXEA 3CRVA 1T4GA 2JFPA 3WGHA 4C08A 2XXAB 2VPZA 1PYOA 1ORIA 1OZ0A 4C4PA 1HSOA 4ZEMA 1H6CA 3LQKA 4MV1A 4BLSA 3NAMA 4B6PA 1R0XA 2ERXA 2PIDA 1XAHA 2YV5A 2GSDA 2RKOA 3TLEA 2AN4A 2JGDB 4EZEA 3VHXA 1JHZA 3GT0A 2DM6A 2IEIA 2FE4A 3COPA 1HMYA 2O7RA 4V0RA 1QCYA 1GTVA 1VLZA 3UKDA 3D4BA 3AV3A 1G8PA 2NO7A 3D8BA 5IVIA 3ER8A 1LPMA 3F7TA 4WLEA 3L7DA 4YEDA 2XB2A 3FPCA 3IBSA 3P9CA 3T4EA 2JANA 4UHHA 1H4QA 5D6OA 1G6Q1 2I4IA 3PL5A 4PQYA 4RJTA 5A4DA 4BV9A 1VLMA 4P38A 4RD1A 4DAOA 3SSOA 4PC6A 2GEVA 3ZHTA 1RIIA 1QGUB 2HIGA 2YXEA 4HEA6 4BGEA 2FG7C 3G02A 4TLCA 5J3JA 3K70C 5E7IA 1I6LA 4IF6A 3DJYA 4AZ0A 4MQEB 3HRHA 1ZMXA 3UW3A 5EIEA 1XTRA 2K2WA 2D1YA 3ET5A 3I45A 2CDAA 4M22A 4GHWA 1XNQB 2JBAB 2J9YB 2ONZA 3HWWA 3OA2A 4AWXA 1AF4A 2WYHA 2YWFA 4C78A 2FPUA 4BV8A 1SKAA 1H2EA 5COBA 3B7GA 4D02A 5C35A 5IANA 1ODTC 3ZWYA 2CL0X 2J4CA 1KFCB 5JXIA 1FLAA 1E7YA 4G3XA 4MWOA 5A0TA 2BIFA 4QRDA 3EGOA 4U2KA 1W2HA 3CUYA 4P7GA 1KYXA 5ALXA 5SYNA 5KPJA 3ICVA 4Y2GA 1QRAA 1YZHA 3ZK9A 1JMYA 4HGOA 1EVZA 1PEDA 2ZWIA 4LKRA 4YHBA 3BGWA 1R8JA 4XASA 4C0XA 5EHGA 5K20A 4MDHA 2DFKB 3RIYA 1PD0A 2E4WA 2PKRA 2V7EA 1TLFA 2XW6A 4G1CA 3LUDA 4Q7QA 2H4JA 4OOFA 4M0MA 1O6ZA 4WKNA 5E6RA 6LDHA 3ML1A 5ER6A 3QWAA 3MLEA 3B1XA 4NULA 4H9GA 4BNWA 3TOVA 1XLTA 4WNAB 4AZTA 4R98A 3UIEA 2O3TA 4M83A 2DH6A 4AYWA 1EGVB 4UXIA 4BMSA 1UMDA 2W6NA 3P9SA 1NW8A 2ZULA 1S2NA 4G81A 5EG5A 1QO9A 1TZKA 3T1TA 5HNKA 1KDOA 3JASB 4FWBA 3V1TC 1Y80A 2E18A 3L7JA 4ER6A 1F1JA 4KREA 3FIUA 4OFWA 1A9XA 2R751 4HPXB 1AT1A 1SMKA 4MVJD 1VG8A 2BLNA 2R7NA 1FFSA 5HK8A 4KXMA 2YBEA 1K0FA 1CR1A 3H3XA 3E9QA 4H3VA 5EQTA 2XYRA 3LWZA 1C7JA 5IZ4A 2DTDA 1HURA 3GELA 1XCGB 4G6ZA 2GPWA 2DWUA 4LZZA 5TGTA 4O4LA 3ZCTA 1M7BA 2P2SA 1N78A 4WNYA 1HE3A 1NVBA 1O9HA 2UVPB 3KQSA 3VVLA 1QC5A 1EHIA 4LMAA 1E4YA 4MVWA 3AM3A 2NXCA 4Z4FA 4QOIA 4DCSA 4N41A 2B7CA 5EKSA 3H18A 2IWHA 3DEFA 4Y8VA 3L5OA 3JCZA 3E4CA 1I80A 2X9GA 3O2SB 4F4FA 4W63A 4A4DA 4OH7A 2AXQA 2RGBA 3KE8A 3WWEA 2ZWAA 4S2EA 1SU8A 1SULA 4UEJA 1HE4A 1GU7A 2J31A 2ZUVA 5AJZA 3RPEA 4DY4A 2P6PA 1LNZA 3AERA 3BMOA 1UMCB 1EEXB 1K6XA 4QHTA 4WXPA 2NNLD 1T2VA 4NAUA 3PIIA 5TQJA 4BJHB 3PV0A 1GPYA 2C9ZA 3E81A 1VKRA 3IQHX 3T4PA 4Z7JA 5FUQA 1DHTA 1JG7A 2C98A 2V7VA 5BPFA 5GZ3A 3ZIUA 3C85A 3P0EA 1D4FA 2Q4DA 2QD3A 1XWIA 3AWIA 3HYLA 3LKZA 3KK0A 1S2GA 3O8BA 2NG1A 2YXBA 4H1HA 2PJRA 2YJZA 2H1VA 4V0MA 3TECE 3H2JA 3W2HA 4BLPA 2CGEA 4NESA 3O8LA 4YT5A 2VXOA 5DZSA 3WKAA 4B4WA 2ZJ0A 3TWOA 4L51A 4XYMA 3AUXA 1T3HA 2ZT7A 4BKRA 4M7RA 1JG1A 2OE2A 3DAYA 3FKJA 2WWGA 1A9XB 1U2DC 3CPJB 1Z75A 2V45A 3DDCA 4K9SA 1PVDA 1YGPA 1O77A 1DJOA 1JDVA 2IKQA 3G89A 1I5OA 3IAXA 3JTEA 2X5JO 4IYRA 3T0GA 2IGBA 1DJPA 1S2MA 2KB0A 1QV6A 3QKIA 3ZHYA 3M1AA 2HF9A 1IBRA 1NNEA 1Y4AE 2G9VA 2QD1A 2RG7A 2XVMA 3EXG1 3N2NA 4R0MA 3WBFA 5BYKA 3DV9A 5KC8A 4CMAA 2I66A 2GD1O 5TJHA 1ECCA 2RI1A 3B13B 3FSEA 3VOSA 4DWWA 1L5OA 1HNXB 1IATA 4XTRA 3QG5A 3EJWA 5M04A 1Z6GA 1N5DA 2EJWA 3KZKA 2I5PO 3TGLA 4LDAA 1E4VA 2PXHA 2PZBA 1O54A 4BKQA 1GIAA 1ZJ5A 5A9TA 2G5CA 4HS9A 3WK8A 5JBNA 3KT0A 2LW7A 1W2GA 2DXIA 2P8SA 1C1DB 4JH0A 1XTTA 3PEFA 1B0AA 3BWVA 3BCHA 4ZK6A 2HU2A 4FX5A 3WOHA 2C0CA 3O31A 4LG1A 2A0UA 4FDAA 4YFYA 4S0XA 4EEKA 5LKAA 2X4DA 2ZDQA 1G9TA 4FHEA 4OU5A 1P2TA 3E9RA 3IHLA 1E7RA 2KE5A 1K5PA 3HH8A 4O2BF 1EVLA 2OZPA 5HZKA 4Z4IA 3RRBA 1JB9A 4A6XA 1GRCA 4RTJA 3GLFA 3SX0A 4CLDA 5HUHA 2JBAA 3SKVA 1SIUA 3W5AA 4GKBA 1KMMA 4ZARA 5KB3A 1K5DA 1XTZA 3QFHA 2GAFA 4RHUA 2W2KB 2BFPA 4MW5A 4CCAA 3TFWA 2HLDA 1GAQA 2WFLA 5KYXB 3HVJA 7REQA 1WZNA 1QBKC 1SKUA 4KHPB 2AN1A 4JXZA 2YW2A 1R18A 3F6YA 2EKDA 2OZLB 3C4VA 2F1HA 1RJFA 3CCFA 3CM0A 3L0PA 2RAVA 1N8NA 3AKYA 3MXTA 4MWDA 5EP4A 3PLRA 2XMZA 2CFSA 4HEA1 4DCJA 1LV8A 3TLCA 2C5HA 1M6WA 2P68A 2P0YA 5C7YA 5GAJA 2PD3A 3DLAA 3IB3A 4CMIA 1I2DA 2H2GA 3ZGNA 5EUQB 2D7JA 2KMLA 1MG5A 3CR3C 1UOOA 1JR4A 3HRIA 4TTTS 3O1HB 3OJLA 2IXTA 2FAXA 1I3OA 1K7YA 1Z4MA 2ZJ5A 2IX3A 4JMPA 1E9SA 2V97A 2RH4A 3S2IA 4ZO9A 1LVUA 4X1IB 4KN5A 3MTDA 2X76A 2DHDA 2G9RA 4XA8A 3SEZA 4XGNA 2IDKA 3UVEA 5JSQA 1T5SA 4EMBA 3VQTA 2V6GA 5J58A 1E5QA 3O91A 2NSHA 2VLBA 2QLJA 3SR3A 2ERCA 2IPAB 2QR3A 1OMOA 1K5HA 2XCIA 4GLOA 4OXKA 1PTKA 4KLZA 3PFWO 4XVCA 3I2GA 1BKSB 3EEIA 4RPLA 3T61A 3BD8A 2ZTMA 3OTHA 2ZIAA 3EVNA 4YRKA 1EAMA 3BYZA 3L7KA 4PRKA 4QASA 1BMTA 4MW0A 1Z29A 1PX2A 3BJRA 1EFPB 2PRZA 1V6AA 1WXEA 1N2SA 2CXPA 1S9HA 3NXSA 4BNUA 2J9RA 1KMIY 3DKKA 4P32A 1QZZA 2WU3A 2ZIGA 4YCBA 5DM4A 1YS1X 3OU2A 4OAPA 3FYDA 4F4IA 1K6IA 5HQ3B 3BFKA 4Q9KA 3W05A 3RDPA 4ZAFA 1M34B 2FPIA 3D7LA 3TMYA 1UINA 3N2GB 4L15A 1TFRA 1UZMA 4R7GA 2UYQA 1FX0A 3HKBB 1QRRA 2VP9A 1UDCA 1ZEJA 4PW0A 3KOMA 2WBLC 4BRSA 1YB1A 1WDLA 2YL2A 3GA0A 1O1YA 2INGX 3B1WA 4ITRC 4QO7A 3RLIA 2PSEA 2OC4A 4RKRA 4P0QB 4GYJA 3RUFA 1JHRA 2X9VA 2I6XA 4HZIA 5TARA 3HDTA 1C1XA 2GFQA 1EKXA 3D1VA 1HFWA 1CC1S 3FYUA 3I4LA 4GSLA 4YRNA 1DIOB 2EG9A 3K5HA 1BYIA 3CH5A 4YAIA 3IE1A 1NLYA 2OORC 1GTL1 1EX9A 3DE6X 3V4ZA 1PV4A 3NIBA 2HL6A 1PJTA 3I28A 4OI1A 4U2EA 4U9IS 1ZIYA 1UIRA 2ZXFA 2V1UA 3IDZA 1PFUA 2VFAA 4NOLA 4RQAA 1M2OA 1Q77A 1CYDA 4C4OA 3PP8A 1IHXA 4EW2A 1S3GA 3FCOA 4MJ3A 4MKFA 3N76A 4IGEA 1SIBE 4L5JA 2C54A 2QXUA 3UV7A 5I7SA 1SZJG 3FMGA 3QVLA 4ND8A 1Q1AA 4IY1A 4GR4A 3IQIX 4XCXA 1TB4A 3L92A 4PQEA 1R0BA 4MS1B 4E12A 1RWBA 2P5SA 3ESZA 1DBSA 1DHRA 1TAGA 4J0QA 4RVSA 3PU6A 3NYIA 4X6LA 3V1YA 5B7PA 2I9KA 2RSLA 1MIOB 2YVUA 3B78A 3U4GA 3CRNA 1VRVA 4IMIB 1B42A 4W1PA 1Z4QA 4DDWA 2QTWB 5AJTA 5CT9A 2P1ZA 2QM7A 1KJIA 5JFOA 5HHTA 1QKJA 3UW1A 2IDMA 2IOFK 1HLPA 4BWGA 3BIOA 4D4HA 1WCV1 3F4KA 3FH0A 3FN4A 2TMGA 3ESBA 5HE8A 3C5CA 4LXIA 3GHYA 1G2QA 2EJCA 1OC2A 3H4VA 5FQNA 3H42B 1OKKA 2RAPA 3VSCA 1SHKA 1PQWA 4OJTA 4DLBA 2LPMA 1JIQA 1T9BA 2RI0A 1C2TA 2SKDA 2YMPA 1ACJA 3QVGA 3QVVA 4GZMA 4YLGA 1WY5A 5JAUA 2PH1A 4MYSA 2PLAA 5LU9A 3U4QA 1WXGA 1SD1A 3H3JA 4LEIA 4X60A 3T9DA 3VA7A 3QG1A 2VTVA 2ZYUX 1DRWA 2Q21A 1TLLA 2X14A 5D3ZA 5ADHA 3I6ZA 1HOTA 2GWHA 4NZMA 1FYXA 3WRYA 1QR6A 5DYWA 3MTIA 3TTYA 3I1FA 2IA5A 5DO9A 1P91A 4XDZA 4EF6A 3RVOA 2G9UA 1E2HA 3E61A 4B3TB 3A6EA 3NYQA 4GRIA 5A3QA 1VJCA 4FNOA 2FUCA 2XE8A 4F4JA 1NP6A 4ZICA 4O4HB 1H1LB 4UUOA 1ZDMA 1EDBA 1N2BA 1KYQA 1VLQA 2YWEA 5LIPA 2C31A 2YV4A 1DTEA 1JKFA 3EMBA 1DKQA 3IAM1 3PT5A 4P0TA 3KKZA 5LYYA 4YCCA 3AUFA 4QOFA 2D3WA 4I36A 4N8EA 1GYPA 4HB4A 4L27A 1P3JA 1U3TA 4CM8B 1N1GA 5EWJB 3G2JA 2C57A 2GFIA 3WHLA 3UMGA 2IQ5A 2J9FB 2W0SA 4X8LA 2QK4A 3KYDA 4D81A 1GKUB 3CRW1 4TVOA 1IEWA 4L5AA 1JJVA 9ATCA 2O8CB 1UQTA 4YJ3F 1X1RA 5K8CA 5B1YA 4JLKA 3Q3HA 1AQNA 3R0XA 4L78A 1W75A 2R2AA 3QTLA 4MWZA 1XRQA 2C0PA 2O5VA 3EN0A 3OE5A 2IP2A 4LXGA 5MN6A 1CB0A 3PLAE 3FETA 5HQTA 4RF2A 4CLEA 4G1MB 4GBGA 5J4LA 2W2LA 1QQ7A 1O4VA 1U8UA 2JFVA 4HK4A 3AKZA 4NIMA 1O57A 2XDQA 4J03A 4MV8A 1IB0A 1XTKA 3UXEA 3JZFA 5BWNA 1X38A 3FPBA 3N0TA 4ECEA 3VNBA 1J1UA 1C8KA 2X0RA 2DHCA 3CISA 4HAUA 1AUOA 4ZT3A 4DG5A 1QRUA 2Y1DA 4CXMA 1A2BA 1JGTA 3A6KA 4AIIA 2Z1NA 2Z0MA 2BN4A 4KCGA 1YJCA 1MJ5A 2YZ2A 1PJ4A 4NYIQ 1XVTA 2QG6A 3IJRA 1BFKA 1U7DA 2JGMA 3O4HA 5D3QA 1XEXB 3LZ6A 1M66A 4FYHA 5EINA 3SKXA 3NH9A 5JE8A 2ZE8A 4DPLA 3NONA 1NF3A 2GVNA 4J76A 3TD9A 2GK3A 2BMVA 2X13A 3EY4A 4LJ7A 2JFGA 1VIAA 5TPWA 4ESEA 5JCXA 4YXWA 1SM4A 2Y93A 2NUAA 3GJ0A 3JWEA 4QUEA 5AI0A 4BE9A 1V47A 2YIMA 1OAKA 4KMOA 4ENQA 2F8TA 3EG9A 4E3WA 4PXSA 4HFJA 5DYGA 4FN5A 4QJ3A 1Z16A 2QJFA 4R2XA 2DR0A 2EBFX 3ED5A 2WSMA 3VC1A 5L40A 2FMIA 2QVGA 1U98A 1GXSB 3AF6A 4S1VA 1DFHA 3ROXA 4E6EA 1GG5A 2VP5A 4HJXA 3TZBA 2GOYA 4DFDA 2OHHA 2A58A 4DM3A 1NLMA 3DTVB 2R8OA 1H0KA 3LCRA 4G07A 4IO0A 2V1XA 3P2JA 4IPTA 4CV3A 4F45A 4QLAA 3EVAA 2R8PA 1E6CA 2DG2A 4JVNA 4E5NA 3AEXA 4X0EA 3RWOA 2W6ID 3O73A 1QJCA 1U7PA 5DTRA 1OA0A 3TS1A 3E2PA 3OZUA 3OLXA 5AW8A 1JPUA 3QIVA 2HK7A 1SCKA 4I14A 3D7NA 4TKUB 2NTEA 1X3SA 5LMCA 5KHLB 2HJHA 3PFNA 3D43A 2OV4A 4QEDA 2F4NA 2ZIXB 1HX7A 1CNMA 2ZJFA 3PQ4A 1Z5PA 5EJ5A 3RFXA 3NC0C 3CEMA 4G9BA 5F52A 1Z5ZA 4GXNA 3IJPA 2Z5GA 1YQDA 2J3QA 2Z95A 1T5IA 3L8FA 5TVKA 3O6VA 1BXGA 1WMEA 1TKBA 2BFAA 2A33A 2VRWA 3H2KA 3LQYA 4RHFA 5BY2A 3K09C 4ZTBA 4HVTA 4MVJG 3W7VA 1QOZA 2QI9C 2IYEA 1NYRA 2G8NA 3D8RA 5CB4B 2G3YA 5T6BA 1ES9A 2YJTD 3FKSD 3F49S 3LIPA 1BGWA 5FH9A 2JFHA 1DU4A 1ZC3A 1DXYA 1HE2A 2Y4OA 2AOXA 5MHTA 5FFFA 2X42A 3H11B 3GCXA 2JAWA 1TIBA 4H4DA 3C8MA 2J7KA 3GLHB 2B94A 1JU3A 1JHUA 1G42A 1MEOA 4GT1A 3S68A 1IWOA 2J9XB 1VPWA 3SHFA 5KYNA 2Z4SA 3D54D 3KAPA 4PZPA 2C4HA 2K7ZA 5LP6B 3FSGD 2EQBA 4YRBA 3NVKI 4LK2A 2ABWA 2VQFB 4LDZA 5IBRA 4PBRA 1IC6A 3DLIA 2FETA 1UP7A 3QFSA 3DKIA 1K06A 2XB8A 2ZB2A 3SC2A 1WIWA 1OXXK 1T6BY 4DJEC 1QTRA 2B8JA 4D9BA 2HXSA 1ZKDA 4LWOA 2R5WA 1OWOA 1W76A 3G2HA 4P3KA 3ZWDA 1SXJC 4XUCA 3CVOA 1FBTA 4RQUA 3AB8A 4U3JA 4XJTA 4CG1A 3PKZA 1AZWA 1S01A 1YWGO 3O94A 1JVBA 4DEXA 3NWEA 2UDPA 1OFGA 4N8DA 3U7IA 2GPYA 1P19A 2O4CA 3KL2A 1M1NB 2FW7A 4H15A 3E84A 4TKVB 4X92A 5IBQA 2Q5CA 3V7NA 1U2GC 5IM4A 4G8JA 5JG7A 1CJSA 1O97C 1Y3DE 1TCCA 4NE9A 1DL5A 4E4TA 3AVOA 5AVUA 1UADA 2UXDB 2XIQA 3FHOA 4A8JB 5AI8A 3WA7A 3I58A 4Q1AA 1C4KA 4M6WB 3BFXA 4YRTA 4YO8A 1KZ6A 5KVVA 1TZ2A 3KYIB 1CYEA 2ZT6A 3C7TA 3U7QA 2RKWA 3SF0A 2QBYA 2HGSA 3NATA 1TAQA 4F3NA 1NXQA 3D3KA 4HLUA 1BJTA 4F38A 2AMLA 1SOWA 4FKZA 1WY7A 2J9GA 4GUDA 4IINA 2YTZA 4BNXA 4G1VA 1H2BA 2ATXA 2NU8B 4TWBA 3V8QA 4G85A 1KFJB 4KXNA 4TN5A 1E99A 1DO2A 3A4NA 1SQFA 5I7HA 1DEOA 1F5NA 2IZ0A 2RGYA 1Q7EA 2YC4C 3IELA 4BVBA 2GM4A 3DPSA 6ABPA 3SZLA 1QIFA 2QS9A 3P32A 2OXTA 2C7QA 1UIMA 3TZEA 5E0KB 4EK9A 4TUYB 1E9FA 1TNDA 1ISHA 1JR2A 4MWTA 1NI3A 4BB6A 1T35A 4L75A 1PO7A 2GXSA 2J1LA 3QHQA 2ES4A 2GCEA 1B73A 1U0JA 4XM0A 5HOQA 2CE7A 5EERA 4EHHA 4HMOA 4QODA 1KOJA 2TMYA 1IYZA 1B14A 3OIFA 2IYFA 3NEAA 5E6RB 4DLNA 2QVCA 3QY9A 4INPA 5I7UA 1YQTA 5C52B 3O7WA 4RTOA 1Q0PA 3QX8A 1FFBA 4OXXA 2AE2A 2OKGA 2IEBA 3U2QA 1HT2E 1S3IA 1XCOA 3IQDB 4ZCPA 4QLOA 4E5YA 4AYXA 4N3NA 4B6GA 5EKUA 3IVXA 3ZE1B 3F6SA 3CX7A 3AERB 3BMOB 1H1DA 4HQ0A 3GEBA 3IQWA 3AW8A 2B8TA 1BHSA 4B43A 3ZV5A 3HA2A 1Y8RB 3N9IA 1XV5A 1NXSA 4TS4A 3CUWA 1RBMA 2VAVA 3W6ZA 3B6IA 5ICFA 2IC5A 3E1SA 2VAPA 3QVWA 4PR0A 3HMKA 3HB9A 2I6GA 3RV4A 3UANA 3UHOA 3ZCSA 5KEIA 1P75A 4B3BA 1BD4A 3EUEA 3ENKA 2YOGA 2HU8A 5CLGA 1UT6A 2B4QA 3KCQA 1P1RA 2CEAA 2H9YA 1PQ4A 3OTIA 1DAGA 1GT6A 4KQKA 2PZLA 4R2JA 3PEWA 4FW9A 4LBYA 4BLRA 3SQXA 1M6YA 1FE8A 4WY5A 2HU5A 3EF3A 4WKBA 2ZQ5A 3V4RA 5AKYA 2AEJA 3D64A 1H42A 1JAYA 1E1CB 5SZIA 1X7XA 1JDBB 1QC5B 5JCPA 3UZUA 4N48A 3G2PA 4FDMA 4TKMA 4YCLA 2MMGA 1LCIA 4YLYA 1T0HB 1Q0UA 1ISIA 2XCLA 4B44A 1J8DA 2JA2A 2GLUA 3HBLA 4ZEOA 1T6XA 2FUEA 2ZIXA 3EULA 3L1JA 2GYWA 4W82A 3AVYA 1BC5A 3O8NA 2PAAA 4QNNA 5T3YA 4KV7A 4LZLA 4TUYA 4FR2A 3ECCA 4Q7MB 4Y1FA 1M3SA 2DYKA 1QO0A 2H5EA 2Z8ZA 2OB1A 3MT7A 3NDIA 1RRVA 2FWNA 2HKIA 2NV6A 3L4BA 1GNTA 1I0IA 3L7NA 3LW7A 5CK4A 1NVUQ 1RYHA 3VZBA 4Z7QB 1NNSA 3O8OA 3EXFB 3HE3A 2Q2WA 3THYA 5KOJB 4NAVA 1UBFA 2X86A 4R8LA 5KUTA 3NOVA 1A2OA 3OKPA 4ZQBA 1SZCA 4IXWA 2XAUA 5AKXA 1EUYA 5JVDB 2ZI3A 3LCVB 3R5KA 1E1RA 2PO5A 2AJTA 2WU0A 5KIAA 5FFMA 2Z5FA 1RKVA 3C6QA 4HZUB 3LC0A 3SHVA 3KR0A 4CQLA 1AURA 3TG2A 1E7SA 2DPXA 3AC0A 1WO8A 1YVUA 1QP0A 3VR2D 1GPAA 4I5DA 3IP3A 3JPWA 4I6JA 3RRXA 1L5HA 1DDOA 1WW3A 2PYIA 2X7HA 3O75A 2XX3A 1ZFNA 4HAZA 4MPPA 5BSRA 3TTXA 1X15A 2C5SA 4KIJA 2A7XA 2IYRA 1L1RA 3TRDA 5EJIA 4D4JA 4YFVA 4YUWA 1SUDA 3TW6A 4ODIA 4DVGA 2JLWA 1IVYA 1G4UR 2WY2D 1SKYE 1LQTA 3LBNA 3P4UA 4KRYA 2WIFA 4RHCA 1Z5OA 3A4TA 5JV5A 3Q9UA 2QMYA 2D5LA 4URVR 4ARAA 1V41E 2GZ1A 2JIZA 3V34A 1EWYA 3D6TB 5KNBH 1R4MA 3MEQA 2G6BA 2Q6IA 1VMEA 2OLEA 3TN7A 2EIXA 3RBAA 1SG9A 1NR1A 2GLTA 3O2QB 4RD6A 4FFNA 4CQMB 1FIUA 5IH7A 3KEQA 4MWBA 1DKPA 4GEGA 4NSNA 2ID4A 3TFQA 1WOMA 4MKIA 4OLHA 4B83A 3HP1A 1D2HA 1DC4A 1O5TA 2WNHA 3DTYA 3FAKA 4LXTA 2YXNA 3DOHA 2WJWA 3N1UA 4NATA 2FX5A 4RJJA 4U39A 4EQZA 4KPGA 3W9SA 3NT4A 3TLZA 2ODEA 2R6FA 1YL7A 2ZR9A 3ANXA 4UEQA 2JCYA 1UWCA 1HA3A 4OTZA 4CW7A 1AMNA 3BZUA 4NARA 2Z3VA 5JALA 1YR7A 5BW4A 2BUAA 5FWXB 5IJWA 4LF6B 1RJ9A 1C8BA 2RGNA 2F8LA 3OZXA 4BNDA 4E1VA 2FRDA 5AVQA 3RVDA 4P5DA 1FS6A 4U2BA 1L5HB 1INLA 4E1AA 3JARA 4ZV7A 4DGSA 1T5OA 2R00C 1U81A 3ANMA 3RSFA 3S7ZA 1L7XA 1T26A 1AHNA 4PXYA 4X93A 5BP7A 3UKOA 4DT1B 1RI4A 2ZBVA 3NRBA 1RLMA 4GNRA 4QQFA 2J67A 4DZZA 3C70A 4R2MA 1X92A 2Q3DA 2RHBA 4V0SA 4LV6A 3TQCA 3E27A 2J3MA 1T9GS 2I2BA 1ZI9A 2ACWA 2WVJA 5FR2A 3DH0A 3SP1A 4URXR 4IW3B 1US8A 4WN9A 2GYYA 2ZS7A 3DP7A 3UFBA 3ZGLA 3T1NA 1F7UA 1JQ5A 4CJXA 3TEJA 2XNDD 2PXCA 2O50A 1IAQA 1JR3E 3GMTA 2H5JA 4LRSB 3AR2A 3BMQA 2CBZA 1L1FA 4CR7A 1QTIA 3MS7A 4IYJA 2PMFA 4V0NA 2HYDA 3M9LA 4HAWA 5IDXA 3IBCA 1KZYC 1TC2A 2QN1A 1ZH0A 3QA9A 1CX9B 3R24A 1AB5A 2PVSA 2WMDA 3KOUA 4HPJB 4MYTA 3W3ZB 3DZFA 1A50B 2R5FA 3R0VA 4KXXA 3V33A 4JJ7A 1FDWA 4QUBA 3KQNA 4Q3LA 5EGNA 2CNDA 1XZAA 3GB9A 2B3TA 2AFIA 2C1EA 2HUNA 2BTOA 3ZD7A 2G0TA 1L8OA 2BOVA 1WBJB 1YZYA 4YYEA 2V7TA 3R09A 2JGFA 4RTLA 3FYTA 4QAQA 4L9AA 4Z54A 1PHRA 1Z47A 1SBCA 2N75A 2Y67A 3H2GA 3COZA 1WQ4A 1PT6A 4EGAA 4AJLA 3OJFA 5HKBA 2D62A 3UT5B 3WP1B 4K6HA 3S81A 2OV8A 1X2EA 2P77A 2Q5EA 4NABA 5AIBA 1IUKA 3QLUA 4LJ9A 4P7KA 1Q74A 2RI6A 3ZOKA 4HDNA 1VXOA 2G8LA 3QKRA 1M75A 2NV2B 1GN9A 3OHPA 4TM7A 3VVBA 3CNNA 1ZH6A 3WISA 3WL4A 5KYWB 3E4DA 3NBYC 4PG7A 1M7HA 4TUYF 1XAJA 4GYKA 2CMHA 4I7EA 3U26A 3IEVA 5K0FA 1Z2CA 3PC8C 3R3JA 4JHLA 1VJRA 5BV2P 2BFDA 2OXIA 4K26A 2BGGA 3AV0B 3AHEA 3T7KA 1PJ8A 5KS2A 3KOWA 4Q03A 2FVYA 2ZXUA 4BZWA 4KPFC 1NBOA 2EZ4A 3R7WA 2WSSD 1V1MB 1GKYA 4OREX 1MC4A 4AY2A 2NVUA 4H7KA 1M1ZA 1R0WA 3G82C 2ENWA 4FYJA 4P31A 5DX0A 2Q8QA 4ABTA 3AYZB 2I67A 1N6NA 3CXRA 2ECPA 3MFQA 3NDPA 5LDGA 2DQKA 4EM6A 1FS5A 3IURA 3EHEA 4LHXA 1R0RE 4XUDA 2W58A 3DL7A 3MRSA 6CHYA 1AQJA 1DKNA 2Z98A 3PEEA 1YDHA 1W59A 2HQRA 3PA8A 1D8AA 2FXVA 1MW9X 3RJMA 4HQOA 1D2NA 4CIXA 2JIPA 4UDYX 4D8YA 5FPTA 1ZD4A 4GW3A 5DN6A 2AFHA 4PBTA 4YLEA 4ENTA 4BBPA 3E1KA 4M87A 2QMZA 3H9UA 8MHTA 3H75A 1YIAA 2ZRDA 4EEXA 4M8KA 1C30B 4QHYA 2CBGA 3RW9A 4L28A 5HE9A 3VNRA 2I1QA 3LBIA 4JYMA 3NBAA 3IKMB 3GOQA 1E89A 1HDCA 1V4BA 1XD8A 3WLKX 2A1TR 1UJBA 3Q12A 2A9JA 1SCQA 4BZQA 4CKEB 1PI3A 1EZZA 1GGNA 3AJ8A 3HUFA 1YCHA 5DKFA 2Q3BA 5KQRA 1PL7A 2H52A 3F6RA 2DFLA 2FUG6 3Q8KA 1RVV1 4XLZA 4WQMA 4MV0A 3EDRA 4FJ1A 4FM9A 3KQMA 2VIIA 2PZFA 4BGUA 2BJWA 3D6NB 1DC6A 3PQ3A 2V96A 4XYBA 5FJJA 3KEGA 4X20B 1BCRA 1ZUWA 1F6BA 1PR9A 2E37A 5H3LA 3R76A 2X1HA 3ANYB 1U90A 4MYCA 5JRDS 3K0CC 4L2IB 1LJUA 2CFTA 2H31A 2VXCA 3QUAA 4U7PB 4XD2A 5CITA 8ABPA 2G5GX 2X77A 2IQIA 3H13A 3U7HB 5KTMA 3PWZA 3OLYA 3QVUA 4RADA 4CTNA 4IDHA 3JXEA 1BN7A 3W8NA 1NMYA 2FEWB 5IX8A 2O2SA 2OYSA 4I2NA 2V6MA 2OG2A 1PP4A 1VIYA 3GXBA 3M4YA 2KPOA 3KJGA 2SICE 3OO0A 3O5AA 4XGIA 4BP1A 4TPKA 1FVOA 4NC9A 4COOA 1E7WA 3FOBA 1ODSA 5IN4A 1Q2UA 1WLYA 5CVEA 5TQVA 13PKA 1AIPA 2LRHA 3TMKA 1WNTA 2WHEA 3SM9A 4HWTA 5KX5A 4UMVA 5ILGA 4PIVA 3DTVA 4YAFA 4DEYA 1LNSA 3QTTA 2CDCA 3PUHA 4XD7A 3BJEA 3TYXA 5I7AA 3I73A 4EDHA 5BVHA 2C99A 4HLQB 1RE1A 5F4BA 5KMGB 3AX6A 4IQ0A 2VHYA 3WJ7A 5EJ7A 2CB9A 3UA3A 1I8TA 4D2IA 2QT1A 1QH9A 5CB6A 3DZJA 1PS9A 3FBGA 4MIOA 4LY9A 1ZD2P 4QECA 2OVBA 2WA1A 2J48A 1LKZA 4E5UA 4LOLA 3R3YA 4YJHB 4CWAA 3FTFA 4Y67A 4B4OA 2FVXA 5GONF 3MMNA 1S3SA 5E1BA 2G9NA 2QRJA 3HLTA 4ZZ3A 1OROA 2Q6OA 4F56A 4YWJA 1GCGA 2NXWA 3UC9A 2D06A 3NTUA 3WNDA 3HKEA 5EHNA 2JCBA 3DAHA 3P0JA 2OV6A 4H7JA 4N6GA 1F4LA 5EHZA 1OILA 1T4MA 4D56A 1E9BA 2X8LA 1MAVA 3RU9A 3LT5A 3CLSC 1HDYA 4BQSA 3U13A 1A88A 4L74A 3SM3A 1CUSA 4H1WA 2Z9DA 4KNVA 4ZDKA 4L5YA 4OQMA 2J0QA 3RYFB 3ECSA 3T3IA 2ZS8A 4EECA 3AP2A 1DFIA 1T2FA 4GBJA 3MCWA 2PU7A 4PZ9A 4FCVA 1Y3CE 2QRUA 3L1KA 1CF9A 2VHEA 4ZYLA 2ZRBA 1QX4A 4JI5B 3X1WA 4RMNA 3A2NA 5J4YA 4D74A 4E5MA 4UBLA 1RYNA 2QENA 4RVHA 3ZQKA 5I7WA 2H8GA 4CKBA 5EXPA 5DPMA 1VSVA 3VR6H 1KJZA 4GI3A 1JA0A 2F59A 2NGRA 3ZV6A 3BRCA 1JBQA 2R1UA 3ACDA 2ZANA 1FYVA 1MLDA 1M73E 3G3EA 3ZC3A 4AKGA 3WGJA 4C7MA 1MOZA 4IAOA 4AUNA 2FTKE 3KZMA 5HGXA 4MUEA 1L8LA 3ETJA 3BB3A 4RIEA 3X43A 1OFUA 5EYPB 5H3CA 2CDRA 3ONVA 1PWHA 1QH8B 4FZRA 2AN3A 3KR2A 1E2MA 1EP3B 1JVSA 3L46A 4KO2S 2WLTA 5K6AA 2VNIA 4HN2A 4KV9A 2BE9A 4WX2B 5GMOA 5TSDA 1QR2A 2CK3A 3T1HB 4HTFB 2FN9A 1GUFA 1R00A 2VYND 3QVKA 4G97A 4ZKEA 1QHFA 1V16B 1L4FA 4ZT6A 1IXYA 4NRDA 3KWFA 4RLQA 1EIZA 5H0IA 5JASA 1TEXA 4MS1A 1B8PA 2RARA 1L4YA 1QLHA 4YMSA 4GPZA 4D9KA 5T4EA 4F04A 4AI6A 4B85A 1I4EB 3W5IA 3ZIAD 2JFZA 4XIYA 3UAVA 5DF1A 4X85A 2J87A 2C8KA 2Q1SA 1R16A 5CVDA 3V8BA 2VSXA 3OMLA 3VR5A 5I9LA 3OOHA 5A3VA 1FYWA 3GJ8A 3EGXB 3BK1A 9GPBA 5LPNA 4LOHA 2JCXA 1JHPA 4J1QA 1RIFA 4FEEA 4RSGA 1YAJA 2ZSHA 3UEOA 3AO0B 1DC5A 2NSYA 2Z56A 5BVHB 3CVWA 3I61A 3WYFA 3SZRA 1VFPA 2WTEA 5BOSB 1NBWB 2BMFA 3H2BA 4FS3A 3ABIA 2BZ0A 4B73A 1FYDA 1Q16A 4YP6A 3W6NA 1U02A 3UAGA 2C2YA 3VU9B 1F6DA 2VDKB 5KYXA 3CT4A 2PE5A 4WOKA 2IIVA 2R6AA 2R8ZA 2DR2A 1L9XA 4G5QA 4FT2A 2X15A 4G4SO 1KYIA 2XEDA 3PIRA 3LVRE 3QNWA 5DLQC 3BUSA 2QM0A 2ETVA 3QQ5A 4QKQA 1GU1A 2HZ7A 2FGKA 2I1LA 3DF7A 1JFLA 3WZMA 4B7ZA 4QDXA 2HPAA 4P93A 4QTTB 2ZVQX 1OT5A 3KP1A 3CLUD 4HQNA 3WGMA 3IAM6 4NMXB 1FX1A 1QIDA 2H16A 5J4HA 2HHJA 3OO1A 5HRUA 4Z8YA 5LNK6 3R9XA 3FZEA 2ZLBA 3S27A 3IL2A 4HN9A 1U0BB 2JI9A 3NOXA 3LPMA 4IJMA 4Z5XA 4IIBA 5TRTA 1Z4NA 2YV2A 3I9MA 4LE2A 4BO6A 3WGUA 3MMSA 1RWOA 4OGKA 3A1VA 2VBFA 3UOGA 5GOTA 1N0WA 2HRBA 2R6GA 5ECWA 5FORA 1YFZA 1Z39A 2ODNA 2XNHA 2ZE5A 3Q10A 1CY2A 4TZ0A 1TM2A 5EP3A 2QLLA 4LPKA 4NU8X 3PNLA 3BAFA 3L05A 2QIOA 3P9YA 4P36A 2HMVA 2OBNA 4I66A 5TC4A 4CF4A 4C2TA 2CJXA 2CLIB 2FW6A 5D51S 1FDUA 3OG9A 2LDXA 1AMOA 4B47A 4X65B 4AAYA 1KBZA 3OJEA 5DB4A 1GYQA 4OH1A 2JLBA 3TSYA 2ZZKA 5IH3A 2BGIA 3HCOA 3W6OA 1P29A 3JWJA 3DBIA 3PD7A 4G0OA 1EUQA 3DEZA 1UJ4A 3SF8A 1OXBB 4R6WA 1TYAE 2W11A 5C8VA 1MH1A 2X19A 4V03A 2A92A 1Z0ZA 1GFZA 3FF1A 1PSZA 3LBHA 4U0JA 2LKCA 2JI7A 4O33A 2V7QD 4FQ7A 2FPMA 4V3BA 3GJ6A 2G36A 1QIMA 4QOJA 1NXXA 3BL5A 4MQFB 4O5AA 1M6VB 1VJ0A 2XXJA 2AOTB 3O9MA 4L5BA 1I14A 4MV7A 3WSTA 4DSZA 4YMLA 1Q0LA 2CNWD 3ODGA 3R7BA 1ABFA 1DQNA 2WAAA 2HWYA 4B34A 3G1WA 5J4KA 3K9CA 3QEAZ 1LPAB 1VBMA 1LFDB 4H0FA 3OEEA 4ICIA 1E5TA 1OY1A 4RF4A 1ND5A 1UAYA 2FOXA 4CMCA 3VNVA 1SU7A 3CZ9A 5CEJA 1B6SA 3DMPA 5AW4A 4OQEA 4HGNA 1TVKB 2Z5VA 4JLWA 3D7SA 5DXJA 3ZTYA 3CEHA 3GF4A 3HP4A 4JJ4A 4J94A 4D3XA 1R12A 2JDID 5DMXA 1K7CA 1NRWA 2VHTA 2W6MA 1Y1KE 5JFTA 3DVRX 3MOGA 2P2NA 2IXBA 1MGPA 3DBLB 3NOOA 4K81B 2JBHA 3UC5A 4X1KA 1A9PA 2ZG6A 3ST7A 4N18A 4C7VA 4EI7A 3ZQJA 3LECA 3KETA 1U2TA 4R2IA 3WLPA 3C1TA 5D5QA 2WFZA 2W98A 1VDZA 3HVHA 1A8SA 3M2TA 4NTZA 4RHYA 2G9QA 4EF5A 4LRYA 4XAQA 3U62A 1XALA 1NPTO 5IF9A 5IKXA 2P2CA 5BUQA 4ZEVA 4KDRA 4WBSA 2WM3A 3H19A 1YFLA 1U63A 4I55B 4OYHA 4BFVA 4C04A 1N6PA 4G9EA 4EA8A 3NEPX 1Y3HA 2OZLA 4GGPA 3DMDA 3C6ZA 4LZOA 4HNRA 1SXPA 1JIKA 3ZHRA 1V5FA 4CTMA 5KVCA 2BFFA 2IYLD 4Y6GB 1H2WA 2A9QA 1DX4A 1PD1A 4YRCA 3BSFA 5JQGB 4YJGA 5LOVF 4UC0A 3IT3A 4TRJA 4XE5A 3FHTA 3E22B 4Q4DA 3R6LA 4EW3A 2Z9BA 2EHDA 2QRHA 3CPSA 4I4TA 3OUUA 1OAOC 3WC4A 1OV4A 5BMVB 1I3LA 3QM1A 1XNJA 1OZHA 1LLUA 2QTAA 2JLUA 1JFRA 1OXVA 4BV3A 2QEQA 3I6MA 4P4GA 4DWVA 2YYZA 2DBRA 3QFFA 3UMYA 3G0BA 3FUVA 5TIIA 4F6RA 4X61A 5TMEA 1ZWKA 4X94A 1RSZA 1B76A 3WIDA 3GLGE 1NVWQ 1TVKA 4K6FA 1E69A 1G63A 1SN7A 5CJPA 2FSSA 4N0DA 2PUEA 3NWBA 1D2GA 2OCDA 1IUPA 3EXHC 4KX5A 4NK4A 3RBZA 4XM1A 4DC1A 4V0QA 2COKA 2ZWOA 2ID8A 1ZMBA 4RVOA 2W6PA 1JHXA 3DEIA 4WECA 4F9GA 3OZCA 1MVLA 3VR1A 4AJ4A 1TJ4A 2BMWA 2CKMA 1JEEA 4D79A 2CV2A 2ZYSA 4DXDA 3CVYA 5C3UA 2ZW9A 1WVIA 3I34X 4M89A 4NFHA 2GKSA 4KBYA 4DLPA 4ER0A 5EWLA 1XZGA 1U0NA 1M33A 1F3LA 3HB4X 4UZFA 4D9EA 5JQWA 1V5WA 4W9RA 5C37A 3FGZA 3Q7QA 4Q3AA 1TYBE 4EG3A 2AQKA 2JI8A 3HN7A 4UBIA 4EG0A 4MLPA 1UJ6A 1M2VA 2YJ6A 1HETA 4A10A 1GGKA 2ZUEA 4JJAA 5KHAA 3SC2B 3VXKA 2UUAB 4TTAA 2Q4RA 2ZEJA 5CDHA 2WUWE 4X45A 4Q4CA 1IJFA 1R15A 1JI3A 1RMTA 3CW8X 3JVDA 1V1RB 1NUQA 3K9QO 3DLBA 1RKBA 3MINA 1JZSA 1A5AB 1PG2A 2QR5A 4JXJA 3AESB 3VFDA 5J63A 1L3BA 2QYOA 2AR9A 3GIWA 1QMPA 2IEAA 3ENVA 4NKRA 2YZGA 4ACBA 1K3UB 1H3FA 1K89A 4I4TB 4BJ3A 4QG3A 5K8TA 1CUBA 4ZN6A 5K05A 1N33B 2J59A 4A92A 4KAAA 1AN9A 2VEOA 4O29A 2O2ZA 2JLSA 2WUEA 1F0YA 2BDTA 1CZKA 3BDIA 3QOXA 3L6UA 3K3PA 2PZKA 2WNSA 3GK3A 5IM5A 3LYLA 4KOAA 1V8ZA 5KQLA 2FEKA 1DX6A 3OAAA 4KQEA 1DRJA 3EA0A 1ENPA 4BO9A 2AR0A 3KKMA 4JT4A 3A58B 4ZOBA 5AO9A 3T3GA 2CCJA 4CPDA 4TTRA 3VU3A 5B5SA 4LE1A 1S02A 1Z0IA 3H1EA 2XA9A 3E2MA 3I37X 4UHCA 5DXFA 4EGJA 4KR6A 4YUXA 1U80A 1PDOA 3D8SA 2H06A 3HZOA 1T36A 5DVZA 2OTCA 1AS0A 1N2HA 3ZQ6A 4YIKA 4EI8A 1RRMA 3LHDA 2BW0A 1Q83A 2PSDA 2H9IA 1V96A 1JSCA 4PVCA 5CFRA 2WOOA 2ZSUA 1ESNA 2KM1A 121PA 4CF3A 3KWJA 1G66A 1WVGA 2B8WA 5LDHA 1IN6A 1JEAA 1RAAA 1HL3A 3EXFA 1X7ZB 2WDZA 5B1EA 4Q9AA 3L7CA 1JE1A 1KYZA 2G80A 4UJ3A 5DHPA 4NCAA 1DT5A 2XWPA 2IYNA 2ZU0C 2WAMA 3B9QA 3HI6A 3UQYS 1NI4B 2J45A 3RNLA 3EIHA 4L6CA 3EGDA 5E3HA 3K1JA 4AVYA 5AHWA 1X87A 3FNFA 2IOFA 3LUGA 1KY3A 1T2CA 4H1VA 1U3GA 1UBGA 4OHOA 4X44A 5G0WA 1UEXC 3EZNA 1T3SA 3RROA 3WHIA 3HXPA 2XCTB 2F1RA 3UHAA 4DLYA 4EDFA 3G17A 5H59A 3WK6A 2WWFA 4FTWA 1G5HA 1Y37A 1WDKA 3DR5A 3CZCA 3RAFC 4J43A 2QRMA 4PWYA 3LFTA 2ZYTX 4IOMA 4UAUA 3OHMA 1PJSA 3NVAA 1FL9A 3HP7A 2FEXA 3V9PA 3SE0A 1E1CA 1F8UA 4F2WA 2PD4A 1CXZA 3TCKA 3PHLA 2E21A 1D6SA 1T1IA 1BW9A 2VL7A 1GUBA 1L4GA 2X1LA 2XITA 4JQYA 1PSWA 3ZJTA 2JFBA 4GPTA 3ZX5A 4KFSA 4YCNA 3JRNA 4QUAA 1JL3A 2C2MA 1ESEA 4HYTA 4LJKA 4QQ8A 4A5OA 4DNQA 3QMPA 1ADGA 5EQDA 4LGYA 1KEVA 1QVZA 2PUHA 1X1AA 3IO3A 5B53A 2H2WA 4JR1A 1N25A 2UUCB 3SK0A 1AKQA 1LUAA 2Z43A 3ESDA 4JFRA 5LU8A 1SXIA 4PO1A 2RGRA 1JQAA 2OMKA 3X2SA 1XXHB 2AKYA 3F6CA 3VHLB 1JPNA 3R3ZA 4M0LA 5F35A 3J81A 1E2PA 3PITA 4WFKA 5F5LA 1M8JA 2JGJA 4CEHB 4OB6A 3CZMA 3E7FA 4HADA 1YA6A 5AXBA 1EXNA 2WZCA 4K46A 4BU0A 3QZUA 1Z0UA 2BFEB 4WLUA 3SX4A 4D92A 4BPBA 4BVGA 4MHTA 3D02A 5DI3B 1CR6A 2BBWA 5HFAA 4CT0A 5A1TA 1SPBS 1BXGB 1G8MA 1FDVA 1YU6A 1YZVA 1R8YA 1U9CA 1DQRA 4MHSA 2Z2JA 4MW4A 4CMEC 1VOTA 2ZB3A 5D87A 3JD3A 2B1IA 3PRHA 5LBTA 1PR5A 1CNEA 5HM8A 1MB4A 4QFBA 1RZRD 1W4LA 1NF2A 1P2SA 5HIMA 1TT7A 2H4HA 1C81A 4EUEA 2BGTA 3D2AA 2C5FA 2XMRA 2H54A 5FL3A 2P5TB 1HDXA 4FDUA 2JLCA 1D0IA 1EAYA 1P7CA 1CP2A 4WZBE 2NO0A 3S1SA 3HGMA 2AC2A 4BGIA 1EK6A 3SVTA 1Z8NA 4FHFA 4BQQA 2HBQA 3GNSA 4ZVKA 1EBBA 5BQOA 4B6FA 1E79D 1KAQA 4HNTA 2PH3A 1V7ZA 1D1QA 5DI3A 3IVCA 5BQFA 4JT2A 1XVIA 3VKFA 2GYVA 2PTGA 2G40A 4FCCA 4HNQA 5AHKA 4PR3A 1MT3A 3B89A 2WR8A 4G5YA 5EJMA 3SZUA 2EL9A 4P3OA 1GA1A 1C9YA 1Q2XA 3QYPA 3M81A 3VPCA 1XXHA 4KVZA 4BZPA 1Z5WA 2FPWA 1O5OA 3J7AC 4WD3A 2QP4A 3ITDA 1Z37A 4HNAA 1PFWA 2AG6A 2X4IA 4MQ4A 3VAZA 2ZR0A 5CDGA 2HCBA 4G5XA 4OFBA 4XIGS 2VF7A 3MSCA 3M3DA 5BUSA 1AUVA 5K0GA 1BG6A 3JQFC 3REQB 5IABA 1V6SA 1XNHA 2I6FA 1WXXA 4K86A 2JJ2A 3D7KA 2PVCA 3HN2A 1K7SN 2Q0XA 1IOLA 1GEGA 3AUYA 1FQWA 1LK5A 3PZRA 4OBWA 4WGGA 4OCZA 3H6HA 2YRXA 4FOOA 4ISCA 4Q00A 4KZKA 2ZE7A 4FX2A 3Q0IA 3WL7A 1B6GA 2VDOB 4HH0A 2QD4A 3QE2A 3EYAA 1ZA1A 4QXMA 3RBVA 1AKUA 2VHWA 5FF9A 3VAAA 4A27A 1I7QB 4WLVA 3WLFA 3RODA 2R62A 1WZ2A 1KDTA 2Q5LA 4I3FA 4B2PA 4Q4HA 1DEHA 3IILA 2QJOA 2Z2XA 5HCUA 3AT1A 5KWIA 2GLXA 5AW2A 1NBHA 4QDTA 3ZS9A 3ETEA 2AHOA 1Q15A 2YY7A 5JTTA 4RVNA 5CNIA 3KHUA 2O5CA 5AVXA 2IBTA 1XZMA 1XZDA 5LQNA 4BNFA 3UG6A 1XZBA 2XTZA 4QJ4A 2WSIA 3HJTA 4EI9A 4M8SA 4CRWB 3I6IA 4DMCA 3WLAA 2I76A 4BGDA 2FRVA 2X3YA 3JATB 3K35A 1QYWA 2HK8A 5IKMA 1RQ7A 2HEGA 1Y6ZA 2BWJA 4JN6B 1JXMA 4RIIA 2O54A 4PZLA 2QI9F 1IOVA 3DKPA 1YSCA 3AETB 5I5GA 3RF7A 1QOPB 2AHRA 4JI6B 1DT3A 1KI6A 4AMBA 3S40A 3FW1A 4AJ1A 1CQJB 4A0RA 3VX3A 2YFKA 4B4KA 3M9WA 2P0AA 1A8IA 5AKKA 2AZTA 3RYHB 5CFMA 1RR6A 3AR7A 3GCWA 4RTMA 1ZOSA 5SICE 4MS4B 5D3MB 5KNCH 5GTDA 3I6YA 1VHJA 1Z74A 5EXXA 4YP9A 1Y5IA 1IEXA 1FZQA 7GPBA 2GB4A 2VF8A 1OT3A 3JVIA 2F3PA 1OLUA 1F8YA 2IU4A 4J0FA 4M54A 4A23A 1GEEA 2GJ8A 2JK1A 3QENA 4JP8A 1XMPA 1UXGA 2PYDA 2VP0A 5L3QB 3GFVA 2GEUA 2WOJA 5BN5A 4TGLA 1H85A 1LNQA 1VKOA 2D00A 2VTEA 5L6LB 3MJ4A 3UK0A 2I71A 3E3MA 3HO6A 1W0JD 3V1UA 4RQBA 3D4LA 4IDQA 2EGHA 5EMJA 5IU6A 2HRRA 1N5IA 1J5XA 1B0ZA 1XVUA 4ARZB 2DLDA 1Q17A 1G5QA 3HZHA 4BNNA 1Z3IX 1XTSA 2HRCA 2PWZA 4HGYA 5A5GA 4HMQA 1XK6A 2E9SA 1KC3A 1RT9A 2MSWA 3RJ9A 3RLFA 2Q7OE 4KOEC 1OOEA 4MPDA 4EUKA 4KE8A 3PX2A 1YOBA 2ONCA 3OOEA 4MYHA 1DZIA 3HL0A 5D7BA 1YJ5A 3PKJA 5I9NA 2PKYX 3PGA1 1RWPA 5FNVA 3ZY3A 1VKNA 2RK4A 3GQBA 2P79A 4RC9A 4B7UA 4YXFA 4GXTA 3AXTA 3OJCA 1R9NA 2O0HA 2WPDA 3PPWA 1LLDA 5MF6A 3CZPA 3DQPA 1IVSA 2ZBFA 2QGNA 2JIBA 4L5IA 5IULC 1DUVG 1NUSA 3GLGA 4N0MA 3UWPA 3U16A 1U4SA 2DBQA 1KMNA 1JAHA 2Q2VA 3C6XA 3DE1X 3FAZA 2ODPA 2RHRA 1N36B 2QUHA 5IZCC 3H1PA 1FLDA 3O3OB 4BZZA 4UBMA 2LXNA 1XZFA 3FTQA 4LSZA 1YQ9A 4JYAB 4C87A 3ZE6A 3JQFA 4BKUA 4UM9B 1CF2O 1K7FB 1NXPA 2J3HA 1A76A 2R84A 4PO9A 4CV1A 2I6TA 4A73A 3DBRA 3TEMA 4PNZA 3TDMA 2W2NA 3VPHA 3A6FA 1BRTA 4ZQEA 2Y9PB 2NNWB 2ZYRA 3IYLW 4X24A 3GDOA 2CT8A 1JHAA 2AWNA 2C7BA 4IH1A 5A4FS 1TF5A 2NTJA 2BKVA 3W04A 1JA9A 4ZI5A 5DI9A 1P60A 2D1SA 3F74A 1VL8A 4JYZA 1AGXA 3GLIA 1PW5A 1T3LA 3RIHA 4HQLA 5JY1A 5JXHA 3AR4A 5E6SB 3CU5A 2P11A 3DB2A 1M1UA 4GQAA 1RP1A 1U4OA 1ZESA 3PPYA 4M38A 4QGAA 3C7DB 3DCJA 1NRJB 1QIJA 1XYYA 3EC2A 2QTTA 3NP7A 4LDRA 4XWOA 2GR9A 3KTAA 4A82A 4GI5A 1CTQA 1FFXA 1M9NA 1OXKB 5I9BA 3THWA 3OM8A 2NPFA 2ZJ2A 1ZW1A 3RU7A 3UV3A 4E7PA 3LE8A 3L6OO 5AVZA 3JQ8B 2AX3A 3M1LA 4ZO7A 1KI4A 4M2LA 3QXXA 4X1YA 4ZVRA 2JKYA 5KYTA 1ID1A 1KO5A 1MO4A 1NVVQ 1R5JA 4OJNA 5HILA 1XSEA 4FFVA 4CFYA 4ZGGA 4TVSA 4Y1EA 3L79A 3QX9A 4FD2A 5JJBA 3FVTA 2NYUA 1Y7TA 2CD9A 4UOQA 3A06A 5JECA 3PPXA 3S7TA 3SPXA 3NEJA 4FE7A 3TVDA 3WICA 3R6GA 5E1DA 3UJPA 4JNCA 1PEKE 1YB4A 3GDGA 4KWTA 1A82A 3S29A 4E32A 2FMTA 4HB2A 2OBMA 3GNLA 4GWLA 1SZPA 1W0JA 1MJGM 2UYOA 4NV0A 5DISB 2O7VA 2IELA 1MD9A 5I9MA 4XCQA 4YMHA 2WWYA 1HR0B 1E1MA 5CDFA 1PE0A 1Z2EA 3DE3X 2ASEA 5FAXA 2RH9B 3A9RA 4IKEA 2Q4EA 4JJGA 2BMJA 4DV7B 3FYHA 3D81A 1NQ5A 1UOPA 1JHYA 5SZJA 2O8EA 1U31A 4KXYA 2AL7A 3AEQA 2EFYA 4W7HA 4Q4JB 4XSHA 4E46A 1VJ5A 1Y9ZA 1N5JA 3A8TA 1GSOA 4P5PA 3VO8A 4XEHA 4JEHA 2QMQA 4A0GA 1GZVA 3Q3JB 4OX9Y 1UPCA 4BIIA 1MHTA 5DHQA 3VX4A 2PT5A 4CFSA 4MQ6A 1IULA 4RK1A 2PUFA 2ZP1A 3C3PA 1QQ5A 2FW8A 1UXKA 3KBOA 5ALFA 4W8OA 4DILA 2XVZA 1EDDA 2IYQA 1F06A 1KIAA 1WDTA 3SZMA 1T34A 5JCZA 2ZCJA 2RBKA 3O4JA 4MPRA 1Y8AA 3DO8A 3T7TA 3V6MA 1HH4A 4YUAA 2FZVA 2HNAA 3PHIA 3N7AA 1IDOA 1E1YA 4JITA 4BAZA 1IZYA 1SXQA 4IOJA 5HFJA 1LTHR 3EVTA 3Q88A 5D3KA 3OY2A 1Z0KA 2LGJA 4D6PA 2XUIA 2GEFA 2X4GA 3GGGA 2K5UA 2LBPA 3NIWA 4RZXA 4OX9B 2J0SA 1MB9A 1PYDA 3ESCA 5BPHA 2GSWA 5CA1B 3C5WP 3HRKA 3LAWA 1O9BA 3NBKA 3V7YA 3WDKA 3ZHZA 2AQIA 5IG2A 3OTOB 1J8YF 2VHCA 3I05A 1QYIA 5FBHA 2O0KA 2Y66A 5TF4A 1P73A 2EHJA 1ZVJA 3DP9A 4OUDB 4TLBA 2ZBDA 2HREA 2HWKA 3U17A 2XHEA 1EWQA 1ECJA 4MO9A 4LCEA 1DTWB 4P98A 3QLUC 3QP9A 1ZNYA 4PLYA 4QDUA 3HXOA 3C6BA 4DHEA 4BQFA 1VZ3A 3I2HA 2DFTA 2VJLA 3MBOA 4BNDB 5G3ZA 3MTQA 5DWQA 4CI9A 4U2CA 2GTIA 4K9KA 1KAEA 4FOSA 2FB9A 3ZTWA 2CJYA 3IFSA 3DWGA 1IH8A 4MUYA 5EHXA 4NS1A 4BATA 3G6WA 2EGUA 2IZOA 1TK3A 3GG2A 4QULA 4AQYB 2FDCA 3IIMA 2YYAA 3H8WA 4RH0A 3WB9A 1V3VA 3BXXA 3WK7A 5TDHA 1JH9A 4TYYA 4ZTZB 4LX0A 1U0EA 2XT6A 3S2FA 2FLVA 2QRQA 4JSYA 4GMXA 1CY7A 2HXGA 1AS2A 2O2DA 2AZMA 3K1TA 5ENZA 4EX7A 6AT1A 4Q48A 1SUSA 1G8SA 2ZYIA 3PUZA 4X1KB 3KUKA 5HIIA 3WYGA 4KO8A 2BGRA 1G8JA 1TM4E 4ZOCA 1P5JA 5EKDA 5H83A 4DCCA 4OLBA 1JKJA 3ND9A 1MAAA 3BF8A 3N2KA 4FIDA 1H0HA 4HWOA 4MW2A 3EJ6A 1K27A 1YH3A 1GPBA 2Z8XA 3I2FA 4IJQA 4BP9A 1W6RA 5AD1A 3GJRA 2BEVA 4G01B 4RIHA 1HXHA 4QTXA 1NSYA 3S2SA 1CZNA 5ALZA 1TVEA 1SFRA 2IS1A 1WU8A 3LDUA 4B0OA 1MTOA 4YCDA 4WFJA 4H3SA 4NBUA 4XGRA 4ONEA 1VQ1A 3ROEA 1KPGA 2OFPA 3OCJA 3S2UA 3CH6A 3ZOZA 2JLVA 3N2EA 2BCGY 4P33A 3OICA 1N8TA 1PDWA 2NUTB 2X3UA 4HXGA 1GZ6A 4MLDA 1PX0A 3P9KA 2QSUA 3GZJA 2HIMA 2ORYA 2VJYA 2Z08A 3C1AA 1U0TA 1YHYA 1E2KA 1VLJA 2B92A 3JZIA 2MR5A 3P2IA 1EXWA 3QPWA 3CLUC 6Q21A 4IJUA 2O2CA 2YYYA 1NDHA 4ZOLB 5EKTA 2VUTA 3LNTA 2CN1A 3P94A 1W46A 2BM8A 4KKVA 1ZGHA 1DBRA 3E8XA 2G1AA 4G4SP 2PMCA 3L5KA 4IMRA 3TIXB 3H2SA 4FMDF 4ZQFA 3I2KA 3GUUA 1EK5A 3K15A 2V8OA 1ARZA 2KS6A 2QP9X 3A25A 1A5ZA 3OZEA 2MR6A 1FMCA 3PD0A 2Q1WA 3OZTA 1GGVA 2VPWA 3TD6A 5K0SA 3CVXA 1X1TA 2ISSD 5J5AA 2O2YA 1GAXA 4D0NA 3E22A 1U2PA 3IGFA 1CQIA 4FWIB 4ZCSA 1XIVA 2I6SA 1SIOA 2QTFA 2XNJA 3B60A 4RWEA 3G5LA 5IAJA 4D25A 2KBFA 2F00A 4NNJA 1RPJA 2GHTA 3HM9A 4TOIA 3GV0A 5EVCA 1FTSA 1U7XA 2CVHA 2H92A 2JAHA 2VH1A 3PB3A 1FU8A 4WXHA 3RJ5A 3OHSX 1N9ZA 1QLWA 2XUAA 1ZMTA 3FTPA 1SBNE 2XVYA 1AQLA 1P6QA 4DQLA 2W5UA 4ZOLA 4AS3A 5FL7D 3PRYA 2F3UA 2QBYB 3CWZA 3ISTA 1AH2A 3BWEA 3ZIAA 3G8DA 4I1IA 2HI0A 3C7KA 1VPLA 3QLEA 1CZUA 1YJAA 4CIVA 1GVNB 4DPMA 4R83A 4Q9HA 1R9MA 1O03A 4O1HA 5KTKA 1WBBA 4RS4A 4BUCA 3QVOA 3AR3A 2WUVA 3NX4A 3PEUA 3PI6A 4Q3CA 3OM0A 3SZGA 3VU1A 2ZWMA 5KBYA 2PT7A 3O4GA 4UBNA 2BPOA 2C2BA 2UU9B 3F3SA 1TUGA 2V03A 3IKJA 4QDZA 4YRQA 4PGGA 4ALMA 3IOBA 1EXMA 2R8YA 4JL5A 1RWVA 3F6EX 3DV2A 4C0QC 3MS4A 4XTCS 2Q2NA 5IC5A 2XD4A 4G1BA 2G1KA 4OQNA 4U3JB 4B09A 4HTAA 5A02A 3K09A 3PCTA 5EMMA 1SG6A 1ZISA 3G79A 5FFNA 1I5EA 1N7IA 4XX0B 1XJCA 5HQJA 2IZZA 1XLTC 1N7GA 1VHQA 3G8CA 2HLHA 3SE7A 1HQYE 1RRPA 1E4OA 2J07A 4PBSA 5KJEA 1LK0A 3S28A 1GZHB 2CWWA 3A3NA 3JD0A