3OYBA

Crystal structure of the prototype foamy virus (pfv) intasome in complex with magnesium and the insti mk2048
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
368
structure length
368
Chain Sequence
LDAELDQLLQGHYIKGYPKQYTYFLEDGKVKVSRPEGVKIIPPQSDRQKIVLQAHNLAHTGREATLLKIANLYWWPNMRKDVVKQLGRCQQCLITNASNKASGPILRPDRPQKPFDKFFIDYIGPLPPSQGYLYVLVVVDGMTGFTWLYPTKAPSTSATVKSLNVLTSIAIPKVIHSDQGAAFTSSTFAEWAKERGIHLEFSTPYHPQSSGKVERKNSDIKRLLTKLLVGRPTKWYDLLPVVQLALNNTYSPVLKYTPHQLLFGIDSNTPFANQDTLDLTREEELSLLQEIRTSLYHPSTPPASSRSWSPVVGQLVQERVARPASLRPRWHKPSTVLKVLNPRTVVILDHLGNNRTVSIDNLKPTSHQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular mechanisms of retroviral integrase inhibition and the evolution of viral resistance.
pubmed doi rcsb
source organism Human spumaretrovirus
molecule tags Recombination,viral protein/dna
molecule keywords PFV integrase
total genus 107
structure length 368
sequence length 368
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2010-09-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
A PF17921 Integrase_H2C2 Integrase zinc binding domain
A PF18103 SH3_11 Retroviral integrase C-terminal SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2300 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3oybA04
1.10.340.70 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Endonuclease III; domain 1 3oybA01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3oybA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3oybA03
4II1A 3QEWA 2OPQA 3A2FA 4IUQA 4MFBA 4DS4A 3E9FA 4I7FA 4FK0A 4KHSA 4C5GA 3VN5A 2LVMA 5D6WA 1CXQA 2DFHA 3DMJA 4EP5A 3O4NA 3WNGA 5C25A 3V81A 4B9LA 4DTJA 3TAFA 4E7LA 3VQDA 4CF9A 3VQBA 5HRSA 4Z4GA 2FBVA 1HYSA 4DF4A 1FKOA 1TAUA 1IH7A 1UWBA 4FW2A 2L89A 1C1AA 3C6TA 4CGJA 5JS1A 5EU7A 4DSIA 4DTRA 1X9SA 1SUQA 4C8NA 2O4XA 3HJFA 4BWJA 2HHSA 2E4LA 1TK8A 3PNWC 4KRFA 2FBYA 2IS3A 1L3TA 3I8DA 1HMVA 3VQ9A 4KO0A 3ZSZA 4CJUA 1XHXA 4KHNA 2Z1JA 3IRXA 4JRQA 1CLQA 3LGFA 3NCIA 3FEOA 3RTVA 2P1JA 3K5MA 2P0KA 1LAVA 3AO5A 3KLIA 4KFBA 3OYMA 1RILA 3EYZA 3DOKA 4CEAA 3DI6A 3HM9A 1WJRA 3K5OA 3EZ5A 3JSMA 2RHZA 1NJZA 4B3OA 1CZBA 2HVHA 2QKBA 3VA3A 4DTPA 1BI4A 3LDSA 4DSKA 2RJEA 1TVRA 2D5RA 2KQ2A 4KREA 5HRNA 1N27A 4DSEA 4N47A 2JTFA 2D0BA 2OZSA 1C0UA 2R57A 1Y97A 1RBVA 2DIGA 2QQRA 1BQMA 1QQCA 1S1TA 3OB9A 2G3RA 1WGSA 1A5WA 1W0HA 3HPHA 4J2EA 3DB3A 3ZSYA 2HNYA 4BE0A 4CFBA 3EY1A 1KFSA 3WNEA 3MXJA 5T7BA 1X1PA 4CJWA 4DTOA 1U49A 5HBMA 3VQPA 1IG9A 3GOXA 1QS4A 2JLEA 4KPYA 4FJ9A 1BGXT 1JLGA 4HCZA 2E6MA 3FFIA 5KCOA 4AHVA 4IUUA 4CEZA 1NK0A 4J2AA 2ITGA 4FM0A 3NF6A 4CJSA 1Q9YA 4CJTA 3IS9A 4CEBA 4FJNA 2X4YA 4Q0BA 1LW0A 4UQGA 1VSEA 3S3NA 4A4GA 1SL0A 4PUOA 2WACA 4B9SA 4CFCA 3VQ4A 4ZTFA 2Y1IA 5HLFA 5E41A 3V9WA 3ZSWA 3ZT3A 1QSLA 1KFDA 1QHTA 4M42A 4L8RB 4CEQA 3LANA 3V9XA 3VQ7A 4E0DA 4Y1DA 3HXMA 1WLJA 3QNNA 4EP4A 3S6WA 2B5JA 4DSLA 3OJUA 3NH2A 1KLNA 2VG7A 3NGIA 2LTOA 1SSFA 5J2MA 4UC4A 4NYNA 4CGDA 2RPIA 1RT5A 1ASUA 3V1OA 3MP8A 4LY7A 3OVNA 2LCCA 4CHQA 1VSFA 5SZTA 1HYZA 4E3SA 4FW1A 4FJKA 1JLQA 4OVLA 4KHWA 2DY4A 3ASMA 2RI3A 3H08A 4BDYA 4ZTJA 2X4WA 3LH0A 4IDKA 3BDLA 4LSLA 3QERA 3SI6A 2P5GA 4PQUA 5HRPA 3RR7A 3M8RA 1RI0A 3MEVA 4JLHA 2BE2A 5I42A 4FJJA 2O4XB 3OYFA 1BI4B 3HSTB 3AA2A 3VQAA 3PY8A 2X4XA 3KIOA 3QIOA 1NKCA 5KRSA 2FHDA 1BIZA 3B6OA 3NF7A 4RW7A 4BE1A 4R5PA 4DFJA 2PY5A 3PX4A 2OPPA 2EQUA 4IUTA 2WONA 4FJXA 4CIEA 2LSNA 3PX0A 1RDDA 4NS5A 3G0ZA 5FRNA 1TV6A 2B4JA 2ZQBA 3ZSVA 3Q1JA 3TAQA 3TARA 2XY7A 1CXUA 2A1SA 3UIQA 1RTIA 4Z4EA 3K2PA 4CCHA 1KRPA 1RBRA 1KVBA 3QEXA 4K8ZA 3AO4A 4C8OA 3KKSA 3QO9A 2VWJA 1SKWA 2PZSA 3O3GA 4CGHA 3MAQA 4FZZA 1YTUA 3LPTA 2OPRA 1RTDA 3KLGA 3C4SA 4NZGA 3OYNA 2YKNA 5D6YA 4L59A 2GFUA 2RN2A 2PYJA 4N4GA 1RT6A 1VSKA 4HCBA 4CESA 3V6DA 2IOCA 1UAXA 3AO3A 3V1QA 1IKYA 1WSEA 3I0RA 1WAFA 3NE6A 5C42A 4HUFA 2GV9A 1TGOA 3V9ZA 4DFKA 1SL1A 4F2SA 3AVAA 1RDBA 1XC9A 3VQQA 2B8AA 3LP2A 3ZEHA 3O3HA 4FJ5A 3NDKA 3RRHA 3NGZA 3HPGA 1OI1A 2L3RA 3ZT0A 3CG7A 3KLEA 3QEIA 4N41A 2X6NA 2HVIA 1HRHA 3L42A 3OS2A 1YVUA 3LAMA 4Z4IA 3THVA 2HHQA 1QSSA 2O4IA 2XO7A 1ZBHA 4O0JA 4DU3A 4OGCA 3L2QA 3KD5E 3QJ6A 1B9FA 2RF2A 4J2DA 2HHXA 4E7KA 1NK6A 4B9TA 3EAEA 2FBXA 1I3AA 2NLUA 3MEWA 3SPYA 2R5AA 3KK3A 1N5YA 1QE1A 1LWFA 2QK9A 1UOCA 4QOZB 1BHLA 3OYAA 5IAYA 3T19A 2HNZA 2JGUA 3AA3A 1IKVA 3OMGA 1RT1A 1TL1A 4LD6A 2O4GA 3V4IA 4KTQA 2L8DA 2DAQA 5D3GA 3KLFA 3LZJA 4EZ9A 3AVHA 4DQPA 4O4GA 2F96A 2BIVA 1JKHA 5KH6A 2D0CA 3AVLA 4DQQA 4E7IA 3DOLA 4CJKA 1G15A 4Q5WA 3KTQA 2HW3A 1YTAA 4JS5A 2E5QA 4M3XA 4CJ4A 2K3YA 2X6SA 1YT3A 4KKOA 3M8SA 3KUFA 4W5NA 1JLCA 5IN1A 2PQWA 3L3VA 3TR8A 4FCYA 4IKFA 3F9KA 3MECA 3PUFA 3B6PA 3MEEA 3HVRA 1RTJA 5CIUA 4IG0A 3F73A 4DFMA 2EKOA 2ZE2A 3K5NA 3TAEA 4FLVA 4HUGA 4FJ8A 2F8TA 3G10A 2HHVA 1WNSA 4CJQA 1J53A 3E01A 5KTQA 4DSFA 4DFPA 2Z1HA 4M3RA 1TKZA 3LWMA 2RHXA 3TAPA 1X9MA 1BQNA 4QQ6A 4BDZA 3LYIA 4BD3A 3E9GA 3P8DA 4CRIA 1ASWA 4W5OA 1UA0A 3PO5A 2BGGA 2HHWA 3O3FA 1WJQA 1NJXA 1U04A 1S1VA 4GVMA 3TAGA 4CK3A 1S1UA 3C94A 4RW8A 1NKBA 4OPKA 4CFAA 3S9HA 4FLYA 5CZ1A 1KSPA 4OLBA 1MHNA 1RNHA 1TL3A 4FLXA 3NH0A 4DS5A 3SPZA 3HO1A 2KFNA 4AHTA 2BKDN 4Z4FA 3CM5A 3OYGA 5C6SA 1NK5A 4OVAA 1RT7A 1BCMA 5CYMA 4HUEA 1L3UA 4AHUA 3WNHA 4FJLA 3NF8A 3PV8A 5DMRA 3TANA 1F21A 3QIIA 1RBUA 4BWMA 3RMDA 4NCGA 4FJ7A 1KVAA 3S3OA 4CJRA 1L3VA 4F4KA 2QQSA 4KAZA 4OKEA 2ATQA 4IG3A 4FK2A 4N4HA 2X35A 1C1CA 1C0TA 4KHYA 2EQMA 3KK1A 4CF0A 5DK5A 1HNIA 1IKXA 1DTQA 1XHZA 4B9MA 4NCAA 4CEEA 4CE9A 2GUIA 3DM2A 4ELTA 3CEYA 2IG0A 4DU1A 3QNOA 3RR8A 4E7HA 3ZSOA 1WJSA 4C5IA 5FROA 4CJEA 2R7YA 4FLUA 1NK4A 2QXFA 1O1WA 1C6VA 4H4OA 3S3MA 1C0MA 1FK9A 1HJRA 4EDUA 3MO8A 3PO4A 1Z26A 3RWUA 4FJMA 4O44A 3L2VA 1SKSA 3PX6A 4CJPA 2KZMA 3TABA 1MU2A 4DQSA 3SV3A 4LSNA 3MXMA 1VRTA 1CZ9A 4CGFA 2XK0A 2EHGA 1FKPA 5D6XA 4B08A 3SJJA 2G8UA 3M8PA 4OGEA 1NKEA 1RCHA 3SNNA 3D0PA 3ASKA 4I2QA 2G8VA 4B9NA 1S5JA 3ME9A 2GFAA 1ASVA 2OPSA 3DLMA 3HVTA 4B8AB 4IBNA 4CECA 4C5EA 1UA1A 2HB5A 5KGWA 3LWLA 4YFUA 4W5RA 4N5SA 1L3SA 3K5LA 4F8RA 3TI0A 3FDRA 4OLAA 3KD1E 2KTQA 3PFSA 3OYEA 2IAJA 4N4IA 1T05A 1L5UA 4IURA 2GF7A 2RHUA 2F5KA 3P5JA 2OYQA 3NNQA 2YNIA 4CEOA 3CM6A 1BCOA 2M16A 1EKEA 1ZBUA 3FC3A 2YKMA 3DLKA 4LH5A 3AVNA 5KGXA 3NH1A 4PLIA 4CF8A 4A4FA 2A1RA 1WN7A 2G8KA 4ICLA 4Z4HA 1VSHA 3RMAA 4QAGA 3DYAA 4AHSA 3ALYA 4F3OA 4C5HA 3AA4A 1HQUA 3P8HA 1SKRA 4FLTA 1U4BA 2G8FA 4M3ZA 3ZSXA 3M9QA 3DLRA 2K3XA 3LPUA 3DLBA 4PA1A 3F70A 1JXBA 4FJGA 4QCLA 1OZ3A 1BL3A 2RI2A 1A5XA 2KZZA 2X78A 5HRRA 1WAJA 4KHQA 3FLGA 4K8XA 4DG1A 2X74A 3VQEA 4LH4A 1BIUA 3MP1A 3LP0A 4A4HA 3AO1A 4Z0UA 3QIPA 2E6LA 1S6PA 4AHCA 4FZXC 1VSLA 3VQ8A 2P51A 3V9SA 1J5OA 1BISA 5FRMA 1RT3A 1LWCA 1SV5A 3HL8A 3KKRA 3ZT4A 1U48A 3BGRA 1S6QA 4HVJA 4F2RA 2FBTA 3LGLA 4QVZA 4O5BA 2VWKA 1C1BA 3PMIA 1R0AA 3META 4ZHRA 2GBZA 3OS1A 1XNIA 1TK5A 2HHUA 4DLEA 3LX7A 3BDPA 1HNVA 3NHGA 3QESA 2QKKA 4KB1A 2XHBA 3OYIA 3NTIA 4B9XA 4FJHA 1J9AA 3AVKA 4DWIA 1OYXA 4Z02A 1LV5A 4CIFA 4FLZA 5J2QA 1TK0A 4B9UA 4H4MA 1VSIA 4DU4A 2RKIA 3NAEA 3AVIA 4RG8A 1XI1A 2F8SA 4ELUA 4DTSA 4FXDA 1GOAA 3I0SA 1H3ZA 1B9DA 2KFZA 4G1QA 3SQ1A 1Q9XA 1JL1A 4IFYA 2EQJA 1NK8A 1VSDA 3T1AA 3L2UA 3V1RA 3ZT1A 4B9WA 2RI5A 3SUOA 3AVMA 3K57A 3M8QA 1S1XA 3AVBA 3HYFA 3VQCA 3NTHA 4FU6A 4Q5VA 3OS0A 2RHYA 5FDLA 1OZ2A 1NK9A 3RMBA 3LALA 4HTUA 5K14A 4M3UA 2M0OA 1TKTA 2WOMA 3U3GA 3TWHA 1RT4A 1D5AA 1NJYA 4FK4A 3OYKA 4M3WA 3TAMA 3HT3A 1ZBLA 4KTZA 4IFVA 5C24A 4DTMA 4JS4A 1TKXA 3P1GA 2EQKA 5J26A 2HNDA 1JLAA 1WSGA 3JYTA 3DB4A 1JLBA 5I3UA 1VSMA 2Y1JA 1SL2A 3DLHA 4ELVA 4N76A 4CJ5A 1VK0A 1D8YA 3NF9A 4XIUA 3QINA 4NYFA 2LDMA 2G8WA 4KI4A 1VSJA 4CGIA 2IC3A 4CJ3A 4DMNA 4JRPA 1IKWA 1RBTA 4LD0A 2XY8A 3CFPA 1DTTA 4OKKA 3NTKA 4FL6A 3DRRA 1FXXA 4AH9A 1RDCA 4MQ3A 2DFFA 3ITHA 1T03A 5J2NA 4WE1A 4RG2A 3QETA 3OYBA 4PLLA 1NOZA 1WSFA 4CF1A 3K59A 2VYTA 1S9EA 3MXIA 4HHTA 1D9DA 2ETJA 2YNGA 3QKJA 2RHIA 1VRUA 1ZBFA 2XRIA 2YNFA 1JLFA 3C95A 3ZCMA 4GW6A 4AILC 1J54A 2XY6A 1U47A 3NFAA 1QTMA 1KHCA 1KLMA 1X9WA 2P5OA 1D9FA 4O55A 3KLHA 3L8BA 1T8EA 3SUPA 4PWDA 1JLEA 3CYMA 5J39A 4FVMA 2R58A 5J1EA 4FZYA 1RDAA 4KB0A 2BUDA 4I2PA 1QSYA 4BE2A 5JS2A 3IAYA 2Z1IA 2B6AA 3CFRA 2VG5A 1TAQA 1K6YA 4M41A 4CGGA 4CHPA 2OA8A 2DIQA 3UT1A 2R5MA 1XWLA 3P83D 4ID1A 1RT2A 4Y1CA 2RJFA 3QBYA 5KI6A 3MEUA 4CJVA 1LWEA 4CHOA 3QEVA 4C8KA 5KCHA 3VQ6A 3HPOA 1U45A 2YRVA 1NJWA 4DTUA 5KE3A 1RBSA 3DRPA 1N6QA 3RRGA 3IG1A 2PYLA 4CIGA 3D45A 1KVCA 2OZMA 1NK7A 2XDPA 3L2RA 3LP1A 5HP1A 5HROA 3CFOA 1EX4A 2IDOA 4KV8A 3AA5X 4B8CA 3DRSA 4N56A 2RJCA 4O0IA 3K58A 1I39A 2HMIA 4EZ6A 1S9GA 3OYDA 5KE2A 2KW4A 3OYHA 1DLOA 2NUBA 1JXEA 4HCCA 3V9UA 1JL2A 2G8IA 4OPJA 2RO0A 2M1HA 2YHAA 4M3YA 3OA6A 2HHTA 3SUNA 3OY9A 1RTHA 5CZ2A 2JZ2A 4OKJA 4CHYA 3KJVA 3SV4A 4E1MA 3VA0A 4E7JA 5J2PA 2Q3SA 5CYQA 1HQEA 1HYVA 4E1NA 4DLGA 5CY4A 2Z1GA 4PL6A 3ZT2A 3C6UA 4DTNA 3QEPA 3OYLA 3LLRA 1S1WA 2AJQA 1LAWA 4BDPA 1Q8IA 4KTWA 1ZYQA 1T7PA 2ZD1A 4FM1A 4YNQA 2DFEA 4RW6A 4CEDA 1A5VA 3ULDA 4FJIA 1HPZA 4W5QA 3OMCA 2MWOA 2EX3A 3PMTA 4J2BA 4M45A 4E89A 4QW2A 4FLWA 3SYZA 1B92A 3ZSQA 1WSHA 3OYJA 2YNHA 3AV9A 3NBPA 4GMJB 5C0MA 4CK2A 4NCBA 3MP6A 3OQ5A 1G5VA 3LP3A 4OJRA 1GOBA 3QLHA 1REVA 4TSXA 2E6NA 2EFIA 4RW4A 3WNFA 3SZ2A 3RMCA 4CFDA 4KI6A 4QQGA 3KK2A 3AVGA 3SQ0A 4PY5A 3U6FA 5M9OA 4QQDA 2BANA 3LAKA 4CJFA 3SD4A 4F3TA 3LZIA 4GY5A 1W9HA 4C8MA 3SUQA 1GOCA 3AVCA 2IGIA 4CEFA 3HP6A 1EXQA 3H6ZA 1Z25A 1NOYA 4IUPA 3L3UA 4I9QA 3DLGA 1TKDA 3O8VA 4DF8A 5KRTA 1IO2A 4X34A 1WSJA 4ID5A 4DTXA 3HP9A 4A4EA 3OYCA 3UWNA 2RJDA 1LW2A 3L2WA 2I5JA 2YV0X 3VQ5A 3U3YA 2BDPA 4FYDA 4CJLA 4CHNA 3AVFA 4CERA 2XY5A 3SCXA 4BACA 3ZSRA 3MEAA 4M3TA 1WSIA 1ZBIA 2LRQA 2MWPA 2D0AA 4KHUA 2DTUA 4W5TA 2HQEA 3AO2A 3O4QA 4C8LA 3HK2A 4CF2A 4IUVA 4I9LA 4H8KA 2D9TA 4B9VA 3MEGA 3DLEA 1KTQA 3ISNC 1EP4A 1KCFA 3NGYA 4RW9A 4DQIA 4E19A 3SQ4A 2VG6A 3H8ZA 4DQRA 2CKKA 1ITGA 4Z4CA 4CK1A 2HQXA 3T3FA 2YHBA 4AHRA 4CHZA 3OJSA 2FC0A 3SQ2A 2W42A 5SWMA 2G8HA 3MEDA 4FM2A 3AVJA 3CQ8A 4DSJA 1EETA
chains in the Genus database with same CATH superfamily
1T3SA 4FK0A 4W97A 4MO7A 3VN5A 2W03A 5GIOA 1MBFA 2YUQA 4B9LA 2IGKA 3DLLA 4R56A 4C92B 1E6GA 1MBJA 3A2KA 2YG9A 4DTRA 1VQLQ 1JKOC 1LJOA 4YELA 1HX1A 3I9QA 1OQKA 1BW5A 2X4HA 3CC2I 3GTLJ 4E7ZA 2K9GA 5JICA 5GAN5 2R93J 2NZTA 1USSA 2VBZA 4J6YA 5KVRA 1KAXA 3ZQFA 2QQRA 2LC2A 2IS2A 5AQTA 2CW8A 5IHNA 4M3BA 2EKHA 4CFBA 3TTDA 3WNEA 1K9AA 3C2HA 4A3KJ 4KPYA 3WHCA 1LJ9A 4IUUA 3VYGA 1UAAA 1MA9B 4MHGA 3JB9J 4FJNA 2YT6A 4LE9A 1SL0A 2GXGA 3TVTA 2KE9A 3CJTB 4A3JJ 5CK9A 4EP4A 3RQIA 1YI2Q 2LSOA 1M3CA 1T0JA 3CD6N 3UPUA 3JS6A 1TWAJ 2K9LA 3MN2A 1BI4B 3KIOA 2PFUA 4CZMA 1B6AA 3THYA 3PX4A 4PKCC 1FZPB 3CC7I 2B4JA 5CO7A 3INZA 2Q0OA 3DXKB 2QYZA 4S04A 5J3LA 1WLPB 5DCFA 1RTDA 3KLGA 4QWQA 1VSKA 5GAHP 3CC4T 3M55A 4D0PA 1UHWA 4IXAA 1J7KA 1WI3A 2R4GA 5H1SQ 1IUFA 5CVJA 3QHSA 4J7FA 2TDXA 3L9FA 4N41A 1U2VB 1O4XA 1Q1HA 2HDDA 3OYAA 4CDGA 2ITMA 3EN9A 1RT1A 4M63C 3R60A 1U2WA 4DQPA 5KYUB 3QP6A 4ZYHA 1HLVA 2C0TA 4DBFA 2D8HA 4M9SA 5AZIB 2LKSA 2HVSA 1N8RC 3TSZA 1GV5A 4J6XA 3B6PA 2R5YB 1D0XA 1M27C 4IQJA 4YOUA 4WCIA 2OU2A 2SEMA 4P9UA 2V8KA 3FJ5A 4OIRF 5FKNA 3L7WA 3KZBA 1IB8A 4GKJK 1V1CA 1J09A 1PD1A 4MFEA 3OW2A 2MSYA 5BRDA 3JAME 1X3UA 1H89C 5EDNA 1U1SA 4AHUA 4KNYA 4FJLA 4O3MA 2VBXA 2R7OA 2UUZA 2XRNA 2QQSA 2DDAA 4Z2YA 1WB9A 2EIMH 1DTQA 1MWMA 2XGEA 4HVWA 4ELTA 2IW5A 3RR8A 1M2OA 3OH6A 5L3DA 2E1HA 3PO4A 3ULQB 1WZOA 3KZYA 1G4DA 1JRIA 3SMPA 2D1HA 3GTGJ 3W0LA 2EGEA 4HF2A 1FKPA 1SMTA 2DOEA 1B72A 2A3ZA 1J0RA 2JXBA 3M3ZA 3ME9A 3SWNA 1D1BA 4B8AB 5IT9Z 4GYIA 3PVQA 3TI0A 2XHKA 3FF5A 3JCMP 1HA8A 3IC7A 4X1EA 3KZZA 4KH4A 2V6EA 1TQIA 4RTVA 3ZX0A 4A3BJ 5ICFA 1RAFB 1W5TA 1YITI 3QZ5B 5AT1B 2H8WA 3BCAA 3WT0A 4WTOB 1M90R 3B02A 5BN9A 3RSEA 1SANA 2E5ZA 3JCMg 3U9ZA 3CCRI 1S6QA 2NS7A 2FBTA 3CO6C 5FO5A 2HHUA 3FZLA 3THWA 3FRNA 2HKXA 4IJNA 2VWBA 5TKWA 4A59A 3M0UA 2QTDA 1W7AA 4FWNA 1WKMA 3NAEA 4MO4A 2P8TA 3I0WA 1H3ZA 2KFZA 2E65A 3T1AA 4CGZA 3K57A 2DZCA 3LDPA 4IFEA 3PIOF 4M3UA 3VS5A 3U3GA 3DWLA 2HI3A 3O8GA 5DUKA 4AFZC 5JR3A 3TL4X 2OD5A 4H4KC 4C1NI 5KQ8A 4A3IJ 1QHAA 2V1UA 1ZA2B 4OAZA 3WVEB 2DFFA 4AG2C 2AS5F 4DR4K 1XOVA 5KAIC 1R59O 1D09B 4KYWA 3ULRB 4A93J 3VEVA 3PE0A 2JPCA 2P5KA 3MWMA 2ZJQL 4M75D 1VQ6A 5KN8A 4BROA 2TCTA 5KI6A 4AIJA 1RT2A 5ICGA 3M56A 3QODA 2E2QA 4C8QE 4RGSA 1LFBA 5E1ZB 3CC7T 3FLCO 2Q1NA 3VRYA 2BW3A 3K58A 3H35A 2HZTA 3NVMA 4Y15A 2O9VA 5I2SA 3QYEA 5J1RA 3BG7A 1W7PB 1M1KO 2PJRB 1JJ2S 2K86A 4E1NA 2AJQA 4BDPA 2HHQA 1D8JA 2JPBA 4H0VB 4EFHA 3M1FA 4CBXA 1D1AA 2NWMA 4NCBA 1WSHA 3ER0A 3S16J 3IP4B 3IWZA 3GFLA 2D0OA 4BEHA 4RW4A 5JHUA 3WNFA 2L3DA 5AQNA 3SQ0A 2FX0A 4IIOA 5L3FA 1AKHB 1LMZA 2XB5A 2LD5A 2YLBA 1NGGA 2P9PB 2YU3A 3IL2A 5HS9A 1VA7A 4MMKA 5M5YJ 4XLPF 1Q81O 4DQIA 4BR7A 3G25A 3AVJA 1WXUA 1YCSB 4BRGA 3ZLJA 3WU1B 3JRHA 1O13A 3WNGA 5GAMj 4DTJA 3EE9A 1MIJA 2FZKB 1IRZA 4LD9K 1SUQA 2O4XA 3EPZA 1MBGA 4ESFA 3I8DA 2Z1JA 4JRQA 2HCKA 3LGFA 3FEOA 3RTVA 1YVNA 3KLIA 3HIFA 1ZG3A 1SVLA 5DM7F 3QMLA 3K5OA 3B6CA 1ZXOA 2PBIA 1K73O 4DSEA 1YN8A 3U9GA 1NHAA 4K42A 2P9NA 4P55A 3EY1A 2R7SA 1H641 3RI4A 5HLIA 1XGSA 1BGXT 1JLGA 3FFIA 3ZMVA 4J2AA 5F2RA 5CR2A 4UQGA 2F2WA 4I2OA 1UFFA 3J80O 4L8RB 1HQCA 3V9XA 1WLJA 4M77B 3NGIA 2IXSA 3S32A 4ME7A 2QWRA 2BHZA 2JWTA 1KC8O 3GZNB 4DYCA 3L09A 4FW1A 2BTTA 1YJNN 3QWLA 1DQUA 1QNTA 1YIJA 3D6RA 1GLBG 3JCMW 3ERMA 5B5EC 1Z77A 3LQQA 2VV5A 1KK7A 1KQ9A 2PFBA 4YOWA 2UXNA 4C3HJ 1MNMC 4NS5A 5GANg 3G0ZA 4CCHA 1GVJA 4C8OA 4BVOA 1IN8A 1DPRA 2VWFA 4FSSA 3HPWA 2NRTA 4BQOA 5IHIA 2EB7A 4DFKA 1I1GA 2Q1ZB 5LJ5d 4B1UB 2CG4A 2B8AA 2RQTA 3SDZA 2E1YA 3OS2A 3H9JA 5HNFA 1LKXA 3CJ7A 4A6DA 4J2DA 1QVGA 3VENA 1WA7A 1LWFA 3G73A 3FE1A 2Q0UA 5C4XJ 2VQGA 1OCRH 3RSNA 3V4IA 2M7BA 4B3AA 3AVLA 1XJWB 4MMLA 2EIJH 2CT4A 1YTAA 1VRLA 2NNWA 3GF5A 3SEMA 5ILVA 4BHBA 1T98A 2X51A 2A3SA 3TU4K 2RK1A 1NJXA 3TAGA 1MBHA 4RW8A 2F6CA 4CZJA 3S9HA 5CKDA 1W36D 1NK5A 1YNZA 5H20A 4XNFA 1JXSA 2CFXA 4JRIA 3CC4A 1YJNA 3VETA 3C3WA 5BPIA 1C0TA 2KXDA 4KHYA 2GQIA 3IQLA 1HNIA 5GAN4 4B9MA 2O88A 4M7DC 3RSEB 4ZGDB 1WJSA 5FROA 4EV0A 1BDGA 2LQNA 4XEIA 1PKTA 3SYTA 2KGTA 4DQSA 4GLKA 1KD1U 2XMFA 2FLOA 4C30A 4B9NA 4BGDA 1R9TJ 3DEUA 4IBNA 3LWLA 3K5LA 4DB3A 1QO0D 1OVYA 3A8HB 4AVZA 3ZETB 3I56Q 1ETKA 2E12A 3FC3A 3TU5A 1PWTA 2DT7B 1Q95G 3GFIA 1Q82O 2P7CB 5GAN3 2FL7A 4M3ZA 3NWSA 1YUWA 5B3SH 4PA1A 3VEPA 1AEYA 2NVXJ 2XAHA 3PFYA 5F6FA 2X74A 3O3KA 3C18A 3HL8A 1RT3A 4HW0A 3KKRA 1U48A 4F2RA 3LGLA 3HFNA 2NAZA 1M90U 4KB1A 5E18F 3CD6T 1QZYA 4A2UA 2DA4A 3ZT1A 4BHPA 3N05A 2RQPA 3AVBA 1BOTO 3LDQA 3JB9I 2XGCA 4BB7A 1JJ2P 1VQMT 2VJIA 4ISFA 3VSLA 3FHZA 2D0PA 3CVSA 1TKXA 3VS2A 3CD6Q 1WGXA 1NGHA 4CGIA 3O5ZA 2GAUA 3W2VA 2KY9A 2F7TA 3A8GB 1RDCA 1N36K 4RAGA 4CF1A 3GEZA 2ETJA 4MZMA 2JQ7A 1TUUA 1U9OA 1X9WA 2HDWA 4ILGB 4I2PA 2B6AA 4CGGA 2KMTA 1QLYA 4Y1CA 2LF8A 3QEVA 2OTLN 1BM9A 5C0YA 1XB4A 4Q4ZF 4UUTA 3G3ZA 1WNLA 3VUZA 4JV5K 3S1RJ 3L2RA 1I27A 3BJ6A 2QA4A 3Q7BA 2LX7A 3VB2A 1NE8A 1NBWA 1BI1A 5KE2A 2QEXA 2KW4A 3URGA 3DBHB 3OA6A 3G6ET 4CHYA 1GCPA 4XTWA 2IIMA 3OYLA 2CP2A 1T7PA 4YNQA 2DFEA 4CEDA 2CQXA 2MWOA 2Q2EA 1YJWA 2BXYA 3KYCB 4LITA 3MCPA 3ZSQA 1R71A 3E9PA 2DTIA 3A4CA 3OIOA 5LRRA 3SD4A 3E1YA 5I9EB 3DLGA 3CCSI 4L9NA 1KG1A 4DTXA 1K9MC 2LMDA 5ERIA 4LJZF 2P9NB 3F8NA 2BGCA 3OOUA 4W5TA 1U8BA 4IUVA 1VQ4T 3CCUN 3O9TA 1JT0A 2A28A 1M1KU 4VUBA 4FHTA 2E64A 4M7DE 2A5XA 3QPLA 1QKWA 4G12A 3ZEUA 1XTAA 1UWBA 2XVCA 1OEBA 4BWJA 1T0HA 1PVSA 4M3FA 4KO0A 3ZSZA 4GDFA 2STWA 5LJ3f 2BY2A 3WUHA 1Z67A 3EZ5A 1O3SA 2P9IB 2KQ2A 5HRNA 4BC3A 4RB2C 2P0PA 1U0JA 4S0HB 1Y97A 2HKOA 4X0GA 1KFSA 3VFZA 2QZ8A 2ELKA 3CC7N 3CMET 2VI6A 3GOXA 1QS4A 4M74A 3TGNA 2BV6A 4GRIA 3QWYA 4CEZA 2QEXN 1TNTA 3VJPA 2WADA 2WB1A 3F10A 2Y1IA 3V9WA 1GV2A 2OAUA 3CCRQ 5C3EJ 4HRIA 2VXDA 3CCLA 1ASUA 4ZZLA 5LHHA 1WHGA 4JN4A 3CMEQ 4BRIA 4OVLA 1FN7A 2DY4A 1BC8C 4A3GJ 3H08A 4PQUA 2P5GA 1VHXA 5HK3A 1UHMA 4JKEA 1V55H 3AA2A 1UMQA 5LJVA 2DK8A 2OPPA 1N3CA 4WQ5C 4HNVA 4FE7A 2A1SA 2ZM6K 2Z99A 1UGRB 3CCUA 4AIHA 3J7ZI 2A69F 3TO7A 3C4SA 1Y64A 3CVTA 4JKGB 1P90A 3VUBA 4D6WA 2OUMA 1WAFA 5C42A 3QWXX 1YX3A 2ECCA 2FF4A 3I0TA 1AVZC 4E9HA 4Z4IA 4FWRA 3L2QA 1KC8U 3VF6A 2R5AA 1JGGA 2XGXA 2OQGA 3QBXA 3IKVA 1RKWA 3QUIA 3J81Z 2CV1A 2OJ2A 2DAQA 2YXYA 3DOLA 1S29A 4L3QA 2HU9A 4M6YA 5EG0B 2HW3A 2NVQJ 3RQ4A 4KKOA 3CCRN 1ARKA 4FCYA 4M6VA 3TCJA 1UG2A 4ESBA 3X2QH 1Z91A 2EW3A 4NHJA 3CC4I 3OW2P 3HOSA 2M30A 5LGUA 3CCVQ 1FYLA 5H6RA 3HHTB 3FISA 1A6IA 1FLIA 1R36A 2DKGA 2L7KA 2HHWA 1VQLT 2FQ4A 1WYXA 3EUAA 3CPWM 4OPKA 1UELB 4HG2A 2NUPB 3EH2A 1UUEA 1K8AR 4DR7K 3AGRA 2XAQA 1NYFA 4Z4FA 1AWCA 3BJOA 3H5AA 1GLDG 2B63J 1FIPA 4K11A 5DMRA 4MZPA 2DA1A 3AL0C 1L3VA 1SHGA 4NXMK 5CQYA 3G6EI 4WFBL 1LB2A 3JCUC 4CEEA 3DM2A 3T1YK 1AOYA 1MJAA 3EKSA 4H4OA 2L01A 2DLPA 3L2VA 2PU9B 1SKSA 1BI3A 1EQYA 3R1XA 1VQMQ 4JKCA 4BI3A 4Z89A 2VKHA 1VQ7A 2K5CA 2EIKH 4N9HA 2QWPA 3O8MA 3O5BA 1EZZB 3W2WA 1H0MA 3CCST 2F5KA 5C12A 3SLCA 4L18B 4A61A 2VLAA 2JUCA 2ZSIB 5F0CA 3RMAA 1QVTA 2A6HF 3M4OJ 3ZSXA 4BRCA 3AFHA 1ZUYA 4FJGA 2BYVE 1ETQA 1BL3A 1M8VA 3QDRB 2MA3A 3CMEA 2ZPBB 2CUBA 2E6LA 4FOEA 1NJIC 2UUBK 3FFKB 4OMQA 1BISA 1WFWA 4GVEA 5GMKl 1M2VA 3CCRA 1NTCA 4C8QF 2EPFA 3KYDB 3LFKA 1KHIA 1FYMA 4DWIA 1HKQA 1T6CA 5AN4A 2Y75A 2F1LA 4M7DF 1KYWA 1HW1A 2Y30A 1TXQA 3QXEB 2RE2A 4JI2K 2K9MA 4FXDA 2NOZA 2KZGA 4Y7NJ 1SFEA 4IEIA 1JHHA 3H92A 1BUPA 2XICA 3VQCA 1W97L 5HY6A 3LL3A 1QP3A 1L0OC 3DLLF 5GAGJ 1IXDA 1BU1A 1ZBLA 3H36A 4P5OA 1IG7A 2EQKA 2IVNA 3DB4A 3W3DA 1U5TB 1BU6O 1QVFM 2K85A 1QMCA 1IN6A 2E41A 3IWFA 4QLCU 2ROLA 3CIPA 5C2DA 1JU5C 3VSKA 2GBYA 1K76A 4B1XB 2RK2A 1MBEA 3E5UA 4RG2A 1F1BB 2WAFA 1X1BA 4ILHA 3LSMA 2P81A 2XY6A 5TJJA 1BA1A 1D9FA 3GFMA 3CQYA 4NL2A 5CHZA 2D2WA 1AHDP 2B9SA 1W4MA 2K5LA 4RWTA 2DO3A 2GTJA 2EBPA 1VQ6I 5D4RA 3WG7H 2LZ6B 3VQ6A 1U45A 2FBIA 3SEQA 4RTTA 4V19K 2FJ1A 3QDFA 1QQMA 5D5UB 1IGUA 3OS5A 5HP1A 3NVKA 2ETHA 5CYVA 2E5KA 4UV8A 2ME6A 5JVGL 2EZIA 1YYVA 1ZG5A 5E79C 4IJAA 1E17A 3QEPA 3VGKA 4E9FA 1A5JA 3O4WA 1A5VA 1HPZA 3KTUA 2DT6A 1TQMA 4J2BA 2KVQG 3MJXA 4DHYA 4WQ4C 4RUGA 1VQNN 5J1YA 1J6ZA 3MP6A 5CVUA 4DR5K 2NYXA 1I6HJ 1HDPA 2O3FA 1VYUA 3KP4A 5M9OA 3HOTA 1JE8A 5BPNA 4JDSA 3KVGA 2CJJA 1LE8A 1QGPA 4MDBA 1IO2A 4A4EA 3U3YA 3Q7CA 3L2WA 4FYDA 1YFHA 4B3RK 3EETA 2YPRA 2EWSA 4M3TA 5AFUA 5AQXA 9ANTA 3G0QA 2D9TA 2KIUA 3P9IA 1NGAA 2XC7A 5CHIA 4H5NA 5BR9A 1XX5A 1Z6RA 3OJSA 3SQ2A 3ID6A 2CSQA 2JNGA 1JJ2M 4DS4A 4FYXB 3DMJA 3CDHA 3VQDA 2L89A 4C2UA 2E70A 5JS1A 2GWKA 2E4LA 5GAMh 2IGMA 2P9IA 1KG2A 4C92C 4A3CJ 2R7UA 3AO5A 2Y90A 3ESWB 4YFNF 4L5GA 3AAPA 3C7NA 2K3FA 4JPBW 2A6TA 1VQLN 4BQLA 3CC7Q 1N8RU 1KU2A 3SK3A 2JTFA 2D0BA 5ECAA 4ISEA 2KPMA 4LNPA 1GXIE 2JM8A 4FWPA 2FBKA 2DN0A 3ABLH 3I58A 4BNCA 1I6XA 5GAOr 3V7RA 4M6XA 5LL6Z 2I5WA 4EW0A 5F64A 1NU0A 1BOBA 1LE8B 1UJ0A 3HOVJ 2FOWA 3VYUB 2B5JA 3OJUA 2EZKA 2ZF5O 2LTOA 1ZRFA 1GFDA 2GLOA 1I1JA 4IRGA 3ZBDA 5HDGA 3GZ6A 5HRPA 2R7ZJ 2RM4A 4B44A 3OYFA 2CQKA 1DUXC 3OW2S 3LAPA 4XLAA 2E3IA 3ZQLA 2ABLA 4HV6A 2KLAA 3Q9VA 1VQ5Q 1TV6A 4CCLA 3Q1JA 2I0NA 1FNNA 4G6TB 4IHVA 1M1EB 3HUGB 2GCXA 2PYJA 2RN7A 4EGZA 2VUMJ 3C65A 4QPQA 4BRMA 3M8FA 4UV9A 4B48A 2X0LA 1QZ6A 1RDBA 2ZJRF 4FJ5A 1J75A 3HPGA 3CWSA 2CH5A 3KLEA 2LY2A 3WHBA 2L4AA 4OGCA 4RCBA 1OCTC 2ZJ2A 2X6YA 1K73C 2E36A 2DJZA 2XUBA 1N5YA 1ZLMA 3EFOA 4F52A 5J3BA 4M7AA 5M1KA 3CC4Q 1JEGA 2DW4A 4M3XA 2K3YA 3TR8A 3WTXC 4GBQA 2HSPA 4ELYC 2QW9A 3JCMJ 4FJ8A 5KTQA 2Z1HA 1TKZA 3CCSN 3BTLA 3FXOA 4B4CA 2VC0A 2EJRA 1U04A 4RDUA 1S1UA 1XQPA 3H5NA 5CZ1A 4I0BA 5K7FA 4MGRA 2DBKA 1YJWI 1M3HA 3JCMd 3LA3A 4OVAA 1XGNA 1L3UA 1O3QA 3WXMB 1WFXA 3CMAQ 4R1HA 4LUEA 2CH4W 4KGXB 5FPMA 2X48A 2H6CA 1BL0A 4LLGF 4JNEA 1X6BA 5GAN8 2ACJA 4B1VA 3OTOK 1OU8A 4NCAA 1VQ4I 1L3LA 1HCRA 4B3SK 2QXFA 1ONVA 2A68F 2DEUA 1Z26A 3CCQI 3F22A 2KZMA 5KQDA 1AT1B 2OCEA 4JZ4A 1Y8QB 2VIXA 1OISA 2DJQA 2DOFA 2XK0A 1MMDA 1H3HA 2G8UA 4A0XA 5FKOA 2RQWA 1KIKA 1CKBA 3J8AA 3U1DA 1DIZA 4UHTA 3ZP5A 5KGWA 2K4JA 1YQAA 4D7MA 1AHJB 1PG5B 2ZXJA 2YNIA 2YLCA 2QLZA 3F6VA 3J80K 2E2IJ 4YRVA 4ZH4F 2G8KA 1WI9A 3JCMf 3FKIJ 5BMZA 2K3XA 1BO5O 2L9RA 3BF1A 3TTFA 1T0FA 2X78A 5TISC 3M1EA 3FLGA 1VIEA 3ZN1A 4LDYA 2K3PA 3AO1A 2JRMA 3ZT4A 2BY3A 4HQEA 4MDWA 1RDUA 2DK5A 1OH7A 2NNNA 3OIPA 4EJWA 2OFKA 3S2WA 3CCRT 3H1VX 2K4YA 2WSEE 2DMNA 3OSGA 1LV5A 3VF4A 4M3GA 1Z9QA 1GFCA 3MHXA 2ZFWA 1WDXA 4AYBA 1FBQA 4WFAL 3IHUA 1BG3A 4A3FJ 1JL1A 1LFUP 1ZK8A 1YJ9Q 1VSDA 4BRHA 3L2UA 4OWRB 1MPGA 3M8QA 1PKSA 2X9HA 4Q5VA 5FDLA 5GAMd 2M0OA 1EF4A 3OYKA 1ZKGA 1V76A 3FJPA 5F08A 3CDIA 3GBTA 1APLC 1Q18A 3R61A 5EX5A 2Y1JA 1D8YA 2HF4A 2G7UA 1HXDA 2X4JA 1B34B 1NEGA 4B1WB 1V5GA 3QAHA 4PJOF 1IV6A 3KLNA 1ZLKA 3QETA 1OU9A 1VQPT 1VQON 4M78D 3G4SQ 4PWDA 2E7XA 3PQKA 4PHTX 1VQ8T 3THXA 4U88A 4EIAA 1PU6A 2I7NA 3KEYA 4FSXA 1QSYA 2NOEA 2NLXA 1K6YA 4CIFA 2DL8A 5KCHA 1RZ4A 1PNJA 5A0LA 5F04A 5DPKA 5M3FJ 3D45A 3CJ9A 2A40A 4U0YA 3F6OA 2XSJC 3RMSA 4O0IA 2A6EF 1LEAA 1VQPN 3R0JA 2HHTA 4DV4K 1FWZA 1R23A 2QEXI 1B34A 3KJVA 3SV4A 2DDBA 5KPTA 2ISZA 1H8AC 3Q0VA 4J9GA 2F2XA 2I10A 2QWNA 2H8RA 1B3QA 1GRIA 1KG7A 4OFHA 4B1RA 1H1VA 4IZZA 4OJRA 2EFIA 4WFNL 1ZHFA 1EBMA 3U6FA 2DFIA 2B86A 1SD7A 4M7DB 1IN4A 4G94A 5J4YA 4ZYEA 1JUSA 1YJ9I 4X34A 4PKHA 2YV0X 3CCQA 4M77A 5AQMA 4A5AA 2HPIA 3K9KA 3JB9H 1DGWY 1NGCA 1LPLA 4B9VA 1X1DA 1SVOA 1PYVA 4GO1A 2P9KA 4DQRA 3T3FA 2M2EA 4CHZA 1X69A 5SWMA 4DR3K 3A2FA 3CXCP 3J7YJ 5D6WA 2DU9A 1CXQA 1F36A 1GLNA 3G6EA 1FKOA 4FW2A 1ZBXA 3PL8A 4C8QB 2HTJA 4KRFA 4GXOA 2LDUA 1M3AA 3VEZA 1HMVA 4PSXA 4B23A 4CJUA 2RA2A 2NOIA 3VMFB 3HHGA 1SFXA 1WJ5A 1HPMA 3RR6A 2YHTA 2GX9A 3A03A 3HG9A 2F69A 3LW5E 3LOCA 3CQZJ 4EPCA 1QQCA 3HPHA 1FSHA 2VXFA 2V8JA 3DB3A 4DTOA 2K7AA 4CYDA 2PUOB 2W41A 1WH5A 1KJWA 1N8RR 4NL3A 4HCZA 4HSRA 1ORPA 3CCLT 2UUAK 1VSEA 2WFBA 1KQSM 5D7UA 4DIQA 2X6WA 2CUJA 5GAOl 3VQ7A 5IT9O 2NS8A 1NH3A 1YOVB 5IY5H 4NYNA 4CGDA 4LY7A 4LOCA 3KPHA 4C8QD 5FLMJ 4PL8A 4PJOG 3PIPA 4JLHA 2TRTA 1VIFA 1J5EK 2X4XA 4F3TA 5J40A 5KRSA 2DPUA 1K8AO 3MCZA 2CW0F 3M59A 2HNHA 4N4OB 2QASA 3RTRA 1SG5A 3QEXA 2XAUA 1VQMN 3QO9A 4YOTA 2P5LC 4M77C 4I6ZA 4EJZA 3OYNA 2GXBA 3ABMH 3DEWA 4BQQA 3QFUA 1K73U 2FEZA 4AM3A 2CZ0B 5IH2A 4KIGA 4UB6C 2H1KA 4D5FA 3EFOB 4O6JA 3SBGA 1RUNA 2X6NA 1MJ9A 3R0AA 2HMPA 2Q31A 4DU3A 3KD5E 5GAEJ 2HHXA 4XTVA 3JCMe 3DTEA 2WY8Q 2HSEB 3WU0A 2O4GA 2E1CA 4M3DA 4K2EA 2L8DA 5HS8A 4JUVA 3KLFA 2O8DA 2F96A 3VF2A 1PSEA 1WJFA 2R5ZA 1RIOH 3REBB 3F9KA 2NUTB 3PJRA 1XN7A 2LJ3A 3K5NA 4QT7A 4DFPA 3U21A 1GLLO 1A31A 3BEXA 3I59B 2NOLA 1WJQA 1NGJA 3BTJA 2HR3A 2GOXB 3DP7A 4J5YA 2GGRA 2NVYJ 1LDDA 2G7HA 4HUEA 1SQKA 2QWLA 1J2XA 3OL4A 3JREA 4OKEA 1ZHIA 3C2BA 1BC7C 2M4KA 2GUIA 1MUYA 3ZOBA 2CZ6B 3HBLA 4XSZF 2F9WA 3S3MA 3C6AA 2DEQA 1MSFC 1VF9A 1FOYA 4YPRA 5GAMg 2KKZA 3EGUA 2MW8A 2L3PA 1LCUA 1NKEA 2Y48A 3U23A 2G8VA 2XIDA 1QU3A 5C4JJ 2OJED 1N75A 4F7UB 4CECA 3NMZC 1KSWA 4W5RA 2UUCK 1EWRA 2E5LK 3JAMZ 5KYWA 1EKEA 4RTZA 4GCVA 4CZIA 3DTIA 1VSHA 4PK4A 4AHSA 1HYOA 2FBHA 5EY4A 1ABOA 5GMKh 3DPUA 3DTKA 2MD5A 1T0FC 4MDXA 1ZARA 2KZZA 1WAJA 4EMHA 4E9EA 1KG5A 2O31A 4LH4A 4AHCA 4A4HA 2P4RA 4Y91A 5A2QE 1C1BA 1WUAA 2XF5A 4FT2A 3JSOA 4I0AA 3CMEN 2H56A 1QWEA 1J9AA 5FLXE 3FIWA 2R0QC 4FO0A 2DETA 4DU4A 2ZFUA 1XI1A 5IOYA 4UXNA 5F1JA 5GTHC 4IVNA 2VUBA 1HW5A 2DYSH 1T38A 2YSRA 3G1OA 4HTUA 2QGFB 3GNGA 3HT3A 3BZ6A 4DTMA 4MEYF 1XC5A 5J26A 2MH9A 3JYTA 2CRGA 3AHUA 4RS8A 4XOTA 4BXFA 1TT0A 3NAUA 4Y52J 2DD5A 3THXB 1HJDA 3X20B 4J9DA 1DGRM 3GBGA 3IRRA 4PJ0C 1WBBA 2AO9A 2X1DA 1UG1A 3C95A 2L7ZA 4N0AA 4J8FA 4A4KA 1WHMA 1OOTA 5JS2A 2P6SA 4M7DA 4M41A 1R5GA 5GAMe 2BZXA 1R5ID 1EA3A 4C92E 2HQ5A 2OZMA 3GVAA 1LNXA 3HM8A 5HROA 1E3HA 1I39A 3H46O 3FMRA 1DLOA 1YJ9A 2YHAA 3I55A 1OCCH 3JRAA 4DLGA 5CY4A 2Z1GA 3E6MA 3LLRA 1FIAA 2HVRA 4M45A 3B6AA 2PLYA 3FXUA 4AC0A 2O2OA 1YJNT 4JI8K 4QQGA 3AVGA 1SZ2A 2NUZA 5H2FC 3AT1B 2MH2A 3SUQA 3L3UA 1DEJA 1TLHB 2VYPA 3THYB 1WSJA 1A04A 1B8IB 2I5JA 4CHNA 2IA1A 4MQVA 3O4QA 4QTRA 4NC6A 5F0HA 3REAB 1KCFA 4RW9A 2JSCA 4G7OF 1PUFA 1C0FA 1OH5A 4BYYA 5C25A 3O4NA 1YHQT 5HRSA 5H6QA 2K40A 2VKEA 1W0TA 3HJFA 2ENMA 5E8IA 1TK8A 3PNWC 2IS3A 3R8EA 5GANj 3IRXA 1Z1DA 2P0KA 2O03A 2W82A 3CPWS 1H9GA 2KHOA 1PM3A 4CEAA 1ZUKA 1K61A 1RRQA 3JSMA 4B3OA 2D1XA 3TW7A 3GDQA 2ZGWA 1XG1A 1IF1A 3HOXJ 2K2MA 2CUDA 1MNDA 4A5NA 2HEOA 2CDTA 3GCMA 3OB9A 2G3RA 1Z3YA 4ATOA 4J2EA 1VQMI 1MWKA 3IDHA 2KRSA 1FMVA 1AWWA 5HBMA 3VQPA 4GLMA 4FJ9A 3GW2A 3CCYA 3SAGA 1NEBA 3M0PA 4K25A 5FU6B 1YG2A 4N4NB 1RAHB 2EJGA 2DPDA 3EGXB 3CCEN 3S6WA 4JP0A 1P4XA 1YJWT 5J2MA 2L5QA 2C6YA 3I55T 2XHIA 4KMUX 5BPLA 3SI6A 2X4WA 1K7AA 4LSLA 5LJ3j 2ZZDA 4AD9A 1QP2A 5TGTA 5I42A 5BPMA 2FQ3A 4IF4A 2EILH 4RW7A 4XRFA 2HFHA 3CW7A 2WONA 3ZEUB 3TAQA 2RD1A 2EK5A 4FWOA 4OFAA 2QWQA 4FX0A 2F5CA 5GAN2 5D6YA 4I76A 1YBYA 4N4GA 1Z3XA 1YWPA 2XPWA 4C9YA 5IYCJ 5GMKe 3TDZC 1IKYA 4HUFA 1SL1A 2J05A 3S1MJ 4DJAA 3QU6A 1UZCA 2DPPB 3CG7A 3HUGA 2KIFA 5IP9J 3L42A 3HZ6A 3ISPA 2XDBA 4XTZA 4JI5K 1B9FA 4E7KA 1NLVA 2DERA 3FHFA 3PGGA 3VPZA 3UKGA 1VQ5A 3G4SN 4YIRX 2MK5A 4YY3K 2UWMA 1ZR2A 4O4GA 3LSIA 3CJNA 3JRIA 2GOMA 3E3VA 4Q5WA 1LCKA 4AU7A 3J80Z 3OIQA 3I3LA 1HSJA 3MECA 3IUOA 4BY6C 4IG0A 4PGHA 2R7WA 2ZJPL 4FLVA 4Q48A 1WNSA 4I6MB 3R6NA 2R7TA 3LL7A 1S22A 3LYIA 2RH2A 1DGKN 4GVMA 3REOA 4H0YB 3LDNA 1RNHA 2YHXA 1TWFJ 1BCMA 5FJ8J 1U06A 3PV8A 1CGPA 2NVTJ 1DKGD 3RMDA 4C0DB 1M9SA 4G7HF 3CC7A 4A2AA 5AQIA 3TEDA 2VXEA 3KP6A 1NM7A 1U6ZA 4MZTA 3KK1A 4CF0A 3FZKA 2BZTA 3T7ZA 4XTYA 3COAC 2FF3B 2NOHA 3BWGA 1VYTA 4FWSA 4FE4A 3PX6A 2O6GE 2DA3A 4ZYAA 1BJAA 1Y0NA 5GANe 2H8HA 4RTWA 3A01A 2CGPA 1OKJA 4N5SA 2PMZN 1E0EA 2PX9A 4XORA 2Q0RA 3EO3A 2HOAA 5CPRB 4IURA 2OYQA 2LNBA 1RR7A 3ZXSA 3NNQA 2DJNA 1FC3A 4HQMA 2CQQA 2DTHA 2J6OA 3I33A 4Z4HA 1R4NB 2NVUB 2WTUA 1SRMA 1XTDA 3P8HA 1SKRA 5FB2A 2PJRA 2V75A 2KEAA 4ZNXA 2RQRA 4LK0F 3C0CA 3CWAA 1SV5A 3K1NA 5KYNA 2VWKA 1SFOJ 3A1YA 2AKLA 4XU3A 2KAFA 4PZJA 2QWWA 4ON0A 4XU1A 4P5NA 2A0FB 4UOBA 4G1QA 5FKKA 3CCSQ 1SD5A 1MGTA 1I3QJ 1S1XA 4N0BA 5AQOA 2VL8A 3LA2A 1XMKA 3LALA 5K14A 2O8BB 2HHHK 5AQZA 4BRLA 1ZR4A 3TAMA 2P9KB 2LTPA 1V3FA 1JKPC 4JS4A 4UVCA 1YQKA 3G1MA 2HNDA 3RVCA 2H09A 2K9SA 1B07A 4AI5A 4RB3C 3CCQQ 2UV1A 2XY8A 1IN7A 2GWRA 4CUGA 4DV7K 4DBRA 3ITHA 2VPLA 5AZJA 4WE1A 1Q86R 3F2KA 4RLQA 3BTCA 1D9DA 3DPTA 3S1QJ 3H3VK 4XN0A 4CHUA 1KQSP 3M58A 3KBGA 1RDWX 2P9UB 4BR4A 2QGUA 3P83D 3DLHA 2RJFA 3QBYA 4CHOA 4JAXA 3SAFA 2A5YB 5L3BA 4X1VA 3WQUA 1PDNC 1HSQA 3IG1A 2DBBA 2OX7A 1XNQK 4CIGA 1PRMC 4CXFA 2M87A 5FU7C 1YHQN 2P5VA 2RJCA 1JXEA 3SUNA 1RTHA 5CZ2A 4RGXA 4E7JA 2DMOA 1S8NA 1PP7U 3MMVA 4UVBA 2M8EA 4W5QA 3PMTA 1N32K 2H27A 4M7AB 3WE3A 1Q82U 2YNHA 3UR3C 4HAMA 3NBPA 4WXHA 3QLHA 1WQWA 3RERA 4BXUA 3DKMA 1K79A 4D1QA 1RACB 3CC2N 3VS1A 4EAHD 3H3ZA 1XG7A 1XDSA 1MSEC 1R77A 3VQ5A 3GOIA 1MV3A 4Z94A 2E2PA 3AO2A 4C8LA 3C2GA 4H8KA 2BTFA 3SXYA 3LSPA 4YHHK 2RGVA 4M7AD 5AQGA 2OPQA 1EO1A 5K7ZA 1U5TA 2GWJA 2LVMA 2K5FA 5ELZA 2A3LA 3F72A 2FBVA 5EVZA 2VASA 3C6TA 2JT4A 1DP7P 1L3TA 3EG3A 1OYWA 1O3RA 4KHNA 1XHXA 4D8DA 2P1JA 3K5MA 1YJ9T 2ZJRL 3CUOA 1RILA 5HLHA 5JLXA 1SC7A 3T8TA 4AUXA 3CJ1A 4AG1C 1QVGS 4FVUA 4C2MJ 3TOBA 4J7IA 4YFXF 5GJWB 3LDSA 4DSKA 3K0LA 5E3NA 1E4FT 2O7OA 5HDNA 2VJ4A 4XU0A 4JK7A 1K78B 5GAOp 2D5VA 4BRAA 3JB9D 1E3PA 1U49A 1V29B 3JV3A 2Z9OA 4F91B 4AHVA 3RYPA 3K69A 1XMOK 2BH1A 1Q9YA 3KK7A 4CEBA 2X4YA 4M7DD 4NNJA 1MV0B 3BPVA 2OTLA 2BZ8A 3I53A 3LANA 3G4ST 2QWMA 4NQWB 4EMKB 1HKTA 2VG7A 4U7BA 3A5LC 3FXQA 4CHQA 2X3XD 1TTYA 1JLQA 5E17F 4HX7A 1O9SA 1LVKA 2MGQA 3BROA 4JI4K 3A8OB 4AQYK 2Y0SA 3HSTB 3MPUB 3JRZA 4KDPA 2AXLA 2ZJQF 3W6VA 4B09A 4Z4EA 5DYMA 1R4MB 4HLYA 4KT0E 4F7UE 3D1NI 3BR5A 2KT8A 3EL2A 3VW4A 3R4KA 1NLOC 4EHTA 4M75B 3SJHA 1GBQA 4JK8A 4HCBA 2KKOA 1NPPA 2CSOA 2GV9A 4A57A 2R3SA 3ABTA 1X19A 4I98B 2YJFA 3GX4X 2L3RA 3ZT0A 2LBFA 4KN7X 3GTPJ 2ZCWA 2VOOA 2ZPIB 2X6OA 4MIMA 2V1NA 3KK3A 1UOCA 5EF6A 2Q2EB 2RC4A 3IUCA 2JWKA 2FRHA 1IKVA 1V54H 4BS9A 3KNTA 1PCXA 3VESA 4F14A 1VQ8A 4H5TA 4UNFA 4NDLA 1MD0A 2R7RA 1G3WA 4RMOA 2Y4YA 4PJLA 3M8SA 1UGQB 5IN1A 3L1PA 3EGDA 3CJQB 4WQ4A 3O08A 2W6KA 1TP4A 1M30A 2RHXA 3TAPA 1M90O 1ASWA 1SRLA 3IKMA 5FPDA 3EE8A 4ZDOA 2KIMA 1NKBA 4AM6A 4M78A 3H1QA 2BY0A 5KK1A 3NF8A 2IVMA 3D2EB 5KAFC 1JHFA 4NCGA 3WVDB 2F48A 5JVGF 1J5YA 1IKXA 3JRBA 2WB1N 4GYGA 2IEKA 3EGDB 2JW4A 1R49A 3AAQA 3BPXA 4C5IA 4FLUA 4X9DA 2QKLB 2KRMA 4CZFA 1ABQA 1VQ4N 3EYYA 4BI8B 1HKGA 1Z7UA 2M4GA 3PO2J 3MXMA 3FDYA 5D6XA 4II3A 3Q3SA 1VQ6N 1KQ2A 1UJ8A 1TTHB 1F43A 3HVTA 5A2QO 1UA1A 1U8RA 1H88C 2CV2A 3PFSA 1I4K1 2GQVA 1F1ZA 2LBFB 2JN0A 2LK2A 1IV0A 2V7FA 3RKXA 3AA4A 2DXTA 4OAYA 3N97A 3DLBA 4Z6YA 4LF4K 4OMFB 2RI2A 3FBNB 3H41A 4XLHA 9ATCB 3AL0B 4M77D 4DG1A 3QRFF 1Z05A 2XIGA 3P9CA 1VSLA 1D8KA 4LFUA 4KTQA 1LWCA 3I8BA 2CUEA 2LMJA 5AQRA 3C7NB 3LQRA 2YU9J 2R7DA 5BRHA 3QESA 3AVKA 3U9DA 2YHWA 2DBMA 1S5LC 3AVIA 3F8CA 2L2OA 1R6RA 3S15J 2VJJA 4J9HA 5AQKA 3V1RA 4M75E 2VE9A 4BXXJ 2NOFA 2CZ1B 1NK9A 3T5XA 3K4JA 5AR0A 5C2FA 1TWCJ 1ZYRF 1YE9A 4F93B 2V1XA 3TSUA 3S6IA 2AZSA 2O61A 3A8MB 3PLAA 4PIIA 3CFPA 3HOWJ 2YWWA 2PMUA 3K59A 4LF9K 4JX6A 5EG0A 5DTDA 1QTMA 4O55A 5FLXK 5J39A 4FVMA 3WGIA 2QTVA 4KB0A 2FRYA 4BE2A 3CCMT 3CFRA 2CGLA 4M73A 1YJNI 1RL2A 2HXIA 3G71T 4LG0A 3WTYC 4Y33A 4LIUA 2QK0A 2PNIA 2WWYA 1NK7A 3C1DA 1EX4A 1ZC6A 4C8QA 3ATVA 4EMKC 2NUBA 5KYYB 2QCOA 2AXTC 3X28B 2G8IA 3FHGA 4M3YA 3QYFA 2OA4A 4JQFA 2FPFA 4R55A 5J2PA 1X2MA 1IJJA 3JSPA 2DMQA 1O7FA 2ZD1A 2ED0A 4C0GA 1N33K 2ZMEA 4QW2A 3QB0A 1IW7F 1SPKA 3VS4A 1D0YA 1GOBA 3E9OA 3I5RA 2DQLA 5EZGA 1OULA 1AWOA 3LZIA 2BZYA 4Y92A 4ITVA 3H6ZA 1Z25A 2ADUA 3CLQA 1WHUA 5KRTA 2DTZA 1QCOA 3VWBA 3UWNA 1TWHJ 2HBLA 3W2AA 3H0FA 1OCZH 4UUSB 3S1NJ 4I9LA 1ZGWA 3P31A 2RPNA 3WTUC 1N3AA 2MI6A 3SFZA 3HL2A 4CK1A 4AHRA 2ZXWH 1F4KA 2QUFA 2O9SA 3BUZB 3LA7A 4MFBA 4JLGA 4ZGEB 5AQHA 4E7LA 3VQBA 3D5LA 3X24B 1IH7A 2CQ7A 1C1AA 4CGJA 4DSIA 3DF8A 3E5XA 1OV3A 4PCQA 2UU9K 1KONA 1Q81C 3QBWA 3LDOA 4HDUA 3NCIA 4J9BA 2WSFE 4UUVA 2OTJA 4LC9B 3WTSC 2L0AA 3HM9A 2E1OA 4B3TK 4XKWA 3T0YA 5M3MJ 2ROTA 1W7PA 3LWFA 3NARA 1GCQC 2VODA 3I54A 2IGOA 2CMPA 1W0HA 2JA7J 3WXIA 3EDPA 4IOCL 1ZAOA 2PVOB 4M7AC 2ZMEB 1Z6TA 3JCMb 3LSKA 4JK9A 3CC4N 1Y39A 3VV0A 3J81K 4CJSA 3K10A 3PIOA 5HLFA 3ZN0A 4KIBA 3AG3H 1QVPA 1SSFA 3EEQA 4IDHA 3I0XA 3HKSA 1VTNC 3V1OA 4QIWN 4DKWA 1HYZA 4E3SA 2H6BA 3ZX3A 1QVFP 3HTVA 4KT6A 5HS7A 4J6WA 4E9GA 5FWBA 2V1DA 3S2HJ 5GAOq 1R0BG 3PX0A 4CZLA 5HK0A 5AQFA 1KRPA 3KKSA 1SKWA 5L3GA 4MQ9F 4CO8A 4NZGA 1RT6A 4BRQA 2J5OA 2NOGA 1EFNA 3AO3A 3V1QA 3I0RA 2KROA 3HSRA 1N25A 2FOKA 4ABZA 2W1OA 2DYBA 4HTLA 1TQPA 4H0PA 2V9PA 2OTLQ 2ZSHB 2YCHA 2XO7A 4O0JA 1Y0UA 4IZ9A 4FISA 3SB2A 1W70A 1XDUA 3CCVA 5IWAK 1MUDA 5LL6S 4LMYA 4YIFA 2E2JJ 3O1WA 4DV1K 2W24A 3AVHA 2EV6A 2ZPFB 4JS5A 2E5QA 3HKZA 1NGNA 3G6EN 2PQWA 3GPLA 3L3VA 2M3AA 3D0SA 5LHGA 2LY1A 3JAMK 5M1QA 2KT0A 2IRFG 2G0EA 1NG7A 3HRMA 4DSFA 3E01A 2OZUA 3OSVA 1ON1A 3HTUA 1QVGM 4BDZA 2E1ZA 1QQJA 4W5OA 5LFAA 1C6VX 5B1BH 3UB5A 3HDDA 1N8RO 3QICA 1W4SA 5HVQC 4DYRA 1S7EA 1LDJA 1DP3A 2P9LA 1XSVA 1UHFA 2EBIA 2YG8A 1MHNA 5F27A 2RDPA 2L9VA 3HGGA 2KL4A 5FFZA 1F21A 4IO9F 3WGGA 2W10A 5FGMA 2ATQA 3DXMA 3SDBA 4KA4A 3PQJA 5DK5A 3TTCA 1PU8A 2LNHB 3ROUA 4E7HA 3ZSOA 4HWIA 2VOPA 1O1WA 3VKIA 2E60A 3RWUA 1VQ9T 2LF7A 2O8EA 5AQSA 1VRTA 3CCLI 4XLNF 2P9UA 3CDLA 1D3YA 3SNNA 1FT9A 2STTA 4LLLA 1EIFA 5LY3A 4CC4B 3FMSA 4HNUA 4FSVA 2LKPA 1YO5C 5IT9E 1DU0A 1IGQA 2C06A 4O5VA 2ME0A 4LH5A 2UYTA 4RTYA 3V7SA 4R8HA 2ELHA 3D2FA 2IVPA 1PRLC 1RAGB 4FLTA 4PFPA 4M3EA 1U9NA 5EG2A 2KISA 3DJCA 3H1CA 4ZYDA 2QQ9A 4A3MJ 3VEXA 4K8XA 2QAZA 3BG6A 6AT1B 4FZXC 4I99C 2HYJA 4PKIA 1ILYA 4QVZA 4P1WA 1A0NB 1QZ5A 3META 4ZHRA 4AT1B 4Z88A 2QKKA 3RKWA 2QDLA 3JB9F 1OYXA 4KT5C 2Z0WA 4JX5A 2EVRA 3BC8A 1M1FA 3KHYA 5GMKm 2FXUA 1PD0A 3DFGA 1LDKB 3SWNB 3M0TA 1VQKI 3CCEQ 1RKTA 2QI2A 1RUOA 1Q9XA 1T6SA 4KMFA 2FVUA 1YI2N 1MBKA 1YITA 3BDUA 4J19A 2I8DA 4M7XA 4JBAA 2PZ1A 4FU6A 2LYCA 2FZCB 2LKXA 3S2DJ 3CUQC 2FMLA 3P1GA 5M1FA 2KT1A 1VFCA 2F5EA 2G8WA 1VQ6Q 3MK6A 1BI0A 1TUGB 2YRDA 1M2VB 1DTTA 1U3EM 1YQMA 2VGMA 3QZ9B 3S8PA 1ZBFA 2WV0A 3NFAA 1KLMA 1JLEA 5IP6A 1XQHA 2QYOA 1KFZA 1YJWQ 2YUPA 2BUDA 3IAYA 1XSDA 1BB9A 2DYRH 3GBQA 4AIKA 4I01A 2X1EA 3CCJN 3FX3A 3RRGA 1WHLA 2QEXQ 4J8OA 2MBFA 2HMIA 1IBMK 3CMEI 5CVIA 2QA4Q 4BAYA 4CZCA 2FMYA 4M9XA 2RO0A 1D5YA 1MMAA 1HU0A 3HI0A 4DV2K 2ECZA 1B4AA 3ZT2A 4B3XA 2ZXIA 1ZSZC 3WTVC 1RAEB 1RUWA 4EMGA 2EX3A 5CJ9A 4E89A 2FNPA 3W6JB 2QM3A 3OYJA 3FXKA 3BY5A 1U5SA 2E6NA 3ZFJA 3KK2A 4CJFA 1NGDA 3M9AA 3CMAN 3K4LA 1NMDA 2EQIA 3E5QA 4J01A 4QVDA 3CERA 3HP9A 4FIBA 1LW2A 3EUHA 3WTTC 4HYEA 4CERA 5EGOA 3TKYA 1E3MA 5J8FA 1U1TA 2E3HA 2PMHA 4OB3B 2OTJI 1Q86O 3I4MJ 2P0QA 3EH1A 2HQXA 1SD4A 3CQ8A 3HHHA 1OH8A 4M75G 4EP5A 3OR2C 3BG9A 1TAUA 2ZWHA 2IPQX 3THKA 4LGWA 2W85A 1Z21A 4WCEL 3SZPA 1XPXA 2WSCE 5GP9A 4BRPA 5J47A 2M02A 4FOIA 4L0ZB 4XQ3A 4C1NK 2IVWA 2LQKA 1ZLJA 2RHZA 3GXOA 1HJOA 3FZFA 2MLGA 5HNHA 1W5SA 2B7EA 3JCMc 1MDMA 2R57A 5IHKA 3PY8A 1BQMA 3DU5A 2VBWA 3ZYYX 1UDLA 2W40A 4NUBA 1SEUA 2OF7A 3R6OA 1OH6A 5DS9A 4E6KG 2MCNA 1NK0A 1IC8A 2M9UA 1STZA 1YHQQ 1T6DA 3C12A 1YIOA 3F9MA 1T39A 1WHJA 5E3OA 3KEQA 4AI4A 1R00A 2GBQA 4CYCA 8ATCB 3C7JA 3J7AO 5E20A 3HXMA 2EFNA 2XB0X 1Y56A 1OYIA 3M0RA 4F55A 1KLNA 2IIRA 1VQ6T 1K8AC 1MJBA 4C92D 4CH7A 1VQPA 1YITQ 4NQWA 4YOQA 2DK3A 4EMKA 1VQ7N 4YG2F 1EH8A 4OB1B 2L3SA 4L6V5 2V26A 1BIZA 3B6OA 2EQUA 4IUTA 3KP7A 3M5RA 1RDDA 1YAGA 1SS6A 1UTIA 2PZSA 3WTZA 4FWMA 1YTUA 3MEXA 4WXDA 2BW3B 3V9ZA 4DCHA 2XKOC 3KP5A 3SZGA 3FZMA 3HOYJ 3QQAA 3G71N 4DBHA 5BREA 4UY8O 3CD6I 2QG9B 4Y3OA 3QG1A 2XKOA 4PFOA 2P0WA 2QK9A 4AIDA 4B24A 1NLPC 2HNZA 1G59A 2MMPA 2Z1DA 3O6BB 1TZLA 3DXJF 2D0CA 5D4SA 2R7VA 4FT4A 3QO3A 5AQJA 2KR3A 1AOJA 5ADXA 1I1SA 2HBKA 4BR0A 3M54A 3F73A 2JSPA 4CJQA 5IOZA 2WUSA 4M3RA 1USTA 3K4KA 4EJUA 1X9MA 1BQNA 4QQ6A 3PO5A 2HL5C 3E9GA 3ZPLA 3S14J 1QVUA 2V51B 3FMQA 4HEA2 1R58A 1YWOA 1MH4A 1TNSA 1AZEA 5DD4A 3IRQA 2LQ8A 1TL3A 2E6ZA 3A0HC 2V7ZA 4DS5A 3SPZA 3KWGA 4A0YA 4LB5A 2HDCA 5C6SA 1TYQB 1FX7A 3MX2A 4IQ4A 2LH9A 3TDUC 1KVAA 4KAZA 1G99A 3OBYA 1E6HA 5K5OA 2L7MP 1X58A 3A5MC 5E8GA 4YIIA 1RLQC 4K41A 1PJRA 1YIJQ 3BG3A 3KCCA 4JJNK 1KU3A 3CCVT 1QQNA 3C6HA 1S9HA 4JKGA 5DD8A 1ON2A 2ZPGB 4B21A 2WAQA 4IWVA 4DR1K 1VZ0A 2PUKB 4JJDA 3PSFA 2R92J 4LFCK 2GF7A 3JTHA 1RGIA 1YIJT 2A5WA 3ID8A 3MKZA 1WN7A 2RNGA 3NFCA 1OJLA 1B59A 5FLXZ 1U4BA 4H0EA 2XSDC 4DNCA 2VB6A 2HYGD 4QCLA 4DA4A 2L2PA 3I4NJ 4A62A 2IBDA 2LQWA 3A5NC 3SHFA 3WE2A 5F0FA 1S6PA 3V9SA 1IG8A 2DL3A 2P51A 4HVJA 4H0XB 1K8AU 1TK5A 5DM6F 4TVRA 4GV6A 1AA7A 3BTIA 4ASNA 3LFUA 5L3EA 4Z02A 3CCJT 1YW7A 1TU0B 1WSUA 2MABA 4DTSA 2DFUA 1GOAA 4YORA 2K7LA 5EC7A 2KJCA 4OPAA 4YPHA 3HYFA 2RHYA 2FEIA 1JGSA 4PGGA 2WOMA 3G71I 1RT4A 1U3OA 4CCOA 3KP3A 1O7LA 1BR1A 2FG0A 2O8FA 1JLBA 2XAFA 2JA8J 4CJ5A 1JXOA 1A6QA 4XIUA 2GUPA 4K0KK 4NYFA 3VS7A 1VSJA 3CF5L 2IC3A 3FZVA 2K4BA 3JW4A 2MPXC 2P9SA 3DV8A 1YLFA 3O9SA 3NTKA 3FXRA 2F5TX 3J81E 4XRSG 4PLLA 3PO3J 4FETA 2AZVA 3CETA 2YNGA 1JI8A 1S3JA 2BVMA 2P5OA 4OIOF 4HDVA 4BEHB 3BZKA 2PN6A 2VG5A 4XH1A 3UT1A 2R5MA 4ID1A 1T3LA 2V1QA 3H9NA 2HYFA 3UE5A 1KG6A 5IYDJ 1ERDA 3CCLN 2YRVA 3MKDA 4BUGA 4IRIA 2CUFA 1MMGA 3RBBB 4D8KA 3VODA 1BI2A 2WAEA 3E9LA 1KQ8A 1RPWA 3TSWA 4OPJA 1A35A 3OY9A 3CQXA 3CCQT 1XQOA 2ASOA 4OKJA 4AIAA 4E1MA 3D2EA 2KRHA 2J7IA 5JLFA 1Q8IA 2KSSA 5DCMA 2ZAEA 2CP0A 4M75C 2CH4A 5C0MA 2ESWA 3OQ5A 2DM1A 2IS4A 1ZBSA 5BR8K 4XR6A 3EZWA 4J83A 3D7SB 2VKVA 4C8MA 3K1PA 3HP6A 1T2KA 3ZL7C 3O8VA 1OKRA 4ID5A 3F3XA 2BDPA 1ORNA 2EZHA 1FPQA 1Z9ZA 2N8GA 1UHCA 1V4RA 4U67L 1VQ9N 3P8BB 3CESA 2QXLA 2CKKA 4HA8A 1YQRA 2W42A 3MEDA 5K7HA 1MMNA 4L9TA 4KHPK 4XKBA 3LSJA 1R5HA 2FO0A 5GMKj 4IOCF 3TAFA 1K6OA 4G6DA 4IEEA 1JUPA 3Q0UA 3M4YA 1X9SA 3Q9SA 5CKTA 4F92B 2Q36A 2L3QA 3ZMSA 4FASD 3L2ZA 3CCSA 4KFBA 1WBDA 3VTIA 1BA0A 5I2MA 4DR2K 2HD0A 5CKEA 5M1NA 1RAAB 4DTPA 2RJEA 2ZPHB 5LJ3g 4XH4A 1JCFA 5EYRA 4XL9A 2E2OA 2EV0A 3VS6A 2DIGA 3N4PA 2RMOA 2X9DA 3MXJA 5T7BA 5IT9K 1I5ZA 2A61A 1KAZA 5KCOA 3BE3A 4J9EA 2Y69H 5DY9A 4FM0A 4PJMA 2YI1A 2ASMA 2KNBB 1Y6IA 1LW0A 1W1FA 3GTQJ 2WACA 4HXJA 3MN5A 1Y0MA 3CQTA 2VT2A 4CEQA 3E1SA 2DXBA 5FLVA 4DSLA 4BH9A 1QZEA 2IPOB 1IXCA 1OQYA 3LAJA 2W6LA 3CCMQ 2KBTA 2UXDK 5SZTA 1JO8A 3LH0A 2OBPA 3CC2Q 3DXKA 3BP8A 3MEVA 3DKXA 4AFUC 2FA5A 3OSFA 1NYGA 1ZG1A 2EYWA 1RTIA 4PFZA 1NK2P 3TSQA 2IVOA 1Q7YO 3O3GA 4CGHA 3LPTA 4WXCA 3VS3A 1GDTA 2XDVA 2O8CA 1BK2A 5LD2C 2EWNA 3L6QA 1YQLA 4FJHA 2Y4XA 4U7DA 1Y07A 3P38A 5JVHL 3RRHA 1NGBA 2V8IA 1R1UA 2DJIA 1QSSA 2O4IA 1GLCG 5CVRA 2A7YA 3ASOH 2NLUA 3SPYA 3MEWA 4QOZB 2OC6A 1KEAA 5FU7B 1O57A 3OMGA 1TUDA 3T1BA 3LZJA 2KRNA 3CWUA 3WQTA 2BIVA 3RKYA 4DQQA 2BE5F 1XSXA 4YOVA 1X3ZB 4QS7A 3B73A 3HFOA 3FBIB 5AYFA 2JN6A 4JZ3A 1MMSA 5AQWA 2M0MA 3PUFA 3VRZA 3CJRB 4LF5K 2LG4A 4O8UA 5LJ3e 1S72Q 4YOXA 5BN8A 1FTZA 1F9NA 1TW3A 4BD3A 4CRIA 4N9IA 1AU7A 1UA0A 4ETSA 3HGYA 4CFAA 5KCMA 2XKPA 1Z0XA 3VYRB 4L0YB 4BR5A 5CYMA 2AK5A 2CS3A 2FE3A 2FSNA 3CBMA 4NB5A 5KPZA 1WEIA 1D4XA 4F4KA 2ZNYA 1N77A 4IG3A 1P9QC 4M71A 2EQMA 4KIFA 4FQGA 3CF2A 4HCKA 1V4SA 4D5CA 3CWTA 1FEXA 1CF7B 2H1LA 2EFWA 3H0IA 4AFQC 1P92A 4L9VA 3LSTA 2FNAA 4PJOD 2FPDA 4PJNA 4BKXA 1N6AA 1JCEA 4B08A 2W00A 1POGA 5JLWA 2DE0X 3O1BA 2GFAA 5LRSA 2HB5A 2P4WA 1K4TA 1V5EA 2HOSA 8AT1B 1SSHA 4B1YB 4DBQA 3CZ6A 1OPKA 1B72B 2M16A 3R9PA 2GA2A 4CF8A 4AFSC 4DV3K 4QAGA 2EFOA 3DYAA 1C0GA 3DXMB 3NMUA 4DEYA 4RBOA 3LPUA 1R8OB 1FW6A 1A5XA 3A8LB 1MNEA 5ICEA 4Z0UA 5AQUA 4XKVA 2EFQA 4M7YA 3BR0A 4KGZB 4EJOA 4O5BA 2M0CA 3BF3A 3PMIA 6PAXA 2DVEA 3QFPA 5EEAA 4B9XA 4OO1J 2EA2A 2D0NA 3J7AP 5ICCA 1HDDC 3G4SA 1VSIA 1JJ8C 3KEOA 3VEWA 3GTMJ 3I0SA 1IXRC 4HSBA 1Y96A 2JHNA 4UVAA 1GLAG 2JA5J 1GT0C 5E84A 2EGAA 3S93A 1MZBA 5HL7L 3CXCA 4FWQA 2P9SB 2DZ9A 1ZRCA 1JLAA 3Q5FA 3A98A 1ITYA 1VQ5T 5KYYA 3MMYB 2E20A 1HC8A 2DLLA 2LNVA 4CJ3A 2M5WA 2VT3A 1RBTA 4U87A 2A6AA 3DRRA 2E19A 1T03A 1FOXA 3I64A 1NJIO 4XK4A 3TW6A 2RHIA 1Q81U 3H0DA 3ZCMA 3K70D 1U47A 1J54A 4DZPA 2L9SA 2E10A 1T8EA 1YS7A 3CYMA 4A3DJ 1W36C 2KZVA 2JM9A 4U0WA 4BUPA 1WRJA 3FB9A 2M8GX 4LK1F 5DLOA 4OMNA 2DX1A 5KE3A 2CGJA 1SEMA 2D8JA 1I8FA 4KH5A 3FSPA 3G1JA 1R0CB 1Q86U 4ZC3A 1BOAA 4HCCA 3L4IA 3I55Q 3FGUA 4FWKA 4L5EA 2XF7A 1XMQK 4FTHA 1CQTA 2Q3SA 4MLHA 3O2PE 1LAWA 3IHOA 4PL7A 1V4TA 3MD2A 1ZYQA 1WJEA 3EG9B 5GAN7 2YHYA 2I7PA 2VPRA 4CA0A 5GPAA 2OI3A 3LP3A 1IBLK 3BQZA 3BR6A 4CFDA 4CI6A 3LAKA 4H03B 3CXCM 2IGIA 3CXCS 1EXQA 2AQEA 4IUPA 4DF8A 2QQAA 3SCXA 5DV5A 3ZSRA 2LRQA 4KN4X 5TRDA 1N9RA 5LJ5j 2K79A 2M9HA 4KRTA 1VAZA 2JMWA 2DRKA 2YHBA 4NOYA 1X2NA 3F8BA 3BT9A 4CC3A 3F8MA 3HXLA 2HZDA 3O8HA 1XUPO 5A0DA 1FJLA 2W57A 1IDZA 5HCKA 4QS9A 2OTLI 5BRFA 2HHSA 4RLFA 2MF2A 3PIPF 2M7AA 1ETOA 1HNZK 5KN9A 1W2BP 4IOXA 4LFBK 3SMSA 1N27A 4LFAK 1C0UA 5K1YA 5BPDA 1M3QA 2HEQA 4MTEA 1S1TA 1NGIA 5A2QZ 3ZSYA 1YXQA 2HNYA 4KFCA 4CJWA 3AGKA 4FL9A 4LG3A 3ZQGA 5IP7J 2O8XA 4Q0BA 1W5CC 1NM1A 1WQ7A 4A4GA 4EJTA 4FPAA 1GHCA 2WC9A 2ZJPF 1E3OC 4LDWA 4JRKA 2O8KA 3GF2A 5FPNA 5C10A 1RR8C 5B1AH 2DI3A 4XM3A 4Y1DA 1IJWC 2D1KA 3QJYA 3ABKH 2RPIA 2O5RA 5FPEA 2I2LA 4CC2A 3ECOA 4E47A 3AG2H 3KETA 1TWBA 1H8KA 3ZGKA 4JKAA 4QPOA 1GCQA 4JHDA 1IHVA 3I5UA 5LMNK 4OIQF 3W6KB 5FKMA 4EM1A 1K0XA 3VQAA 3L4QA 1I0CA 3VS0A 2F4MB 3CPWP 1KC8C 4ZDPA 2AIRB 3ZSVA 3K2PA 4KH0B 2DTRA 4PNOA 1KVBA 2V4JC 2QVOA 3DKYA 4FZZA 2QDYB 3MAQA 2KXCA 2YKNA 3GG4A 3HTRA 4A63B 4JLIA 4NC8A 4BG9A 4M78G 2WBNA 5AQLA 3RCOA 4RB1A 1H9TA 4KITB 3NDKA 2GTDA 2HVIA 1IRGA 3LAMA 1FP2A 4OF1A 1K4SA 1DJ7B 3QJ6A 5HODA 3E2UA 2PTKA 3F0ZA 4AYBN 3SEZA 1OPCA 5HDKA 2AQFA 4KISA 3E0JB 5J8CA 3CCEI 1VQKQ 4KUMA 4DV0K 3R3LA 3WEEA 2DPNA 5GAOn 4ZJZA 3A01B 3KUFA 4W5NA 3QOPA 4GV9A 4C0ZA 3HVRA 4HNTA 5CIUA 4FX4A 4IOAL 3TAEA 3DQVC 1UFMA 4EJYA 3KLOA 2ID3A 4P96A 1QRYA 4DK9A 4F7ZA 2HWVA 4F7UA 3LM9A 4BL0B 4LF8K 2ATCB 4CK3A 1BR4A 1Y57A 2CP3A 4FLYA 5DLQE 3M07A 4FLXA 3L00A 3MKLA 4DR6K 3I56I 1Y1VJ 2Z5UA 1NGEA 4LLNA 4BR9A 4PJOA 3GL1A 3CEYA 2COZA 3U4LA 2ZCFB 3ENBA 3DLLL 4I6MA 2EHGA 1J9IA 2JVGA 1RCHA 1OYYA 4L5JA 3ASKA 2QBYB 2XRLA 2ZGYA 3JCMX 2JS0A 4OLAA 1KQJA 1M90C 2KTQA 2RQVA 5GAEP 4HBLA 2L4MA 3OYEA 1HNXK 1KQ1A 4JI3K 4BU2A 4CEOA 4V2GA 1BCOA 2YKMA 1WHHA 2K57A 1K9MU 3BJAA 4E4HA 3MWPA 5CQXA 2G8FA 1LWWA 2CV0A 3GZ5A 5HLGA 3HSFA 3JRDA 2X3WD 4DQ8A 1W2BA 4KHQA 1BIUA 2A42A 3QIPA 2V79A 1E4GT 1S7OA 2V6CA 3ZQIA 3OS1A 1U6GA 3NTIA 4RM3A 1TK0A 4H4MA 4ESRA 4RG8A 2XGDA 1ZH5A 3VERA 1LEBA 2CYYA 4MLEA 1SHFA 1T33A 2VBYA 2EQJA 2DRMA 4B9WA 3CJAA 4WWCA 1XCBA 3BQYA 4I02A 3I55I 2XPVA 1WHKA 5EXWA 4IHTA 1WJCA 2XASA 3AY9A 1HBXG 3A5ZB 3OH9A 2HQRA 4IEJA 5DCMB 2DA9A 4EM0B 4KBOA 4E1JA 3JRGA 3QYBA 2BBYA 1WSGA 3ONQA 2G6FX 3NF9A 2XHCA 1LWYA 3DAWA 3F21A 4JRPA 2MFZA 3GTJJ 2KRFA 2EFPA 3H3UA 1O3TA 2KDOA 2HQAA 1XGOA 4JKHA 2EYZA 4Y17A 1R22A 3JCMh 1NOZA 4EJVA 1RRJA 1W6XA 1QA6A 3TMOA 1HW2A 2AA4A 1RABB 3HYIA 4EIKA 2Q97A 5J1EA 3P4IA 1RDAA 2Z16A 1YI2T 2YUNA 3QPTA 2LOOA 3GYHX 2Z1IA 5K5RA 1X27A 1WVRA 2DIQA 1XWLA 2NRXA 2W84A 3ATUA 4CJVA 1LWEA 3V42A 2ESNA 4CBUA 3EFRA 2DA6A 3VGLA 4GV3A 5LHIA 2YS9A 4C92A 5CCAA 3JRCA 4Q47A 4XN3A 4FT8A 3A1PA 1NMNA 1X9JA 2M1HA 1XMXA 5JMVA 4JKDA 2JZ2A 3VA0A 3K6GA 2XAGA 5AZIA 5TKYA 3RDVA 3SJMA 4OMYA 4ZN1A 2L7FP 1WH7A 5IPAA 4XIDA 5AJ3K 4XK8E 3WODF 5FD6A 4WQ5A 1B92A 3SZ2A 5EEGA 3S41A 2AHQA 4R0KA 1M8MA 5A0GA 4GY5A 1W9HA 3AVCA 1NOYA 2OANA 2JA6J 2RREA 3N5BB 2R5YA 4BY6B 3M8JA 1M3BA 3AVFA 4A2BA 4CZKA 2D0AA 2VC1A 4J9IA 3P7NA 2RF0A 1KC8R 4CF2A 3MEGA 3CCUT 2K5IA 1RADB 1KD1R 2JHJA 5FW9A 4F16A 2F5DA 2LREA 2DFHA 1VQ9A 4X6AJ 1HYSA 1KAYA 4DF4A 1D1CA 4C92G 5GAGP 3H9GA 2UXXA 1IAWA 1LQ1A 3L0QA 2Y2ZA 1CLQA 2WA0A 1TL8A 2DXCA 2HOTA 4ELZC 3I56T 2B0LA 3OYMA 3BR1A 3DOKA 3FK7A 1WJRA 3AKZA 4WYBA 1JTXA 5D8LB 4NBQA 1JT6A 3V8KA 3BR2A 1TVRA 2AHJB 3E6CC 2BUPA 2OZSA 2UXBK 3M4GA 2DCEA 1A5WA 5J1UA 2JMCA 3U2RA 2E34A 4K43A 3ML6A 2JLEA 3TEEA 3GMEA 5D5WB 1LOJA 1H92A 4M7DG 3S3NA 2GELA 4CFCA 4M78E 3ZSWA 3ZT3A 5CE3A 2C0OA 1SVMA 4M7AG 3EG9A 1WPKA 2K27A 2KMUA 5AIPA 1FBUA 1BYMA 1JKQC 4IHSA 3FZHA 2PAVA 3OVNA 5HKCA 1OLTA 5FU6C 1SF9A 4KHWA 4Q5SF 4RKUE 1Q81R 2RI3A 4F7UG 2W48A 3BDLA 3E97A 3QERA 3KX2A 1JJ6C 1C0WA 1K8KA 3AARA 3TBIA <