3OYBA

Crystal structure of the prototype foamy virus (pfv) intasome in complex with magnesium and the insti mk2048
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
368
structure length
368
Chain Sequence
LDAELDQLLQGHYIKGYPKQYTYFLEDGKVKVSRPEGVKIIPPQSDRQKIVLQAHNLAHTGREATLLKIANLYWWPNMRKDVVKQLGRCQQCLITNASNKASGPILRPDRPQKPFDKFFIDYIGPLPPSQGYLYVLVVVDGMTGFTWLYPTKAPSTSATVKSLNVLTSIAIPKVIHSDQGAAFTSSTFAEWAKERGIHLEFSTPYHPQSSGKVERKNSDIKRLLTKLLVGRPTKWYDLLPVVQLALNNTYSPVLKYTPHQLLFGIDSNTPFANQDTLDLTREEELSLLQEIRTSLYHPSTPPASSRSWSPVVGQLVQERVARPASLRPRWHKPSTVLKVLNPRTVVILDHLGNNRTVSIDNLKPTSHQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular mechanisms of retroviral integrase inhibition and the evolution of viral resistance.
pubmed doi rcsb
source organism Human spumaretrovirus
molecule tags Recombination,viral protein/dna
molecule keywords PFV integrase
total genus 107
structure length 368
sequence length 368
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2010-09-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
A PF17921 Integrase_H2C2 Integrase zinc binding domain
A PF18103 SH3_11 Retroviral integrase C-terminal SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2300 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3oybA04
1.10.340.70 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Endonuclease III; domain 1 3oybA01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3oybA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3oybA03
3HXMA 4FL6A 2F96A 3K5MA 3FFIA 3QEXA 4FCYA 1ASWA 4MFBA 5HRNA 4FM2A 2G8KA 2RHIA 2X4WA 4CHPA 1BI4B 4CF9A 1SSFA 3S9HA 2Z1HA 3V9WA 3FDRA 4M3YA 4LSNA 3P83D 4QQGA 4CFAA 4B9SA 1EX4A 3DLRA 4DF8A 1S1XA 4HHTA 1KRPA 3OS0A 1TL1A 3QETA 2PZSA 3QLHA 4DQRA 4Y1DA 4L59A 4KB1A 4OPJA 3OYFA 3HL8A 4CJLA 3OYIA 2EX3A 5E41A 1JLGA 1UWBA 2E4LA 3KIOA 3HVRA 4DTUA 1TK0A 4J2DA 2O4GA 1KVBA 4W5QA 4Q0BA 4BD3A 1RBSA 4O44A 1KLNA 3SQ2A 2R58A 4A4EA 2OA8A 4FK2A 2HHSA 1FKOA 4OPKA 4F3TA 4CHNA 3OMGA 1IH7A 3VQEA 4CK1A 4DFPA 3DLGA 2Y1IA 3EZ5A 1KFSA 4UQGA 3UT1A 3MEDA 1SL1A 2R5MA 1S1UA 4G1QA 3RR8A 4HTUA 1BHLA 4CERA 1RT7A 5HRSA 4KHSA 5CZ1A 3OJSA 4DTOA 2VYTA 1QSYA 3M8QA 5EU7A 2E6LA 1HQUA 4CEQA 4RG2A 3JSMA 4HUEA 3OYHA 2JGUA 2HW3A 2HHQA 5D6WA 2BGGA 4DSLA 4I9QA 4GVMA 4AHVA 3SUNA 4FLYA 4AHRA 3OYLA 3OB9A 2KZZA 4FM0A 2HHVA 3L3UA 3MP1A 4MQ3A 1KVAA 4IUTA 4CEAA 3THVA 3SUQA 4EZ6A 1X9MA 4FW1A 2RHUA 4KO0A 4B9XA 3LP1A 2OPPA 3KK1A 2O4XB 5C0MA 4NCGA 2P5OA 2F8SA 4Z4CA 3V81A 3AVHA 3SUPA 4FJ7A 3U6FA 1T03A 1B9FA 2M0OA 4BE1A 4YFUA 5KRTA 1TL3A 4DTMA 1IKYA 4OLAA 1RBVA 2X4XA 3O4QA 2P1JA 3KK2A 4QW2A 4UC4A 2HVHA 1VSEA 2VG6A 3AVKA 4CGJA 3K5LA 4BDPA 3QEVA 2HHTA 3UIQA 4PUOA 1TV6A 4KPYA 2QKKA 3TARA 1NJZA 3RWUA 4CJKA 3E01A 2BIVA 3U3GA 1DTQA 3HYFA 2G8IA 4BWMA 1CLQA 3AV9A 3LZIA 1BGXT 4I2QA 3MXMA 1NKEA 4AHUA 1RBTA 2HVIA 4DTJA 4KFBA 1LWCA 4FLZA 4PY5A 1ZBUA 2HHUA 2X78A 3UWNA 2E5QA 1QHTA 3LH0A 3IS9A 4OGCA 2RJEA 1VSDA 3V4IA 2PYLA 3KD5E 1WJRA 4F2RA 1MHNA 1GOAA 1HMVA 4KV8A 2YNIA 1SKWA 4H8KA 1RCHA 4R5PA 2RHXA 4DMNA 3O3HA 2F8TA 2YNGA 3VQAA 4CGIA 3KK3A 3TR8A 4W5TA 1NJWA 4KHNA 4KHQA 3FC3A 3OQ5A 2QQRA 3OYDA 2LRQA 1Q8IA 2IS3A 3AA5X 2R7YA 2GF7A 3DMJA 2RJDA 4RW6A 3VQ9A 2DFFA 3NH1A 3OYNA 4Z4HA 4H4OA 3QEIA 4J2BA 1TK5A 4E0DA 3ULDA 3M8PA 3BDPA 3V1QA 4CESA 1S6PA 3OMCA 1A5WA 2IOCA 3LDSA 4PA1A 1TVRA 3LPUA 3QNOA 1S9EA 3AA2A 2L8DA 4DLGA 2LTOA 2X6NA 1VSKA 1QTMA 2QKBA 4O5BA 4N4GA 2RO0A 4IKFA 2GFUA 1WNSA 3H6ZA 2HB5A 3AO3A 2Z1GA 5FRMA 1T7PA 4B9NA 2BKDN 4W5NA 1ZBHA 4BE2A 1S1VA 5D6YA 4HUFA 4IUPA 1BCOA 1FXXA 3M9QA 3G10A 4I2PA 4FJLA 4E7KA 3EAEA 4IDKA 1SV5A 4X34A 3O3GA 1BISA 3S6WA 1VSJA 3K58A 3KTQA 2XHBA 4ZTJA 1C0MA 4N4IA 1LAVA 1VSHA 2VWKA 4Q5WA 3AA4A 3D45A 2LVMA 3LP3A 3P5JA 4DSIA 4PLLA 4FJXA 3MEAA 4KI6A 2JTFA 3TAEA 1NJYA 1CXUA 3MECA 4AHTA 1ZBLA 1L3TA 4Z4GA 2JLEA 4IG0A 3SV3A 3VA3A 4L8RB 1N6QA 4CRIA 3P1GA 4YNQA 4DWIA 4N41A 3META 1C1CA 4FYDA 1RI0A 4RG8A 3F73A 4KTZA 3MO8A 3ME9A 4FZXC 2R57A 3ASMA 3NF8A 3VQBA 3OJUA 3LWLA 3KKSA 4DF4A 1I39A 4CFBA 1BL3A 1N27A 2RHYA 3DOLA 4ICLA 2XY8A 4E89A 4DTRA 1Q9YA 3CFRA 2OYQA 1ZBFA 4FJ9A 5J2NA 4C5EA 2A1SA 1KVCA 2D5RA 4LD6A 1UAXA 2BANA 1NK0A 1JL1A 1WSIA 1YVUA 4O0JA 1XC9A 4RW9A 4FJJA 3CM6A 2B5JA 4E1MA 2RF2A 3OYCA 1QQCA 4FW2A 3BGRA 2M16A 4CJUA 2IG0A 3H8ZA 3LX7A 1BI4A 4B8AB 3U3YA 2Q3SA 2RKIA 2DTUA 2HQXA 1TKDA 1YTAA 4KREA 1U49A 3DI6A 2K3XA 3SYZA 4DTPA 5T7BA 1HJRA 3LLRA 4FM1A 3ZT0A 4M41A 4NCBA 2KFZA 2G8UA 2R5AA 3AVFA 2B4JA 2EKOA 2D9TA 3PO5A 1WAFA 1NK9A 1C1AA 3IRXA 1C0TA 2ETJA 2RJFA 1GOCA 4CFDA 1NK6A 3K2PA 1Z25A 3D0PA 2FBYA 4ID5A 3NH2A 3MEUA 3B6OA 4FLXA 3C94A 2OPQA 2XY7A 5JS2A 5I42A 1RNHA 3L8BA 4JLHA 3HP9A 4BWJA 3LZJA 2RHZA 3P8HA 1U48A 4F4KA 1HYVA 2HQEA 3OS2A 4CJPA 3FEOA 1KSPA 4B9WA 3C95A 1NK5A 5KI6A 3NBPA 2GFAA 1DTTA 1X1PA 1SKRA 1D9DA 3SNNA 4CGFA 4Y1CA 1EP4A 5C42A 4AILC 4JRPA 4B9MA 3MXJA 3OY9A 4II1A 1TKTA 3LALA 1JLBA 1LWEA 3LAMA 4LSLA 3ZSQA 4CEFA 4OJRA 1REVA 4CIFA 4DSJA 2GV9A 2LCCA 4FZYA 3AVMA 3KLHA 3TABA 2NLUA 3AVLA 1T8EA 1G5VA 3DRSA 3QIOA 1IG9A 2HMIA 3RR7A 4CEEA 1RT3A 1WLJA 4N47A 1BCMA 3MAQA 3QIPA 1ASUA 4IG3A 1XI1A 3CFPA 2VG5A 2JZ2A 2PQWA 2IC3A 4C8NA 1JLCA 4J2AA 1W9HA 4M3UA 3OVNA 4A4FA 1RT6A 3VQ5A 3PY8A 4CJFA 4CF2A 4CE9A 5IAYA 5SWMA 3K5OA 4IFYA 3QJ6A 5J39A 1LW0A 3K57A 1HRHA 3NF6A 1TAUA 2P51A 2YHBA 3TAGA 3SQ0A 1L3UA 4FXDA 1LAWA 4C8MA 1NK7A 4GY5A 2EQJA 4IUUA 3PMIA 1WN7A 4RW8A 4CEDA 1VK0A 1WSJA 2IDOA 4ELVA 4CIGA 2BDPA 1ASVA 1K6YA 3SD4A 3NFAA 3LPTA 1VRUA 4OVLA 1YTUA 4JS4A 2DIQA 2YV0X 1NOYA 3ZT2A 4QVZA 3HSTB 4IUQA 1EETA 3TAPA 4BACA 2DIGA 4TSXA 3L2WA 5DK5A 2YNHA 3WNEA 2EQMA 4FJGA 3HPGA 5JS1A 1WAJA 3NGYA 4K8ZA 3NHGA 4CEOA 1VSMA 1TAQA 4JS5A 3SUOA 1NK8A 1TKXA 1U4BA 1ZYQA 4DG1A 1SKSA 4M3XA 3PMTA 4M3TA 3S3MA 3FLGA 3Q1JA 4HCZA 4IUVA 1SL2A 4KB0A 4KTQA 4LY7A 4FLTA 2X4YA 3OYKA 2RI3A 4F2SA 4KAZA 4FJ5A 1TK8A 2X35A 1D5AA 3VQDA 4AHSA 4CJTA 4DQIA 3C4SA 3E9GA 5C6SA 3WNHA 2CKKA 3NTKA 4HUGA 2ZQBA 3SI6A 3M8RA 1WJSA 3IG1A 3HM9A 3H08A 3SZ2A 2M1HA 3WNFA 2MWOA 3VQ7A 3QO9A 3WNGA 3ZSVA 4N56A 1RTHA 3OYMA 5HP1A 3TANA 2X74A 4LH4A 3QEWA 3L2UA 5KRSA 4DS4A 4A4HA 4DU1A 4PL6A 1S9GA 4KHWA 2E6MA 4CHYA 2DFHA 5FDLA 1OZ3A 3PUFA 1U45A 1J5OA 3VQQA 4KHYA 4ELUA 2ITGA 3MEWA 4KTWA 3AO5A 4C5HA 3KKRA 3MEGA 5J1EA 4FJ8A 4DLEA 2HNDA 4O4GA 2PYJA 4K8XA 3ZSRA 3VQ4A 1BQNA 4CJ4A 4Q5VA 1U04A 5CYMA 1NJXA 1W0HA 5KE3A 1RT1A 3SCXA 3L2RA 2FBTA 1QE1A 3AVJA 3L2VA 4C5GA 4DSKA 1RILA 4IURA 4PWDA 2G8FA 3AO1A 3PFSA 3ZSXA 2FHDA 5FROA 4NZGA 2VWJA 1L3VA 1TKZA 3RRGA 4DFJA 5J26A 4M3RA 4A4GA 1QS4A 3F70A 3A2FA 2WOMA 3LP0A 3QNNA 3O8VA 3F9KA 4CF8A 3KLIA 2WACA 4CFCA 1ZBIA 3MEEA 4DS5A 4DTXA 4ZTFA 2MWPA 5KCHA 2DFEA 3AA3A 5D6XA 3ALYA 4ID1A 3OYAA 3OYBA 1S1WA 1F21A 3OS1A 4AH9A 5HRPA 4BDZA 4CGGA 3K5NA 3DLMA 3NGIA 1UA1A 1WJQA 4N5SA 1WSGA 3NF9A 3PX6A 2ZE2A 3TAQA 2EHGA 5CY4A 3V9SA 3KD1E 4NYFA 1HYZA 3NTHA 3ZCMA 1IKVA 3QINA 1D8YA 3OYEA 3MP8A 3LYIA 1RBUA 4I9LA 3AO4A 3SJJA 5C24A 1B9DA 1B92A 4B9VA 2W42A 1A5XA 1OZ2A 1C6VA 1HYSA 4PLIA 1IKWA 4E7IA 1JKHA 2IGIA 2QXFA 4NYNA 2LSNA 2LDMA 5SZTA 4KI4A 4M42A 4Z4IA 1N5YA 3EY1A 4E7LA 1LWFA 4EZ9A 4OLBA 4OKJA 5DMRA 1X9WA 3CEYA 3LGFA 3SQ1A 1JLFA 2RI5A 2D0AA 2O4XA 1J54A 3T1AA 3ZT3A 4KHUA 4CHOA 3CFOA 2G3RA 2D0CA 1RT5A 5HRRA 3I0RA 4FU6A 1KCFA 2OPSA 4BE0A 3ZSYA 4CJ3A 3HPHA 4FLVA 4QQDA 2XY5A 4FK4A 5CIUA 1RBRA 3JYTA 3NAEA 2HNYA 3CQ8A 2L3RA 2P0KA 2GBZA 1YT3A 2L89A 4CEBA 4ZHRA 3LP2A 1NK4A 2OZMA 2KZMA 1WGSA 5M9OA 1Y97A 1S6QA 3BDLA 4CK2A 3LGLA 4FLWA 3CYMA 4DSFA 3E9FA 3KUFA 2YRVA 4CJ5A 1XHZA 4HCBA 3I0SA 5J2QA 5IN1A 4E19A 4DU3A 2IAJA 2B6AA 3PV8A 1JXEA 2DY4A 4C8OA 3O3FA 1RDAA 1WSEA 1MU2A 3TWHA 4E7JA 2DAQA 3ITHA 1SL0A 4B9LA 3RMBA 3SV4A 4Z02A 3KLGA 1RDBA 4BDYA 2WONA 4WE1A 3V9UA 3T3FA 3AVAA 2ATQA 1J53A 3AVGA 3V1OA 1BIZA 4CF0A 4DQSA 1Q9XA 2G8HA 3NNQA 1C1BA 4QAGA 3L3VA 2BUDA 3ZT1A 2EFIA 3V9XA 4QOZB 4OVAA 4CK3A 1JLEA 2NUBA 1VSIA 2XK0A 1VRTA 1XHXA 3V6DA 3IAYA 4FZZA 2YKMA 5K14A 1RDDA 4HCCA 2RJCA 3PNWC 2HHXA 3MP6A 2Y1JA 3OYJA 1J9AA 4B08A 4F8RA 4RW4A 1KLMA 2X6SA 2QQSA 4FLUA 4DU4A 2EQUA 3VQPA 4GW6A 1HPZA 3VQ8A 4CJVA 1D9FA 1SUQA 2G8WA 4DFKA 1HNVA 2HNZA 3DLBA 4B9TA 5KTQA 3QBYA 3AVBA 2XDPA 1HQEA 1A5VA 4FK0A 4PQUA 3HT3A 4OKKA 2Z1IA 4Z4FA 2K3YA 3QERA 2PY5A 1R0AA 1WSHA 4N76A 3CG7A 3ZT4A 2KQ2A 4M3ZA 2KTQA 1FKPA 1S5JA 1ITGA 1OYXA 4CJWA 4E3SA 4B9UA 4O0IA 2F5KA 3VQCA 1JXBA 4CECA 3RTVA 2VG7A 2YHAA 2YKNA 3S3OA 2OZSA 4N4HA 1HNIA 1IO2A 3ZSWA 2GUIA 3HP6A 1LW2A 4M45A 1FK9A 4DFMA 3C6UA 3CM5A 3VA0A 1U47A 4CHZA 1LV5A 1KFDA 4FJIA 5J2MA 4NS5A 5FRNA 1CXQA 4FVMA 4QCLA 3ASKA 1L3SA 4M3WA 1DLOA 5KGXA 1H3ZA 1QSLA 4CJEA 1GOBA 4IBNA 4CHQA 5HLFA 2O4IA 1RTDA 4Z4EA 1C0UA 2EQKA 3DRRA 3PO4A 3QIIA 4CIEA 3KJVA 3KLEA 4H4MA 2AJQA 4LH5A 3ZSOA 1O1WA 3QESA 5HBMA 1OI1A 2KW4A 2BE2A 3NTIA 5KH6A 4QQ6A 3V1RA 2A1RA 4DQPA 1UA0A 1XNIA 4B8CA 2P5GA 4GMJB 2XY6A 3DRPA 4CJSA 4HVJA 2HHWA 5HROA 1RT2A 3SPZA 3LANA 4DTSA 3VQ6A 3TAFA 3I8DA 3DM2A 2FBVA 3OYGA 2Z1JA 5CYQA 3V9ZA 2RPIA 2QK9A 3OA6A 4W5OA 1IKXA 5I3UA 3DB3A 3AVCA 3NE6A 4NCAA 1UOCA 2FC0A 3B6PA 4KRFA 5KGWA 1RT4A 3ZSZA 4B3OA 3L42A 3K59A 3RMDA 1CZ9A 4DQQA 1CZBA 4FJNA 4E7HA 1RTIA 4J2EA 3DLEA 1NKBA 1S1TA 2YNFA 1BQMA 2ZD1A 3LWMA 2D0BA 1T05A 2FBXA 5CZ2A 1NKCA 1L5UA 3DLHA 3ISNC 2RI2A 5D3GA 3ZEHA 2OPRA 3EYZA 1WSFA 1NOZA 1VSFA 3RRHA 3QEPA 1KHCA 3DB4A 4EP4A 1EKEA 5KE2A 1QSSA 4FJHA 1I3AA 3C6TA 3NCIA 4I7FA 4DSEA 3NGZA 3AVNA 3AO2A 3DYAA 3L2QA 4IFVA 3SQ4A 3HK2A 4EDUA 2KFNA 3S3NA 3NF7A 3NDKA 3DLKA 4CJQA 4CGDA 4ELTA 3T19A 3LAKA 3G0ZA 3QKJA 3P8DA 4OGEA 3SPYA 3HPOA 3M8SA 4C8KA 4FJMA 1TGOA 4CJRA 3RMCA 1BIUA 4FJKA 1Z26A 1XWLA 3AVIA 4AHCA 1RDCA 3TAMA 3DOKA 3VN5A 4OKEA 5J2PA 3HJFA 4CGHA 4O55A 1RTJA 1VSLA 3O4NA 1JLAA 4JRQA 4W5RA 1EXQA 4CEZA 2RN2A 2XRIA 4LD0A 1G15A 4KKOA 1JL2A 2E6NA 2I5JA 4XIUA 2B8AA 2XO7A 4DTNA 3PX4A 4F3OA 4C5IA 3HO1A 1X9SA 3NH0A 4RW7A 4C8LA 3MEVA 1KTQA 4EP5A 4Z0UA 4CF1A 3PX0A 5KCOA 3TI0A 2G8VA 4CCHA 5C25A 3RMAA 4E1NA 3HVTA 3MXIA 1JLQA 3GOXA 3KLFA
chains in the Genus database with same CATH superfamily
3HXMA 4FL6A 3BR6A 2DL8A 1G59A 3VDXA 4KBOA 4YOQA 3T8TA 2Q97A 4WFBL 2JWLA 2CG4A 3DKMA 3HL8A 4CJLA 3KXTA 3HRTA 3SWNC 3RSEB 1WVRA 1KYWA 2J5OA 2XHKA 2E2JJ 2WAEA 4LGWA 4ZYEA 2STTA 2FLOA 4HTUA 4P9FA 3JSMA 1HQUA 5C0YA 5I2SA 5HDNA 4UNFA 3MP1A 1OPCA 1K83J 1S7OA 1YIJQ 2QA4T 1BBZA 5F0CA 4XLFA 2TRTA 3HKZN 1IG7A 2YPRA 3N4MA 4B3XA 1XDSA 2VB6A 3W3DA 4C0ZA 3I4MJ 1T95A 2X4XA 4M78D 4CGJA 1S72N 3DWLE 1NKEA 1SHFA 3CCVI 2DA4A 4KFBA 3W3CA 4ENJA 2CH4A 2DT7B 2E2NA 4OX9K 5GIOA 2HEQA 1FY7A 3KK3A 2JMAA 1Y8QB 1MW7A 2ASOA 3RYPA 4BJTA 2BE7D 3OYNA 3OW2P 2BTTA 5E84A 5AZIB 3U2RA 4Y28E 3F6OA 3AHUA 3RPUD 2V6CA 1HW5A 2M3AA 2VE9A 2VBYA 4FSXA 3T69A 3BR3A 1HNWK 3VKIA 4M72A 1WJAA 3QXEB 3EAEA 4F7UG 4D0PA 1HLVA 3O3GA 3O5ZA 2KIFA 2DJQA 5CR2A 1XSVA 4YELA 4N9IA 5GAEP 1L3TA 2EZKA 3E3VA 3PNYA 3VJPA 1TQIA 4LFUA 1BU6O 4CFBA 5KAIC 2RREA 2JTEA 3JCMe 4A69C 4HAMA 1OQYA 1JJ8C 1F5TA 2RKIA 3FSPA 1NGGA 4UV9A 4FM1A 2DM1A 1KQSA 1X27A 3I0XA 1C1AA 1YCYA 4L5JA 4CD3A 2DYRH 1PU6A 3C94A 5I42A 4XRSA 2ACJA 1XC3A 1BL0A 1HYVA 3A01B 1RAFB 4UNOA 3OSFA 3QDRB 2IP2A 3SNNA 5KYXB 4Y1CA 1DP7P 1NGHA 4RMOA 3QZ5B 2HBWA 3HTUA 4RGXA 1HKQA 4CI6A 1EJ9A 5FU6C 1WH5A 3WG9A 3AG4H 1T3VA 3C2GA 4XH1A 4IVNA 3CFPA 2VG5A 4J9BA 4MO5A 2VKEA 2L0KA 3DLAA 3H5RA 2VKDA 4CJFA 1NZ9A 3K5OA 3SQ0A 2YS9A 1SAXA 1OOTA 3I56T 4M75B 3C12A 1JJ2S 1JHHA 3MN2A 3HSTB 4CICA 5DK5A 2L2OA 3WXJA 5LJ3f 3FKIJ 3L4QA 2AZVA 2ED0A 3SMSA 3KWGA 3SXYA 3S3MA 3CMEQ 3PL8A 4KTQA 1XNQK 3FXMA 2P7VB 4CCOA 5D5VB 4N0BA 5GP9A 1GUUA 5C6SA 1ORNA 4BROA 3DJCA 4NB4A 3RPUA 3CBOA 3HOSA 1GFDA 3P31A 3CIPA 3WT0A 3OH9A 1LWVA 2MD5A 2MMPA 4UVAA 1Q86O 5H20A 4IOCF 2O3FA 2ECCA 4DU1A 4KHWA 4K25A 3F22A 1W1FA 2BZ8A 1R59O 1U45A 2EIKH 1BB9A 2HBMA 4C5HA 2FZKB 3CF5L 4CJ4A 1NJXA 1RKWA 2FBTA 2E7WA 3FHZA 1E3HA 4HPQA 2HOEA 1LPQA 5A2QZ 1WJBA 3ALYA 3VF4A 4ELUA 4BDZA 4C3HJ 4LLGF 3TAQA 3P7NA 2CQ7A 1QVGA 1VQ5N 1K73C 3LYIA 4Z94A 2E1HA 5C24A 1FPQA 2VJIA 3G25A 3O6WA 3TTFA 2LSNA 4PJ0C 3IMXA 3O3KA 3KVGA 2HAXA 2XAHA 4EA5A 4X66K 2X4JA 3TU5A 4RAGA 5FU7B 3NAEA 4JK9A 2HD0A 5GAOl 1MNMC 1VQMA 1YI2T 3I0SA 3E9OA 2DD5A 3EG1A 4O5FA 1X4OA 4K41A 2JK3A 4PKGA 4XKVA 2KT8A 3K0LA 2FRYA 1CF7A 1X58A 1E6GA 4I01A 4PCQA 3G4SI 5GADP 2YKMA 2RJCA 2YUQA 2DLPA 5IT3A 1RC9A 2G8WA 1HNVA 3OYYA 4LNPA 4C92E 1HYOA 3CC2N 1EH6A 5AQGA 3T9NA 1YOVB 5GMKi 5D4RA 5BN9A 3THYA 4ANJA 3QWXX 4M45A 1W5TA 5FRNA 1FP2A 2F4OB 1KONA 2M4KA 4LDWA 1MGTA 4CXFA 2EYWA 3ZYYX 4BRFA 1H9GA 4GRIA 1MNEA 2GM4A 4HQMA 3RDVA 5GAOq 5I11A 5GAMg 1MJAA 1Z05A 3S6IA 3CO7C 5HCKA 3I55N 3DB3A 1IBLK 1UG0A 5KGWA 4FWSA 3CJAA 4E7HA 3JRBA 1VQ8A 3LWMA 3CXCS 1IV0A 1U6ZA 2WSCE 5KE2A 4PL7A 1AHJB 1UGVA 2Y4XA 3CWSA 3MDQA 2YU9J 4I02A 4EDUA 3WU0A 2YG8A 3HOXJ 1QQNA 3CMEI 4ELTA 2PX9A 1Q81O 2OX7A 4FM4B 1XWLA 3DOKA 4AVZA 2XPVA 1RTJA 2YX6A 4LG0B 1G15A 4KKOA 3KZYA 2I5JA 2K5CA 2R7OA 3JCMh 3TI0A 4Z0UA 2JW4A 4CCHA 3RMAA 3MXIA 2KRSA 4LF6K 3HTSB 3D7EO 1HKTA 1SSFA 1QPIA 3RBBB 3DWLA 3CCUI 1B9NA 1PUEE 4PUOA 2DRKA 4OPJA 3N4PA 2EB7A 5E41A 1V76A 2VUBA 4JKBA 2X51A 2BY0A 3LDLA 3J7AF 4ENKA 2XU8A 3CTAA 1T0FC 3ZQFA 2ZO4A 3PO3J 3E2UA 3W2VA 4CC4B 2JZYA 3OH6A 3OB9A 1YW8A 1M1EB 1NK3P 5DLQE 1PVEA 3I33A 3BOQA 4A57A 1VI0A 2OPPA 1KQJA 1ZG3A 4NNJA 3DKYA 3MHXA 5KRTA 1B72A 4JP0A 4QW2A 3H9QA 1VIFA 3NFCA 1TV6A 4KPYA 5CVIA 2UUCK 3MQ0A 4KN7X 2R5ZB 3LZIA 4AHUA 3J80K 1U78A 3VS2A 4S04A 2HHUA 2CW8A 1HMVA 2M51A 4CGIA 1NJWA 1YS7A 5I21A 2JPBA 3DMJA 1O7LA 3VODA 4FYWB 2C0IA 2IOCA 1TUDA 2HZTA 2DBKA 2LTOA 3K9TA 1YXQA 3W6VA 3CVTA 4O5BA 3H6ZA 4IEIA 2VKNA 1H92A 4LF9K 2M45A 1OX9A 2UU9K 1WQ2A 5FB2A 3C1DA 5JFRA 2ZAEA 3LP3A 5BR8K 2HKOA 3EPZA 3JB9D 1H9TA 3GL1A 4IG0A 4L8RB 1IDZA 3MO8A 4RGSA 4LG0A 3M4YA 4OMOA 3VQBA 2ZMEA 5M1KA 1OQKA 1NJIO 2HL3A 4E89A 1T3LA 4RB0A 4C5EA 3EE9A 1C0WA 5LGTA 4RW9A 4E1MA 2RF2A 4CJUA 2EPFA 2YHTA 3LX7A 3A8OB 3THWA 3X24B 1U49A 3WU1B 2FBKA 3EYYA 2HQHA 2PVGB 1QHAA 2XGXA 3CC7I 2IVPA 1IJJA 2L9NA 3LW5E 1R4NB 2FBYA 4BI8B 5FPDA 1RNHA 3KYDB 1AWOA 4DKWA 1U48A 2JTMA 3ZEUA 2ATCB 3SLCA 1NK5A 4YEJA 2FPEA 5CPRB 4PJMA 8ATCB 4DNCA 1YTYA 5KYXA 4FIBA 4M7AE 1EA3A 1MJBA 1BR2A 2E8AA 3M0RA 3E0JB 1M2OA 3K4KA 3CCVT 3AG1H 3WTVC 4IRGA 2AXTC 1TSFA 2BVLA 2GELA 4A59A 4P55A 1P2FA 4A54A 1G99A 5LGUA 2V79A 4M7AB 3NFAA 2A5WA 5LJ5f 1QMCA 4OVLA 2DN0A 2OAWA 4Y92A 2YV0X 2KHOA 2K4JA 3L2WA 3HPGA 1NK8A 4F04B 3FLGA 4DV1K 1RR8C 4LY7A 1R49A 5AQUA 3SMPA 2MFZA 1KGSA 2ZWHA 3C4SA 2KMUA 3BROA 2M1HA 1BJZA 3OOPA 4UB6C 2BV6A 4E7ZA 4N56A 3NMUA 2HSTA 2UYTA 4A6DA 2PQ8A 2EYXA 4CHYA 1OZ3A 2FSKA 4JEPA 2LQNA 2HF4A 4DLEA 4BRHA 1P4WA 4ISFA 5J3BA 2A5XA 2A61A 3Q0UA 3CC4I 2Q2EA 4JK8A 3AARA 5HRPA 3RRGA 3MK6A 4BR9A 3K5NA 3QMLA 2XICA 3BC8A 1D8YA 3UE5A 3CLQA 1I1SA 2AA4A 5ADXH 3BCBA 4B9VA 1S6LA 2XVCA 2MOXA 3G1OA 1X6BA 3M6GA 3MX2A 3CCYA 4EJTA 4YIFA 3ERMA 4OWRB 3A5NC 4OKJA 3SFMA 3G6EI 1OCTC 4II2A 2BY1A 2DZCA 1YHQN 1U5TB 3KP5A 5EG2A 3D4VA 4HCBA 4KH1B 1MV3A 2QXLA 5CCAA 1YJ9Q 2HS5A 1YCSB 3S1QJ 2EKHA 4ZN1A 4DQSA 2COYA 4EHTA 1NGBA 1N9SA 1JLEA 4EVVA 3WVEB 4B3AA 4FZZA 3QFUA 1T8IA 2QQSA 4HDUA 4OIRF 2F4IA 5LJ3g 1E2XA 1UECA 1ILYA 3L1PA 5C10A 3HT3A 4Z4FA 3CQTA 2XKOC 4KIFA 1SD6A 2XF6A 1X2MA 2XRLA 2F5KA 5TISC 2KLAA 3S3OA 3S16J 4EMHA 4PJOB 2ELHA 4FJIA 3R6MA 2QWWA 3BQYA 3ASKA 1BI1A 2CYZB 4KISA 1V4RA 2ZXWH 1YJ9N 2GA1A 5HBMA 1VQKN 1T6CA 2NYSA 1ZH5A 3ZETB 4U7BA 1K9MO 4M75A 2VQEK 2FEZA 4B6MA 2HTJA 2UUZA 4NCAA 2FC0A 3LCNA 1ONVA 3CD6Q 3VENA 4RM2A 3RMDA 2NOEA 4PJOD 4DQQA 1NKBA 1JEGA 4H5WA 1WCMJ 5LJ3d 3IFRA 3HC7A 5GAHP 3I3LA 1EIFA 1NGAA 4Y7NJ 2PMZN 2P9UA 4ATOA 1Z7UA 3FBIB 4H5NA 2LF8A 1AWJA 1K8KA 3QBWA 2QYZA 5AQFA 2DCEA 1R0CB 2VJ4A 3O4NA 1ZX6A 3HKZA 3N5NX 2RN2A 2B8AA 2M34A 2VXDA 2G7HA 5KCOA 1A31A 2F96A 2QWPA 3QEXA 2HQAA 3G71A 5AJ3K 5HRNA 2WAFA 2O5RA 2P5LC 4DF8A 2IJLA 1D0XA 2V1RA 2PZSA 3QLHA 2BZTA 2Z5UA 2AP1A 4G6DA 5GANh 4W5QA 2X0LA 1I5OB 4O44A 1XOVA 3OMGA 3G71Q 1KZHA 2Y1IA 3DLGA 4FOEA 3CO6C 1BHLA 4CERA 5BMZA 1J0RA 2HHQA 5KYWA 4DSLA 2J4RA 3T7ZA 3HOTA 4FM0A 2RH2A 3L3UA 5C12A 3NVMA 2IBDA 5DCMA 3IUOA 4GKKK 5IT9Z 3CJNA 5AQIA 4YFUA 2Y30A 4XNFA 4F9OA 3VRYA 3GFJA 4JKGB 1WZ2A 2JM9A 2K3PA 1KD1C 1LWYA 4DTJA 4PY5A 1BKBA 4ELYC 1DPRA 3UWNA 1BUPA 1IZ1A 1BJAA 1MV0B 5TGTA 1DU0A 4FO0A 4A0ZA 2P7CB 3HM8A 4OMYA 1X3NA 3OQ5A 2J05A 4AU7A 3VWBA 2IS3A 1V54H 4UVBA 2GF7A 3CCQQ 2YR2A 1S3XA 4J2BA 4B3SK 1XQHA 3LSTA 4LOCA 1OYIA 2DTHA 4I6ZA 1K76A 5GADJ 2L8DA 1VSKA 3L6QA 2D5VA 1GLAG 3I8BA 4XK4A 2CUEA 5FLMJ 1POGA 1QZEA 1SC7A 4ZNXA 3I53A 2BYVE 1VQ9A 4B9NA 5IP9J 2LD5A 2CZ0B 2Q0RA 3EG9B 1R4MB 2JS2A 3WGIA 3QPTA 5GANe 2JTFA 4Z4GA 4BR0A 1BN5A 2VQCA 2HYJA 2KHMA 3HSCA 2K40A 3SZTA 2R57A 2O7OA 3PIPF 3FHFA 2IA0A 3EG2A 1ZSZA 5DV5A 1IGQA 1J2XA 1RADB 2VODA 4EMGA 1RABB 1VQ6T 4OMNA 2HBJA 2FMLA 2HQXA 4J6XA 2QKLB 2PJRA 3OMYA 3HPWA 4A4KA 1TTHB 3WGHA 1K0XA 1TZLA 3GZ6A 3NH2A 2QENA 3U4LA 4BWJA 5FPMA 1VQ7N 1G8XA 1X1PA 3ZEUB 3I56Q 3KEOA 4AILC 3NHNA 4GV6A 1V4TA 2P9KB 1RR7A 2CGPA 2ZFUA 5M1OA 3IUCA 5B1AH 2DA7A 1BU1A 1P90A 2A5YB 2ROTA 5J1UA 4FXDA 5GAOm 2PBIA 5FLXZ 2FE3A 2A28A 3H3NO 4KBMB 5DM6L 3JV3A 1GL5A 2O61A 3S1MJ 2YNHA 2A3ZA 3JAMZ 1WXTA 1QO0D 2QSHX 2CZ7B 3IWFA 1K0SA 2LJ1A 4M3TA 3CCJA 2X4YA 4C92D 2F48A 3CCSA 4DQIA 5D5XB 4XOPA 3F21A 1Z9ZA 2MWOA 5GAGJ 2EWSA 2MGQA 1X6GA 2M9UA 4LIUA 5GPAA 4KRTA 3TDUC 3MEWA 4KTWA 2HNDA 1M90C 3HRGA 3VW4A 1U04A 3A1PA 1CZAN 2OTLT 4C5GA 2K5IA 1S3JA 3AO1A 2L3PA 2HZYA 1ULYA 3F70A 1QCOA 3O8VA 3ZMUA 3H0IA 1M3QA 3FXUA 2O8BB 3OYAA 2DVJA 4CGGA 3THKA 1W5SA 1KQ0A 1IKVA 2RM4A 3JXUA 4C92F 4Z6YA 1Z9CA 5LJ5h 2EH3A 1B9DA 2M02A 4L9NA 3CW7A 3FIWA 4DR7K 4WF2A 2VQGA 1N34K 3HIFA 4OPAA 2VVKA 3GNGA 2ZSHB 1JLFA 2PAVA 2AIRB 1IHVA 3GLXA 1HDDC 4MTDA 2OPSA 3CMEA 2CH5A 2EIFA 5C44J 3FFKB 4AIHA 4HNUA 3F72A 3I35A 4RB2C 2XGCA 4JI1K 3D2EB 2HI3A 3E9FA 1YFHA 3L00A 4G7OF 5DM7L 2OQGA 2IAJA 5BRHA 3CMAT 1M2VB 3SV4A 2CRGA 4AC0A 1RDBA 1YI2A 3ROUA 4XU1A 2JQ7A 2ZF5O 3PT9A 3Q9VA 2VGMA 5GIPA 3BTIA 2KRMA 5K14A 4A2UA 3OYJA 3R6NA 5B66C 3PJRA 4XQ3A 1RI9A 1I27A 4AD9A 4C8QE 1M1KR 4FWLA 1HQEA 2M8EA 4N9HA 4JI4K 1JKQC 2HPMA 2I5WA 2DTIA 4N76A 4M3ZA 1FKPA 3L2CA 3LFKA 2B86A 3TEEA 1S8NA 3VA0A 3H5NA 4HNVA 1BR4A 2MPXC 2QG9B 4QCLA 5JLWA 5KGXA 1ON1A 2ZSIB 1ZLJA 1H3ZA 1GOBA 1VQNN 2GCXA 1C0UA 1GV2A 1O1WA 4HW0A 3H46O 3LDQA 1X3UA 3H9JA 1UA0A 1G4DA 4AMCA 4GMJB 2DA2A 4CJSA 3NVKA 2HDCA 1RT2A 2ECBA 3OIOA 3TAFA 2MI6A 4J9EA 1AHDP 3OYGA 1YITI 4J7FA 1LE8A 3AVCA 1YUWA 3KLOA 4BBSJ 2QLZA 1S1TA 5HL7L 2RAEA 3QUIA 5HOOA 2NVQJ 3FXJA 3CUQB 3MZYA 1VSFA 4W1UA 5AQKA 2ISZA 5FW9A 4IFVA 4E6RA 3HK2A 2WADA 1MSFC 3F8MA 4BRDA 2GXBA 4C8KA 1TGOA 3RMCA 4HG2A 4IX7A 3AVIA 1FMVA 2D0QB 2M1BA 2KBTA 4C92G 4HT8A 1VSLA 2F5VA 5FLVA 1KU9A 2LY2A 4DTNA 4C5IA 3HO1A 1QKXA 1JTXA 2OV7A 3WTZA 3KE2A 4KGZB 3DP7A 3KLFA 2LKSA 3PTAA 3CJ9A 5IT9O 3PNTA 1V29B 2JRMA 2KLOA 4AM3A 2V7FA 3M0SA 1PDNC 2NOIA 1NM7A 1RKTA 2HHSA 4FK2A 1H88C 3CCST 4BVPA 4LN2A 1M1GA 3W2AA 1XQPA 3H5AA 4G1QA 3CPFA 1TYQB 2RN8A 4DBHA 3OJSA 3ABKH 4BS9A 2VYTA 2JGUA 1W70A 2KXDA 3QPLA 3O5BA 1C0FA 4IZ9A 2RHUA 4KO0A 1VQKQ 3EEQA 1WHLA 1T03A 4Y52J 3ZQ7A 1XD7A 3FDYA 5D8KB 4LF5K 2GTDA 1VQ7I 1OX8A 1G6NA 1WQ7A 4J01A 2FNPA 1BI2A 4MMKA 2HQNA 2JVGA 3MXMA 4XM3A 2D8HA 3EKSA 4S0HB 1VSDA 3H9NA 1RCHA 2RHXA 3QSUA 2F8TA 2DODA 3VQAA 1SAUA 1X2NA 2CGLA 4K0KK 3JTHA 2E19A 1FYNA 2DFFA 4EIAA 1TK5A 1W2BM 4M7YA 4CESA 2P9IB 3LOCA 1S7EA 4PGGA 3CCLN 2FZCB 4FT2A 4NO7A 2IT0A 2UWMA 4M75F 4IO8A 4CI0C 1VQ8T 1S72I 2BKDN 4B21A 3ZX0A 2FF6A 2XF5A 3Q9SA 4CBUA 2ITMA 3QYGB 4HSBA 1S5LC 1ZA2B 2NRVA 1WHHA 3UA6A 1SF9A 3JB9F 5LJ5e 3C0BA 1ARKA 2CGJA 2DJZA 2W03A 4XU3A 4BQQA 2XIDA 5GMKe 1B3QA 1NGEA 2D8JA 1KO9A 3U3YA 2M16A 4B8AB 4MLEA 1TKDA 1M90O 2K3XA 3CC4T 2FQ4A 1VQ4I 2EZLA 1NK9A 5AIPA 3KETA 4XTUA 4Q5SF 5FO5A 1U2VA 1NK6A 3CCLQ 4K43A 5FLXO 3I5SA 5JVHL 4ID5A 3MEUA 3J81E 1K8AU 3CI5A 3KYCB 2UXDK 4H0EA 4Q48A 5HLHA 1D1BA 3X20B 2A37A 3VTHA 3ZMDA 1EP4A 4JZ4A 3V8KA 4CIFA 2W25A 2NUTA 3ZCOA 3AVMA 1P4XA 2L0AA 1OPKA 3N05A 4CEEA 4HVWA 4BC4A 4F92B 1HUXA 2M30A 1YQKA 1D4XA 2E1ZA 4C9YA 1YQRA 3OVNA 3VTIA 3PY8A 3TKYA 1PG5B 5GAOr 5IAYA 2LMDA 5BS6A 1HRHA 2YHBA 2LNHB 4F52A 1JCFA 1SANA 1IJWC 3MPUB 2XV4S 3QP5A 3EYIA 4E9FA 3CPWM 2DIGA 4AIDA 3DXKB 1X75C 2O88A 2D2WA 3SUOA 1W4SA 3PMTA 4OO1J 3SEQA 5GAHJ 2WV1A 3TTDA 4KULA 2RI3A 5GAMe 2LNBA 2KK4A 1AVZC 3E9GA 3W6JB 2X6WA 5F1XA 3HM9A 1W2BS 5K7FA 5HK0A 1MD0A 3BUZB 4ESRA 1ZUUA 3TANA 3PFIA 4LFCK 3VYRB 1J3TA 1TNSA 5IHKA 1NPRA 3H92A 1RT1A 1IUFA 3L2VA 1T6SA 3PFSA 1M5Q1 1Z77A 1VQNQ 2X6YA 4RTVA 4ETSA 3LA2A 1ETOA 2IIRA 1N8RU 1ZBIA 4DTXA 4ZTFA 5BQTA 3AA3A 1S1WA 3OS1A 3FGUA 3V8LA 3X26B 1XJWB 4YFXF 2E3HA 5B8HA 5CY4A 2EWNA 3RIRA 2YJFA 1G2HA 3CJBA 3PFYA 2L54A 3VS4A 1RBUA 2DFUA 2GQQA 4L5GA 2DL7A 1BI0A 2W42A 3R0AA 4NYNA 2F1LA 3CBMA 1UFFA 3GTOJ 3HRSA 2P8TA 2WV0A 5AT1B 5HRRA 4CJ3A 1R9TJ 4QQDA 4FK4A 2BW3B 3JYTA 1P6RA 3A02A 4HA8A 3BY5A 2QDYB 1NK4A 1SAZA 2Y31A 1UHCA 4BGDA 1B1BA 4BBRJ 1WSEA 1KQSP 2DVEA 3RMBA 2DPNA 1L0OC 1M2VA 3KX2A 1J53A 3VETA 2Y9ZA 1S72A 1DQUA 2EFIA 2P0WA 1XHXA 2HHXA 4GY2B 4C2MJ 4IL6C 4U0YA 3K2ZA 3O8MA 1WGXA 2M7BA 1VQ5T 4CZHA 3GTMJ 2EINH 4BY7J 2NRHA 5GAMh 2HNZA 5KTQA 2PU9B 5GANf 1NU0A 3GZ5A 4L3QA 3O1BA 4M73A 3PUBA 3EZWA 3A03A 4B9UA 5K5OA 1VQ8I 3I56I 5A0DA 4GNIA 3C6UA 2HCKA 2AZSA 3HI0A 3FF5A 3DRRA 5LMNK 4JLGA 3J7YJ 4MHGA 1M90U 4MLHA 3O9SA 4D9JA 3S2DJ 3ELKA 2HHWA 3CDHA 3NRVA 2GTOA 2JN6A 2O9SA 2L9SA 2KDSA 1PP7U 5C15A 2XPUA 1WHGA 3NE6A 2DBBA 5H2FC 4RDUA 5EG0B 1CZBA 1RTIA 3R0JA 2EGAA 3RDIA 3IL2A 5CZ2A 1L5UA 4KJZA 1TLHB 3NGZA 3MKZA 3Q5FA 1M8VA 4GDFA 3NF7A 1ON2A 4LK0F 3LAKA 4KICA 1IO6A 2HTSA 3VOEA 5J3LA 3VF2A 4WXHA 4CJRA 1LWWA 2ASMA 4CGHA 1NBWA 3PLAA 4ZGEB 2W40A 4OFHA 4IOAF 5ILSA 3CQZJ 3RYRA 2W41A 3CMAI 3EG3A 1B07A 1ACIA 1MMDA 3FFIA 3SEZA 4ESJA 4FCYA 2CZ6B 2RHIA 3SYTA 4H0YB 4ME7A 4LSNA 1T0JA 1TL1A 3ULEB 4WQ5A 1ZBXA 3MJXA 4LDXA 1ODDA 2F9WA 3KIOA 1HSTA 1HXDA 2XPWA 1VUBA 2FZGB 1P9QC 2O4GA 3K10A 3E6CC 5DY9A 4EJYA 5LY3A 1I07A 3TDZC 2K9LA 2DXCA 4NLBA 3MKDA 3C2HA 4IXAA 2A68F 1BIAA 4KHSA 2DBMA 1M1KU 4PJJA 4FASD 4BI3A 1NPPA 3T0YA 3ID6A 3LSIA 4NHJA 5KPZA 1QHHD 1T44A 1ZKGA 4GO1A 1IN7A 3TPQA 1SQKA 1QPMA 3TCJA 3ZOBA 1F9NA 1WQWA 4BI4A 2X1DA 4KUMA 4NCGA 2VWBA 3SUPA 4FJ7A 4LXCA 4CZIA 5LJVA 3G6EN 2NVUB 2NOGA 3UIQA 1FW6A 2WTUA 1VA7A 3E01A 3CJQB 3HYFA 1JQQA 1Z7LA 3DEEA 4O5VA 2OTLA 2K9QA 1RFQA 1YBYA 1VQLN 3BG5A 3G4ST 4B48A 1Y39A 4ZYDA 5LRRA 3HTVA 3NH1A 3QEIA 4NXMK 2OPTA 4NL2A 3BDPA 2FF4A 2A05A 3GCMA 4DV3K 4CH7A 3O4WA 2VXZA 3BPVA 5FRMA 3HZ6A 2KPMA 3EUKL 4RB1A 1ZHIA 3Q7BA 3KTQA 3F9MA 4WWCA 1FTTA 1X4PA 2NLXA 2YT6A 4LB5A 3G1JA 3SV3A 2R5YB 2QWNA 1DU6A 1GCQC 4N41A 2W10A 1TP4A 1GXPA 2YSRA 4BHPA 1N27A 3EN9A 2MYSA 1YJWA 4LD9K 1FYKA 3OYCA 2IG0A 1QVGM 1YTAA 4KREA 4OFAA 3DI6A 5T7BA 4AFUC 2G8UA 4M9XA 1YQLA 3CF5F 1PC0A 2ZGZA 2KKZA 3WODF 3TU4K 1QGPA 2OPQA 2D1VA 3HP9A 5JVGF 5EOYA 2RVCA 2H94A 5F04A 3D6RA 1OVQA 3NBPA 3HG9A 3FJPA 4NOYA 5C42A 1YO5C 2J6OA 1X9MA 4CEFA 1D8JA 2DU9A 5GMKm 4MTEA 3V7SA 1R36A 2AO9A 1FBUA 3GBQA 3SEMA 2QI2A 3MAQA 5ICEA 3G4SQ 1AOYA 5DTDA 5AQYA 3A8YA 1QWEA 3VQ5A 4CA0A 5IPAA 2DXIA 1QU3A 5EXWA 1STZA 3SK3A 5KVRA 1U8RA 1MMSA 1R5ID 5EGOB 4NDLA 5I22A 4I76A 3BG7A 4IO9F 3CCJT 2NVTJ 3M3YJ 4HX7A 1ZLMA 1LEBA 4B24A 3NHGA 5AZJB 4X0GA 1YQAA 1JXSA 4LLNA 3WUHA 2JA2A 5E26A 3H0DA 4MLOA 3HRUA 4OF1A 1RTHA 3OYMA 5JR3A 4BY9C 1MH3A 4C8QF 3U1KA 3CCRI 5E17F 1AZEA 2PYJA 1BQNA 3IP4B 5J26A 4IO9L 2WC9A 5AQSA 2DPUA 3K6GA 4ZDLA 2LMJA 1TXQA 1WSGA 4RKUE 4IHWA 4HNTA 5CKDA 1MBFA 2E41A 1OH5A 5BREA 4D1QA 4I98B 2IVOA 2W6KA 4PFOA 4PHTX 4AI5A 4NQWB 2K4BA 2IGIA 2QXFA 3M1EA 3VUBA 4KI4A 3EY1A 3LSGA 3DF8A 3F6VA 3KPHA 1TWCJ 4JLIA 3CEYA 5E8IA 3HDDA 2NVYJ 3J81O 1NMNA 1MJ9A 4EMKB 3CXCP 4M6YA 2HVSA 2ESHA 2HNYA 3SDGA 5DCFA 1Y8RB 1Y97A 5HS8A 5BRDA 2QQAA 4DSFA 3CYMA 3C7NB 2DTZA 5J2QA 5IN1A 1V55H 3FXOA 3A1YA 2DY4A 2NRTA 3LWHA 1GCPA 4O8UA 3ZFJA 4C3JJ 2ATQA 4A53A 1KG4A 5KN8A 4QOZB 2OAZA 4N4NB 3TP3A 4KYWA 3K0SA 1KC8R 1RDDA 1SVLA 1HNXK 4EGYA 5B3SH 2YHWA 3QBXA 3CCEI 2H1KA 2X6SA 4FLUA 4DU4A 1K9MC 3ENOA 3CP8A 4CJVA 2MLGA 4DFKA 3AVBA 1SFUA 2DAOA 2HYFA 1R0AA 2V51B 1N8RR 2XD0A 1NWKA 5GJWB 4CJWA 2IVMA 2WFBA 3S2HJ 1MDMB 1DGRM 3S2WA 4CHZA 3K9JA 4KH6A 5GPCA 1AT1B 3ONQA 1T6DA 2K57A 4CJEA 3S17J 4CHQA 2KY9A 1MIJA 4LH5A 4XN3A 2CFOA 3RMQA 1OI1A 4A0YA 4F55A 1LKXA 4JK1X 1D0ZA 3DBLB 3A8GB 2FBVA 1N78A 3EGDB 5JVTA 1K78B 2DK8A 5AQMA 1ATRA 4DJAA 1YNZA 4A3FJ 1PUFA 5GAEJ 3GIBA 2R7FA 4KGVB 2FB7A 2QA4A 4CD1A 3G6EA 1UGPB 4G7ZF 1JGGA 4WX9A 2O9LA 3FZMA 1GLBG 2HBKA 4BREA 1WIEA 4CJQA 3FE1A 3T19A 2GNCA 4OGEA 2QTDA 5DDGA 3ASNH 2C0OA 3FIFA 3OTOK 3WHCA 1J59A 4QVCA 3R9PA 1VQON 1IGUA 1YIJN 5IT9K 3NH0A 2CW7A 4DIQA 3MEVA 5HNFA 1RI7A 1VIEA 4EA4A 5E1ZB 3CVSA 2GQIA 4HHTA 3QETA 1WI7A 4Y33A 2JN0A 1M9SA 1TT0A 3PIOL 1VQMQ 4BD3A 4BU2A 2WBNA 1ZTRA 1VQ9N 5GAMj 1KFSA 2R5MA 1S1UA 4JYKA 2JWKA 5EU7A 3OYHA 4AHRA 2DZ9A 3DEWA 4Z89A 5M1FA 3S41A 4Y0WA 3D5SC 4EZ6A 1FTZA 2E6ZA 1I1GA 4RUGA 3QYFA 4NBQA 3JRDA 3Q3SA 1B9FA 1ZHFA 4BE1A 3LDOA 3RVCA 2KJCA 2ZXJA 3E1SA 2QKMB 3PGGA 3F8NA 3UKRA 1WHJA 5E18F 4PJOC 2PEXA 3J81K 3AV9A 3OGDA 3QO3A 2BXZA 4XTWA 3LH0A 3IS9A 3RJPA 1MHNA 1KK7A 2H27A 5TRDA 2LRQA 2ECZA 3SJJA 4RW6A 2I0NA 4E0DA 4YOUA 2F2VA 3OMCA 2KDOA 4IEEA 1S9EA 3AT1B 3MCZA 4N4GA 2RO0A 2IIMA 2BY2A 2O31A 5GJVB 1HW1A 3M5AA 1S1VA 2PMZA 2F2WA 1QP3A 2R4GA 2KT1A 2V8IA 2QQ9A 1WBDA 4EJVA 5IHIA 3JTGA 4IOCL 2CS3A 2WAQN 2FBIA 1YRNB 3VOVA 1T38A 4A3JJ 3HSRA 3NF8A 5ELZA 3OJUA 3KKSA 4DF4A 3C6AA 4IIMA 1IW7F 3PE0A 4GVEA 3D2EA 5J2NA 5LEJA 4O8KA 2COWA 4IRIA 3BGRA 5KPRA 2E2IJ 4XRMA 3S14J 1ATNA 4BKXA 1Q18A 2P9SB 1HJRA 3BDUA 4E9GA 2R7DA 2KMTA 5AFUA 1O3SA 3GTQJ 2OAUA 4LIVA 3QPSA 3DTKA 3U9GA 4CJPA 5KI6A 4X62K 2E2OA 3BG9A 1Q82U 4KH0B 1JLBA 4HOBA 4FZYA 4E1JA 2EZHA 4EPCA 1G5VA 3UKGA 4WFAL 3WEEB 4GFBA 4Z88A 3FK7A 4JNEA 4JAXA 4BVOA 4BRKA 1PVSA 2W24A 2ZZDA 4IFYA 1N8RO 1TAUA 1E0EA 4C8MA 4C92A 5AQVA 2LX9A 3SD4A 4ILGB 5GINA 2EV6A 1MUYA 1N39A 4QVZA 4IUQA 2Q36A 3M0QA 3WNEA 4FJGA 4Y4RA 5AQXA 4KUIA 2LKXA 5AN4A 3ZMVA 1WXBA 2L5QA 1P8ZA 3WTTC 1RLPC 4FLTA 5D5WB 2DDBA 2JT4A 4F16A 1PWTA 3WNFA 3D5LA 4CZJA 3WHBA 3HEFA 3IDHA 3I56A 5FPEA 5IYDJ 1VQPI 2STWA 1OH8A 2R7UA 1Y96A 4DSKA 3OV8A 3JRAA 4IHSA 4RGUA 4DFJA 2LP5A 4M3RA 1QS4A 4AM6A 1YYVA 1NGNA 3LP0A 2K2MA 2VBZA 3JRGA 4ID1A 1YF5L 2R7SA 3OYBA 4B8XA 2CH0A 3F2KA 2EHGA 2JTVA 5LJ3j 3QINA 4YIIA 5ICFA 1HSQA 1UJ0A 4PFPA 3IKMA 1B92A 1RAGB 3WXIA 2V9KA 1HYSA 3QQAA 1JKHA 2DMUA 3HXLA 2MW8A 5F1RA 2K6DA 4E2FB 4LJZF 2E5ZA 4XR6A 4OLBA 4K8XA 2ZGWA 4X65K 1N6AA 3P4IA 2JWTA 4RAZA 4GLKA 1WZOA 4KT0E 2VJ5A 1MBEA 2CQXA 4E19A 4OIQF 2YDLA 1PJRA 1RDAA 2NOFA 1CF7B 5IY5H 1R71A 3V1OA 2VQFK 2G8HA 1YJ9T 3SAFA 4QAGA 3GP8A 3HFOA 2BUDA 2NUBA 4QSHA 5LJWA 4M7DD 3ZQGA 1EH7A 3E9PA 2ZFWA 1FIAA 5AONA 2M0YA 3FXQA 3CCUA 1HPZA 2DXUA 4B9TA 3EKUA 2Z1IA 2RQTA 4CYDA 2KTQA 1JO8A 4MZTA 4B4CA 3O08A 4ZYAA 3ECHA 3MMVA 1MUDA 3HBLA 3ZSWA 3HSEA 2RQRA 2GUIA 3HP6A 2A69F 2BHYA 3C65A 4DFMA 1RPWA 2OTLN 3HUGB 3CJ7A 2AHQA 4IBNA 5IYBJ 1MMAA 3AKZA 4CIEA 2E4HA 3G4SA 3D0SA 3K1NA 1YS6A 1MUZA 4KMUX 4DEXA 4DV5K 2EYQA 4HLXA 2VV5A 1UHMA 1MBGA 3A5ZB 3IH4A 3VMFB 4IF4A 5LJ5d 5B5EC 2P0QA 3DLEA 2V1DA 3H1QA 2ZPBB 2ZD1A 4PGHA 2CP5A 3FWEA 1F36A 1GVDA 1XN7A 3ZEHA 3ISNC 3W2WA 3ZN0A 4I7FA 4M74A 1KQ9A 3WE3A 3J80Z 4G7HF 3S3NA 3NDKA 5DM7F 4U0VA 3ZMTA 3RNJA 1K9MU 1Z26A 1WUAA 2FYKA 3WTWC 2XAGA 3VN5A 3HJFA 4JX6A 2V52B 2CP6A 2DJIA 2FU4A 4A93J 1OKJA 4PJOF 2RKHA 4P96A 2WAQA 1N3CA 2KROA 3BWGA 4YFKF 5JMVA 3PX0A 2HZDA 4BHCA 2NS7A 2JJ7A 5M3MJ 1UZCA 1UB4A 3P83D 4C1NI 3AFHA 2PNIA 2PVDB 3JCMP 4D8KA 1H641 4OMFB 1TU0B 9ATCB 3WXKA 4DV4K 3OYFA 4LG3A 4BEHB 2ZPEB 1I4K1 2KISA 3S15J 2OA8A 3PVQA 1FKOA 4CK1A 2VKHA 4LC9B 2X9DA 4D5FA 5I2MA 4O6JA 4H4KC 2JS0A 3T1HK 3M1FA 1QSYA 4RLFA 2E65A 1FYLA 1VQNI 5EF6A 2E12A 3TSPA 4MEXF 2E3IA 4WQ4A 5M1QA 2QK0A 3REBB 4Z4CA 1VFCA 2FOKA 4M9SA 2M8GX 4LLLA 1RBVA 3THYB 2O8CA 2QWMA 4RCBA 2K9MA 2LBFB 1UDLA 2FPDA 2NVXJ 1UHFA 1J9IA 1CLQA 2LZ6B 2NOBA 2OTJQ 2ABLA 2QM1A 5IYCJ 2H56A 1I6HJ 2DA6A 4KV8A 2QBYA 1IXSB 5IP6A 1PCXA 1Y64A 3CC7A 4PL8A 1A04A 1QRYA 3OYDA 2MF2A 3H0GJ 4RTTA 1Q7YC 4H4OA 1XG1A 2R0QC 2ZNYA 1SFOJ 1TVRA 1T56A 1GLNA 4XIDA 2X6NA 3MCAB 2VCPA 2PLYA 1A0NB 4IOXA 1FXXA 3ULRB 4E7KA 1SV5A 2RHKA 1QZZA 4ZTJA 4Q5WA 5KYYB 3F5TA 1QVFS 4H03B 4DWIA 2DILA 3ASMA 4MGRA 1OV3A 3RKYA 3VEXA 1F1BB 4BRAA 3RPQA 3ZN1A 2RHYA 1SEMA 1KVCA 2O9VA 2AQFA 3AG3H 3TQNA 3H8ZA 1BI4A 4EATA 3R61A 2DTUA 2IS1A 2KFZA 1MBHA 5F1JA 4B1ZA 1JRIA 4C1NK 2D9TA 5HK3A 2RE2A 5AQJA 1KU7A 5HS9A 2PBDA 4JV5K 1RAEB 1OU8A 4FLXA 1D8KA 3B6OA 5F0XA 5JS2A 3L8BA 3LZJA 4JLHA 2L4MA 5LMUK 4FWMA 4JRPA 4KGXB 3OY9A 3TREA 1GBRA 2VJJA 1FP1D 3KLHA 2NLUA 2MABA 2HMIA 2E1MB 4ZZDA 3BTLA 3UKUB 4C8NA 2IC3A 1M8MA 2VXFA 2EVRA 2A0FB 5HLGA 2RC4A 2CW0F 3DBRB 4LK1F 1JI8A 1LW0A 3A5LC 3M4GA 5K7HA 5ILVA 1WN7A 4ELVA 3CCSI 2DIQA 1MBKA 1VYUA 1JTYA 2XG8D 1DKGD 4DOZA 1U4BA 1R5GA 2RV8A 1SKSA 1U2WA 1KD1O 5BPNA 4HUGA 4LUDA 2DXBA 4L9VA 3KZBA 5F6FA 1WX6A 2A08A 4DS4A 1HF0A 1BK2A 2G0EA 4WTOB 2EFOA 1UG1A 1J5OA 4KHYA 3VQQA 1VQ7T 2DT5A 4G6TB 4B1UB 3THWB 1Y96B 4M78G 5CYMA 3SCXA 4TVRA 1NHAA 5J1YA 1TKZA 3FZVA 4BEHA 5F64A 4ESFA 5L3EA 4RS8A 4CFCA 4N0AA 4CVNE 3CBPA 4R8HA 5K5QA 2OTLI 3PX6A 1XMOK 3OYEA 1U0JA 1M90R 3QYBA 2Z3YA 2KR3A 3AO4A 3H0HA 1S22A 3E6BA 1C6VA 4KIBA 5FWCA 5LL6S 2GWJA 4BRQA 1ZA1B 1AD5A 3CC2Q 3T1AA 2RI5A 1S1NA 2O4XA 1SRLA 2IGMA 1FEXA 1RT5A 2CZ1B 4FLVA 3HPHA 1I5ZA 1W2BA 4Z2YA 4NLCA 2BE9B 2KZMA 2L89A 1ZBJA 2HWVA 4FLWA 2YRVA 4CJ5A 2LCLA 1ETXA 2DA9A 1YJWQ 2XAJA 1JXEA 3VEPA 1MU2A 4Z02A 3WE2A 1YITN 5AZIA 3JCMf 1R6RA 3CCLT 1WHMA 3CCUT 1VRTA 4HCCA 1JB0E 4YIRX 4RCHA 4XTZA 4F8RA 1Q1HA 2CYYA 5L3DA 3NARA 3VQPA 2CP2A 1O57A 2XDPA 5HY6A 2PY5A 4BRNA 4L0YB 3G71N 2FF3B 5KYYA 1WSHA 2D0NA 4IDHA 3BZCA 3G3ZA 4E3SA 1KHIA 3VQCA 4CECA 2LVSA 5ICGA 1QWFA 1HNIA 1OLTA 2ZMEC 3CM5A 1LV5A 5AQPA 2WWYA 1Y0UA 1L3SA 2I5UA 2F69A 4C23A 4H4MA 2ASPA 2QZ8A 4BQLA 3V1RA 2ZJRF 2KRCA 2IGNA 3HTRA 3FMRA 1YITQ 4IWVA 2E60A 4C8QC 1QVGP 1WEFA 2EIMH 1I1JA 1UOCA 4KRFA 3WGGA 2QGFB 2IVNA 1EBMA 1YP5A 2FBXA 4IEJA 5IWAK 3AVNA 3FISA 3SQ4A 1LDKB 4AYBN 4CGDA 4ENMA 4BRPA 2MC3A 4JI2K 2H1LA 3MX5A 4FJKA 1PKTA 4OKEA 2G6FX 4O55A 1SVOA 2A7YA 1N3AA 2F7TA 1LPLA 1VQLA 3ERED 4I2OA 2G8VA 1SVMA 3CC7T 3QU3A 1UUEA 2GXGA 1PSEA 2Z2SB 2Z1HA 1VQ4A 3CCMA 1DPUA 4L59A 1LFPA 1QVGS 3HOUJ 1EWQA 3LQQA 2CJJA 2GQVA 1HKGA 2LK2A 4XU0A 1DP3A 4UQGA 1ZK8A 1YI2I 5CZ1A 3BT9A 4E6KG 4ABZA 2BGGA 3L1AA 1YWOA 4JKHA 2VC0A 2CH6A 2ZB9A 2EYYA 2ZJPL 2LF7A 2GTJA 4B9XA 1JCEA 4KDPA 1P7JA 1IKYA 1RGIA 4BRLA 4BHBA 2P1JA 2J6KA 3JRZA 2L3SA 2DETA 5E79C 5H1SQ 4CCLA 4XTYA 3MN9A 4LFAK 4GV9A 3CMAA 1HNZK 4OGCA 3KD5E 1T08B 4RAFA 3TL4X 1KD1R 2OFKA 3MVPA 2EJGA 2WB1N 4DMNA 3IKVA 3GUDA 5C4JJ 1KC8U 3K9KA 2XKOA 1XGSA 4PSWA 4IHYA 2P0PA 3AG2H 2R7YA 3K1PA 2F5CA 3ULDA 1MMGA 4MFDA 1S6PA 1JBMA 1QBJA 4AIAA 3EFRA 1T7PA 4JI6K 2HOAA 3BJOA 3DCFA 3G10A 2XASA 4PSXA 4OINF 4ZYHA 4IDKA 3VGKA 5K7ZA 2JA5J 2XGDA 4N4IA 4A5BA 1VQ7Q 4DSIA 4TV7A 3WXMB 4X64K 1LCKA 3META 3F73A 2L9RA 5DD4A 1IHWA 2GLOA 1SKUB 2OYQA 1MGQA 3AGRA 4LD6A 5BR9A 2DOFA 4MZPA 2F4VK 3C2BA 5CQYA 1VQ4N 4EM0B 5C3EJ 1R1TA 1R00A 4CFDA 3CWTA 3D0PA 2EV5A 2E5NA 3KTUA 4UVCA 4M77D 2VWFA 4CZCA 2HDWA 3JCMg 3OS5A 2HQEA 1TC3C 2VGNA 3JAMK 4N0AC 4WXCA 3CWUA 2LFBA 1TKTA 4DOVA 3LAMA 4LSLA 3ZX2A 2OTJT 3AY9A 2UUAK 3RESA 2GOMA 4BR5A 3CJCA 4QPQA 2FUG2 4D6WA 4J2AA 2JA8J 5FJ8J 2XMFA 2W4SA 2NZTA 1WFWA 2NUPA 4XEIA 2YUPA 3K57A 2P51A 3TAGA 2RMOA 3SZPA 4B3TK 1QP2A 3K70D 4LITA 2HOTA 4EEFG 4X6AJ 5DCMB 3B8AX 1AKHA 3TO9A 3PIOF 4K8ZA 4F7UF 4C30A 1AWCA 2K27A 3CCET 3IAM2 4OIOF 1HX1A 2ZQBA 2EFPA 3CHWA 2D0PA 3SZ2A 5FKMA 3C0CA 3CCMI 3WNGA 4RTYA 4IOAL 1TTYA 2CS7A 1IXDA 3GOIA 4LH4A 2KSSA 3ZQIA 3RQ4A 2Z1DA 3AL0C 1IN6A 3BP8A 4JQFA 2LSOA 2IGKA 1EFNA 3VGMA 3W6KB 5CK9A 1QLYA 3A8LB 3CCQT 1FBQA 3CC4Q 2A36A 4P1WA 3VYSB 3ZSXA 3CCEA 1OH6A 1NM1A 1SFXA 2JA6J 2R7TA 1FJGK 3MEEA 4HZFA 5C2FA 4HWIA 1ZRFA 4FWRA 2ISYA 1FOKA 3NF9A 3EH1A 2E1NA 1GXIE 4DUYK 4I9LA 3BDDA 4CZLA 1TUUA 2HPIA 2H3EB 3TQ7P 2CSOA 4UOBA 3GTPJ 1N5YA 3UKUA 3JREA 4EZ9A 1JXOA 1HKCA 4A3CJ 3SQ1A 3ZT3A 2HQ5A 1TWAJ 2R7XA 1YHQT 1LNWA 3A0BC 4FU6A 4BB7A 1WYXA 3M56A 3KYLA 2GBZA 1HD3A 4CEBA 5M9OA 1S6QA 1XPXA 4RTZA 4NC8A 4RTFD 3ZETA 3MAJA 3BZ6A 2K5LA 3TWHA 1QVFM 4AFQC 4FL9A 1ITYA 4CF0A 4A3EJ 3DEUA 3F8CA 1HLUA 3V9XA 1VQ6A 1XUPO 5CKHA 5IHNA 2E35A 3PNWC 4B1YB 1W7PA 3ENHA 4DBFA 4RW4A 4M7DF 3SAHA 5FLXK 1A5VA 2K5FA 2GWRA 2DL5A 3VS6A 3CG7A 2DNUA 2KQ2A 5GAN6 1ITGA 1JXBA 3H1VX 4X9DA 2YKNA 4N4HA 4FPBA 3LWIA 4EMKA 2OANA 3VEVA 3MWMA 3E6MA 5GMKj 1E3MA 2O4IA 2AJQA 1VQMI 3HGYA 4LB6B 1LJOA 3QESA 4JOMA 2DKGA 4OOIA 3BF3A 3ZMSA 2O0YA 1GLDG 4CZGA 4JPBW 1VYTA 5CVVA 2V1UA 2IPOB 3E9LA 3VS0A 1IUYA 2V9PA 2ZJRL 2Z0WA 2XAQA 3I8DA 4CYCB 4JJNK 2Z1JA 4R1HA 2L2PA 2VBXA 2ZM6K 2AT1B 1A5JA 4ZYGA 3NEUA 1KG7A 1FZPB 2Q2EB 3FKJA 1SMYF 1BA5A 2D0BA 5JVGL 1HA8A 3RRHA 3K4LA 2XROA 1VQ8Q 2JRTA 3DLKA 1RNLA 2ZNZA 2KYMA 2NUZA 5E3NA 2IS2A 1OCCH 2P5VA 3OW2S 4EW0A 4CEZA 2DA5A 1IREB 4FWOA 3CQYA 4ISGA 2RQQA 2QGUA 5TKYA 1SD4A 4CCNA 5C4XJ 2L7FP 4IXCA 3K5MA 4MFBA 1OKRA 2DT6A 4RLQA 4I99C 2ZJPF 2LJ0A 4M3YA 4QQGA 1XMQK 4KB1A 2RN7A 3U21A 1KVBA 1XDUA 1VQLQ 4HRIA 4HXJA 1Z91A 2EQIA 2QEXN 4DFPA 2LBFA 1MH4A 1USSA 2CGHA 3FR0A 2ZXHA 2EFNA 2XHCA 1KQ1A 3DAWA 4K2EA 3TTCA 3TW6A 3U8XA 2QA4Q 3OYLA 5F27A 2KZZA 4C8QB 4HQEA 3DU5A 2I10A 3SUQA 2JVHA 2QCOA 2O4XB 3PIPA 4DHYA 1FJLA 3CCUN 3GDQA 3U6FA 1FBSA 3CCMQ 3O4QA 2RQPA 3CCRT 4GLMA 4BDPA 3N4QA 1K8AO 3FZFA 1NJZA 5BPMA 3OSVA 1DTQA 2RQWA 1B34B 3CUQA 3GWZA 1ZBUA 3T5XA 2X78A 3QG1A 2WSFE 2PYLA 4UV8A 2KL4A 4XLPF 4BRIA 1VZ0A 5HLIA 4KHQA 3LDPA 2OBPA 1XB4A 3LA3A 3SHFA 3UF4A 2MK5A 2NNWA 3L0QA 1NG7A 4DR3K 1A5WA 4M75C 3NPFA 2ELKA 4HX8A 3RTRA 4P5OA 2E10A 2QKBA 1ZUYA 2Z1GA 3HL2A 3KP6A 4JJBA 3M55A 1P7MA 3S6WA 1VSJA 1QZ6A 1VRLA 1NMDA 3WTYC 3U9DA 4FJXA 4HV5A 4M6XA 1FN7A 3R8EA 1X43A 1NJYA 4AHTA 4KIGA 1PSFA 3VA3A 3OR1C 1FMWA 2CUJA 1OPLA 2I7PA 1JUSA 2F6CA 1QQJA 2ZMEB 4CZZA 3BTCA 2IA1A 4FJ9A 1C0GA 1VTNC 2RF0A 2BANA 3BCAA 1WNLA 4FJJA 2VUMJ 4MIMA 3D2FB 4FW2A 4EV0A 2CO5A 1MKMA 3LDNA 1NLPC 2IA2A 3K4JA 2OTLQ 5AQLA 1O7FA 4XU2A 4XKCA 3G71I 2EV0A 5L3BA 1HK9A 5CE3A 4GBQA 4OB2B 1AZGB 5HDGA 3HUGA 1X01A 4YOTA 2L9VA 4CO8A 1Q86R 3LALA 1YIOA 1REVA 3BR2A 3TABA 3AVLA 1T8EA 3DRSA 4MZMA 2YI1A 2QEXA 2K86A 1R0BG 4QS7A 3GVAA 3IAS2 1ZQ3P 1AOJA 2PQWA 2KRHA 1AU7A 1ZN2A 1RT6A 1JHFA 1H0MA 2AKKA 1KXPA 4XTVA 2EQJA 2ZPGB 3VSKA 2ENMA 2IDOA 1FIPA 4H0TB 4CIGA 1VQOQ 1XMKA 1D09B 4M7AA 3ZT2A 1GFCA 2HNIA 4TSXA 1ENHA 2YRCA 4FWNA 1WAJA 1KQSS 4IQ4A 3KFWX 1LFBA 4KAZA 2X35A 4CZKA 3WNHA 3OBYA 4OB3B 5KN9A 2L7ZA 3SI6A 3IG1A 1XGMA 2K9SA 3CDLA 3VQ7A 5LBQA 1UG2A 2BZXA 5KRSA 1S9GA 1MPGA 1GCQA 4M75G 4J7IA 2QQ8A 3FM5A 3D5RC 2M9HA 1JJ2A 2DPPB 2E2HJ 2DX1A 2H8WA 1RILA 4A3BJ 2G8FA 4EFHA 2XB0X 2DLLA 2K7LA 2WOMA 3JW4A 1HC8A 2DOAA 1N5ZA 1LDDA 3CCRA 1NK0A 2YUNA 4AUXA 3TSWA 3GTGJ 2JG6A 3NTHA 5FFXA 4WCEL 4CSWA 1AWXA 3GXOA 4FYVB 3PSFA 3LL7A 1Z6TA 3FLCO 1Z1DA 1N9RA 4L0ZB 1LDJA 1RRSA 4E47A 3TO7A 1LE8B 1O75A 3DKXA 2GZWA 3LSRA 2HBPA 1XCVA 4ITVA 3JCMc 2XY5A 3MKYB 4G8XA 2EIJH 4RB3C 3HM5A 4G12A 1IRZA 4I0AA 4UB8C 3LGLA 2LC4A 2PN6A 3J7ZI 2R93J 3CPWA 2P81A 1QNTA 4BRMA 1EO1A 1J6ZA 4JN4A 3V9UA 3AVAA 1Q9XA 3X28B 5JLXA 5DUIA 1MZBA 3HHTB 3V6DA 1JUMA 5GAMd 2V1QA 4B08A 4KA4A 3OIPA 4BJ5C 5HNHA 1KLMA 1ZARA 3CCEN 5EDNA 1DJ7B 2CREA 3ZRGA 2LCSA 1Z3XA 4M7AG 4GYIA 4XMYA 1YN8A 1SUQA 2P4TA 4M77F 2AK5A 2PUOB 2YXYA 1Y71A 1KG1A 1W6XA 3HB9A 3KEYA 1XCBA 3K4MA 3SDZA 5AR0A 2OZSA 1E4FT 3GLLA 4J6YA 4NS5A 2PI0A 2GGRA 2NUPB 2D4WA 1U5TA 4M77C 4U88A 2L01A 1TT5B 1OVYA 5A2QO 4PJNA 1ZR2A 5GMKl 1Z3YA 1YW9A 3NTIA 1XNIA 5ILUA 1XNRK 3DRPA 3VQ6A 2CQQA 5IXBA 3CCRQ 4A3LJ 3OA6A 2H09A 3INZA 5BPIA 1HR0K 3I55I 2IGOA 2RDPA 1JKRC 5AYFA 3D7SB 1VQNA 4J2EA 5KHDA 2PVOB 1NKCA 3DLHA 2VIXA 2RI2A 5TKWA 1ABQA 1I3AA 2CT3A 3C7NA 3L2QA 3NGPA 1W4MA 4G94A 1GVJA 1YHQI 1VQKA 3QKJA 3QHSA 5J8FA 3N0UA 3CLOA 3ABTA 3WVDB 4EGZA 4S05A 4PIIA 2FXUA 1T0HA 2LTPA 3MN6A 1X9SA 1K9MR 1KTQA 3IWZA 2YUSA 2VT2A 1H8AC 4AM7A 1KAZA 2LT1A 1PRLC 2G8KA 4DV7K 2ME0A 3SFZA 3MZHA 3CC4A 1HKBA 5AQRA 4CFAA 3OW2A 4DQRA 4JYAK 4V2SA 3OYIA 3JCMX 3ULEA 2E4LA 3O1WA 2D6FA 4XONA 1NGFA 1D3BA 4KNYA 3MEDA 3ISPA 2XHIA 2E6LA 3OL3A 4RG2A 2N8GA 3FMQA 3CQXA 4AHVA 5AQTA 2HHVA 2VLAA 1IXRC 1W0UA 2HQRA 4OAYA 4FW1A 2DMPA 2NUTB 1G3TA 3KK1A 3THXA 1BW5A 2OF7A 3AL0B 4OLAA 5CR4A 4WQ4C 8AT1B 3A01A 4R56A 3ECOA 4G9ZA 3N97A 3TARA 4LUEA 2BIVA 3CWAA 4P9UA 1M3BA 4H5VA 3HOZJ 2Y90A 4I2QA 3COAC 5EEAA 5CQXA 3GFMA 2P84A 4CC7A 4J8FA 5M1NA 2YNIA 3FMSA 5M5XJ 3CC2A 1BDGA 4R0KA 4IPAA 4DR1K 3AA5X 2KDZA 4L5EA 2GA2A 3VS5A 3VRZA 4MDBA 3TMOA 4PKIA 2COBA 1UHSA 2DOEA 2DL3A 4WYBA 3BFMA 1WHKA 4C2TA 4JI8K 3DQVC 1NLOC 1I5LA 1J09A 2D1HA 1FX7A 3Q0WA 2ZPIB 4PLLA 3ZPLA 1U2VB 1ZBLA 5KNLA 4F91B 4CRIA 1N6QA 3EUHA 3H9GA 4KTZA 2EFWA 3AAFA 3NQOA 2L7KA 3I5RA 2A6HF 3HKSA 4CC2A 4M6VA 1Q9YA 4ICLA 2EQRA 3ATUA 2A1SA 1Y7XA 3AGKA 4XLCA 4AIJA 4EAHD 1KQ2A 1M27C 4C8QD 4CCJA 5LEKA 5CJ9A 3SYZA 3CCJQ 1Y6IA 3LLRA 3CMAQ 4M41A 2F5FA 2M0CA 3T1BA 2R5AA 4F7UE 2ETHA 3V8JA 1GOCA 1KFZA 1VAZA 5FWBA 1Z25A 1XTAA 1QKWA 3GW2A 5BPDA 5EZGA 3J8AA 3CCUQ 2DEUA 1IXCA 3S32A 2P9NA 1SKRA 4XN0A 2GFAA 2QTVA 1DTTA 3BF1A 3SFIA 2F2XA 3ZSQA 4B1RA 1XQOA 3H3ZA 1OJLA 1ETWA 1IG9A 1BM9A 1WLJA 4B43A 3GO5A 1QVFA 1H8KA 3O80A 4RTUA 5GAMf 4JK7A 4E9HA 2P6SA 1NE8A 3J80E 2KP6A 1K8AC 4M3UA 4HVUA 3H3OB 3V7RA 4CF2A 1WJEA 5KPTA 3O9RA 1ZGAA 3NF6A 4HV6A 2J6FA 2OD5A 4BJ6C 3RZDJ 2CUFA 1W7AA 1T39A 2DK5A 1Q95G 2EQMA 4UHTA 3IC7A 1J75A 4DGWB 4X1VA 4VUBA 5HS7A 1F43A 2DK3A 2W84A 3VQDA 4AHSA 1KG5A 4CJTA 4F7UB 1ZXOA 3F0CA 3QO9A 2J06A 1U84A 3L2UA 1I81A 4HEA2 4LF4K 4PL6A 2NOLA 2LQWA 3PUFA 5IOZA 1FC3A 2E1YA 4MO4A 3ZSRA 3VQ4A 5DUKA 3QWLA 1QE1A 3L09A 2MG4A 2VN2A 4OMPA 3QDKA 4A4GA 1UGSB 3A2FA 3M57A 1YJNI 3QNNA 4CF8A 1REPC 1VF9A 4A2AA 1G83A 2V7ZA 1PRMC 2AQEA 3OW2M 3ZCMA 1KC8C 3MP8A 1AKHB 1EH8A 1A5XA 1JCGA 1U5SA 1WBBA 4LFBK 2D0AA 1RRQA 3ER0A 2KIMA 4DA4A 4C92B 2RQVA 1I6XA 1I50J 1JUPA 3F10A 1K73O 5EC7A 1SD5A 4CK2A 3BJAA 2Y0MA 1HKSA 4G9YA 3NWTA 5EEGA 2CP0A 1JJ6C 2DAQA 2X4HA 3EGXB 3VS7A 4KH4A 2GUPA 3T3FA 4UUTA 1LOJA 1VQ5A 3NNQA 3H35A 4LDUA 5CHZA 5GMKh 3IH7A 2XK0A 3L9FA 1W5CC 4Q4ZF 1TWBA 2B7EA 1NJIU 5DLOA 3F0ZA 2PJPA 2EQUA 3KK7A 3KZIC 1NH3A 3TO6A 4OKKA 2HKQB 2DE0X 2DPDA 2Y75A 4JHDB 1OYXA 1ZG1A 2XIGA 2EBPA 5JLFA 2FBHA 2X1EA 4C0DC 3RR7A 4DCHA 1ZGJA 5J2MA 1CXQA 1NEGA 2E70A 1JKOC 5J8CA 4DQ2A 2GXAA 3SBTA 4Z4EA 1ZR4A 1B4AA 3KLEA 2FX0A 5D6EA 3I9QA 9ANTA 4BY6B 2O8EA 1IF1A 2PTKA 4OU0A 2LKPA 3BLYA 2LQ8A 2YG9A 4LD5A 3WG7H 1TS9A 3LANA 3RERA 2YX7A 1K78A 1FLIA 1RACB 1WJFA 2KYBA 3MWTA 1YLFA 3B73A 3G73A 4M78E 4B3OA 1V1CA 4M71A 3HJEA 2QSGX 1XI1A 2LR8A 3EUHC 1W36D 4DSEA 3NCIA 2CH4W 4B23A 1I3QJ 4GGGA 4IZZA 2RB6A 1LFUP 1ERDA 2I2LA 4EJUA 4JKFA 3R4KA 1ETKA 4BL0B 1UE9A 4HVVA 3ATVA 3JSOA 3A0HC 1YWPA 4YDUC 1TWHJ 2K7AA 2LX7A 1QCFA 4CF1A 1TYQA 3GOXA 4B9QA 1PD0A 3J7YP 2VPRA 3M5RA 2Y48A 3G2BA 1ASWA 1Q86U 2X4WA 3FDRA 1UHWA 1EX4A 1X3MA 2VKVA 3IQLA 4JHDA 1WRJA 1LJ9A 2HU9A 3IKTA 4E9EA 2H3GX 3HVRA 4J2DA 1NNEA 2KJBA 3RSNA 2CSQA 5E8GA 4DZPA 5HRSA 1OCPA 2VASA 3CCJN 2EW3A 2BH1A 3LSKA 2HVQA 5FGMA 4M7DG 2ICWG 1O3RA 3LSJA 5J6XA 2P9KA 1JE8A 2VXEA 2W04A 4IRHA 5C0MA 3BQZA 1TL8A 2P5OA 2L4AA 4FVUA 4M78B 2M0OA 3KNTA 3QP6A 4M7XA 2EILH 1VSEA 2QW9A 4IQJA 4J00A 2QVOA 4CJKA 2NRWA 3U3GA 2ZJQF 2QWOA 1E6HA 2F5DA 4H0PA 4IJNA 1M1KO 1PM3A 3E97A 2E5KA 3I55T 4MDWA 4F2RA 1GDTA 2CFXA 2UUBK 1HJOA 2B0LA 4UUSB 3TR8A 3A5OC 1PP8F 5KQDA 4ILJA 2KFDA 1JT6A 3VQ9A 4Z4HA 4R79A 2DMOA 2VBWA 3M8PA 1ZSZB 4C3IJ 4PA1A 3QNOA 1CGPA 4ILHA 3F8FA 4LDYA 4CC3A 1QTMA 2TCTA 1FMKA 4IKFA 2HB5A 4BUGA 1K6OA 4K42A 3M9QA 2O6GE 4ZH4F 2R7RA 2XHBA 4U7DA 2RNGA 3P5JA 4BC2A 2HOSA 2HDDA 2LVMA 3G6EQ 3TAEA 3CC2T 1Y1WJ 2H6BA 5CO7A 4M3DA 4FYDA 3SZGA 1X1DA 4RG8A 3H1CA 1NGCA 2L3QA 2LC2A 4EMKC 1I39A 3DOLA 2DDAA 1ZBFA 5FD6A 3I5UA 5JI6A 3JAMO 1EZZB 2LRDA 1JL1A 2KNBB 4ZGDB 4HSRA 2G7UA 3J81Z 1KAXA 2YCHA 3CCLI 4A63B 3KHYA 2V8KA 4DTPA 3EG9A 4GV3A 5FKNA 3ABMH 3IRXA 2KIUA 3CJTB 1VHXA 1VQKT 3WTUC 2ESNA 2FMYA 2RHZA 2K02A 4YOXA 3WXLA 3GEZA 4B9MA 2DEQA 1QVFP 1HQCA 1MWMA 3L2ZA 3ABLH 1KG2A 3FB9A 4F17A 3QIPA 4IG3A 5GANj 1OFCX 1GBQA 1YFNA 2A3SA 4A4FA 3QRFF 3U23A 2IRFG 4M7DC 4CE9A 4FT4A 4JKGA 2GWKA 3CJRB 3CUOA 4GY5A 3PMIA 2Y0SN 2Z99A 1ASVA 4EVIA 3LPTA 1UFMA 4BACA 4M3EA 4HF1A 1U6GA 3K4BA 3NGYA 1TAQA 3VEWA 2LH9A 4MNUA 2QEXI 3CD6T 3Q1JA 3SJHA 3OYKA 4BR2A 2LP0A 1IAWA 2OQRA 1HU0A 1T0FA 2XAUA 1UMQA 1WOQA 2LY9A 3QFPA 4M78C 2V8JA 3JRHA 2V7YA 1K8KB 5KYUB 4AYBA 2M87A 3VU3C 5HKCA 2O03A 3OSGA 1VQOA 4JD2B 4FJ8A 4O4GA 4HKEA 1HDPA 1DGWY 4JZ3A 1IV8A 4NZGA 2FHDA 3RSEA 2HNHA 2MWPA 5K1YA 3NGIA 1UA1A 1RLQC 3RCOA 3G7ZA 3V9SA 2W6LA 2P9UB 1FYMA 2DRMA 2BHZA 3ZXSA 4PLIA 2QDLA 3FRNA 2LDMA 1SD7A 4BC5A 3TSUA 4BRCA 2ZCWA 3CDIA 5BRFA 1BI3A 1V4SA 2AS5F 4LF7K 2G3RA 3ZSYA 4UUVA 1KD1U 1KCFA 3OL4A 2L3RA 2YHXA 4RCCA 2HVRA 2IW5A 1YT3A 3ZGKA 2OZMA 2W1OA 5LL6Z 1NEBA 3M9AA 2EJFA 1LB2A 1Y1VJ 3BDLA 4X9CA 2YX4A 1ZBSA 2W48A 3V42A 2GBQA 1R7JA 3EGDA 3FXKA 4ON0A 4A5AA 1IDYA 4WE1A 2WONA 3GFLA 4EIKA 1UGQB 1BIZA 2LJ3A 1BOTO 4J9DA 3ZT1A 1VQ9I 3WQTA 5JHFA 4B1WB 1U8BA 2Y1JA 3G1LA 3EFOB 4FYYB 1LNXA 5EGOA 3DLBA 3JCMJ 4ZC3A 3KP3A 2K3YA 3LAPA 2K3BA 1VYVA 2R7WA 1S5JA 2XF7A 3O9TA 3LAJA 4P5NA 2YHAA 2GX9A 1IO2A 3TBIA 1LW2A 1U47A 1FK9A 1RAHB 3QPHA 1WPYA 3CCLA 1E4GT 5HLFA 5B1BH 3UA7A 1AWWA 5E3MA 2EQKA 4IHTA 4U67L 3KJVA 2PFBA 2IAIA 3ZSOA 2BE2A 2KI7A 5KH6A 4QQ6A 2A1RA 3EUAA 2DTOA 1M30A 4B8CA 5GTHC 2IXSA 1WEIA 2P9PA 3V7CA 1KU2A 4YTLA 3HBTA 2JPSA 1HOMA 4FISA 2FPFA 2FVUA 4EM1A 1F1ZA 2O01E 1TOVA 2JHJA 2RK2A 5BPLA 3ZQHA 3K4CA 3ZQQA 2SEMA 4CDGA 2Z33A 5EYRA 4AHCA 5J2PA 5EJCA 4ZN3A 2WBMA 4W5RA 1IN8A 3EGUA 3H3VK 2E6NA 1OR7C 3E1YA 4J9CA 3M53A 2LDUA 3SAGA 3TW7A 3G0QA 2D1XA 3HVTA 4HDVA 2RD1A 4L18B 5GTIC 5M5YJ 5CYVA 1XSDA 2IS6A 5GAN8 1KRPA 5HLTA 3OS0A 4IHXA 4Y1DA 2HKXA 3GF5A 2XC7A 1B8IB 4DTUA 3A8HB 1LVKA 3UDCA 4B3MK 1VQ6N 5DYMA 4DYQA 4CHNA 4OMMA 1TW2A 1B9MA 1QVUA 1V5FA 2IEKA 1BYMA 1ZGWA 3T1YK 1WB9A <