3OYBA

Crystal structure of the prototype foamy virus (pfv) intasome in complex with magnesium and the insti mk2048
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
368
structure length
368
Chain Sequence
LDAELDQLLQGHYIKGYPKQYTYFLEDGKVKVSRPEGVKIIPPQSDRQKIVLQAHNLAHTGREATLLKIANLYWWPNMRKDVVKQLGRCQQCLITNASNKASGPILRPDRPQKPFDKFFIDYIGPLPPSQGYLYVLVVVDGMTGFTWLYPTKAPSTSATVKSLNVLTSIAIPKVIHSDQGAAFTSSTFAEWAKERGIHLEFSTPYHPQSSGKVERKNSDIKRLLTKLLVGRPTKWYDLLPVVQLALNNTYSPVLKYTPHQLLFGIDSNTPFANQDTLDLTREEELSLLQEIRTSLYHPSTPPASSRSWSPVVGQLVQERVARPASLRPRWHKPSTVLKVLNPRTVVILDHLGNNRTVSIDNLKPTSHQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PFV integrase
publication title Molecular mechanisms of retroviral integrase inhibition and the evolution of viral resistance.
pubmed doi rcsb
source organism Human spumaretrovirus
molecule tags Recombination,viral protein/dna
total genus 107
structure length 368
sequence length 368
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2010-09-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
A PF17921 Integrase_H2C2 Integrase zinc binding domain
A PF18103 SH3_11 Retroviral integrase C-terminal SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2300 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3oybA04
1.10.340.70 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Endonuclease III; domain 1 3oybA01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3oybA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3oybA03
4Z4HA 4RW4A 3ZSZA 3P8DA 3MXIA 1JL1A 3HVTA 3ZT0A 4FLTA 2YV0X 3RMCA 1VSIA 3VQEA 4CGJA 2XY7A 5C6SA 1L3UA 4B9WA 4KPYA 4OKJA 1LAVA 3WNEA 3K59A 4QQGA 3OYCA 1WSJA 1VRTA 2DAQA 3OJUA 1U49A 3K5MA 3FFIA 4W5QA 4ZTJA 3ZSRA 2L8DA 1ITGA 2GV9A 3O8VA 1UA0A 4B08A 3AA2A 3AVHA 1KVCA 3DYAA 2PZSA 2RO0A 1UAXA 4DFPA 1H3ZA 4H4OA 3H08A 4N5SA 3DLMA 3E9FA 2VG7A 1J54A 1RCHA 4M3RA 4DFKA 3QKJA 5C25A 2XHBA 5IN1A 1Q8IA 3SV3A 1TKTA 2XY5A 4LY7A 3DRRA 3SI6A 3AVLA 3TANA 4CK3A 1Z25A 1LWCA 3DOKA 3NHGA 4DS4A 4DTJA 3NGYA 3NF8A 3PV8A 1B9FA 3MEVA 2PYJA 3L2UA 2YNFA 4E19A 4Z4CA 1QTMA 4CIGA 3L2WA 4W5OA 4CCHA 4DQSA 1HQEA 1VSEA 3T3FA 4C5HA 1C1BA 3LP1A 1LW2A 3K5LA 2R5AA 1RTIA 4PQUA 1KVAA 1S1UA 2KFNA 1BL3A 1FKOA 4FVMA 3UT1A 1WSIA 2R58A 4OPJA 3OB9A 1NK8A 4Z4GA 2K3YA 2XDPA 4DQPA 4Q5WA 2P1JA 4PY5A 4W5NA 4CFCA 3HJFA 2W42A 1DTQA 3LANA 3OYMA 3OJSA 3TAEA 4JRPA 1VSFA 3TI0A 3QIPA 4O55A 3RR7A 1HJRA 4F3TA 5HRNA 2YHBA 1CXQA 1KFDA 3KK1A 3QINA 4HCCA 1ZYQA 2X6NA 5K14A 1U04A 4DTSA 3SQ4A 2QQSA 4CJLA 1X9MA 3WNGA 4BDZA 1JLAA 3VQPA 3SQ2A 3LX7A 3TAGA 3QERA 3ASKA 2E6MA 4CHZA 5KE3A 2KW4A 2IAJA 4CJEA 4HUEA 4E7KA 5KCHA 1ASVA 2EQMA 1WJQA 3VQ6A 1R0AA 4H8KA 5HLFA 4PLIA 3BGRA 3OYNA 3LWLA 1N6QA 1RNHA 2DIQA 1HYSA 3V1QA 3V1OA 3CFPA 2X35A 1HQUA 5CYQA 4ELTA 5C42A 2E6NA 2PQWA 2Y1JA 4CF2A 4NZGA 3CEYA 3V9SA 3NF9A 3NBPA 3MP6A 3CYMA 2XK0A 1TL3A 4FJ5A 1OI1A 3PFSA 4KTZA 4OKKA 3E01A 1A5XA 5JS2A 4FJ8A 3V6DA 4GVMA 4FLXA 4OJRA 2EQJA 3P1GA 4IFVA 4N41A 2ETJA 3PMIA 3AVCA 2EX3A 2X4YA 4FU6A 4IUUA 1RT1A 4FLWA 3NNQA 4N76A 4IG3A 3VQ9A 1IG9A 4F2RA 3QEWA 3OYKA 2YNHA 1SSFA 3KUFA 2RJFA 3AO2A 4OGEA 3DI6A 2HHUA 3VQBA 3FC3A 4I7FA 2DTUA 2F96A 3MEWA 3RTVA 1JLCA 4I9LA 2VYTA 1TVRA 4N4HA 3SCXA 2B6AA 1TAQA 1SUQA 1A5WA 1CZ9A 4FK0A 4E0DA 2D9TA 5KTQA 2D0AA 2E5QA 1YTUA 1Q9XA 2G8VA 4FJ9A 1NK7A 5KI6A 2YRVA 4GMJB 3OYDA 3EZ5A 2G8IA 2XRIA 4F2SA 4M3ZA 3TABA 3LZJA 1C1AA 4BD3A 1U4BA 3ITHA 1RT6A 1L3VA 1QSSA 2R7YA 2LTOA 3BDLA 1D9DA 2OYQA 4PL6A 3QETA 1FXXA 4BE2A 3JYTA 1NK9A 2HVIA 5HROA 1WAFA 2GFUA 4BE0A 3PY8A 3F73A 2HNDA 3LP3A 5CIUA 2E4LA 4FJGA 4PLLA 2VG6A 3AVBA 2M0OA 2HHWA 4IUTA 2VG5A 4FJKA 1QS4A 2LDMA 4J2BA 4NS5A 4FZXC 1TGOA 4HUFA 1NOYA 1S1TA 2HB5A 3PMTA 3SUPA 2D5RA 5HBMA 4HCZA 4GW6A 3V9XA 3DLKA 4Y1CA 4FM0A 4AILC 5J1EA 1IH7A 3SYZA 1JXEA 2BGGA 3RMAA 1SKWA 2G8KA 4KI4A 4BWMA 4JRQA 1VSDA 4EP5A 4AHVA 2FHDA 4I2PA 2G8HA 1L3SA 3C95A 3VQDA 3QEIA 3V9UA 4R5PA 1NK6A 4CK2A 3OY9A 2HNYA 2B8AA 5I3UA 3QEVA 5HRRA 4DTNA 2F5KA 4M41A 4FM2A 3MXJA 3HM9A 3MEUA 4CK1A 1JKHA 3M8RA 4DTOA 1T03A 1EX4A 3LH0A 4OLAA 5FDLA 3ULDA 2O4XA 2BIVA 2KQ2A 3META 3OQ5A 4DU1A 3T1AA 3PX0A 4OKEA 3ZSVA 1TK8A 4IFYA 3LDSA 4FZZA 3KKRA 4Q0BA 2HHTA 4Z4EA 4DS5A 1HNVA 2HQXA 2RJCA 1TV6A 1ZBIA 3QIIA 4E1NA 4DTPA 1ASUA 5J2PA 1CXUA 1TKDA 1LWFA 1NKCA 5D6YA 4C5IA 1RBUA 3PX6A 3D45A 3ZT3A 1NK0A 2YKMA 4QQ6A 2OPQA 5E41A 2HHXA 1WSEA 2WACA 5SZTA 4FJ7A 1WJRA 4AHTA 4E7JA 4B9MA 3QO9A 3V9ZA 1WAJA 1KLNA 2ZE2A 4KHNA 3KKSA 4HTUA 2ATQA 4B9SA 3MEGA 3NTKA 4N47A 4IURA 3ALYA 3S3MA 3O4QA 3ZT1A 3OYJA 2RI5A 3K5OA 4JLHA 3CG7A 2IGIA 1OZ3A 2VWJA 1IKXA 5D6WA 3B6PA 2IS3A 3M8PA 1LV5A 3KLEA 4DSKA 3U3YA 4CEOA 3HPHA 4DG1A 4AHRA 4EP4A 3NH1A 3OYBA 2R57A 1MHNA 4KFBA 3KLFA 2O4GA 2NLUA 1BIZA 4UC4A 2Z1GA 3NDKA 1HNIA 1OYXA 2RHZA 3MXMA 3AVGA 4O0JA 4CJUA 1RT7A 1DLOA 3ZCMA 4FW2A 3TR8A 4HHTA 4OPKA 2YKNA 3VA3A 4KHYA 4IKFA 2OA8A 3OYAA 3DLGA 4DF8A 3FDRA 4A4EA 1VSKA 3NAEA 4YFUA 3M8QA 1J5OA 1WLJA 3OMCA 5CY4A 1Q9YA 4KO0A 3OYIA 3EYZA 4CERA 5M9OA 1QE1A 3VQ4A 1ZBLA 3I0RA 1S5JA 2X74A 2CKKA 1WSFA 2DFEA 1MU2A 2EKOA 5J39A 2WOMA 1T8EA 4F8RA 4BE1A 3MP1A 4M3YA 4CEBA 5KGXA 4KREA 4C5GA 4B3OA 4PWDA 3M9QA 2DFHA 1S6PA 1N5YA 1TKXA 3S3OA 3ASMA 2Z1JA 4DQRA 1EKEA 2XY6A 3MECA 3OYFA 3FEOA 1ZBFA 2HHQA 3SZ2A 1WJSA 3QNOA 4B9LA 4E1MA 4AHSA 5C24A 4KKOA 3IRXA 1YVUA 3H6ZA 1EP4A 3DLBA 4BWJA 1BI4A 3HYFA 3LAKA 2RJDA 2LRQA 3LYIA 3AA3A 1BQMA 5KGWA 1NOZA 4M3WA 1HYZA 3H8ZA 4ZHRA 4CF1A 1VSJA 2RI2A 1BQNA 1SL2A 1I39A 1HRHA 4CGGA 3TAQA 1SKRA 3NCIA 1WSHA 2KTQA 3ZT4A 3RMBA 1IO2A 4E7IA 3T19A 3OS1A 4JS4A 3I8DA 4Z02A 2I5JA 1RDDA 4DSJA 3PNWC 4DF4A 2ZD1A 4Y1DA 3KK2A 1BISA 2HW3A 1C0MA 2M1HA 3AO4A 4LH5A 4CJ4A 4CJ5A 1DTTA 4CJKA 1T7PA 1XI1A 4FJLA 2BKDN 1UA1A 3UWNA 4OGCA 5CZ2A 3GOXA 4AHUA 4ELUA 1B9DA 4MFBA 3TAMA 2GUIA 1TK5A 2Y1IA 4IUPA 4IG0A 1ZBUA 4DU3A 1TKZA 3HO1A 3SJJA 4RW7A 2FBYA 2JTFA 1JXBA 3DRSA 1RT2A 3C4SA 4FXDA 4KHUA 4CGDA 1KRPA 3VQQA 1L5UA 3IG1A 2Z1HA 4WE1A 1JLFA 3HSTB 2QKKA 4C8KA 2BE2A 1BCOA 4PA1A 1I3AA 3AVNA 2K3XA 4L8RB 3C94A 2RHUA 2BUDA 4II1A 3QIOA 1O1WA 1IKVA 4CEEA 3OYLA 3P83D 1VSHA 1X1PA 5J26A 4FCYA 2KZZA 2IDOA 1ASWA 3NE6A 3HPGA 1IKWA 3HP6A 3AVMA 3BDPA 3SNNA 4B9UA 3OYEA 4FW1A 4CJFA 4CHQA 2AJQA 3DLEA 3WNHA 4DTRA 1WSGA 5HP1A 3THVA 1X9SA 3RMDA 3DLHA 2G8WA 3HXMA 3AA5X 2RHXA 3SV4A 1REVA 2YHAA 4Q5VA 3O3HA 1NK5A 3U6FA 4AHCA 3ZSWA 1Y97A 2HVHA 5EU7A 3RR8A 4CJSA 1OZ2A 3AVFA 4CF9A 3HPOA 3OA6A 3G0ZA 4N56A 3DB4A 4QAGA 3M8SA 4ZTFA 3MP8A 3WNFA 4FL6A 2LSNA 3KLIA 4XIUA 1KCFA 4DWIA 4LSLA 5I42A 3QBYA 2HHSA 4FJMA 1SKSA 2X6SA 1HMVA 1SL1A 1NKBA 5FROA 1QSYA 4QOZB 3NTIA 4B9NA 3SD4A 4LH4A 1HYVA 4CGFA 3TAFA 3HVRA 4I9QA 4KAZA 1KHCA 2WONA 3QLHA 3KLHA 2DIGA 4LD0A 2MWOA 3F70A 1S1WA 3LP2A 4CJPA 4N4IA 1NKEA 3DM2A 2JLEA 2M16A 3HP9A 4M42A 2DY4A 1XWLA 3B6OA 4B9VA 3TAPA 4OVAA 1S9GA 3C6UA 1NJWA 3LLRA 2X4WA 4HUGA 4FJNA 3MEDA 1Z26A 2XY8A 4F4KA 1QQCA 3SPYA 2GBZA 2JZ2A 3QNNA 3RRHA 2VWKA 4CJVA 5SWMA 2P51A 3AO1A 2HNZA 5KE2A 1VK0A 4DU4A 1K6YA 3O3FA 4NYNA 1RDAA 4FYDA 1L3TA 1XHXA 3QESA 3C6TA 3UIQA 3K58A 3MAQA 4HCBA 3RRGA 4H4MA 4UQGA 3OMGA 5FRNA 1C6VA 4NYFA 3LWMA 1LWEA 3SUNA 1RT4A 1TL1A 4E89A 1S1XA 1GOCA 3OYGA 1HPZA 1U45A 2Z1IA 3QEXA 2BDPA 3AVAA 4ICLA 1QSLA 4PUOA 1JLBA 4B9TA 3VN5A 4IBNA 2DFFA 4B8CA 1F21A 2PY5A 2X78A 2BANA 2QK9A 1KTQA 4DFJA 2HHVA 4O4GA 3K2PA 2EQUA 1GOBA 3ME9A 1IKYA 4CHPA 5CZ1A 3NFAA 4B9XA 4A4GA 1BHLA 3EY1A 3VQ5A 4EZ6A 4L59A 4CFAA 4QVZA 2IG0A 1RDBA 3VQCA 1BCMA 4YNQA 1GOAA 5J2MA 1NJYA 2RHIA 4DQQA 2Q3SA 2XO7A 4FLZA 1RBTA 4CF0A 3SQ1A 3LP0A 3V9WA 1G5VA 1LW0A 1JLEA 3K57A 4W5RA 2OPPA 1D8YA 1XNIA 4FZYA 3V4IA 2LVMA 1TK0A 2A1RA 4CGIA 3PO4A 1JLGA 4DTMA 3AVKA 4RG8A 3L2RA 1C1CA 2LCCA 1A5VA 3I0SA 1S6QA 4E3SA 3AO5A 2RJEA 3LPUA 1KVBA 5KRSA 4C5EA 4KTWA 3KK3A 4LD6A 4JS5A 2YNIA 4KRFA 1N27A 1YTAA 1NJZA 2RI3A 4O44A 5KCOA 4EDUA 4NCAA 2OZMA 2P5OA 2FBXA 4CESA 2EQKA 4CJWA 4OVLA 2OPRA 1EETA 3MEEA 2RPIA 5KH6A 5DMRA 4AH9A 4CJ3A 2OPSA 1EXQA 3QJ6A 3LALA 3CFOA 3CQ8A 1FKPA 4C8LA 4Z0UA 4CJTA 3DRPA 4ID5A 3L2QA 4RW6A 1J53A 3VQAA 1JL2A 3HK2A 1B92A 1D9FA 2D0CA 3VQ7A 3KIOA 4CJQA 4DSLA 2JGUA 5HRSA 2QKBA 3ISNC 1RT5A 3ZEHA 2FC0A 1VSMA 1J9AA 4C8MA 3O3GA 4M3UA 4CEQA 3PUFA 4CEAA 1X9WA 2E6LA 3AV9A 4DQIA 4LSNA 3LGFA 3K5NA 3OS2A 1WGSA 2RF2A 2L3RA 1T05A 3Q1JA 4DFMA 1LAWA 4J2EA 4FK2A 3TARA 4A4HA 3EAEA 4HVJA 1UWBA 1RTHA 2X4XA 3L42A 4FJXA 4CJRA 1TAUA 3ZSXA 3S9HA 4FK4A 3DLRA 4I2QA 1BI4B 3S6WA 2G3RA 4FM1A 1XC9A 1JLQA 1C0UA 4DLEA 4DSFA 1NK4A 3CFRA 4KB0A 4KHQA 2G8FA 4CRIA 2KZMA 4KI6A 2RKIA 4IUVA 2G8UA 4DSIA 3OYHA 3NGZA 1WN7A 2IC3A 1CLQA 3DMJA 2NUBA 3OS0A 4CEZA 5C0MA 3SUQA 3IAYA 1FK9A 4M45A 4O0IA 4BDYA 3MEAA 5DK5A 4CGHA 4Z4IA 4TSXA 3AA4A 2KFZA 3NH0A 3SPZA 3SQ0A 3S3NA 3TWHA 5T7BA 4W5TA 1D5AA 3AVIA 1VSLA 3CM5A 1KSPA 3E9GA 3KD1E 3AVJA 3NTHA 4CECA 2PYLA 2P0KA 2FBVA 2RHYA 5J2NA 1CZBA 2IOCA 5KRTA 3VA0A 1YT3A 5FRMA 3ZSOA 4DTUA 3L2VA 1RDCA 4FJJA 4J2AA 4IUQA 4ELVA 4RG2A 4RW8A 1S1VA 1RBVA 3ZSYA 3QEPA 3NH2A 2F8SA 2GFAA 3V1RA 4K8ZA 2R5MA 4M3TA 4CEDA 4QQDA 4OLBA 3PX4A 3P8HA 4KTQA 3KJVA 4N4GA 1KLMA 4FLUA 1VRUA 3PO5A 2A1SA 4ID1A 2HQEA 3L3UA 4J2DA 2HMIA 2OZSA 3RWUA 3CM6A 4A4FA 4O5BA 3JSMA 4KV8A 1BGXT 2QXFA 1XHZA 4FJHA 3D0PA 4FJIA 1RBSA 3LPTA 3L3VA 1U47A 1WNSA 1UOCA 4DMNA 3DB3A 1S9EA 3IS9A 5D3GA 2B5JA 4EZ9A 3A2FA 1KFSA 4Z4FA 4KHSA 1ZBHA 4CFBA 4E7HA 4FLYA 2P5GA 4G1QA 2L89A 3FLGA 4IDKA 4CFDA 1U48A 4KHWA 2EHGA 1RT3A 2GF7A 1RBRA 1C0TA 4GY5A 3LAMA 3OVNA 3G10A 4CEFA 5HRPA 4QW2A 3F9KA 4C8OA 3DOLA 3P5JA 2ITGA 2QQRA 3O4NA 3LGLA 3KD5E 3HT3A 1RI0A 1QHTA 3ZSQA 4CHYA 3HL8A 4FLVA 4K8XA 5JS1A 2YNGA 2F8TA 2RN2A 4CHOA 3L8BA 3KLGA 4CF8A 1SV5A 5J2QA 4M3XA 1W0HA 3AO3A 4C8NA 1W9HA 4BACA 4DTXA 4QCLA 4NCGA 2EFIA 4CIFA 2FBTA 4KB1A 2ZQBA 4BDPA 5IAYA 4X34A 1NJXA 1G15A 4E7LA 5D6XA 4NCBA 2O4IA 4DLGA 2B4JA 4CE9A 1BIUA 3NGIA 3ZT2A 4DSEA 3SUOA 1SL0A 3MO8A 2MWPA 4MQ3A 1RTDA 3NF7A 3V81A 3U3GA 1RTJA 3LZIA 3KTQA 4B8AB 4CIEA 2D0BA 2O4XB 5CYMA 4F3OA 1RILA 4CHNA 3NF6A 3VQ8A 4RW9A
chains in the Genus database with same CATH superfamily
2ZCFB 2JHJA 4RW4A 1E2XA 3HC7A 3JCMP 1LWVA 1MW7A 2HFHA 1LE8A 3I59B 5C15A 1IF1A 4FLTA 3LM2A 3SB2A 4UUSA 1V5GA 1FW6A 3RMCA 4LOCA 4LF4K 3VQEA 3CBPA 5C6SA 2Z9OA 2WY8Q 2ZPBB 4B9WA 4OKJA 5E3MA 2Y4XA 3K59A 2LTPA 1AOYA 1WSJA 1AHDP 1TH7A 3TKYA 1WQWA 1VI0A 1XGSA 1U49A 2HDWA 3J7AY 2F5DA 3ZSRA 1UFFA 3KYCB 2DZCA 1ITGA 4JDSA 4OMQA 3CDHA 2PVOB 4DOZA 1G6NA 2RO0A 1FYMA 4M78E 3DPUA 5HNHA 1UAXA 1WX6A 3CXCM 2WBMA 2X6WA 1AWXA 4Y17A 2LT1A 3MX5A 2SEMA 4DOWA 1WBBA 4CBXA 1P4XA 2E2NA 1I3QJ 1U6GA 2K2MA 2QDYB 4I6MB 3BTLA 3DLMA 1WDXA 3E9FA 3G1OA 2VG7A 1PVSA 3CPWA 3FXJA 3IAS2 1RCHA 3H5NA 5GMKi 3N4QA 4M3FA 4C2TA 5J8FA 2XGCA 5A2QO 3QICA 5ADXA 3MWMA 2XY5A 1VQNA 1GHCA 2CH5A 4CK3A 2LCLA 1WJFA 3DOKA 1XMOK 1M90U 3E2UA 4LB6B 3CD6N 4DV6K 3N05A 5GPAA 2K85A 1B9FA 4RCHA 5AQIA 1JJ2A 4BGDA 4JD2A 2PYJA 3L2UA 2QWWA 2YNFA 4CCNA 1JGGA 4D8KA 4CCHA 2VB6A 3IUCA 1R71A 1LW2A 3E1SA 2EV5A 5ELZA 1RTIA 4PQUA 1BA1A 4A3FJ 2E35A 3I5SA 4CC4B 3KXTA 1NK8A 2CH0A 4L9VA 2V6CA 2K3YA 2UXDK 4BQOA 2ZKZA 4WQ4C 2BXZA 2H6BA 2XDPA 4DQPA 3URGA 2IJLA 4W5NA 3Q9VA 4CFCA 2ELKA 3CMEI 4II2A 2W42A 4R8HA 3ZRGA 4QS9A 3JB9I 3TI0A 1NLPC 2LD5A 3V4GA 5F64A 2P9PA 4BI4A 3QIPA 4UV8A 2ASOA 4O55A 1YRNA 4F3TA 2QCOA 5HRNA 4LK0F 2DXUA 2E5KA 5AQSA 1B34A 3KK1A 1N75A 3CCEI 3CCLT 2EQIA 3F23A 1ZYQA 1QVTA 3S1RJ 2FUG2 2HZTA 3CJNA 4BGBA 4DTSA 2MIOA 3IP4B 3EUKL 1AHJB 3H1VX 3EUHA 1VQ7A 1V4SA 2ZGYA 1Q1VA 1TQMA 1BDGA 2DRKA 1VQ4A 2RV8A 2EZIA 3QDKA 3TAGA 5C4JJ 1VQOQ 1ZA1B 1STZA 1REPC 4HT8A 2E6MA 1LQ1A 4KH6A 3NVKA 4DR4K 1YJNN 4M75G 1V1CA 2P5VA 1KAZA 4J6WA 1QHHD 4B43A 1GLBG 5GAN7 2BUPA 5KCHA 1U5TC 4IZZA 3VQ6A 3P9CA 3DKWA 4PLIA 1MDMB 3BTJA 3I5UA 4IXCA 1XUPO 3T7ZA 5LHHA 3V1OA 1DGRM 2DXCA 4DUYK 1N36K 2RC4A 4ELTA 4C1NI 2F69A 2Y1JA 1KQ9A 1WXTA 1N78A 4FWQA 3NF9A 1J2XA 3KYDB 4EVIA 3NBPA 3MP6A 1X1DA 8ATCB 4HQMA 4PK4A 4D6WA 4X1EA 1QZ5A 2YX4A 1HKTA 3PFSA 1HDDC 5ED4A 5C3EJ 1VQ5N 1A5XA 3F0CA 1PHTA 1U6ZA 2CRGA 5MLCQ 1HD3A 4X9DA 4M77A 5GAOn 5HDNA 3FXRA 3C12A 3WTWC 5GAMf 3CP8A 5GMKj 3G6EN 3S32A 3SFMA 4PGGA 1WHGA 2COZA 4MZTA 5E1WA 3HRSA 2COBA 2ASMA 3HBTA 1JT6A 4N76A 4IG3A 1MGTA 3I5RA 3LNQA 4UVAA 2FE3A 3OYKA 3QYEA 2ED1A 1K9MO 4HWIA 2QUFA 4JHDB 3N4PA 2YPRA 1KO9A 1XPXA 4OGEA 1M5Q1 1CGPA 2WC2A 3BT9A 1YQMA 3RTVA 1JLCA 5B3SH 3K4MA 3CC2N 1M1KR 4PJOD 4FK0A 4E0DA 3NARA 2Z33A 2QA4Q 2FBIA 4AG1C 4YY3K 4IHSA 3BC8A 1SVLA 2MC4A 3WXKA 3EGXB 2G8VA 1NK7A 4RGRA 5I21A 4GMJB 2HTSA 3O4WA 2DJIA 4KMFA 2EZHA 4B4CA 4F2SA 5FLXK 3TABA 3CCSQ 2LLKA 2BY2A 3S41A 1TSFA 1FMVA 3BDLA 1PVEA 3WTYC 1D9DA 4OAYA 3CERA 2BY0A 2HVIA 1SANA 4BE0A 2HPMA 3A5NC 2O8EA 1G8XA 3UKUB 2HNDA 2LQWA 3NPFA 4F04B 4PL7A 2E4LA 4OWRB 4M78C 4KGXB 3AVBA 4NXNK 4M7AE 1B3QA 3DU6A 3SLCA 2M0OA 3H0IA 4UNOA 2HHWA 3U1DA 2VG5A 4FJKA 5AIPA 3WU2C 2ETHA 1VQ8T 2LDMA 1TUCA 4FZXC 4KT5C 4X0GA 3SXYA 1TGOA 4RBOA 3LOCA 3VGLA 1V4TA 3CCQN 5FD5A 5JLHA 1J5EK 1GDTA 3K0LA 4BUPA 4LF8K 4EJOA 2CGHA 4FVUA 2NS8A 2ZJ2A 4GW6A 1O75A 3V9XA 1M90O 1HX1A 4OB0B 2VPLA 4AILC 3ZQCA 5IOYA 1ERDA 2R7OA 2A40A 3QQAA 2AXLA 3D5RC 4IVNA 2MMPA 1WUAA 2A0FB 3TU4K 2VV5A 1JJ6C 3HG9A 5EGOB 2WA0A 4WXDA 3C95A 3QEIA 1GLJO 1NK6A 3JXUA 3OY9A 4CZFA 3QEVA 4DTNA 4Y91A 4FM2A 1A6QA 2ZZDA 4P1WA 3HM9A 2E5NA 1BA5A 5GMKh 1KG1A 2MABA 5ICEA 3WXIA 5K1YA 2WWYA 3JRCA 1EX4A 1OPCA 3VERA 2BIVA 3S6IA 3H3NO 3ZX3A 2KQ2A 1Z1DA 4B1UB 1U5SA 2X1CA 1Y64A 5FLXO 4HNUA 1OH5A 1LB2A 3DKMA 3I56A 4FZZA 4JK7A 3KKRA 4Q0BA 4ZGEB 1I94K 2HSEB 3P31A 2NZTA 1OR7A 1X9JA 2V26A 3T1BA 3CCLI 2F2XA 2HQXA 2RJCA 4JEPA 5F0XA 4O8KA 2E6ZA 3QIIA 4K43A 3QYBA 1S72T 4ETSA 4KT6A 2ZNZA 4H5VA 5D6YA 1ZG5A 4F7UA 3CCUN 3ID8A 3EKUA 3GTOJ 2O8DB 2PFUA 1TTHB 3CESA 5FPEA 1JJ2M 2O6GE 3S2DJ 1G83A 1ZREA 1WIEA 3DBRB 2CUEA 1DEJA 5TKWA 1BJZA 4JYAK 5SZTA 2K9NA 1WJBA 2XPVA 4FJ7A 2MLKA 2NOHA 1OPLA 4AHTA 2O9SA 3CCRA 1XG1A 1SPKA 1D5YA 3QO9A 2ID6A 2H27A 2OTJQ 4H0YB 3V9ZA 3F72A 1KLNA 1SRMA 4HTUA 3MEGA 5FD6A 3NTKA 3IL2A 2IA2A 4RAYA 4PZJA 1YW9A 2QEXT 3RERA 1YS6A 1WJEA 3TSWA 3O4QA 4CBWA 2GBQA 2RI5A 2W0ZA 2YUOA 3K5OA 2Y69H 3H3ZA 3T9NA 3M8PA 1ETQA 2EIFA 4CXFA 1LV5A 2CZ7B 1S6LA 1T56A 2BGCA 2V75A 4AFSC 2X51A 4DG1A 3BTCA 4DB3A 5BMZA 1T8IA 4YIRX 3GTLJ 4C92E 4G6TB 3ABKH 2JVVA 1FWZA 2X4HA 1QVFM 1YLFA 3ZMDA 4BXUA 2QWMA 2JMAA 4UC4A 3A5MC 4IHTA 3T8RA 1E6GA 3ZX0A 3IKTA 5AFUA 3AVGA 1NG6A 2V9VA 4DR5K 3A0BC 1WBDA 1Z05A 2ABLA 2HYJA 1K76A 1VQMA 5LGTA 2KEAA 3LDQA 2VPRA 2JN0A 2O8FA 3S93A 3VA3A 4FWNA 4IKFA 1JKRC 2PU9B 2YUPA 2OA8A 4JKCA 2F4OB 2FXUA 4FL9A 1XQPA 1QVUA 3ZEUB 4J5YA 4IL6C 3FDRA 3KCCA 2ZM6K 1QNTA 1KXPA 2V7YA 2P0QA 2MH9A 2HSPA 3JRBA 4A3LJ 5ILVA 1I6HJ 3RESA 5TISC 3OYIA 1FP1D 3P9IA 5EDNA 4CERA 4RTXA 3WTVC 5IYDJ 2CKKA 1JEGA 1WSFA 1S22A 1LFBA 1P7MA 3CC4Q 4FX4A 2ZJRL 1JUSA 2WOMA 3B8AX 4F8RA 1Y57A 1K9MR 3A0IX 1AWCA 4C5GA 2KKZA 4BL0B 4PWDA 3EGDA 4ZZDA 2YJFA 2LKPA 1S6PA 1P4WA 2WY7Q 4C8QE 2GEMA 2BZXA 3OYFA 2HHQA 3SZ2A 1WJSA 3QNOA 4GCVA 2V7ZA 2CU7A 5C24A 2QGUA 4YPHA 3IRXA 3H6ZA 4ZC3A 4FYWB 1EP4A 3VYTB 3W2VA 1H89C 5H6QA 1BI4A 4Z2YA 2YX6A 3G4SQ 1YWOA 4B8XA 4HF0A 3A5ZB 3WG9A 2LMJA 1BQMA 5KGWA 1R59O 1X58A 1C0WA 3M9AA 3CC7A 1VQ8I 3CO6C 4ZHRA 2RI2A 1IRXA 1I0CA 2WB1N 4GLMA 3RPQA 2FZKB 3PIOL 2X9HA 1N9SA 4F9OA 4XR6A 2DD5A 2CWEA 1RABB 3TAQA 5CYVA 1Z9QA 2ZJQF 4M7AC 3U4LA 1Y1VJ 2M0CA 2E1CA 1WSHA 1MBFA 5ICFA 4Y52J 2DRMA 4FT2A 2KTQA 3RMBA 2EW3A 4DBRA 3K70D 3UKRB 5HVQC 2IS6A 3THXB 2OTLA 3I8DA 1RADB 5CR2A 4M7XA 4IHXA 3HI0A 3OL4A 1HCRA 1MNMC 4DSJA 1VA7A 1RDDA 2M45A 2LF7A 4JUVA 4XKWA 2VOOA 2XKPA 2LQNA 1FIAA 1HXDA 3F0ZA 2M1HA 3J7ZI 3AO4A 4LH5A 3HJEA 1NPRA 3J7YJ 4M6YA 2ROTA 1DTTA 2CSOA 4CJKA 4V2SA 4CCLA 5GINA 4BQNA 1M90R 4AFZC 2DMTA 2DBKA 3Q3SA 3UWNA 3GOXA 1YCYA 3TAMA 2X6YA 4OMOA 2MYSA 1FSHA 4JPBW 3PT9A 2Z1DA 2D0NA 2P9LB 1BU1A 5KYYA 3SJJA 4RW7A 2FBYA 1IN5A 2JTFA 4CDGA 4NNJA 3LSMA 3DEWA 2ZPHB 1FOKA 2PMZA 2P5KA 5M1OA 1KRPA 3VQQA 1VUBA 1VQ9A 3F8NA 4FWSA 5GAEJ 1L5UA 1YHQQ 3I58A 2OV7A 3ID6A 3MN6A 1JLFA 2KHOA 4C8KA 3FHFA 2VQHA 1S72I 4JP0A 4A3BJ 2LBFB 3SHFA 5LJ5g 2K3XA 1WJCA 1G2BA 4DQ8A 3C94A 1JTYA 2FRWA 4GNIA 3QIOA 2VI6A 3HOZJ 1IKVA 2QWRA 4CI0C 3P83D 4RTVA 5C0YA 3EYYA 2CREA 3VW4A 1ZK8A 2B0LA 4JLIA 2M34A 2CGJA 2M9HA 3A8LB 1IKWA 3HP6A 2ZO4A 3SMSA 3SNNA 5E20A 4B9UA 2DZ9A 4ON0A 2O9LA 1Q82C 3RSEA 2Y0SN 2DX1A 3JCMQ 1W6XA 1VQPT 2EYXA 4YFXF 2JWLA 2QEXI 3S1NJ 3THVA 1X9SA 4KRTA 3U23A 4KN7X 3DLHA 1JKPC 1XOVA 4RTYA 1U8BA 3D0SA 2RHXA 3SV4A 4BY6C 1O4XA 2EIJH 2N8GA 4AHCA 2KYMA 1RR8C 5CR4A 1ZGAA 3CF2A 2D2WA 1BI3A 3HPOA 1X1CA 5D7UA 3PIPL 3FZLA 2FEZA 2FO0A 2IT0A 4XU2A 3FKIJ 2M8GX 2D45A 1X19A 3DV8A 5GAMd 4LFUA 2P9KA 4BBRJ 2KXCA 1ZXOA 4ME7A 2LSNA 1Q1HA 2E2QA 1LDDA 1KCFA 2W85A 1W7PB 4XN0A 3QBYA 3HSFA 2QA4N 2M9UA 3DXJF 2ZMEA 2DA1A 2VXEA 2X6SA 3TTFA 1UHMA 2L01A 4NHJA 1SL1A 2JA2A 3SQNA 4B9NA 4JZ3A 1J75A 5C4XJ 3TAFA 4E70A 4KAZA 3HHHA 1NPPA 2JXBA 2WONA 2XI9A 1ZLKA 3CCSN 4BEHB 1ZR2A 1RDUA 4EHUA 3CD6A 2M0MA 2RQVA 4LDWA 1S1WA 3LP2A 5AQRA 1NKEA 1KQ0A 4XLAA 2DO3A 2TRTA 3LMMA 4NUBA 4CO8A 4L9TA 2NUZA 2GQQA 3B6OA 5AQPA 5CVRA 1PKSA 1Z9CA 2YG9A 2VE9A 4OVAA 3IFRA 1WQ2A 2MSYA 1S9GA 4A3CJ 1NJWA 4FJNA 1HSJA 3WTSC 3MEDA 5M1PA 1UMQA 2LR8A 4AYBN 4M7YA 3ULEB 5E3NA 4PL8A 5IPAA 2OX7A 5CQXA 2HDAA 2XY8A 3AG2H 1R1VA 3S1QJ 2KIQA 4M7DC 1QQCA 3SPYA 3TCJA 3RZOJ 3RRHA 2VWKA 4LN2A 4BI3A 1M9SA 3K9JA 5H6RA 2OJED 2XSJC 3GTGJ 5KE2A 5FPDA 3N97A 4LK1F 4DU4A 4JV5K 2W6KA 3DTIA 4FWPA 3JRFA 3I59A 2HEOA 3L0QA 2IGKA 2CFOA 2KISA 3IRQA 4G9ZA 1SAXA 1QWFA 2JM8A 4FYVB 2CFXA 4XRMA 2WSCE 2F5CA 4NYFA 1MWKA 2CUDA 4BXFA 3D7SB 5GAOq 4UB8C 4IIMA 4RTWA 2LC2A 4MLEA 1Q82U 2DN0A 1HPZA 1A35A 5AQXA 2RPNA 3PVLA 2O8CB 2KROA 2VYPA 1WGXA 3L4QA 2DQLA 2BDPA 2JSPA 3OBYA 1YJNA 1JLBA 2FF3B 3EGUA 4Y4RA 3VN5A 1GCQA 4CZZA 1EV7A 5LJ3e 3MCAB 1UGSB 1BI2A 2KLAA 4DCHA 4F55A 4C92B 2X78A 2BANA 4IIOA 4HTLA 2VCPA 1KTQA 2JUFA 3K2PA 1N9RA 1TYQB 4I6MA 1FOYA 1LVAA 2L9NA 4A4GA 3SJHA 3VQ5A 1OFCX 1QVPA 3H46O 2P9SB 1XQSC 3ZQ7A 1BCMA 1XCBA 2VQEK 4XONA 5BRDA 5J2MA 5LMNK 1O9SA 3OSFA 1ZYRF 4BRDA 3R6MA 3HBLA 3CXCP 3ONQA 3WTTC 4HF2A 4FSSA 4FLZA 2VJIA 5JLXA 5B8HA 1RBTA 3LSKA 4CF0A 3LP0A 5IH2A 4FPAA 1VQ5A 1UGPB 2NRWA 4G6DA 2KNBB 2JM9A 1JLEA 3WTUC 2KL4A 1SMYF 4ZDOA 3RR6A 4B1XB 2L3SA 3EFOB 1Q7YO 2OTJN 4CZMA 2E5LK 1D8YA 2A3SA 2E2OA 3G6EA 3V4IA 4FOEA 3CXCS 4L5IA 4JI1K 1QQIA 1ZELA 4GKJK 5FFZA 3KP5A 2RQTA 2VWBA 2ZAEA 3IUOA 2E5ZA 2R7VA 3AVKA 1R00A 3L2RA 2EFPA 3G1LA 1X2NA 1KG4A 2ID3A 1UGVA 5GANe 1H8KA 1JTXA 4CHUA 4C1NK 4C8QB 4TVRA 2O0YA 2NRAC 2RJEA 2JK3A 3Q5FA 3W6JB 2KMUA 4OMNA 1KVBA 2XD0A 1TP4A 1FEXA 4KTWA 4XIDA 4HYEA 3KK3A 4JS5A 3CC2A 2YNIA 1VQPI 3N0UA 2BY3A 1WHLA 5IXFA 4BRNA 2LSOA 3JRAA 2L9RA 5KCOA 3CWAA 4JRIA 4C92F 5E1XA 2RN8A 4V19S 1EETA 3HGGA 4HX7A 4MO5A 1ONVA 3FHGA 1XSVA 2RPIA 2Q2EB 5DMRA 3C18A 1RFQA 3WGIA 5L3FA 2STTA 2HVQA 1VQ4I 5GAOm 1UUEA 2EFQA 3CUQC 4OMPA 2A08A 3CQ8A 2UU9K 2ZPFB 3O8GA 1Y8RB 4ID5A 3L2QA 3GF2A 3FXOA 2L7KA 1VQKQ 2YHWA 3F21A 4WWCA 2D0CA 3VQ7A 3KIOA 3CC4N 4M75E 2JGUA 3GF5A 1MDMA 3IH3A 5EOYA 1V3FA 4HSTA 3FHNA 2D4WA 3DBHB 4CGZA 4Y92A 3D6RA 2NOLA 4PJOG 1VIEA 4XU1A 3CCQA 4CEQA 3O3GA 2W03A 3SHWA 2E6LA 5IP6A 1M3QA 1WNLA 5AQGA 2PJRB 3UDCA 4ENMA 2NRRA 1BC7C 4RM3A 3ZQLA 2R5YA 2V6EA 3K5NA 2FLOA 2XMFA 2DFIA 2JVGA 1K8KB 3EG1A 2EJGA 4DFMA 3QJYA 4RA2A 4C8QF 2NLXA 5GAN2 4D7NA 3EAEA 1RTHA 3L42A 4XRSG 3G4SN 3A02A 3BG9A 1AD5A 2Y2ZA 2ZPEB 3S6WA 2K4JA 4JK1X 3QDFA 1DPRA 4FM1A 4EM0B 3WXMB 1C0UA 5GAOp 5BN9A 4DLEA 3RKXA 3OW2M 3JRZA 4BBSJ 2ZPIB 4J83A 3CFRA 3HSRA 3GTMJ 2GWKA 4KHQA 3CJTB 1QU3A 2GBYA 3CBMA 4XTYA 2PVDB 1OCCH 2RKIA 2G8UA 2NOEA 2E19A 3DEEA 1OISA 1ZAOA 1ZQ3P 4CCMA 4JHDA 3AARA 4B1YB 2WV1A 3K4JA 1FC3A 3ENOA 5C0MA 1Z67A 4M45A 2EB7A 3MEAA 1ETOA 5DK5A 4CGHA 1P6RA 5GPCA 4TSXA 2ESNA 1XC5A 2OC6A 4YOYA 4CSWA 3SPZA 4GYGA 2FBHA 5T7BA 3CCUA 1T6SA 2ATCB 1VSLA 2W41A 3PFIA 4FASD 5K5OA 1TXQA 2D0QB 3HOXJ 3L7WA 1V55H 5KQDA 1IZ6A 4QKUA 4CECA 3LQQA 3CF5L 2PYLA 2P0KA 1HKBA 3TO7A 5BPLA 4D0PA 4A2UA 2UXXA 4YOTA 3CDIA 1CZBA 2D8JA 4L6V5 1YIJN 1Y7XA 3RPUA 3DWLA 2XC7A 3VS3A 3WVEB 4DTUA 3L2VA 4FJJA 1SD4A 5D6FA 2RQQA 1RBVA 3SWNB 2VUBA 3CPFA 4MO4A 1QGPA 3ZSYA 1YHQN 1S7EA 4EIAA 2KQWA 3UKUA 3V1RA 3RNJA 1OVYA 4P5OA 3JAME 1FYNA 5KPRA 2XSDC 3FHZA 1SHGA 4QQDA 2W1OA 3VB2A 2HEQA 3CC7T 2KY9A 2F2EA 3P8HA 2HBMA 4N4GA 1KLMA 3CO7C 1O3SA 3C7JA 3L3UA 5DV5A 3O3KA 1IHWA 3DAWA 4A4FA 1TLHB 4O5BA 5TGTA 1I1SA 2DTZA 5FKLA 2L7MP 3JSMA 4GV6A 1BGXT 3R6SA 3TDZC 4A0ZA 1IRZA 2LP0A 3LPTA 3OTOK 2M5WA 3L3VA 4JKFA 1VFCA 2WC9A 2LT4A 3DB3A 3EN9A 4LDVA 3BG5A 1UEBA 1RZ4A 4FISA 1S9EA 5EGOA 3QO3A 1R5GA 2HAXA 3M8JA 4M6VA 4A3JJ 4KHSA 1ZBHA 1MWMA 3O9QA 4NOYA 4OMFB 4JZ4A 3QRFF 4M77E 1B4AA 1MIJA 1JCEA 4YPRA 2RNAA 4G1QA 1Q7YR 2L89A 2QWQA 5E17F 4PGHA 2Q97A 4YHHK 4UV9A 3LAJA 1QQMA 3CCEQ 4KHWA 1VQ6T 1Q18A 4GY5A 1W2BA 3JCMV 3OSGA 1TOVA 4CZLA 1B6AA 3DOLA 2CZ1B 3UA6A 2QASA 3C1DA 5FU7C 2YRCA 4K0KK 5HK3A 3KD5E 4IOAL 3HT3A 1KK7A 1RI0A 2OFIA 2ED0A 2LMDA 1IV0A 2QSGX 2VKDA 2PLYA 4I02A 3PNTA 4M9ZA 2F8TA 2O01E 3VOEA 3GBGA 1XNQK 5HK0A 4M74A 3L8BA 4QS7A 2P6SA 5HDGA 5HS8A 4DV5K 4CF8A 1M2VB 3J7YP 1R22A 4E7ZA 3QPHA 2CSQA 4DTXA 4XLNF 1YXQA 4UUTA 3FMRA 1X3NA 1TUGB 4KB1A 1KYZA 3A01B 1HKCA 4BDPA 3CMMA 5FJ8J 3GFJA 2H1KA 4X34A 2V1QA 4E7LA 4C3HJ 4CE9A 3GOIA 3ZT2A 4DSEA 3VS6A 5J3LA 2WB1A 3MO8A 3PNVA 4OPHA 4MQ3A 5KYXB 4XICA 5GAEP 2ACJA 1P7IA 5GAMe 4KIFA 3OOUA 1IZ1A 2BZTA 3V81A 1SS6A 1J09A 3S2WA 4KIBA 2KIUA 2D1HA 2MW8A 1OKJA 2OAZA 4EJYA 4F3OA 2VOPA 1RILA 4CZEA 3BROA 4AM7A 1JJ2S 2J6OA 3HZJA 4E4HA 3ZSZA 2PMHA 3DEUA 4J8FA 1TC3C 1WJDA 4A3MJ 1QZEA 5GAOl 1QPIA 5EJCA 3HRGA 5M1QA 1VSIA 2QW9A 2VJ4A 1V29B 1L3UA 2CV0A 4KPYA 1RAAB 1HLUA 4QQGA 3C2BA 3OYCA 4V19K 1VRTA 1IBKK 3ZQIA 2M87A 2R5ZB 1FX7A 2HQHA 3AAPA 3K5MA 2VBWA 1S3JA 3D7EO 4W5QA 1QVFP 3I9QA 2L8DA 3ZEUA 3F8MA 1UA0A 4B08A 3AA2A 3AVHA 2QSHX 1CSKA 3DYAA 4AMCA 1BBYA 1GCPA 2EVRA 3PJRA 2YU9J 4B3TK 4A0XA 2F2WA 5FO5A 2L02A 4I99C 4OPAA 4DFPA 4KUDK 4JX4A 2XIGA 1LMZA 1UGQB 1QBJA 1VYUA 1YS7A 3H08A 2ECZA 1YI2N 2QLZA 1V76A 1QVFS 2QQ8A 4L18B 4XQ3A 2NRHA 1SD5A 2QGFB 1YG2A 2Y30A 4KA4A 2MAMA 5B66C 1TW2A 1J54A 4G7HF 1XSDA 2ISZA 5DEQA 2O31A 1JXOA 2YLBA 4WFAL 2XHBA 5IN1A 3PM1A 3IHUA 3ZMVA 3BZCA 1Q8IA 1TKTA 2E1MC 2F1LA 2HQAA 2ZJPL 2QM3A 1JI8A 4F7UE 2V4JC 2Y0SA 3HRMA 4LY7A 3VF6A 4DQ2A 1Q81O 1QP2A 1K78B 3SAGA 3E1YA 2W25A 3EYIA 1X2KA 3NGYA 2OZ6A 3CWSA 3EG2A 3JAMZ 4GY2B 2DBBA 3PV8A 2NOBA 3AG1H 3ZMTA 1NU0A 3EUHC 3VODA 4W5OA 3R0AA 1HQEA 2WSEE 2E20A 3CC7I 4B44A 1WJ5A 4C5HA 1C1BA 5KQ8A 3LP1A 4H5RA 1LCUA 3K5LA 2R5AA 3FWEA 1X1BA 1ETVA 4HSRA 3RJPA 3E6CC 2KFNA 2HOTA 4ZYDA 4RGXA 3TREA 2E1HA 4FVMA 3UKRA 4OPJA 3VYRB 3THXA 3EE8A 4DW6A 2OTLI 1D5VA 2HNIA 3WHCA 1IXSB 2EFNA 4Q5WA 4MLOA 2QA4A 1V54H 2DMUA 1QP3A 4KH4A 2V9PA 1E4FT 4DEXA 3TAEA 3CTAA 1VSFA 3E19A 2IIRA 2KK4A 3LDNA 3RR7A 1HJRA 2H6CA 4A69C 3J7ZO 3GE1A 1ABOA 2QGGA 2M4KA 2J5OA 3CCSA 4HCCA 1BI0A 4J9FA 2QQSA 4CJLA 1X9MA 3WNGA 3OV8A 3CCLQ 1JHHA 1BUPA 1LPLA 1VQ6I 5H2FC 3VQPA 2UXNA 2E10A 1N5ZA 2P9LA 1MNEA 2GZWA 3LX7A 4H0VB 2KI7A 4A5MA 4M77C 3QERA 1VQKN 2P0WA 1QCOA 4JKDA 3H3OB 4FO0A 5E8IA 2X9DA 5J4VA 2IAJA 3GXOA 3JCMf 4AYBA 4E7KA 5KN9A 4R79A 4HXJA 3KNTA 2EQMA 1MV3A 5GAHJ 5HLFA 3JW4A 1N6QA 4LJZF 1FMKA 1W4MA 2DIQA 4ABZA 2DEUA 1PRMC 3ZMZA 1WPKA 2MOXA 4M75F 4B1ZA 1QMCA 2HTJA 4M78D 1HSQA 2DAOA 3HM8A 4KJZA 2DA4A 4NZGA 3V7SA 2F4VK 4B6MA 1D0YA 1G3TA 4HSBA 2CYYA 2DTRA 5EZGA 4AC0A 4RLQA 4IX7A 3QYHB 5KYWB 1I5ZA 1RUWA 2P8TA 4HV5A 3E01A 5GJVB 4EAHD 1MPGA 3AT1B 4DBFA 1ZUKA 2AXTC 2W40A 3J80K 2XAGA 1MUYA 2M1BA 4GVMA 4FLXA 4MQVA 9ANTA 5GIOA 1SEMA 1PJRA 1EH8A 4B23A 3TO6A 2I5UA 2EX3A 2CQ7A 5GMKe 2E88A 4FU6A 5EEAA 2KR3A 3BF1A 3L4IA 3BLYA 1X6GA 1UHFA 2LNHB 2E60A 3QPSA 3QEWA 2YNHA 3KUFA 2DETA 4J00A 4ESBA 2RVCA 4JKEA 3DI6A 2IVMA 3DQVC 3COAC 3VQBA 3FC3A 2DTUA 2R0QC 2PBIA 1W7PA 1G3SA 1L0OC 1TTYA 3R6NA 4JX6A 4B3AA 4DYCA 5DCFA 4N4HA 2B6AA 5LY3A 1TAQA 4MGRA 2XF5A 2BXYA 1CZ9A 2CQQA 1X2QA 1E3PA 3RBBB 2K9MA 3TTCA 1IRGA 3TW7A 3EDPA 4WK8F 3BR2A 3CETA 2QYZA 3EZ5A 2G8IA 2OTJA 2GWRA 2DLPA 2DLLA 1K4SA 3HRUA 4PKIA 2OQGA 3ITHA 4H0XB 2VT3A 1S5LC 2NS0A 4U88A 4A57A 1RRQA 1YTYA 5HL7L 4PL6A 1PU6A 3QETA 1Z77A 2FSWA 1NK9A 3VS4A 2CH4A 3TVTA 1N8RO 2XF7A 3HTSB 4EJTA 3ULEA 2E2IJ 3TTDA 3J80O 3LA7A 1FOXA 2AS5F 2M4GA 3VYSB 3JB9F 5AQJA 2ZF5O 5KYNA 4P9FA 3WTXC 1S1TA 3GLXA 3PMTA 1QPMA 5CPRB 2EPFA 3GFLA 2GM4A 3T1HK 3THWB 1VQ8Q 3DTEA 2D5RA 2B63J 4KDPA 4HCZA 1W97L 1MUDA 1OR7C 5GMKm 1GFDA 1SRLA 3UB5A 2NXNB 2KBTA 3G25A 3A5OC 2XV4S 2JWTA 5JR3A 2KPMA 3SYZA 1NLOC 5K5RA 3V42A 2PFBA 1OX8A 2R7WA 4JRQA 4BWMA 3ATUA 4DHYA 1D1AA 4AHVA 4OMZA 2RHKA 4EGZA 4I2PA 1NGIA 1L3SA 2ZFUA 2I7PA 4R5PA 1KSWA 2FMLA 2P6TA 1Q81R 2B8AA 4EMKB 5I3UA 5FPNA 1XMKA 5HRRA 3CCEN 2F5KA 2LZ6B 1T0HA 1SKUB 3Q7CA 3GUDA 5KNLA 1YCSB 1K8AO 3MXJA 3MEUA 5LL6S 4D7MA 5AQMA 3M8RA 2MLGA 3OYYA 5CQYA 4BRQA 5EG2A 4MFEA 3ULDA 5J3BA 3CC4A 4DYQA 3ERMA 4F16A 4C92A 2EQRA 1A31A 3LA2A 3META 4DU1A 4YORA 2E65A 2RE2A 3G71T 3PX0A 2KT0A 1TYQA 3K9TA 3ZSVA 1TK8A 2DW4A 4BJTA 2EWSA 2QG9B 2BHZA 2HHTA 2RF0A 4Z4EA 4XK4A 4BR0A 3KEQA 5DM6L 2GOMA 4DS5A 1EH7A 2RD1A 1ZX6A 1ZBIA 1GLEG 2AA4A 6AT1B 5AN4A 4E1NA 1V5EA 1CXUA 1LWFA 1N3AA 4XLHA 4I2OA 1KG6A 1ZLJA 3QSUA 2WV0A 4A6DA 1S72Q 4ZGJB 3ZT3A 4JI5K 2YKMA 3H41A 2OPQA 4NC6A 3G4SA 2HHXA 1WSEA 5LJ3j 2WACA 5HDKA 2DPNA 1T44A 2VT2A 1FBSA 2E1NA 4E7JA 2CV2A 1BOTO 2AK5A 3C2GA 1WAJA 2DXTA 1K73O 2LF8A 4Y7NJ 1NG7A 3U1KA 1T2KA 1VIFA 1GLDG 1J59A 3WT0A 3S3MA 4UB6C 4BNCA 3CG7A 1VQLT 5FKMA 4KULA 4K25A 5D6WA 2QEXQ 2IS3A 4C8QA 3KFVA 3CMAT 2E7XA 4BU2A 4YOWA 4DSKA 1RKWA 2DI3A 2YI1A 4FPBA 1R7JA 4ILHA 4LG3A 4A61A 4HLXA 4LF9K 1JO8A 3NH1A 1BOBA 1ZR4A 3OYBA 2R57A 3KLFA 1GLFO 4NO7A 2COYA 1NH3A 5E84A 2QTVA 1PYVA 2O4GA 1X6BA 4A5AA 3D2EB 2R7DA 4JX5A 3OMYA 1FJLA 4WF9L 2Z1GA 3NDKA 1HNIA 1KQSA 2LFBA 1UHWA 4O0JA 1BR1A 2X48A 2K5CA 4PNOA 1YW8A 2IPOB 3X24B 1YW7A 2Q2EA 4DBQA 3KHYA 4MQ9F 3FLCO 1YQRA 2VUMJ 3QB0A 4QVCA 1YIJA 5LLQA 1IAWA 5GANj 5EYRA 5AQNA 1R36A 1PSEA 3BR5A 3N5BB 1W7PD 2K5IA 4DF8A 1YHQA 3FB9A 1GT0C 1FLIA 3WE3A 3LAPA 2HPIA 1SC7A 3NAEA 4IF4A 4DUZK 1RETA 3M8QA 3OMCA 4C0FA 4CBUA 1W1FA 4ZJZA 4DR3K 3EYZA 2EIKH 3F8FA 3PIOF 1QE1A 3S8PA 1ZBLA 3I0RA 2X74A 3F5TA 4L5EA 2L7ZA 4KGZB 2DFEA 5F08A 5I2MA 1K79A 3JRGA 1T8EA 3THYB 4BE1A 1O3QA 4M3YA 3MPUB 4IQ4A 1T39A 1RAHB 3CLOA 4DGWB 1ZGWA 4KREA 2PJPA 1UG0A 5CKEA 4NQWB 4HDVA 2KP6A 2R3SA 2JMCA 2DCEA 1TT0A 2I5WA 3MECA 4FX0A 1OX9A 4PHTX 1PP8F 1K8KA 4DZJA 3M3ZA 4E1MA 4AHSA 3IH7A 2O61A 1JB0E 5IP7J 1M8MA 4DV1K 1YVUA 2V7FA 1NYFA 2DE0X 2DA9A 4BWJA 2YXYA 4ZYAA 1K1ZA 4HQEA 3HYFA 2A6HF 3ECHA 5LJ3h 4BROA 1TNTA 3LYIA 2BE9B 2XAQA 1TL8A 1BIAA 1AZEA 4YG2F 4ZYEA 4CF1A 1X43A 1BQNA 3ABMH 1SL2A 3KP7A 1EFNA 1HA8A 3L9FA 2M2EA 5BOXA 1M8VA 3T5XA 4M63C 3A98A 3AL0B 3CVTA 3GTQJ 1N8RR 1IO2A 2R7RA 4F17A 2AO9A 3SEZA 4JS4A 3K1NA 1H1VA 1BG3A 3OW2P 2DERA 1J6ZA 3K6GA 1B07A 4Z02A 2HGCA 1R6RA 2I5JA 3PNWC 3FZFA 3VS0A 3VS1A 4IO9F 2CS3A 4Y1DA 2DL7A 4LDXA 1O13A 4RDUA 1YAGA 4JLGA 1MH3A 5JHUA 4JNEA 2DPPB 4AWXB 1SD7A 4CJ5A 4JI2K 2K27A 4ENJA 3CCLN 1T7PA 1EF4A 3GDQA 4GLKA 3OW2S 4C92D 2CGPA 2HNHA 4AHUA 5DCMB 4KUMA 3L2ZA 5IP9J 3I55T 2XHIA 1YE9A 1E3HA 4RTZA 2EH3A 4XORA 1TKZA 3RUXA 3MZ8A 5K7FA 3PO3J 1JE8A 5K7ZA 3G71I 3TSUA 3SWNA 5GANh 4HEA2 1RT2A 5KK1A 1YQLA 2XIDA 5AQFA 1XNRK 4KHUA 4G8XA 3BZKA 4CC3A 2XDBA 4GGGA 4MO7A 3IG1A 5GMKl 1K8AR 2Z1HA 1XGNA 3R2XC 3R61A 2KDOA 1BCOA 4PA1A 4E9FA 2IS4A 4N4NB 2JG6A 1RLPC 2XAFA 2IVOA 4NB4A 3Q7BA 3QOEA 1X75C 3JCMd 3G3ZA 1O1WA 4CEEA 1GVDA 3VSKA 5CQGA 2CS7A 3A8OB 3OSVA 3Q0VA 4FCYA 4EIKA 3CCMT 5BRFA 2ZMEC 2I8DA 2KXDA 2A6EF 2DT5A 3AVMA 3BDPA 3E9OA 2K9SA 3OYEA 4NC7A 3CJBA 2Z3YA 3GNGA 3WNHA 5EZHA 1N32K 1LPQA 4H5TA 1UJ0A 5HP1A 4JOMA 4WTOB 4C8QD 3P38A 1ETYA 1YUWA 1VQPQ 4H0OA 5LMUK 1VQLI 3EFSA 3HXMA 3JTHA 1B59A 4RAGA 4Q5VA 1NK5A 4H5NA 4ILJA 3CMAI 1CKBA 2JTEA 2Q0OA 1WFXA 3U6FA 3MVPA 4MHGA 4CJSA 1OZ2A 1XMXA 3VTHA 4FSVA 4CF9A 4CVNE 3OA6A 3G0ZA 3DXKB 1K73R 3DB4A 3L1AA 3M8SA 4HVWA 1MDUB 2VASA 4C0DC 1YI2A 2W4SA 1QCNA 1FPQA 4BQZA 4DWIA 3HUGA 4HZFA 5I42A 2TCTA 4AM3A 3CMET 4FJMA 1TUDA 1VAZA 8AT1B 2V8IA 1R77A 5FROA 2XB5A 1QSYA 4QOZB 3NTIA 3QOPA 2HZYA 1M2VA 2O8BB 3U9DA 5K7HA 3A8GB 2MI6A 3QLHA 3UE5A 2KZGA 1IDYA 1WH5A 3M55A 1QVGM 1SFEA 2HXIA 2M16A 2E1OA 2A05A 4M42A 4BS9A 1SQKA 4PJMA 3TAPA 1FTZA 2JMWA 3N4MA 1DP7P 2X4WA 2K4YA 1HC8A 3I54A 1GCQC 2KRSA 3GL1A 2GQIA 3RKYA 1M3CA 2JZ2A 2IW5A 3QNNA 5GAHP 2R7TA 4CJVA 5SWMA 1ILYA 3AO1A 1XDSA 2HNZA 5CQEA 1SAUA 3M1FA 3K1PA 4DYRA 1KQSM 4OIRF 3FIFA 2CW0F 1HR0K 3CUOA 1OQYA 1L3TA 1XHXA 1T3SA 3CJAA 1OCZH 5D5UB 3MAQA 3P4IA 3DPTA 4PJJA 4N9IA 4HCBA 4OP0A 3O6WA 5AZIB 4WFBL 3RRGA 1TWFJ 4UQGA 1C6VA 2J7IA 1N25A 1R1TA 5LGNA 3GFMA 1OH7A 3WU0A 2A61A 1S1XA 4P55A 3OYGA 2P5LC 2F2VA 5GAMj 3VGKA 1U45A 1VQKA 4UY8I 5TKYA 4QS8A 2RH2A 1W5TA 3AVAA 1I8FA 3RMSA 3H1QA 1QSLA 4JI7K 1XMAA 1JRIA 1ZC6A 5F0CA 2DFFA 1CQTA 1B1BA 1DU0A 4AVPA 5J1RA 5EX5A 1HJDA 3GTJJ 2EQUA 1GOBA 1JJ8C 3HKZN 1OEBA 1UG2A 5CKHA 1OH8A 3V7RA 3NFAA 3EY1A 2W24A 3ER0A 3Q9SA 2ZSIB 1KC8C 5DD8A 1RDBA 1QQNA 3G1MA 1GOAA 2L5QA 3Q0WA 1NJYA 1NJIO 2TDXA 2RHIA 1K61A 2PEXA 1M2OA 2W7NA 1S72N 2BVMA 3OBWA 2Q3SA 3I55I 1BL0A 2C0IA 3V9WA 3SDGA 4OB2B 3SFIA 3E9LA 4IO8A 2CW7A 2OPPA 3TO9A 1Y07A 2FSKA 1I50J 3CWTA 3GVAA 1P2FA 1LE8B 1XNIA 3X25B 4M75A 1E3MA 2MK5A 5F2RA 4KH5A 3EFRA 4PKCC 5BRHA 1PNJA 1HBXG 3FXMA 3PTAA 2QEXN 1PCXA 3ROUA 5H1SQ 2FPEA 4E6KG 3I0SA 1D0ZA 1S6QA 3RSNA 4J9GA 4PJOB 4N4OB 3FR0A 4M78G 4B47A 4E3SA 3P7NA 4XTXA 3AO5A 2VKVA 3CCMI 3BG6A 3VJPA 4RWTA 3LPUA 1WVRA 1HSTA 3GBQA 5IXBA 1H9TA 2DVJA 2DA7A 1NK2P 5AQWA 2F7TA 3C6AA 1KD1O 2BBYA 1AT1B 3LL3A 4KRFA 3I9V2 3H35A 4DA4A 2HBKA 3TSPA 1VOMA 1QLYA 4RTTA 1YTAA 1KAXA 2YU3A 2J06A 4DV4K 2IBDA 3MJXA 3D5SC 1V5FA 4NCAA 3WQUA 4CESA 5CHIA 1EH6A 2P4WA 2EQKA 2E3IA 3M58A 2GXAA 2OPRA 4ZYHA 2OI3A 3FBIB 5IOZA 2P9UB 1IXCA 3JSOA 1TWAJ 1IREB 3SZTA 3H45C 3TP0A 1YYVA 2NWMA 2HKOA 2VXDA 4CCJA 4JI8K 4CJ3A 1Y56A 1Y39A 3BFMA 3H5AA 2XASA 2JTVA 2EGEA 3I64A 5GAMh 2IXSA 1J53A 1ZQ1A 3VGMA 1M3HA 4XAXB 1B92A 1D9FA 1HQCA 3SZGA 4MTEA 3L6QA 5HRSA 2QKBA 5D5XB 3D1NI 3ISNC 3JRDA 3ZEHA 5IT9E 1QKXA 2UV1A 4IRIA 1VSMA 3CCJT 4G94A 4LUDA 3CCVT 3E6DA 4M71A 5GAN8 5FFXA 3AV9A 3K0SA 3IKMA 1OLTA 4LSNA 4HW0A 2NYSA 1PKTA 2Q1NA 3O1WA 2DT7B 3OS2A 2FMYA 3WU1B 2RF2A 1M4ZA 2ZCWA 1KC8U 2CO5A 2ITMA 4B1VA 1T05A 4J2EA 5KYWA 1LAWA 3VEPA 4PJOF 2IVWA 1WCMJ 3TARA 4A4HA 4J9HA 3FXUA 2QKMB 4HVJA 1OU8A 4FJXA 4CJRA 1UTIA 3HKSA 2UXBK 1UCRA 3KP2A 4PSWA 2C0TA 4U7BA 3VEYA 1Q86O 4XN3A 4FK4A 3JCMc 3CF5F 5EVZA 4I2QA 2G3RA 3K4BA 3K10A 2Q1ZB 1JLQA 3CCEA 2JZYA 2KRFA 4HX8A 1B34B 5HS7A 3E5UA 2BEOA 1I1GA 3M7GA 3KEYA 2HVRA 3ZQHA 4A3EJ 2H3EB 4FSXA 1YIJT 2H8HA 3H0HA 1KG7A 4VUBA 4HAMA 1HKSA 2RMOA 5AQUA 3J7AF 3DMJA 2JN6A 4BDYA 4EPCA 2WADA 4Z4IA 4PIIA 2OU2A 1MMSA 1H3HA 3EUAA 2IVPA 1OCPA 4ZGDB 3O6BB 4EQQA 3S3NA 3WHBA 2HZDA 5D8KB 1LOJA 4DV2K 4JKHA 3IHOA 4P5NA 2ICWG 3CM5A 3F3XA 3C6HA 3E9GA 3KD1E 3K4NA 3AVJA 4F52A 2FBVA 4V2GA 2RHYA 1K0XA 1LJOA 4JJDA 5J2NA 5A2QE 1UHCA 2IOCA 1TUUA 1NE8A 1YITN 1TQIA 2L9SA 1YJWT 2YS9A 4IUQA 2M30A 3VPRA 2LKXA 2DYIA 2EIMH 3KFWX 1PUEE 4AIHA 3QEPA 3NH2A 2F8SA 1BO5O 4YOVA 3GLLA 5AR0A 3T8TA 2IPQX 4K8ZA 2AQEA 2R5MA 2DFUA 1NKUA 4OLBA 2FOWA 1TT5B 3E0JB 1TW3A 3PX4A 1TS9A 4DV0K 1R0CB 3O5BA 1GXPA 2MFZA 2P9IB 3KJVA 3JTGA 3VS7A 3P9KA 3CC7Q 3QMLA 3THWA 1VNDA 1U78A 2GLOA 2OZSA 2L4MA 1N6AA 4M75D 4EMSA 2ZGZA 3I0WA 3BQZA 4KV8A 4U0YA 4FJHA 3H9NA 1G3YA 1RBSA 3VV0A 1NJIR 1W1WE 1XDUA 3JB9G 1WNSA 4B21A 3OSSC 1UOCA 1VQPN 4DMNA 1Y0NA 2E12A 3W0LA 4AU7A 2HBJA 2W00A 3ECOA 1LOTB 5D3GA 4AVZA 4J01A 4EZ9A 1D3BB 3OGDA 3H5RA 2JA6J 4H5WA 1H88C 2O88A 4CFBA 1WEIA 4EMKA 4UVCA 1IN8A 2P5GA 2DA5A 4IHWA 2A36A 1P9QC 2VJJA 3FZMA 3L00A 2A42A 2EYQA 1TZLA 3M0TA 4IDKA 3FM3A 2XU8A 1IW7F 4CFDA 4XH1A 2GXGA 2VQFK 3OVNA 2ECCA 5HRPA 2MH2A 3KWIA 3GTKJ 2JT4A 1IBLK 1MKMA 1VQ6Q 3TGNA 5BPDA 4R0KA 4M7AG 2QQRA 4YEJA 3LGLA 1IXRC 3WUHA 1QHTA 3ZSQA 4CHYA 3JCMe 4BY9C 4K8XA 2XB0X 1RAIB 5FU6B 3BZ6A 1KD1R 2RN2A 1LUJB 5J40A 3O9TA 2OF7A 3VUZA 3BF3A 3BJOA 3KLGA 5J2QA 1B72B 5JFRA 3E7LA 4BACA 3PIOA 3IQLA 1U06A 4CIFA 2FBTA 3QWYA 3QZ5B 5IAYA 4I76A 2NRXA 1G15A 5D6XA 4WFNL 2JHNA 4AIDA 4FWOA 4FOIA 2CUZA 4DZPA 5IT9Z 3CJRB 4ANJA 2O4IA 4DLGA 4PJNA 3S14J 3FSPA 2B4JA 2Y31A 4RB3C 3CPWM 1BIUA 2FA5A 4RB0A 4ZN1A 3CCJI 3CCVI 1AU7A 2GQVA 4U0WA 2E1ZA 3FKJA 3NF7A 2GXBA 2O03A 2J5PA 1YJ9T 1KG2A 4CIEA 1BKBA 2R93J 2RQWA 4B3SK 5M5WJ 1ETKA 4K42A 3R60A 1WHKA 3LSJA 2SRCA 4MZMA 4RW9A 3P8DA 4NL2A 1YI2T 3D2EA 1M1KC 3HVTA 4CZJA 3ZT0A 1U0JA 5GP9A 3CCLA 3K69A 1ATSA 4CGJA 2ZXIA 2XY7A 1WXBA 2ZJPF 4OIQF 3EPZA 1W7AA 4IFEA 3BEXA 4BVPA 2KKOA 1YIJI 2PUOB 5DLQE 3W6VA 3NQOA 3FFIA 2GX9A 2GV9A 2NNNA 1LKXA 3GZ6A 1Q86R 5IHIA 3CJQB 3K7AJ 3IC7A 1S7OA 4LG0B 2YHXA 1XSXA 2DDBA 1D8KA 3LSIA 4RKUE 5ILSA 1XX5A 1FBQA 4C3IJ 2W84A 2Y0MA 4M77D 1BR2A 1H3ZA 2P81A 2HKXA 2YDLA 3THYA 3F2KA 2G7HA 2P4TA 3MKDA 4N5SA 4OAZA 1QQOA 4ENKA 4M72A 4NQWA 1NBEB 1H8AC 2OJ2A 4DFKA 3VEWA 5A2QZ 4ZDPA 3QKJA 1QZ6A 4KFCA 2QSFX 3FMSA 2VGNA 3D4VA 2D6FA 5CVUA 2XF6A 4B22A 4MEYF 2QWOA 3DRRA 4CD1A 3SI6A 1YJWI 4ISFA 3AVLA 3IWFA 3TANA 4ELYC 1Z25A 1IGNA 3FF5A 4U0VA 3DJCA 2QF7A 3NHGA 3JR9A 3V8KA 2NYXA 1MMDA 4DTJA 4A53A 1VZ0A 2PVGB 2W6LA 5LHIA 2AHJB 3NF8A 4IWVA 5IHNA 2MBFA 1N39A 5LD2C 4GV9A 4EW0A 4E19A 4BRMA 4CIGA 3L2WA 5J1YA 5EEHA 4DQSA 3KE2A 1IJWC 5GTHC 4XEIA 2HI3A 3LWIA 2RAEA 4HPQA 2CUJA 4W97A 1GBRA 1S1UA 5C12A 2UUAK 2F9TA 2X0LA 2EJFA 3HL2A 1RL2A 4OFAA 1BL3A 2Q2RA 4CYCB 1NG9A 3M1EA 2CP7A 4LB5A 3UT1A 1WSIA 2R58A 3ZQFA 3OB9A 4OMYA 1HU0A 3JV3A 4M7DG 1QZYA 1QA6A 4YELA 4XTUA 4Y15A 2P1JA 2E4HA 4E9HA 5FLXE 4J19A 1DTQA 4L9NA 3OYMA 4I0AA 5AQLA 3TDUC 2O8KA 3OJSA 2V1NA 1N77A 1AWWA 2WTEA 5GTIC 2XPUA 3PQJA 5KVRA 4K11A 4JKGB 2CDTA 1CXQA 2RN7A 1NNEA 2E36A 1VHXA 4LDYA 4A63B 5TRDA 1M1KU 5DCMA 1U04A 2KJCA 5AZJB 2EAYA 2FZCB 3PSIA 4BDZA 3VEVA 1R5ID 5BQTA 2YUNA 5KPZA 5CO7A 1S1NA 4CZCA 3IH4A 3ASKA 1WFWA 4D5CA 2E3HA 1EWRA 1QHAA 2I10A 3U21A 2CH6A 4EATA 5ECAA 1PD0A 4PDKA 4RTFD 4HUEA 5EXWA 5EY4A 2ZXWH 4XLPF 1F36A 1G3WA 1CF7A 3IDHA 4EMHA 5EG0A 1WJQA 1R0AA 1OCOH 3W2WA 4AQYK 1HYSA 2K9LA 3CFPA 2X35A 1HQUA 5AYFA 3VKIA 3WEEA 2OD5A 5J6XA 4M4ZA 3C7NB 2DDAA 4BXXJ 3M07A 1ABQA 5CYQA 3NWTA 1ORKA 3GMEA 4M3GA 5D6EA 1UAAA 4AFUC 4XSXF 2E6NA 5L3GA 2FG0A 4CF2A 3VUBA 3CEYA 3S1MJ 1VQON 2F5TX 5BPIA 1NBWA 1L3LA 1ODDA 2XK0A 3FJPA 4FJ5A 1VQNT 1OI1A 4BQAA 2VKNA 3FDYA 3GO5A 2OANA 4OKKA 2GA1A 2GGRA 3PNYA 1T38A 2NVXJ 2HKQB 1MBGA 3ZQQA 1GRIA 3ESWB 2Q36A 3R3LA 5AQHA 4LD5A 2EQJA 4IFVA 2L54A 2ETJA 2A5XA 3PMIA 1Z7LA 4NXMK 4IHVA 1BJAA 1LWYA 2ZB9A 3KPHA 1YJ9I 1Y1WJ 2EBIA 4I09A 3NNQA 2O3FA 1IG9A 2BZYA 1KA8A 1K4TA 3PFYA 1VYVA 3DXKA 3OHRA 3U9GA 4XK8E 2WSFE 2BH1A 4F14A 2PZ1A 5E79C 3CJCA 1XN7A 2DA3A 3HKZA 2FYKA 1YI2I 3HOUJ 2Q0RA 3NMZC 2DMOA 4I98B 4BRKA 3MEWA 3ZCOA 2HOEA 4I9LA 1K9MC 2ROLA 2VYTA 5KPTA 4S0HB 1FBUA 1GV2A 5GAN4 4RB1A 3SCXA 2FPDA 1S72A 4EV0A 1JHFA 1P7JA 5DPKA 2P7VB 2D9TA 2MPXC 2HWVA 5KTQA 2KFDA 5M5YJ 2D0AA 2E5QA 3TSZA 2AIRB 2XHKA 3ZR8X 3MWPA 5LJ5d 4C2MJ 2JPCA 4UHTA 1HPMA 2YRVA 3OYDA 2KQRA 3LSHA 3ISPA 3TQ7P 1ZSZB 4D5FA 1VQ7T 4M3ZA 3LZJA 2EGAA 1G4DA 1U4BA 4XSZF 1U2WA 3EZWA 5C44J 2DPUA 1RT6A 3S17J 1VQ4T 3RSEB 2R7YA 2LTOA 4Z6YA 2ZFWA 1SFOJ 1FXXA 3H92A 4BE2A 4RM2A 2QEXA 1Z21A 1WAFA 3PY8A 4KN4X 1CKAA 1X4OA 3F73A 3LP3A 5CIUA 1Q95G 2V51B 4PLLA 2CZ6B 2QTXA 3LSTA 1QVGP 1NGBA 2FEIA 3X28B 3O9RA 3BY6A 2NVYJ 1SG5A 1POGA 4C92C 3F9MA 3SBGA 2ZWHA 1QS4A 3M57A 4J2BA 4NS5A 1YVNA 1ZH5A 1NOYA 2HB5A 4FETA 5IYBJ 2MCNA 3SUPA 2RGVA 5LRSA 3QP6A 4NC8A 2R7XA 2A28A 2I7NA 1H641 4XH4A 3DLKA 2FSNA 4Y1CA 1QVGS 4MDBA 3Q0UA 3ZETB 1RC9A 5AZIA 1SKWA 2G8KA 2F48A 4KI4A 2V9KA 3T1YK 2EV0A 1JGSA 2V79A 2DK8A 4RS8A 2BV6A 2UYTA 2FHDA 1M90C 2DOEA 3LL7A 1KQ8A 3VQDA 1ESVA 3V9UA 4ZH4F 1KQSP 4M9SA 2K79A 2HNYA 1PDNC 1D4XA 3ZN1A 4M41A 1R9TJ 2C0OA 4RGSA 4JI4K 3ZGKA 4A6EA 3KZZA 2KIFA 4OB3B 2RDPA 3ZBDA 1WKMA 5LFAA 4UY8O 1JKHA 4OF1A 5FLXZ 4HVVA 4OLAA 1VQ6N 1FZPB 1LJ9A 2NRTA 3DU5A 2VN2A 2O4XA 1Y96A 2P9NB 2CGKA 1I5OB 2COWA 5HLGA 3QWXX 3M5AA 3OQ5A 1C0GA 3T1AA 1DJ7B 1KQSS 1MMNA 4RGUA 1KG5A 4C8QC 2L9VA 4BY7J 1DT9A 3HTUA 3GPLA 3G71Q 2CQNA 2LY1A 3RQ4A 1WHUA 1HNVA 3SDBA 3W2AA 4W1UA 3VYUB 2DTHA 1NGJA 4DTPA 1ASUA 5J2PA 4HLYA 3R1XA 4EVVA 3PO2J 4ZNXA 3QU6A 1QHGA 4ESJA 1WPYA 1U1TA 2DEQA 3PX6A 3H0DA 3GX4X 2H94A 4NBQA 5E1ZB 1NK0A 3HOVJ 1NEGA 5DM7R 2VC8A 3TOAA 4QQ6A 5F0HA 5KCMA 5E41A 5CKDA 1AZGB 4HV6A 4LFCK 4IDHA 2GOXB 4BH9A 3LDPA 4B9MA 4WX9A 1XTDA 4KHNA 4PFPA 4V2FA 4B09A 4N47A 2A5YB 3ALYA 1NGAA 2IS2A 2AKKA 5CE3A 1W36D 5EEGA 4QPQA 4WQ5C 3ZT1A 2NUPB 2QZ8A 3NGPA 1M3AA 1RI9A 3SAFA 4B3MK 1NYGA 2QENA 2V8JA 4KYWA 1KHIA 2IGIA 2VWJA 1IKXA 1BW5A 1K7AA 4PJOA 2HF3A 1AWJA 3W6KB 3HZ6A 4XKBA 3KLEA 3U3YA 1ZHIA 3A2KA 1VQLQ 2A6AA 4X62K 1YFNA 3CMAQ 1VQNI 4AHRA 1SD6A 4AD9A 2KIMA 1MHNA 4ORZA 4KFBA 4BUGA 1UG1A 3E9PA 4LMYA 1E17A 5ILUA 3CLQA 1LWWA 1AKHB 2NLUA 1BIZA 4XRSA 3OOPA 4R56A 3LSRA 1IGUA 1OYXA 5F0FA 3IH2A 1GXQA 2P9UA 5FKNA 2ENMA 3HM5A 4ILGB 3H3VK 4FE4A 4CJUA 1PD1A 2MC3A 4C3JJ 4EM2A 3M4YA 1DLOA 4NDLA 3ZCMA 1YITA 2XHCA 4HHTA 4OPKA 5DYMA 1WZOA 3FBNB 3OYAA 3GYHX 4A4EA 3BP8A 1MMAA 3I0TA 2J6KA 2QBYB 1NGEA 3HSCA 1J5OA 3DLLL 1IGQA 2ELHA 2OAWA 4L5GA 4CI6A 4XTVA 2L3QA 2DBMA 5E18F 5M9OA 1LNXA 1S5JA 2EZLA 3I56T 2EKOA 4EHTA 2Y48A 1FOWA 3MP1A 1DKGD 2PNIA 5KGXA 2CMPA 2VXZA 4EA4A 4F7ZA 3HOSA 3JB9H 3S3OA 2PI0A 5AQQA 4JI0K 4DQRA 1JBMA 3QG1A 1GXIE 2XY6A 1YF5L 1VQ7I 3FEOA 1ZBFA 4B9LA 1VQPA 3VTIA 5CJ9A 3FM5A 4KKOA 1ZUUA 2YUSA 3DLBA 3LAKA 2A5WA 3VSLA 3CCRT 4ZN3A 4BRFA 1QVFA 2FNAA 1NGGA 1NOZA 4XU3A 3OIQA 1QWEA 5JICA 1VSJA 3SWNC 1MMGA 4BI8B 1HRHA 3EQLF 1EQYA 2X1EA 3ZP5A 4Y33A 3FZKA 1HW2A 4BG8A 4XOPA 3G1JA 5I9EB 3MQ0A 3DKYA 4D8DA 1OCRH 2CG4A 4A54A 3DPLC 3J8AA 3DCFA 1IHVA 3BUZB 2ZD1A 4IOXA 1D1CA 3KK2A 2LYCA 5HNFA 2IP2A 2L0AA 4CJ4A 2BE7D 5EF6A 4BRLA 1TWCJ 2DF6A 4MDWA 2KLOA 4DJAA 4G9YA 5CHZA 3ZMUA 5CZ2A 4MDAA 2R5YB 1IDZA 1VQMT 3KK7A 4JKAA 4IEIA 4IUPA 4IG0A 1ZBUA 3O9SA 1TNSA 2PN6A 3VFZA 2O7OA 5CK9A 4DU3A 3HO1A 2R7FA 4XBFA 2BYVE 2DODA 3ERED 5JVHL 3I55Q 1MUZA 4IPAA 5HLIA 4MFDA 1F1BB 3E66A 2EBPA 4FXDA 5JLWA 1UHSA 5L3EA 2HYGD 3AAFA 2DMNA 3W3CA 4CGDA 4WXCA 3I33A 2KYBA 1LFUP 2F5EA 2AP1A 4E2FB 1MBKA 1T6CA 5E8GA 4AIKA 2QKKA 2RNGA 2H3GX 4LNPA 4JJBA 2P9IA 1IG8A 4J7FA 1MBHA 2X6OA 5FLVA 3UNGC 1I3AA 2CUFA 4X6AJ 2FBKA 4FT8A 4L8RB 4CICA 2A3LA 2FD5A 1Q82O 3EGXA 3IV5A 2RHUA 3OR1C 1R8OB 3VENA 1VSHA 3LA3A 4YDUA 1X1PA 5J26A 2KZZA 5M3MJ 1BB9A 2YUQA 2IDOA 1ASWA 2O5RA 2JTMA 2RA2A 3QWLA 2D8HA 1U9NA 1RPWA 4F91B 3CCMQ 3H1CA 3X2QH 4CHQA 1YWPA 3EH2A 3WXJA 3SEQA 3DLEA 2NS7A 1NGFA 4DTRA 4ESFA 3UKGA 1WSGA 4UUVA 1D3BA 5LJ3g 3DFGA 3CJ1A 3QAHA 1N3CA 3ULRB 3RMDA 4G7OF 1T33A 1VTNC 2QM1A 1X3WB 4ZZLA 2EYYA 4MDXA 1REVA 3O3HA 2KT1A 3E6MA 1BK2A 1BA0A 2ZPGB 3ZSWA 5FW9A 1BI1A 1Y97A 4F93B 1I4K1 5EU7A 4QSHA 3H0GJ 3V8JA 3RR8A 3LWFA 2CSIA 1U5TB 2NNWA 2YX7A 1WH7A 1ZRFA 4H0PA 4N56A 4U87A 3SFZA 2VVKA 3GP8A 5CVVA 4HKEA 4IXAA 4ZTFA 3WNFA 2X6XA 4FHTA 2NVUB 3I35A 2OTLT 4XIUA 1DDNA 3M56A 3T69A 4LSLA 5LJ3d 3BR3A 2DMQA 1NMNA 2HHSA 1YO5C 1SKSA 1HW1A 4M3EA 3MZYA 4Q4ZF 3BJ6A 3FX3A 3SBTA 3IMXA 1NKBA 3F6VA 1EWQA 5IT3A 3K4KA 5GAN5 1CZAN 3BPVA 2UUBK 2RK2A 4BRCA 3SD4A 3CMEQ 4AF1A 3C3WA 3JCMb 4HNVA 4CGFA 1IN4A 1RLQC 1B72A 2EINH 4RMOA 1TWHJ 1FTTA 1KHCA 2VODA 1GLCG 3G7ZA 2NOJB 3KLHA 3F70A 1LDJA 2H56A 3D2FB 3E3VA 2MGQA 4CJPA 4N4IA 1N34K 1FT9A 2QVOA 5CVIA 5ICCA 5GANg 5GAOr 1OYYA 4F92B 3OS5A 2B86A 2L7FP 4UXNA 3A8MB 2V8KA 5AQKA 1IV6A 4RCCA 3D5LA 3CIPA 1ZN2A 2RREA 3I56I 4M77G 1Z6RA 3C6UA 2D5VA 3LLRA 1TBXA 4RLFA 4WCEL 1VQ9T 3VYHB 1GLAG 4DR6K 3CVSA 5DM7F 1OKRA 2QQAA 4A5BA 2GBZA 5LBQA 2CW8A 4M9XA 2P51A 3CPWP 2O8DA 4J9IA 2LX9A 3QBXA 3FK6A 1XQHA 2JPBA 5KYUB 5GANd 5J1UA 3MMVA 3JSCA 1I6XA 1UB4A 1XTAA 2LRDA 2FVUA 4FYDA 4J6XA 4N0BA 3ZLJA 3K58A 1K9AA 3CCRI 5LJ5e 2FX0A 1Y8QB 2DILA 4H4MA 2CGLA 2K86A 5FRNA 4KH1B 1NGHA 1WI3A 3CPWS 1LWEA 4PJLA 4JI3K 3F8BA 4HDUA 1JJ2P 1RT4A 1ZTRA 4EGYA 4E89A 5L3BA 1GOCA 4KGVB 1R23A 1SMTA 1UJ8A 4DIQA 2NAZA 3CQTA 2YWWA 4K2EA 3HOTA 5GAGJ 2CT4A 5B1BH 2Z1IA 5BPMA 3QEXA 4M75C 4CCKA 5E3OA 4EFHA 3NRVA 4ICLA 2VQLA 4LG0A 4HF1A 1TWBA 4IBNA 5M1FA 3N5NX 4M78B 1UECA 4QPOA 3VDXA 3RCOA 3EHQA 5M5XJ 4MIMA 4O4GA 4M3BA 3G71N 3ME9A 4II3A 4BQLA 5AJ3K 4O5FA 5C2DA 2STWA 1TG0A 4EZ6A 4CFAA 3PQKA 3ZQGA 2IG0A 3VQCA 1ZG3A 5A0GA 4FWLA 1UE9A 5IHKA 1JQQA 1VQMI 3VF4A 2EFOA 1VQOA 4DQQA 2GNCA 2XO7A 4CH7A 4FM4B 3ZXSA 5HKCA 1UZCA 2CZ0B 2JA7J 2XKOA 3TMOA 1LW0A 3REOA 2M51A 1A0NB 1RESA 4WF2A 1NGDA 3EHRA 3LSPA 1W0TA 4KNYA 1ZG1A 3CD6T 2JWKA 2OA4A 4W5RA 2FJ1A 2E71A 2FRYA 3M0PA 3PLAA 4FZYA 4BR2A 1E7OA 3KP3A 2WTUA 2LVMA 1BYMA 2DOFA 4CGIA 1X27A 3PO4A 1JLGA 1Q7YC 4FIBA 4RG8A 3M0SA 1E6HA 1C1CA 2LCCA 3O8HA 1VQLN 2E70A 1WYXA 4IEJA 4CYCA 1GFCA 4ATOA 1YFHA 3JCMh 3RPUD 3CMAN 2IRFG 1WZ2A 5KRSA 2ZXJA 1XC3A 4BRPA 3A8HB 1RUNA 3LDOA 5CKBA 1HW5A 4J9CA 4M7DE 2WAQN 3MD2A 4GFBA 1SFUA 1N27A 2YLCA 2P4RA 1NJZA 4M78F 1F43A 2DPDA 4U7DA 1Q82R 4JKGA 4EDUA 4LC9B 2P5OA 1LNWA 3ASNH 2Q8KA 2FBXA 4BAYA 4OVLA 1PWTA 4BB7A 2OZUA 5A0LA 2A68F 4F7UG 3MKZA 2XICA 3MEEA 2BZ8A 1XMQK 5AZJA 4QLCU 4L3QA 3MDQA 5KH6A 4A3KJ 1YX5A 4N0AC 2OPSA 1EXQA 3MAJA 4CW7B 3THKA 1QKWA 2CP2A 4M73A 4LLLA 2HQ5A 1YJNT 3HHGA 3KZBA 4Z0UA 3OH9A 3DRPA 4A4KA 3GCMA 3BWGA 3VQAA 2ZXHA 3HK2A 1HYOA 5KAIC 2NVTJ 9ATCB 5HCKA 3CW7A 3CI5A 4DSLA 1R0BG 3VRZA 1PM3A 2HOAA 3FK7A 1RACB 2FC0A 1SHFA 1J9AA 3M0RA 3QHSA 3PL8A 4M3UA 3KP6A 2NUTB 4CYDA 3C7NA 2K5LA 1T98A 3JREA 2KRMA 4DQIA 1YP5A 1D0XA 3S2HJ 2FU4A 3CCJQ 4DKWA 5D5VB 1AVZC 3LGFA 1T3VA 3CCVQ 1KJWA 3QYGB 1M3BA 1WGSA 4H0EA 2L3RA 1JU5C 3H9JA 1WJAA 4FK2A 3TOBA 1VQ5T 3C0CA 1UWBA 4HX4A 1UJYA 2X4XA 1VRLA 2V1RA 4OU0A 1A6IA 4G12A 1Y6IA 3HYIA 2KZVA 4BGAA 4C0ZA 4BG9A 1ZUYA 5F1RA 4M3DA 1VQ9I 2FSJA 5L23A 3KBGA 3G6ET 1XC9A 5B5EC 3RIRA 1PUFB 4DSFA 4DBHA 3V7CA 3VU3C 1MJAA 5DLOA 2BTFA 2D1XA 2A07F 2LBFA 1F4KA 2LQKA 2KSSA 2KRHA 4CRIA 1VQ6A 4BKXA 3NMUA 1YITT 4YTLA 4DSIA 5J47A 3OYHA 3NGZA 1WN7A 3M0QA 4CCOA 2J6FA 5DUKA 1G59A 2F6CA 1YIJQ