3OY7A

Crystal structure of a virus encoded glycosyltransferase in complex with gdp-mannose
Total Genus 138
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
138
sequence length
392
structure length
392
Chain Sequence
MKLIIVGAHSSVPSGYGRVMRAIVPRISKAHEVIVFGIHAFGRSVHANIEEFDAQTAEHVRGLNEQGFYYSGLSEFIDVHKPDIVMIYNDPIVIGNYLLAMGKCSHRTKIVLYVDLVSKNIRENLWWIFSHPKVVGVMAMSKCWISDICNYGCKVPINIVSHFVDTKTIYDARKLVGLSEYNDDVLFLNMNRNTARKRLDIYVLAAARFISKYPDAKVRFLCNSHHESKFDLHSIALRELVASGVDNVFTHLNKIMINRTVLTDERVDMMYNACDVIVNCSSGEGFGLCSAEGAVLGKPLIISAVGGADDYFSGDCVYKIKPSAWISVDDRDGIGGIEGIIDVDDLVEAFTFFKDEKNRKEYGKRVQDFVKTKPTWDDISSDIIDFFNSLLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glycosyltransferase B736L
publication title Crystal structure of a virus-encoded putative glycosyltransferase.
pubmed doi rcsb
source organism Paramecium bursaria chlorella virus ny2a
molecule tags Viral protein,transferase
total genus 138
structure length 392
sequence length 392
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-09-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 3oy7A02
3.40.50.11930 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3oy7A01
3S0JA 2SKDA 4WHMA 2JZCA 4PQGA 3S2UA 3UYLA 2GEKA 3ZCVA 1PSWA 3CX4A 2GM9A 3NCHA 4CDRA 4GYYA 4RELA 3T7DA 1C8LA 3TAXA 4RIGA 3E3NA 1GPAA 3ZCSA 1E4OA 1FC0A 2QRGA 5IKOA 3OKPA 1L6IA 3CUWA 4AN4A 3MQFA 2PYDA 2X0DA 1RZVA 4EKYA 1P2DA 3CEMA 1XL1A 2QRMA 3DZCA 2VSYA 3S29A 3G2HA 1PNVA 3T3IA 4YUAA 4M7PA 3ZCQA 2Q6VA 3RSZA 1AHPA 1F6DA 2C4MA 3MT7A 5DXFA 3DDWA 4GZ6A 2ACVA 1Z6QA 2XMPA 2F3QA 4MI9A 3OTHA 5TMEA 3ZCUA 3MRXA 1L5SA 2G9RA 2QRHA 4N3BA 5TMDA 4HWGA 3G2JA 4L22A 2R68A 2GPAA 2IYFA 3OKAA 3HBNA 4MHSA 5GPBA 1M5RA 2IEIA 4CTNA 1NOJA 2AMVA 4Z5XA 3E3LA 2XGSA 1XC7A 4GZ5A 4GPBA 1A8IA 4YI3A 1O6CA 1GZ5A 4BQEA 3S27A 2GEJA 2QLNA 1VGVA 1L5VA 2VCEA 2VG8A 1EXVA 4RIEA 4N3AA 1GPYA 2GJ4A 4W6QA 2FFRA 4MICA 2C9ZA 2BISA 1YA6A 4EKEA 1GGNA 1C50A 3IAAA 4M83A 4RENA 4EL5A 3T3GA 3CUTA 4WACA 1H5UA 4CTMA 1NVKA 5JTTA 1L5RA 4X7MA 1LWOA 2BGTA 1JIVA 2H1HA 4N3CA 5D01A 1NZDA 2QN3A 2GPBA 1FTQA 1JEJA 1PN3A 2PQ6A 3UYKA 3C4QA 1P29A 3DDSA 7GPBA 4XIFA 2F3UA 2QLMA 1Y8ZA 3BD8A 3OKCA 2G9QA 3BEOA 3MBOA 2F3PA 3MTDA 5IKPA 1IIRA 4AMGA 6GPBA 4CTOA 3BDAA 1BX3A 3NP9A 1P4GA 2SKEA 1LWNA 4REMA 5DLDA 4N9WA 2F3SA 4MRAA 2H1FA 3VDMA 2X0EA 1E1YA 1FA9A 4WADA 3L79A 5BNWA 3NP7A 1AXRA 2FF5A 1WW3A 3BCUA 2XGMA 3MS7A 4NESA 4EJ2A 1L5WA 5D00A 1XKXA 1JG6A 5I45A 4LEIA 2QN7A 3CEJA 1NZFA 3RT1A 3C48A 3MS2A 1HLFA 1Y6GA 1NOKA 2G9VA 3WADA 4EL0A 2XA1A 5JTUA 1XV5A 4NEQA 3MT8A 2GT1A 4HLNA 3NB0A 2R4UA 1FU8A 1EM6A 4RIHA 1NLMA 3EBPA 2ACWA 4X7RA 1IXYA 2BGUA 1Z6PA 4FKZA 3QHPA 3HBMA 8GPBA 2IW1A 3PE3A 4AY5A 1NOIA 3CEHA 1SXPA 3BCSA 3MTBA 1JIUA 1YGPA 3Q3EA 1FTYA 4KQ1A 4NC9A 1FTWA 5ENZA 2C1ZA 4MHOA 3T3EA 3BD6A 1C8KA 3TSAA 2X6QA 3H4TA 4GYWA 2QLLA 2X0FA 1L5QA 2IUYA 1PYGA 4LDPA 3NAZA 2HY7A 2QN2A 1UZUA 3RHZA 3E3OA 1FS4A 2QN9A 3MRVA 4N39A 3WAGA 1Y6FA 1WUTA 3EBOA 2IEGA 4XI9A 4QLBA 4F96A 2WTXA 3L7CA 3ZCRA 3S28A 3L7DA 3Q3HA 3MTAA 3COPA 1WW2A 5HXAA 2QNBA 4MI3A 2FETA 5TVGA 3HBJA 1RRVA 3OY2A 1P2GA 2JJMA 1Z62A 3HBFA 3MT9A 1K08A 3D0QA 1C3JA 2O6LA 2F9FA 3G2KA 2BFWA 1K06A 4BQFA 3MRTA 2QRPA 1GPBA 1J39A 1QM5A 1B4DA 2XCIA 3RSCA 3G2IA 4RIIA 2SKCA 5TMBA 2PYIA 1GFZA 3SYMA 2C1XA 2P6PA 2XGOA 4KQMA 4AY6A 3OTIA 1WV1A 2AV6A 2QN8A 2IV3A 3H4IA 2R4TA 4F97A 3O3CA 2G9UA 3CUUA 2XA9A 3BD7A 4RBNA 3L01A 1QKJA 3T3HA 3CV3A 3VUEA 3D0RA 4G2TA 2PRJA 3QKWA 5C1DA 4MI6A 2GPNA 1Z8DA 1XL0A 2AW3A 1FU4A 1V4VA 2QN1A 2QZSA 1SXQA 2IV7A 2JLBA 5LQDA 3CUYA 5DU2A 3WC4A 2KS6A 3Q3IA 4X6LA 3ZCPA 3OY7A 1FU7A 2ECPA 3BCRA 3GPBA 3T3DA 1UQUA 2R60A 3ZCTA 3VUFA 2QRQA 1XOIA 3NC4A 2PRIA 1RZUA 4RIFA 1F0KA 4X7PA 2IYAA 2ASVA 3L7BA 3D1JA 1WUYA 4YI5A 1GG8A 3T5TA 4F9FA 3PE4A 1ABBA 2AZDA 4BFCA 1WV0A 3CUVA 4M60A 3G2LA 1L7XA 2VSNA 3G2NA 2VCHA 4FZRA 9GPBA 3MS4A 1JG7A 3VDNB 4AMBA 3AMVA 3SYRA 1P4HA 2XA2A 3DD1A 3L7AA 3MSCA 2ZB2A 3OTGA 3FROA 4GZ3A 1JIXA 4KQ2A 2OFFA 1P2BA 1KTIA 2R66A 2XCUA 3GUHA 2X6RA 2ATIA 4BQIA 1P4JA 2YJNA 3OT5A 3C4VA 3TOVA 1UQTA 3NPAA 3IA7A
chains in the Genus database with same CATH superfamily
4RF3A 3MPOA 1DINA 3PJGA 4O1MA 1LRKA 4RKYA 1CUBA 3I01M 2BGLA 4O4JF 5ALHA 3VNUA 4LX8A 4DV3B 3RAPR 3E5NA 2DTEA 5E1BA 3EIOA 2O2DA 1W0JA 2IYQA 1I4TD 2YIJA 2R8ZA 5DNYB 3FDJA 5K6TA 3BIJA 2X3UA 3F6CA 4MA0A 1YB6A 4P4SB 4QOIA 3O4HA 4R0NA 1KEUA 3LYLA 3TIXB 3LZ6A 3P45A 1NLYA 3RANA 2AWOA 2WI8A 3RABA 4FQ7A 3TOXA 2GEKA 3NDRA 3H3XA 1JILA 3NCHA 1L4EA 4FFVA 4N8EA 1GDDA 1I3NA 3NGMA 5IWCA 3IBSA 1G63A 1UBRS 2Q1YA 2AN5A 1QONA 3C3JA 3P2EA 3HJGA 4XGIA 2X9NA 2KWIA 3DJYA 1UXOA 2BBOA 1GPAA 3HGMA 3LC0A 3LUPA 4MS3A 1XCMA 2CMDA 4I55F 1U8UA 1UZNA 1WUIS 1QGYA 2IU0A 3WRYC 2JLCA 5CXSA 5LA6A 4G89A 3QF7A 4PHFA 2BFFB 2IKSA 5DHTA 3UTDA 5EP2A 3N58A 3V8EA 4CM1A 4G56A 2EHJA 2P91A 1QTRA 4DLXA 1BD3A 2VUSA 2IEZA 3IPCA 2FPIA 5AKHA 1N4AA 4BLOA 3HR7A 4CIXA 2IYOA 5FOTA 2V9PA 4LVOA 1A95A 4LX0A 1UOQA 2P9YA 2QAJA 3KU1A 3NX4A 4RJTA 5TXGA 4CV2A 4I4TA 2W6IA 1WUHS 4D98A 1WNTA 1JDTA 3M4JA 2GD2A 3VZQA 5JSFA 2PUGA 1W2HA 4KAJA 5BQ3A 4HS4A 2J6BA 3KVRA 1H93A 5I9BA 1EFDN 5HDBB 4BOYA 1MHPA 2P1RA 3MUOA 1EAMA 5BVHA 1JHVA 1N5LA 1XYVA 1XQXA 3TDNA 1HLPA 1NP6A 2ZTVA 2DC1A 3CTPA 1QSGA 1ZJ5A 2WT4A 3E4DA 4ABYA 2ZJ3A 3IILA 3I1FA 2ZSUA 1AGNA 5AKJA 4GF5A 1LW6E 4UFNA 4D81A 3CC8A 1O0CA 2IBTA 1U4SA 3A04A 1MQAA 3C3XA 4NOLA 4X93A 5AIAA 4IHJB 5EGNA 1E6MA 5FUVA 5EJ9A 4WY5A 1G8PA 1FFBA 3WLNA 1BYUA 1TM4E 1O9HA 4NHOA 1SOWA 4QM6A 1Q1QA 1ZCBA 3BGSA 3NBMA 1VSVA 4B8YA 5GADl 4KR2A 3ICWA 1W5AA 3ZK9A 2EJBA 2XVAA 3SOZA 3QZUA 2FWMX 4A1FA 3VKUA 3BVPA 4PNEA 3JRNA 2B3TA 1HYQA 1UJBA 2HB6A 3BRCA 5FTNA 1QOZA 4U6QA 1U9ZA 1KSGA 4P1ZA 5K4AA 1YIDA 2GCPA 3HVHA 4Y0AA 5LLDA 1SU4A 3ETNA 3F49S 1YR1A 3D3NA 3FF1A 4P4GA 3LTNC 4WA7A 2NUTA 5B64A 2ZUFA 1X1QA 2N47A 3ZWAA 3ZHUA 5HMMA 3ELBA 4WSOA 4EY8A 1UZMA 5FLEX 3L18A 3L6EA 4MUNA 4QDUA 3UK1A 2C9BA 2FG7C 2VHUA 5JLAA 2PUAA 1TAHA 4GFDA 2JJ2D 4YUWA 2XWBF 3TLGB 5FTLA 1DMRA 3NIDB 2IH5A 1J0EA 1UMBA 4RIEA 1N2BA 3R0IA 4GZMA 4TLAA 3VU9A 2VHQA 4DAEA 2WD9A 4W6QA 2IS6A 3KPJA 1T26A 3PNBA 5AICA 4M0LA 4JJEA 4JBLA 4KRFA 2P11A 3S7ZA 2WSMA 2CDRA 5HR5A 1Z2PX 5G0VA 2CE2X 1OH7A 5JAOA 5ALLA 1XJ5A 3FPAA 5J1SB 4DCOA 4MK4A 1JB1A 2PZKA 3AINA 3M83A 2JLRA 3QUSA 3C8DA 2LKCA 4WEOA 5EKXA 2YH2A 1BU8A 5ALQA 5THXA 1R9NA 3ZW7A 2XXAB 2V6BA 4PXYA 4CMIA 2OE2A 1JL3A 3QTTA 2RAFA 4R9UC 4AI6A 2HV9A 1PL0A 4MX8A 5B1YA 1PQ4A 3MGCA 1IK4A 4E5SA 1HYHA 3V2GA 2ORYA 5H3CA 2B61A 4D3ZA 5A9RA 3L6DA 2LUOA 5BWBA 2VQSA 2IA5A 3NASA 4DBZA 1RYHA 1ZVMA 3LKZA 1VYTA 3ONWA 4HFNA 2POCA 4RFLA 5KWJA 1GRCA 2H1VA 4PLZA 3SPXA 5KTOA 1HE1C 1XFAA 1JKJA 2ETVA 3E3AA 4MVYA 4RWZA 1EMDA 1UFKA 4IMPA 4PINA 3MJCA 2CLOB 4YA6A 2XCSB 4P08A 1U7XA 4MWGA 1FDUA 3IBGA 3FTQA 3MTGA 5AYVA 1OY1A 3BSYA 5E6UA 3VYVA 4B7XA 2K7FA 2HTFA 2L42A 4MJLA 1LXCA 1NXTA 2IUUA 4OFBA 1L7BA 1XWFA 3LVQE 3NP9A 4TMYA 3RTAA 4ZYVA 4MIKA 2NO0A 2VR1A 3QLEA 3TLBA 2GM3A 2QT1A 3U26A 4CR8A 1SKQA 3GUYA 3EF1A 3CCBA 1KVTA 4FXPA 4IVRA 3GLGE 3W5DA 1R88A 1I94B 1XP8A 4KZPA 2CHFA 7MHTA 4QQKA 3EFOA 4DC9A 2A3RA 3NP7A 3IODA 4FLFA 3EAQA 3EGOA 4FNAA 1ODSA 4INOA 4JLJA 4L0MA 1Q7TA 1AXRA 4L15A 1U2DC 4ZP1A 2JLWA 3GRPA 5I7OA 3R3ZA 1NJ8A 3WISA 2JDID 1SUPA 3F2IA 3GLVA 1XZHA 4Q34A 2W43A 3MS7A 1XTBA 4E70A 5CFOA 3RRBA 1SGWA 4EYGA 4K9OA 3UVEA 1RM4A 1RVDA 1K97A 1FNCA 2RI6A 3INRA 4MQFB 1QF6A 3F98A 3LIPA 3AHJA 2Q8QA 1F2TB 4DNXA 1B0PA 4GZLA 4ZD6A 3WDLA 3WLQA 1Y6JA 4Q21A 4EPYA 2JGRA 4MW0A 2YZNA 5KAMA 4CG0A 1CIVA 5EJGA 3KR1A 1DKPA 4KRGA 2Q6OA 3GAZA 3GD7A 1ZONA 2DFTA 4ZHQA 1DKMA 4EBFA 3RUAA 1FRNA 2ZRJA 3NW9A 3FBGA 2HQ1A 1LRLA 2I1QA 4O2AA 1NGSA 1TQ8A 3HWX1 1I2BA 1UBJS 2OWDA 4L5JA 2BEJA 1UEIA 4YJHB 1DC6A 3HU1A 5E9AA 1HNZB 4WEQA 3MWJA 3FDFA 1CCWA 4MVXA 5FPSA 2HFJA 2PVPA 2ZRFA 1XZIA 1AKVA 2LPMA 4R2HA 8GPBA 3CW8X 1EDBA 4TLDA 3CEHA 1IHYA 4H1WA 5EQFA 3PUIA 3ZI7A 1IONA 4M99A 1MXHA 2H4FA 1GKLA 1WETA 2WU0A 4ED9A 4MGIR 5DSTA 1E7RA 3EIEA 1XHLA 3NMUF 3H1FA 3CWQA 4WCFB 1OREA 1NPYA 2GK4A 2VQ3A 1MP0A 2HQRA 5CJPA 3ZDYB 2VTBB 1KDTA 2EYQA 3B5IA 4HRYA 2VI5A 1VIVA 1RADA 1HYBA 3ONEA 2RARA 3NRJA 1CR4A 1BXRB 2MHCA 3P5SA 5DBGA 3BWYA 3COWA 2GXAA 1HE8B 3QA3E 5MDHA 1C8KA 3NFRA 4M0PA 2WMOB 3IOYA 3C8ZA 2NN3C 3FOCA 1ANKA 2CXOA 5K3OA 4EO9A 1XMSA 1A4XA 4ZREA 1UODA 4YRRA 5JPCA 2Q4TA 1ZDMA 4GYWA 2A7XA 3HFRA 4PGHA 1ACJA 4WAUA 5FUMA 2YOGA 5I9NA 4RM2A 5CT8A 1Q91A 3CUSA 3NM6B 5IHPA 3GDFA 2ZI5A 5KNDA 3DUFB 1V8PA 2J3JA 5IT5A 3DTNA 4P7KA 1HOTA 1KEZA 1JWAB 2RHJA 3NWOA 3TQOA 3EMDA 5HMLA 4F3YA 1IEWA 3H5AA 3OD1A 1B0UA 1BXZA 2RBGA 2QN9A 1CUGA 2IOYA 2XADA 3GFVA 3KJEA 3Q9NA 4BLPA 2G4VA 2JLAA 3EBOA 1KK2A 3KZKA 2EJTA 1B42A 2VBGA 2Y1XA 4O4JB 4ZODA 3LWNA 1J9EA 1P9LA 2B69A 1D9XA 4G85A 2B4QA 2HDHA 3NTVA 1JSLA 4I19A 4MVJA 4BO3A 3ROZA 1J24A 3S28A 3IVMA 2PRZA 1VTKA 4GE3A 5HK8A 3SEZA 3WP0A 1FXWF 5J23A 1X8XA 4ZVPA 1ZZGA 5M04A 3WGGA 1NQ5A 2YNMD 3RI3A 1Y3FE 1Z75A 3FYSA 1C2TA 1YCFA 4J9UE 1E4YA 4DSNA 5TVGA 2PKQP 3HBJA 3WYNA 5EHZA 5A9SA 3U13A 3AFIA 1H42A 3UIEA 2BEKA 3JY6A 4GP6A 1GNSA 1OOEA 3KQUA 4D9HA 4OHFA 4I55B 1PK9A 1I0ZA 3TNLA 3S55A 2ZKIA 1EIZA 4JLVA 4E4RA 2E37A 3L46A 2ZIZA 3LXUX 5C4GB 3LO5A 1ONOA 5KYYA 1JFFA 1EJ2A 4YUXA 3HRKA 1ZJJA 3D0QA 2W2QA 2NVUA 2RGCA 3IP5A 4MRRA 4OQ4A 5K51A 3K73O 4M46A 3ETDA 2PUWA 7ABPA 3CLTC 3PPXA 4EB8A 1LK7A 1RRMA 2LTAA 3G2KA 4UNSA 1QHYA 4RORA 4WQMA 1EUYA 1UT8A 4MH0R 3O2QB 2FJ0A 1YIAA 5D6OA 3FPBA 1IJBA 2O20A 4NU6A 4EVRA 5J2TA 1JA1A 4RE5A 3MRTA 4BV2A 3O9VA 1S2MA 2ZS9A 2CL6X 3HWRA 4MUHA 4FWBA 4LMAA 4RD4A 3K20A 2DUWA 3W5JA 4B6SA 2BL4A 3TLEA 1RD4A 4G09A 4XEHA 4JCCA 2JLQA 2IPXA 1WXXA 3TB4A 3G2IA 1RYYA 3NBXX 1TC1A 4B43A 5DNCA 1CUIA 1OA0A 4NBKA 5CU7A 3ANXA 2XCTB 1MB0A 2AMYA 2YUIA 1DHTA 1DJLA 5EHGA 5DHPA 3V8NA 1NVBA 2WIAA 3CSSA 4KQIA 3V97A 1FNDA 4NNJA 1VG0B 1U81A 5DLYA 4DLAA 2ZBFA 4WECA 1YVDA 3LXXA 1HOXA 3GIDA 5FI0B 3HYNA 4AP5A 3QOXA 4ARAA 2R6AA 4FC7A 3GCZA 4WD3A 4CKCA 4MW5A 3NHYA 5LWQA 4D4LA 2P5SA 2QZ9A 3M9WA 2PUCA 3TLZA 1H0HA 4E2ZA 2UXDB 2F1IA 1UXJA 4OAQA 3U4DA 4YAWA 2CXHA 4Y2VA 4C03A 5U1PA 1FMCA 3CNHA 1Q1NA 1XD2A 3NKLA 4YT8A 4FEGA 4HZUB 2GN6A 2QSJA 1K3UB 4CM5A 4MMYB 1X8JA 1H2EA 1BW9B 1PJTA 1Z6YA 3I37X 3OEHA 1G20E 3QVVA 4L5AA 1DEHA 2CJWA 4L3WA 5COAA 3WO0A 5EWJB 4MHTA 4NENA 2XECA 2HJVA 1TX4B 1WSDA 4YUZA 1U0NA 1VRWA 2JGMA 2WHRA 4XUGB 4BJ5A 4FZ3A 4FQ8A 2ZLBA 4NOMA 3R8CA 3FVQA 3VTZA 2PH7A 4X6LA 1QU2A 2PGXA 1VP9A 1PFWA 3D59A 1R9GA 2HYDA 4ZYLA 3SDZA 1OLUB 3BRWD 1NW5A 3IR5A 5JQWA 5I8WA 3TGLA 2O0HA 3M89A 3RJ9A 2P68A 2BGGA 2BE9A 1TK9A 4MEBA 1IQ0A 5H9VA 5IUJC 2H0QA 1K6MA 1T0UA 3I30X 4YV2A 3U39A 3T4XA 1IN1A 4BFZA 4IILA 5KQGA 3RFTA 1YJCA 4FX2A 3IEXA 5DOVA 5BQFA 4C14A 1NV9A 1Z7BA 3T4UA 1MRZA 1Z0JA 3GJRA 2PH5A 2Z5LA 1MA3A 4RS3A 5CK4A 3UJ8A 4RANA 1BMFA 4Z4IA 2WB4A 3R0ZA 1E4EB 4S2UA 5JIBA 2QL5A 1QRTA 5EJIA 2MDTA 4XJVA 5HJ7A 1F06A 1GGVA 4C0QC 1CUSA 2EW8A 4JQYA 3DFZA 1KIAA 3MFQA 1T35A 2IHJA 3OPYA 4BJ1A 2VXCA 8MHTA 1EFLA 4OJQA 3ZHZA 4GICA 3MS4A 5BT8A 4AS1A 3UAZA 1I5RA 3L7JA 4DE5A 3CVWA 4FZVA 2NLOA 2NTJA 4AMBA 1X7WA 2J07A 3AMVA 3UTCA 3GX1A 4Q1DA 4A0HA 4F4FA 5EYPB 1QPZA 2V4ZA 1SCUB 1ZISA 4N0MA 1SWWA 4ENTA 2BCEA 5DYIA 1BGVA 1BE6A 3MSCA 4L75A 2ZB2A 3EDOA 1GUFA 1W5SA 3MLAA 3ZU2A 4D56A 1T9KA 2X19A 2FMTA 4Q4AB 1ZGHA 1T8YA 5FO0A 3DOOA 4CF5A 4ETWA 3AV0B 5FA8A 1IM2A 4G97A 4YCCA 1PWZA 1Z5GA 2QXUA 2PD4A 3G89A 3VPXA 3BX1A 2BLLA 3OZIA 4UQOA 3DM9B 3EUAA 5KX5F 3D2BA 1UPBA 4L8WB 3WTCA 1ID8A 4GP9A 4XCQA 5JWRA 1DBQA 3HH8A 3M1AA 3PNKA 3DTVA 5AHXA 5FV4A 1OU4A 1R27A 4FDTA 1LSUA 2H00A 2EIXA 1D7AA 5IDXA 1G291 3KZOA 5ALIA 1P0PA 5FIUA 4CF3A 2R0QC 4WLNA 2IPNA 2X14A 2W71A 1PUIA 1Z16A 4B3XA 1ZNWA 1OAKA 2OKGA 5E0KB 1OH6A 1JAYA 3UCXA 4L57A 4Q02A 3DEIA 3FPEA 3GVIA 4PGGA 1RJDA 4CM6A 3L4BC 4KXVA 1UDRA 1CRZA 4UBJA 3PFIA 3VZRA 4C4TA 3WJ2A 3HNPA 3DE6X 3PC8C 1NJ5A 3QLJA 3GGSA 4AX4A 1NUPA 5BQXA 3R6LA 2JARA 3MCZA 3C3BA 1MB3A 3HVUA 1HT2E 1J56A 3WHLA 1JYEA 1Z6AA 5FI1B 1WXEA 2ECFA 2GN2A 5KHLB 2GILA 3R44A 3ZBQA 4EJ6A 1U7HA 3HO8A 1OGJA 2H2AA 2VRNA 4L3OA 4QXPA 1L5GB 3UGTA 5CFNA 3WWZA 2ZCJA 1AKMA 3WLFA 5TB5A 1YS7A 1RYDA 4ZEOA 3JYPA 2PX6A 1TC2A 4DFDA 4A0RA 4ZYTA 3T0IA 1P6XA 5C52B 1E3QA 4R5MA 2NMVA 3W5UA 3GPDG 2HQOA 2DPHA 2W2KB 3GZNA 3IR7A 4JJKA 5FBLB 3STYA 1MAWA 4UXHA 5CH3A 4MTLA 1LA2A 3UAYA 1RRPA 4FFPA 1D2RA 4LF9B 1OWPA 3H2HA 1BWRA 1GAWA 2FW1A 4Z49A 3BXZA 1JEQA 1H4TA 1KYXA 3I4FA 4H0NA 2HCTA 4BZXA 2FQYA 3E6AA 5A0VA 5KNCD 3RG2A 3WIUA 4HGRA 4B4KA 1QQAA 3FDIA 4FFBB 2O8EA 1U8AA 1PNVA 4KBYA 2IOHA 4ZO4A 3B1JA 4IIVA 3FH0A 2KHZA 2Z8ZA 2V7VA 2WM2A 3EXIA 2EZ8A 4NI5A 1YZTA 3O8DA 2Q0QA 4FOTA 1BN6A 2P90A 3EVGA 2JL1A 2O2GA 3UB3A 2Q6VA 4I9UA 4DPMA 1I1OA 4NS4A 3RSZA 2XQJA 1EHYA 4LF6B 2I29A 1LDBA 4UBNA 4JDPA 4YRMA 4PHGA 4AP6A 4RPJA 4QYIB 3E35A 4O2BB 3F6BX 4C0LA 5HF6A 3ZQ4A 2PKEA 1JAXA 4GI3A 2ZP1A 3X1WA 2BKLA 1PNQA 5ITVA 2BM1A 3GP8A 4ZTUB 1F51E 3FSGD 5TGDA 4ND8B 5B4UA 4BB9A 3ZCUA 1GPJA 3ESQA 1SB9A 3LK6A 3SBXA 3K0AA 3BL5A 1T8WA 3VSEA 3LFTA 5E2BA 3H9JA 4RV9A 4QXOA 1THTA 2ASEA 1URPA 1X38A 4PLHA 1QK3A 3WLTA 3QV1A 2IZ0A 2HRCA 2DUUA 2BELA 2B20A 3QKSA 4C0KA 3KIPA 3R9XA 4HX9A 3MZ0A 2AG1A 1N6NA 1A8HA 4HH4A 4L22A 3UAVA 1MIOA 1W48A 2YYYA 1GTG1 1BC5A 4M8NE 2KX7A 2QOEA 1KY2A 3DQQA 1E2KA 4MRMB 3TZLA 2W90A 4Z7QB 1LV8A 2FZKA 3QELB 4BJ6A 5A7FA 1RXYA 1T6YA 2JI6A 4P35A 2OCPA 3SFZA 4CMJA 2BH2A 3H8JA 5CA0F 1DX9A 1F8UA 4KPUB 1KERA 1KMQA 5CFMA 2BZSA 4JOQA 1HLGA 4B2IA 4AECA 8OHMA 4QOHA 5C34B 4V0RA 4CBVA 4EYEA 821PA 1E3MA 4UVHA 4FFWA 3UV6A 1U2DA 1BQ3A 2E1PA 5ICMA 4ENQA 1WB4A 2E21A 5H5JA 2FMXA 2OORA 1XO1A 3OZAA 1F6BA 3SYLA 5A6SA 1JEOA 4RGBA 4UCFA 4AZWA 1I01A 1QP7A 3OLYA 2FFRA 2W98A 3EJWA 4RZXA 4X8OA 5B7NA 5FPKA 3T1YB 2VTDA 2DERA 2XUIA 1JWBB 1XTZA 3OZFA 2FP4B 3PPVA 1CVIA 1U5BB 4TN5A 1N8SA 3ELYA 4L6IA 3IAAA 4Q1AA 5K0FA 5FORA 4BLTA 1CQJB 1V3VA 3A25A 3I4CA 3I6IA 4HBZA 4YR9A 5ELXA 2O54A 4J76A 4CWAA 1T4CB 3B6EA 4GO1A 4NV0A 4LMRA 4IEFB 3Q87B 3OQJA 1E5XA 3ZNNA 4FFMA 4OO3A 3CKMA 4CEJA 3BHIA 1NL3A 3I9V6 4B35A 3DS8A 5D8DA 3HA5A 4G5XA 4URHA 5EP3A 1WHSA 5LXTA 1SUCA 1Z4JA 5LP6A 1XZDA 1AUVA 4HDCA 4EMBA 4YUVA 4DUPA 1RQPA 4YJ3B 5GQSA 3USCS 1ECLA 5FADA 2OCBA 5KVSA 2MTBA 5JCXA 4EFMA 3UYKA 3V34A 2X13A 4B71A 1I9CA 4AY4A 3EXHC 2QTFA 2W83A 2X58A 3A31A 4MCJA 1Y6QA 4MOWA 4QNNA 4UTNA 2CVFA 1NF9A 1UKAA 2W8BA 2J9ZB 3RSHA 3VR3D 3M4XA 4QPNA 4X8LA 5LCXA 5KQMA 5EQDA 1M6VA 4MXDA 4M88A 3ADDA 2QPTA 5KHOC 2JEYA 3A14A 2BAGA 2W6JD 1KPIA 4AMGA 4HYQA 3DVRX 4DN6A 5DM60 2IHTA 3ORRA 4LKRA 2XE7A 4G5OA 2ISCA 4RH3A 5HCNA 2NZVG 3UB4A 13PKA 3OU6A 4M1QA 4FX5A 4E07A 1PQWA 3PHGA 3PNPA 2WK1A 3DOEA 1O77A 1LWNA 1Y8QA 3HDYA 1JIIA 3IDFA 1Z45A 3K2EA 3NONA 5DGCA 5H3LA 3QY9A 5IS2A 3A6JA 4WJKB 4XPZA 1UKZA 3JQ9C 4HPWA 1JH9A 3UC9A 2WFAA 3DBIA 3TCXB 2YJ5A 5IAAA 3L79A 1R3DA 4DIOA 5THKA 1XWWA 1PGPA 4HZIA 5TE9A 1F60A 3K15A 3QGMA 1QC5A 2DWQA 1TT5B 1M1YE 3UMVA 3QI7A 4B1FA 2AW5A 2C7BA 2JASA 4K03A 4TM7A 4C5AA 2FUG1 2Z5FA 3A0UA 3NKVA 4GT1A 1X9GA 1KZHA 4UU7A 1L4MA 1T0BA 2OCKA 2VWHA 3L7OA 3P71T 5IEJA 3FPHA 1QZUA 4ARIA 5HDQA 1P74A 3HFGA 1PRYA 3QUAA 3MGAA 3A27A 4KDRA 3U56A 1VPWA 4A26A 1VJGA 4AY2A 4E08A 4NLLA 1O87A 4R9RA 4F3KA 2DPYA 2JRLA 5IT0A 1A9XA 4H7HA 3ULKA 3EIWA 4J8PA 2FSFA 3T1HB 1CUDA 3HKDB 3LCRA 1RZ3A 3EW9A 3BGVA 3ZWOA 2BJWA 3BXXA 4I8DA 3EIHA 3GJ5A 5CG2A 1TZMA 3ISJA 4B82A 1NSTA 2GO1A 4ZU1X 3R23A 1VMIA 1L9KA 4HEJA 3S68A 1T6ZA 3TW8A 2XKAA 4QWMA 2G0NA 5U4QA 8ATCA 4F6LA 5EVCA 421PA 1Q0TA 2OPHA 2Z6QA 2BJHA 4HC4A 3QVGB 2BKVA 2NVOA 1WA5A 2ACWA 3EBPA 5LD2C 2Q29A 3ED5A 4ZEVA 1WQ4A 3V4VB 3W8DA 1F38A 3PNVA 5HKLA 4IIDA 1T2UA 1XWIA 3LY5A 1QZXA 1POXA 3UF0A 2B4KA 3PNYA 2NXNA 2AFIA 3BWDD 2BTOA 2IZ1A 3AIMA 3KO8A 3W3ZB 1UP7A 5KWEA 1PFVA 4U4AA 4BAZA 2Q5IA 2W7TA 4S1PA 4EHKA 3OVMA 2B0JA 3O8RA 4XUDA 3E22B 1QG4A 1KK3A 2H08A 5K0EA 3Q3JB 1UCFA 1YS2X 1GKYA 2H31A 5JSZB 3ICEA 5I5EA 3OWOA 1C0KA 1PG5A 1QLJA 1E3EA 2JEOA 5I3CA 5EIXA 2C1ZA 3HU3A 3KYCB 4QJ4A 1Y5NA 4OEHA 5IVHA 2JI4A 4ZZ0A 2CF5A 4YT5A 1HDCA 3R76A 2QQGA 4CQLA 1VBFA 1CQIA 3B7WA 4HB2A 3R7AA 5EZQA 1IWOA 2IPOA 1XXHA 3KPUA 4E5NA 4V02A 1Z25A 5ALNA 4GEGA 3FTDA 1IG3A 2YICA 1EK5A 1GN8A 1QUEA 3QU7A 3TXYA 3OZTA 2P5UA 2R3SA 1ZD5A 2Z8YM 1P4AA 2CN1A 3KBBA 3T7TA 4EF5A 5KX5B 5EXTA 5KQPA 1UMCA 2W70A 3TMAA 4U2DA 4XX0B 3U7JA 2P4HX 4ZI7F 1U9JA 2BWJA 4D4KA 1O94D 4M1OA 3UA3A 4EMSA 3P9NA 3KQNA 4EA8A 1FMJA 1RABA 1W1IA 2BKEA 4K2AA 4HVLA 2QUAA 3BWMA 4DVGA 2I7TA 3HNRA 3O2JA 4M7RA 4N41A 3L7LA 1IBRA 2J9XB 4YCBA 4OMFG 4XI9A 4ZFNA 3FLEA 1QS0A 2Z4SA 4F96A 4DA9A 3J7AC 1E2FA 1ONBA 2YJGA 1XDGA 1P4SA 2B5WA 3AZPA 1AK9A 1DT5A 5LYYA 2ZDGA 3ZCRA 1U2EA 5FPQA 1HNXB 3SOPA 4PLTA 3Q3HA 2WTAA 1DV1A 2C78A 4RCYA 5B36A 1NXPA 3FYDA 4DCSA 3GLHB 3QVXA 1UADA 2A9PA 3HXQA 1YNOA 2NNLD 3LL4A 5IH7A 3FZEA 5HCIA 4TL6A 3ZXXA 1M7BA 2FETA 3QG1A 1YBFA 4P4NA 3H83A 5L7TA 4UHJA 3FA2A 3K6SA 5FBWB 4RVSA 2F48A 2H2IA 4B74A 3OY2A 5HQ3A 3IBCA 4JVOA 3I2YX 4LQDA 3RKUA 3FI9A 2HRDA 3DDOA 3LGAA 1YKSA 3LT2A 3L77A 2J6CA 4FOSA 3KVOA 4LBZA 5IYZA 1OQAA 2R6HA 2H5LA 3JYHA 1E94E 3LY9A 4IYRA 5ES3A 3WY9A 4R9VA 4DR6B 2C7QA 5DHFA 4Q9DA 2HL6A 4MYCA 1S89A 4ZAVA 1JZTA 4UCXA 5HF9A 4BFTA 1K6XA 4X45A 3FCOA 3B6KA 4Q9JA 5LWHA 1W88A 2OSBA 2XVXA 5C9ZA 3VXKA 4Q00A 1L7NA 3HUEA 2FI1A 4DYDA 3M9XA 3HCOA 1U3DA 3CW9A 3KSRA 1HNNA 4JJZA 1TMGE 2F67A 3T9FA 1YE3A 1E2HA 2W6OA 4EO7A 1VHJA 2O3QA 3K9LA 2HCBA 2JH9A 2XCIA 3RG8A 3S1AA 4RIIA 1DX6A 3T34A 3NUQA 3AVTA 2VVTA 4FYKA 1WS6A 2XJ4A 4KU4A 5IJ9B 4EFDA 4LHZA 4FYYA 3KVVA 4Q6BA 3THXA 2C0QA 3QSGA 1QH0A 2WVHA 3A2NA 3SIRA 3IXLA 3U62A 3W9SA 2EEPA 4REQA 2MWMA 3OTIA 4DLNA 4FKMA 1KTVA 1M9NA 2P3SA 5BW4A 4JI2B 4L4XA 3RWMB 5LNK6 3A1NA 2GHQA 1M7HA 3E9MA 4F97A 1Y4UA 1M73E 2EFGA 2HLNA 3HVIA 5C5IA 2JCBA 1NUUA 4CM9A 1XCOA 1B8PA 4HD8A 2PFGA 3ZHYA 4EJ0A 2PNFA 4P81A 2RHWA 1HG0A 2I4TA 2WM8A 2EWVA 4PTYA 4RHEA 1OYWA 3ZVRA 1DXOA 4TLBA 1A5TA 5LB4A 3HXKA 1DHRA 2N46A 4K9KA 1AKQA 2FF7A 2REQB 1L7PA 1TYAE 3N87A 5T7BA 4DCMA 1FFEA 1WPQA 4N7JA 1XEXB 3QVMA 2ZKLA 2FSHA 4M0CA 3RJ5A 3B48A 1WZUA 1V4VA 2Q4DA 1C4KA 4BASA 1R0WA 5CA0B 4NX2A 3AUKA 4MNTA 2JLBA 3FUUA 3VI4B 3CUYA 4ACBA 2H1IA 5DGIA 4G8CA 3OE7D 4WUVA 5F4BA 4A2WA 4EMUA 4HX2A 3RFUA 2J7KA 5E4TA 3ZHQA 4DB4A 2IYEA 3PC7A 1SPBS 2PSEA 2O3UA 4YLGA 2CJPA 2DJIA 2JAPA 4J7XA 2ZB3A 3ITEA 4LOHA 3RVBA 4DR7B 5AWFC 1FDTA 3EZ2A 3GPBA 1JECA 4D26A 1SUDA 4UNQA 4GXNA 5C53B 5U4XA 3LYAA 3OIYA 3VUFA 3IERA 4HEA1 2CXXA 3CVXA 4WXMA 3TSCA 5CBPB 2VJAA 5A3RA 1EX6A 1OZFA 3RS4A 4BMXA 4OYYA 5TGZA 2IXBA 3FNGA 3GB9A 3A3KA 3PC8A 1FX0B 2BDTA 4H7PA 1GDHA 3ZGVA 1GTMA 5TQ2B 3W4IA 2QT0A 4DILA 1E3IA 3AB3A 2ZSFA 2CUZA 2IHZA 4TMTA 4B3RB 4GLBA 3GJ6A 4PSDA 3VMFA 1FB5A 1Z22A 3LVBA 2FEWB 1IBCA 3LZCA 4GX1A 4BFCA 4C7JA 3THWA 1X2EA 4C2TA 3V9AA 4PU0A 4H3VA 4M60A 2O5VA 5EE9A 4JR1A 2QDKA 3T1QA 1ZVJA 2I3BA 5AK5A 2QVXX 2ZSEA 4RK7A 3RC7A 3V8BA 3AUAA 3ETHA 1Y7IA 4HAZA 2WUGA 2K5UA 3B51X 3NBUA 4F4UA 1UFRA 3KLMX 4H27A 3FTEA 5CIYA 3U19A 3FCCA 1RQGA 1P5ZB 2GZSA 2ORVA 3CF2A 4JLBA 4F85A 1YZYA 3ADCA 1PZGA 1FUIA 1N1GA 2B1JA 5E1OA 2FGJA 3SDBA 4YMGA 4GPEA 5JYCA 5K8UA 5LZ9A 4XASA 3BBPA 5ITZA 2XA2A 2Q5FA 3ZY5A 1WTCA 5CA1A 3OCXA 1T10A 3ZBPA 4BECA 3GHYA 1VE9A 1KI4A 3O8QA 4MYHA 1NR5A 1FTSA 2JFOA 3TDKA 5BW5A 2YWXA 2J08A 3AM5A 3BSWA 3MN1A 3EEIA 4MUFA 4TM8A 1BH2A 1T36A 2WYVA 2DLDA 1FW8A 3N07A 1W0JD 1T0HB 1W44A 4LXTA 4P84A 3LQKA 4Q4HA 3E03A 4YYEA 4DMHA 5AUPB 1AKEA 2AKEA 5FT9A 1S3GA 4TL7A 3JCZA 4KAFA 4AJIA 2ZJBA 3QWIA 4GWGA 3FOFC 3NNSA 4MS1A 1Y3BE 3TCKA 4YK7A 1M6EX 1EBUA 1XJWA 2RI1A 2VQDA 3EQ9A 4IMJB 2JS7A 1M76A 2P0EA 2XRYA 3MXTA 3UT6A 1M0SA 1USWA 3J80A 3S0JA 4ZCMA 2WWFA 4CUZA 4UOEA 2YFYA 3C8UA 3Q41A 4HLUC 1JQKA 1YU6A 2BW0A 4HLCA 4MYUA 3SG0A 3TRFA 3ZW9A 1ORIA 1Q0HA 2BM9A 2AR0A 2PWAA 4DA6A 2SCUB 1NYQA 2JZCA 1GYRA 1G8KA 3DAPA 1IEXA 1VHDA 1R4MA 4B7CA 4US0R 2PZBA 1R10A 1N2CB 1NVDA 1Z12A 2UUPA 4HYYA 4K28A 2GM9A 3NYQA 2YMLA 4HTAA 2C5SA 1W5BA 2W6ID 1MW9X 1J0CA 3D1VA 3H1TA 3PQ8A 1HLDA 4LMPA 3E3NA 2CCGA 1WMBA 3X0DA 4P7JA 4YRZA 3A70A 3QLTA 2RAVA 1VC2A 1L7MA 1WMAA 4RQAA 2IDKA 4XYGA 4DLRA 4J16A 1E4OA 1Z4OA 3QBEA 4ITVA 1Y1TA 4QL3A 4XWGA 1LTKA 1NXVA 2AZ4A 1TTHA 2H7CA 3EY4A 1DU4A 4KXMA 3TQIA 3KQKA 2XUPA 2JD2A 3IPAA 5LDHA 4Y9DA 2I1VB 4ZU6X 3HGQA 3G85A 2NACA 3FDXA 1RWWA 1ACMA 3TRJA 2IEYA 2GVNA 1YQEA 1Q84A 4PQYA 4ZV9A 1WLSA 5CDHA 1YFLA 4DG5A 4EP1A 3HP1A 2ZIUB 4KI0A 4GI2A 3A8TA 1RI5A 2PSJA 2PL1A 4KNWA 3HJFA 3KSZO 2NZJA 2OGWA 1NG1A 4Z9YA 2FEPA 4H1UA 4F5EA 2PR2A 4HNVA 3HU5A 5L3RA 5H81A 3NDJA 4UQLA 4AJJA 1HZZA 3WK6A 2WG0A 1ISRA 5C3UA 4EW1A 1T9BA 1RTTA 2XIJA 2GK6A 3PEFA 4XTCS 2DVMA 3RVLA 5C5CA 2E4WA 3P2IA 1YS4A 4MIOA 3MIZA 1NY5A 4HSGA 3DBRB 4OGFA 4ER0A 2HADA 1TDJA 3O21A 5CH8A 4ZIRA 2D2FA 3O9MA 1T9DA 4BKMA 2CBGA 4HDRA 4UMDA 2ZDHA 1WKBA 1XZEA 1AK2A 7MDHA 3DPUA 3UPDA 4NQZA 2GNOA 3DEFA 3DLTA 4RK4A 4QVIA 2B1QA 3ZWBA 4DIEA 2A0KA 4P54A 2QRHA 3EXHA 4GGPA 5H80A 5IT4A 2CLKB 2PT9A 4PS0A 1JSZA 4RKWA 5ICCA 1VPTA 3C85A 4XSGA 3OJ0A 3QEBZ 2F59A 2XDQA 3VPSA 1IQPA 4ZI7B 2X23A 4FYIA 2I3GA 5AVKA 4KEAA 3RTDA 3AEXA 2WE7A 2O8NA 4AL4A 4DBLC 4PBTA 5LA6F 3U60B 1NU6A 2AZTA 3A4NA 3QP9A 3PTZA 4NG5A 4L27A 2G0AA 4L76A 3TEFA 3I9KA 1GIAA 4CTNA 1VI2A 4GWLA 2OHOA 1P6UA 1A72A 1UP6A 2B36A 1X7ZB 2XGGA 3AJDA 2MYUA 3E3LA 2OWEA 3JQ9A 3NYWA 1RFGE 4GPBA 4RABA 2HKIA 4EJSC 4EHFA 1EXWA 2OCYC 4I4TF 2C0CA 2ETXA 2OYCA 3ROTA 4BLWA 3TNDA 3S27A 2GEJA 3H1EA 1JDPA 1Q0SA 3KUDA 1TVKA 4BX2A 1ULHA 1TI7A 2BF7A 2JLYA 3K4HA 2VYFA 2MINA 1V1RB 2K87A 5GOTA 1K6EA 1LF0A 2WSBA 4BMNA 4FS8A 1I6KA 2JFFA 3VU8A 4C5BA 1SELA 1A2OA 1VZ2A 4ATNA 4D79A 1IPFA 3VTFA 5F7ZA 3IAM1 3AVYA 3N8GA 4ZO8A 2C2KA 1R4ZA 2P9FA 1S2OA 2DYKA 2ZOSA 4CQMD 1GGNA 3W9YA 3PKZA 1ODCA 4HQ6A 1ZCAA 1YA6A 4J4BA 1ZSVA 1QH1B 1RBMA 3HKCA 3L8HA 1JXQA 3RSQA 1O58A 4ZYXA 2C94A 2ISSD 3HP4A 4Q03A 4PG8A 1GZ4A 1XF9A 4X6YA 5AVQA 3QUBA 3LHSA 1HR0B 5J43A 4BFUA 1Z08A 5BRAA 2O59A 3HN7A 1K0FA 1WP9A 4JVMA 4M0UA 2WUVA 1NBME 5L8VA 1PIWA 4Q4JB 1KXJA 3M6UA 1LWOA 2HJRA 2GZ1A 2EXXA 5AFSA 1ETUA 1O4VA 1UOOA 2GPBA 4EO4A 2VF7A 1C4XA 1QNLA 3A1FA 4PBRA 4UFOA 3VVBA 2WLSA 1G6Q1 3F4KA 3KWJA 4IHKA 2ONJA 4WI1A 2Q5CA 2I8AA 1SIOA 3AO0B 3KOOA 4N3NA 2QVYX 4I7EA 1CUZA 3FCXA 2HV8A 3QYJA 4UCWA 4B3SB 4WY2A 2GTPA 2A9QA 1FQWA 3GDHA 5E1MA 4IJ6A 3X2SA 4HQOA 4NDAA 4YHBA 2QG9A 3O38A 5JS6A 2AG6A 3JZIA 4OH7A 4FYMA 4ZVTA 2C4TA 3FNIA 4YP9A 2HA0A 2IHNA 1R6AA 2LXNA 4FSDA 3VX4A 1MOPA 2RFLA 3OJLA 4LCJA 4XSHA 2XMQA 1LDGA 4LRXA 3OOJA 2AA3A 2HDWA 4X63A 5DRYA 4PAGA 4NK5A 5H82A 1PFUA 3C16C 2OHFA 4YMLA 3IXQA 2Z6VA 4LRWA 4QQ8A 1V1MB 3H9BA 4BVGA 5BVGB 3I45A 2GN0A 4R6WA 2DH6A 4PZPA 4WBNA 5IZCC 2VOEA 3WYEA 3CGWA 2QJOA 4IBOA 3FYCA 4CEHB 1UBOS 5HJ2A 5KMGB 5JAUA 1B8UA 2C92A 4MUGA 4C0HA 3SNHA 1D9ZA 4JI6B 5JNUA 2VK4A 5EZYF 5HZHA 4F21A 4BLUA 2C8KA 3IP3A 1HFKA 2R6DA 1KMIY 1XB2A 5DZSA 1MQ9A 3R3YA 1B6SA 3LLMA 5ALVA 5AVOA 4B6JA 3I58A 2Q1UA 2B83A 3RT1A 7ADHA 3C48A 5JSUA 1GQOA 5EWMA 2PU5A 1EPUA 3AKYA 3MUNA 3LPLA 4MPDA 5TQ0B 2NGRA 2E4XA 1TLFA 3KXDA 2WJ3A 4YFVA 3WGZA 1P8AA 2LIPA 4JU9A 5KAPA 1H1DA 2CXNA 4XR4A 5A06A 4ZOCA 5J58A 4Q3AA 5A04A 4O4IA 3X1JA 5I7RA 2X4IA 2R4QA 3DSRA 3EVBA 1SZCA 1VYVA 1Z36A 1ZRSA 4FDLA 3S4YA 2RMKA 5FD8A 1J23A 1TRHA 1CEYA 4EELA 1YK1A 2EBFX 5MGNA 4Z9XA 2JFHA 2VEDA 3I73A 4IEEA 2IT1A 4CE6A 1G8FA 1OX4B 2EWWA 3OOSA 4OSEA 2Q4RA 3FPGA 3GLFB 1UK6A 5K0SA 4Z0HO 3DQPA 4ZOEA 1NOIA 3B6ZA 2B37A 3ZBTA 4JYBA 2J0QA 5KNDD 4XGRA 1BKYA 1CUEA 3ZXYA 5HRAA 3TLAA 1JIUA 1QJ4A 1TECE 1YBMA 3DAYA 4X91A 4G9GA 5AXCA 3UFBA 1IE3A 4NEHB 4BLVA 4CW7A 2ERYA 5K6AC 1N2IA 1GPWB 1HETA 1M10A 2FR1A 1FTYA 3ASYA 5IUKC 3M4ZA 1MORA 4KN6A 2YWDA 2JGDA 3QE0A 1LW7A 4ZVLA 3NBZC 2ZI9A 4HGPA 5F2EA 1XRSB 5ESRA 4JJAA 1Z63A 3HSKA 4H3SA 2MYPA 1AGRA 2HMTA 3JQ8A 3NYIA 3C1UA 3ENQA 4UEQA 2HCJB 3TMYA 3V4ZA 4CDGA 2CNLA 3U61B 4MVJD 4G0XA 5KHAA 2Y68A 1E32A 1YVEI 4BEBA 2A9FA 2OC4A 4W7IA 1ZC4A 4LXYA 1VL1A 4QEZA 3BF8A 2ZRBA 1V5GA 4FYXA 4JC5A 4KWEA 4ZT4A 4ZHQF 2EV9A 4LHYA 4R71A 1SCQA 4AG5A 3OFVA 3RBVA 1YL5A 4U8GA 5ESXA 4L51A 1JXAA 2GNAA 4RVFA 2DKOA 4BVFA 3HY6A 3WZ2A 1Y5MA 1WVMA 1UIMA 1WUTA 1N1EA 5EXEA 5HFNA 1Z28A 5HBRA 4F04A 1VB3A 5HIKA 1QQTA 4KXUA 2DETA 1QU3A 4LWOA 4XVQA 3CBQA 4LYGA 3SQXA 4BWYA 3ABRB 2O8CB 2VH2A 4CU2A 2R8XA 2FWBA 1NMSA 3ROFA 4MQMA 4BNLA 2Z1MA 1N92A 2RAUA 3FWZA 4RVDA 2G06A 2H4XA 5BO5A 3GT7A 3WLHA 5CEEA 3PGXA 4DJFC 1QE5A 1P2FA 1WW2A 3Q15C 5FPPA 1EUCB 2FW0A 5TS2A 5JU6A 3BWBA 1PR0A 2B8EA 3NWEA 1NRIA 2FPPA 4BXOB 1JHYA 4WKPA 1GUZA 1DBSA 2CLFB 1YCHA 3DBLB 1E9VA 3OIDA 4Z4CA 5CYFA 2Q3LA 4AULA 3EGDB 1YFZA 2HK7A 3QNMA 4OF4A 4FBMA 2EF0A 4LI0A 1RAIA 1A69A 1XTJA 3PUJA 3H6KA 3PFCA 5ERGB 4HUJA 2XSZA 3OWHA 3H99A 1IWBB 3OJWA 3PI6A 4TWIA 4BNTA 3L0DA 3TGWA 3VGPA 2ROQA 2J09A 3IT0A 1IK6A 1Y33E 1E7QA 4BQNA 3IDAA 4LZPA 1T3TA 5JFTA 4GL4A 4DDMA 3OZXA 4R1PA 1MGPA 5KB3A 1IATA 2B7LA 1JLKA 2JH3A 3GP5A 2J3LA 3ZIDA 3TG2A 2NTNA 1SKAA 2XMCA 4P3KA 3D8TA 1ZH6A 5EL0A 2W37A 4C30A 6NULA 1GN9A 1OT5A 2DPXA 4IIJA 4W5HA 5EINA 4Q01A 2QRPA 2WPNA 4I5IA 1DNPA 2IOQA 3A9CA 2RC6A 2ZB7A 4H15A 3OF2A 3JQFC 5INTA 3JS5A 1HRKA 1KAMA 1U8XX 1CR6A 2V8OA 2W22A 2HUPA 3CH4B 1L3CA 1MT0A 1OI7A 5TMBA 2R11A 4EBBA 4D9KA 3MJVA 2O07A 3BT7A 4MQEA 1HL7A 2OBXA 3OEHD 5JMTA 1UIRA 4IHAA 1MX3A 2Q1SA 2NXJA 2QU8A 4MVJF 1Q1EA 3CE9A 1EK0A 1JMVA 2FE4A 4ROSA 4E4TA 4EHJA 1GA4A 2XTZA 1L5FA 2E3JA 2VDUE 1ZUIA 3LDAA 2IC5A 4GVLA 2VIIA 4DV0B 3SM3A 1OX6A 2R4TA 3GWZA 2R47A 2NP6A 3JWJA 2AFHA 3T6KA 3EWAA 5A1TA 1P7YA 1V25A 3EQ8A 3UJCA 4XQEA 2ADFA 3RSGA 4PM4A 2Q99A 2GYWA 5TT0A 2A0FA 4KVAA 1PEKE 5EHQA 5A6VA 1E9FA 4QQFA 2ERCA 3OO0A 4TVBA 3KQHA 1JPJA 2GAIA 3DLIA 3WR5A 2G8LA 4F56A 2BGMA 1I0IA 1P1IA 2HF7A 3H9EO 4U3JA 4DDTA 2BLNA 5CYOA 4HP8A 3ZIAA 5I9LA 1GVHA 2QN1A 1P0CA 3KZCA 5JC1A 4KHPB 4CCYA 5EJAA 1NRXA 5JR3A 4JFRA 1VL0A 2ZTMA 1L8AA 4QDJA 4ZK6A 4EK9A 5LBIA 4JYAB 2A1UB 4TWJA 3Q3IA 3O8BA 1BMFD 2YJZA 3H19A 4I4TB 1A96A 3ANNA 5J2TF 4EG7A 2PGDA 1GSIA 4DTIA 1VL5A 1TEVA 1X6VA 4IJVA 5K3EA 4B9AA 3ZV3A 2OEPA 2XQKA 3IQZA 2VKQA 2BSXA 3E2MA 1PG0A 1ULSA 2PY6A 2R96A 3PT5A 4QATA 5ER6A 5AXAA 4EGSA 1JE1A 3OZSA 3TLYA 1G3IA 1Q0LA 4KMMA 4CFYA 3ERCA 1QDUA 1IPEA 1QV6A 4IDHA 2QTWB 4OTZA 4PRLA 1KDVA 3QPBA 5EEGA 4MVJM 1XQVA 3H16A 3VPHA 1CU1A 1I5EA 3U3MA 1SCJA 2VJCA 4MEJA 4L4SA 4MUBA 1D1QA 4X7PA 2GDZA 3EXEA 5BSMA 1N6KA 1NMYA 4WL0A 1CP2A 4WY8A 5BPHA 2G40A 5JMOA 4KTTE 1CDZA 3BKXA 4ND1A 4Q3OA 1FFAA 2FA9A 4HDAA 4OGLA 2OAQ1 5A2GA 3DXFA 5ADUS 4M1EA 3EWIA 3MMNA 4Q1BA 4G0QA 5IXJA 4OBBA 1D5WA 5ECGC 2B30A 3G2LA 1Q44A 3LC1O 5A4KA 5F9FA 3B13B 5AK6A 4G4GA 1IHPA 2BE7A 2YHBA 3TIFA 4EENA 2C4VA 5IRCD 2VLBA 4LKOA 4ZV4A 1YR7A 4GM0A 1AQIA 1DRUA 4A0SA 1ZYUA 3AF2A 1FLDA 3DE0X 3DTVD 3SSAA 4C4RA 1FMTA 1IHOA 2H29A 3MWEB 3SYRA 5BNTA 3WHPA 2ZAYA 3W9UA 2NUTB 4RXMA 1ZI6A 2UXBB 3L8GA 2IX9A 2PSHA 3QU4A 2G71A 4M4SA 3WE7A 1JBKA 3H6HA 5D51S 3IVCA 4W5QA 5FWYA 4LBYA 1KFEB 2Z43A 1DG3A 2QYTA 3FROA 1D2HA 1HYGA 4OQXA 1TM1E 4EZEA 4LNAA 4C87A 4BNIA 7REQB 3M2TA 1GTSA 1UMBB 2BKAA 1WX1A 2QRVA 3LD9A 5FHQA 4G1BA 4NY1A 3RK4A 5EUBA 1YB7A 1F0PA 2YASA 4JQZA 3SKYA 5JJ5A 2Z0MA 3OX2A 2Z1NA 4G4SO 3I9MA 3A6LA 1MVOA 2C95A 2I2CA 2HPZA 3N8KA 4XFDA 2K6GA 4BEVA 1L7RA 1J4AA 2I66A 3EZLA 1KI9A 2YJNA 3FZYA 1T25A 4N5HX 2G83A 2VZLA 3JD4A 4PNZA 4EFKA 4F45A 5EIEA 5HPYB 5I9IA 1UWVA 3RYCA 3KKZA 1YWGO 3KRTA 4E33A 2I4LA 1QWOA 4CLOA 4IRXA 1LI5A 3A2MA 4YLYA 2C42A 1H2RS 1ZK0A 2SKDA 3A11A 1SVNA 1CQWA 1Y80A 5EKDA 1TKCA 1ZUNA 5EZ6B 5EZYB 1LB1B 2F43A 1O57A 2JAUA 2COKA 4PG6A 1JVNA 3ILYA 3QBTA 3D0KA 1PV4A 3P9ZA 1R50A 4GLLA 5AOBA 5CCBA 2PGLA 2OLJA 3RVRA 1CR1A 3NEJA 4QDZA 3A9RA 4YPOA 5K8VA 3O8CA 2YQ4A 4PGFA 3KCNA 3INNA 4XDGA 3OBBA 3TAXA 1OH5A 1VMDA 1Q2UA 4CQMB 5D1NA 2GPJA 1RWXA 2IU4A 3MJDA 4K8RB 2C2WA 1X7YA 2QLJA 2AEJA 3UWOA 4W9NC 1XALA 3C43A 1MHTA 1JKJB 2CMHA 2QD2A 3CEPB 4OHUA 5JY6A 1L4FA 1VIYA 1MNAA 3AB8A 4Y2RA 4DA7A 4ZOBA 3HMKA 5IKOA 3RB8A 2GYUA 1YZFA 3IC5A 3KEQA 4KP7A 3KOMA 3AILA 4KZKA 2C3OA 4HVTA 3C24A 2O8DA 5KYUA 5CT9A 4DZTA 4DDUA 5REQB 1RZVA 4GSLA 3PC6A 4KVGA 4KYUA 2WF7A 1OVGA 3D4LA 1ZGGA 3QTBA 1WG8A 2Q46A 2ZANA 3PGA1 3RTBA 3M6XA 1KF0A 3CNOA 4O0MA 4OJNA 1LX6A 4XQ0A 4OREX 5H68A 1P8JA 2R5NA 3F8SA 1PS8A 1PFKA 3EFOB 2ZSDA 5DIFA 2F8TA 3ETEA 4BP9A 4C0SA 1EX7A 4GI7A 2EGGA 4TQUS 4G41A 2X2EA 1AMOA 1EK1A 3USES 2A5JA 3BD9A 5MGBA 4BV3A 4AURA 3HYTA 4DADA 1VL2A 1Z2DA 2YL2A 1I51A 1NUTA 1F6DA 3ZGYA 1AHPA 2B8NA 4ZOLF 1V45E 1GU7A 2A0UA 2JHCA 3DKRA 3M3PA 4H0FA 4AYWA 2CV2A 3G7UA 2Z83A 3HMQA 3PRJA 4TV9B 5BP7A 5K0CA 1R64A 4HDKB 1YXMA 4MI9A 1L3BA 2PG3A 2OB1A 1A9PA 1DBWA 1CZRA 3ZHCA 4I14A 5I7AA 4H17A 1PWYE 2WWXA 1JDJA 2V7EA 4JLUA 4F8JA 4KK3A 3HRHA 3PA8A 2QVLA 1Y9AA 2BOVA 1NQXA 1KKMA 1Y98A 2BRUA 2NSJA 1AURA 3I6MA 3KPYA 5CW2A 4EITA 3E7DA 4W82A 4D74A 5CX1A 2EDCA 5E4YA 4NBRA 4PONA 5DBOA 2QVZX 1VXRA 3JQAA 4WNYA 2I76A 4G1VA 4QGGA 4EIWA 2IEIA 3EGIA 4UHHA 4Q9IA 3OEYA 1SD1A 2B2CA 2WUEA 3P1JA 4PYRA 2DWOA 3BHJA 4PTZA 5FOXA 3JZAA 5DKFA 3T7KA 1A50B 4BBJA 1E1KA 3IQFA 1J70A 2AMVA 2PEZA 2QY6A 4UE3S 4GZ5A 3LP6A 2DP4E 2JD1A 3NHUA 2WF8A 4EX7A 5KPJA 4KQGA 3T5PA 1USKA 4X85A 2VJDA 3GMIA 1N6LA 2RH8A 4IUDS 4KGDA 2AKYA 2N75A 3PP8A 4F2DA 2F64A 5DGHA 3U9SA 1KVSA 2GF0A 2VCEA 3KZVA 3ONVA 2WF6A 4MV8A 1EXVA 3CUKA 4HT3B 5EAIA 3DOJA 4G3XA 5HEKA 4WZAB 1J1ZA 4E12A 3G8YA 2M6RA 2FW8A 2GESA 2J3QA 4X54A 5LJIA 4AF7A 1C5KA 4DQXA 1SBQA 2R7MA 3B6JA 2EL7A 3JWHA 3O74A 5ELMA 2QM8A 5JROA 4M83A 2Q3FA 2VPIA 2RGEA 4MVCA 1EGMB 4PN7A 1AUQA 1SD2A 4U2FA 4HRVA 1K63A 4FIZA 4GYKA 3VOAA 1NE7A 2B4TO 2KSQA 1H65A 3E84A 1JLRA 3KYDA 2QD1A 1G41A 3L93A 3DNMA 4RU1A 4CFSA 2DULA 1P33A 2H9IA 3B8HA 4XDYA 4QJ5A 1Z5UA 1XKLA 1OYVA 1SHJA 2QTMA 2R5WA 3G8BA 3UH1A 2W0MA 2YQZA 1ZW1A 4JX9A 4CM8A 5ENDA 1NQOA 2C04A 3NNDA 5HJEA 4HXGA 4BCDA 1KOGA 4BWFB 4NARA 1KJIA 2BTEA 1U6IA 3GZ4A 1CIPA 2F8LA 1P9RA 3G3EA 1DI0A 4WOBA 4BRUA 2G8NA 2NG1A 1NSFA 2C7VA 4B3JA 3KQMA 3HK2A 4FN4A 1TFUA 4ZO6A 5ICEA 2F3PA 5JQGA 5ECYA 1ODLA 1OUMA 4FWTA 3JQGA 2PQ2A 3TZQA 4ZQEA 1ZUD1 1TK3A 1X13A 3C45A 5JCZA 5IC6A 4CTOA 3U4MA 2AZMA 3AONB 2BUCA 2Q62A 3A9VA 1BX3A 1KNQA 2JFYA 4Q37A 3OF5A 3V8RA 5HVNA 2QL7A 3HXOA 1EXDA 1NMQA 1T9HA 2Z56A 2XMRA 4NEQA 1K7XB 3UG7A 4YRBA 2J5XA 3LUDA 5LQMA 4N9WA 5A9SB 4MRAA 2PV0A 2VH5R 3MSXA 4P93A 4KO2S 1YV9A 5BR7A 1U3VA 3F3MA 1WSBA 4IDFA 5EE5B 2C8LA 3PHLA 3MWFA 1Y81A 2XZPA 4MPRA 1DQSA 1O6GA 4XIGS 3M6LA 4XLTA 2H2WA 2UZ3A 5E3HA 5KYYB 5IM4A 1JFFB 6REQA 3O2SB 5TGTA 4Q93A 2NVUB 1AN9A 1OJ7A 2BF4A 1GQFA 4C6SA 1V48A 3D4IA 4JR2A 1GY8A 4JUBA 3FE2A 4Q6WA 4UBKA 4BNMA 3KR2A 5AQEA 1GNLA 3QNUA 4BO7A 2FEMA 3INGA 3GELA 1YQWA 4MZXA 5I9TA 1NA5A 4J2TA 5J2TB 1QCDA 1T2NA 2AG0A 4O8ZA 4XVCA 1J0XO 4MYRA 3K96A 3EXFA 4Y1GA 3W5VA 5BUQA 1O0BA 5LP6F 5IH3A 1YS9A 4DCPA 3CLSD 3EODA 3IOEA 1NOKA 5KNBA 2PLRA 3HA3A 3LCCA 1X1EA 5ADWA 5J4HA 2HBRA 1GZDA 2ZWMA 1XRJA 2BCGY 2ZWVA 3DO5A 2WSSA 3M0EA 4IDGA 4FYVA 4IOKA 2JGLA 1Z5VA 4ZANA 1UK8A 2OZPA 3HGTA 2OESA 2WIGA 1MQSA 2JA2A 2VP5A 4FIDA 2CFIA 4X8HA 5D3MA 1Z9BA 3LUAA 2X5OA 1IHDA 5IBQA 3V2IA 4NEGA 1R4AA 4C7XA 4EUKA 3EVFA 2HRBA 4RSMA 2A78A 1E1CA 2J0UA 2ZAGA 2DSNA 4P58A 3UMRA 5JH7B 3SS8A 1E98A 5HSGA 1QO0A 5F3DA 3KTAB 3NGLA 4U02A 2XUFA 4Y9RA 3ROEA 4B0PA 1EGVB 3B9RA 3SE7A 3FJ1A 3BKWA 4AXBA 4D4IA 3SNKA 3L06A 3U40A 1PDWA 4J7CA 2BH9A 3HJTA 4JLPA 1QKIA 4RMIA 4URVR 2B9VA 2VHTA 3QV2A 2H1SA 1SEPA 3OPNA 2PX3A 4ZDKA 4TYPA 5CR9A 5JARA 1XCPA 3STTA 3IX7A 1I32A 3GH1A 1L1EA 1PT7A 2VXBA 3G9XA 2J1LA 5JY1A 4OGWA 1HRDA 3VI3B 4CKYA 3JVIA 2BHRA 3LT4A 1JJIA 3SLGA 3N2YA 3ZBUA 4QGAA 3E82A 1C9NA 3HJBA 1GARA 1WCXA 4NR0A 2FPMA 5DXJA 2PJRA 1M2OA 4LK3A 4OQFA 1SIBE 3B3FA 3KSDO 3EBLA 5FJIA 1I7DA 1CEEA 2JIRA 4Z86A 1QDLB 4MV0A 3WI7A 4LJ7A 2NUAA 1E6WA 5DGDA 2FEKA 1NVVQ 1Z82A 3N0TA 1X7DA 3HDVA 4XWWA 1N2SA 1FP6A 1TGYA 4PLPA 4RDIA 4YGXB 3ZQKA 2QLFA 2VATA 4QBGB 1RCUA 1HDRA 4OJMX 3QJ5A 2CY0A 1ULTA 3EFHA 1QRUA 2MYNA 2PKRA 1H8HA 2GN1A 1M5UA 2R48A 4MDYA 3QQPA 3F71A 2WT9A 4M9ZA 5HF8A 2HQBA 3HWSA 3NM4A 5F52A 5DNAA 5CVUA 1S96A 1CX9B 2H11A 4RGQA 1G5TA 3RAJA 3WG9A 4FE7A 3DOHA 2AYXA 4Z0NA 2OVFA 2QAGC 5T3YA 2XE8A 1XK7A 1BXGB 4F4CA 1RJ9B 4FPXA 1U6JA 2NSDA 4RESA 1DEXA 3TF5A 2R6GA 2ZUSA 2CHQA 3KOYA 1KMCA 1HI9A 3QLVC 4HYEA 3H3FA 1G8JA 1P61B 4BB5A 3K92A 4JJIA 2FAXA 2QSYA 2ZBVA 1GNPA 1CW2B 2C88A 3QF4A 4JGBA 1X7WB 5LZ5A 3EC1A 1ZMOA 2XWPA 4MVJP 4V0NA 2ATVA 5GMOA 1SVIA 2OXRA 3H87A 4PX9A 3C8HA 2WC1A 4CCSA 4F84A 2PK3A 2GFIA 1SKYB 4CLRA 3HN2A 1TQDA 4KBFA 2WOJA 2AJCA 4BHTA 1S01A 1IHXA 1TYCA 1Z4LA 2B82A 2UAGA 2Y99A 4IGAA 5E8JA 4C3ZA 2QZZA 2PA0A 3HLTA 4HXYA 4KITB 3FR7A 5D87A 2V98A 4G01B 1WXWA 3Q4GA 5F5XA 3F1LA 1E6KA 2A5YB 5CX4A 4ZAFA 4F6RA 4JODA 2BEUA 3GAMA 2C3YA 4PFQA 4UHFA 2JEZA 3REGA 3CRVA 2VBFA 5LBUA 2JLUA 3LT5A 3P9PA 1EVIA 2C1EA 1MTOA 3AFOA 3IHKA 1T4DA 4NBWA 4BTVA 4GRAA 1DS6A 3DTVB 4D0GA 4CM9D 3L1JA 1UP4A 2QDXA 4JI3B 1B74A 3I8SA 1VM6A 1H6CA 1X8KA 3AY0A 4QX6A 3I0NA 2SKCA 2PYIA 3E5MA 3FTNA 4YONB 4LGVA 4ZOLB 1GT6A 2UYYA 5F1KA 5IVIA 4AUKA 5E4FA 5JJCA 4HDNA 3TL6A 2GUWA 3QKUA 4Z4QA 1ICIA 1PEYA 2PJZA 2G67A 2L2QA 4Q3EA 5AJZA 1J5PA 1K6IA 5JSKA 2J5RA 3V80A 5A5EA 1P2TA 2M9MA 3EGXB 4YB8A 2FMKA 3RAEC 1HX7A 3QM1A 1ISHA 5DASA 1Z2CA 3WGJA 3EYAA 2CVQA 3IUSA 4YJDA 1ZIYA 5EE1A 2ORED 4TXMA 1DTSA 1DXYA 2PHZA 3PQ2A 4UHEA 1EP9A 3KG2A 1ZL2A 2QRNA 4G8DA 1M0WA 3C7AA 1O97D 4QD3A 6AT1A 3VUEA 4A03A 2VT2A 3PIDA 2LKDA 5JS7A 3D54D 1JU9A 1V11A 5BOVA 3OQ6A 1W0KA 3PYLA 3B3AA 3GZNB 4CMHA 3CCCA 5IYZF 3ABSB 1RWBA 1TCVA 1Z2OX 2WKSA 2EFEB 3OSZA 4DR5B 1LK0A 3NKFA 1IBSA 4WK2B 3VOTA 3M4NA 5DU2A 4OHPA 3T9AA 5IUNC 1KSJA 2ZVDA 2DFNA 3A1SA 1MC1A 2IOFK 1RI4A 4DG9A 4Z1OA 1ZX1A 1V2GA 3EWNA 1TMOA 4KMOA 1VP3A 3TWOA 1ZL0A 1N8NA 1AQYA 1P91A 1SD5A 2PGAA 2Z1DA 2Q3JA 5FF9A 5E7MA 3CIOA 2NYVA 3ESAA 4FDUA 1B7GO 1CS4C 1AKNA 3EXIB 1LSOA 3SFVA 2SICE 5C8YF 5IFKA 2GBLA 4Y1EA 1D07A 1PT6A 1P6QA 2XHZA 3I61A 5BW8A 1TW2A 3R0XA 3VHQA 1TQ2A 4EPXA 1JEEA 1W4LA 2Y0PA 5FWDA 3DKPA 1L7QA 1OYYA 1ZG3A 5C1OA 4P3PA 2WHPB 1N2OA 4O33A 3EVCA 3BGOS 1GZSA 4E22A 4RD2A 5FUYA 3IIKA 2PMFA 2W4IA 1YRYE 3ITNA 2X4DA 1W1WA 2OZLB 4ISCA 3QMWA 1GG8A 4QPZA 1MAHA 1ABBA 1RWOA 4OOFA 5CVEA 1RP7A 3GGGA 1JF8A 1P45A 1H22A 2P2SA 1UK7A 2XKBA 4W9NA 3UWMA 4K2HA 1X2BA 4GXQA 4S1VA 1DKLA 3T61A 4Q3KA 4YIHA 5D85A 1U2SA 3DYIA 2VSNA 1BWSA 3BREA 1Z83A 5BSRA 4B3IA 5CXXA 4M86A 1D5CA 4ZXPA 3GYBA 4L8GA 1E2BA 2J0VA 4GOJA 4DA0A 1VI6A 3HCFA 1E0AA 1L7AA 4J7UA 2WFLB 5CMLA 4ZDIA 1XMQB 2QI9C 4FILA 2D5BA 3R6GA 2H51A 2O2HA 3C0KA 3EW7A 2FR0A 4BO5A 3SHTA 3AJ9A 1JRLA 4DCVA 1G4AE 2HFKA 1GR0A 1ZHFA 2JJQA 2YV3A 1JTEA 1NBAA 1Z8NA 3AY6A 2ZU6A 3H2KA 1A1VA 3WDMA 3EHDA 4C4YA 1IOZA 5B12A 1SM4A 2DBRA 1T13A 3FKQA 3BFPA 3IBTA 4M54A 2Z57A 3H05A 5DCYA 3B60A 3RHTA 4I50B 1G60A 3EZNA 3TQFA 4BUZA 4E46A 4EI8A 3AR2A 2EZ9A 2O6HA 4DUGA 5J4KA 1YB4A 2RGRA 1VE7A 5A6SB 1J97A 3WJ1A 4M87A 1S9HA 2NSHA 2JZOA 4S1WA 5FWAA 4TKUA 3FZGA 1Y8RA 3EC2A 3AFNA 3KB2A 4FNGA 4JXXA 5TIIA 3FY4A 3GL9A 2M1ZA 3FBTA 3ROXA 1RAFA 1TIBA 2NSLA 4P4SA 5CG1A 4NCBA 1L5ZA 1NQWA 2NTVA 4YNBA 7AT1A 3ETJA 2WJVA 1E2LA 1Q11A 4G0OA 3NI2A 2YC2C 1WR8A 3CPEA 4FCCA 3TO5A 1L5LA 3NIWA 4DLVA 2HXGA 2BKXA 1MFZA 3A9WA 3VR4A 3I8XA 1KP9A 3DB2A 2WKRA 2A94A 2PLNA 1R4NB 3IB3A 4ZI3A 1TF5A 4OXYA 3GN1A 3UCEA 2C5LA 2P6MA 2ZJAA 2VP6A 3M6VA 1JFRA 1UBTS 1EX1A 3BCHA 3L0IB 4NPAA 1LJLA 3S2UA 2BFFA 2E4UA 3O83A 3DOIA 5T8KC 3UCFA 5LP6B 1F9AA 1WB5A 1VGQA 1T2AA 2I54A 3VPGA 2YVQA 5EJ5A 4PPYA 1CT9A 4IZOA 4N54A 3VX3A 2AWNA 2J5BA 1T5SA 2IDZA 2D74A 3CLRC 1XEAA 4IJQA 4YGYA 2ODEA 3HKBB 4DSZA 5K5EA 5EMLA 5EIBC 5CA1F 1M6VB 3K9QO 1N7IA 1PL8A 1UJ4A 5B7QA 1JIQA 2OECA 3OCCA 1INLA 1Z4QA 4DRYA 2ZTLA 1HFEL 3MMXA 1BDHA 4B45A 1W5TA 4IDPA 3W2GA 1F4PA 1SIUA 4EKYA 5DBIA 4B32A 4MYSA 1DCMA 1Y5IA 2ZIVB 3D5QA 3KM0A 1E6CA 1N0VC 4KR0A 4AZSA 2JG3A 3HCNA 2QRMA 3PGLA 2JRCA 2XDWA 3HY4A 2V58A 4N4AA 1OWNA 1D2EA 1VFNA 3NOOA 4UHBA 2IBMA 2D2XA 4GM1A 1TTTA 1PEAA 1XCJA 3TDMA 4ND7A 1QC5B 4IHJA 4PNHA 4L72A 3W0LB 2QJRA 3SR0A 5C3MA 1UT6A 1PVVA 1ZZEA 1RXEA 2GQ0A 1E6LA 3ZCQA 1LPBB 3JW8A 1C3OB 3GQVA 2D62A 3V4PB 5KYVA 3VU0A 5IEBA 3B6MA 3EGWA 2QN6A 2GFHA 4GZ6A 4QUHA 3ORYA 2X5XA 4GOXA 1JR3E 2N1BA 2RHHA 3CFYA 2R7LA 4LZLA 1EX9A 5CEJA 1YO6A 3AR7A 3NG1A 4RA6A 3QXXA 4NJEB 2OQVA 4GC9A 1JHRA 4Y2QA 4GXRA 3GFSA 1B6GA 4K8OA 2XMDA 3U0BA 4DM7A 2P3QA 3CEAA 4IJMA 3UPTA 3Q8LA 4H18A 1A9XB 1CJUC 2ZQZA 4CG2A 3VRHA 1RWPA 1V7QA 3BDVA 5CB6A 4M6WB 1JFSA 2IH2A 3WHIA 1E6EA 4UPVA 4U2BA 2VHEA 5BWLA 1T5DX 3QWHA 3KHUA 3JX9A 3LBHA 1NYLA 1XQWA 2ATXA 3GJZA 3GMSA 1S5PA 3H84A 1LCIA 4GR9A 4NYIR 1D4ZA 4YH1A 4IWYA 3IVXA 3VH2A 3EZXA 4MKHA 3TLGA 2JHGA 4NG4A 4NDNE 2I7VA 3K0EA 3MELA 4UVIA 1MXFA 1O8CA 1SOMA 3NIBA 4Q4CA 3RBZA 4NCAA 2EFYA 1J8MF 5JS1A 3ZNOA 4B3BA 2AK3A 5ALTA 5IC5A 4RTMA 3EVAA 3ORQA 1KA9H 3WLAA 3JWPA 4HQNA 1EBBA 2PUBA 3WNDA 4EGQA 2O8BB 3A4YA 3L9XA 1ZO8A 1Q83A 1KBZA 2VEOA 3REOA 4POOA 1IXSB 4QNRA 4OFWA 2XT6A 1YRBA 3H2IA 3O9ZA 1VHQA 4V0KA 4AYTA 1N0UA 1PG2A 1XLTA 2NM0A 1H23A 4PV7A 221PA 3V4SA 4C0JA 5B4TA 5HGXA 5D7NA 2GBPA 5JJLA 2VJBA 3IUNA 1FS5A 2P65A 3P2JA 4P8RA 2XXAA 3OE4A 4YAJA 4XYBA 4LY0A 3OU7A 4JQSA 2HA3A 2NZWA 1ZU4A 1WL8A 4M76B 4HCJA 5ALWA 3MD0A 3UHJA 4CQLB 1QZ3A 2F6RA 2M1XA 4KAAA 1CQIB 9ABPA 4AG3A 5C5DA 4BCBA 1KGDA 1GPMA 3TTWA 1GT91 1Z0DA 4BBPA 4D46A 2IH4A 5LSAA 4YP0A 1DLJA 3KSBC 4MUJA 4H1HA 2O06A 2Y2VA 2OAEA 3WK9A 3JAWB 4OQNA 1WEHA 3R2JA 1UMCB 2BGTA 3DMHA 3UXYA 5C37A 3WGNA 3WFJA 3DP9A 1HZJA 4CF4A 1CZUA 1EE1A 2A5GA 2E9SA 4PX3A 3W77A 2IY9A 1EHIA 1BX1A 2PZJA 4PLCA 2XNDA 4A1OA 3IUMA 2AB0A 1J1UA 2BZGA 1NC1A 1OXSC 2DECA 1N78A 4MLCA 5FL3A 5JCJA 1XZLA 1PNRA 2R8OA 4Z7OB 1X7HA 1IY2A 3N2LA 1F1BA 3ZY4A 1MG0A 1IJFA 2J59A 3EEYA 1HTBA 4LNUB 4ZAXA 1A98A 4BDTA 1G5RA 1DC7A 1Y8ZA 2D0OB 2VBCA 1G42A 4ND6A 3ESBA 1X9IA 4XQGA 5LQCA 2XITA 3VOBA 1TKRA 3JQBA 1ZGZA 3PI7A 1CLEA 3VQTA 3ESRA 1YQXA 4QXRA 3VH4A 2WU3A 3HLYA 3J81k 4P92A 5HOEA 3ROGA 2EIHA 4ZJYA 2C9CA 1FMFA 1HEYA 2JGFA 3FETA 4BNYA 5JAHA 1NVEA 4PS1A 4NICA 5LNK1 3KSAC 2HU8A 3AJEA 2LGJA 1MJNA 2M32A 4R7GA 1QVVA 2JFQA 1QK5A 3OH8A 4EJFA 4YQFA 4ZDJA 2X76A 3H86A 1P7CA 4EX6A 1A2BA 3GXOA 5EVJA 1I1HA 2H0AA 2ZRLA 1XI2A 3KP1A 3NALA 3I0ZA 4LYYA 4R8LA 4JXZA 1SRRA 3LT0A 3FG9A 4LVCA 2FSGA 4TXNA 3DBOB 3RHFA 2AR9A 2XYGA 1PKXA 3SD7A 1EESA 3G9UA 3TX6A 2KW5A 2CNDA 2LVBA 2IYWA 3QMVA 2XKJE 5KC9A 2A7QA 4AF6A 4CKBA 3U3XA 5JD6A 4H08A 3FOBA 1JG6A 1QYXA 3N9IA 5EUMA 1DEKA 1IVNA 1YRAA 3ZJ4A 3TQHA 5DK6A 1DEOA 2NU8B 1GGEA 3I92A 3ME5A 4E11A 1LBQA 1NZFA 1PP4A 2ZETA 3BQ9A 3FRJA 4C7BA 4CN8A 3LUHA 1ZMTA 4OGKA 4EY7A 1CRPA 4DWVA 1AM4D 1P2VA 1SUIA 2YCBA 5D86A 1DCTA 1QYRA 2AI3A 4WMLA 1Q7BA 3S1AB 1B2RA 2G3YA 3BN3A 4FFNA 3KFVA 5KYXA 5JTUA 3AVPA 3TUZC 3IKMB 5KYWA 4Z9BA 4KXNA 4WZZA 3FOEC 3ND5A 1WDWB 4ZT5A 3ZU5A 4ACAA 3EPLA 1NMEA 3BHNA 4XRRA 1G1AA 2V8BA 3Q8XB 3UBMA 5FWXB 1I1QB 2D1FA 2JI7A 1IU9A 3ELWA 3E5HA 3O8NA 1QIMA 4WCFA 2ZRDA 5SZKB 3E7XA 1MJGA 2EVWX 3PF8A 5T4BA 2C2HA 1CJMA 1DAHA 1V4NA 3P0EA 3BMCA 4AIRA 3O94A 2NPFA 2PZMA 1BXRA 1MNQA 1DBRA 3EMBA 3GNLA 1H3FA 3KFXA 4LJAA 2GHRA 3AUJB 3T1TA 2RGXA 1PT9A 1TKAA 2I1LA 3ILSA 2XOEA 1MPXA 3MILA 1TUBA 2WIJA 4BMYA 4WBNF 4JUAA 1G8SA 4RKFA 1GZ3A 1SXIA 1F5SA 4ARUA 1GSAA 4HQFA 5JOQA 1AD2A 2WUDA 1ZH0A 4Q1FA 1QYDA 5B1DA 3G0CA 3N7TA 3O92A 4D3FA 1FTWA 1Q1GA 2IEAA 3DUFA 3CHYA 4MR7B 3W78A 1B2LA 1XLVA 2VUHB 3BD6A 3P2YA 1YZ3A 3RUCA 3WBFA 5JRJA 3CCFA 4RQUA 5CVJA 5FHRA 1JDVA 2J3DA 2X5KO 3GRFA 4WK6A 2C3MA 5HYVA 4II3A 4LZAA 1ORDA 2CZCA 1TA0A 3G0GA 3LKVA 2C20A 3PYXA 2V6FA 1WB6A 4TZKA 2V1UA 1WMSA 2ERXA 3PS9A 1WF3A 3DWFA 4PHTA 4DLZA 1SMKA 1KBOA 3F47A 3KXLA 2Q9UA 4OCZA 4KE8A 5JJBA 5JECA 5ALGA 4O4IF 3JRXA 3PL1A 2WJPA 1DDIA 3P2KA 3AI2A 4FGKA 4ZAGA 1FTGA 5IAKA 5B1EA 2GARA 4N39A 3WAGA 4CIBA 2Q5EA 1J06A 2RKBA 4RA9A 4RDHA 4AMUA 1Z39A 1G8HA 3GLGB 1AZWA 4QLBA 3DV9A 4KXXA 5JDIC 4BEWA 3CR3C 1G7RA 3D4NA 2BFBB 5J9FA 4PFSA 3HPQA 4V0ME 4DS3A 2BDEA 5I8PA 1C41A 1T3SA 3COPA 2B5VA 3L9WA 2ID4A 2ID8A 5L3SB 4YMSA 3WLJA 5H8WA 5LDDC 2BZ1A 3OZUA 3KAQA 2ON6A 2R86A 1RHKA 2CBZA 2YS7A 4R8MA 4CLEA 1PZEA 1KPGA 1YI0A 3TNFA 2V3CC 1G8MA 1W5FA 3CS3A 1Z4NA 3P9CA 3KKEA 5EERA 3FMFA 1VSBA 1GRNA 3BB3A 2PJDA 3SSOA 1QJCA 4TQAA 2VWGA 5CA1B 1BGXT 3O8QB 3WGQA 3FTCA 4FJ2A 2YIMA 3W06A 3PGMA 4Y2YA 4XD7A 4FHFA 3WKBA 4QYMA 1T36B 3UHFA 1GDTA 1N5KA 4Q4HB 3UJNA 4HNTA 1FSSA 1Y3AA 5IPFA 2J46A 5IBPA 1EB8A 3P4XA 4AY3A 5ETJA 1WE2A 2BFWA 1K06A 2XAAA 2Z9DA 1GAQA 3AC0A 3JAKB 4FFLA 4KLNA 4IQ4A 4LJKA 4UUQA 4BQFA 5CDSA 2YCLA 3LPAA 3GDOA 4A23A 4MS1B 1ATZA 2W4QA 4Y7CA 2VP3A 5CLLA 2OENG 2Y1LA 1YQGA 3G49A 5IXSA 1L3IA 3HA2A 1KNXA 5CNJA 2ZT5A 4BBZA 2BBTA 5CM8B 3W7VA 3LCMA 4NAVA 1WMDA 3RYIA 2A35A 4WLEA 1WDTA 2UYCA 1NX6A 2YJ4A 3F9IA 3WSWA 4JIGA 1RYZA 3B8EA 3GCXA 1GD1O 3I28A 4AY6A 1N1MA 4HZUA 1UOPA 5H1YA 3ZH9B 4YMVA 2VT3A 2QN8A 3C15C 4RWEA 1P72A 4KSCA 4A4DA 1J42A 3LMKA 3ZJ5A 1BVRA 3KPWA 3W04A 1BW9A 2B7BA 1PWEA 4PWYA 1KAGA 4CYMA 1OZAA 2YTZA 2GPWA 4R2JA 4R81A 2TMKA 1P77A 1G7TA 3NZEA 1N2XA 4UE2A 1YT5A 3C1OA 3NYRA 3W2TA 4ALNA 1SKMA 4MWTA 4URYR 1DIAA 2VNSA 4B8ZA 5IABA 1ZVKA 3CV3A 4V3BA 1MC5A 4YTEA 1E7YA 4QOJA 5DB4A 2FK7A 2ZYGA 1IHUA 1UM9A 5H0IA 2B8TA 1OLUA 1TADA 4E30A 5I48A 2GHTA 1SXJE 5C1DA 1NG9A 2GHIA 2YJTD 3Q2KA 4G81A 4D4GA 2HRRA 1E2MA 2A33A 5AW4A 2QPAA 2RH5A 3Q9UA 4GYJA 1M2JA 1DADA 5L9AA 1KH2A 2QAIA 4O29A 4PC3A 2V45A 4CFZA 5ES4B 5AJTA 1MEOA 3OICA 3VR5A 1JBEA 1YDHA 4WK0B 3UXHA 3V8MA 4JB0A 4NULA 4EECA 2A1TS 1PNOA 2VF8A 3KYIB 2ZR9A 1DDGA 1E8NA 2VKTA 3L6CA 3N75A 1SU7A 4TKMA 1W9MA 3KQPA 4FGUA 1FU7A 1LC0A 1C1HA 3N6RA 2P3OA 3I5MA 3S70A 2BT4A 2QGFA 2Q7DA 4IIJF 3CVOA 1RRGA 1VPVA 5EG5A 3Q6NA 4JX8A 1Y42X 4PC1A 2CHUA 3I0MA 1L7VC 4F2GA 3FPCA 1AT1A 2I4RA 1E4EA 1NASA 3K5WA 1HT3A 1YHZA 2XOKA 3DO8A 2ZIEA 3EIUA 3HC7A 4M38A 2XQFA 4J0IA 1A7AA 1Y1LA 4BLQA 3CVVA 1JLLB 5CYPA 1Z34A 1RZUA 1W5EA 3EUWA 2Q9AA 1I4WA 2HXSA 3K09C 4ISBA 4PSKA 1YTLA 5CLQA 5EE3A 5T3UA 3TFQA 3EEQA 3RVOA 3UK7A 2AN4A 1AY0A 2JIDA 2YHAA 4HX5A 5FR1A 5EXSA 3ZHXA 3PX2A 5C7OO 3F67A 3UMGA