3OYBA

Crystal structure of the prototype foamy virus (pfv) intasome in complex with magnesium and the insti mk2048
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
368
structure length
368
Chain Sequence
LDAELDQLLQGHYIKGYPKQYTYFLEDGKVKVSRPEGVKIIPPQSDRQKIVLQAHNLAHTGREATLLKIANLYWWPNMRKDVVKQLGRCQQCLITNASNKASGPILRPDRPQKPFDKFFIDYIGPLPPSQGYLYVLVVVDGMTGFTWLYPTKAPSTSATVKSLNVLTSIAIPKVIHSDQGAAFTSSTFAEWAKERGIHLEFSTPYHPQSSGKVERKNSDIKRLLTKLLVGRPTKWYDLLPVVQLALNNTYSPVLKYTPHQLLFGIDSNTPFANQDTLDLTREEELSLLQEIRTSLYHPSTPPASSRSWSPVVGQLVQERVARPASLRPRWHKPSTVLKVLNPRTVVILDHLGNNRTVSIDNLKPTSHQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular mechanisms of retroviral integrase inhibition and the evolution of viral resistance.
pubmed doi rcsb
source organism Human spumaretrovirus
molecule tags Recombination,viral protein/dna
molecule keywords PFV integrase
total genus 107
structure length 368
sequence length 368
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2010-09-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
A PF17921 Integrase_H2C2 Integrase zinc binding domain
A PF18103 SH3_11 Retroviral integrase C-terminal SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2300 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3oybA04
1.10.340.70 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Endonuclease III; domain 1 3oybA01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3oybA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3oybA03
4A4EA 2NUBA 2KZMA 3V4IA 1KFSA 3QEIA 4BE1A 2JZ2A 1LWFA 4CJWA 4Z4IA 3NH2A 1L3UA 2OPQA 1Z25A 4BE0A 3VQ5A 4FJKA 2LSNA 2W42A 1J5OA 1BISA 3O3FA 5CYMA 4FJ5A 1HMVA 1QHTA 4E1MA 1B9DA 3K59A 3LGLA 1FKOA 2EKOA 3C6TA 4C5EA 1BCOA 1QS4A 1W9HA 1U47A 3ASKA 1S1TA 4QQGA 2L3RA 3AVCA 1ITGA 1NJYA 4FJ9A 4O0IA 1WLJA 3V1QA 4DU3A 4DF4A 3F9KA 3SUNA 2E4LA 1TKTA 3SQ2A 2PYLA 4CK1A 3RMAA 4FM0A 2OYQA 2PQWA 3LALA 2YNIA 1KHCA 3TAMA 3PV8A 1T03A 3QKJA 3G0ZA 3RRGA 4CIFA 4FJ8A 4DQRA 3HXMA 4B9MA 2B8AA 3NNQA 2DY4A 3DYAA 4FXDA 1YVUA 2QXFA 1KCFA 3LP1A 4NYNA 3OYDA 1SL1A 1JLEA 1MU2A 2RF2A 4CEOA 3OYJA 4JRPA 2PYJA 3HO1A 4C5IA 2YRVA 3MP1A 4C8NA 1TL1A 4CFCA 5EU7A 2QQSA 3OA6A 1VSMA 4PWDA 1UAXA 1RBRA 1TK5A 3GOXA 4CJUA 4QQ6A 3L2WA 1A5WA 3SV4A 4FJNA 4M3TA 1LW2A 4W5NA 3SPZA 2G3RA 2D0BA 3B6OA 1ZBLA 4CGIA 3LPTA 2F5KA 4ELUA 3K58A 2B6AA 4TSXA 3AO5A 4H8KA 4QW2A 3QNOA 3OYLA 1ZBHA 4HVJA 4UQGA 1G15A 2RJDA 1HPZA 2HNZA 3KIOA 4CFBA 4FK4A 1RTHA 1KVBA 3I0RA 4CJVA 5FRMA 1HQUA 2A1SA 2BKDN 2VG6A 2OPRA 5DMRA 3RMBA 1VK0A 1NK9A 4AHCA 3TAPA 1RDAA 4M3YA 5C6SA 4DG1A 4DS5A 1ASUA 3AA5X 4H4MA 2EHGA 1JLCA 3I8DA 3SCXA 4F2SA 4DTOA 1BL3A 4FLUA 5C42A 1OI1A 4CFAA 1NJWA 2R57A 5KGXA 3SUPA 5HRSA 3RMDA 1WSJA 3DI6A 2P1JA 1RT1A 4Z0UA 4M45A 2Y1JA 3ISNC 1L3SA 4FJJA 4LY7A 3ZSOA 3LLRA 4LH5A 4B9NA 4M3UA 1KSPA 3OYKA 3AVFA 4B9SA 3PNWC 3HP9A 4CK2A 3MXJA 2IGIA 4E7HA 2LTOA 3EAEA 4IUUA 3HPHA 4O0JA 3SUOA 2I5JA 1SKWA 5CYQA 5KH6A 1RDBA 4C8OA 4PUOA 3TAQA 4BDZA 2M0OA 3LP3A 4HUEA 2F8TA 5I42A 3PUFA 1XHZA 3S6WA 4IKFA 3THVA 1QQCA 3VA0A 1C1BA 3DLBA 4F3TA 3NTIA 2VG7A 1NK4A 2F96A 1D5AA 4ZHRA 1RT3A 3AVBA 2RJCA 2GFUA 3MEVA 2ATQA 4CE9A 3AVHA 1NJZA 4AHSA 4ELVA 1HYSA 1NOYA 2DIQA 4RW9A 2QQRA 1ZYQA 1NK7A 3RR7A 4CIEA 2Q3SA 3HP6A 4FLXA 1X9WA 4DQSA 4EZ9A 4ELTA 2XY6A 3O8VA 2OPPA 2XY8A 4IFYA 2D0CA 1UA1A 3MP8A 5M9OA 4DMNA 3U3GA 1CLQA 2YNGA 3DM2A 3MAQA 5D6XA 1QSYA 3EYZA 4Q5WA 1KRPA 2RO0A 4RW6A 3FDRA 1WSHA 3ZT2A 1U04A 2E6NA 2GV9A 2X6SA 1JLAA 2P0KA 3LWLA 4DSJA 3VQCA 3ASMA 4DTMA 1XNIA 1ZBIA 2RI5A 3V6DA 4E0DA 2HQXA 4CJ4A 4BDPA 2OA8A 1KFDA 2E5QA 1A5VA 4J2AA 2X74A 4ID5A 3V81A 3AVMA 4IUPA 3V9UA 1S9GA 2RKIA 1RCHA 4F3OA 1NOZA 4QVZA 3ZEHA 1RT4A 5HRRA 3OS1A 1FK9A 4CEAA 4DLGA 3KD1E 2JTFA 1YT3A 3TABA 2LVMA 3OYGA 4QOZB 4GY5A 4FVMA 1C0UA 3L2UA 2L8DA 2P51A 4J2DA 2AJQA 3SQ4A 2ZE2A 1BIUA 3OYFA 3IRXA 3CFRA 2RPIA 3D0PA 4HTUA 2QK9A 3OY9A 3OMGA 3AO1A 4LD0A 5JS2A 3S9HA 3OS0A 4FJGA 3M9QA 1FXXA 2YV0X 3LPUA 3PX6A 4BE2A 4F2RA 4K8ZA 4FK0A 4DTJA 1F21A 3VQ8A 1VRUA 3MXMA 4DQIA 3LX7A 1NK5A 2HHSA 2X4XA 4BDYA 3OB9A 3QEPA 4WE1A 3SNNA 3AO4A 4CGJA 4LH4A 4K8XA 1C0TA 2KW4A 3CFPA 4IBNA 4MQ3A 1X9MA 1WSIA 2G8KA 4DQPA 2Y1IA 4ZTFA 4KFBA 4W5OA 4HCBA 3DLMA 1WAFA 3HPGA 2PY5A 4E3SA 1WSEA 3LAMA 4DQQA 3QEWA 5HROA 2RJEA 1Q8IA 3HJFA 4DSEA 1VSLA 2BUDA 4II1A 3SD4A 3BGRA 3VQ6A 4CJ5A 4B9VA 4Z02A 1JLQA 3SZ2A 1D8YA 3KD5E 2HQEA 3CQ8A 5CZ1A 4I7FA 2X78A 1JXBA 3LANA 2FC0A 4ID1A 5HBMA 4FLYA 1QSSA 2FBTA 2GBZA 3KKSA 4DU1A 3FEOA 4NYFA 4UC4A 4A4FA 3CM6A 3DLKA 2HNYA 1T8EA 5D6WA 3AA4A 4B9TA 1KLMA 2YHBA 4JLHA 3KJVA 1TVRA 2VWKA 1GOAA 4CF2A 3NE6A 3QETA 1VSHA 2XRIA 2WONA 3NF6A 1BI4A 3MO8A 4BACA 3NTKA 4I2QA 5CZ2A 3NGIA 2P5GA 3TAFA 1S1VA 3AVIA 1GOBA 3O4QA 4FJLA 3OYCA 4YFUA 1MHNA 3EZ5A 3AVNA 4PY5A 1LAWA 2IS3A 4OLBA 1RT5A 4CEQA 1QSLA 4ZTJA 2G8FA 4FJXA 1OZ3A 3UWNA 3C4SA 3S3OA 3PMIA 1S1UA 2DFHA 3QIIA 1EX4A 4AHVA 2R5MA 5J2QA 3SQ1A 4CRIA 4N4IA 4KTWA 1NJXA 4KB1A 3ZSWA 3OJSA 4N5SA 3LP2A 2XDPA 4CHQA 4DLEA 2WACA 4AHRA 1CZ9A 5KRSA 4CCHA 5J26A 1D9FA 3IAYA 3AVJA 5SWMA 4Q0BA 3CM5A 3HVTA 4KHQA 4CEZA 2O4IA 4Z4EA 1K6YA 4DTPA 4KHUA 4KB0A 1WN7A 1WAJA 2HHTA 4DFJA 1IKYA 1REVA 1VSFA 4OKEA 3LYIA 3MEDA 1JLFA 2HB5A 4G1QA 3M8SA 4FLTA 4DFKA 1QTMA 3ZSYA 2O4XA 3ZSRA 4Z4HA 3SYZA 2FBYA 3VA3A 4CJQA 2B4JA 2NLUA 5KI6A 3AV9A 1RNHA 1L5UA 4B9LA 3HPOA 3OYBA 5KCHA 2ZQBA 4EP5A 4DSIA 1LWEA 4KTQA 4J2EA 3OS2A 1DTQA 1U48A 1GOCA 5HRNA 3TAGA 5J1EA 3SPYA 1TAUA 4IUQA 1LAVA 4PQUA 1WGSA 1WJSA 4IFVA 1IH7A 3OYNA 2PZSA 5KRTA 4HHTA 3META 2XHBA 4KO0A 1L3TA 4CECA 1YTUA 2RHUA 4DS4A 4DSFA 3OJUA 3TANA 3TR8A 4B3OA 3TWHA 3NGZA 1RT2A 3QERA 3HVRA 2RHZA 1JXEA 4DSLA 4Y1DA 4CEEA 4KHYA 1I39A 3RRHA 4J2BA 4M3ZA 3F73A 3OYIA 3PFSA 3DLEA 3OVNA 4E19A 5T7BA 4FJHA 4NCGA 3VQ7A 2X6NA 1C1AA 1S1XA 2X4YA 4RG8A 3D45A 4CHNA 2D5RA 3VN5A 2KZZA 2VG5A 4B8AB 1XC9A 4QQDA 1EETA 1HNIA 4CEDA 3QLHA 2F8SA 3IG1A 4LSNA 2G8WA 2VYTA 3HYFA 3ZSQA 3AVGA 3QIOA 3S3MA 5DK5A 3MEAA 4N4GA 3L3VA 3CG7A 1TK8A 3AO2A 4O5BA 3QESA 1RTIA 2YKNA 4IG3A 4QAGA 4M41A 3QNNA 3JSMA 1KLNA 3O3HA 3VQBA 4FCYA 4CF8A 3ULDA 3OYAA 1S6PA 3CYMA 5KTQA 1QE1A 2OZMA 3P83D 2XY5A 3DLHA 4GMJB 3NH1A 1XI1A 1U49A 2RHXA 2X4WA 1RBTA 4A4GA 1IG9A 4KREA 4CJKA 3VQ4A 1J54A 4FYDA 2X35A 5HP1A 1DLOA 3MECA 4AHTA 4DTUA 2DAQA 1S1WA 1UOCA 3DLRA 1CXUA 3E9GA 2YKMA 3NTHA 3G10A 2EQMA 3LGFA 1RTDA 2BDPA 1OYXA 2BIVA 4HUGA 3SV3A 2CKKA 1SSFA 1VSJA 2G8IA 2HHXA 2QKKA 3QJ6A 4FJ7A 4C5GA 1S5JA 4OPKA 4ICLA 1RDDA 2QKBA 2IG0A 4NZGA 3IS9A 3MEEA 4H4OA 4W5TA 3PX4A 1C1CA 3NGYA 5HLFA 4KI4A 4Z4FA 4E7JA 3OMCA 4PLIA 4PLLA 4M42A 4EZ6A 4F8RA 2YHAA 3DB4A 3PO5A 3L2QA 3S3NA 4GVMA 3ZT4A 4M3WA 1TKXA 4CJSA 3A2FA 3ZSVA 3WNGA 2KTQA 2XY7A 3RWUA 4CFDA 4L8RB 1HNVA 5FRNA 3AO3A 1IKWA 4B8CA 4OKKA 2EQJA 4LSLA 4CEBA 1U4BA 1NKBA 1JKHA 1CZBA 5CIUA 1JLGA 3AA2A 4OGCA 2ZD1A 3T19A 4CJFA 4DU4A 3QEVA 2HVHA 1UWBA 3SQ0A 2Z1IA 4BWJA 3SUQA 3ZT1A 3FC3A 3KTQA 4X34A 3ZT0A 5I3UA 3OYHA 3MEWA 3NF7A 4O4GA 1U45A 3ZT3A 3OYEA 1TK0A 4E89A 4NCBA 4KI6A 4KTZA 4CHZA 4FJIA 4Z4GA 4OGEA 3U6FA 4FW1A 2XK0A 4I2PA 4Z4CA 3OQ5A 4IG0A 3MXIA 4DTRA 3VQQA 1I3AA 4CHPA 1WJRA 4N4HA 1G5VA 1JLBA 1W0HA 2MWPA 2LRQA 3MP6A 4FU6A 1RBUA 1WSGA 3L2VA 2EX3A 3C94A 4CGFA 4W5RA 1SL2A 4E7LA 3M8RA 1FKPA 2GFAA 1C0MA 2O4GA 4CJEA 1O1WA 3V1RA 4QCLA 1OZ2A 1SV5A 3O4NA 2D0AA 4OVLA 3OYMA 1SL0A 5K14A 3MEGA 2GF7A 3WNFA 4CIGA 4B9WA 3LWMA 3KLFA 1RTJA 4W5QA 4L59A 2BE2A 2Z1JA 5J2MA 5C25A 4OPJA 5FROA 5IAYA 2E6LA 2RHYA 2KQ2A 3LZJA 4DF8A 1JL2A 3P8DA 3TAEA 1NK8A 2K3XA 4XIUA 3HT3A 4NS5A 3PY8A 4CK3A 3QIPA 2MWOA 1BQMA 4CJPA 3KLEA 2R7YA 1BQNA 4EDUA 2D9TA 3LZIA 3V9ZA 3QEXA 1L3VA 4F4KA 2RHIA 5D6YA 3KK1A 3H6ZA 2BANA 3HSTB 4FM1A 1N5YA 2EQKA 4KHNA 4KV8A 1TKDA 2XO7A 1RT7A 3SI6A 2JLEA 3RMCA 3H8ZA 1BIZA 2RI2A 4CJRA 4JRQA 4DFMA 4BD3A 1ZBUA 3NDKA 5KCOA 1B92A 4N56A 5J39A 4M3XA 3K57A 3L3UA 4CF0A 5C0MA 1IO2A 4I9LA 4Y1CA 2RJFA 4FJMA 2HHQA 3LDSA 5SZTA 3V9WA 3QINA 3P1GA 1NK6A 4CESA 1T7PA 4N41A 4N47A 2EQUA 3WNEA 3AVKA 1HQEA 3EY1A 2LCCA 2EFIA 4FLWA 3V9XA 4RG2A 1UA0A 3K5MA 1VSDA 3K5LA 3VQAA 5JS1A 4E7KA 3DRPA 3I0SA 5KE2A 4AILC 2JGUA 4FLZA 2G8UA 2OPSA 2G8HA 2LDMA 4JS5A 2O4XB 1KVAA 1RBVA 1VSEA 4OJRA 3VQDA 4JS4A 3BDPA 1D9DA 4NCAA 2HMIA 4MFBA 3O3GA 3NH0A 1J9AA 2HHVA 4KPYA 4DTXA 3T3FA 2KFZA 4CJTA 1LW0A 3K2PA 1VSIA 1X1PA 4RW8A 5FDLA 3L2RA 3DLGA 4AHUA 3BDLA 3KK3A 3L42A 4PA1A 1A5XA 5KGWA 5IN1A 1RT6A 2ITGA 1IKXA 3NF9A 2R5AA 3LAKA 4YNQA 1Z26A 4FK2A 3QBYA 2KFNA 1H3ZA 1HYVA 3ALYA 3VQ9A 3VQPA 3RR8A 3NCIA 4GW6A 1IKVA 1BCMA 3FFIA 3HK2A 3KKRA 4IUTA 3RTVA 3KLHA 5CY4A 4M3RA 3ITHA 2HVIA 3KUFA 4IUVA 1VRTA 4FW2A 3DRSA 1S9EA 3M8QA 3PX0A 1BI4B 4C8LA 3L8BA 1WNSA 2IAJA 3ZCMA 4OVAA 4CF1A 1LV5A 1TV6A 3C6UA 5J2NA 1VSKA 4E7IA 3JYTA 3ZSXA 4OKJA 1S6QA 3FLGA 1X9SA 5HRPA 1Q9YA 2ETJA 1XWLA 4OLAA 3ME9A 4KHSA 3CEYA 3E9FA 3KLGA 3F70A 4DTSA 2DTUA 2FBXA 1NK0A 4IDKA 3UT1A 2RI3A 1ASWA 3WNHA 2A1RA 3NFAA 1RILA 3PO4A 4FZZA 1BGXT 4KAZA 1XHXA 2IDOA 1RBSA 1WSFA 3K5NA 5D3GA 2R58A 4Q5VA 4N76A 4FZXC 2M16A 4R5PA 3TI0A 3V1OA 4C8KA 4CJLA 5KE3A 1SKSA 2FHDA 2IC3A 4CF9A 4FL6A 2B5JA 1ZBFA 3C95A 4O55A 4DFPA 1ASVA 1WJQA 3MEUA 4KRFA 2Z1GA 3TARA 1TKZA 3DOKA 4B08A 4B9UA 4I9QA 2BGGA 4FLVA 1EKEA 2DFEA 2OZSA 3NHGA 1NKCA 2Z1HA 1B9FA 4RW7A 1HRHA 1TGOA 1CXQA 3Q1JA 3NF8A 3LH0A 3H08A 2YNHA 1BHLA 3AVLA 2VWJA 3P8HA 4BWMA 4CERA 4HCCA 3E01A 3NBPA 1LWCA 1TL3A 2E6MA 3HL8A 1RDCA 4EP4A 4RW4A 4DTNA 3SJJA 1N6QA 1Q9XA 3AVAA 4FZYA 4DSKA 1EXQA 2WOMA 3B6PA 5J2PA 1T05A 3LP0A 4HCZA 1HJRA 3M8PA 5E41A 1R0AA 1C6VA 2HHUA 1J53A 3PMTA 3P5JA 4CEFA 4CGDA 4LD6A 4B9XA 2HW3A 4CJ3A 4PL6A 4CGHA 3KLIA 4O44A 4CGGA 4HUFA 1KTQA 1NKEA 1SKRA 2P5OA 1Y97A 4DWIA 2FBVA 4IURA 4C8MA 2K3YA 1N27A 3V9SA 4CHOA 4KKOA 1YTAA 3ZSZA 2HNDA 2GUIA 3KK2A 1TAQA 4A4HA 2M1HA 1DTTA 1SUQA 3NAEA 1JL1A 2HHWA 4FM2A 2IOCA 3DMJA 3AA3A 4CHYA 4C5HA 1HYZA 3U3YA 1EP4A 3QO9A 2L89A 3CFOA 3T1AA 2RN2A 2G8VA 3HM9A 3VQEA 3UIQA 4KHWA 3DOLA 5C24A 3DB3A 2DIGA 1KVCA 3DRRA 1RI0A 4E1NA 4AH9A 2DFFA 3K5OA 2YNFA
chains in the Genus database with same CATH superfamily
1OV3A 3VMFB 3WXJA 2WC9A 4XLNF 3CDIA 4AIDA 1SAXA 1LMZA 1YJWN 1NJYA 4DU3A 4BG8A 2O8DB 2BHZA 3AKZA 4ZDOA 1XMQK 2HXOA 1R6RA 4DQRA 3GF2A 3DYAA 2QXFA 3LP1A 4BHBA 3SAHA 3THYA 2HZTA 5DUIA 2A0FB 1U3OA 2ZJQF 5LJ5h 3JRZA 2B63J 2E7XA 1SANA 2VL8A 1IO6A 3CCJA 1E2XA 4DEYA 5C12A 2GCXA 4PJOA 1LPQA 2WSCE 3CJQB 3BG6A 2OD5A 1VQ9I 3JSCA 3KP3A 4JJNK 1QVGA 2JMAA 5C2DA 4DS5A 1ASUA 3I9QA 2GUPA 1FNNA 1I81A 5C42A 1XUPO 4LLNA 2KISA 4ATOA 5AQHA 4LB6B 2EV0A 3W3DA 4E7HA 4VUBA 1M1GA 1RR7A 4JLGA 3DPUA 5CYQA 4C8OA 1XN7A 3KZYA 2CS7A 1QQCA 3NTIA 4R0KA 2KKZA 4ZYHA 4B1RA 4HDUA 1IF1A 2CV2A 4BHPA 4XSXF 5ILSA 2OPPA 3K2AA 1GLBG 4AIAA 2Q2RA 1P7IA 2LCSA 3VEYA 3CJ9A 5EZHA 2RM4A 1XNIA 1VQ6A 4LK0F 5GADJ 1RAEB 3RUXA 4J2AA 4CI0C 2MW8A 4DV0K 4ID5A 1MJ9A 4BBRJ 1NOZA 2BEOA 3ZEHA 4RGUA 1OPCA 1Q82U 3C6AA 2HKQB 2H8HA 1YX3A 3OY9A 3VWBA 3PX6A 3CCMN 3CCEN 2HHSA 2X4XA 1H89C 2Y0SA 4LH4A 2GELA 4XH5A 1X1DA 2CWEA 1KAZA 1PD1A 3BGRA 2PJPA 4WQ5C 4A3LJ 4KISA 2V9VA 3QPTA 2EBPA 2KROA 2FBTA 3O9UA 5BPDA 1PKTA 1VQ5Q 2KE9A 4HZFA 3TO9A 1W7PB 3KJVA 3UA6A 3A02A 4ASNA 1GOAA 2VYPA 3NF6A 3NGIA 3QO3A 1I1GA 4K0KK 1X1BA 1RT5A 1QSLA 1ZGAA 4YRVA 1YJNN 2FA5A 5FKMA 5EEHA 1FBQA 3LP2A 1M1KC 4CHQA 1HCRA 4JHDA 4WXDA 1WRJA 4M72A 2KDSA 3KXTA 4MO7A 4OMLA 2O4IA 5BN9A 4XKCA 3MPUB 2E5KA 4DFJA 1MUNA 4OMFB 1TT0A 1IAWA 5AZIA 1TW2A 2HZDA 4MNUA 3MKWB 1X2KA 2L02A 4XRSA 2M0YA 1ITYA 3CWTA 2DDAA 4DSIA 2P4RA 2XAFA 3OS2A 1LAVA 3G73A 1WGSA 1ZELA 4BEHA 2LMDA 2LNVA 4AMCA 4P96A 4X9CA 5KYXA 2OTJA 2KRNA 5JLHA 2DL4A 3UKUA 1S6LA 2P7CB 3VEOA 3JV3A 3WTZA 3THWA 3SAGA 2WV0A 4Y52J 2KZZA 2EB7A 3P8BB 2IP2A 2H09A 2G8WA 3E5UA 3MWMA 3AVGA 5MLCQ 3MEAA 1XG1A 3L3VA 4IHSA 1N8RO 1PD0A 1AOJA 2MF2A 5KTQA 2OZMA 2A41A 2V79A 1LKXA 3FFKB 2LDUA 1ARKA 4FYDA 1VQNQ 1S1WA 4ENKA 3CCMT 3U23A 3JRBA 4BGAA 1TWBA 4KNYA 5LHGA 2KHMA 5IHNA 3FXOA 4RB2C 1W6XA 3CF5L 3EGDB 1H8KA 2KTQA 4IO8A 3RJPA 4LE9A 2DQRA 4DU4A 1XGNA 2XI9A 1G99A 2QBYA 1WEGA 1NLOC 1IDYA 3GYHX 1QCFA 1IV6A 1L3LA 1WOQA 2HVQA 4KTZA 4OGEA 2M1BA 5AQQA 1JT6A 3JCUC 1VQ5A 4JKDA 3L2VA 1W7AA 1OKJA 3JXUA 1NEGA 2ZPEB 5JFRA 2KR3A 5CLSA 5DYMA 1TQPA 1W0TA 1MJAA 1NK8A 5HDGA 1IBKK 1P4WA 3FDYA 1BQNA 4P1WA 2QA4N 1HKSA 3H6ZA 4FM1A 1WJEA 2DMPA 1X2NA 2WTEA 2FBIA 4ILHA 2IIMA 2HHQA 5LJ3g 1WJBA 3SDBA 3QINA 2EQUA 3INZA 3R6MA 3AG3H 4RG2A 1VSDA 3QHSA 1VZ0A 4KYWA 2IAIA 5IT9K 1E3MA 2HMIA 3Q0UA 5F2RA 4AHUA 3R61A 4J8FA 4DR6K 3RYRA 5KGWA 2E2HJ 2O7OA 1G3YA 1GV5A 3ALYA 3CQYA 3BQYA 5FLMJ 4B3TK 4BS9A 2PVGB 4LK1F 2R0QC 3JSOA 4GRIA 1HXDA 3VOVA 4A12A 3V7CA 2HVIA 2A36A 3FX3A 3PFYA 4L3QA 3CCLI 1PWTA 3CCQI 4M75D 3DRSA 5KQDA 2LX9A 3H1CA 2P5KA 1DGRM 2QWMA 2EFWA 3ULQB 4E7IA 2SEMA 4M7DG 1G59A 5CCAA 2ETJA 1LCKA 1R5ID 4C1NK 3E9PA 4IOAL 2ADUA 4B3MK 2RI3A 1ENHA 3K5NA 4P55A 3O08A 2JJ7A 5JVGF 1NPPA 4IOCL 3ZQ7A 1BW6A 3MN6A 3VS7A 2BGGA 1TUCA 3NHGA 2DA4A 3S1QJ 2MMPA 2W25A 4CO8A 4A5AA 1IV8A 4IWVA 2CGHA 5DDGA 4EP4A 5AQPA 2AHQA 1BR4A 4L5EA 3ZETA 1KU9A 3UA7A 2GWKA 2NUPA 2SRCA 4LFBK 3BE3A 3ZX0A 4AVZA 3VYSB 1IB8A 3ZXSA 2IOCA 2R5YB 3QO9A 1UEBA 3HOZJ 3VQEA 3K5OA 1KFSA 1RDWX 5BRHA 5GJVB 3KLOA 1LDKB 1R8OB 1D0YA 4ZGJB 2GIVA 4BRFA 3LDOA 5FFZA 5F1JA 3L1PA 1RAIB 1MBGA 4ZNXA 1T3LA 1EWRA 2V75A 2JHJA 4CK1A 2DNUA 2I5WA 1Z9ZA 4F2RA 1T6CA 4FXDA 5FLVA 2CP7A 1H641 3UF4A 3DP7A 4FHTA 1K0XA 1REPC 1O75A 3DU6A 2ZFWA 4PSWA 3SAFA 3SLCA 2PU9B 5L3EA 1MV0B 4C92E 2P0WA 1BU1A 1TL8A 4XRMA 2A1SA 3CC7A 3TAPA 2DMUA 4KRTA 4H4MA 2F2XA 4A93J 1AHDP 3CCQN 1OI1A 4F16A 3ID6A 1RT1A 2Y1JA 5GAN6 3ZSOA 3LSRA 2BW3B 3EYYA 3EAEA 4JAXA 5LHHA 3SXYA 1YO5C 2XU8A 1SG5A 3OIOA 3O9RA 1SEUA 5DY9A 1HYSA 2V51B 2QM1A 2HVSA 1IC8A 3I0XA 2XY8A 2D0CA 1M30A 2PFBA 3E97A 4L9JA 5LLQA 3O5BA 3A5MC 2HQXA 4CJ4A 2R7VA 2X74A 2ZCWA 4ENMA 4QVZA 4YOQA 3WVEB 4QSHA 5E1XA 1V1CA 3PJRA 4G6QA 4WK8F 2L0AA 4E6RA 5GAN2 4QOZB 1OPLA 3G71I 4HTUA 3BWGA 2H3EB 2W84A 3OMGA 3FMQA 2M8EA 3SZTA 4F14A 1PRLC 3GCMA 3VJPA 3PVQA 2PEXA 4PUOA 2PY5A 4QCLA 1IXDA 2LX7A 2CP0A 4I7FA 3GE1A 2Y0MA 3DLKA 1T8EA 4AG1C 3AA4A 3I59B 3GUDA 3QUIA 3FKJA 1O3QA 2WONA 2DA3A 2O3FA 4OINF 2RQUA 4NHJA 1VQOI 1NJIO 3S3OA 1UG2A 3SQ1A 1R49A 3QIIA 5KYUB 4KICA 1YJ9A 3I56I 3SYTA 2DKGA 4EA4A 5SWMA 5J6XA 4Z4EA 2O8EA 2QBYB 2YPRA 2RE2A 3TTCA 3GFLA 4BJ5C 4RCCA 5HVQC 5M3MJ 5EEAA 5M1PA 3H35A 2P5VA 3CCQQ 3CCVT 3DWLA 4JX4A 2QEXN 2FNPA 1OOTA 1OX8A 3HOWJ 5B66C 1MMSA 3I35A 3GWZA 1ETOA 2DTZA 1NGBA 1RT2A 2JVVA 3HVRA 1W5TA 3TWHA 2JMWA 1XCVA 9ANTA 1JXEA 1LFBA 1XMOK 1JKPC 3QDFA 4CC7A 4IFEA 2FMLA 2H1LA 2D1XA 1MNDA 2VG5A 3BF1A 2FZGB 3O9SA 4F7ZA 1RAGB 3GFMA 3WGIA 3S3MA 4HPQA 4JYKA 2JS2A 3CMEN 3OYAA 2DLLA 2WAFA 3K69A 5I22A 2RHXA 4IEEA 5HP1A 2CGLA 1UOCA 2YKMA 2EQMA 3VS4A 1T33A 1YN8A 4FJ7A 2ABKA 4FT4A 1YTUA 2V9PA 4I09A 2AP1A 4D8DA 2KMUA 4F8RA 2Y69H 3RNJA 4FPAA 1VQ4I 1X69A 5H2FC 2CW8A 5FRNA 2X51A 2WTUA 2OTLA 3FXRA 3QEVA 4Z88A 5LJVA 5E17F 3C2HA 2D4WA 1VQLT 2HKOA 2ENMA 4E89A 3RZDJ 1WJRA 3TEEA 2DL5A 1YUWA 4M7DD 2FX0A 4N0BA 1ZUKA 2D0AA 4MIMA 5GAGJ 2HEQA 4RLQA 1S3XA 1MDMB 2IJLA 5CQYA 5EG0B 3SDZA 3FWEA 2VB6A 1QP3A 2RHYA 2LKXA 4KMUX 5GAOl 1N6AA 1FMVA 3ESWB 4IIOA 5DCFA 4BB7A 4KHNA 2KSSA 4F7UE 1NK2P 1RT7A 2JLEA 4UB8C 4B1XB 2WAEA 1DPRA 3EUAA 1O9SA 3ABUA 2GAUA 2PBDA 5AQKA 3DKWA 2M5WA 2VODA 2DODA 1U8BA 2ICWG 3EFOB 2VQLA 1B4AA 2LSOA 3CHWA 1T3SA 4YNQA 2VQHA 5GANg 1K8KA 4UXNA 2Y4XA 4AI5A 4M7AD 3QBXA 4DZPA 4BUPA 4M3DA 4M74A 3L9FA 2MC4A 1NG6A 4LF8K 4U0WA 3U8XA 2QWLA 3PX0A 2JW4A 4U87A 2ZJRF 2OTLQ 2O8FA 4GLMA 2IA0A 3KLGA 4CHUA 2AHJB 4B09A 3NFAA 3LWIA 5KAFC 6PAXA 5D3GA 2IDOA 4CBUA 4D6WA 4C8KA 3OWTA 3G6EQ 1HU0A 2DT6A 3F6OA 4DFPA 3BTJA 1HDDC 1NGJA 2NOEA 1WI3A 2P6TA 1RGIA 1JI8A 1VQMQ 4IEIA 2HYJA 2UWMA 3VF2A 3P8HA 2H3GX 3H0DA 3V8LA 3SEMA 4FZYA 3ZP5A 2XAUA 1IHVA 1HJRA 2P4WA 1UFFA 3LA7A 3P5JA 3HSCA 1GHCA 4HUFA 1OPKA 4DBQA 2E1MB 3ZSZA 4NXNK 1YJWA 1IV0A 2RN8A 2F5TX 4FE4A 1V5EA 1XPXA 3I5SA 2Z33A 2JA8J 5BR8K 1G83A 1EH6A 2JJ9A 3ONQA 4PIIA 4CJWA 4R1HA 2O8DA 3MZHA 2W42A 1B72B 5F08A 3WE3A 1HMVA 1U6ZA 1DU6A 1KD1O 2KXDA 4YPHA 3HBLA 1YQLA 3CC4Q 4ESFA 2PYLA 1QCNA 3HTRA 2CQXA 2GTOA 1DUXC 4NYNA 5I21A 2E1HA 3TEDA 4FE7A 2JQ7A 3SMSA 2W48A 3B6OA 3B8AX 4M7DA 4JRIA 3Q9SA 4JJBA 4QS8A 2KQRA 2X3XD 3JCMc 3VS5A 2K79A 4H5TA 1MNEA 4GYGA 5FRMA 4M78D 3BCAA 2R7XA 1NK9A 2QK0A 4BI3A 1WQWA 1E6GA 1ORNA 4M71A 1M90U 1RLPC 2VQCA 2Q1NA 5DPKA 4CW7B 4IUUA 4HNTA 5ICEA 2I5JA 5KH6A 2XROA 2Q31A 3LP3A 5I42A 3D5RC 3GEZA 3BROA 3WTVC 1AWXA 4JKGA 4F3TA 2DERA 4ZHRA 8ATCB 2ATQA 3SHFA 2XC7A 3MX2A 4AHSA 3OW2S 4EW0A 4RTTA 4RW9A 4LG3A 2DEQA 2XRLA 2XY6A 2QUFA 4M77G 2OQGA 3VS1A 3EYZA 1W70A 4WF2A 2GV9A 4A0XA 3ASMA 2ME6A 1ZBIA 1XSDA 3ROUA 1XQHA 1M1KU 4AM7A 2R7ZJ 1YHQQ 2NOJB 4LOCA 1B72A 4OPAA 2ROLA 3AO1A 3ISPA 5F1XA 2CH5A 1IJJA 3CUQB 2HYGD 3MKZA 1I5LA 3CC4T 3RSNA 2RDPA 4XICA 3DEUA 3PT9A 3EUHA 1ZREA 2GLOA 4DBHA 4FT2A 4IBNA 3CCRQ 1ZSZC 3LAMA 4B9VA 1VQ4A 1IUYA 2DXCA 5HBMA 4NYFA 1GLJO 1MH4A 2F4VK 1Y96B 1P90A 3DAWA 2P5GA 5CZ2A 3NTKA 3KFWX 3I71A 4YFUA 3BCBA 4FSSA 3A0IX 3VW4A 1YS6A 3C4SA 2R5MA 4I02A 2QGUA 1UFMA 4N5SA 1Q82C 1U5TC 5FPNA 1YJNQ 2LY2A 4M7XA 2K85A 4PCQA 2CUFA 3VEXA 4FLTA 3LWHA 2JG6A 3ZSRA 1BA1A 2VT3A 3FHFA 3WG9A 2YX4A 2JN6A 1NGAA 3NARA 4EJWA 3BFMA 4L5GA 1FN7A 4KO0A 3G4SI 5IOZA 4DS4A 3JCMJ 3TANA 3A01A 3GTPJ 1V5FA 4DSLA 3BT9A 1BKBA 1U6GA 1BI0A 2HTSA 2QQAA 3DLEA 1V4RA 1J6ZA 1VA7A 4MDWA 3C1DA 3ZL7C 3QLHA 5AQVA 1Y64A 5JVTA 3CCYA 4NQWA 3TSQA 4ETSA 3QNNA 1PP7U 2RNGA 1RLQC 1JXSA 4C0DC 1IDZA 3VYRB 3G10A 2F5VA 5F1RA 3C2BA 2QKKA 2GWJA 2VQGA 1OKRA 2QKBA 3NVMA 3IS9A 1M8MA 2QG9B 1MUYA 3QPHA 3LSKA 2FG0A 4JI7K 1VQ7I 5CK9A 4M3WA 1Q86R 3ZSVA 2P9SB 1KK7A 1WPYA 3JR9A 3CWAA 4F7UA 5JLWA 3L7WA 5GANh 1WVRA 1ZHIA 3I55T 1ZYRF 2F9WA 5CE3A 2D0PA 3ZT0A 1BIAA 4LLGF 3WTTC 4CHPA 1S7OA 1W0HA 2FJ1A 3MP6A 3GTGJ 2KZGA 2OAUA 3M8RA 3TL4X 2XB5A 1JE8A 5H20A 2NYXA 2UUBK 2XKPA 2KQWA 2ZFUA 4XLCA 4DIQA 1Q7YR 3N0UA 2LREA 2LKPA 3PY8A 3QIPA 1OCTC 2RHIA 1Q86O 3CD6I 2KRCA 2ECZA 4EMSA 1H9GA 5FKOA 4DKWA 2RI2A 2O8BB 2E8AA 5J39A 3JCMQ 3HTUA 4CICA 5SZTA 4B9QA 2DA7A 1JJ2S 3K5MA 4ORZA 1OJLA 3ZCOA 4XIDA 4BR7A 3JRCA 4DTXA 3LFUA 1HPMA 2KEAA 1F43A 1GLFO 2NLXA 2EGEA 2R5AA 4FK2A 3QBYA 3LSPA 4E70A 1HBXG 2XVCA 1Z3XA 2UUCK 2L9NA 3CLQA 3EYIA 3KUFA 4C2TA 3HKSA 4WQ4A 3C6UA 5J2NA 2FXAA 5KCMA 3VENA 4QS9A 3B02A 1RILA 4V2SA 2W1OA 5TRDA 1KG1A 4XORA 2LOOA 1U5SA 2Z1GA 2VBXA 1XNRK 1EKEA 3AAPA 4IO9F 1B9FA 4RW7A 2YNHA 1TNTA 3T7ZA 5ERIA 1IUFA 2E1MC 4BXUA 3ASNH 4RW4A 1KQSS 4DSKA 3CQXA 3PMTA 4JYAK 3IQLA 2NNWA 1YJNT 2HMPA 1MWMA 4N0AC 3RIRA 2K3YA 5L3FA 2HNDA 4ENNA 2HHWA 3PIOF 2XSJC 4QWQA 1EP4A 4CC3A 1KVCA 3DRRA 4CZJA 1KQSP 1EWQA 3PQJA 5K5RA 1SFKA 1ZG1A 1BA0A 1VQ9T 3C6TA 1QS4A 2DO3A 3AVCA 2A61A 3F9KA 3GTKJ 3DWLE 4FJ8A 3QWXX 3D7EO 1JUMA 4IDHA 3V7SA 4EMHA 1KCFA 1K4US 2VWBA 5BPIA 3CBOA 4KITB 3OYJA 2BE5F 5D6EA 2PYJA 4C5IA 1FW6A 3OA6A 2YR2A 1QVPA 3CCLT 2G3RA 3WT0A 3KYDB 1Q81R 3H9QA 4HVJA 4UQGA 2HNZA 2MYSA 3HSRA 5LL6Z 2XF5A 1JLCA 4F2SA 4FM4B 2AS5F 2A42A 5JLXA 2E5ZA 1HKQA 1TYQB 3E0JB 5DCMB 2LQWA 2DX1A 3CPWM 3K70D 4BRPA 5K5OA 3HHTB 3AVFA 4KULA 1V4SA 4D7NA 4HF2A 4KA4A 3E9LA 2XAJA 2WB1A 5D5WB 1VQ7T 3CO6C 1YRNB 1NG9A 4ZZLA 2VG7A 2OTJQ 2HBKA 4CE9A 4RDUA 1O57A 1F36A 1BU6O 3R6SA 1WBDA 1BO5O 2Q3SA 4EZ9A 3KZZA 3K4MA 4G7ZF 4Q5WA 1VQ6Q 3M0PA 3LSGA 4A3MJ 2M0CA 3LWFA 3PGGA 2O8CA 1XOVA 1FEXA 1ZG3A 5LJ5g 4H0TB 4U7BA 1RT4A 1I5OB 4P5OA 3K4BA 1Z91A 5LJ3e 5KPTA 2CQKA 2HF3A 1FLIA 4FVMA 3GTMJ 2PVDB 3GP8A 2ZE2A 2LT4A 3J80O 1HDPA 4M78B 1GXPA 3S9HA 3O8GA 4KH6A 1VI0A 4BE2A 3VTIA 4K8ZA 4DR5K 3BG3A 4CGJA 4K8XA 1UJ0A 1GCQC 1VTNC 1XGMA 3IWFA 4W5OA 5FU6B 1SD4A 2KY9A 4EMGA 1T0HA 4EW4A 1V54H 2DA9A 1NBWA 4NBQA 1UELB 1RUOA 1J3TA 4DU1A 3FEOA 4RCHA 4JI6K 3CTAA 2C0TA 2IGNA 2KRHA 1W2BP 3DLLA 3G3ZA 1LAWA 1APLC 2UU9K 2G8FA 3PMIA 3T5XA 4A5NA 3MZ8A 3E5XA 4EQQA 2EIFA 5F6FA 3ENBA 4M77F 4NC6A 1S72N 4CEZA 4KHUA 2K86A 4DCHA 3HJEA 2DZ9A 2G6FX 4E9EA 4OKEA 2FYKA 5D4SA 3ULRB 3EETA 5LEJA 4N4NB 1L5UA 5E3OA 1MIJA 3SZPA 3EGDA 3S1RJ 4J2EA 3KLNA 1X1CA 3J80E 5KYYA 4IFVA 3G1LA 1MDMA 3RQIA 2QZ8A 2GOMA 3OJUA 3K1MA 1NGDA 2E1YA 1ZRCA 2FSWA 3U2RA 4X65K 5D8LB 3O4WA 2MH9A 5EG2A 3CC7Q 1S1XA 4RG8A 2JHNA 5L3BA 4U7DA 2LD5A 3J80K 1HNIA 1HSTA 2TCTA 4EPCA 3HYFA 5BPMA 4OP0A 1ACIA 3AO2A 3O3HA 4CF8A 4BAYA 5HNFA 3MHXA 2DE0X 2VJIA 4UV9A 2FOKA 4XLFA 4MFEA 3G6EN 1T98A 2G8IA 4E9GA 3RTRA 5AQSA 1WHJA 3H1QA 3KZBA 3MKLA 1Y0MA 4A0ZA 1N34K 2OF7A 4MDBA 2AKKA 3CP8A 2DZCA 3TU4K 2GTDA 2WSFE 2DPNA 1QVTA 4B6MA 1JKHA 3NRVA 5A0DA 2HBMA 1ETWA 3SUQA 1WCMJ 1S22A 1RKWA 4X34A 2VKEA 5B3SH 1YIOA 3JCMg 3HG9A 2J05A 3VEVA 3AL0C 3HIFA 1ORPA 1WSGA 1GDTA 4ZYAA 2W57A 3U4LA 4NC8A 4JLIA 4RKUE 2STTA 2BZYA 3LDQA 3KWGA 3F2KA 1PP8F 2M4KA 2MWOA 4PGGA 1B9MA 4KIGA 4U0VA 2HS5A 4X9DA 2RF0A 2GGRA 3CCJN 1T7PA 1J7KA 3WNEA 4KHQA 3V9XA 4F91B 1PRMC 3VQAA 3BR3A 4E9HA 4OMYA 3H5RA 1VOMA 2A40A 1P4AA 3WGGA 2CUDA 1LW0A 4CJTA 1VQMT 2LQNA 2EJ9A 3PSIA 1VF9A 1R1TA 5DD8A 4LG0A 4KBMB 4HX4A 2D8JA 4IUTA 4I76A 2AIRB 4M75F 1MMNA 5JMVA 4LFAK 1HNWK 1DDNA 2HKXA 2E19A 3CEYA 2VPLA 2OTLN 4RTUA 3U9ZA 4JOMA 4IJNA 3BTCA 3FZKA 1XDSA 2OZ6A 2M16A 4R5PA 3IHOA 3TI0A 3V1OA 2BW3A 4N0AA 4CJLA 2P9UA 1ASVA 2P9LA 1NJIC 3DOKA 4B08A 3HSBA 3MKDA 9ATCB 1LE8B 4H5NA 4KFCA 3R6NA 4DR4K 1RI7A 4BWMA 3G71A 2JA2A 1TL3A 4M7AF 1Q9XA 4DTNA 3AVAA 5GINA 1KHIA 2PNIA 3L2ZA 3MQ0A 2NS8A 4YDUC 2JT1A 2DYRH 3PO3J 4C8MA 1WPKA 4HBLA 4HSRA 2WC2A 1DTTA 2V1RA 1PSFA 3CCEQ 1XG7A 3C6HA 2EQRA 1HQCA 2M87A 4BE1A 1O3SA 4MGRA 3JB9F 2HDCA 4A0YA 2VPRA 2KFDA 1GBRA 3M53A 4CZZA 4KGVB 4QPOA 3QBWA 1SD6A 3GXOA 1P9QC 4FJ9A 1B3QA 4FM0A 2KP6A 3TOAA 2YNIA 3QKJA 3LA2A 1ETXA 1YVUA 4NXMK 1JBMA 2R5YA 4BQQA 3HSFA 3L00A 1TUGB 2VUBA 1OH5A 4JZ3A 1IRZA 4S0HB 4ELUA 3K58A 2B6AA 4RAGA 3AO5A 4TSXA 2OZUA 4PJ0C 4AYBA 4HVVA 2X48A 3OYLA 4AC0A 4ILJA 1G15A 1JTXA 1OR7A 3UDCA 3GOIA 3GVAA 1WJAA 3TTFA 2HOAA 5GIOA 2R57A 4BI4A 1L3SA 5E79C 3VFZA 5EZGA 1AWJA 3HP9A 4CK2A 2LTOA 3HFNA 1RDBA 3BEXA 4UNFA 3S6WA 3H0FA 4XAXB 3AVHA 3CUQC 2HYFA 1NOYA 1NK7A 4DZJA 3P9CA 4ELTA 2QASA 3MEXA 4X64K 4LD5A 4BRQA 1ZH5A 5AQFA 3U3GA 1YX5A 2YNGA 3S16J 1QSYA 2RO0A 5LRSA 4EATA 2NUPB 2KK4A 4K2EA 1R71A 4RWTA 2CREA 4E7SA 3CJAA 2M30A 2ISYA 5FPEA 1D1AA 2DA1A 2MIOA 1EH7A 3QU3A 2IS1A 4C3IJ 1IBMK 1YFHA 2HPIA 5GTIC 2EWSA 3QDRB 7AT1B 4X1VA 3BR1A 1AD5A 3VQ8A 1A6IA 1OQKA 5AQUA 2E12A 4LN2A 4HCBA 1WAFA 3TOBA 1H92A 1M1EB 2MPXC 3VQ6A 2FSKA 2JM9A 4FLYA 4JX6A 1KIKA 2M51A 3BP8A 5K7HA 4A63B 5D5VB 4HTLA 1S5LC 2VKDA 4FJLA 3OYCA 1ZA2B 2RA2A 4IHXA 3DBLB 4UOBA 3REBB 1VQNN 3MN7A 2Z2SB 2LR8A 1LEBA 2TDXA 4J6XA 1D9FA 2A6AA 3BDUA 3FIWA 5M5YJ 3EUKL 2CW0F 4F7UF 4LUDA 1KZHA 2UXDK 3IRQA 1YIJN 4WCIA 4ANJA 2FBYA 3HOUJ 2KKOA 4KHPK 3OBWA 4PL8A 3QG1A 5J1EA 3EGXB 4YIRX 1WJSA 3VSKA 4H0EA 3R6OA 1GCPA 4R79A 2YJEA 3T8RA 4B3OA 4J6WA 2QVOA 3CO7C 4HDVA 2MABA 2JWKA 2R7SA 4B8AB 1XC9A 2EA4A 3I5UA 3H0HA 2CFXA 3H9JA 1BM9A 3QIOA 5ADXH 3J8AA 4MLEA 4IG3A 2EAYA 1HLVA 5AQWA 2JWTA 1C0WA 3CYMA 3C7JA 3NH1A 1U49A 2X4WA 4A53A 4GXOA 1NEBA 2E5LK 1WHUA 3MECA 3C18A 1RTDA 3HPWA 3CCLQ 3PVLA 1YOVB 1S5JA 2BYVE 3FHNA 2O2OA 3MEEA 5K5QA 5DM7L 3S32A 2VGNA 4CJSA 1JEGA 1D3YA 3BW1A 3LNQA 4D0PA 1U4BA 3ZLJA 1JLGA 4O6JA 4YOVA 4MLOA 4JKBA 2VQFK 2IA1A 1JCEA 4IVNA 2XK0A 5DM7R 3NHNA 4DTRA 3VQQA 3HOTA 1JUSA 1G5VA 3HDDA 4CGFA 1LNXA 4BRNA 1HKCA 1NTCA 2W4SA 1SL0A 4M7AG 1HKGA 4J5YA 3M0UA 4RA2A 5I2MA 4HSBA 5IAYA 1O3RA 2FQ4A 3RESA 4M7AA 6AT1B 3WQUA 3KLEA 5DEQA 3LZIA 2ETHA 3CCVA 4UY8I 3DXKB 3SI6A 1UJYA 1BIZA 3DCFA 1ZBUA 1V29B 3IKMA 4H4KC 4FLWA 1FBUA 4AILC 4FWMA 2JGUA 4JKGB 4GLKA 4HVWA 1KD1U 4XU0A 1KVAA 3K10A 1RBVA 5IXBA 4WFAL 3T3FA 4H5RA 1N9RA 3SWNB 2L3SA 1WXUA 1R4NB 4PA1A 5HLHA 2ITGA 5IY5H 4Y15A 2IS2A 3CPEA 3DXMA 3FBNB 4C92A 5GANd 4LFCK 2E41A 2R7FA 2JPCA 2QXLA 5F0FA 3L8BA 3ZCMA 3EGXA 3TDUC 1XMKA 4CI6A 3SFIA 1WEFA 2E2QA 3OGDA 2VOPA 2DF6A 5IT9O 2DXIA 4XOPA 1USTA 2HPMA 3LW5E 5AZJB 3CC4N 4N76A 4HA8A 4FZXC 1RNLA 2E65A 4YDUA 3FM3A 2O9VA 1QHHD 1YP5A 2E1CA 4CF9A 3C95A 3C0BA 2EK5A 3KP7A 1I27A 2M7AA 1F1BB 3JB9H 5FWBA 1IN4A 4M6XA 2JPBA 1MJBA 4S04A 2F5FA 3S2DJ 2H1KA 3G1OA 4XK4A 4MO4A 1YHQN 1WSUA 2GTJA 1J53A 1T56A 3I0WA 4HCKA 4FSVA 4DWIA 1N27A 4DR1K 2EPFA 1W5SA 3DMJA 3T1AA 3UIQA 2Q2EB 2VBWA 3CC7I 1KG5A 4BRGA 2W04A 2HR3A 2F5DA 4L18B 2DFFA 4AH9A 2NUBA 3WG7H 3CD6N 1Z25A 2JA6J 1BG3A 2V7YA 1ABOA 4E1MA 3BQZA 3BPXA 1U47A 4LXCA 5GAOn 3HRSA 3RKQA 1ZR2A 3UPUA 5HK3A 3RKXA 4B8XA 1TKTA 5C0YA 3VPRA 4J9FA 2OYQA 2IGMA 2K02A 2PQWA 4LIVA 1IHWA 2O6GE 3SJMA 1SL1A 2RF2A 3KCCA 4PHTX 2DFUA 1R00A 2YRVA 4C8NA 2LZ6B 1RBRA 4PK4A 3V8JA 2QKLB 4RMOA 5C15A 3LPTA 4HVUA 3MJXA 1Q82O 2CSIA 1QKXA 1ZBHA 2YUSA 5CKBA 1KG6A 5AIPA 4IHYA 4CJVA 1D3BB 1RDAA 4DG1A 1CZAN 1RKTA 1FYMA 2A5WA 3TDZC 4B9NA 3OYKA 3FZLA 5FLXE 3HPHA 2AK5A 3I56N 3EH2A 1AKHA 1LWWA 3GTLJ 3H3ZA 4HV6A 5IH2A 2JTEA 3TP0A 3QB0A 1WJ5A 2HSTA 1N78A 1QBJA 2GQIA 2E34A 2A5XA 4IOAF 2FEIA 1FPQA 1VQ6I 1J75A 2K4JA 4IUPA 3HI0A 2UXBK 4DLGA 3OS1A 1NGCA 4PZJA 2YUQA 2W7NA 3A8OB 1FOKA 2VC1A 4BY9C 1PKSA 2RPIA 3QYGB 3H36A 2RQQA 1FXXA 1KQ1A 2FL7A 1K8AU 4DQ8A 2DD5A 5DM6F 1NK5A 3OB9A 3PIPA 3SNNA 2VWFA 1WSIA 3CP2A 1LPLA 2QDLA 3CF2A 3TBIA 4DSEA 1AU7A 1RESA 1JLQA 1D8YA 3PL8A 2C0OA 1JJ2M 2DFIA 4M77A 3CM6A 5GAHJ 3HUGA 3CC7N 2AT1B 4I2QA 4BACA 5GMKi 3D5SC 4C8QA 3QODA 1MHNA 5HLTA 4B1WB 3FZVA 1OZ3A 2DFHA 4C92G 2W03A 1SVMA 3IC7A 2QA4Q 3VS0A 2DW4A 2EBIA 1OYYA 2ELHA 4HQEA 3AVJA 1ZQ3P 3QFPA 1TWAJ 2UYTA 4HX7A 4EGYA 2RD1A 5FLXO 4DFKA 3MEDA 3CI5A 2AZSA 2LJ1A 1E17A 1RI9A 1X3UA 1K4TA 1YI2T 2ABLA 4HF0A 1ZLJA 3DXKA 1GOCA 5HRNA 2JXBA 3OHRA 2KIMA 5AZIB 5M1QA 1L3TA 1UB9A 4AFZC 2IS6A 4Z2YA 2P9IB 2BZXA 2LF8A 2P9UB 3WTWC 1QZ5A 2LNHB 3VQ7A 4PL7A 2X4YA 4F92B 2DK8A 1RAAB 3L0QA 3RYPA 1T08B 4LSNA 4AM6A 2OJED 4KIBA 1N3AA 5DK5A 4DA4A 1P8ZA 3A8MB 1YJ9I 2QQBA 3ZGKA 1XTAA 3WTSC 1S6PA 2VQEK 1BR1A 4KH5A 3A0HC 2K2VA 3KWIA 4KHWA 3M55A 1HOMA 4A3BJ 2BIVA 3SV3A 5EEGA 1M3QA 2K9QA 1VQ8I 4AIJA 2Y4YA 4EJVA 3CW7A 5I9EB 1R0BG 2Z0WA 1TKXA 2EPDA 3NQOA 2W6KA 1MD0A 4CFDA 2P7VB 4XTZA 2AJQA 2I8DA 5CIUA 2PVOB 5HDNA 3G1MA 5DLOA 3SQ0A 4GO1A 1B9NA 2DETA 4M7AC 3MEWA 3GF5A 1ZRFA 2OUMA 3FXMA 4OF1A 3F6VA 2DMNA 2IXSA 3BJ6A 1RBUA 2LRQA 3DEWA 2O4GA 1VAZA 3V1RA 1R4MB 3ZQGA 3IKVA 3LWMA 3OSVA 3GDQA 5C25A 1K8AO 3BR5A 5KVRA 1TU0B 2HF4A 3CCVI 2YHXA 2CQQA 1NE8A 2JTVA 2E10A 2BANA 5A2QE 3RMCA 4MHGA 4DFMA 2LY9A 1LFPA 1SFOJ 5IOYA 4I9LA 4DJAA 4ITVA 1NK6A 3O1WA 5AQRA 4QKUA 3ERMA 2JA5J 1UA0A 2OPSA 1MWKA 2M4GA 2OV7A 1VQPA 4M7DC 3O3GA 2NOGA 5D7UA 4C9YA 3L2RA 1GXQA 2E1ZA 3KK3A 2NXNB 2JUGA 3A1PA 2IVWA 2MCNA 3CCVN 1HX1A 3HTVA 2PJRA 1QHGA 1QVFS 3KEQA 4A69C 2HHHK 2EFOA 1K0SA 2X6WA 3RDVA 2ZSIB 1JJ8C 3VYUB 5HRPA 4YIIA 3FJPA 2AO9A 1KC8R 3EG0A 1SEMA 2HFHA 5KQ8A 2EYQA 2ASMA 5HLIA 3OOPA 2JMCA 3ERED 2FSJA 1ATSA 2PMZA 2OTLT 4DHYA 3VB2A 2OU2A 3J7YJ 4RBOA 4HCCA 3CVTA 3ABMH 1FOYA 2OTJT 5GMKl 2L4MA 3WTXC 2HHUA 3NWTA 4B9XA 4CGHA 4O44A 2DK3A 1YJNA 3TPQA 3IP4B 1X3ZB 2YU9J 3VS2A 4CHYA 1QVGM 4XKBA 2KIQA 2YI1A 4X0GA 4JI0K 2YNFA 2DVJA 5ICCA 3WU1B 3HBTA 3K9KA 1TWHJ 2ZNYA 1B9DA 1QHTA 3A4CA 4AF1A 2EKOA 4M78E 4HNUA 1C0GA 2L3RA 3CCRA 1WLJA 2ZBKA 4FYWB 2DBBA 2RQVA 1Y8QB 1TQMA 3SQ2A 3I5RA 4UUSB 1POGA 2P9KB 3OYDA 4JV5K 4I6MA 4CEOA 1IN5A 4XQFA 5IHIA 1VSMA 2NRTA 1Y7XA 3CWSA 5GP9A 3FXUA 4CGIA 1LVAA 4PKGA 3G7ZA 2YHYA 4OU0A 1T6DA 4WCEL 3QWYA 5EJCA 1VQ7A 3GX4X 4KUDK 1XGOA 3M4YA 1GUUA 2P81A 2BKDN 2DK5A 2OPRA 3WHCA 5LMNK 2RREA 2VI6A 4DTOA 4I0AA 5KGXA 2FBHA 1FMWA 5HRSA 1WSJA 3W6JB 3VF6A 2HQRA 3EKUA 2CP5A 1IN8A 3LLRA 3PNWC 2ESNA 2MLKA 1OEBA 3PUFA 4Z8AA 3CC2Q 1YJNI 2MC3A 4K25A 2EV6A 1ZYQA 3JRFA 2AZVA 2XDBA 3SBGA 1WQ7A 2BY2A 4DMNA 3HEFA 2ZXHA 4NUBA 2H56A 4DTMA 2M8GX 4BDPA 5FWCA 1A04A 2GBQA 1A5VA 4L9TA 3ULEA 3JCMV 3V9UA 1ZUYA 1H1VA 4AT1B 4EVIA 4CEAA 2BY1A 4BR2A 2EGCA 3LQQA 3QP5A 2P51A 3SQ4A 3IRXA 3F8MA 1T0FC 4JKAA 3OS0A 2XICA 2YSQA 4L0ZB 1VRUA 1J0RA 3W6VA 4W1UA 1I3QJ 4B22A 3LQRA 2ZPFB 1HJDA 4OFEA 1WSEA 3HJFA 1K83J 1JCGA 1EQYA 3CQ8A 1BYMA 2QENA 5CQGA 1QSSA 2NYSA 5AQOA 3OW2M 4BQOA 4J01A 2YHBA 2VWKA 3U9GA 1RC9A 2XRIA 3CMEQ 4PWDA 1TWCJ 2QYOA 4ZTJA 4CZHA 2VJ5A 2VUMJ 4KI6A 4KTWA 1RAFB 3EPZA 2FF6A 2Q97A 2STWA 5L8RE 2X3WD 1G2BA 3DFGA 2L2OA 2G7UA 1ETQA 3CD6T 1RADB 3QYHB 1WI9A 4FWLA 2NLUA 5HNHA 3OYBA 1QWFA 5A0LA 3QYBA 1NGNA 3H41A 4IUQA 5CVJA 3HL2A 1NBEB 2KXCA 3META 3PNTA 2ZPGB 4WFNL 4C3JJ 1QVFP 3MZYA 4JNEA 3WVDB 3CBPA 2V26A 2RKHA 4A6DA 1BK2A 2D5RA 2DVEA 1PM3A 1GRIA 2CG4A 1ETKA 2W40A 1JT0A 1WKMA 5LJ5j 1IZ1A 3QESA 3JSMA 2ZJQL 4BRHA 4D1QA 4A4GA 2H6BA 2DPUA 1W97L 2X35A 3RQ4A 4ESBA 3PSFA 5FKKA 5GAGP 2P9PA 3OL3A 3B6AA 1QVFA 2L4AA 2LNBA 4CZGA 2Q0UA 1VQ9N 5K7FA 2HEOA 2X6XA 1CF7B 4TVRA 1S1NA 4IQ4A 2Z99A 2DOEA 2J5PA 3JB9J 3IH2A 2RC4A 4LSLA 3CCUT 4OGCA 3GZNB 3MCPA 1UWBA 2D6FA 4ZGEB 2QWWA 2JS0A 3ZT1A 1G3TA 3KYCB 3EO3A 1G3SA 5LJWA 3DBRB 4FJIA 2DXBA 3KETA 4ESJA 1PCXA 4WQ5A 5HKCA 2NRVA 3EZWA 2Z16A 4BEHB 1Y96A 3C94A 4FU6A 5LFAA 1WZ2A 3CJTB 2F2WA 4ZN1A 1ZBSA 1QZ6A 3IUCA 4E7LA 1U8RA 1FKPA 1C0MA 2YDLA 1LEAA 2LRDA 5A2QK 2DXTA 3WNFA 2D1HA 1D5VA 5KYYB 4DUZK 5GAHP 4W5QA 5J2MA 4P9UA 4P5NA 3MN9A 3I53A 2I2LA 3ABKH 3HT3A 5DUKA 4CJPA 4OMOA 3K4JA 2XHKA 2RQRA 1KQ2A 1QLYA 2YHTA 3NDKA 5AR0A 1OH6A 4N56A 1VQOA 4CF0A 4CVNE 5EY4A 3EG1A 1ZHFA 2ZO4A 3KNTA 1HF0A 4CC2A 1OYIA 2COYA 5CYVA 2X4JA 2G8HA 3VPZA 4XLAA 1J9AA 3G6EI 3K2PA 2YUPA 3DLGA 2PLYA 2O8KA 3OW2A 3I8BA 4N4OB 3CQZJ 2ISZA 1IKVA 3JCMP 1D1CA 3HK2A 3UKRB 1YE9A 3VGMA 1LDJA 2BXZA 2P9SA 3CCJI 4PSXA 2NOZA 3VYHB 1R59O 4M9ZA 3ZPLA 3HZ6A 1M90O 1WNSA 1W4MA 3MK6A 2NRXA 2HBJA 3JYTA 3ZSXA 3FLGA 4XLHA 2FBXA 3UT1A 2A1RA 4XLEA 4Q5VA 1XNQK 3DBHB 4GV3A 2VOOA 5LL6S 4JK8A 2MG4A 1WZOA 2FHDA 2XGEA 1ZBFA 1TXQA 1OCZH 2NVTJ 1VQ6T 2FQ3A 4B9UA 3CXCM 4F93B 2VXZA 1ABQA 4BG9A 1KQJA 1MPGA 1R7JA 2E6MA 4XU1A 2JT4A 3BUZB 2I0NA 2FO0A 3M8PA 5LJ3f 1NGHA 2A28A 1E3PA 4ELYC 2HW3A 4F3QA 2RQTA 3O6WA 4CGGA 1G3WA 2P5OA 1YW7A 4DGWB 4JKCA 4LMYA 3EL2A 2XKOC 1K78B 4FM2A 3LL3A 1HYZA 3U3YA 2Y0SN 2MFZA 2OPTA 1RI0A 4BJTA 3M57A 3I4NJ 1XGSA 2OPQA 1R5GA 2LSNA 2N8GA 3O3FA 4FJ5A 3I55A 1I6HJ 5ADXA 1OLTA 4GBQA 1YXQA 3TSPA 4KBOA 3HRTA 2EZLA 1WHMA 1VQLA 1T03A 5CVUA 2UXXA 2FNAA 2OTJN 5LJ5f 2KYBA 2WY7Q 3K4NA 4Y13A 5E18F 4M77B 4CJUA 2XHIA 3CVSA 4IOXA 1X4PA 1WFWA 1SHFA 4QW2A 2E2NA 4OB3B 1A0NB 1U2VB 4PFOA 4FK4A 3LSIA 4IX7A 1RRSA 3OH9A 2LP0A 3JCMW 1V4TA 4M3YA 5DM6L 1JCFA 3AA5X 4EA5A 4M7DE 1N33K 2ED1A 3SCXA 2K5FA 4FLUA 3P7NA 2OBPA 3S8PA 4DEXA 4EJZA 4E2FB 1AZEA 2Z5UA 3A8YA 4EM1A 3SUOA 4N9HA 4B3XA 2O9LA 4YTLA 2VXDA 3E1YA 2V4JC 5IP6A 4B3RK 4OB0B 1FZPB 1M2VB 2NOBA 3MWPA 3K9TA 4IFYA 2O0YA 3O6BB 4G6DA 1V55H 2CU7A 2D0NA 1RETA 2HU9A 4XK8E 2E70A 5HY6A 4JP0A 2P9LB 2XF7A 2OA8A 5CVVA 2V6EA 3BF3A 3V81A 2L01A 3EE8A 2RKIA 4YORA 4CBWA 4NL3A 2EYZA 1WHKA 1KGSA 3RVCA 2IGOA 4LD0A 1TW3A 1EO1A 3K4CA 1F21A 4DTJA 2Y90A 4EV0A 3AO4A 1YJ9Q 3CFPA 4CZMA 2Y1IA 2W85A 2ROTA 2G9WA 3I4MJ 1VSLA 3ZOBA 3KD5E 1KYWA 3MN2A 1GBQA 3CIPA 3M8JA 3HXLA 1Q81U 1X4OA 5GMKh 2YG8A 2LTPA 4RAYA 4FWSA 1ZKGA 1OU9A 4KH4A 2M9HA 1G8XA 4OIRF 4ABZA 5F27A 4DQ2A 3TAFA 3AVIA 3UWNA 4IOCF 5J2QA 5D4RA 3CPFA 3OJSA 1Z77A 5BREA 3ZQIA 2ZM6K 3IV5A 3IAYA 3J7ZO 4K42A 1X01A 1OVQA 4LNPA 2HHTA 1QPMA 1I5ZA 4BY7J 2QCOA 3SYZA 1W5CC 1GFDA 3CCLN 3BY7A 2B4JA 2M7BA 2ZQBA 4EP5A 5CJ9A 3WHBA 2QF7A 3LOCA 3WUHA 3M4OJ 1Z05A 3I9V2 4M63C 3TW6A 2RHUA 2EJFA 2FU4A 2YRCA 3RSEB 2R5ZA 3J7ZI 1ZARA 1YI2N 4KHYA 1I39A 1VQNI 1N32K 2H27A 1I6XA 2QTDA 4ZYEA 1C1AA 3X20B 3VRYA 3VN5A 2F6CA 1FY7A 4CZKA 3Q9VA 4CEDA 2Y9YA 3RPUA 4IHTA 3VUBA 2QA4T 5AQJA 2QQ8A 1NK3P 4HKEA 4C1NI 4A2AA 3W3CA 1U9OA 3ZQCA 5D6FA 4GYIA 4M75C 3DLHA 1QA6A 4QS7A 4NDLA 2VKVA 4CYCB 1RL2A 3X2QH 2DAOA 4YOUA 2D8HA 3ER0A 2O8FB 4UNOA 3FZFA 1RRJA 4BRKA 3L2QA 4GVMA 3T0YA 4HT9A 4R56A 4Q48A 3K1PA 3LA3A 3X24B 2ZGWA 3FXKA 4PJOE 1NKBA 1XJWB 5GAMe 1LJ9A 3E2UA 3HOSA 3HHHA 3FC3A 3EN9A 4J83A 4DV6K 1U45A 3VUZA 3DJCA 5LBQA 3VF4A 5KN8A 1WYXA 4PKCC 3HGGA 1Z6TA 1BUPA 4N4HA 4M9SA 2MWPA 2V8IA 5FD5A 5BRFA 2WADA 1ULYA 5KN9A 3ZQQA 1D5YA 5IT9E 1RTJA 2Z1JA 2GA2A 4G94A 2PI0A 2EWNA 4G7HF 3ML6A 1F1ZA 4HV5A 2V1DA 2CO5A 2Y31A 4NS5A 5GMKj 2D9TA 4ZGDB 4M9XA 3DV8A 2CT4A 1SRMA 1W1FA 1FYNA 1VQKQ 2L0KA 4EMKA 3CMAQ 3I56T 1AEYA 4K43A 1GXIE 3EKSA 2OC6A 4M7DF 4UHTA 4EJUA 4OJRA 1D9DA 2PMUA 1I50J 1X1PA 2IW5A 3CMYA 3CC7T 4C8QG 1WBBA 3P39A 3L42A 3NF9A 2JZYA 1Z26A 2AQFA 3THXB 1M27C 1VFCA 2XG8D 1I4K1 4BQLA 4GGGA 4BNCA 4RTVA 4JKEA 1ONVA 2LG4A 2Q8KA 4RB1A 2DM1A 3HKZN 3UATA 3M8FA 5BPLA 1TV6A 1YQRA 1NGFA 1VSKA 1XSXA 1NH3A 4RAFA 1S6QA 1XWLA 2KMTA 3F70A 1UHFA 1YFNA 2ATCB 3PO4A 5AQMA 4M75G 1UGQB 1X2QA 1VQ8Q 4AM3A 4LUEA 1R1VA 2IA2A 4FL6A 1PNJA 4KRFA 3EGUA 1TKZA 4FLVA 2Z1HA 1CXQA 2GX9A 1ZN2A 5EC7A 4EVVA 1NJIU 1G4DA 3FM5A 3NBPA 3W6KB 1LWCA 3EG3A 2RK1A 1RDCA 2WOMA 5J2PA 1E3HA 5FLXZ 4JX5A 3JCMh 3OSGA 4YOYA 1NKEA 2E2OA 3U9DA 1OU8A 3M0QA 2E60A 4CHOA 3KK2A 2JM8A 3NAEA 2FUG2 3LSHA 4O5FA 3C65A 4BKXA 1K9AA 2RN2A 1E3OC 2JA7J 5AJ3K 2GIZA 2A3SA 3KX2A 4E1NA 4FISA 1M1KO 1AHJB 2JZ2A 5GAMh 1WH7A 1W2BA 1BISA 3R0JA 2O8EB 1FKOA 1S29A 1BCOA 3LDLA 4P9FA 2NRWA 2J6FA 1MBEA 3ZX3A 2OX7A 1ZLKA 3SDGA 2FOWA 1HR0K 2OI3A 3F5TA 3OOUA 4BH9A 4I98B 3DU5A 4CXFA 1LDDA 4PJOB 3LFKA 3HO1A 4ZZDA 4CFCA 1MBJA 2LJ0A 1HA8A 3VS6A 4G9ZA 3B73A 3D0SA 1A5WA 2NAZA 4FJNA 3FBIB 3Q0VA 4NOYA 1ZBLA 2D0BA 5B8HA 1K79A 4H8KA 1YIJQ 3QNOA 1BJZA 3HZJA 2DMQA 1M1KR 2MOXA 2VG6A 3OSFA 1T0JA 4AFQC 2HBPA 3EHRA 4IRHA 1J5EK 1WWXA 4IIMA 3CERA 2HVRA 1YHQT 2ZXJA 1BL3A 2CUZA 4Z0UA 1K8KB 2X85A 2GWRA 3I33A 5ILUA 2IGIA 1KQSA 2R7QA 2A08A 1SS6A 4JQFA 4IJAA 2EVRA 1BI3A 3ZN1A 1FT9A 2CGJA 2D1KA 4FO0A 3QXEB 4F7UG 2B9SA 4JD2A 3OR2C 4E1JA 3RR7A 3WQTA 4A5BA 1IG8A 1CKBA 1UG0A 3CMMA 3O8VA 3RMSA 2KJCA 5M9OA 2ZB9A 3EFRA 4B21A 1QWEA 3PNVA 4AQYK 1J9IA 1P59A 3HOXJ 1QRYA 4PNOA 5GIPA 1NG7A 4F3OA 1Y8RB 2OQRA 5L3GA 1TSFA 2JTFA 1Y1VJ 3CCRI 3I55N 1Q86U 2HD0A 3FSPA 1C0UA 4GY2B 4J2DA 3I3LA 2H3JA 3F8FA 2DCEA 3LAPA 1C6VX 2KT1A 4DQIA 5GPCA 5D5XB 3G4ST 4BDYA 2MGQA 3HYIA 1C0TA 2CW7A 1NKUA 4ZYDA 1I0CA 3A01B 2GEMA 3R8EA 4E3SA 5HROA 1ZXOA 2CZ0B 4II1A 3K70C 2JRMA 1BOAA 4CJ5A 4M73A 5J1UA 2O01E 1Y0NA 4IF4A 2GBZA 3P9KA 2HNYA 1KD1C 3VEWA 1UHSA 4CF2A 1N75A 3VESA 4U67L 3AVNA 4CEQA 3LM9A 2OAZA 4AHVA 4MTEA 1EX4A 1PVSA 3G71Q 2LC2A 2Q0OA 1TUUA 2WACA 5JI6A 1F5TA 4AHRA 3U1DA 4UUTA 4H0XB 3W2WA 1FIPA 2OCCH 4BGBA 5LGUA 3M8SA 5FU7B 2R7UA 5GAN7 1KFZA 2O4XA 5AQGA 3LAJA 2IPOB 4CJQA 4RCBA 3AV9A 5LEKA 2YJFA 1N9SA 2DOFA 2KI7A 2NNYA 1BI1A 2XHBA 4CECA 4X1EA 4DSFA 2IVPA 5E3MA 4BRDA 4M75A 2R7DA 4YELA 1W36D 2ZJ2A 4A3KJ 4M3ZA 1FTTA 3F73A 3OYIA 1D4XA 1WFXA 1UE9A 1DGWY 1MUZA 3L1AA 1M90C 3IG1A 2FPEA 2QDYB 3F23A 1J2XA 3VRZA 3E6MA 3FZMA 4DYQA 1AWCA 1Q81O 4M41A 2W0ZA 2V1QA 5JVHL 2KPMA 3E6CC 4EHTA 3A98A 1STZA 1J54A 4JUVA 2E4HA 4LD9K 2DAQA 3DPTA 3NTHA 1OYXA 1QMCA 1SSFA 2HHXA 2EYXA 1O13A 4IEJA 4ICLA 3U21A 4H4OA 2R93J 5HLFA 5B1AH 4HAMA 1Q18A 4FYXB 3ZT4A 1E0EA 2QEXQ 2A6TA 4PJNA 3IH4A 3JAME 4HYEA 2E2PA 2LKSA 4KH0B 1HNVA 4L8RB 4OMNA 4OKKA 1QGPA 4X62K 2KLOA 2K4BA 5F0HA 2ZD1A 4YHHK 1RDUA 2CP6A 1FWZA 4U0YA 4KMFA 1K9MC 2GQVA 1C0FA 4B1YB 4NCBA 3E6DA 4CHZA 1D09B 4H0PA 3MXIA 4Y3OA 5LJ3h 3HRUA 1BOTO 3ECHA 1Z7LA 1Z9QA 4BR9A 1DP3A 3IAM2 4M77E 5LRRA 5M1OA 3IWZA 1QO0D 4DF8A 2E6LA 2KQ2A 3SZGA 1LB2A 3DXMB 1X3WB 3GPLA 3OIQA 4EDUA 1PJRA 2F2VA 3RR6A 3C12A 3CCMA 2XO7A 5E26A 5KCOA 5DCMA 4YPRA 3P1GA 3EY1A 1HQEA 3VSLA 1OCOH 2HTJA 2LLKA 3K5LA 1D0ZA 4E7KA 3VODA 5KE2A 5J3LA 1R5HA 3V8KA 3KEYA 2O4XB 1VSEA 3IRRA 4NCAA 2VE8A 3NH0A 3TAEA 3LSJA 3H9GA 1HSQA 1IGUA 4BREA 2KIFA 1EF4A 1Y0UA 4CD1A 1IKXA 2KFNA 2LFBA 1SAUA 4B48A 3RTVA 4LFUA 5CKFA 3K4KA 3EHQA 3FXLA 4MTDA 1BI4B 1YRNA 2NZTA 4J19A 1QKWA 1Q9YA 4KHSA 4L6V5 1ASWA 5FPDA 3FK7A 3CD6Q 3I58A 1EBMA 1WSFA 5KE3A 2IC3A 4M75B 3CJ7A 2NNNA 3GTOJ 2A69F 3FHGA 1MBHA 1J09A 1HRHA 3NF8A 1UECA 2NVYJ 2M3AA 2FVUA 1YF5L 2EJRA 3H5AA 5A0GA 1EIFA 5C10A 1KG7A 3M54A 2FBVA 4M77D 3PQKA 1AVZC 3HOYJ 2ZKZA 2M1HA 2A7YA 1S7AA 4NLCA 2HL3A 4XQ3A 1KC8O 5HS9A 2BE7D 3HM9A 3NGPA 2DTIA 4IQJA 1KU3A 4BRIA 1LWFA 4BE0A 5FB2A 3WGHA 4HT8A 2HWVA 2UZKA 1X6GA 4C5EA 1W9HA 2UUZA 3TQ7P 1HJOA 3QQAA 5TISC 4O8KA 5CVRA 1KHCA 3L2CA 1FTZA 4A3GJ 3HXMA 2B8AA 2EFQA 3WEEB 3CMAN 1VQKN 1JLEA 4KH1B 2CZ7B 5C3EJ 1E6HA 1LCUA 4CSWA 1QPIA 1KQ0A 2NUZA 2IVOA 1OQYA 2F5KA 2P8TA 1VQNA 4M3BA 3LSMA 3X26B 3A8HB 1PUEE 3VU3C 3CC4A 3FE1A 4DK9A 3TO6A 4J9DA 3RMBA 5DMRA 1TG0A 1VK0A 3S1MJ 4PUSA 2YHWA 2QM3A 2EHGA 4WFBL 2NRAC 3FMRA 3VOEA 1S72T 3RMDA 2YUNA 1K73R 4OMMA 3ISNC 2KYMA 5KHDA 1BBYA 4WQ4C 3ZRGA 4M3UA 2NUTA 1I1JA 3HFOA 1A5JA 2LC4A 2J06A 3GTQJ 3A03A 1OR7C 4FQGA 2R7WA 3RKYA 5GAEP 3AVBA 2EYWA 3A5LC 2BBYA 3ID8A 5E20A 3MP8A 4DNCA 1CLQA 4AU7A 2V8JA 2XF6A 1HNXK 2ZPBB 3ZT2A 2X6SA 1UGPB 5GANe 3LWLA 4DSJA 1M3HA 5FW9A 1UG1A 3JCMf 2RI5A 1VQMA 2WY8Q 2E5QA 3CBMA 1S9GA 1M2OA 2FSNA 2FB7A 1B07A 1FK9A 3KD1E 1K73O 2ZCFB 2E88A 2JK3A 3EH1A 5ECAA 2QEXT 3M9AA 2ZGZA 4Z6YA 3CFRA 1BIUA 1HW1A 3QRFF 4J9BA 3LPUA 3H3UA 4CZCA 1VQ5I 3PIOL 4XKVA 4WE1A 1X9MA 2EZKA 2Q36A 4LDYA 3HPGA 4GVEA 3QEWA 1TAUA 2CUBA 1SFUA 3R1XA 1JXOA 4A4FA 4KUMA 1P7MA 2WSEE 1BL0A 3WE2A 2DTOA 3C7NA 4EJOA 3R3LA 2VGMA 1BIBA 3BG5A 2CP2A 4KB1A 1R22A 4N4IA 2ZJRL 1JUPA 5KRSA 3UKGA 1RRQA 2K7AA 3CM5A 3JTHA 1MGTA 5DS9A 3GBQA 2BTFA 4KB0A 4LDUA 3S2WA 5AONA 1K6OA 2HB5A 4EGZA 2PMZN 4BYYA 3CCMQ 1PUFA 1NG2A 2CH6A 2ZGYA 3GFJA 2V8KA 3FR0A 4LDVA 3PTAA 3SB2A 2JUCA 3OYNA 4LF9K 2CQNA 4JRKA 4FWPA 2KLAA 2QWOA 4CEEA 4NL2A 4E19A 4YFKF 1VRLA 2XSDC 3D45A 2OFKA 4ZDPA 2CGPA 2VXEA 5M5XJ 4NC7A 2DQLA 3CG7A 5FU7C 1RTIA 1FOWA 5GAOr 1JJ2P 2QLZA 3BPVA 1SRLA 2NRHA 3L4IA 4KREA 1RAHB 3O80A 4DTUA 2EIMH 3MN5A 3Q0WA 2IIRA 4JDSA 2K5CA 2RK2A 3A1YA 3TSZA 3NGYA 4PLLA 1ORKA 1SZ2A 3CDLA 3A2FA 3RWUA 3I4PA 4B8CA 4L9VA 1M9SA 3AG2H 4A59A 2XAHA 2O61A 3V7RA 1QQIA 4C2UA 4EMKB 2L3DA 4XEIA 4MEYF 4MDAA 4JKFA 3U6FA 5IYDJ 3HGYA 2EX3A 2XRNA 1XQPA 4DR7K 4CJEA 5CKEA 4HX8A 1OZ2A 4PKIA 4DR2K 1VQ5N 3NAUA 3OYMA 2QW9A 2GF7A 3MFKA 2MBFA 2DYSH 1CSKA 3FKIJ 1IXRC 2HL5C 2M9UA 1JL2A 2PFUA 1WIEA 3QEXA 2YG9A 4RM3A 4IZZA 1FP1D 1VQ9Q 1PU8A 3AT1B 3K57A 4Y1CA 3VTHA 3LDSA 3MX5A 1XC5A 2LJ3A 1JRIA 3CCJQ 3RKWA 4ZDLA 2DA6A 4MMKA 2LQKA 4D8KA 2FRYA 2I10A 2KAFA 4A6EA 4C3HJ 2W82A 2QWQA 3S1NJ 1RT6A 4FIBA 3LAKA 1B7TA 1X2MA 2X0LA 1OYWA 1W2BS 4XU2A 4KT5C 5CY4A 1RUNA 5J40A 4IUVA 4FW2A 2FMYA 3CC2I 1LV5A 3CXCA 1UJ8A 1UGSB 3ZETB 2VJ4A 3V42A 3CCSQ 1VIFA 2OANA 3S41A 4BR4A 2DPDA 3M8EA 3G0QA 3THKA 1XS9A 5GAOm 4M4ZA 4M78A 2B5JA 2IVMA 2GQQA 5L23A 2IPQX 3LH0A 2W24A 3D2FB 1XSVA 2FE3A 3UR3C 3GFIA 4C23A 3SJJA 1JTYA 4D7MA 4J00A 3B6PA 5E41A 3F8CA 1R0AA 3IL2A 4LD6A 5CPRB 4A3IJ 3OS5A 3G4SA 4PL6A 3UKUB 1SKRA 4ZH4F 4XU3A 2PX9A 4HW0A 3M0TA 3LDPA 2LH9A 1LVKA 4JZ4A 1YTAA 4KKOA 5TJJA 1SUQA 3S6IA 1NGEA 2LBFB 2ZZDA 2NWMA 4QVCA 2DIGA 4DOZA 3HB9A 4DB3A 1N77A 1M3BA 3GLXA 4Y91A 1KEAA 2ESHA 4OX9K 1S1TA 3T8TA 3FXQA 1ITGA 5J8CA 3V1QA 1YHQA 3U1KA 3SUNA 2E4LA 3IH3A 3KBGA 3ATUA 1YCYA 3F9MA 2PAVA 5BMZA 4CZLA 3N5BB 1U2WA 2XV4S 3D5LA 2VCPA 4V2FA 2JRTA 2K5IA 4JRPA 2L9SA 1TL1A 4RMNA 1TK5A 4PJOG 3SPZA 3CPWS 5IP9J 1YITT 1GL5A 2X9HA 3TKYA 4G12A 1ZA1B 5BOXA 2KRMA 4HQMA 4JI8K 1SMTA 1HPZA 1RTHA 5ICFA 2ZF5O 3I0TA 3FB9A 1TYQA 5EX5A 2R7RA 4O3MA 2I7PA 2HNHA 5HK0A 1G2HA 3NVKA 2RNJA 1XB4A 5ILVA 4C8QB 1SMYF 4RGRA 3MXJA 3IUOA 4IL6C 2V1UA 2Y48A 4DV2K 4DUYK 1H9TA 4X66K 4DW6A 1NK4A 5GAN5 3F8NA 4LITA 1RT3A 1QNTA 3I56Q 4ELVA 1B34A 4BXFA 1NJZA 2Z3YA 4CIEA 3HP6A 1W2BM 4DQSA 4C92B 2JSCA 2X1CA 1MW7A 2P9KA 3DM2A 1YQAA 1Z7UA 5GJWB 1U04A 2PJRB 1YW8A 4A62A 4FX0A 4Y7NJ 1X6OA 4E0DA 1VQ6N 4CBXA 4WXHA 3CC4I 1A6QA 4C8QE 3EG9B 1T44A 2ZC2A 4JI5K 4CZEA 1VQOQ 5LJ5d 1M5Q1 4FPBA 3R2XC 3L2UA 4FWNA 1QVFM 3QJYA 4RB3C 3D0PA 4OMZA 4LIUA 1PDNC 4FJGA 3DQVC 2ZAEA 2YT6A 5GAEJ 3JSPA 2RV8A 1Q95G 1WHGA 2QI2A 2KW4A 4MQ3A 4ZTFA 5FGMA 3P9IA 3DLMA 1WI7A 2BUDA 4Z02A 4DR3K 1YJWQ 2CRGA 3EFSA 1JXBA 4YOWA 2K9NA 1PC0A 4X6AJ 3WXLA 4B9TA 4BR5A 1TVRA 4BU2A 5IYCJ 5CKDA 3SEQA 4LC9B 2A68F 1JXMA 1NZ9A 4CRIA 3M5RA 2X1EA 4ILGB 3K4LA 2L7KA 1R9TJ 4DBFA 1ETYA 3NFCA 4M77C 2ZPIB 1I1SA 1YIJA 3G6EA 3SWNC 3ZMSA 1UGRB 3VA3A 4C2MJ 1T6SA 4B9LA 1YITI 4C8QC 1RNHA 2BVLA 3E1SA 3CJBA 1UAAA 3J81Z 4B1ZA 4QT7A 1K73C 1X43A 1SQKA 4Y1DA 2RH2A 2QTXA 3RRHA 2EYYA 3C2GA 4J2BA 1RPWA 3S2HJ 5BN8A 1IREB 3A5NC 4QQDA 2F8SA 5AQIA 2Q0RA 2OAWA 4WYBA 2X9DA 2VVKA 3LM2A 4B3AA 1BC7C 2XY5A 3RPUD 2V52B 3ULEB 4A4KA 3L6QA 3SEZA 1JGSA 1H8AC 3SJHA 2G7HA 3DLRA 4JI4K 1U5TB 1QW1A 4UY8O 2R5ZB 2IT0A 3QJ6A 4C5GA 3JREA 1RDDA 3W0LA 4E7JA 4M42A 4EZ6A 4C0FA 4UUVA 2R7TA 2F2EA 5EG0A 3PIPF 4RTYA 4DOVA 4ELZC 3PIOA 3AA2A 1UB4A 2HVHA 3JCMX 5E84A 2WAQA 3WTYC 2QA4I 1TUYA 5I3UA 5C4JJ 4Z4GA 2L9RA 2K3BA 5ELZA 1DJ7B 4M6VA 2XKOA 3QAHA 4DYRA 2KVQG 1BJAA 1UMQA 4I2PA 2HOEA 3VETA 1Q82R 1O1WA 2O31A 1H0MA 4OVLA 3O4NA 1TLHB 3F72A 4BUGA 5K14A 2BE2A 2JVHA 3P8DA 3F21A 3H3NO 2K3XA 4PFPA 2FBKA 1BI2A 3VEZA 1MMGA 1WH5A 4AWXB 1L3VA 1TC3C 2LVSA 2VLAA 2DOAA 1BB9A 2YWWA 5KYNA 3HSTB 4JRQA 1B92A 1WUAA 1NYFA 5M3FJ 4FJMA 3BR6A 4KUIA 1ZLMA 4NQWB 3ZFJA 4G9YA 3M0RA 3BR2A 3MMVA 1NM7A 5KNLA 2P5LC 3HSEA 3CDHA 2LDMA 2LT1A 4MDXA 1KG3A 2DN0A 1VSIA 2V6CA 5IP7J 3QDKA 3DTEA 2IEKA 3EG9A 4F9OA 4A2BA 1A5XA 3AAQA 2P9PB 1GFCA 1R36A 4WCGA 4CYDA 3KVGA 1DIZA 2DXUA 1F4KA 4Y28E 1I07A 2JWLA 4GDFA 4M78C 2RB6A 1Y71A 2CYZB 2YS9A 3M8QA 2HQNA 5AN4A 1HLUA 1U9NA 4OVAA 5LGTA 5CHZA 3CCQA 5LJ3d 4EIAA 4J7IA 5CAIA 1X9SA 4FT8A 3NMUA 3OYYA 3T1HK 4C0ZA 4IDKA 1XHXA 2R58A 2FF3B 1VQ9A 2XIDA 2P9NA 1USSA 4PJOD 3TARA 4OAZA 2F48A 4KJZA 4CERA 3ENHA 4EEFG 3HL8A 1YIJI 4Y92A 4Y0WA 4JK1X 3LP0A 4HCZA 3JB9D 1JGGA 3CJRB 2DTRA 2VONA 1J5YA 5FJ8J 2ZJPL 3BG9A 1KAXA 2YUOA 2K9GA 3CQTA 1JL1A 1DT9A 2BOLA 3CFOA 5IT9Z 3EG2A 2W41A 2RN7A 4BQNA 2VXFA 5EYRA 4A4EA 1QQMA 5TGTA 1FJGK 2H8WA 4Z4IA 4B47A 4XN3A 3KK7A 5CYMA 3G4SQ 2V9KA 2KBTA 3KYLA 4QQGA 4MQ9F 1F9NA 5E1ZB 1VQNT 4PJOC 2I7NA 3PV8A 3RRGA 3ENOA 3GIBA 4CIFA 5J4YA 1KQSM 1UHWA 5IT3A 2ZXIA 4QQ6A 3ZMUA 3THXA 2CV0A 1VQ5T 5F64A 4Z89A 3E6BA 1GVJA 1N8RR 4BJ6C 4II2A 4CFBA 3KIOA 2EV5A 4RS8A 4DV7K 1VQLQ 4J6YA 2M45A 4EM0B 3CWUA 4AHCA 3JRIA 2RMOA 1HYOA 1UZCA 1ERDA 3DF8A 3GMEA 3GNFB 3M3ZA 2K7LA 3M1CA 1KSPA 4B9SA 1YBYA <