3OYBA

Crystal structure of the prototype foamy virus (pfv) intasome in complex with magnesium and the insti mk2048
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
368
structure length
368
Chain Sequence
LDAELDQLLQGHYIKGYPKQYTYFLEDGKVKVSRPEGVKIIPPQSDRQKIVLQAHNLAHTGREATLLKIANLYWWPNMRKDVVKQLGRCQQCLITNASNKASGPILRPDRPQKPFDKFFIDYIGPLPPSQGYLYVLVVVDGMTGFTWLYPTKAPSTSATVKSLNVLTSIAIPKVIHSDQGAAFTSSTFAEWAKERGIHLEFSTPYHPQSSGKVERKNSDIKRLLTKLLVGRPTKWYDLLPVVQLALNNTYSPVLKYTPHQLLFGIDSNTPFANQDTLDLTREEELSLLQEIRTSLYHPSTPPASSRSWSPVVGQLVQERVARPASLRPRWHKPSTVLKVLNPRTVVILDHLGNNRTVSIDNLKPTSHQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PFV integrase
publication title Molecular mechanisms of retroviral integrase inhibition and the evolution of viral resistance.
pubmed doi rcsb
source organism Human spumaretrovirus
molecule tags Recombination,viral protein/dna
total genus 107
structure length 368
sequence length 368
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2010-09-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
A PF17921 Integrase_H2C2 Integrase zinc binding domain
A PF18103 SH3_11 Retroviral integrase C-terminal SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2300 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3oybA04
1.10.340.70 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Endonuclease III; domain 1 3oybA01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3oybA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3oybA03
1RT3A 1Z25A 3LP3A 2PZSA 3SI6A 3E9GA 2RI2A 2R57A 3OJSA 1VSFA 3O4QA 3I8DA 3MXMA 3U3YA 1C0MA 1BGXT 3HYFA 5C6SA 1TKZA 1CZBA 3T1AA 2O4IA 3S3NA 5C0MA 4KTQA 1F21A 4PY5A 4F3TA 3AVNA 3B6OA 1KFSA 4ID1A 5SWMA 4OLAA 3NGIA 3LPUA 3JYTA 1U4BA 1W9HA 1IH7A 1RDAA 3MP8A 3NTHA 1C1CA 3OYIA 1RCHA 4Z4GA 4CEDA 3AA3A 4W5OA 1SKRA 2M1HA 4B9XA 3D45A 3EZ5A 3QLHA 4GMJB 1JL2A 2RJEA 2E6LA 4O55A 3PMTA 1KFDA 4KAZA 1SL1A 3ITHA 2X78A 1DLOA 4CHQA 3K58A 1JLAA 2FBYA 2KZZA 3PNWC 3NDKA 2RKIA 2YHAA 4OVAA 2DIQA 4CGJA 4EDUA 3QESA 3AVCA 4CK1A 1BCOA 1TL3A 3LP0A 1B9FA 4BWJA 1WJSA 3DB4A 3RRHA 1JLCA 3NF6A 1JKHA 2KQ2A 2R7YA 1HPZA 3T19A 3H08A 3TAFA 4LH4A 1BQMA 4Q5VA 1HNVA 4B9NA 1WSIA 4CEEA 1S1WA 4I7FA 3TABA 4N4GA 3RTVA 3DM2A 2QK9A 4E0DA 3TAEA 3KKRA 1LAVA 2DY4A 1ZBHA 3M8QA 2P5OA 3META 3O3HA 1N6QA 1LWFA 4FLVA 3QERA 2LDMA 3P8HA 3HXMA 1S5JA 2P1JA 4FJNA 3OYMA 4GY5A 3KKSA 2HHXA 3LPTA 3S9HA 4CJFA 1LWEA 4FJHA 3K59A 3LZJA 3CYMA 3L3VA 4CGDA 3ZSWA 2I5JA 3AVBA 4MFBA 3MEVA 3QNNA 2O4XA 1SKSA 4AHTA 2YNIA 3VQ8A 4M3XA 4BACA 3F70A 3SV4A 3THVA 1RTHA 2HHWA 1U48A 3HPGA 2EFIA 4K8ZA 4II1A 4E19A 1QQCA 2KFNA 4A4HA 1RT2A 3OYDA 2B5JA 4IUVA 3AVFA 3LP2A 2MWOA 1UWBA 4DQIA 4KREA 1GOBA 2OPPA 3QEXA 3DLRA 4FJKA 2OPRA 4OPJA 3OA6A 3HVRA 4DU3A 3OYFA 3KK3A 4AILC 1NK9A 3DRPA 1X9MA 3S6WA 3VQ4A 3SV3A 3U6FA 1C0TA 5IAYA 4LY7A 2WOMA 1WN7A 4PUOA 3L2RA 4FLYA 1RBTA 4CGIA 3AVLA 4CRIA 2FBVA 2G8VA 1EETA 1QS4A 4IBNA 1DTTA 4E7LA 4QOZB 4IKFA 4CIGA 4DMNA 1NK6A 1MHNA 4KB0A 3L2UA 2EKOA 4BE2A 3HJFA 3OYCA 1G5VA 3IS9A 2K3YA 4DTOA 3C95A 1WAFA 1RDCA 3OS2A 5KI6A 4F2SA 4OVLA 3DLMA 4HCCA 1JXBA 4B9TA 1NOYA 2RF2A 3CFOA 1VSLA 2HHQA 2RI3A 3OYNA 3JSMA 2VG6A 3G10A 4I9LA 3KLHA 4H4OA 1LW2A 2YRVA 2OPQA 1TVRA 1TKTA 3NHGA 2QKKA 3OY9A 3IG1A 1X9WA 3ISNC 3NGYA 5HLFA 1XHZA 4B9LA 4FJIA 1YT3A 4C5IA 5I3UA 2L8DA 3LALA 1L3VA 5CZ2A 3NNQA 4Q5WA 1HYZA 3OYAA 1I3AA 3HPHA 3B6PA 3AO2A 4AHUA 2RJCA 4HHTA 3AVMA 1Y97A 4F4KA 3KUFA 3SJJA 3HL8A 3ZSZA 1RBVA 2HNDA 3VQ5A 3SPYA 2PYLA 3MO8A 4O5BA 4J2DA 1TL1A 1YTUA 4H4MA 4FM1A 1XC9A 1MU2A 4FL6A 4B9WA 2HHTA 2VG7A 4IG0A 3AVAA 4CGGA 1KVAA 1HQEA 4CF8A 4DTXA 1L3TA 3EYZA 5CY4A 1RT6A 3SD4A 3CQ8A 3KD1E 2EQMA 4FLTA 1RBSA 4CIFA 5KTQA 3O8VA 4FVMA 1CXUA 3V1OA 3FLGA 4IUTA 4W5NA 1LAWA 4DSKA 3ZT0A 3VA3A 5DK5A 4W5RA 1S6PA 3DLHA 4DQPA 3KJVA 2HW3A 4FZYA 2BUDA 1WLJA 3VQEA 4BWMA 4CGFA 2PQWA 3V9ZA 1J9AA 2FBXA 3OJUA 3WNGA 4CJPA 5J2MA 3VQCA 4AHCA 2D5RA 2VWJA 4E1MA 1REVA 3AA4A 4IUUA 4E1NA 4IURA 3P8DA 2RJFA 3QJ6A 1WNSA 1N27A 1X9SA 4CJ5A 4DWIA 2X4WA 4BE0A 4CJSA 4QW2A 1CLQA 3TAQA 1ZBIA 1RDBA 1QHTA 1U49A 3NF9A 4OGEA 4C8KA 4F2RA 3TANA 5FDLA 5J2QA 4CFBA 5JS1A 4FK0A 3OVNA 2QQRA 1YTAA 5KRTA 3DI6A 4FLZA 3P83D 3FC3A 3WNFA 3VQ6A 2HHUA 2XK0A 1WJRA 3KLEA 3CG7A 4G1QA 5CYQA 3OYGA 3TI0A 4DTUA 1H3ZA 3O4NA 4FLWA 2OPSA 4DLGA 2X6SA 4KHWA 3MEEA 3L2QA 1K6YA 2Y1IA 1RDDA 3RRGA 4C8LA 4FM2A 2IC3A 2Z1HA 4CJQA 3ASKA 1VRTA 2ATQA 1BISA 4K8XA 3LWLA 5M9OA 4WE1A 2BANA 3HT3A 3VQQA 3T3FA 4QVZA 4B8CA 2EQJA 3VQ7A 2HVIA 3AV9A 1RILA 1IKVA 4CJ3A 2X4YA 4FXDA 1HMVA 4L59A 3UT1A 1C1BA 4O4GA 2X4XA 4KTZA 2Q3SA 4CEFA 2D9TA 4DS4A 1JLEA 2NLUA 3VQAA 3K5MA 4OLBA 4Z4FA 1BI4B 5KGWA 2LTOA 4L8RB 3KTQA 3TAPA 4RW8A 4KI6A 1KVCA 1RBRA 2E6NA 2D0CA 2BE2A 4B9UA 5J26A 3H6ZA 4CJLA 1Z26A 1VSMA 1J5OA 4RW9A 4CEBA 3F9KA 1NJZA 2X35A 3ZT1A 4B9MA 1TV6A 5CZ1A 2B6AA 1YVUA 2Z1GA 4AH9A 5CIUA 3TAGA 4KFBA 4LD0A 1NJYA 1JL1A 3CEYA 1JLFA 2ZD1A 3LANA 4J2AA 1KHCA 3RMAA 4B9SA 5CYMA 1NK8A 1TKDA 3C6UA 1Q8IA 2FHDA 3OYJA 2RHUA 2IS3A 1ZBUA 3AVIA 3LAKA 2OYQA 3DMJA 3PX4A 3NBPA 2G8UA 4KHQA 1BQNA 1B92A 1KLMA 5HBMA 3PY8A 3FFIA 1RNHA 4N4HA 3ZT3A 1EP4A 4E7KA 4C5HA 4DFKA 4CECA 3DRSA 1QSLA 2HQEA 4CFAA 5FRNA 3A2FA 2XY8A 2VWKA 5HRRA 3DOLA 1D5AA 1IO2A 1W0HA 4KKOA 4OJRA 1TKXA 2RHYA 2B4JA 3SPZA 4Z4IA 1SL0A 2RO0A 4N41A 1NJWA 1KSPA 4M3RA 3AA5X 3IAYA 5FROA 1B9DA 3VQPA 2G3RA 3ZSXA 1VSKA 4CCHA 1FK9A 3C4SA 1RTIA 4M3UA 2XY6A 1UA1A 3V9SA 1NKBA 2QKBA 4IUPA 2VG5A 4N5SA 2HHSA 4RW7A 4NZGA 1S9EA 4KHNA 3S3MA 1HRHA 2DFHA 4IFVA 3V9XA 4W5QA 3V81A 2JLEA 5KE3A 1WSEA 4CEZA 2FBTA 2F5KA 1J53A 1NK4A 1IKXA 4O0JA 2LCCA 3DYAA 4LD6A 1NK7A 4LSLA 4W5TA 4C5GA 4FK4A 3M9QA 4ZHRA 2EQUA 3OQ5A 2OZSA 1S1UA 4JS4A 5T7BA 1TAQA 5J1EA 4FYDA 3P5JA 3QETA 4JS5A 3TR8A 2D0AA 1ZBFA 1JXEA 3PX0A 4TSXA 4DTSA 5KRSA 5D3GA 5J2NA 1S1TA 1RTDA 4Z02A 3RWUA 2JZ2A 3M8SA 2EX3A 4GVMA 3CM5A 3LWMA 2XY7A 1D8YA 1IG9A 1RT7A 1BHLA 2BGGA 3D0PA 2Z1IA 1T7PA 4HCBA 3AO5A 3S3OA 2IG0A 3CM6A 2KW4A 2A1RA 1NK5A 1EX4A 2O4XB 1S1XA 2CKKA 3SQ1A 4DSEA 1RT4A 3SUQA 3NTIA 2PYJA 4ZTFA 1LWCA 1L5UA 3K5LA 5J2PA 3L3UA 2XHBA 1VSEA 4HUGA 4DLEA 3PUFA 3AO1A 2O4GA 4I2PA 4I9QA 4DSIA 3HPOA 3I0RA 4XIUA 4FJ5A 2HB5A 4KI4A 1IKYA 3LLRA 2M0OA 4DF8A 1WSJA 5IN1A 2EHGA 2RJDA 4CF2A 1ZBLA 3KLFA 1S1VA 5HROA 2YNHA 4KHYA 1NJXA 3PV8A 4FCYA 2ETJA 4KHUA 1RT5A 3MEDA 4NYFA 2X6NA 1JLGA 4A4EA 2E6MA 5C25A 3NGZA 1X1PA 1SSFA 3KK1A 1ASVA 4FJXA 3BGRA 4BDYA 4N4IA 1Q9XA 1T05A 3NF7A 3M8RA 4DU1A 1ASWA 4CJTA 4C8MA 1HYSA 1KLNA 1RTJA 4FU6A 3DLEA 3PO5A 2P51A 2RN2A 4CHYA 4KPYA 1KVBA 1WSGA 2WONA 1LV5A 4YNQA 3KD5E 4CK3A 3QEVA 1ASUA 2HNZA 1OYXA 3HM9A 3L42A 5D6XA 1CZ9A 3PO4A 1KTQA 1SL2A 4DFMA 3RR8A 4CHOA 1QSYA 3WNEA 2RHZA 1RI0A 2IDOA 4DFPA 4FJLA 4H8KA 3SQ0A 3Q1JA 3SZ2A 2G8IA 3K57A 3O3FA 4C8NA 1EXQA 3SUNA 1S6QA 3ZSYA 4DQQA 3MXIA 3QO9A 4RW4A 3HVTA 2YNFA 4BD3A 4CEQA 4KB1A 4EZ9A 3UIQA 4GW6A 4AHRA 4HUEA 3OS0A 4CK2A 2EQKA 3V1QA 4HUFA 4A4FA 4FJGA 3V9UA 4E3SA 1UOCA 4O44A 2DIGA 1GOAA 1WJQA 5J39A 3U3GA 4DQRA 3ZEHA 4ELVA 2LVMA 2E4LA 2P0KA 4DTRA 4CHNA 3NFAA 1SKWA 3NE6A 2BKDN 3ZSOA 1T8EA 1G15A 1GOCA 4KTWA 4CFDA 3LGLA 3V1RA 3SUPA 4JLHA 3LP1A 4FJJA 2DFFA 5K14A 2RHIA 3OMGA 4B9VA 1L3UA 3DOKA 3OYHA 1FXXA 3QIIA 3NF8A 3IRXA 4KV8A 3ZT2A 4FLUA 3L8BA 3MECA 1WGSA 3TWHA 3NH2A 3MP6A 4FJ8A 2BIVA 1EKEA 2L89A 4HVJA 2BDPA 3AVKA 3QEWA 4O0IA 4CJEA 3QIOA 1J54A 4C5EA 4DTMA 3BDLA 3DLBA 4UC4A 5SZTA 4EP5A 1BIZA 4CFCA 1U04A 3ZSRA 3ZSVA 2XO7A 5KGXA 4R5PA 1CXQA 1A5XA 3CFRA 3I0SA 1OI1A 2HQXA 1VSHA 4E7HA 2LRQA 4Z4HA 2OA8A 3E01A 1XNIA 3LGFA 5KCHA 4CJVA 5HRPA 1ZYQA 3MP1A 3VQBA 4Z4EA 1JLQA 4E7JA 4DQSA 3AVHA 5JS2A 4CJUA 3HSTB 2VYTA 1U45A 5HP1A 4IFYA 2E5QA 3OYLA 4CGHA 3KK2A 3ALYA 3LH0A 3WNHA 1HQUA 5DMRA 4Z4CA 4Z0UA 5D6YA 2GFUA 4DTPA 4ELUA 2ITGA 3GOXA 4KRFA 3MEGA 4AHSA 3AVGA 1UA0A 4QQGA 1C1AA 1OZ2A 3BDPA 2XDPA 3TAMA 4N76A 3OS1A 2R5AA 5HRNA 1BCMA 3G0ZA 1WSHA 1QTMA 1D9DA 3SUOA 4CF0A 1A5VA 3ULDA 1VSIA 3KIOA 4OKJA 2L3RA 3E9FA 3SQ4A 3AVJA 1VSDA 2IAJA 3V9WA 2GFAA 3V4IA 4BDZA 4CE9A 4OKEA 2KZMA 4DG1A 4CHZA 4NS5A 1TGOA 4FJ7A 2DTUA 1XI1A 2HHVA 2IOCA 3ME9A 3UWNA 3QNOA 1QSSA 4DF4A 3V6DA 4DU4A 3RMBA 3VQDA 3DLKA 1RBUA 3RMCA 3SYZA 4FZXC 3PMIA 3C6TA 2NUBA 4N47A 2YKNA 3SCXA 1BIUA 2R58A 4EP4A 3QEPA 4DFJA 3HP6A 4FJMA 4CEAA 4X34A 3SNNA 2D0BA 4LH5A 4NCGA 2QXFA 1NK0A 2F96A 4DS5A 1TAUA 4A4GA 4FW2A 3QBYA 2WACA 4J2EA 2HNYA 1WSFA 4M45A 4B3OA 3SQ2A 3OYKA 4FJ9A 3KLGA 2HMIA 5KCOA 4M42A 2XY5A 3VA0A 3QKJA 4B8AB 4NYNA 3AO4A 3ZT4A 3FDRA 1SUQA 3AA2A 1S9GA 3KLIA 5FRMA 2K3XA 4QAGA 4J2BA 4FZZA 4HCZA 1XWLA 3H8ZA 2G8FA 3DLGA 3MEWA 4MQ3A 1TK0A 5EU7A 4FM0A 2B8AA 4BDPA 1TK8A 2KFZA 1HNIA 3FEOA 2A1SA 3PFSA 5I42A 4N56A 3OMCA 1NOZA 2DAQA 1O1WA 2G8HA 1C0UA 3LYIA 1I39A 4CESA 2G8WA 4FW1A 2YHBA 3RR7A 4DTNA 4M3WA 3VN5A 4FLXA 4Q0BA 5C42A 3HK2A 4UQGA 3EY1A 3NCIA 4ZTJA 2JGUA 4CJWA 3MEAA 3AO3A 5E41A 1VRUA 4CJRA 2RI5A 2Z1JA 4CHPA 1RT1A 3HP9A 4F3OA 1C6VA 1JLBA 2R5MA 3CFPA 2YV0X 4M3YA 4QQDA 4I2QA 3PX6A 2G8KA 5C24A 4KO0A 3TARA 3K5OA 1U47A 4AHVA 1HJRA 1WAJA 3VQ9A 4Y1CA 1BL3A 4PQUA 2QQSA 1HYVA 4B08A 4JRPA 2DFEA 5KH6A 3C94A 1TK5A 3LAMA 4M3ZA 1Q9YA 3F73A 2LSNA 2P5GA 1OZ3A 4ID5A 1LW0A 4DSJA 3LZIA 2M16A 4CERA 4DSFA 2ZQBA 2KTQA 4CJ4A 2HVHA 3L2VA 1XHXA 2AJQA 4DTJA 4ICLA 3QEIA 3K5NA 2MWPA 3MEUA 2F8TA 3OB9A 3OYEA 3MXJA 2X74A 2F8SA 1VSJA 2YNGA 3EAEA 5D6WA 3LDSA 4EZ6A 3NH0A 2YKMA 4C8OA 4PWDA 1N5YA 4RG2A 1BI4A 1ITGA 3DRRA 1UAXA 4IUQA 4M3TA 1IKWA 2GBZA 4IDKA 5KE2A 4QCLA 3K2PA 4QQ6A 3QINA 4FK2A 1KRPA 2RPIA 3NH1A 4NCBA 2OZMA 2IGIA 4LSNA 1NKEA 4HTUA 1NKCA 3ASMA 1QE1A 3NAEA 3QIPA 4OPKA 3OYBA 4F8RA 4PLIA 4PL6A 2GV9A 4E7IA 2PY5A 4OKKA 4RG8A 3NTKA 4CEOA 4CF1A 3HO1A 2GUIA 3M8PA 1DTQA 1FKPA 3ZSQA 4YFUA 4NCAA 3DB3A 1L3SA 2GF7A 4BE1A 2FC0A 3O3GA 2JTFA 2ZE2A 4IG3A 2RHXA 3LX7A 1SV5A 1T03A 4DSLA 4Y1DA 4PLLA 3RMDA 2Y1JA 1KCFA 2XRIA 4RW6A 4M41A 3ZCMA 2W42A 4OGCA 1A5WA 4CF9A 1R0AA 4E89A 1VK0A 4KHSA 3L2WA 4CJKA 3MAQA 4CIEA 4ELTA 1D9FA 3P1GA 4PA1A 1FKOA 4JRQA 5HRSA
chains in the Genus database with same CATH superfamily
1RT3A 2DD5A 2PZSA 3SI6A 4BEHA 4FPAA 1LOTB 1BW6A 2R57A 3OJSA 1P4AA 4D5FA 3FKJA 1C0MA 4M72A 1E4FT 2KIMA 3A4CA 1RFQA 4DNCA 2LC4A 2K9QA 2P81A 4LD5A 3KETA 3I0XA 2O4IA 2CSIA 2EH3A 2E2OA 3TREA 1Q1VA 2FLOA 5LHGA 4MZTA 2XC7A 4BH9A 1F21A 5GAGJ 1KFSA 5SWMA 4YDUC 3LPUA 1ABQA 4J00A 1W9HA 4MEXF 3VRZA 2JG6A 1JJ2P 2HZYA 4K43A 5AZJA 2EGCA 1NJIU 1C1CA 1LVKA 1ZBXA 3CCRA 4CCNA 4GNIA 3VF2A 3IH3A 1AOJA 5GAN5 4Z4GA 5LGNA 4BRMA 3ZN0A 2M1HA 1XX5A 5KQDA 4XEIA 1ORKA 3I9QA 3QLHA 2X6OA 4LMYA 1WHKA 1NKUA 4O55A 1KFDA 4TVRA 3SQNA 3O6BB 4KAZA 5ICFA 3OW2M 2FBYA 3VTIA 5BN9A 1BKBA 4G8XA 2RKIA 2V1DA 2JT4A 2GA1A 3CUOA 1I81A 1VQON 2HYJA 4M78B 3AVCA 1LDDA 1JGSA 1TL3A 3WQUA 4RCBA 1YJNN 4BWJA 2YG9A 1JLCA 1YHQN 2R7YA 3QOPA 1HPZA 4PGHA 1I5OB 4Q5VA 4B9NA 4CEEA 1W36C 4CCOA 2HPMA 3EE8A 4A6DA 4Y92A 4N4GA 4FWPA 4M7DF 4JYKA 1B1BA 4XLEA 3WTTC 4YOUA 2DOAA 3RKQA 4IRIA 3BC8A 2HBJA 1LAVA 2F5VA 4GV9A 3CMEQ 1NU0A 4YEJA 1FP1D 1WWXA 3ZCOA 8AT1B 1QU3A 4Q5SF 2O8BB 1JRIA 1HKBA 4ZGDB 3QERA 5HLHA 2LDMA 4B24A 4B3TK 1VQMA 1N77A 3O9SA 2PBDA 3LAPA 2HHXA 4CGZA 3LPTA 3CCQI 3BF1A 3CMET 2M8GX 1LWEA 1HLUA 3O5BA 3LA7A 2DBMA 1B72A 2SRCA 2MD5A 3VEOA 2FB7A 2RMOA 5CKFA 3M55A 2YLBA 3DTIA 1IAWA 2FA5A 3ZSWA 3A8MB 3ZMUA 3MEVA 1SKSA 2O4XA 3UA6A 2YNIA 1WHLA 4LG3A 3GTJJ 2E12A 3WTZA 2NS8A 2FMLA 3ZLJA 2P5LC 3HPGA 4AFZC 5GAN7 2NOBA 4FYVB 2V7ZA 4K8ZA 4II1A 1QQCA 9ATCB 5M1NA 3B6AA 2B5JA 3IWZA 4IUVA 5LL6S 1M1KC 3TTDA 3LL7A 5LJ3g 3FGUA 1GOBA 2XB5A 1UDLA 3QEXA 1MBHA 2DPPB 3DLRA 5AQVA 2HQNA 4NC7A 3JCUC 4DU3A 3OYFA 1GV5A 4AILC 3SHWA 1AZEA 1X9MA 3ZQ7A 2P7VB 4OIRF 3VQ4A 2M9HA 3CPWA 4JI3K 5IAYA 1LCKA 2BVLA 2LP0A 2GIZA 1J09A 2M7BA 5F0CA 2O3FA 2HZDA 4WCEL 4FLYA 3AAPA 2MMPA 2LBFB 1UECA 1RBTA 4CGIA 3LSKA 1K8AR 3AVLA 2DXBA 2PTKA 4CRIA 5DCFA 2NYXA 1LMZA 2XRLA 4RLQA 5LRSA 5JVTA 4C92G 2HKXA 4E7LA 1VQ6A 1UHFA 3CC7A 4QOZB 1IO6A 4IKFA 3CCRI 1DKGD 1G4DA 1T08B 1MDMA 1OEBA 5DD8A 2EKOA 2VB6A 2JZYA 3OYCA 2JA8J 4OO1J 2JS2A 4FYWB 5A0GA 2K3YA 1SRMA 4NC8A 1WAFA 5KI6A 4I02A 1GRIA 4G9ZA 3CLQA 3SZPA 4OVLA 4GCVA 3U4LA 1XJWB 2ZGWA 1JXBA 1N39A 3VEPA 3M59A 3E3VA 2HOEA 2BXZA 1XMOK 3HGGA 3W2WA 3G10A 1BBYA 1QZYA 4AIJA 1XDSA 2OPQA 1TVRA 4JHDA 5ECAA 3F6OA 1G3TA 4XLFA 1LDJA 1WX6A 2LJ1A 3VYUB 1OH8A 1X9WA 5GMKi 2DA7A 1P4WA 2HXOA 3CCLN 1YT3A 4XKWA 5C4JJ 5AT1B 1X01A 4FL9A 2BY2A 4BUPA 3BPVA 1K4TA 1UHSA 2K9MA 5KYXB 1J5EK 1HYZA 4HSTA 2IS2A 2ACJA 2QENA 3DF8A 2E41A 2AHQA 3IRQA 5JHFA 5HNFA 3AVMA 5DM6F 1K9MU 2I7PA 2M51A 1VUBA 3RKXA 3KUFA 4D0PA 4XICA 5J4VA 1F1ZA 1VQMI 2HBPA 5F08A 4C92B 5AQGA 2CH5A 4PFOA 2KY9A 4C30A 1YFNA 2YHXA 2D5VA 1RBVA 1K73O 3F0CA 1RIOH 3VQ5A 3SPYA 1TW2A 3MO8A 2Y69H 1Q86U 1Q81O 5B1AH 1TL1A 2ZPGB 4H4MA 4FM1A 3KWGA 4CZIA 4B9WA 2D2WA 1ZXOA 1W6XA 3M07A 2FVUA 3AAFA 1HQEA 1MJBA 3EG9B 5GAMh 1RT6A 2LLKA 4JP0A 2YWWA 4FLTA 2KDSA 5E1XA 1RBSA 1XTAA 2DYIA 1OKJA 4CIFA 1EWQA 5GADJ 2GA2A 3CI5A 4C23A 4FVMA 2KBTA 4KH5A 3BROA 3UKGA 2WUSA 4W5NA 4DBHA 3VYRB 1LAWA 2XB0X 3UB5A 4W5RA 4DQPA 1WFXA 1RUWA 2COWA 4A6EA 3D2FA 3GWZA 4CGFA 2FBXA 4PJOA 3WNGA 2DXTA 1YIJA 3HHTB 5J2MA 5EEAA 2E5NA 5JFRA 2D5RA 2BZYA 1REVA 4XR6A 4YPHA 2E1NA 4IURA 4J83A 4IHXA 3LM2A 4JN4A 4BE0A 4QW2A 4CSWA 1ZBIA 1VFCA 2KISA 2FEZA 2XDVA 1QHTA 3NVMA 1VQNN 3JR9A 1WYXA 1YO5C 3VPRA 1VQ6I 3LWFA 3CC7I 1TBXA 3ENHA 1FPQA 2ZWHA 2QQRA 3MHXA 4DV7K 2PBIA 5GTHC 2OTJA 3DI6A 4FLZA 3FC3A 2O61A 3VQ6A 2FZCB 1RESA 1ATSA 2JTEA 4G7ZF 1WJRA 2EWSA 4HNUA 2FRWA 5J40A 3CG7A 1FTTA 2JHNA 1KQSA 2EZLA 3O4NA 2OPSA 3DLAA 1UHMA 3ZQGA 5A0LA 4EMHA 4U87A 2QCOA 4FT4A 1UEBA 2PN6A 2W24A 1IZ6A 2ZJPF 3I59A 1T2KA 2Y1IA 3O2PE 1IRZA 4IWVA 1WI7A 1R5GA 2PMZN 3BE3A 3CPWS 2W6LA 5FO5A 2IW5A 3JAMK 1I5ZA 2ATQA 1BISA 4OOIA 5CKTA 2VQFK 3EQLF 2DW4A 5FU6B 1K0XA 5M9OA 3ZX0A 4AT1B 2QTVA 4FASD 1J7KA 1G3SA 3P9KA 4BROA 3H3NO 3MD2A 3VQ7A 3S2HJ 2HVIA 4HPQA 4CCJA 3E97A 4PJOC 1IKVA 2DL5A 3OW2P 5BOXA 1B3QA 1KYWA 3FK6A 4AF1A 1JTXA 3I56A 4DV1K 1OPCA 3AT1B 5DEQA 4JX4A 5ADXA 1FYNA 3R0AA 2WSCE 4O4GA 4KTZA 3J7ZO 3EG1A 2Q3SA 3REOA 4CEFA 4EEFG 1Q7YO 3C2GA 4AM7A 3HDDA 2YX6A 4C3JJ 1JLEA 4ILHA 3K5MA 1K4SA 1J9IA 3IHOA 2V7YA 3CC4Q 4JPBW 3R60A 4AIAA 2BBYA 5IOYA 2JPSA 3EGXA 1ON1A 2KHMA 5E8GA 1Z3XA 2E6NA 2BE2A 3H3VK 5GAN2 4DV0K 1X3WB 3H6ZA 1K79A 4KIFA 2K02A 5AQZA 4R1HA 1GLLO 2KLOA 1QHAA 3F9KA 1KC8U 2CT3A 1XSDA 2D1KA 1TV6A 3CCSA 2F5TX 5CZ1A 2Z1DA 3VWBA 1MV0B 2B6AA 4CD3A 4J7FA 2Z1GA 2FF3B 4KFBA 4OMNA 3QAHA 4ILJA 2NRVA 2PMUA 1JL1A 4FWRA 3MCAB 1EF4A 4GGGA 2ZD1A 2QQ9A 2FRHA 4H03B 4J2AA 5JLWA 2X85A 5AFUA 1W7PB 2QKLB 3CBPA 4HX4A 1YIJI 5GANe 1W36D 1R59O 3PNVA 4JRKA 5GAGP 2EINH 2AO9A 1S22A 3VS0A 2J6KA 4XRFA 3MKDA 3DMJA 1TS9A 3PX4A 2ASMA 4WXDA 4F16A 1KLMA 5HBMA 3QHSA 2H8WA 2RQUA 2EFNA 3FFIA 3LW5E 4N4HA 3G73A 5EG2A 2QVOA 3A02A 3F23A 4DFKA 2CZ0B 1HSTA 2OTJI 3R6MA 4CFAA 2P84A 3CJ9A 1DIZA 1YITQ 2VXFA 2AXLA 5HRRA 3DOLA 1T8IA 1H88C 2KE9A 1D5AA 1S29A 1W0HA 2OU2A 1HJOA 4KKOA 1JQQA 3M56A 5L3FA 2C0TA 2VN2A 3G1OA 2VOPA 1KSPA 3TW7A 2PAVA 1YITT 2XF5A 3OOPA 4F91B 2VPRA 3LDOA 2FQ3A 2VLAA 2E1YA 1VSKA 1FBUA 1VQ9Q 1FK9A 4IDHA 2W7NA 5EEGA 2VIXA 1PCXA 1UA1A 4WXCA 1U06A 2KJCA 1NG6A 3JRFA 4BR9A 1VAZA 2VBXA 2XAJA 3CBMA 3RESA 3WEEB 4L3QA 2HBMA 2VG5A 2HHSA 1WPKA 3BTLA 1YW8A 3H0IA 1KK7A 3R0JA 2BEOA 2XPVA 2OZ6A 3HEFA 5M5WJ 1VQ9T 2JA7J 1PU8A 2V51B 4IFVA 1S9HA 1IGQA 2K5IA 4RUGA 5L3EA 4JD2A 2JLEA 4G6TB 3I56I 2WB1N 1T98A 2IA1A 1VIEA 2FBKA 5EYRA 1WSEA 4JI7K 1BN5A 1R5HA 5F1RA 1NGBA 1FX7A 2IVOA 2V8IA 1QQIA 1NK4A 2J7IA 2LC2A 1T6CA 1LEBA 5LJ5f 4LD6A 4OINF 4MMLA 3ZOBA 3QICA 1UAAA 3CIPA 1Z6RA 2MC3A 2VQHA 2EQUA 3UPUA 1O3RA 4HVVA 2LK2A 5F0HA 4OAZA 1M3BA 4KA4A 1QVUA 1SQKA 1TAQA 4LC9B 1IGUA 2F1LA 1ARKA 3D2EA 5FLVA 3MWPA 2X1DA 4WK8F 3VV0A 4II2A 4TSXA 4DTSA 2COBA 3H45C 3SFMA 5D3GA 2LSOA 1RTDA 3WODF 1S3JA 4ISGA 2JZ2A 3CCSI 4IO9F 5JHUA 2QSFX 1PJRA 2GWKA 5E26A 2O03A 1GLDG 2M0MA 2XY7A 2R7DA 3I8BA 2VJIA 5AQOA 4EM1A 2E2HJ 2VC8A 3FIFA 2LDUA 4A3GJ 2K9SA 1IXRC 2CP6A 3EH1A 3O5ZA 1SC7A 1NGGA 1T7PA 3AG3H 4HCBA 5AQUA 3AO5A 3N5BB 5I11A 4IHYA 2LJ3A 3M1FA 2ESWA 1EX4A 1TWHJ 2FOKA 2CKKA 3R6SA 2JW4A 3QB0A 4XLAA 3RUXA 1SVLA 2H6BA 1WZOA 4AFQC 1OH5A 3GFLA 1LFUP 2ABKA 1KQ0A 4ZTFA 2HNIA 1N25A 3K5LA 5J2PA 4XK8E 1JXSA 3PSFA 3D1NI 1FNNA 4HUGA 4GLMA 4UHTA 3CCQQ 3LFKA 1X2MA 3U9GA 3CJAA 2W0ZA 4I2PA 4F52A 3HB9A 2HB5A 3O80A 6AT1B 3FF5A 1M4ZA 1GLAG 4CZEA 2OQGA 2K2MA 5M1FA 1GLJO 1I1SA 1WSJA 3MX5A 1NMDA 2RJDA 3IAS2 3KLFA 3THWB 3KHYA 1U9NA 1RAHB 2YNHA 3ID8A 3VYHB 3I0TA 2A6HF 4EHUA 4AD9A 1RT5A 4WFAL 2UXDK 1U8RA 3MEDA 5CQGA 2E6MA 5C25A 2EK5A 3KK1A 1ZKGA 2AS5F 2P9LA 2NUTB 2M0CA 4FJXA 2ZZDA 4BGDA 3M8JA 3BGRA 4N4IA 3ZXSA 3NF7A 2VQLA 5K5OA 3JTHA 1PUFA 1MNMC 1YI2A 4C8MA 1MH3A 3LSIA 4YORA 3TTCA 2WC2A 3G6EA 1TQIA 3PQKA 5JLHA 2RN2A 4ESBA 1QZZA 3EDPA 4CHYA 1OR7A 4YNQA 3KD5E 2C6YA 2YX7A 2HNZA 5CR4A 4BI3A 3L42A 3DPLC 5DY9A 3M1CA 4ZDLA 3KZZA 2D8JA 3CCRQ 3CC2A 1SD4A 4Y17A 2RHZA 1V5GA 1HXDA 2PZ1A 1R4NB 3K4BA 4BQOA 1NGHA 2WV0A 2RQPA 4OMOA 3JSOA 3S17J 1TH7A 3QDRB 3SZ2A 2VASA 3FZVA 2HXIA 3I3LA 3Q0WA 3L1PA 2G8IA 4C8NA 2Z3YA 2QDYB 5CVRA 5DYMA 3CWSA 3D6RA 2R92J 4DQQA 4RW4A 4UUSB 2VONA 3HRTA 4N0BA 4LGWA 5IWAK 4EJTA 4PKGA 1MUYA 2LQNA 4CK2A 5GADP 4D7NA 4LDXA 2F9TA 1ZARA 4HUFA 1K1ZA 2M0YA 1AU7A 4O44A 1WQWA 3H9GA 3CJNA 4DQRA 3ZEHA 1VQ4Q 4A3MJ 4OFEA 3OH9A 3JCMh 4LB5A 3VFZA 1SKWA 2HQRA 1BR1A 1V54H 4KBMB 4ASNA 1ZH5A 2BKDN 1R36A 2XSJC 1X6BA 3TSPA 5TJJA 4U0VA 4M3EA 3U8XA 1OR7C 1VQ4T 5F2RA 3LP1A 2MFZA 2M34A 2DFFA 3T8RA 4PJOD 4DB3A 1OU9A 3BTIA 2K9LA 5J4YA 4MO5A 1VQMQ 2E19A 3MMYB 3OMGA 4B9VA 1SFUA 1L3UA 3OYHA 1ZHIA 3QIIA 2CP7A 1IBKK 3QYGB 3L8BA 1I6XA 2QWWA 4FPBA 4PDKA 4AG1C 2QGUA 1WGSA 3M53A 4ESJA 3J81Z 3CCEA 5CAIA 4I6MA 4A3IJ 2CWEA 1FJLA 1VQMT 2HDDA 2XAGA 2PLYA 4DCHA 4Y3OA 4H4KC 2XHCA 3A0IX 2DMQA 4HVJA 1UJYA 4A5MA 2M02A 4BRDA 3HHHA 1P7MA 4XM3A 4J9HA 3NWTA 4U7DA 3CQZJ 4CJEA 2BW3B 3VB2A 1N78A 3AGKA 1BA5A 1V4SA 4BQQA 1Y6IA 2CZ1B 2CG4A 2HL3A 3RDIA 3BDLA 5ILVA 3N05A 4UC4A 5SZTA 3GP8A 5D5VB 1BIZA 3UKRB 4NL2A 4N4NB 3G4SA 3ZSRA 2XO7A 4YIFA 1ZK8A 1YI2I 4C2MJ 1U1SA 3BG3A 2ZSHB 1IW7F 4Z94A 3CCUA 5CVUA 3OR1C 3A8YA 2F69A 4B9QA 2KMUA 3PNTA 3G6EI 2FL7A 5AN4A 3CUQA 3KP7A 2CP5A 5BRHA 2LRQA 4BR0A 3KNTA 4O3MA 1UGPB 3L4QA 2HF3A 3HHGA 5I2SA 4H5VA 3GFIA 3E01A 4DW6A 1XNIA 5I9EB 2HGCA 2CT4A 5E84A 2O8FB 4Z89A 1ZYQA 3MP1A 5JICA 4I76A 3CWUA 2K40A 4DYCA 3VPZA 1R77A 1TWAJ 1AWXA 3AVHA 5JS2A 1VQ6Q 3SLCA 3CC7Q 3ERMA 3CC2I 3HSTB 1HPMA 2I7NA 5GMKh 4BEHB 3ULRB 2A40A 3OYLA 1W5CC 3ALYA 1OISA 1OU8A 2XKPA 5BPDA 4LNPA 1VQ6T 5CVJA 3CC7T 4J7IA 4DTPA 4ELUA 3CJQB 3GOXA 2ICWG 3MEGA 1E6HA 4AHSA 1IXDA 2NOFA 1YRNA 5KK1A 4A53A 4QQGA 4H0XB 4KYWA 2FMYA 1WHHA 2X6WA 3BDPA 2CYZB 4ZC3A 4WWCA 3LSTA 4BUGA 2R5AA 2XDBA 5IYBJ 1WSHA 2GOXB 1KSWA 1D9DA 4AM3A 5L23A 2PJPA 4PJOE 1M90O 3AVJA 2WY8Q 2TRTA 2EFQA 2CGHA 2IAJA 1TTYA 4KH1B 2GFAA 2OQRA 1NGDA 1YQLA 4CE9A 4ZYEA 4E2FB 4OKEA 3WUHA 5LJ5g 4NL3A 2E1HA 2WBMA 5GANd 4HWIA 3AHUA 4B3MK 4FJ7A 4IZ9A 2XU8A 3CUQC 3A03A 3PFYA 2NZTA 4XTVA 2F5FA 2DTUA 3E1YA 1PUEE 2HHVA 4N9IA 5BN8A 2DBBA 3UWNA 3NGPA 4XU2A 4RTVA 3QNOA 4OIOF 1JI8A 2KRCA 4ZYDA 1T0FA 3JCMX 3ZQLA 3RMBA 3OV8A 5A2QK 1E3OC 3RMCA 3SYZA 4QTRA 2EPDA 3X20B 1BW5A 2NUBA 4N47A 3E66A 2YKNA 4NLBA 2CYYA 4PJJA 1GDTA 3H46O 4XN3A 1G3WA 5DM7F 3UA7A 4JKAA 3H9NA 3JRCA 3BDDA 4X34A 4MDBA 2JJ7A 4BI4A 3IDHA 4MEYF 3CCEI 2OTLN 1KU7A 2J6OA 4KMUX 2QXFA 3THXB 1NK0A 1V4RA 2HCKA 2O9VA 1T3SA 1TAUA 3HL2A 3U23A 2WACA 2AQFA 2F2WA 4J2EA 2RQTA 2HNYA 2F5DA 2ROLA 3SQ2A 2EGEA 2IS6A 2HBLA 4FJ9A 3BQZA 1WJ5A 4IOAL 1XNQK 4DUYK 5KCOA 4M42A 2L3DA 1HNXK 4BHPA 4ZN3A 1NGCA 2VQCA 4ENKA 1SUQA 3A8HB 3OBYA 4L18B 2K3XA 4NB5A 3G4SI 1U9OA 3HTRA 4FZZA 4S0HB 6PAXA 2DMTA 1RADB 3H8ZA 3HFNA 1YIJQ 5FD6A 1TK0A 3CCUI 5GANf 4KITB 2XPUA 1B72B 5AQJA 5E8IA 4RTYA 1ZRCA 3S16J 2B8AA 2KFZA 1IG7A 1QGPA 3FXOA 4HF2A 2KZVA 3FEOA 1MUDA 1LWWA 4HDVA 4C0GA 1FIAA 1NOZA 3DBHB 4G6QA 1GHCA 4EMSA 1P8ZA 1YIJT 2DCEA 3M0UA 2ZXHA 2K86A 4CESA 4LIVA 5C4XJ 2K9NA 1T0FC 3EUKL 1BI0A 2I8DA 2YHBA 3RR7A 2YSRA 4M3WA 2OTJQ 3TU4K 2JA6J 3M58A 4ELZC 3FXJA 4M3DA 4XTUA 4JI5K 4ZTJA 5FU7B 2JGUA 1XGOA 3MEAA 1Q81U 3VERA 3PIOL 1OCZH 1YITN 4Y4RA 1PRLC 2KGTA 3HOVJ 4CHPA 3HOTA 2MA3A 3E0JB 2CGPA 5LJ3h 1GL5A 1G59A 1C6VA 2OD5A 3CFPA 2YV0X 2MIOA 2JRTA 2OTJT 4ENMA 4QQDA 2R7QA 3LWHA 3VS4A 5GMKm 1KQ1A 5ED4A 3G25A 2YUPA 5AIPA 2ITMA 1YBYA 5C2DA 3PX6A 2G8KA 1K8AC 4P5OA 3FSPA 1KO9A 3P31A 3K5OA 4H5WA 5EX5A 4DHYA 4K0KK 3VQ9A 3A5OC 2UZKA 2ESNA 4Y1CA 1NEBA 4E1JA 1VQ9N 2QYZA 2QQSA 2CH4W 3HG9A 2DFEA 1OPLA 5KH6A 5C2FA 1WLPB 3LAMA 3DXJF 2RM4A 1VZ0A 1MDMB 2PFUA 2P5GA 1LW0A 1T56A 2QLZA 4DSJA 4F93B 2JOYA 3URGA 4ZDOA 4L9TA 2V1NA 1B9MA 3I56Q 2F2VA 1S1NA 5CQYA 2EYWA 2HVHA 3MQ0A 3L2VA 2EYYA 2RF0A 5FPNA 1P7JA 4XSXF 3QEIA 4BC4A 4ZN1A 2MWPA 3TO6A 3OB9A 2X74A 4PFPA 4M3BA 1Z7UA 2VI6A 3CCJA 2QSGX 4YIIA 3I56T 3O1WA 3ZPLA 4RG2A 4JHDB 3LAJA 1R9TJ 3DKWA 4E9FA 2ID6A 3P39A 2ECCA 2L4MA 5EY4A 2O7OA 4QCLA 1N5ZA 2HI3A 4PJOG 4Z8AA 4XK4A 2RPIA 3J80O 1ZHFA 2IGIA 1M1FA 1A35A 4J19A 3CLOA 1NKCA 2JPBA 2RD1A 3OYBA 3CCSQ 2Z99A 2UUAK 3FXLA 4PLIA 4E7IA 2RQVA 2RNAA 2DEQA 4CZCA 2R7SA 4RG8A 1M2VB 3NTKA 2A69F 3HO1A 2R5YB 2GUIA 1Q82R 2A37A 3VETA 3EFOA 3JTGA 1X2KA 4NCAA 1VYUA 5LJWA 3DB3A 2K3PA 3WGHA 3JRHA 4BE1A 2XAUA 3BOQA 3R1XA 3Q7BA 2JXBA 3GXOA 2JTFA 3CVTA 2N8GA 3CCST 1PKTA 1KZHA 3AG4H 4NQWA 3G3ZA 5TISC 1T03A 2W84A 2XRNA 1PD0A 4J8OA 2RN7A 3S1MJ 3JV3A 4FX0A 2XRIA 4M41A 2RE2A 3ZCMA 1A5WA 5KAIC 4KULA 2VL8A 1VK0A 3G71A 1S8NA 2VUBA 4VUBA 2KT8A 3OSVA 2DT6A 4CIEA 4BR2A 2HNHA 3Q0VA 3RR6A 4WCGA 4YRVA 4DIQA 5LL6Z 5CLSA 1PRMC 2RI2A 3K9JA 3PO2J 5BR9A 1W2BA 3I8DA 3MXMA 3U3YA 2O9LA 1X43A 1ZREA 1BGXT 1BR4A 4H0YB 4IOXA 1RAAB 3FRNA 5HY6A 4LF7K 2BY1A 1I3QJ 1TKZA 1XQHA 3T1AA 4CO8A 2V52B 2RNGA 5C0MA 2P0PA 4PJOB 1PM3A 1SKUB 4DYRA 4F3TA 4H5NA 3JW4A 4OLAA 4E7ZA 1QVPA 3ECOA 2LNHB 3NGIA 2P5VA 2L2OA 1AEYA 2VJJA 4QVCA 2W40A 3NTHA 3VYGA 4H5TA 3JB9J 2QK0A 3OYIA 2ELHA 3AL0B 3K10A 2FSJA 2O88A 4C0DB 3GOIA 1XG1A 2GBYA 3CERA 4MLEA 3F6VA 2DI3A 5E3OA 1WXUA 1MBEA 5FD5A 3HJEA 3R9PA 3D45A 3D0SA 3EZ5A 4GMJB 3ZQQA 1JL2A 2HR3A 4IHVA 1QQJA 4EW4A 4FYYB 5B66C 2RJEA 5CKHA 4LFCK 1LOJA 2VBWA 3QWXX 1BIAA 1A6QA 5GMKl 4B1XB 1JLAA 3PNWC 4EJUA 4M7AE 3NDKA 1HDDC 5IHKA 2DXUA 4EDUA 1M8MA 2NOGA 1NJIO 4MDWA 3LP0A 1M1GA 1B9FA 4UY8I 3WG9A 5AQLA 4M6VA 1NGJA 4XH4A 1FJGK 1SFXA 1JJ8C 2IIMA 4PK4A 1FWZA 3RRHA 1OH7A 4BVPA 2YSQA 3CCJI 4C2UA 2KL4A 1IRFA 4JX6A 4KICA 3T19A 1KFZA 1TYQA 3H08A 1W2BM 2MPXC 1HNVA 1K83J 1OYYA 1UG2A 3TABA 2CDTA 2OJED 3RTVA 2OCEA 2QK9A 3P38A 1YN8A 3RJPA 3HSEA 1N8RR 5M5XJ 1R49A 1Y96A 2M4GA 3M8QA 2P5OA 3KEYA 5ADXH 4YOVA 4MFEA 3META 3P8BB 1BU6O 4JK1X 1LWFA 4FLVA 4HSRA 1SMTA 2O8KA 1S5JA 4OB3B 4IQ4A 4FJNA 3OYMA 5J1YA 1OMIA 4BRCA 3J80E 2NVQJ 3ID6A 3S9HA 3NARA 3OHRA 1SHGA 1TZLA 1VQ4N 4JKEA 4BRPA 4CGDA 3CMAA 4RB3C 2L7ZA 2I5JA 3AVBA 1POGA 4M3XA 4YFNF 3F70A 3SV4A 3THVA 3L09A 3IH4A 5ILSA 3K4LA 1YIOA 3EG2A 3HXLA 4P9FA 3G71I 4HXJA 4E19A 3FBIB 5LFAA 1H9TA 3MMVA 1QLYA 4ISFA 1UWBA 2OPPA 3I9V2 5E79C 1OX9A 1X3MA 3OA6A 2BHYA 1QW1A 3A5LC 4LDUA 2P9NB 3I55A 1BOTO 1GLBG 1N33K 4BHBA 4EGYA 2C0IA 3BR6A 3T0YA 4Z6YA 4KFCA 4A2AA 3F8CA 3ZX2A 4DV5K 3RKWA 4A5AA 1C0TA 5F0XA 4DV2K 1DT9A 3DU6A 1HA8A 3KZBA 1WN7A 2W03A 2BHZA 4EJVA 2RQWA 4XRSA 3L2RA 2STWA 3EN9A 2FE3A 3T1HK 1QMCA 4OMYA 4A69C 3D7EO 1P2FA 1OVQA 5GANg 4CYDA 2G8VA 1EETA 1QS4A 4IBNA 3CPEA 5EZHA 9ANTA 2ZPIB 2BTTA 4HF0A 5ICCA 2HVRA 1YI2Q 2BYVE 3U1DA 3BDUA 3LDPA 4M78F 5IP7J 1LPLA 2RHKA 3HJFA 2AP1A 5J1UA 3G6EQ 2GAUA 4B1ZA 1JE8A 5KYUA 3CXCA 4DTOA 4B3AA 3MFKA 1WJBA 3C95A 5KN8A 2K7AA 3OS2A 4NXMK 4F2SA 1R4MB 4ZYAA 1YI2T 1W2BS 1Z0XA 1B4AA 3CD6A 5E3MA 2B63J 3HZJA 3G6ET 2K3BA 2HHQA 4U7BA 3CC2Q 1RR8C 1QQNA 1TKTA 2F7TA 2LOOA 3U2RA 4BQZA 2QZ8A 3OY9A 3VTHA 2ZCFB 3IG1A 2Q1ZB 2E20A 2QF7A 5FKOA 5KCMA 1I5LA 4FWMA 1DUXC 1MUZA 1EIFA 5IY5H 1ORPA 4C5IA 4U0WA 1T0JA 2L8DA 3LALA 4ELYC 2HF4A 1L3VA 4AQYK 4FHTA 3NNQA 4CH7A 3L2ZA 4BNCA 5J3LA 3F8MA 2FF6A 1D5YA 4M7AG 1O57A 3HZ6A 1A6IA 2WAEA 1QZEA 4F4KA 2G6FX 2XGEA 3SJJA 4FE4A 4CC3A 1T6SA 3C65A 3F22A 2H3JA 4NOYA 5AQSA 2NRTA 3GIBA 2IS1A 1QA6A 1XMXA 1JGGA 1KAXA 2QWNA 5E20A 1M3QA 1KAYA 3GBQA 2PYLA 2Z9OA 2VODA 4O5BA 3SZTA 1G3YA 3CXCM 3CMAI 2MD0A 5CVIA 3HPWA 1XC9A 1VQPN 4DR2K 2HMPA 1HKSA 4LD9K 5GAOn 2PU9B 2L0KA 2F5EA 1K9MO 2JMWA 2ZJQL 2HD0A 1KVAA 2LYCA 3TGNA 3EYZA 5CY4A 1EH7A 1VQ8T 4YTLA 2RREA 3MAJA 2EV6A 3CCMA 1P9QC 3JCMW 4DBFA 5HVQC 1IHWA 2VV5A 4IUTA 4J6XA 2BY3A 3ZFJA 4UVCA 1U6GA 1Q86O 4DSKA 3VA3A 1UG0A 2BY0A 2P5KA 3I55I 4WQ4A 1WLJA 4YPRA 4BWMA 3CCEQ 1S72A 2NRXA 3V9ZA 2PVDB 5FGMA 2STTA 1CF7A 2JQ7A 4M6YA 4L5JA 2JMCA 4CYCA 4EIKA 4FSXA 4E1MA 5GAN3 2Q97A 3DTEA 4CW7B 2YS9A 4FT2A 2F48A 3UE5A 2R93J 3JRIA 4B1RA 1N27A 1NG2A 4CJ5A 2MYSA 3GZ5A 4CJSA 1E4GT 1CLQA 2G7HA 4LDYA 3K9TA 1K76A 3CCET 4GRIA 4ISEA 1RDBA 1U49A 4C8KA 1U5TB 3CDLA 2D0OA 4F2RA 4M7AB 2E60A 5J2QA 3TANA 4GYGA 1U3OA 2A28A 3CDHA 3G4SQ 3OVNA 2J06A 3BY6A 3KLNA 3OMYA 3P83D 4EMKB 3OSGA 2YR2A 3CCUQ 5GAOm 2Y75A 2HHUA 2XK0A 1K6OA 4UUVA 2K7LA 3NEUA 2GBQA 3JREA 1ZQ3P 3TI0A 4DTUA 1H3ZA 2X6SA 4LLLA 3M0PA 4X6AJ 1ZN2A 3G4ST 2FYKA 4A93J 3TTFA 2MOXA 1K6YA 3CD6I 3CCUT 3DXKA 4IXCA 2GQQA 2XAFA 3I5RA 4F17A 2D0QB 2IC3A 1KQSP 3O9RA 2Z1HA 4CJQA 1X1DA 2P7CB 1XPXA 3ASKA 5KYWB 4BXXJ 2P9LB 2OTJN 5BR8K 1IGNA 3QJYA 3LWLA 3VYSB 2NRAC 2W48A 2H56A 2BANA 3HT3A 3TW6A 2V1XA 3QYBA 1PUFB 4FWSA 4WQ4C 2X6XA 3T3FA 1GVJA 3MKWB 3B6CA 4M74A 1JJ2A 1D1AA 1PSFA 3A5MC 3SJHA 3AV9A 1RILA 2DFIA 2X4YA 4FXDA 1RKTA 4WQ5A 5LD2C 4HRIA 1X9JA 4EV0A 4CC7A 3UT1A 5B5EC 3CXCS 1VQOA 3VS5A 3IHUA 2X4XA 3KWIA 1QBJA 2WA0A 2A5YB 2Q0UA 1FSEA 2NLUA 5I22A 1KJWA 3HTVA 3QG1A 4Z4FA 2J5OA 1CQTA 5KGWA 2DAOA 4HG2A 4L8RB 3ZMZA 5ILUA 3KTQA 4RW8A 1ATNA 1IN7A 3G1MA 1BDGA 3MN6A 1VQLN 3KCCA 4B9UA 4EVIA 2K4YA 2DN0A 2LCSA 4CJLA 4LG0A 1Z26A 1VSMA 4DV6K 4RW9A 4JI6K 3I56N 1S3XA 2IVWA 4B9MA 3E2UA 1R1UA 1V1CA 2EZHA 5BRDA 1N34K 4MTDA 5HDNA 4IL6C 3BZCA 3RVCA 4LD0A 3CCMI 2RGVA 2VOOA 4Y7NJ 2J6FA 3SEZA 4BRNA 5FLXO 2O2OA 4A3CJ 1VYVA 1V5EA 1RDUA 1NBEB 3WU0A 4JI1K 3E7LA 1QKXA 1JHHA 5E3LA 1NYGA 3RMAA 2WY7Q 4B9SA 4OMQA 1JKRC 3P4IA 3C6UA 1ORNA 1S72I 4BREA 4BRAA 3OYJA 3W6JB 1KC8O 2ZKZA 1IN5A 5JMVA 3LFUA 2A3ZA 3I35A 3U9DA 1JJ2M 2IS3A 5F0FA 1ZBUA 2HPIA 4IOAF 1TWGJ 1H9GA 4FOEA 4CCLA 2OYQA 1MBGA 3NBPA 3EGUA 1B92A 1ZX6A 4WQ5C 3F5TA 4KN4X 3PY8A 2X3XD 3FXQA 1SS6A 1WGXA 3P9IA 3L1AA 3ZETB 3T1YK 2QTDA 4J8FA 4ZJZA 5JI6A 4HCKA 5FRNA 2CP0A 4L6V5 2RK2A 3BG9A 2PJRA 2QA4N 1MMDA 3H3UA 4EGZA 1IO2A 2UXNA 5AQKA 4IFEA 4UB6C 2OJ2A 1TKXA 2RHYA 3PGGA 3SPZA 1NEGA 1XN7A 1GBRA 4V19K 1SL0A 2RO0A 4M77E 2Q0OA 1XQOA 4M3RA 1K61A 1KG6A 4JZ4A 1R0BG 1JT0A 2IVNA 4IHTA 4B3RK 2DO7A 2WAFA 5LHHA 4IJNA 3G7ZA 3HIFA 5IH2A 4GO1A 2NOIA 1X2NA 4EVVA 3INZA 3PIOF 3A0BC 4ETSA 1NKBA 4A0ZA 5CHIA 2EKHA 1ACIA 3EGDA 4A57A 3N0UA 2DYBA 4RW7A 1EA3A 3CO7C 4LDVA 1EBMA 1HRHA 2JTMA 2DZCA 1M2OA 3C7NA 3CUQB 2HFHA 5KE3A 4IZZA 2KDOA 4OU0A 4CEZA 2DD4A 2EJFA 2EFPA 4CZKA 4MDAA 4J9FA 2ED0A 3TP3A 1VQOI 1IKXA 4O0JA 3DYAA 1JEGA 2CMPA 1TSFA 1I94K 3ABKH 2DEUA 3TSUA 2Y2ZA 4LSLA 3RMQA 1SAXA 2LNVA 4C5GA 1KQ8A 2QYOA 4FT8A 5HK3A 1GBQA 1JJ6C 3Q3SA 2OZSA 1QVFP 3R6NA 2QBYA 4JKDA 5J1EA 4FYDA 4NC6A 1C6VX 1GUUA 4JS5A 4ILGB 5BMZA 4K41A 5LLQA 1ZBFA 3PX0A 1HKGA 3L00A 3WXKA 5J2NA 3RWUA 3MZ8A 1U1TA 2DU9A 3H1CA 4YFXF 2CH4A 3K2AA 4DOZA 1B34A 2M5WA 4GVMA 1VIFA 3JRBA 5IT9K 3H36A 1IG9A 5GAMf 1RT7A 4A59A 4U0YA 4IHSA 1JJ2S 1BHLA 2BGGA 3DWLE 2Z1IA 5CYVA 3R8EA 1U6ZA 4BQNA 1O3QA 2GGRA 1U5SA 4ZZDA 5CPRB 4FSVA 4CZZA 1K73R 3S32A 2DVJA 4B4CA 2AZVA 1PKSA 1TTHB 2XGCA 3J7AY 2ZGZA 3NTIA 5FLXE 1N75A 2O5RA 1XUPO 3QP5A 1TQPA 5CKDA 3ABMH 4FWQA 1XMKA 4A3EJ 4DSIA 3I0RA 4XIUA 4A3KJ 4KI4A 1L3LA 3LLRA 2COZA 1ZGAA 5D5UB 2M0OA 4DF8A 4QVDA 3HSRA 4A5NA 2YXYA 3QFPA 5D4SA 4BG8A 2ATCB 2P9SA 3I0WA 1TUGB 4KHYA 2H09A 1NJXA 2Q2RA 1BL0A 4FCYA 2CW7A 3CJBA 4LJZF 3G71Q 4KHUA 5GPAA 2G9WA 1YLFA 4I0BA 5B3SH 3JAMZ 1TUYA 3IQLA 1OQYA 1JLGA 4A4EA 3HOZJ 3NWSA 2QQAA 4IEJA 4ZGJB 1N9RA 4CICA 2KKZA 4B1YB 4BDYA 4RTWA 1VQNA 3G71T 4D6WA 3T7ZA 3M8RA 1Z9ZA 2DLPA 4CJTA 1HYSA 3K4KA 1KLNA 1Y64A 2GQIA 1D3YA 1UFMA 1R0CB 4FU6A 1T95A 1D1BA 3J7AO 4M4ZA 3TU5A 3BFMA 2CZ6B 4XMYA 1WHUA 5EDNA 1KVBA 1LV5A 4YFKF 4CK3A 2O6GE 3HOWJ 1HSQA 3HM9A 1KG4A 5AQNA 1VHXA 4E70A 5HLTA 5D6XA 4IO9L 1PU7A 3PO4A 4F7UE 4DA4A 1KTQA 1SL2A 4DFMA 4Q47A 1QSYA 2J05A 2TCTA 1RI9A 1RI0A 3VMFB 2XDDA 4DUZK 4QPQA 3IC7A 4IJAA 1YI2N 2W00A 3H1QA 4KGZB 3Q1JA 3G6EN 1K8KB 3ZEUB 3K57A 3CCYA 3BZ6A 4X1EA 4M6XA 3SUNA 4KN7X 3GZNB 2EV5A 3ZSYA 3QO9A 1TL8A 1BOAA 3I53A 3K4NA 3PE0A 3LDQA 1V76A 2YNFA 1USTA 1WH7A 3KTUA 4HUEA 3WTVC 4A0XA 5DLQE 5FKKA 5JVHL 4PFZA 4G6DA 3ONQA 1A36A 1YQAA 3E19A 1S6LA 1R23A 2CUJA 4E3SA 5D7UA 1Q7YR 2NVXJ 5J39A 3U3GA 3OSSC 4EQQA 4M9XA 4I7HA 3SXYA 3MN2A 3EL2A 2LVMA 2RVCA 2VGNA 3OW2A 5BPLA 2E2QA 4DTRA 2XGDA 3EYYA 1Y1VJ 4C92E 5GAN8 3ZSOA 1YCSB 1LJOA 2QQBA 3HOYJ 4KTWA 3GE1A 2ASPA 1WJAA 3C2HA 1GXPA 2YU3A 3V1RA 3SUPA 3Q9SA 4DGWB 3J81O 3S1NJ 4FJJA 4BHCA 2IVMA 2YPRA 5FLMJ 5K14A 1YQMA 2OAWA 1WI3A 2R7RA 2O8BA 2QQ8A 3FKIJ 1ZUUA 3DLLL 1Z05A 3H41A 2NVUB 4ATOA 2KVQG 3H6EA 2RC4A 1FYLA 3EYIA 4UXNA 5FKLA 1PC0A 4X1VA 3O8GA 3O6WA 3K6GA 4M77B 3MECA 4KJZA 4F92B 3X24B 2H1KA 2DA6A 3MP6A 3CMAQ 2DMUA 4NHJA 2EJGA 3GTQJ 3QBXA 4JI2K 3NMUA 3M4GA 2MC4A 4L5EA 1VQ8N 1WUAA 4J9CA 3KFWX 3JRGA 3VEVA 2QEXQ 2LH9A 1EJ9A 2QASA 3SJMA 4F14A 4IEEA 3QIOA 4KGXB 2D45A 1IUFA 1TOVA 1EH8A 5KYYB 3CO6C 5LJ5e 1Q82C 3DLBA 5C3EJ 1YP5A 1WFWA 2YUNA 4EP5A 2VE8A 1YW7A 1BM9A 3I55Q 5ERIA 3EFOB 1VQNI 1U04A 2RH2A 3CJCA 5KGXA 2QEXT 4R5PA 4B3SK 1UELB 1G8XA 2V1UA 3E6DA 3CPFA 1A5XA 2Q8KA 2MW8A 1VSHA 3CCEN 3KBGA 5BNGA 4XN0A 1JTYA 3QPTA 2P8TA 4BGBA 3PJRA 2W6KA 2F2EA 4Z4HA 4OMLA 4DYQA 1VQ7N 5ELZA 1KYZA 3H0GJ 4LFUA 4KDPA 2M87A 3LGFA 4EMGA 5KCHA 3WVEB 1D0YA 1G83A 2PUKB 4HQEA 2WFBA 4CZHA 2CV2A 1NK2P 4DR1K 1MMGA 2NRHA 1AHJB 1M3HA 1W0TA 2JMAA 3MEXA 4YY3K 3LH0A 1BG3A 1HQUA 1LDKB 1YTYA 4A54A 1OQKA 2XVCA 4QS8A 5DMRA 2V8KA 4CC2A 2CH6A 4BS9A 2QTXA 2QUFA 1IREB 3ULEB 2HQAA 2FZGB 4KBOA 1BJAA 2CRGA 2JN6A 3CD6Q 2VJ5A 2DK5A 2PVOB 1C1AA 1OZ2A 2R7XA 2DMOA 5C0YA 4M75E 4NB4A 1S7AA 5HRNA 2WB1A 4MZMA 3G0ZA 1VRLA 2DXIA 1A5VA 1VSIA 4F7UG 3RSEB 2IAIA 4M7XA 3QOEA 3CD6T 4OKJA 2L3RA 3M0TA 3E9FA 3SQ4A 4HA8A 3VUZA 3IRRA 5JLXA 5HCKA 3V4IA 3W2VA 2KZMA 5IPAA 1FLIA 4CHZA 1B7TA 4NS5A 3FM5A 2DRKA 5KYXA 2H8HA 1Z77A 3TO7A 5FB2A 4RBOA 3OS5A 2Q2EA 2P9UB 1CZAN 1IRXA 2NOLA 1SHFA 2M2EA 2EILH 1HKQA 1LQ1A 3GL1A 4CZLA 1T39A 1LE8B 3O08A 4GYIA 2DL7A 4I98B 4C9YA 3C6TA 3GF2A 1ETWA 3SCXA 2ENMA 2ELJA 5LMNK 3GYHX 2DJIA 5J1RA 5H6RA 1HQCA 3HP6A 5KPZA 3J81E 4AM6A 4CEAA 2Q31A 4V19S 1TYQB 2F4OB 3GVAA 2FOWA 3SNNA 5GAMg 5C10A 4LH5A 2DZ9A 4NCGA 2XAQA 4NUBA 2A0FB 2E36A 4AYBA 2ZJQF 3A98A 3G1LA 2VQEK 3QBYA 4XRSG 2OI3A 1N8RC 2J5PA 3JCMV 4P96A 1R22A 2XSDC 1WSFA 3DKMA 1IC8A 4LFBK 5DUKA 1B59A 3OYKA 3OW2S 3QZ5B 1W5TA 1I6HJ 1K8AU 4A3LJ 1U2VB 2XY5A 3CCMQ 3ENBA 4RTTA 4ZH4F 4B8AB 3PT9A 3M54A 1S9GA 2L02A 2XUBA 5FRMA 4ZYGA 1HSJA 4F7UB 4QAGA 1NZ9A 1S72Q 4HCZA 3V7RA 2O8XA 3ZQFA 1WH5A 2IGMA 3CCMT 2E1ZA 4PJNA 4LE9A 4BDPA 2K79A 1V5FA 1HNIA 2LMDA 1E0EA 1WHGA 2KMTA 4Q4ZF 3PFSA 2D0PA 4N56A 4KHPK 3C3WA 1C0UA 3LYIA 2CUFA 1T33A 2G8WA 1GFDA 3CHWA 3FLCO 1UZCA 2IPQX 1IRGA 4IPAA 3BPXA 2DTIA 3MDQA 3VJPA 3GEZA 3R61A 2AZSA 4UQGA 4CJWA 3IAM2 5DPKA 5C44J 1VRUA 4CJRA 2RI5A 3FZMA 4PJ0C 1EZZB 4LK1F 1OPKA 4C0FA 4F3OA 4FIBA 1YJWN 3CTAA 3RCOA 1CKAA 3O8MA 4KO0A 3TARA 1U47A 4FOIA 4AHVA 2EQRA 4FWNA 4GVEA 1WCMJ 1QZ6A 1VF9A 1HLVA 1HYVA 4IHWA 5DM7L 2VWBA 3EE9A 1ZA1B 4BY7J 1Q9YA 2YRCA 4HF1A 2HL5C 3F73A 2MI6A 2NRZA 5GANh 1BYMA 4ID5A 3IUCA 2GELA 2JJ9A 3H0HA 1G2HA 2ZJRL 3JCMf 5KYUB 4CERA 2A6EF 5HL7L 4LK0F 2DJZA 3GFJA 4CJ4A 2E64A 2F9WA 2HVSA 3CF5L 4PIIA 2AJQA 4DTJA 1M5Q1 3PIOA 2VPLA 1WZ2A 2P9IB 4C1NK 4OB2B 1B8IB 3K5NA 3QU3A 2F8TA 1H8AC 4AG2C 5FW9A 5D6WA 4Q48A 4A12A 3DPTA 4EZ6A 3NH0A 1ILYA 4M75G 2O8DA 2V9PA 1YWOA 5AQFA 3WTWC 2D0NA 2XASA 2L3PA 2EB7A 3KPHA 3DRRA 2HKOA 3MN5A 2Q36A 1O9SA 2GWJA 4L9NA 1ENHA 3HOUJ 3K0SA 4FK2A 5GMKj 3IH7A 4BRQA 3M8FA 3M1EA 4LSNA 2NOEA 1W1WE 3QZ9B 2NUPB 3GBGA 3OSFA 3FHGA 2LX9A 2A68F 2KJBA 2F4IA 4CEOA 4LOCA 4PCQA 3VEWA 4YFUA 2ZAEA 3R6OA 1L3SA 3H9QA 3EEQA 2IGKA 4RS8A 2HOSA 4I09A 1E2XA 3KP3A 2ZE2A 3WXIA 4IG3A 1CKBA 1SV5A 2YU9J 1W7PA 4MLHA 2LCLA 5FU6C 4V2GA 4KH6A 1KCFA 2LVSA 2UXXA 2V75A 2DMPA 1FMWA 4CF9A 4E89A 4KHSA 2X1EA 3CCVA 3TOAA 2L5QA 1HC8A 4A3FJ 2DQRA 4ELTA 1D9FA 3P1GA 4RGXA 1FKOA 2CJJA 4JJBA 1XGMA 2M1BA 3SDBA 3X26B 1Y7XA 3LP3A 5FPDA 3KZYA 3E9GA 1LJ9A 4S05A 2MBFA 5CE3A 3O4QA 1BI1A 4M75B 3HYFA 2H94A 5C6SA 4OIQF 2LY1A 1OCOH 1CZBA 1I07A 4GKJK 5LJVA 3S3NA 2ZPFB 1LCUA 2O8EA 3AY9A 1CF7B 2I5WA 3DPUA 2KSSA 4KTQA 4OX9K 4UV8A 3AVNA 3G71N 3LSMA 4ID1A 5AQIA 3ZN1A 4MO4A 4H0TB 1U4BA 2RPNA 3ZP5A 4XU1A 2FPEA 2Y48A 2CSOA 3X28B 4WCIA 1NPPA 3GTKJ 1RCHA 4CEDA 1G6NA 3VS1A 2L3QA 1SKRA 4PKHA 4LN2A 1FT9A 4B9XA 5H6QA 2ED1A 3LWIA 1FZPB 2DILA 2QSHX 2CP3A 4E9GA 1X2QA 1M30A 2E6LA 5E1WA 1Y0NA 1E3HA 3QU6A 4H0PA 1SL1A 4EM0B 2HMAA 3CC4T 1DLOA 2YHYA 3K9KA 2KRSA 4CHQA 3K58A 3SAGA 1XMQK 2KZZA 5A2QZ 4OMPA 2ZMEA 2H27A 2YHAA 4OVAA 4A2BA 2NVTJ 4EHTA 4CGJA 2JNGA 3WQTA 3LSPA 3QESA 4O5VA 1TLHB 4XTYA 2EZIA 2LR8A 1HOMA 3TDZC 4AWXB 3DB4A 2DK8A 3NF6A 2R7ZJ 2K3FA 1HUXA 1ZRDA 2LTPA 1PHTA 4LH4A 1PP8F 1MH4A 3L6QA 1DQUA 5IT9O 1S7EA 4XBFA 2W85A 4BR7A 1WSIA 2YUQA 1S1WA 3E9LA 1M90R 4W97A 3HFOA 5C15A 3OIPA 3W3DA 4XTWA 3T8TA 3LCNA 3TQNA 4XKVA 3ATUA 3DM2A 2QW9A 4LLNA 2DRMA 5FLXZ 1ZRFA 3RERA 4EM2A 4E0DA 3HRGA 3VGLA 3SK3A 3KKRA 4K11A 4NBQA 2DY4A 4BAYA 3WE2A 2CO5A 4GLKA 1M1KO 1WEGA 1N6QA 3HSCA 3ISPA 4M3GA 1D8KA 4Y91A 5LJ3j 4R56A 1QP3A 2V8JA 4ZGEB 2P1JA 5LJ5d 2DQLA 2WSFE 4GY5A 5KHDA 1OCPA 1XMAA 3E5UA 2VC1A 3S93A 4FJHA 1SANA 3K59A 3CYMA 4P55A 4HAMA 1FC3A 3L3VA 3BG6A 2YT6A 1FOXA 4BBRJ 1MMAA 5DCMA 3QNNA 1GCPA 1X6OA 4YG2F 4MZPA 2DJQA 2ZM6K 1RTHA 3WXJA 2OTLA 4JYAK 4N0AA 2E1MB 4LG0B 2V4JC 3CCVI 2ZMEC 2KFNA 4A4HA 1KGSA 2Y9ZA 3F8FA 5IOZA 3KYDB 4RAFA 3AVFA 3LSHA 3KYCB 2MWOA 4DQIA 2ZB9A 1Y0MA 3FWEA 4YIRX 4R0KA 4FJKA 3EUAA 4PJOF 4OPJA 2V79A 2QM1A 2OAUA 1NGIA 5F64A 3FHFA 1X4PA 2XV4S 1JUPA 3DRPA 1Y39A 3BQYA 4HVUA 2P9PA 3S6WA 2M45A 4Y13A 3TEDA 1QWFA 3TCJA 2W57A 2IA2A 2PX9A 3ABTA 4XL9A 4PUOA 2VT3A 4EPCA 3DV8A 2VXEA 5EF6A 1MBJA 4DR7K 4A62A 2QEXN 4I99C 4P5NA 4LF9K 2EFOA 2XHKA 4FWLA 1KD1R 3UF4A 1KHIA 1DTTA 3LDLA 2NUTA 3E5XA 1MD0A 4JJNK 1VQNQ 1Q95G 4CIGA 4AIKA 4LF5K 1NK6A 1MHNA 2NNNA 3G2BA 1TWBA 1BC7C 2D4WA 4AFUC 4XH1A 3VSKA 3UKUA 1KG5A 3K0LA 1TU0B 1T0HA 1JCGA 3IKVA 4OMZA 1RDCA 3DLMA 1VQNT 4HCCA 2FSWA 4WYBA 1W0UA 3A2KA 1SAZA 2JM9A 2HSEB 1NOYA 2RF2A 5IXBA 2KRFA 5FKMA 1MJAA 4N0AC 2RI3A 3OYNA 1IHVA 2EGAA 1C0FA 4BRFA 2ZXIA 4I9LA 3KLHA 2YRVA 3HYIA 4PUSA 4EIAA 3LNQA 4RM3A 1FBQA 2M8EA 4EA5A 2Z0WA 3M4YA 2E6ZA 1WRJA 4H5RA 1WXTA 5EGOA 1WQ2A 3ISNC 1OH6A 3ZQIA 3NGYA 3EG0A 5HLFA 1LWYA 3FE1A 1VQ9A 4FJIA 1Y8QB 1I0CA 2FBHA 5LRRA 3NRVA 4C2TA 4OFHA 2QGFB 3RYRA 3FZHA 3CMEN 1F9NA 4LLGF 5CZ2A 3V8JA 5ICGA 4UUSA 4Q5WA 4XOPA 3OYAA 1NLPC 1OX8A 2DA4A 1REPC 3CD6N 3HPHA 4R79A 1OV3A 2RJCA 3C7NB 5IT9E 3MCPA 4HLXA 4M7DA 4HHTA 5BREA 4FM4B 4GFBA 1OJLA 3JCMg 1Y97A 1U0JA 4G9YA 3K1NA 3N5NX 2M30A 4HVWA 2QWRA 1MMSA 2KRHA 4E9EA 2DODA 4UVAA 3FXRA 4E9HA 3PNYA 3H5NA 1BK2A 4Z88A 1QPIA 3D7SB 4BC2A 2FNAA 3JSCA 3CCQT 1ZG5A 3HKZN 3SMSA 4J2DA 3HUGB 3S1QJ 1ZQ1A 4BQAA 3H0FA 5HNHA 4FL6A 3LMMA 2QBYB 2EYQA 2OTLI 3J7AP 3AVAA 3DLLF 5HS9A 1AWJA 3L4IA 1JU5C 4DTXA 1L3TA 3SD4A 1YF5L 2QI2A 3A01A 1JKPC 5KTQA 1QRYA 3O8VA 2OCCH 3JB9F 4W1UA 1DP7P 1EO1A 1FYMA 1B34B 3V1OA 4NDLA 2Z5UA 1BJZA 5DK5A 3DLHA 1UGQB 2HW3A 4BRGA 4FZYA 1D3BB 3VQEA 2DK3A 2PQWA 3OJUA 1IXSB 1K73C 4CJPA 5JVGL 2ZXWH 2KP6A 3CJRB 1WJCA 4AHCA 1B9NA 1IZ1A 1YW9A 7AT1B 3L0QA 2L7KA 3FXMA 2CV1A 2M7AA 1WNSA 2Z16A 1HJDA 3X2QH 2K85A 4DWIA 5DM7R 2X4WA 4B8XA 1X75C 4M3FA 2DO3A 3KK7A 2BW3A 4XQFA 1HU0A 4KRTA 2BTFA 2WC9A 5AQQA 4IOCL 3DBRB 2XAHA 4KISA 4KMFA 2E3HA 4M7DC 3CCMN 3ATVA 4CI6A 1MBFA 5FDLA 5E1ZB 4FK0A 2MH9A 1YTAA 3CWTA 2ZNZA 3C12A 3WHBA 1JB0E 3ZX3A 3CQTA 5J47A 1PSEA 3CCRT 1YUWA 3WNFA 2X9DA 2RA2A 2IGNA 2YX4A 4JLGA 3VENA 3M5RA 3KLEA 4G1QA 3GNFB 3QFUA 3OYGA 3NAUA 2IGOA 1RACB 4KHWA 4DZJA 5TRDA 3MEEA 2GQVA 3L2QA 1M27C 4MNUA 3M0SA 3LA2A 1JCEA 4NLCA 4KUMA 1RDDA 2A41A 4C8LA 2DL8A 3I64A 3COAC 4FM2A 3CJ7A 3EKSA 1ONVA 2AK5A 4E6KG 1ZA2B 2BE7D 1WSUA 5AQPA 2KZGA 1VRTA 2HYFA 2L2PA 1J6ZA 3MWMA 4JKHA 3BZKA 2DTZA 1UJ8A 2YHTA 3P7NA 1T6DA 1A0NB 4WE1A 2LQKA 1VQ9I 1NHAA 2F4MB 2AIRB 3QRFF 1TC3C 2JUCA 3D4VA 3V8LA 1JBMA 3QWLA 2EQJA 1MZBA 2XD0A 3DEWA 4CDGA 4CJ3A 3W3CA 4K42A 2K9GA 4KT6A 2JSCA 3FJ5A 1HMVA 2XIGA 2I10A 2FG0A 4FYXB 1J2XA 1NJIR 4JI0K 3GPLA 4C3IJ 5FPEA 5FFZA 3FJPA 5GJVB 3RNJA 4XSZF 1R00A 3VQAA 2OBPA 4IXAA 3HI0A 2K57A 3OL3A 4M7YA 4EJZA 1BI4B 1FSHA 1NH3A 1Z7LA 2W41A 3TAPA 4JOMA 3TBIA 8ATCB 4JKBA 1W7AA 1KVCA 3TSQA 4IRHA 1BUPA 2D0CA 2KAFA 4J01A 2FSKA 3FZFA 4CEBA 1NJZA 2E70A 4CCKA 2R3SA 2X35A 2CGLA 1F1BB 1W7PD 1LUJB 3F2KA 1QVGP 5KYNA 2QKMB 2OZUA 1X3NA 3BP8A 4XOTA 2VVKA 4AH9A 1IN4A 1JO8A 3TAGA 1NG7A 4IIOA 4GV6A 2CW0F 2IRFG 3AG2H 5HOOA 3ER0A 1JUSA 1JLFA 2ME6A 1DPRA 3LANA 1Q7YC 3K1PA 1IV6A 2VGMA 3MKLA 1LKXA 5CYMA 2ELKA 1TKDA 4LF8K 3MZHA 1Q8IA 2Y31A 5CR2A 4M7AF 2RHUA 1VQ4A 5KNLA 2KKOA 3THXA 4LF6K 2BH1A 3F10A 4YOQA 2DVEA 3AVIA 1SFOJ 3R3LA 2R4GA 2FUG2 1OFCX 2A6TA 3TO9A 1Z9CA 1ZUKA 1K4US 3LL3A 3GCMA 4KHQA 2MABA 5GAHJ 4IRGA 5MLCQ 3MKZA 2BE5F 1RNHA 1IBMK 1NE8A 3MVPA 1FYKA 4E7KA 4C5HA 2PMHA 3DRSA 2HQEA 2EA4A 2LFBA 3DJCA 2LKSA 3QP6A 1G2BA 1X58A 2EBIA 2XY8A 2IEKA 5LEKA 2GEMA 1UB9A 1X3ZB 5AQXA 2DM1A 4LXCA 2GTJA 2DXCA 3JCMQ 3ML6A 2KI7A 2XIDA 4OJRA 4BBSJ 2FXAA 3H1VX 1QKWA 4Z4IA 1K0SA 2W04A 4N41A 1NGNA 4B43A 3AA5X 3OYYA 3DU5A 5AZJB 5FROA 2IA0A 2NVYJ 3RDVA 3IAYA 1B9DA 2AHJB 5HK0A 3VQPA 4X0GA 3ZSXA 2Z33A 5FJ8J 1BC8C 3J7ZI 2I2LA 2SEMA 1RTIA 4M3UA 2GXBA 2L9VA 2JUGA 2XY6A 3A8GB 1X69A 3V9SA 2JTVA 4JK8A 2QKBA 4IUPA 2FPDA 1SMYF 3JRAA 1Y71A 2W4SA 3VODA 5BRFA 4N5SA 5GAEJ 2VT2A 3NVKA 3HBLA 4NZGA 4C0ZA 3S3MA 1WJFA 2WAQN 2DFHA 1Y57A 2A08A 2ZPEB 3F0ZA 4RTFD 4A5BA 3V81A 3JSPA 3L2CA 3K4JA 1KIKA 4X62K 3LDNA 4DKWA 3VS2A 4O6JA 2E7WA 1KG1A 5LGTA 1J53A 1XCVA 3M5AA 2LCCA 1VQ5A 1Q1HA 1YQRA 4FETA 3CC4N 1BO5O 1WHJA 1NK7A 4W5TA 1ETVA 3VS3A 1WPYA 3JCMJ 2DE0X 3A5NC 5F1XA 2ZJRF 4YOWA 4JS4A 5T7BA 2JWLA 4A3DJ 3CF5F 3P5JA 3M0QA 3TR8A 2D0AA 2FX0A 2ADUA 2KRMA 1S1TA 4Z02A 3M8SA 2HHHK 2HZTA 3F8NA 2GZWA 1YWPA 1D8YA 1IBLK 1RKWA 1RRSA 2CQXA 5CHZA 1GLCG 4F9OA 2OANA 5FKNA 4OF1A 2OC6A 1M3CA 3E6MA 1RRJA 2VJ4A 2KW4A 2A1RA 3BJOA 2CUBA 2O4XB 1UUEA 5HODA 1MKMA 2ZF5O 5FU7C 3R2XC 2LREA 2NXNB 1VQ4I 5M1PA 5CKBA 3W6KB 1RT4A 3TVTA 4OPAA 5AR0A 4BJ5C 1F36A 2FZKB 3CPWM 5B8HA 3ZMTA 2R5ZA 2Y0SN 3THKA 4FO0A 3GNGA 4UUTA 1VQPA 4F3QA 3SDZA 1K9MR 1LWCA 3DEUA 1M2VA 1ZLMA 2HOTA 3L3UA 2R5YA 2JVHA 2Q2EB 3TMOA 1SG5A 4OP0A 2O0YA 3PUFA 2ISYA 3VDXA 1MDUB 4NNJA 4FJ5A 3JAMO 1QO0D 1OCTC 1IKYA 2NNWA 4LF4K 2JWTA 1SD5A 1Q86R 3GBTA 1AHDP 5DLOA 2MCNA 2CQKA 1S5LC 5IN1A 1ZBLA 3EKUA 5GP9A 2NNYA 3B73A 4O8KA 1S1VA 2K6DA 4JQFA 2DDBA 2DDAA 2FBIA 2HVQA 3ZMVA 3S41A 4BR4A 3CCVQ 1KG2A 4LDWA 4IF4A 4EJWA 2M3AA 3PIPL 1TWCJ 1X1PA 1MSFC 5D4RA 4FSSA 1F4KA 2AT1B 1WB9A 1HDPA 4M9ZA 2B9SA 4BR5A 1Q9XA 4JJDA 1XNRK 1T05A 1XGSA 3PUBA 3CCVT 1ZGWA 2DA1A 2YLCA 4DU1A 1ASWA 1G99A 2G0EA 4YHHK 4KPYA 1WSGA 2WONA 3U9ZA 3H5AA 5EVZA 3QEVA 1ASUA 2A5WA 5CQEA 4CCMA 2EIFA 3C18A 2VWFA 2B0LA 4B1VA 1W4SA 1X27A 1CZ9A 3VEZA 5F04A 4KH0B 2CFOA 1ZBSA 4CHOA 3V7SA 1UGRB 4BY6C 1HK9A 2IDOA 4DFPA 2UYTA 3T1BA 1VQ5I 4FJLA 1YE9A 2CUZA 4D1QA 3ZMSA 4M7DD 1NPRA 4UB8C 5M3MJ 1PNJA 4I2OA 3KEQA 1I50J 1GLFO 1TW3A 2P4TA 1YVNA 3O3FA 2LKXA 1S6QA 3CW7A 3FMSA 3IP4B 2JRMA 4BVOA 1RAEB 4AU7A 4PNOA 1AOYA 2WV1A 2HSPA 2A6AA 3HVTA 3MN9A 4BD3A 4CEQA 3LQRA 2O9SA 3V42A 1RLQC 4KB1A 2LF7A 1H89C 5CVVA 2A5XA 1FTZA 2EQKA 2KIFA 3B02A 2VUMJ 5D8LB 3V1QA 1Q82U 2ZNYA 4A4FA 1ETKA 3V9UA 2KROA 2DIGA 1O75A 1WJQA 2L9NA 4RGSA 2B7EA 3BR5A 2QWMA 4ELVA 3DTKA 2BZTA 2HDWA 4II3A 4BJ6C 3T69A 1J75A 3V4GA 3OOUA 3I5SA 3TSZA 3BW1A 2OFKA 2LY2A 4ESRA 1VQLA 4CFDA 3BJAA 1GXQA 3VOEA 2A3LA 5D5XB 4IO8A 2NAZA 1K78A 4L0ZB 2XGXA 3OH6A 3KVGA 3CP2A 1AWOA 1E3MA 1VQPI 3CCQN 3FM3A 2IT0A 1QNTA 5GAOr 2EBPA 3DOKA 1FXXA 3SEMA 2GXAA 2GLOA 1SRLA 1B6AA 3NF8A 3ZT2A 1R1VA 1ZSZA 1MPGA 3BLYA 3AL0C 5IYCJ 4C0DC 3D2FB 2XI9A 3TWHA 3NH2A 2DNUA 2O8CA 2O8DB 1BA1A 2GOMA 2K5FA 1EKEA 2BIVA 2HDAA 5FWCA 1U2WA 3WTYC 4DK9A 2L89A 2OTLQ 3C6AA 2PG4A 4WXHA 1KC8R 2CU7A 1D8JA 2AQEA 5LEJA 2RNJA 3F72A 3QEWA 3C2BA 3JAME 1KQSM 3QSUA 3QODA 2YDLA 2KNBB 1DJ7B 2CSQA 4P9UA 1J54A 3KP5A 1IV0A 4C5EA 2F6CA 5EG0A 1KEAA 4GKKK 3FBNB 4ME7A 2OTLT 4RCCA 4JV5K 4RCHA 2P9NA 3HC7A 1PVSA 2QGGA 4XRMA 3ZSVA 2X51A 2HDCA 1CXQA 3DLLA 4E6RA 3I0SA 1KQ9A 4HEA2 2JWKA 5GAN6 3J80K 3AG1H 4UOBA 1Z9QA 4BY1J 4M7DE 3GX4X 3RKYA 1H641 1J0RA 2QA4A 1O4XA 3HTUA 3Q7CA 3I59B 1M1KU 1XGNA 4CJVA 5J6XA 3VQBA 3CCRN 2RAEA 1JLQA 4E7JA 4JZ3A 4DQSA 1Y0UA 2A36A 2AKLA 1X19A 5GAMe 4CJUA 4C8QF 2GX9A 3UR3C 2ESHA 2OA4A 3VRYA 4CBUA 1RDWX 2VKEA 4QT7A 3WXLA 5HLGA 3MKYB 5HP1A 3MJXA 4IFYA 4A0YA 4ANJA 5CK9A 1YAGA 4CGHA 1V55H 4B6MA 3GTPJ 3HGYA 3WNHA 5LJ5j 1ZSZC 3VGKA 4Z4CA 3RSNA 4Z0UA 5D6YA 2GFUA 4JX5A 3N4MA 5D6FA 1IJJA 3HM8A 2ITGA 4KRFA 3I4MJ 5IT9Z 1LPQA 2X4HA 1R6RA 4X66K 1N8RU 2R7FA 3AVGA 1UA0A 4XTZA 4XIDA 2O8EB 4AI5A 2BVMA 2IBDA 5KVRA 5H1SQ 1JXMA 3TAMA 4N76A 4CBWA 1AWWA 4MGRA 2BV6A 3H3ZA 1YJ9A 3WE3A 1XG7A 3KIOA 3K2ZA 4K2EA 3EFSA 3FISA 3HRSA 4G12A 1D09B 3V9WA 3EGXB 4OWRB 4BDZA 5EOYA 3TL4X 4BRLA 4XKCA 1MMNA 1NK3P 3SBTA 2FXUA 2P0QA 1QCOA 4HYEA 1MA9B 1TGOA 1XSXA 4BRHA 4M77F 1VQLI 3AAQA 2IOCA 3BY5A 4RTZA 2GWRA 2BGCA 1VQMN 4PKCC 2ZMEB 5HS8A 3MWTA 5GAHP 2RKHA 3V6DA 2BZ8A 3OIQA 4DU4A 2Y4YA 3DLKA 3E6BA 2AA4A 3OA9A 4FZXC 3VF4A 4MFDA 3PMIA 2PI0A 3I4PA 5AQYA 1QVFA 2JVVA 4M71A 5J3BA 3I4NJ 2R58A 4EP4A 5FWBA 5M1QA 5L3CA 4X9CA 3M6GA 5H20A 1KQSS 4CZJA 4DFJA 5M1OA 1OCRH 2CFXA 2GM4A 1YX3A 5IP6A 4A3JJ 2HTJA 1M90C 3C0CA 2D0BA 2DA5A 1TT5B 4B21A 1RLPC 4JRIA 4DS5A 3Q0UA