3OYBA

Crystal structure of the prototype foamy virus (pfv) intasome in complex with magnesium and the insti mk2048
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
368
structure length
368
Chain Sequence
b'LDAELDQLLQGHYIKGYPKQYTYFLEDGKVKVSRPEGVKIIPPQSDRQKIVLQAHNLAHTGREATLLKIANLYWWPNMRKDVVKQLGRCQQCLITNASNKASGPILRPDRPQKPFDKFFIDYIGPLPPSQGYLYVLVVVDGMTGFTWLYPTKAPSTSATVKSLNVLTSIAIPKVIHSDQGAAFTSSTFAEWAKERGIHLEFSTPYHPQSSGKVERKNSDIKRLLTKLLVGRPTKWYDLLPVVQLALNNTYSPVLKYTPHQLLFGIDSNTPFANQDTLDLTREEELSLLQEIRTSLYHPSTPPASSRSWSPVVGQLVQERVARPASLRPRWHKPSTVLKVLNPRTVVILDHLGNNRTVSIDNLKPTSHQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PFV integrase
publication title Molecular mechanisms of retroviral integrase inhibition and the evolution of viral resistance.
pubmed doi rcsb
source organism Human spumaretrovirus
molecule tags Recombination,viral protein/dna
total genus 107
structure length 368
sequence length 368
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2010-09-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
A PF17921 Integrase_H2C2 Integrase zinc binding domain
A PF18103 SH3_11 Retroviral integrase C-terminal SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2300 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3oybA04
1.10.340.70 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Endonuclease III; domain 1 3oybA01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3oybA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3oybA03
1S1XA 1BCOA 1HRHA 4E19A 5SWMA 3K5LA 3AO2A 3KK1A 3MEDA 4DU3A 3OYIA 1DTQA 1CZ9A 4KHNA 3MXIA 4RW9A 3PX0A 3V9SA 1U45A 3DI6A 3LX7A 2L8DA 3ZT3A 4JLHA 2IC3A 2X6NA 3MEGA 3NF9A 4Q0BA 1OZ2A 1DTTA 3TI0A 3S3OA 2HB5A 4BACA 2JTFA 5CZ1A 3LANA 2Q3SA 3CFOA 1BIZA 3QIOA 3IS9A 1ASWA 3TAQA 1UOCA 3META 4I2QA 4I2PA 3PFSA 3MEAA 3C95A 4B9LA 5JS2A 1QSSA 3K57A 2RI2A 1S1UA 3NH1A 4IUVA 3KLGA 3F9KA 3OMGA 3L8BA 3K5MA 4CJ5A 4OKJA 4FLWA 3M8SA 1LV5A 4CFBA 2RJCA 3QO9A 4Z4IA 1TV6A 3MAQA 2E6LA 3F73A 4BD3A 4CERA 4F3TA 4QQ6A 4M42A 4CFDA 1QS4A 2G8KA 3JSMA 3QNOA 2HMIA 4FYDA 1RT6A 1MU2A 1SKWA 2F8TA 4IG0A 3LPUA 4CJQA 3B6OA 4Z4EA 2YNIA 1WSFA 5T7BA 4DTOA 1YTUA 4B9VA 2P5GA 1C0UA 3ASKA 4M3ZA 1RBRA 3AVIA 3LYIA 3KKSA 2EQMA 4CHPA 3H8ZA 2I5JA 2Z1GA 3OYBA 5KE2A 2PYLA 3QEIA 1JL2A 1SUQA 4X34A 2FBXA 4KTWA 1HNIA 3PUFA 3RMBA 4FJIA 3VQ8A 4OGEA 3IAYA 5FDLA 5KH6A 3L3UA 2EHGA 4IKFA 2WONA 1HPZA 4FLZA 1TK0A 3NHGA 1OI1A 3FEOA 3CYMA 4CJPA 3SUPA 3O3HA 1EKEA 4FLYA 3TAFA 3KLEA 1TAUA 3VQAA 3MEVA 3DOLA 1WJRA 1F21A 5J2QA 3PX4A 4FJ9A 1C1BA 4Z02A 2AJQA 3RMDA 2E6NA 3TAMA 4DG1A 4Q5VA 4ICLA 3HVTA 1UA0A 4FW2A 3HJFA 1D9FA 3U3GA 1WGSA 3AA4A 3KJVA 3LP3A 4LD6A 1U48A 3AVBA 2GV9A 2BUDA 3OYDA 3LWLA 1QSYA 4J2BA 2G8UA 3AVFA 1LWCA 2KQ2A 4JS4A 4O44A 4KI6A 3VQBA 3HL8A 4HCBA 3H08A 3AVGA 3MP8A 1XNIA 1LWFA 2X74A 5C42A 1NJXA 2LCCA 4CEQA 4H8KA 4RW7A 2RJEA 5HBMA 4DF8A 5J39A 1GOAA 1ZYQA 2B4JA 4CJSA 4KB0A 3DLEA 3L2VA 4FLXA 4CEEA 4QCLA 1KVAA 1OYXA 2LRQA 2EX3A 3MP1A 4FZZA 2FBYA 4PQUA 1RNHA 2X6SA 4KFBA 4PY5A 3D0PA 3DLKA 3TWHA 3WNEA 3NH2A 1WJQA 3AO4A 2FBTA 3M9QA 3NF8A 1QTMA 4DWIA 2Y1IA 2FC0A 1IO2A 3CG7A 1U04A 2M0OA 4CJRA 3AA5X 1RT3A 2Y1JA 1HYVA 1TGOA 3ZSVA 1W0HA 4OKEA 4FL6A 3NBPA 1J53A 4ZTFA 1O1WA 1JXBA 1ZBFA 1L3SA 1NJZA 3PX6A 4Z4CA 1VK0A 4B3OA 4C5GA 2P1JA 2R5AA 1I39A 2GUIA 4CFAA 2D9TA 2BE2A 4NYNA 4FZXC 3PY8A 4PUOA 2KZMA 3SYZA 2YRVA 3SUOA 1N27A 4CJTA 1X9SA 4FJ5A 4KV8A 4FCYA 3TAGA 4E7HA 2ATQA 1SSFA 3EAEA 4IURA 4CJEA 1LWEA 4IG3A 2XO7A 1JLEA 1BI4B 4CHOA 4FJJA 4PLIA 2PYJA 4Y1CA 1VSJA 3K5OA 3NF6A 4HUFA 5CYMA 3CM5A 5HRRA 2IOCA 2XY6A 5J2PA 3HYFA 3OYKA 3VA0A 4LSNA 4PWDA 4CJFA 4F2RA 1JLQA 4DTRA 3EZ5A 4B9WA 4DQIA 1BGXT 1ASUA 2D0CA 5CZ2A 3V9XA 3QEXA 4EP4A 1U47A 2HVHA 4O0IA 4W5RA 1HMVA 3NDKA 2HHQA 3M8RA 1RDCA 4LSLA 3QLHA 5KGXA 4FM0A 5C6SA 3PO4A 2HHTA 1S9EA 3ALYA 1RTDA 2RI3A 4BDZA 3RRHA 3P8HA 1NOZA 3HP6A 4CF8A 4E0DA 3SQ0A 3NFAA 1G5VA 4CHYA 3KKRA 4GVMA 1HYSA 4GW6A 2G8IA 3QESA 2OPRA 3BDPA 2LSNA 1A5WA 5FRMA 3E01A 1IH7A 1YTAA 2RF2A 1ASVA 3TARA 1X9MA 3O3GA 4B08A 4GY5A 2PZSA 3DB3A 2JGUA 3E9GA 4BWMA 1VSMA 3OYEA 4W5QA 2RPIA 3LGLA 2MWPA 3NH0A 3OJUA 1NK7A 4FLVA 3NTIA 4JRPA 4PLLA 2O4XB 2RHXA 4CEFA 3SQ4A 1QSLA 3FDRA 1L3UA 3KK2A 4FJ8A 4OJRA 4C5EA 4N4HA 3LP2A 4FJHA 1IKWA 3VQ9A 1XC9A 4M41A 3VQCA 4CHQA 3ZSOA 2XDPA 3CFRA 4HUEA 2E5QA 2HHSA 4AHTA 3K59A 1NJYA 1NK0A 1WAJA 3SUNA 2JLEA 3AVMA 4ELTA 1RDDA 1L5UA 3SPYA 1C6VA 1H3ZA 3ZT4A 3T19A 4DFMA 3AV9A 3AO1A 4E7LA 1RDAA 4CRIA 2R7YA 4E7JA 3U6FA 4N4GA 4DTUA 4C8OA 1WSHA 2B6AA 4I7FA 4NCBA 2RJFA 3I8DA 3LAKA 4BWJA 4HTUA 3BGRA 4FJLA 1WAFA 1N5YA 4FM2A 1TKXA 3T3FA 3FC3A 2R5MA 4A4GA 4MFBA 2DTUA 2QQRA 1LAVA 3OYLA 3ASMA 2VG7A 3TAEA 4E7KA 2DIGA 5KCOA 4CF2A 4W5NA 3QERA 3OS1A 2F5KA 3UIQA 2LVMA 3MEUA 1WN7A 3OY9A 3QINA 4NZGA 4C8KA 4KHQA 4B8AB 1VSEA 1CLQA 2YKNA 4J2DA 3SCXA 2HNYA 3NGIA 2VWKA 3LPTA 2RKIA 4N47A 2X4YA 3DLRA 1L3VA 4QQDA 3ZT1A 3MECA 3ZSWA 4CGDA 3OS2A 2DAQA 1VSDA 4CGIA 1TK5A 2XY7A 4FW1A 3VQPA 3MXMA 4IUUA 2KTQA 4CHNA 1UWBA 4AHUA 2KFZA 1JLBA 4CE9A 4OGCA 5KRSA 3C94A 1RDBA 4B9SA 4RG2A 2LDMA 3OS0A 1C1CA 4M3RA 4KPYA 4IUPA 3V1OA 4R5PA 1I3AA 3SI6A 4MQ3A 4OVLA 3CQ8A 1TK8A 2IGIA 2HW3A 3F70A 1EXQA 4CF0A 1CXQA 1DLOA 3OYFA 3VQ6A 2YNHA 3I0RA 1EP4A 3O3FA 4E1NA 2GFAA 3B6PA 4PL6A 3G10A 1XWLA 4FVMA 2VG5A 3TAPA 1J5OA 4Q5WA 1S6QA 5KRTA 1RBUA 4DU4A 4CGGA 2A1SA 2IDOA 1RT7A 1JLGA 2ZQBA 5KI6A 2OA8A 3PNWC 1VRTA 3S6WA 2Z1HA 1CZBA 3L2QA 4DTXA 1RT5A 4DTNA 2RJDA 1CXUA 2NLUA 1J9AA 3CFPA 1VSLA 2YKMA 1W9HA 4KB1A 4M3WA 1KLNA 3NGYA 4CK3A 1S1WA 2XHBA 3A2FA 3E9FA 3LZIA 4A4HA 2W42A 3LP1A 3ZSRA 3SNNA 4DLGA 4CGJA 1EETA 4BDYA 1BHLA 4IFVA 4QOZB 1S5JA 5HRPA 3NAEA 4DS5A 2VYTA 2PQWA 1EX4A 4CEZA 1BQMA 1NJWA 4CEBA 1RILA 2BIVA 1B9FA 5HLFA 2YV0X 4C5HA 3KIOA 1HYZA 1Q9XA 2QKKA 2P0KA 2MWOA 4OPKA 5C25A 1FKOA 4KKOA 2OPPA 4CIFA 4KRFA 2P5OA 2D0AA 2IAJA 2G8HA 1S1VA 1SL0A 4KTZA 4OLBA 4I9QA 3HXMA 3QIPA 2Z1JA 4DS4A 4CJ3A 3OYMA 4O5BA 2XK0A 2A1RA 4Z4HA 1GOCA 2R58A 4N4IA 1LW2A 4HHTA 4DQRA 4CEOA 1IG9A 2F96A 4NCGA 4CF9A 4QAGA 2X78A 3VQ5A 3KD5E 4C8NA 1XHXA 4CEAA 3SD4A 3PV8A 3SQ1A 1LAWA 3QETA 4C8MA 4AILC 3L2UA 1ZBHA 1ITGA 1XHZA 2BGGA 1QHTA 3HK2A 4C5IA 1YVUA 4RW8A 4UQGA 1Z26A 4DMNA 2DY4A 2D5RA 2K3XA 3FFIA 2OPSA 1NKCA 5C24A 3V1QA 3KD1E 1A5VA 4TSXA 3M8PA 2QXFA 4CEDA 4W5OA 3DLHA 1BIUA 4CHZA 3K58A 2B8AA 3EY1A 1KFSA 3ISNC 2EQJA 3LALA 3VN5A 2DFEA 4FJ7A 4CF1A 3K2PA 1WSEA 2WOMA 4ELVA 4KTQA 4FK2A 3LDSA 4DQQA 4CECA 5SZTA 4FJKA 4IDKA 4BE0A 1D9DA 2P51A 2EFIA 4E3SA 2EQUA 3THVA 1NK9A 2XY8A 4CIEA 4DFJA 3VQ4A 3ITHA 3HP9A 4HCZA 1ZBIA 4CFCA 4LH5A 1N6QA 1KTQA 1LW0A 4DF4A 4E7IA 2RHZA 3MP6A 2EQKA 2HHVA 3HPOA 3ZSYA 1Q8IA 3MO8A 4CGFA 3TR8A 1G15A 5KTQA 4CGHA 4B9UA 1RT2A 3KTQA 3V4IA 4N76A 4FLTA 3NE6A 4N56A 2RHUA 1T7PA 1WSGA 4B9NA 4L59A 4FK4A 3KK3A 4OVAA 4M3TA 3DMJA 1VSHA 4UC4A 3DRSA 3I0SA 1KRPA 2OZSA 1B9DA 3O4NA 2GF7A 3P83D 1IKVA 5M9OA 4DTSA 2BDPA 4Y1DA 4KHSA 5DMRA 3OMCA 4AHRA 2RHYA 3SPZA 3ZT0A 3G0ZA 2EKOA 3QEPA 1ZBLA 4KHWA 3PO5A 1SV5A 3H6ZA 3FLGA 1NK4A 3DOKA 1C1AA 3LLRA 3OYGA 2PY5A 4ELUA 4B9TA 1U4BA 3WNFA 4DQSA 3KLHA 2IG0A 2B5JA 3O4QA 4M3XA 2K3YA 4I9LA 5HP1A 5IAYA 1TKTA 3CM6A 1HJRA 3KLIA 2ETJA 3VQDA 1D8YA 4LY7A 3MEEA 5J2MA 4IFYA 1BL3A 4Z4GA 1KHCA 3DM2A 3WNHA 5D6WA 3OYNA 4HVJA 3C6TA 4HUGA 2RI5A 3ZT2A 2R57A 4QVZA 4F8RA 5KE3A 3AVCA 2OPQA 2XY5A 1WSIA 3RR7A 3HPGA 4LH4A 5I42A 4DSEA 3S3NA 3QIIA 3VQQA 4YFUA 2HNZA 4Z0UA 1NK5A 3L2WA 2KW4A 1IKYA 1VSKA 4ID1A 1KSPA 1TAQA 1QQCA 2KZZA 3K5NA 1XI1A 3BDLA 4BDPA 4II1A 2HNDA 1K6YA 4G1QA 1J54A 3ZSQA 3SV3A 4GMJB 3PMTA 2E6MA 4H4MA 3SUQA 4O0JA 4KHUA 4DTPA 5IN1A 2X4WA 1S6PA 1HNVA 1A5XA 3AO5A 3P5JA 3AA3A 4KHYA 2WACA 2FBVA 3AVHA 3AA2A 4FJXA 5CYQA 2X4XA 1RBTA 3NTKA 4B9MA 2M1HA 2VG6A 4F3OA 5EU7A 1SL2A 3DRPA 4DSKA 2CKKA 3VQEA 4IUTA 2RN2A 4RW6A 1KVBA 1RTHA 3AVJA 4N5SA 3Q1JA 3NGZA 3P1GA 1R0AA 3RWUA 1WNSA 4FXDA 1QE1A 2D0BA 2DFFA 1NOYA 3S3MA 2YHBA 2ITGA 4B9XA 1Z25A 3SZ2A 1S9GA 1T05A 4FJGA 3IG1A 1MHNA 2NUBA 5J26A 4FM1A 2BANA 4DU1A 3L3VA 3KUFA 4W5TA 3LH0A 4DSFA 2RHIA 4FK0A 4E1MA 2ZD1A 3HO1A 2O4GA 3V9WA 3QJ6A 2E4LA 4A4EA 1GOBA 1HQEA 3ZSZA 5FROA 3DRRA 1BCMA 4FU6A 4WE1A 3KLFA 2LTOA 3QNNA 3GOXA 5D3GA 3D45A 1TVRA 2YNFA 4RW4A 4XIUA 4AHCA 3AVAA 4CIGA 4K8ZA 1KCFA 4A4FA 4ZTJA 3RMAA 4F2SA 1HQUA 3OJSA 4YNQA 1T03A 1Y97A 4FZYA 1RI0A 3IRXA 4ZHRA 3OQ5A 4KO0A 1JLCA 1C0TA 4OPJA 3ZEHA 5JS1A 4DTJA 4JS5A 4FLUA 1FK9A 3HPHA 1ZBUA 2HHWA 1VRUA 5DK5A 3U3YA 4O4GA 1RCHA 1VSIA 4NCAA 3LWMA 3LAMA 1TL1A 3V1RA 2ZE2A 2G8VA 3AVLA 4DTMA 3AO3A 1FXXA 3NF7A 4EP5A 4FJMA 5CY4A 5D6XA 4IBNA 5K14A 5J2NA 4M3YA 4OKKA 4DFPA 1WJSA 5HROA 3NNQA 4CJKA 4DSIA 1NKBA 4B8CA 2HVIA 4M3UA 3WNGA 3AVKA 1RBSA 3L2RA 3VA3A 3T1AA 4CCHA 1BISA 2VWJA 3TABA 3DYAA 1TKZA 4CK2A 1RBVA 5CIUA 1SKSA 4K8XA 4RG8A 4EDUA 3OVNA 5C0MA 4KI4A 3PMIA 3DLBA 3RTVA 3HSTB 3AVNA 1RTIA 2GBZA 1JLFA 1C0MA 3TANA 1U49A 4M45A 3RR8A 1BI4A 4CJVA 2OZMA 1JL1A 3V6DA 2IS3A 2YNGA 2M16A 2F8SA 2X35A 4QW2A 5KGWA 1FKPA 4H4OA 1YT3A 3NCIA 4NS5A 3QEWA 1VSFA 4BE2A 2QQSA 3V9UA 4AHVA 3MEWA 1RT1A 1S1TA 4L8RB 1Q9YA 4OLAA 2DFHA 3ZSXA 1X1PA 1JXEA 3SQ2A 1TKDA 2FHDA 3OYHA 2QK9A 3UT1A 3ZCMA 2O4IA 3S9HA 2KFNA 3RMCA 4O55A 5J1EA 2QKBA 1REVA 3NTHA 2JZ2A 1BQNA 1L3TA 3ULDA 5KCHA 4LD0A 3HM9A 3HVRA 2BKDN 4C8LA 5FRNA 2YHAA 3EYZA 1WLJA 3OB9A 3ME9A 3P8DA 2HQEA 1TL3A 1KFDA 1OZ3A 5I3UA 4CESA 4J2AA 1UAXA 2Z1IA 3OYCA 4ID5A 1T8EA 3SJJA 4QQGA 4KREA 3C6UA 4CK1A 3DLMA 1D5AA 4DSJA 3DB4A 1NK8A 2O4XA 3OYJA 4NYFA 1SKRA 2GFUA 3V9ZA 4DSLA 2L89A 1NKEA 4CJUA 3QBYA 4Z4FA 3L42A 1KVCA 4EZ6A 2L3RA 3OA6A 1JLAA 2G8FA 3SV4A 1RTJA 1NK6A 3HT3A 4CJWA 2DIQA 2G3RA 2HHXA 4DQPA 1X9WA 4J2EA 1KLMA 5E41A 2HQXA 2XRIA 5HRNA 4EZ9A 4CJLA 4DFKA 4HCCA 2OYQA 4AH9A 1WSJA 4AHSA 1JKHA 4BE1A 3LZJA 1IKXA 1B92A 3UWNA 4DLEA 4PA1A 5D6YA 3CEYA 3RRGA 2HHUA 4JRQA 4KAZA 1RT4A 1UA1A 4IUQA 3QEVA 1SL1A 3VQ7A 3MXJA 4E89A 3C4SA 3OYAA 3QKJA 2RO0A 3JYTA 2G8WA 4FJNA 3O8VA 3V81A 3M8QA 4CJ4A 4F4KA 3LGFA 5HRSA 3DLGA 3LP0A 4N41A
chains in the Genus database with same CATH superfamily
4HLXA 1SANA 1BCOA 5IT9E 3R4KA 3HIFA 4E19A 5SWMA 3RKYA 5IT9K 3K5LA 2HS5A 3KK1A 2O9SA 3JB9D 2VQCA 4MZMA 4RTZA 5K5RA 3KWIA 2D8HA 4KHNA 1ZREA 3EZWA 4E6KG 2GOXB 1U45A 4B43A 2CW0F 1RRJA 2L8DA 3VUZA 3EFSA 4QS9A 5GMKh 3ERMA 5LJ3g 2X6NA 1HD3A 1N8RO 2MC4A 3CDIA 3TI0A 2HB5A 1D4XA 1Q7YC 2CH0A 5J3BA 2R7UA 2LK2A 2P9UA 1KONA 3TAQA 1I0CA 4MO4A 2V1QA 3META 1W1WE 4KYWA 4I2QA 1K73U 4XMYA 2ZFUA 1WBBA 3JRGA 4I2PA 3MEAA 2M4KA 3G71N 2R5ZB 3CDHA 1K8AO 1NGFA 4B9LA 5JS2A 4NC6A 3A1YA 3T8RA 1AZEA 4XLEA 1SFEA 1XDUA 3I64A 3CLQA 4KHPK 2CQQA 4IXCA 1I5LA 1LV5A 1SHFA 2J06A 1VQLA 3BJ6A 2WTEA 4JKEA 3DPTA 2RJCA 3CJQB 1TUGB 3E3VA 1OQYA 4Z4IA 4AM7A 2W1OA 2E6LA 2ED0A 4BD3A 4CERA 1NM1A 3F2KA 2LG4A 1JXMA 3ATUA 2FQ4A 3FXOA 1YI2T 4CFDA 4S04A 3Q5FA 1OYWA 2NNYA 3BDDA 2L5QA 4JX6A 3QNOA 4FYDA 1JJ6C 1F4KA 2X85A 1QZYA 1IHVA 1MU2A 4KICA 3B6OA 4Z4EA 1KQSM 3K6GA 4ASNA 2ZJRF 4UOBA 4EA4A 2HYFA 4W97A 4CA0A 5L3EA 2KKZA 3BQYA 5AQQA 4M3ZA 2Y0SA 2X1DA 3C18A 3VYTB 2WB1N 3CCEQ 1T8IA 3LYIA 1JJ2M 4F55A 4J9DA 2EQMA 4F7ZA 3H8ZA 5F6FA 3DXJF 2Z1GA 3GUDA 3OYBA 1XMQK 2ATCB 4LD9K 3QYBA 2DT5A 5FKNA 4X34A 2RH2A 1YE9A 1HNIA 3RMBA 2Z2SB 3A2KA 4JK1X 5FDLA 1R59O 2K4BA 4HQEA 2CH5A 2F5VA 1BOBA 4AIAA 2JHJA 4OP0A 4XSXF 3LAJA 1KD1C 1TK0A 3I4MJ 1YITA 2YJFA 4AWXB 1G59A 1OI1A 3FEOA 3CYMA 3SBGA 4U0WA 1VQMT 3O3HA 2UZKA 2F1LA 2YPRA 4L0ZB 4FLYA 2ZPGB 1TW2A 3JAME 3MFKA 2LJ3A 5F1XA 3MEVA 3KLOA 2DMTA 5J2QA 3RNJA 4OMFB 5GANg 3L09A 2E41A 3TAMA 4Q5VA 3HVTA 1RADB 1D9FA 3FZLA 2CFOA 2F5CA 1GLAG 3CCLA 1WGSA 2RD1A 4L5JA 1VOMA 3OYDA 1QPIA 1QSYA 3I0TA 1S8NA 3AVFA 1WSUA 1LWCA 4BRIA 4JS4A 3Q0VA 4ANJA 1LEBA 3H08A 1VQKA 3MP8A 4NL2A 1WBDA 2NVTJ 5JHUA 1FWZA 1MJ9A 3VPZA 1M8VA 1P90A 1FX7A 1WGXA 4JKCA 2GZWA 1K78A 5HBMA 4M75F 5J39A 2FOWA 5GMKm 1CF7B 3QYFA 2K9QA 1VA7A 1T0FC 5EYRA 2OZ6A 2JA7J 4KB0A 3L2VA 3BG9A 2KHOA 3CCMT 4LDXA 1I4K1 3MP1A 4FZZA 1RNHA 2X6SA 1NGHA 4DOZA 2DXUA 3K2AA 4JD2A 1EFNA 1WJQA 2CU7A 3AO4A 3CJ9A 2LKXA 2A3ZA 3JRAA 4HVVA 4DWIA 3H45C 1EQYA 1JGGA 4BGBA 3RPQA 5AQWA 3UPUA 1IO2A 1LWYA 1T3LA 3I56I 9ATCB 5KN8A 5AQYA 1U04A 2M0OA 3V8KA 2VBWA 1WHLA 4CCJA 4HOBA 3AA5X 1MMAA 4AYBA 1RT3A 2W24A 4D9JA 2K40A 3I56N 3JRHA 1POGA 1VQOI 1SPKA 4JKGA 1MKMA 1KU7A 1O1WA 2BVMA 3P8BB 2V9KA 4RAZA 3DTEA 2F2XA 4L9VA 1NJZA 4EHUA 4M75G 1RRSA 3KZBA 2P1JA 1Y39A 2R5AA 1I39A 3F72A 4LNPA 4YOXA 2VUMJ 4BB7A 3C3WA 4NYNA 2GA2A 3O5ZA 3RESA 5F0HA 2LREA 2ZWHA 3PY8A 3SYZA 2D8JA 3SUOA 5ECAA 1UUEA 2V1RA 1ETOA 1KQ1A 3TAGA 1HNWK 3JSOA 1XX5A 3H3VK 3C0CA 1R0CB 1LWEA 2LMDA 3BDUA 5FO5A 3BW1A 2PTKA 1UGRB 1KAZA 1G4DA 4G94A 4PFPA 1N3AA 5GTHC 3JRFA 4Y1CA 2VGMA 5IXFA 4WF2A 4JX4A 1MDMB 3UB5A 1VSJA 5HS9A 3K5OA 3NF6A 2M5WA 1UHMA 1PSEA 1Y57A 2HOSA 5HRRA 5FGMA 2XY6A 2J6OA 5J2PA 3HZJA 3OYKA 2XG8D 4OAYA 2V8KA 2CW8A 2OCCH 1VQPT 3VEVA 3TQNA 3VA0A 4JBAA 4KT6A 4EGYA 1K8AC 5GMKi 3HKSA 1TT5B 5FPMA 4DTRA 2PUKB 1VQ4I 4ZDPA 2DLPA 2FUG2 1DQUA 4M73A 2RM4A 2G7HA 3TOAA 1ASUA 4A69C 5CZ2A 5FU6C 3H5RA 1WYXA 2YHTA 4JLIA 1ILYA 1LWWA 3CBOA 4A2UA 4FETA 1BW5A 1XC3A 2CYYA 1HX1A 4ESRA 1GXPA 1T0JA 1F1ZA 4B22A 2IP2A 3IUCA 4J5YA 2O8CB 2KZGA 5KNLA 4PNOA 2XKOC 2X1CA 4WQ4C 4MEYF 1SVOA 2NOZA 2ITMA 5B1AH 4DYRA 4DEXA 3H9GA 3PO4A 3E5UA 2ICWG 3ALYA 1XUPO 3CD6I 3ZOBA 4BDZA 3I59A 3MJXA 1NJIO 4E0DA 3I55I 1WJBA 5FLXE 3NFAA 4C2UA 3O8HA 2CT4A 3JXUA 2CW7A 4RKUE 3QESA 2OPRA 3CD6N 2GXGA 4CSWA 3BDPA 5F04A 4B1WB 4RM2A 2HVQA 3I55N 3JCMc 2RF2A 4F3QA 2HSTA 1QP2A 2EBIA 3GX4X 1NKUA 2PZSA 4A63B 1VSMA 3CMEN 2RPIA 2MWPA 4BC3A 1FEXA 1UFMA 1PUEE 3NGPA 3NTIA 4C92A 1VQNN 4KGVB 4IDHA 1VQ8Q 3S93A 4C5EA 3G71A 4IPAA 3J80O 3LSIA 4QTRA 3PIOF 1ACMB 2COWA 1BI2A 2F5DA 3QODA 1XSDA 2VQEK 1DPRA 3FSPA 4M72A 4GV6A 3B6CA 2HKOA 3HGYA 3SZGA 5KPZA 4G6TB 2E5QA 4QS8A 5C0YA 1IRZA 3QOEA 3I59B 1MIJA 5JVTA 2HQ5A 5D5XB 2AKLA 2O8DA 1I6HJ 3AVMA 4WWCA 2FF4A 5CE3A 1L5UA 2NVXJ 1R8OB 1C6VA 1LDJA 2E5NA 4JUVA 4E7LA 4E7JA 4U67L 2EPFA 1S72A 3CHWA 4QSHA 4LJZF 4N4GA 4DTUA 1ZYRF 5AZJA 1WSHA 2GQIA 2YS9A 2DM1A 2RJFA 3KZZA 3I8DA 4IEEA 4FJLA 3JRIA 1SMYF 5ILVA 1JT0A 5LJ5g 1WQ2A 3FC3A 1BA1A 1W1FA 1WJDA 1KA8A 3HUGB 5EEAA 3ASMA 3TAEA 4LF8K 3S2WA 3UF4A 4W5NA 1GHCA 3QDFA 4JYKA 3UIQA 3CCET 1ONVA 5HL7L 4FWOA 4JK8A 2F2EA 4BEHB 1YAGA 3ZP5A 2BY1A 3QINA 2QI2A 1UECA 4EVVA 3CUQB 1G6NA 4IHTA 1YN8A 3RVCA 3LPTA 2X4YA 2D1KA 3DLRA 1OV3A 3MX5A 3HTVA 1L3VA 3ZX2A 3LSHA 3S1QJ 4JHDA 3ZT1A 3MECA 3CMYA 1VQ9T 4MHGA 2J6KA 5AZJB 3JTHA 3G4SI 3THWA 3M0TA 2KIMA 4WFAL 2VC8A 3FK6A 2HSEB 1IXSB 4PKIA 2WAEA 2E1ZA 1JLBA 4M3BA 2HKQB 2RK2A 3C1DA 3FXKA 2VT3A 3G4SN 2PZ1A 2HZTA 4WXHA 2L4MA 1C1CA 5IYBJ 2KR3A 1M90U 4YDUA 1U8RA 1UFFA 3VPRA 2MBFA 2AZSA 4JK9A 5F0FA 3LWHA 2A6TA 2DOEA 5CVUA 3F23A 1F43A 3BR0A 5CVJA 2FBKA 4XIDA 2QEXA 4LDVA 1V5FA 3CQ8A 1EXQA 1CXQA 1DLOA 4HW0A 4UV9A 5GJVB 3O3FA 2NS8A 4E1NA 1YWOA 4ELYC 4PL6A 2MC3A 4H0OA 3QUIA 4AQYK 3OH6A 2HNIA 3I71A 3RZOJ 1S7EA 1IV0A 3KP6A 1S6QA 1B1BA 4C8QA 3H1VX 1SFKA 2OAUA 2QQ9A 3VEYA 2LVSA 2ZQBA 4M75B 4PJOF 1KXPA 3THWB 4AMCA 2OA8A 4DTXA 2RMOA 5IY5H 2R7DA 3SEZA 2NUTA 3DLLA 4PUSA 5FFZA 2NRWA 4DTNA 1CXUA 1DIZA 2NLUA 1SSHA 3VDXA 3JCMQ 4KB1A 1ORPA 4A4KA 1MUNA 3RZDJ 2BY3A 1XD7A 2HBPA 1N6AA 1XPXA 4JYAK 5GAEP 2XHBA 4A4HA 4EJOA 2LBFA 3SNNA 1YCSB 3H3ZA 3CCVN 1UCRA 1BHLA 1S5JA 1TTHB 4DS5A 1Z67A 1PU7A 1V29B 1AWOA 3I56A 5GAN8 2GTOA 2CMPA 2QTVA 2KIFA 2V52B 1K73O 5LEKA 1B9FA 5LMUK 2XF7A 1BBYA 1XDSA 3LWFA 5TKYA 3KIOA 1IW7F 4PJOG 3TVTA 2P9LB 1NJIC 4C8QB 4EMHA 5IYCJ 3VYRB 1FKOA 3M0UA 1B7TA 2MH2A 2RC4A 3HFOA 4KRFA 5FPEA 2P5OA 1SL0A 2EV5A 1HKBA 4OLBA 2ZMEA 1OR7C 5A2QO 4UVCA 1IHWA 3FISA 3QIPA 2UUCK 1TWAJ 3E1YA 2Z1JA 3QFUA 4F93B 1YHQQ 1I6XA 4LG0B 1KC8R 1E3OC 4IO9L 4O3MA 4O5BA 3VF2A 2WTUA 2XK0A 1D5YA 2V1DA 2UWMA 3BJOA 2PLYA 1XG1A 1TC3C 1MMGA 5AQTA 2C6YA 3TU4K 2H94A 2D6FA 2F96A 3A8LB 4CF9A 1OU9A 1KEAA 4QAGA 3AHUA 1H9TA 5BR8K 2Y9YA 3CXCM 4C8NA 1XHXA 3QSUA 4CEAA 3TTDA 2E12A 1PSFA 5LMNK 3QETA 4AILC 1JTYA 2LLKA 1ZBHA 1ITGA 4IRGA 2BGGA 4A59A 3MZHA 2ZC2A 4XN0A 1Y07A 1PUFB 3HK2A 3JCMP 1G3YA 1FBQA 1BIBA 3CPWM 4XKWA 5B3SH 4RW8A 3VFZA 3SDBA 2QWWA 2K3XA 3R6NA 2ZKZA 4BRCA 2UUAK 2OPSA 1UG2A 4F7UA 2O9VA 2P5VA 1XQHA 3WODF 2A37A 2DJQA 1OPKA 3VWBA 2KYBA 3DLHA 1U0JA 2BBYA 2HQAA 2DVJA 1O3SA 3ULQB 1MH3A 3K58A 3EY1A 5IHIA 2X4HA 1WI7A 1KFSA 2P9SB 3ISNC 2XB0X 3CI5A 4CF1A 4XTVA 4KTQA 5AZIB 3I55A 4CECA 2ROLA 5SZTA 4IDKA 1TH7A 4FJKA 2P0PA 4A54A 2HQRA 3ZBDA 3IKMA 3UKGA 4XN3A 3FZKA 2Y4YA 3KNTA 2R7XA 2LDUA 2XY8A 4CIEA 5CVRA 5CYVA 3GL1A 3A8HB 2FPEA 3CMEA 2YUPA 4M75D 5DM7L 5J40A 1ZBIA 4A12A 1VQNA 1O3TA 1IBMK 1OKJA 2IEKA 2RHZA 3JREA 1VQ8T 3ML6A 3O6BB 2EQKA 4BRQA 2HHVA 2VXEA 3GBGA 3EKUA 3T0YA 1W5SA 3S1RJ 1OPCA 3MO8A 3IRRA 3TR8A 1G15A 5GAMj 2A69F 4RB1A 4B9UA 2F4IA 5GMKl 1O4XA 3QO3A 3NE6A 1Y0MA 1T7PA 4LUDA 4BC4A 1DJ7B 2FBHA 3KK3A 4H0YB 2FPDA 4BGAA 2JA5J 1H8AC 3DMJA 4ORZA 1D1BA 1J2XA 1S3XA 3DRSA 3I0SA 1JU5C 2OZSA 2EK5A 2UXDK 1HF0A 1B9DA 5JICA 1G3WA 3KP7A 2VC0A 1IG8A 3QFPA 3CCUQ 2BZYA 1XNQK 3P83D 1QZ5A 1YG2A 3PTAA 3CO6C 4C8QD 2BDPA 1KQ2A 4AHRA 4DHYA 2DT7B 1VQ6Q 3ID8A 5L3GA 2K5FA 1OKRA 3QEPA 4QPOA 5D5VB 1Z6TA 1Y1VJ 1SV5A 3H3OB 1AA7A 2A5YB 3FLGA 3U2RA 2CV1A 1RNLA 3BJAA 1YI2I 4FWNA 3WNFA 4DQSA 2VXFA 2B5JA 1KQSS 4MDWA 3O4QA 4GYGA 3R61A 1CQTA 1PNJA 1SD6A 4OMMA 2BUPA 2EWSA 3V7RA 2KPMA 4LG3A 1ON1A 3CWAA 1RUOA 1YI2N 4LY7A 1Y96B 5E8GA 3VS1A 1JJ2S 1BL3A 2MIOA 1KHCA 2GIVA 4H0XB 3RUXA 3NAUA 3GTOJ 3OYNA 4XLFA 3OH9A 2FF3B 4KH0B 1NMNA 2CP0A 2D0NA 3THXB 4HRIA 2OPQA 5M1PA 1H641 4EJZA 3RR7A 1TNSA 1ATRA 3NEUA 3HPGA 2WC9A 3GXOA 2H3GX 4LH4A 3WTVC 3F21A 2DNUA 1BW6A 4G8XA 3KP3A 2Z5UA 2AIRB 1NGCA 1KO9A 4R55A 4M75C 4YFUA 2UV1A 4Z0UA 3O8GA 3OL4A 3SZTA 1N9RA 4DOVA 4RBOA 2STTA 3LCNA 3OW2P 1YFHA 3PL8A 2IA2A 3G4SA 2ECBA 2AT1B 3K5NA 1K6YA 1J54A 1K73C 2IW5A 3I0WA 4DTPA 1JT6A 5IN1A 1S6PA 1OISA 1A5XA 3AO5A 3AA3A 2O0YA 3AT1B 5EY4A 5BPMA 2M8GX 4B1UB 3CCRQ 1YXQA 1VQMI 2C06A 4ISGA 1Z3YA 4EMKA 3KK7A 3AVHA 1P7IA 4EW4A 4XBFA 2XRLA 2V8JA 4XTWA 3DRPA 2CKKA 3HG9A 2MA3A 4PJNA 2JVGA 3W2AA 4N5SA 4C8QC 4FVUA 4HF1A 4FXDA 3GIBA 2D0BA 4H5VA 5J8CA 2DA5A 1NOYA 3S3MA 4HT9A 4KIBA 5L3CA 3D2FB 1S9GA 1T05A 1KC8O 2E5ZA 2DD5A 3K4LA 2Y30A 4XLHA 5FWBA 3REAB 2M0YA 4FM1A 1BU1A 3U1KA 2BANA 2HKXA 1WPYA 2HHHK 2MYSA 3MQ0A 3ZN1A 1E17A 2KMTA 4W5TA 2CSOA 3LH0A 4KA4A 2LJ0A 4IQ4A 3MHXA 2R0QC 2DA7A 2RHIA 4K25A 3I9QA 3M1FA 5CPRB 3CCVA 1KU2A 5DDGA 1E0EA 3VERA 2KYMA 2O4GA 1KIKA 1YBYA 4R56A 2E4LA 3CCMI 2JZYA 4IHVA 2EFOA 4IZ9A 3EGXA 2E88A 3ZSZA 1S29A 1HKQA 3HM5A 2W04A 4FM4B 4A0YA 1QVGM 3W6JB 2DBKA 2OUMA 3KLFA 2LTOA 4JEPA 2DDBA 1OFCX 3KXTA 1RI7A 4OMNA 1Q86R 5D3GA 3D45A 1PP8F 4MZPA 4XRSA 2F7TA 4AHCA 4K8ZA 5GANj 4ZTJA 2JTVA 3K7AJ 1FMVA 1B59A 2X48A 4F2SA 3MZYA 1HQUA 2JSPA 4NB4A 3GTJJ 4A57A 4FZYA 3IRXA 4A3KJ 4BRGA 4ZHRA 1OH7A 1NGGA 2JHNA 3CWTA 4C23A 4KNYA 2FLOA 1V3FA 1FT9A 1P2FA 1UTIA 1TUUA 1ORKA 3JCMd 2RQPA 3ASOH 1K9MR 3LM9A 3GEZA 1YHQT 3TP3A 2XHKA 4LF4K 4FLUA 2OTLI 3HPHA 3EHRA 4GCVA 2KJCA 1ZBUA 1K9AA 2NOHA 1X3UA 2OTLN 2KT1A 2RREA 2ZXJA 5C2DA 4E7SA 2XICA 2HDCA 3AO3A 1HDPA 2LZ6B 3ZL7C 4OKKA 3VTIA 2BGCA 4CJKA 1MJBA 4BRKA 1ATNA 1NKBA 1ZR2A 2PVDB 1QVFA 1BI0A 3WG9A 4M3UA 3WNGA 5GPAA 2RVCA 3QJYA 3IWFA 3QP5A 1VQPI 5DPKA 4GLKA 2JTEA 5IT9Z 4CCHA 5A0DA 2E7WA 4A3DJ 3ZCOA 2VWJA 3T8TA 3DYAA 1SKSA 4RG8A 4EDUA 4MO7A 4E4HA 2E1YA 3OVNA 3WUHA 3NFCA 4B6MA 3PGGA 2M9UA 2EILH 5HDGA 3PMIA 3VYSB 4LFAK 2ZJRL 3DLBA 2EYZA 3AVNA 5DUIA 2WBNA 1HR0K 1WPKA 1M2OA 2OI3A 4FOEA 1JLFA 1C0MA 3TANA 1B34A 1Q95G 4OU0A 2LH9A 4ZGDB 3DQVC 5HNFA 2L3DA 2DQRA 1AWCA 3OSFA 1YQMA 3M3ZA 2FXUA 2F8SA 1XJWB 4QW2A 5KGWA 2JMCA 4S05A 5BS6A 4YOYA 4H4OA 2F5EA 1M90O 3JCMV 3QEWA 4BXUA 1WKMA 3CC4Q 2QQSA 2LQ8A 2ZJ2A 1JTXA 3ESWB 4DV0K 4M4ZA 3CMAN 1ZUKA 2K7AA 4WCIA 3DLLF 3JV3A 5AT1B 5EZHA 3BZ6A 2B9SA 2DFHA 1V55H 4IL6C 1C0WA 2EFNA 1X1PA 1Q82U 2QLZA 3H9NA 4J9FA 3SQ2A 4PJOE 3LL7A 1NPPA 2EGCA 8AT1B 2EZKA 2VN2A 4IXAA 1CKAA 2QK9A 1I1GA 3GTPJ 2ZF5O 4DUZK 3P7NA 2LMJA 4WFNL 1OYYA 1RDWX 3GTGJ 3UA7A 3CETA 4M6XA 1EF4A 1X2QA 1U1TA 3I5SA 1R00A 5EGOA 3E6CC 3LSTA 1BQNA 5C4JJ 2Q36A 5GAN7 4AD9A 5KCHA 3HM9A 2GM4A 2OF7A 1HSTA 1NYFA 3CCUT 2M7AA 3QPHA 3CCJQ 1RZ4A 3RI4A 3EYZA 4A61A 5LRSA 3OB9A 4FE4A 4K11A 5EC7A 2MG4A 1WDXA 2V7FA 5HY6A 1M2VA 2VPRA 2L3QA 4RLQA 4G6QA 1VQ6T 3BG5A 1N77A 4B44A 4DBHA 1OH8A 4CESA 4GO1A 4TV7A 3TQ7P 3TDUC 3OYCA 2ZSHB 1MH4A 5K7HA 2Z3YA 3SJJA 4CC4B 1HW5A 4HNTA 4HX7A 4KREA 4DYCA 3DLMA 3EUHA 2K9NA 5JLFA 1SFOJ 3U8XA 3CP2A 1JKRC 4B24A 3CC2Q 2GFUA 1DPUA 1QZEA 3ISPA 2DTRA 1WUAA 6AT1B 3COAC 3KX2A 3DEEA 2YHYA 3JCMJ 1ETKA 1NGEA 5GAMd 3H1CA 2FSJA 5GAGP 4LUEA 3WE2A 3R6MA 3CCEI 4JP0A 3VS6A 1ZSGA 1YX5A 1OCTC 3TSUA 2XRIA 5HRNA 2K9GA 4HCCA 4PHTX 4AH9A 1JKHA 4KRTA 1Q81O 1Y8QB 3K0LA 2PI0A 4Y7NJ 3HSBA 1QP3A 3C2HA 2DPNA 4E47A 1GLEG 1R4NB 1ETWA 2YU9J 1ZXOA 3RPUA 3JCMe 1BO5O 3PUBA 3J7YP 4CUGA 1JXOA 1UA1A 2HGCA 5LLQA 3F3XA 5BMZA 1SL1A 2EINH 4ZDOA 5EX5A 2V79A 4JI5K 4LOCA 3CCRT 3QKJA 4PKHA 2FD5A 4FJNA 4IHXA 2GOMA 2QSFX 1VZ0A 3V81A 5GPCA 1M1KR 4RTYA 3AY9A 3GTKJ 1FBUA 2R7RA 5HRSA 3LP0A 4RCBA 3JSPA 4N41A 3AL0B 1M3CA 3AO2A 2A6HF 3M4GA 3CJTB 2HOAA 4DU3A 2EVRA 3KEOA 5LJ3d 2DPDA 2COZA 5LJ5j 2RGVA 1X9JA 1MZBA 3I8BA 1R5GA 1RGIA 3ERED 1PRMC 3DI6A 3BQZA 3QYHB 3SFMA 2YLCA 1NLVA 2GWJA 3MEGA 3TSPA 2R4GA 3OYYA 3NF9A 2W25A 1DTTA 2K2VA 5AQSA 1PU8A 2XD0A 1X2KA 3LANA 3CFOA 2DYSH 3QIOA 1OCCH 3IS9A 2OFIA 5FKLA 1WHGA 2FB7A 1ASWA 1UOCA 1QU3A 2O5RA 1NG2A 3R0JA 4E9HA 2OJ2A 4RTTA 1H9GA 4DR3K 1S22A 1C6VX 3K4KA 1DGRM 1ZBXA 1QSSA 2P4WA 5JVGL 4EW0A 1R58A 3FMSA 3NH1A 1QHHD 4IUVA 2FSWA 2QGGA 1M3BA 2YXYA 1HU0A 3LFKA 2KI7A 3L8BA 4CJ5A 5AFUH 2ZM6K 4OKJA 4ZDLA 3OA9A 3M8EA 2HTJA 4HSBA 3P38A 4FL9A 3G0QA 2M1BA 1R6RA 3OBWA 3MKDA 4PGHA 4R0KA 5BRDA 4LDYA 1YVNA 3F73A 4HSTA 4GYIA 1R1VA 4CVNE 2V51B 1MW7A 2LP5A 4M42A 2CUZA 4G7OF 4BVOA 3ATVA 1IDYA 2OX7A 3JSMA 2GWKA 1U9OA 1M90C 2EIMH 3QBXA 1U9NA 3FHNA 4M3GA 4LFBK 2PX9A 3MN2A 1IO6A 1BK2A 2NRAC 1SKWA 4IG0A 3S1NJ 5T7BA 2XAHA 1YTUA 4EVIA 2P5GA 4ZYEA 2OTLA 1C0UA 2M0MA 3ASKA 5DY9A 1YYVA 1RBRA 4Z88A 3AVIA 3M4OJ 4VUBA 4I7HA 3R0AA 2LCLA 4I76A 4N0AA 1RPWA 2L3SA 4BBRJ 4JK7A 1UDLA 1IBLK 2ZB9A 2FYKA 5AFUA 2XUBA 4KJZA 2L2PA 1MV3A 2P4RA 1SUQA 3J80K 1ZTRA 2Y90A 2FBXA 3PUFA 2F2WA 3IAYA 2IS1A 1FW6A 3CPWS 3L3UA 1TUYA 2EHGA 1LE8B 1VYTA 2H6CA 3AG4H 4AT1B 4JZ4A 1MNMC 3S16J 3NHGA 2AHJB 5GANd 4XNFA 1OYIA 5A0LA 4BR5A 3TAFA 1IXRC 2WADA 3FM3A 2O31A 1TAUA 5ERIA 1KQ8A 1M3QA 5GAMe 1F21A 2Y0MA 3KFVA 1ZGJA 4Z02A 1UJ8A 5E1XA 1XOVA 4DG1A 2L0AA 4B1RA 5KN9A 3HJFA 3RTRA 5E8IA 2NOLA 1YQRA 4V2FA 1IREB 2NUZA 3RSNA 1U48A 4DV3K 3AVBA 4NDLA 4OPAA 2DJNA 4JKHA 1NGDA 3FZVA 3CC4T 3FXLA 4KI6A 1E3MA 1I3QJ 4AF1A 3CMAA 3CJAA 2QVOA 4ZZDA 3AVGA 2KDSA 4M74A 1DGWY 4BRAA 2JWKA 1LWFA 4K43A 4CEQA 2FRYA 4H8KA 4EMSA 2BV6A 2RJEA 3SQNA 2AO9A 4C92E 3S14J 4RMNA 1FTZA 3G6EQ 2X51A 2XGXA 4QCLA 2M34A 1OYXA 3CC7Q 2FBYA 4PQUA 4WQ5A 3GO5A 1VQ8I 4PY5A 1Y64A 3I35A 2P9PB 3TWHA 4Y3OA 3WNEA 4XLAA 3EKSA 2KXDA 2FBTA 2FJ1A 1T08B 2KAFA 4QKUA 3M9QA 3VMFB 4BBSJ 4DQ8A 5LJ3e 1Q86U 2Y1IA 2ECCA 5JLHA 3CG7A 3CCJT 2E71A 1P8ZA 3KFWX 3UE5A 2AKKA 1M27C 4FL6A 4XKCA 4OX9K 4DR5K 1I5ZA 1Q18A 3WTYC 3EFOA 1ZELA 3RBBB 4BVPA 2ROTA 2QWLA 1XCBA 4Z4CA 2ZBKA 1VK0A 4HV6A 1TYQB 5KPTA 2LKPA 2GUIA 1IAWA 2A5WA 4FZXC 5EG0A 4RA2A 3H0GJ 1K9MU 3LNQA 1X9SA 4RB2C 4RTUA 4Z6YA 1WWXA 3CC2T 4KV8A 4FCYA 1M9SA 1E7OA 3EGDA 5GANh 3E6DA 2BXYA 4E7HA 1GLCG 3FB9A 2PJRB 1SSFA 2HDDA 3M8JA 4IURA 3AL0C 1AWXA 2V75A 1REPC 1X1DA 1VQLQ 5K1YA 4YOWA 2PYJA 1OMIA 2BE5F 2OTJA 3PQKA 2CP7A 3CM5A 2XDBA 3F8CA 2EKHA 2RNJA 4XK4A 2PJPA 2DL4A 8ATCB 3ELKA 2BE9B 5GMKj 4IOCF 3DAWA 1Y71A 3EYIA 3OOUA 3WU2C 1ZA1B 2V1NA 3EZ5A 2X1EA 1BU6O 3PNVA 1BGXT 1BBZA 2D0CA 5CKBA 2YSQA 3SEMA 2KKOA 2VWBA 2IA1A 4XRMA 4A3LJ 4YIIA 4QWQA 3TSQA 2A7YA 1D1AA 2F69A 3R8EA 2CH6A 3IDHA 1R1UA 4OIQF 3C7JA 4YFXF 4Y92A 4P5NA 1XTDA 4M7XA 2Z1DA 4F9OA 4W5RA 4CCKA 3NDKA 1T33A 3FRNA 3QZ5B 2HXIA 4A2BA 1FJGK 5AQUA 4KGZB 2HHQA 2CZ0B 2XF5A 3KEYA 1HUXA 2CUEA 1RDCA 3HOTA 1Q7YR 2QBYA 1XMAA 3BZCA 3R3LA 1TXQA 2KP6A 2XASA 4BRPA 1OH6A 1B3QA 2IGNA 5BOXA 1S9EA 2DO3A 3FXUA 1BG3A 1RTDA 1BB9A 4BY6B 2JS2A 3PJRA 2GXBA 3M59A 1EBMA 3RRHA 4CF8A 2XGDA 3M7GA 4AG2C 3SYTA 4AIKA 4B3SK 2VJ4A 4GW6A 2G8IA 3VF4A 2LSNA 1ZHIA 5L3BA 5A2QK 2V9PA 2P5KA 3CCQN 2KRSA 3F8BA 4Z89A 1TWFJ 1YW8A 1ZSZB 1WH7A 2CRGA 3ULEA 1VQ5T 1X9MA 5GANe 4QS7A 4B08A 2Y2ZA 4ZNXA 2DJIA 3E9GA 1VIEA 3FLCO 2O2OA 4KUIA 3LWIA 1IN7A 5C12A 4FX4A 3JR9A 3U9GA 3EH2A 4M78A 4FLVA 4C2TA 1TWBA 2ZPFB 4JRPA 3SQ4A 1QSLA 3B73A 4ZN1A 3PLAA 3LP2A 1IKWA 3VQ9A 3GZ5A 1VQ7A 1NTCA 4H0VB 2TCTA 4CZIA 3CCLQ 4CHQA 2FG0A 1GL5A 4RTFD 3HOYJ 1IXDA 3DXMA 1K79A 2QKLB 1YRNA 2HHSA 2H8HA 2NOEA 1BJAA 3K59A 1W36D 2VC1A 1WAJA 4LC9B 1Q82O 1T56A 2GCXA 4EQQA 2NRVA 2M51A 2O8FA 2R5YB 2CP5A 4FT4A 5ELZA 3I53A 1QLYA 3N0UA 1H3ZA 3T19A 3CERA 1IN8A 1LFUP 4CRIA 2PU9B 5KQ8A 4ISEA 4DK9A 4L3QA 5FKKA 5LJ5d 3CPFA 2JT4A 2B6AA 3LDPA 4NCBA 2VXDA 4ENNA 1IUFA 3LQQA 3NRVA 2J4RA 3ZPLA 4NBQA 2HQNA 2LY9A 4DGWB 3Q0UA 1WAFA 3HZ6A 2KHMA 4FM2A 3TKYA 3A01A 5LJVA 3T3FA 1YJNI 1KD1R 2R5MA 1KQSP 2HBMA 5AQHA 4L5EA 3OYLA 4BYYA 3UKUA 1HKGA 3QERA 3M6GA 2F5KA 1JRIA 1YJNN 1V4SA 1JKQC 5JHFA 3J7AY 4HWIA 1JJ2P 2D45A 1YHQI 2QYOA 3H92A 1WN7A 2M0CA 3RSEA 4DR1K 3J7YJ 3HTRA 4LB5A 3IAS2 2E2OA 1CLQA 2YKNA 4J2DA 2HI3A 3VYUB 2XROA 5D6FA 2VWKA 4KDPA 5GIPA 4N47A 1M1EB 4E1JA 4PSWA 2LD5A 1BC8C 5BRFA 1JE8A 4M77A 2EJ9A 1UHFA 2EQRA 3ZYYX 5M3MJ 2E20A 2KRHA 2LR8A 5M1NA 2K5LA 2DAQA 1E3PA 1TK5A 3GFMA 3VQPA 1LPQA 4IUUA 4M7DF 2KTQA 4HPQA 4FWPA 2NLXA 4AHUA 3AFHA 2X9HA 4F7UE 4LF5K 3DF8A 1J59A 1WNLA 1RDBA 4B9SA 1IGQA 2LDMA 3OS0A 3J81O 1M1KU 1HNXK 4J9IA 2E3IA 2D0OA 3DTIA 2KVQG 4IUPA 3V1OA 1ZA2B 4R5PA 4XRFA 3HOUJ 5GAN6 2MGQA 4JRKA 4OB1B 4NQWB 1QCOA 4YPRA 4LGWA 4LB6B 4BRDA 1W36C 4FWMA 1VYVA 3HRUA 4OVLA 2L7FP 1Y7XA 4DR7K 1R9TJ 4JI2K 2O8EA 3F70A 2EGAA 4CF0A 1GV5A 3MN6A 4JKFA 1UB4A 5AQRA 3OYFA 5AQGA 3I0RA 3GTQJ 1LCKA 2GFAA 4BUGA 3G10A 1U5TA 2V6CA 5EF6A 3KTUA 2HCKA 2FSKA 4DB3A 4HXJA 4FVMA 2QWOA 2KRCA 3WVEB 2A5XA 4M7DG 5E17F 2A1SA 1XMKA 2IDOA 4CD3A 5DCMB 3K0SA 1RT7A 1B6AA 1WEGA 1JLGA 2ZFWA 3JCMW 1VRLA 5I9EB 5KI6A 1TWGJ 2AK5A 3L2QA 3LFUA 3LSGA 1X4OA 3G6ET 3TREA 1RT5A 3WXIA 1LOJA 1M8MA 3CC7T 4KN7X 1J9AA 1VSLA 2YKMA 4B47A 1WRJA 1YLFA 1FMKA 2W10A 1SQKA 1WZOA 1KLNA 1P92A 2Z16A 4CK3A 4X64K 2YX6A 2HDAA 1FOXA 2W42A 4OMQA 1IRGA 4P96A 1AWJA 3ZQIA 1HDDC 3WTXC 4RAFA 4QOZB 1NGNA 4X62K 4JI7K 1TTYA 3A5OC 1N8RR 2GX9A 1RRQA 2O8EB 5KYNA 2HF4A 1N39A 3FXQA 4M7AF 4CZKA 1ZUYA 4CCNA 1MNEA 1EX4A 2IVWA 3B6AA 4CEZA 5L3FA 1IRXA 3RKXA 3CCSN 2YUSA 3ROUA 4OIPF 1AZGB 2E64A 1WJAA 2JTMA 2MD5A 5HLFA 3CCUI 1IC8A 3Q7CA 2W82A 3T9NA 2YUOA 2NRRA 5BR9A 2OQRA 1HYZA 4BC5A 1Q9XA 1LDDA 3G71Q 1K8AR 1QQNA 3FZHA 2OJED 4EA5A 1SFXA 1N75A 2UXXA 2A28A 2MMPA 5C25A 3SEQA 4KKOA 1B9MA 2V6EA 4CIFA 3N05A 1TS9A 5GTIC 1VQ6I 2NVYJ 3CCUN 2IAJA 1S1VA 4I9QA 3IH2A 2NOGA 3FZFA 2EA2A 1YX3A 4DS4A 4CJ3A 5F64A 1KG1A 1VQLT 4H0EA 2W85A 2M9HA 4WYBA 2A1RA 1GOCA 1LW2A 4M7AG 1WCMJ 3GE1A 2KNBB 1S72Q 2J5PA 3O1BA 3SXYA 4M6YA 3VRZA 1ZSZC 3VEOA 3SBTA 2P9NA 4DR6K 5LJ5e 2RQWA 1HA8A 4K0KK 2LRDA 3NVMA 1H0MA 4X0GA 3KCCA 1LAWA 3BWGA 4C8MA 4CC3A 3L2UA 5B5EC 4FQGA 4YFNF 2KMUA 1R22A 1U5SA 1Q82C 2KL4A 2XHIA 3OIQA 1FYLA 2D5RA 3FFIA 4M3DA 3A5ZB 4FASD 2YDLA 5FLMJ 2M45A 2LNHB 3V1QA 2JUCA 1H3HA 1JUPA 3DP7A 2GXAA 2DKGA 5DCFA 3M8PA 3HRGA 4W5OA 2B8AA 2RKHA 4JKBA 1DU6A 4CYCB 1T0FA 1B8IA 2RQVA 3CCRI 4CO8A 1KZHA 2XDVA 1ESVA 3LALA 5AQPA 4FJ7A 3A0HC 2EFQA 3GDQA 4C30A 4ELVA 4LK0F 2QSGX 4BE0A 2RQQA 3CCQA 3CCRN 4M77D 5KYWA 2EFIA 1RKTA 3THVA 2O7OA 4U7BA 2G0EA 2BTFA 3ZRGA 3LDLA 3M54A 2I0NA 5DM7R 3EDPA 4HCZA 5GAHJ 5EDNA 2VKHA 5KAIC 1N6QA 1YIJQ 2VKEA 2P81A 2CP2A 1LW0A 2Q0RA 1UAAA 2VODA 4E7IA 4BY9C 2Q8KA 1I1SA 1SZ2A 5M1KA 1T6SA 3T69A 4C0FA 2BW3A 4MFDA 4HDUA 1ETQA 1RAGB 2QEXQ 4PK4A 3QBWA 3EG9A 3CCLT 4CGFA 5KYUA 4EATA 3QPTA 3VS3A 4BHBA 1RAHB 1NGJA 3E1SA 2JWLA 1MUZA 1MDUB 1PKSA 1ZBSA 1WSGA 1B8IB 1RESA 2D4WA 2ME0A 3F22A 1AKHA 1KYWA 3DBLB 1E2XA 2H1KA 4OVAA 4D7NA 4M3TA 1MJAA 2F5TX 1VSHA 4YFKF 4UC4A 2ZPIB 5GAOp 1SEUA 2K2MA 2COMA 1KRPA 4DEYA 2RDPA 4WXDA 2GF7A 3H9JA 1IJWC 2R7QA 5E84A 2PMZA 4RGRA 1Y1WJ 4CZFA 1R0BG 5DMRA 2JG6A 1J3TA 3CJRB 5DM6L 3OMCA 1U2VB 3J7AF 4LITA 2RHYA 1YS7A 4JDSA 2Y4XA 3OOPA 1WLPB 5LJWA 4KHWA 3BCBA 1KQ9A 3PO5A 1HJDA 4AFQC 3OW2S 3DOKA 4ABZA 2QDLA 3LSJA 1C1AA 4I98B 5CCAA 3M3YJ 4ELUA 1N34K 1Q1HA 1U4BA 2ZZDA 3HOZJ 9ANTA 1YJNA 4DV4K 2K3YA 1NWKA 3SAGA 3KBGA 5AONA 4CCLA 2NVQJ 2E2HJ 1HJRA 4LMYA 2IVPA 3KLIA 1YJ9N 2R5ZA 2ETJA 3UKRA 3VU3C 5GAOq 2GNCA 5J2MA 4Z4GA 4RB3C 3DM2A 4DYQA 2RQUA 2XKOA 4HV5A 3U9ZA 4HVJA 3JAMO 4C2MJ 4WQ4A 4KT0E 4HUGA 3ZMVA 4M77C 1MBJA 4YOQA 3AVCA 4OIRF 3DCFA 4CZHA 1WSIA 4RS8A 5I42A 4DSEA 3R60A 3RYPA 3VQQA 5FPDA 2Q0UA 3HOXJ 2LNBA 2YUNA 4RAYA 1VYUA 2QG9B 3IH3A 1FOKA 2WAQN 4ME7A 1GLBG 3L2WA 1YTYA 1IKYA 3WXJA 1FYKA 2AQFA 2WY8Q 2J6FA 2XGEA 4MMKA 4M7DB 3P9IA 1GT0C 5E3MA 2VBYA 4BDPA 2DPPB 3QYGB 1AEYA 1W6XA 1BI1A 3AKZA 2BY2A 1TNTA 4GMJB 2O9LA 1RAAB 2JS0A 1T38A 3EGUA 2HEOA 4H4MA 3SUQA 5I22A 3JCUC 3M4YA 3L6QA 1TOVA 2E6ZA 1M1GA 3FFKB 4L9JA 2CGHA 1HNVA 4F52A 3RQIA 1X6OA 4KIFA 4FOIA 5J8FA 2FBVA 3M9AA 3AA2A 3ZQQA 3UKRB 4FJXA 3ULRB 3FE1A 1R71A 2QUFA 4Y33A 1NBWA 2A40A 1K4TA 1GFDA 2X4XA 1RBTA 5GAOn 5LGTA 3NTKA 5H6RA 3F10A 4JJCA 2VG6A 2ASMA 1U5TC 1SL2A 4I2OA 4DSKA 3M57A 2ZPHB 3GW2A 2JK3A 4KUDK 3AGRA 2VV5A 2MF2A 4A3EJ 2I7PA 2V8IA 1RTHA 3EETA 3AVJA 3G7ZA 2DTHA 2A41A 3P1GA 1WNSA 3E66A 1QE1A 3N4PA 3C12A 5LL6Z 2XSJC 3HXLA 2YHBA 2ITGA 1G3SA 3SZ2A 3E5XA 3WXLA 4YOTA 5H2FC 3IG1A 3PQJA 1RL2A 4IEIA 1DDNA 1BN5A 1RIOH 3BFMA 4HT8A 2ZPBB 2L7MP 4JRIA 3A1PA 3O2PE 4Q47A 1L3LA 4RGUA 1NJIR 3KUFA 1IZ6A 3DKMA 3EG2A 1NYGA 1RR7A 4MNUA 4IHYA 1X6GA 2VVKA 2E8AA 4DSFA 2E34A 3ZMDA 3MKLA 1EZZB 3AARA 5JR3A 2QA4I 3HO1A 5C3EJ 3QJ6A 3V9WA 2M30A 5J4YA 3OW2A 2DETA 2QSHX 4A4EA 1I94K 1HQEA 2DA3A 1ULYA 3LA3A 4FU6A 1Z1DA 1JEGA 1FNNA 1Z7UA 3CCSA 2QA4N 3GPLA 4PJLA 3CMEQ 4K2EA 2K3FA 4JJNK 4M7AB 5JFRA 3QRFF 4BJ6C 3SLCA 1VQNQ 5GMKe 2YNFA 3CCJI 3OSVA 1ZLMA 4FT2A 1OQKA 5BPDA 3G71T 2BHZA 2ZJPF 3I0XA 3CCUA 4YNQA 1T03A 1SG5A 2PMHA 1KD1U 3DXKB 1BJZA 1VQ9Q 2PVOB 2D1HA 3OQ5A 2L9SA 4KO0A 1JLCA 1C0TA 4YG2F 1X75C 1CF7A 3V8JA 1AU7A 2D0QB 4YORA 4OPJA 3ZEHA 2YCHA 3HI0A 4DTJA 5K5QA 3RJPA 1A04A 5HDNA 4XR6A 4C0ZA 1Y0NA 4R1HA 2QM3A 4DV2K 1FK9A 1WXTA 3CC2I 1K7AA 1STZA 5DK5A 5J1UA 1RCHA 2L4AA 1VF9A 1QMCA 4ZGEB 3CF5F 1VHXA 3A8OB 1IBKK 1VIFA 1XTAA 1NM7A 3LWMA 3LAMA 1S72T 3R6OA 3EG3A 3CXCP 1WHKA 3VJPA 4A3JJ 1FXXA 3NF7A 4EP5A 4FJMA 4HF0A 5K14A 1TQMA 4OINF 3OHRA 5HROA 3NNQA 1FIPA 2HBJA 1AWWA 4B23A 4Y4RA 2W4SA 4PKGA 1JKOC 1RBSA 4YY3K 3EUKL 3L2RA 1W2BP 4M7DD 3KVGA 3G3ZA 4RGSA 4IO8A 3CPWP 2FE3A 5F0CA 2L3PA 1RDUA 3QB0A 5FLXO 3CUOA 4ISFA 2FBIA 4B3RK 4X1VA 5CVIA 4YIFA 3TABA 5LHIA 1GUUA 4GGGA 3BTJA 2CDTA 1RI9A 3FMQA 3DU5A 4WF9L 4JI1K 1LMZA 4M7DE 4FX0A 2JVVA 1F5TA 5C0MA 5GAOm 3FZMA 4CZZA 5AQVA 2NRXA 2DA4A 5D7UA 1U78A 1IV6A 3OWTA 2HSPA 2W7NA 1RTIA 2WSCE 1WJEA 2LYCA 2VONA 2GBZA 1XQOA 1U49A 1HQCA 2RV8A 3W6KB 4M45A 5LBQA 3BUZB 2KRFA 4CJVA 2ADUA 3CCRA 2UYTA 2FNAA 1SMTA 2YG8A 2BE7D 3V6DA 2IS3A 2YNGA 5GAN3 2KK4A 4JKAA 2O8BB 1MDMA 3GG4A 1D5VA 2X35A 3H5AA 3F9MA 5CR2A 1H89C 3HDDA 2LNVA 3ZEUB 3HRSA 4EIKA 1N36K 3HKZA 2Z33A 1FJLA 1BUPA 4EFHA 3ZXSA 4AHVA 2K02A 4XTZA 4O5FA 2E60A 1YIJT 4A6EA 1KG4A 3HSFA 4Q5SF 1FBSA 3TO9A 1IB8A 4J9EA 4MTEA 4RTWA 1T0HA 1Q9YA 3VS5A 1ZGWA 4XH4A 1EH8A 3ZSXA 4D5FA 3K70D 3M8FA 1VQON 1JXEA 3O5BA 2HYJA 3VS2A 2QEXT 2R7VA 2PQ8A 5DYMA 1HSQA 1R77A 2YRCA 1D3YA 4CZLA 3PE0A 1TKDA 1LJ9A 3GNGA 5F27A 2ZXWH 2FHDA 3EHQA 3UT1A 1JHFA 3ZCMA 2O8CA 2O4IA 3S9HA 1X3NA 3K4CA 2MI6A 3A5LC 3GF5A 2PVGB 2LX7A 2ZGYA 1N8RU 5CLSA 4MDXA 1OR7A 4FYYB 1J6ZA 2E1MB 2OC6A 1SAZA 2JZ2A 3P31A 2CUJA 2FX0A 4LD0A 2V7ZA 2BKDN 3QOPA 5FRNA 1GVDA 4L5IA 3IFRA 3M1CA 1W4SA 4DZJA 4MQ9F 1LPLA 1WLJA 3JB9F 3K4MA 2R7SA 3HJEA 4M6VA 1ZG5A 4M7AE 1JXSA 4M7DC 3ME9A 2FXAA 1OLTA 4YOVA 2XAGA 3WTUC 3ABKH 2HD0A 5F1JA 5I3UA 4Q48A 4J2AA 2Z1IA 4IVNA 1WH5A 2OD5A 3H35A 1T8EA 4LLGF 2DVEA 3CCVQ 3I54A 1E3HA 1VQ4N 4DSJA 3J80Z 1QQJA 2FMYA 3OYJA 1QCFA 1EH6A 1QBJA 1YJ9A 3I56T 4RTXA 2K9LA 3CCYA 4M9XA 1NZ9A 3LSMA 3J7AO 1K73R 3X26B 2Q1ZB 4Z4FA 4B48A 4U0VA 2AP1A 4B8XA 5HS7A 2GAUA 3C6HA 2L3RA 3HT3A 4CJWA 4B3AA 2DIQA 2JOYA 2QQ8A 4CXFA 5ICGA 2PN6A 2HZDA 3JB9G 2HXOA 3KWGA 2BEOA 3I4NJ 3NMZC 4JJDA 1XCVA 2HHXA 1J5YA 1MGQA 2F4MB 4J2EA 5E41A 3TSZA 4A0ZA 4FYVB 1NE8A 2WAQA 3KLNA 1XG7A 2LX9A 4DFKA 5KHDA 1WSJA 4GV3A 4AHSA 2C0OA 4PL8A 5AJ3K 3THYB 1GBRA 2X3WD 1G3TA 1IKXA 3ZQGA 2Z9OA 5HK3A 3SJMA 5DD4A 3D2EB 3M07A 2FA5A 3NHNA 3DKXA 1PJRA 2VI6A 3CEYA 2FEZA 3K70C 2I10A 1T44A 1JGSA 2HHUA 1ORNA 1PWTA 2NNNA 3X2QH 4HVUA 2MLGA 3KP5A 2K7LA 1LVAA 2YR2A 4IUQA 3IRQA 2D2WA 3QEVA 3D5RC 3MXJA 4E89A 3OYAA 3BY5A 1ZH5A 2XSDC 2ECZA 3CWUA 3HUGA 2G8WA 1KQ0A 2L2OA 3LSRA 3M8QA 1A6QA 5M5WJ 3LGFA 2QYZA 2KDZA 1B4AA 2XAUA 4BEHA 3WVDB 2VJJA 1S1XA 3BOQA 1OU8A 5CK9A 4FTHA 2JMAA 1HRHA 3O1WA 3FHFA 4D6WA 4LDWA 4CD1A 3CUQA 1R36A 1DU0A 3OYIA 2IS2A 4IOCL 3GTLJ 1DTQA 1RETA 3ZFJA 5LGNA 1QQOA 1D1CA 3MXIA 5HLHA 4NL3A 3I33A 3O08A 3CTAA 4BKXA 4RW9A 3PX0A 3EYYA 5K5OA 1X01A 1K83J 1YOVB 4PIIA 2KGTA 3ZT3A 1ZHFA 1R49A 2DFIA 4V19S 1ZG1A 1ZLKA 1Y0UA 3HOSA 4X6AJ 3BEXA 2I2LA 3T1BA 1OZ2A 5AQZA 3H3NO 2JTFA 4DBQA 2Q3SA 2JJ7A 2XV4S 4Z94A 1JBMA 1X58A 1OVQA 5IP7J 5HS8A 3G6EI 1W7PB 3V4GA 4XTYA 5GAN5 2YLBA 4IHWA 4GLMA 3MKWB 4EMGA 3VYHB 4N9IA 1K0XA 2QA4A 2WB1A 3OS5A 1QVGP 2G9WA 1QHGA 1S1UA 5M5YJ 1HBXG 4ITVA 3CMET 4ZC3A 4BAYA 1PKTA 2Q2RA 1F9NA 1Y8RB 4JI3K 2DK3A 1C0FA 2JXBA 3GBTA 1VQNT 3OMGA 4XH1A 1JO8A 1Z21A 5JI6A 4FLWA 1XGOA 4BR9A 1IJJA 3A0IX 2YWWA 4HF2A 2KY9A 4CFBA 1FOWA 2IAIA 4U7DA 2D1VA 2NXNB 4GXOA 1K76A 5IP6A 1CSKA 1TV6A 3MAQA 5LY3A 1IGNA 1LCUA 4F3TA 2A61A 4QQ6A 2MCNA 1Q1VA 3S32A 4IQJA 2JPSA 1WXBA 1QS4A 5E3NA 4UUSB 4M75A 4JZ3A 2HTSA 2EA4A 2HMIA 1M1KC 2JA6J 1JJ8C 4LDUA 1S5LC 2RNGA 1WQWA 4ON0A 3B02A 2HPMA 5B8HA 2F8TA 2VBXA 4DW6A 3HTSB 3LPUA 4N0BA 2YNIA 1WSFA 1D3BB 2JWTA 1SD7A 1OULA 2H6BA 4B9VA 4BHCA 5BN8A 1Z05A 3U4LA 4IHSA 3SFZA 2BH1A 3EQLF 3VF6A 1IF1A 2ZJQF 1VQLI 3ABTA 3W3CA 1BKBA 4CHPA 1K8KB 1EO1A 3MCZA 3G1JA 3SWNB 4BI4A 3MVPA 2DTZA 5KE2A 4RTVA 2CP3A 3FJ5A 1UMQA 3SHWA 5HDKA 4KTWA 1JUMA 4II2A 4OGEA 2HOEA 2W41A 2P9LA 4IKFA 2XB5A 1HPZA 4A6DA 4FLZA 5ICCA 3PT9A 3DTKA 1V4TA 3FGUA 2MK5A 4C0GA 4BRNA 3A03A 1P4XA 3KLEA 4ESBA 1WB9A 3VQAA 3RERA 2VYPA 3DOLA 2E1MC 2DJZA 2O8XA 4NB5A 4I6MB 3PX4A 2AJQA 3KPHA 3RMDA 3JRDA 2E6NA 1X1AA 4LG0A 2H3EB 3RKQA 1UA0A 4X65K 1W4MA 4OIOF 1X3MA 2Y0SN 4EJUA 2VQGA 3U1DA 1QGPA 1ZGAA 3U3GA 2J7IA 3FHZA 3AA4A 1MUDA 4LD6A 3VEXA 2GV9A 2GQQA 1G8XA 5KYXA 3LWLA 3QPSA 4J2BA 2P6TA 1HW1A 3H3UA 3QMLA 3X25B 5EVZA 2KQ2A 4O44A 3H46O 3VQBA 2FF6A 4HCBA 2ELHA 2E5KA 1EWQA 3R6SA 3EE9A 2X74A 4O8KA 2LCCA 3MD2A 1VQOA 1O3RA 2JUFA 1PUFA 2WFBA 5ICFA 4BRFA 2KZVA 4M78E 1GOAA 4A3FJ 1GLFO 2DMPA 4OFHA 2O01E 2X6WA 4CJSA 3KYDB 3A8MB 3DLEA 1W7PD 4KH4A 2PFUA 2CV0A 3LSKA 1GDTA 2DL3A 2MFZA 5AQOA 2DK5A 2LRQA 5CQYA 1NBEB 4EEFG 2A08A 4KFBA 4WFBL 4OPHA 3D0PA 3SDZA 5FD6A 2TDXA 3WU0A 2R7ZJ 3SMPA 4ZGJB 3VSKA 3CCLI 1F36A 1LNWA 3IH7A 3NF8A 2CGLA 2P9SA 3H6EA 3PIPL 2E2IJ 2DRKA 4J9HA 2ETHA 4BY1J 3RCOA 1K61A 3Q3SA 2FC0A 2O03A 3R9PA 2QWRA 4CJRA 4A3IJ 2QTDA 3CCLN 5AZIA 4G9ZA 5KYXB 4DCHA 3KYLA 1J0RA 3NBPA 4U87A 3C65A 4ZYGA 4XQ3A 3J81K 1J53A 4ZTFA 1ZRCA 4M63C 3SAFA 2I5UA 2DK8A 2YG9A 4EM2A 2M02A 1JXBA 5IT3A 3IAM2 1ZC6A 1RR8C 3PX6A 5BQTA 4B3OA 2A3SA 2DFUA 1VQ4A 3DWLE 3LA7A 3CCVT 1WFWA 3M0SA 1YJWQ 1HCRA 4CFAA 4U88A 4H0PA 3AAPA 4BRMA 1W2BM 2BE2A 4PUOA 3E9LA 2HQHA 2KZMA 1USSA 4CJTA 2WA0A 1FSEA 2DILA 4PL7A 5C2FA 4OB3B 4UNFA 4A3MJ 1BC7C 4YELA 2ATQA 3KHYA 4H03B 1ENHA 4XOTA 4RWTA 1WHMA 3PIOA 3E0JB 1QWFA 5AR0A 2JW4A 2QASA 2L9NA 4IG3A 2XO7A 3K4NA 1LUJB 1L0OC 3BPVA 1JLEA 1BI4B 1J9IA 4FJJA 4KITB 5HLGA 4QPQA 1F1BB 2EZHA 3CD6A 3H9QA 2IOCA 1LOTB 2E10A 3L9FA 3LDQA 3HYFA 4H4KC 4E7ZA 1HKCA 1ZQ3P 4LSNA 4CZGA 4PWDA 3ZETB 2P0WA 5BNGA 4PZJA 4RMOA 3HC7A 4B9WA 3FBIB 4YHHK 3S1MJ 4OB0B 1SRMA 3V42A 3V9XA 2VT2A 3TGNA 3PNYA 3QEXA 1D0ZA 3LA2A 3DV8A 3DEUA 1U47A 2HVHA 4O0IA 5EJCA 1UHWA 3CJ1A 3D0SA 4B1XB 3ER0A 2QM1A 4L5GA 2D0PA 4AFUC 1V4RA 2Q2EB 1EWRA 5LD2C 1KGSA 1LNXA 1LKXA 2XAQA 4LSLA 2QF7A 2Q97A 4FM0A 2VPLA 1FOYA 2HHTA 1A35A 2E19A 4LK1F 2RI3A 3CUQC 4I6ZA 1Y96A 1LVKA 2JPBA 3P8HA 3HP6A 3E19A 3SQ0A 1G5VA 2E65A 3KKRA 1B72B 3U21A 3THXA 4HYEA 1YF5L 5FRMA 3E01A 1IH7A 4Y0WA 1I07A 4KBOA 1EV7A 4HVWA 1YTAA 4FWRA 4HNVA 3WEEB 1NG6A 2JJ9A 3VEZA 3O3GA 3DB3A 2JGUA 4ENKA 1UGVA 2XPUA 3INZA 4H5RA 1HLUA 2I8DA 3JCMX 3LGLA 3OJUA 3O9UA 2ABLA 4XH5A 1KAYA 4XLNF 4PLLA 2O4XB 4CEFA 4Z8AA 4RB0A 3A5NC 3FDRA 4FJ8A 4OJRA 4FJHA 2JN0A 1XC9A 1M90R 5C10A 5TRDA 3ZSOA 2XDPA 2P8TA 3A8YA 3CJCA 1Z0XA 3CMAQ 2EZIA 1NGIA 1NJYA 4ZYHA 1FC3A 1UGQB 3DPUA 2NYSA 2OA4A 5HK0A 3VB2A 4ELTA 1WI9A 4EM1A 3SPYA 1ETVA 4DFMA 4L6V5 3AV9A 3AO1A 3VOVA 1RDAA 1V5GA 3X24B 2F48A 2R7YA 3JSCA 3U6FA 3D5LA 4C8OA 1W5CC 5CKHA 2XDDA 1SKUB 3S6IA 3NMUA 3D2FA 2CFXA 3N5NX 4FIBA 4I7FA 4BS9A 2C0IA 5DUKA 2OV7A 5FU6B 4BWJA 4HTUA 3G71I 4PJOA 2IS6A 2DA6A 4BQQA 2K57A 3I3LA 4D8DA 3DU6A 3ENBA 2AXTC 5TISC 4MFBA 1LAVA 4GV9A 1TT0A 2CQXA 2MPXC 4EHTA 4E7KA 5KCOA 3OS1A 2IIMA 4HLYA 2COBA 4J9CA 1OVYA 2FSNA 3MEUA 4E9FA 3OY9A 4Y13A 4F04B 5D6EA 2A0FB 4B21A 4KHQA 4B8AB 1VSEA 2A3LA 1VQMN 3SCXA 1S72I 2RKIA 1W0UA 2Y69H 4QQDA 3ZSWA 4CGDA 3VW4A 3GCMA 1DT9A 2SEMA 5HODA 1UGSB 3OS2A 1VSDA 1S1NA 5IXBA 1S72N 1NGAA 3TOBA 4CGIA 2XY7A 4FW1A 1HLVA 2P84A 4Y17A 4C92F 1RFQA 5GJWB 4CHNA 1E4FT 4BY7J 3CJNA 4PJOB 2P9UB 4J6XA 1RC9A 2DX1A 4OGCA 2D1XA 4HKEA 3W0LA 1FYMA 4D1QA 4RG2A 2H8RA 1G99A 3NQOA 2IT0A 2OTJQ 4KPYA 3CMMA 4DA4A 3BE3A 4AM3A 3SHFA 1Q81R 5F0XA 3TMOA 4JKDA 3GWZA 4MQ3A 3WE3A 2KT0A 3HSEA 4CBWA 2PMUA 2IGIA 3VTHA 3JCMb 2COYA 3VQ6A 2YNHA 2KRNA 1KQSA 1U6ZA 2RA2A 1EP4A 3KP2A 1SD5A 3B6PA 3CCMN 3OGDA 1D0XA 3ZMTA 5TKWA 4NXNK 1X3ZB 1M30A 1WFXA 2VG5A 3TAPA 3H36A 2CUDA 1JJ2A 4WTOB 2DMQA 4Q5WA 5KRTA 4DU4A 2CWEA 4CGGA 4C92G 2M87A 3KE2A 2F9TA 2E1OA 4UB8C 3PNWC 4XLPF 3S6WA 2Z1HA 4BQZA 1MBHA 3T1YK 1YIJI 3JAMK 2R3SA 1YWPA 2DZ9A 4PFZA 2DYBA 4ILJA 1FP1D 2E2JJ 2C0TA 3CFPA 1BDGA 1W9HA 5ILSA 4ILGB 5FW9A 3L7WA 3CJBA 5B1BH 2OFKA 2MW8A 1YIJN 3CF2A 3A2FA 2QEXI 4BR7A 4KFCA 5EXWA 3ZSRA 3PO3J 5E26A 3OIPA 2E70A 3X20B 1QVFM 4B4CA 4DLGA 4ETSA 3S15J 4CGJA 1EETA 4BDYA 3J7AP 5HRPA 3SDGA 2QEXN 1B07A 4XONA 2J05A 3GFLA 4LIUA 5LHGA 3BF3A 5HOOA 2PQWA 1X1CA 5IHNA 4BI8B 1BQMA 3QXEB 1NJWA 4PJ0C 2XRNA 4XKVA 2BIVA 3JCMf 1HNZK 2MD0A 1ZLJA 2YV0X 1NEGA 3K69A 2OQGA 1YJWT 2QK0A 3L4QA 5KAFC 2P0KA 4OPKA 1DUXC 1QW1A 4J83A 1UG0A 1ZRDA 2OPPA 5KQDA 1VQ7Q 3F0CA 3K10A 3M5AA 2BHYA 3BG3A 1VUBA 2FRWA 2YU3A 2QWNA 4IF4A 1RLQC 1BYMA 5KVRA 1VQPN 3WGIA 4A2AA 3K1PA 3HXMA 3OR2C 4KH5A 5BN9A 3W2VA 4CC2A 3G1LA 1MWMA 2BY0A 3E6BA 3V7SA 3F6OA 1KG7A 2QWMA 3SMSA 2A6EF 4ELZC 4I02A 3OYMA 2HMPA 3M0QA 1MBKA 3CESA 5L8RE 4XOPA 4Z4HA 2R58A 3H0HA 4ILHA 4DQRA 4D0PA 5FJ8J 4CEOA 2NOIA 4NCGA 4A93J 4NUBA 1KG3A 1I27A 3G25A 3MCPA 4WK8F 3PVQA 2B86A 5I21A 2F4OB 3KD5E 4I0AA 4Y52J 2L9VA 3F8NA 1WA7A 3PV8A 3SQ1A 2XU8A 2X6OA 2MABA 2CS3A 2K3BA 2EYQA 4C8QF 4F17A 2ZJPL 4BXFA 1XHZA 3N4MA 4QT7A 2VLAA 4PJOD 1DP3A 2OZUA 1YVUA 1K78B 1Z26A 1K4SA 3TBIA 1TLHB 4DMNA 4EGZA 1Z9CA 2JMWA 1MWKA 1Z77A 2VQFK 3FIWA 2OTLT 2DY4A 2WWYA 1CGPA 4LE9A 1ETXA 2DERA 2EYXA 3L4IA 3HFNA 5EEGA 1NKCA 5C24A 5AQXA 2ZGWA 4TSXA 4JD2B 1GCQA 2QXFA 3RIRA 3BPXA 1N8RC 2A68F 5J1RA 1BIUA 2I7NA 4CHZA 2GIZA 3SJHA 5E3LA 3CF5L 2EQJA 2NOBA 3BF1A 2BZXA 4GKKK 2DA1A 3E6MA 2QQAA 2DXBA 4R8HA 2DFEA 2MAMA 3GTMJ 4EM0B 3M0RA 2GWRA 2CQKA 1TU0B 3WG7H 1J7KA 3ZMZA 1WSEA 4QVDA 4YPHA 4FK2A 3LDSA 1W0TA 2VUBA 5K7ZA 2HU9A 5M1OA 5GINA 3JS6A 1GLJO 2P51A 4JV5K 4C3HJ 1KK7A 4E3SA 2EQUA 4YRVA 4C8QG 2WSFE 3QICA 2CZ7B 4JKGB 4GBQA 1OH5A 2L54A 1KFZA 3HP9A 1IZ1A 4ENMA 1A0NB 4H5TA 1V76A 4XU2A 1ZX6A 1QO0D 1QQMA 1UJ0A 1KTQA 2OAZA 1FIAA 3M56A 4X9CA 4C1NI 3MP6A 4MDBA 1O3QA 4NO7A 2E2NA 3BC8A 4XEIA 3VETA 2DEUA 4OOIA 1XSXA 3FHGA 3FMRA 4KBMB 5KTQA 1IN5A 1GXIE 3V4IA 1KC8U 4CZMA 1YI2A 4FLTA 5JVGF 4HCKA 4QLCU 4IRIA 4IIMA 4N56A 3JRZA 1XQSC 1LWVA 5AQKA 3CMAT 4ZZLA 5IOZA 1HSJA 4L59A 5I2SA 4IOAF 5FLXK 2XF6A 4LFCK 5KPRA 3F8MA 2RPNA 2LF7A 3CMEI 3SB2A 3O4NA 5GADP 5C44J 1NK2P 3D1NI 5M9OA 2Y31A 1YQKA 1VQNI 3ECHA 2UUZA 4GKJK 4Y1DA 4KHSA 3FXJA 4PJOC 4XORA 3A5MC 3CCEN 3DKYA 2FVUA 3ZT0A 4NNJA 3G0ZA 2EKOA 3AGKA 3CWSA 2PUOB 5GAMf 3H6ZA 1IV8A 4FPBA 1NK4A 4E2FB 5D5UB 2CGJA 3G1MA 4F7UF 2H3JA 2X6YA 2HR3A 3OYGA 2EB7A 2DQLA 1VQ9I 3E2UA 3SFIA 3TTCA 1Y56A 2ZXHA 2DODA 4AU7A 5J47A 4I9LA 2JPCA 3GP8A 3RKWA 2LKSA 1HKTA 3VQDA 1VQ9N 4WXCA 1D8YA 2EGEA 2VBZA 4IFYA 1PG5B 4B1VA 1VQMA 3WNHA 1M4ZA 3FKIJ 3GYHX 2XAJA 2MH9A 2KLOA 2RI5A 2LOOA 4QVZA 4F8RA 1YW9A 4A5NA 3FWEA 1JKPC 3REOA 4PDKA 4OMLA 4FISA 3S3NA 3LL3A 1QVTA 3VOEA 4RLFA 1OEBA 2WAFA 2VCPA 1T3VA 5FD5A 4BI3A 4J19A 4AFZC 3LQRA 1VSKA 4ID1A 1KSPA 3CIPA 4F7UG 4Z2YA 1QQCA 4UHTA 2CZ6B 4C92B 1VQ5Q 1XI1A 3BDLA 4II1A 4G1QA 2RK1A 3ZSQA 4FWKA 1MV0B 3R1XA 1GFCA 3PMTA 2E6MA 1XGSA 3L0QA 4KHUA 4J00A 2OTJT 5LJ3f 2HYGD 2X4WA 3FKJA 3KEQA 3DKWA 3P5JA 3LSPA 2WACA 1D8KA 4U0YA 3BTCA 1OX9A 4E70A 2DOFA 3UR3C 1PC0A 1ZUUA 2WV1A 3I4PA 1IG7A 3CCMA 1TBXA 4B9MA 2O8DB 2M1HA 5EU7A 2CH4W 3VQEA 1TQPA 3ONQA 2RN2A 1M1FA 3Q1JA 3NGZA 2DRMA 3RWUA 2I5WA 4BC2A 1EJ9A 3VSLA 3AAQA 2DL8A 2UUBK 4G7ZF 4FO0A 4B9XA 1Z25A 2QQBA 3G73A 5CHZA 3FM5A 1MHNA 3C7NA 2HEQA 3IP4B 2DTIA 4IOXA 2M3AA 5J26A 4HAMA 1NG7A 1LE8A 4XQFA 2YUQA 1R1TA 1OJLA 4EPCA 2UXNA 1BR2A 4BUPA 1DKGD 1YIJA 3MWMA 2HPIA 3BCAA 3QWYA 2RB6A 1YQLA 1LFPA 2DBMA 2KRMA 2DMNA 1KG5A 2ZD1A 3PIOL 3CCQQ 5J3LA 2EBPA 3RYRA 3LDOA 1Y6IA 2GUPA 5FROA 4ESFA 3ZQCA 1RUNA 3DRRA 2LY2A 1FZPB 1WQ7A 4OO1J 4WE1A 2RE2A 3QNNA 3MCAB 2PAVA 1V54H 3GOXA 2P6SA 4CC7A 4DV6K 1TVRA 2EIFA 3CXCS 3BR5A 4JHDB 4RW4A 3M55A 4HG2A 5CO7A 1R7JA 4XIUA 3JRBA 1XGMA 2O3FA 4CIGA 3J80E 5I2MA 1KCFA 1N25A 4A4FA 2L02A 1VQ7T 3RMAA 2HF3A 1OCOH 1W2BS 3C7NB 1HOMA 3IHUA 1Y97A 4RCCA 2HKNA 4BRHA