3OYCA

Crystal structure of the prototype foamy virus (pfv) intasome in complex with magnesium and the insti pica
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
368
structure length
368
Chain Sequence
b'LDAELDQLLQGHYIKGYPKQYTYFLEDGKVKVSRPEGVKIIPPQSDRQKIVLQAHNLAHTGREATLLKIANLYWWPNMRKDVVKQLGRCQQCLITNASNKASGPILRPDRPQKPFDKFFIDYIGPLPPSQGYLYVLVVVDGMTGFTWLYPTKAPSTSATVKSLNVLTSIAIPKVIHSDQGAAFTSSTFAEWAKERGIHLEFSTPYHPQSSGKVERKNSDIKRLLTKLLVGRPTKWYDLLPVVQLALNNTYSPVLKYTPHQLLFGIDSNTPFANQDTLDLTREEELSLLQEIRTSLYHPSTPPASSRSWSPVVGQLVQERVARPASLRPRWHKPSTVLKVLNPRTVVILDHLGNNRTVSIDNLKPTSHQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PFV integrase
publication title Molecular mechanisms of retroviral integrase inhibition and the evolution of viral resistance.
pubmed doi rcsb
source organism Human spumaretrovirus
molecule tags Recombination,viral protein/dna
total genus 106
structure length 368
sequence length 368
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2010-09-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
A PF17921 Integrase_H2C2 Integrase zinc binding domain
A PF18103 SH3_11 Retroviral integrase C-terminal SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2300 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3oycA04
1.10.340.70 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Endonuclease III; domain 1 3oycA01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3oycA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3oycA03
4LY7A 3LWLA 3EAEA 3TARA 2HW3A 4CJQA 3KK2A 2X78A 2HVHA 1RBRA 4PA1A 1OZ3A 4F8RA 3P8HA 2P51A 3NH2A 3NGYA 2XY8A 3HK2A 3EYZA 5KRTA 4HVJA 1TKZA 2QKBA 4KHNA 5J2NA 1GOBA 2B5JA 4JRQA 4OLAA 3C4SA 2DAQA 3ZT4A 4E7KA 1TK5A 2G8KA 4CERA 2G8UA 1MHNA 4RG8A 1DTTA 3DYAA 3TAGA 4IDKA 3SUQA 2L8DA 2RJFA 1ASVA 4IBNA 1QSLA 1RTIA 3SV3A 2OPPA 3LZJA 3PV8A 4KHSA 1OI1A 3SQ4A 1JLCA 4FJ9A 3TWHA 2YHAA 1X9SA 3GOXA 1NKBA 3H6ZA 1D5AA 4DFKA 4Z4HA 1Q9YA 4N5SA 4DLEA 1X9MA 5KTQA 2DIGA 3SNNA 4CJFA 3ZSZA 4FLUA 3PO4A 4C8NA 3MP1A 3D45A 2HNZA 2XY5A 5CYMA 2JTFA 4KTQA 3NH1A 4II1A 3HP6A 3OS1A 4F2RA 1ZBUA 4A4GA 2JLEA 4CJ5A 4B3OA 3MECA 3AO4A 1QTMA 4OLBA 4N4IA 2DY4A 5HRNA 1JXBA 2HHSA 1BCOA 2BANA 4FJXA 3THVA 1UOCA 3DLRA 3CM5A 2M16A 3RMAA 4N47A 3DI6A 1IKVA 2B4JA 3LPUA 2D0BA 5FDLA 1LWCA 4CECA 4C5HA 1S1UA 4HCZA 2Y1JA 4BWJA 1HQEA 1BCMA 2VG7A 5HLFA 5KGXA 4FLYA 4EZ6A 4GMJB 2RI2A 3VQ5A 4CJUA 4I9QA 4MQ3A 2EQMA 1RBTA 4DSKA 3OQ5A 3QJ6A 4E89A 1VRTA 4AHTA 3CEYA 4YNQA 1RBVA 3OB9A 1C1AA 5IAYA 3DOLA 3B6OA 3TANA 1RTJA 4JLHA 4DFMA 1WJQA 2RHXA 3PMIA 2VWJA 4C8MA 3VQAA 3QEVA 3VA3A 3QBYA 2OZMA 1L3VA 1JLGA 3QO9A 3DRRA 1KVAA 1TK8A 3O4NA 4GY5A 4CK3A 4IG0A 5J39A 1CXQA 4GVMA 3QIPA 3M8SA 2XDPA 3ASKA 1DLOA 3F9KA 3UT1A 4KHYA 4PQUA 1REVA 5KH6A 4HUGA 4F4KA 2DIQA 3AVFA 3QETA 4NZGA 4KREA 1TGOA 3KK1A 2EQUA 1WSFA 1G5VA 4DTXA 3OYLA 3V1OA 5SWMA 4OPJA 4CEAA 4FLTA 4DFPA 2Z1JA 4FLVA 2KW4A 3EZ5A 2XHBA 1JLFA 1A5VA 1J5OA 3OYAA 3E9GA 2BKDN 3OYGA 1ITGA 3KLEA 4K8ZA 3FC3A 3L8BA 4M3WA 1RT5A 1G15A 1YT3A 4LD6A 4CK1A 1XNIA 3ASMA 3ZSXA 3G10A 4PL6A 1JLBA 1ZBHA 3LP0A 1S6QA 3ZSOA 4FJLA 1D9DA 4LSNA 4QW2A 3KUFA 3S3MA 4CJRA 4KFBA 4CEQA 3AO2A 4HUEA 3KIOA 4M3TA 5J26A 2R7YA 4NCGA 3HO1A 3LGLA 3RTVA 4ID1A 1J9AA 4KHUA 3MEWA 2CKKA 3SYZA 4M3RA 1JLEA 5FRNA 3LDSA 3BGRA 4Z4IA 5DMRA 4FK2A 1T03A 5HRPA 2RI3A 3MEUA 4BE1A 1RT1A 1SKRA 3K2PA 2KFNA 2IG0A 4YFUA 1TKDA 3TAMA 3V6DA 4DSIA 2HNYA 2VWKA 1LAVA 4FJGA 3ZSRA 4IFVA 2P5GA 4DTUA 4FJIA 3KTQA 1UA0A 4DU3A 1VSJA 4N4HA 2RKIA 3SQ1A 1FXXA 1HNVA 4BACA 4B9TA 3KD5E 4TSXA 1GOCA 4J2AA 3DLGA 1NK0A 3HSTB 5C0MA 1HYVA 2EQKA 3VQQA 2PQWA 3TAPA 2RJCA 4IUUA 3RMBA 4PUOA 4CIFA 4F3TA 4CF0A 4BDZA 1S6PA 1XI1A 2E5QA 3O8VA 3ITHA 2F5KA 1JL2A 4OKKA 4ICLA 5J2PA 1RT3A 1FKPA 4M42A 4AHSA 1ASUA 2Z1HA 4M45A 3OYKA 4PWDA 4CJTA 3LGFA 3L2RA 2IGIA 3Q1JA 4DFJA 1U04A 3ZCMA 5CY4A 3O3HA 5I42A 2XY6A 3P1GA 2M0OA 4B9UA 4KTZA 3NTKA 2GFUA 4FJHA 2X4XA 4CFCA 4FZZA 3VQPA 3M9QA 3OYMA 4CJWA 1N5YA 2PZSA 2OYQA 5HRRA 2KQ2A 1RILA 1KFSA 3VQ6A 3OYHA 1FK9A 2GFAA 1B9FA 3LX7A 2Z1IA 4EP5A 3K59A 4N56A 1KLMA 5DK5A 3DLBA 4PLLA 3SQ2A 2E6LA 1SKWA 2YNFA 3CQ8A 3BDPA 3NFAA 1TL1A 3O3FA 3RR8A 2G8FA 4CFAA 3PX6A 1IG9A 1HYSA 3DRPA 4HUFA 4Z4CA 4E19A 3O3GA 2W42A 1EX4A 2F96A 1WJRA 1Z25A 3HPOA 3IS9A 3TAEA 3C6TA 4WE1A 3SCXA 4EZ9A 3I0RA 2YV0X 2FC0A 2A1RA 3LYIA 4F3OA 3VQCA 4DSLA 1JL1A 4IUTA 4AHVA 4E0DA 4OVLA 2A1SA 1SL0A 3FLGA 3ZT0A 2ZQBA 3KK3A 1LWFA 4FM2A 4HHTA 2RHZA 2YKNA 3QEXA 3MEAA 2QKKA 3NTHA 3AO5A 4FZYA 2G3RA 1QQCA 4Z0UA 1YTUA 3QERA 3HVRA 1TKXA 3P8DA 3QNOA 3AVMA 3RRGA 2X74A 1NKEA 3VQEA 3MEGA 2HHWA 4CGFA 3MXMA 1RBUA 2R58A 3V9ZA 4DU1A 3K5MA 2HHXA 2RPIA 4M3ZA 3OS2A 3SI6A 3OMCA 2Z1GA 2VG6A 4Z4GA 1XC9A 1MU2A 1Q8IA 2GBZA 4C5GA 3ULDA 2XK0A 3LZIA 4CEFA 2HHVA 4M3YA 2EFIA 3HT3A 1WN7A 1BL3A 3SD4A 4CFDA 4DS4A 4LSLA 3ZSVA 3HL8A 1NOZA 2EX3A 3AVGA 2WOMA 3MEDA 4J2DA 2ITGA 4J2EA 2F8SA 1QS4A 3AVJA 2I5JA 1U4BA 5C25A 4FJNA 1C0UA 3AV9A 2RJDA 3L2WA 4N4GA 4A4HA 5HBMA 4DTOA 2YNHA 2BE2A 2WACA 1X1PA 4DF8A 1WAFA 5KI6A 4O5BA 4DTNA 1IO2A 5HP1A 3ZSWA 3K57A 3AVHA 2P1JA 3V4IA 1U49A 2G8HA 4FM1A 3WNGA 1KRPA 1C1BA 1Z26A 3KLHA 4FCYA 1NJZA 5J2QA 3KLIA 1SSFA 1VSLA 1S1XA 1XHZA 3AVKA 3KKRA 1T8EA 4CGHA 2DFHA 1WSIA 1SL2A 3T1AA 4EDUA 3P83D 3AA3A 3OYJA 3KJVA 4M3XA 2YRVA 3E01A 1C6VA 4FM0A 1KTQA 1HJRA 3DB4A 1JKHA 1RI0A 3NF6A 4F2SA 3ZEHA 3NAEA 1RCHA 4QVZA 3HM9A 4BD3A 4CF9A 4NCAA 2DFFA 3V9SA 3M8QA 1NK5A 1KCFA 5C42A 3NF9A 4FZXC 1SL1A 4DTMA 4B9WA 4QOZB 4IG3A 1Q9XA 3VA0A 4C5IA 1LAWA 1VSKA 1S1TA 4BWMA 2O4IA 2FHDA 4FU6A 3L2QA 1NJYA 5HROA 4BE2A 4HCCA 3VQDA 1NOYA 3OYDA 1RT4A 3S3OA 3RMDA 1RTDA 4CGGA 3L2UA 2RJEA 5KCHA 2EQJA 3IG1A 1RDAA 3E9FA 3UWNA 1O1WA 3VQ8A 3LANA 4CGDA 5J1EA 3DOKA 5D6WA 2IOCA 1D9FA 2RF2A 4CJSA 3LWMA 1VSMA 1R0AA 1CXUA 2XY7A 3C6UA 1RBSA 1U45A 1NK6A 1SUQA 2FBVA 2EHGA 3U3YA 3MP8A 1S1VA 3DM2A 3AO1A 3DMJA 3LP2A 2QK9A 3S6WA 3SUPA 4KB1A 3ZT1A 1ZBFA 3OYBA 4FLXA 5FRMA 4I2PA 2G8VA 2RN2A 1LV5A 2D9TA 1KVBA 1I3AA 3G0ZA 2HHUA 5CZ2A 2DTUA 3HYFA 1HYZA 4EP4A 1HRHA 4CIEA 2PY5A 1WAJA 3TABA 3NCIA 1KVCA 3WNHA 3LAMA 4B8AB 4B9MA 1EXQA 3TAQA 3LH0A 4Q5WA 4W5TA 3P5JA 3OJUA 4KI6A 3OYCA 1I39A 3NGIA 3ME9A 3UIQA 1TV6A 3PX0A 2YNIA 2KZZA 3NDKA 4E3SA 1QSSA 4Z4FA 4Y1CA 5KCOA 1TL3A 4CHOA 4J2BA 1A5WA 4HCBA 1WNSA 4L59A 3MO8A 1CZBA 3QLHA 4KRFA 2RI5A 3AA2A 3HPHA 3KLFA 1S1WA 3V81A 4B9VA 2JZ2A 2GF7A 1RT6A 1YTAA 4CJVA 2HVIA 2YHBA 1L3UA 4FYDA 1NK8A 3HVTA 3HXMA 3PO5A 1VSFA 4OPKA 1BI4A 1NK9A 2D5RA 3S3NA 1H3ZA 1WJSA 4CGJA 4RG2A 4KV8A 3ZT3A 4LH5A 1IKXA 4I9LA 3CFPA 5M9OA 4FL6A 2X6NA 1UA1A 1BI4B 3T19A 3V1QA 4PLIA 3T3FA 4CJKA 4AHRA 1TK0A 2L89A 2KFZA 4O44A 4NCBA 2ZD1A 5JS2A 3FFIA 1WGSA 4FK4A 4CE9A 2QQSA 4CGIA 3NH0A 3QNNA 2LCCA 3AVBA 3VN5A 1A5XA 3OJSA 4CHNA 3F73A 2LDMA 4NS5A 2WONA 3IRXA 4E1MA 2P5OA 5I3UA 2X4WA 1EKEA 4O0JA 1SV5A 4GW6A 1WSGA 4X34A 1TVRA 4O4GA 4CIGA 3AVNA 4B9XA 4DQQA 1HQUA 3M8RA 1TAUA 4H8KA 4DF4A 1VRUA 3DRSA 3QINA 3L3VA 3PY8A 4FW2A 2P0KA 4LH4A 4OKJA 2BIVA 4O55A 3SQ0A 5IN1A 4W5OA 4FJMA 1C1CA 1ZBLA 4KAZA 2HHQA 3VQ7A 3QEWA 4MFBA 2GV9A 2R57A 3KLGA 3SPYA 2LTOA 3M8PA 4KPYA 4JS4A 4A4EA 4DTPA 2D0AA 1KHCA 1UAXA 4FK0A 3TR8A 3U3GA 4RW4A 5FROA 5CYQA 2LSNA 1U48A 3AA5X 4RW9A 2XRIA 1T7PA 1B92A 4IKFA 4CJ4A 4DSEA 1BQNA 1BISA 4UC4A 1NK4A 3ISNC 4DSJA 1JLAA 2B8AA 4OGEA 4RW7A 3ZSQA 2X35A 4CEOA 5SZTA 2KTQA 2RHIA 1OYXA 4B9SA 4Q0BA 3CFOA 3MEEA 4DTRA 1CLQA 4ZHRA 2G8WA 2OZSA 4FW1A 4CCHA 3SPZA 3F70A 2HHTA 3OYEA 2IS3A 1W0HA 4FJKA 4CEEA 3C94A 3U6FA 3META 1LW0A 1VK0A 3PUFA 1RNHA 4DG1A 3EY1A 1RDBA 4DS5A 4A4FA 4FLWA 2MWOA 3OYFA 4Z02A 4CEZA 1TAQA 4OKEA 4M3UA 3OA6A 4HTUA 3NNQA 2O4GA 2ZE2A 4CJLA 1RT2A 1UWBA 1NJWA 3NTIA 3O4QA 2LVMA 3DLEA 5HRSA 3AVAA 1BIZA 3V9XA 4OVAA 3JSMA 4CF2A 3S9HA 2X6SA 4IFYA 3L42A 4CFBA 4ELVA 3SUOA 2RHYA 1NKCA 4ZTJA 2FBXA 1N6QA 3D0PA 3PX4A 3V1RA 2BGGA 4W5NA 4DU4A 4BDYA 3VQBA 1D8YA 1N27A 3AO3A 5E41A 4AILC 3WNEA 5JS1A 5K14A 4CHZA 4DQPA 4JS5A 1QSYA 2HNDA 1L5UA 1QHTA 2AJQA 1EP4A 2K3XA 3NF7A 3DB3A 3MEVA 3VQ4A 4NYNA 4CF1A 1X9WA 4B8CA 2OPQA 3B6PA 3PFSA 3AVLA 3H8ZA 3I8DA 2PYJA 2R5MA 2JGUA 2NUBA 3C95A 4KO0A 3RWUA 4B08A 3DLHA 4E7JA 4W5QA 3ZT2A 3H08A 4IUPA 2R5AA 3WNFA 4O0IA 5D6YA 3MXJA 1NK7A 4CJ3A 3AA4A 1DTQA 4FJ8A 2OA8A 3OYIA 1J53A 3QEIA 1OZ2A 1TKTA 2MWPA 3CYMA 3K5OA 1HPZA 3FDRA 1K6YA 5T7BA 4CF8A 2VYTA 1VSIA 3QEPA 2IAJA 3SV4A 4ELUA 4CHQA 2VG5A 1W9HA 1IKWA 4KKOA 1RDDA 2QQRA 1RT7A 2HQXA 4N41A 4QQ6A 4JRPA 1IKYA 2M1HA 4AHUA 4FJ5A 2PYLA 2HQEA 1WSEA 1KFDA 3DLMA 4C5EA 1XHXA 1EETA 3PMTA 4M41A 3MAQA 1C0TA 3K5NA 3IAYA 1LWEA 2FBYA 3RR7A 2RHUA 2X4YA 3ALYA 3QKJA 4E7HA 4KI4A 4DQSA 4KB0A 4QCLA 4ELTA 2RO0A 3L3UA 1ZYQA 1CZ9A 2LRQA 2BDPA 3I0SA 4KHQA 4IUVA 1FKOA 3DLKA 1F21A 4UQGA 4DQIA 3PNWC 4FJJA 1YVUA 1C0MA 3SZ2A 1S5JA 2ATQA 4CHYA 4R5PA 3QESA 4CEBA 3V9WA 1B9DA 4Q5VA 3OMGA 4ID5A 4N76A 3AVCA 3AVIA 2D0CA 4KTWA 4IUQA 5D6XA 3TI0A 1RTHA 4B9LA 4DMNA 3LAKA 1ZBIA 3FEOA 1QE1A 4CHPA 4DQRA 4E1NA 3LALA 4C8KA 2Q3SA 3HPGA 3A2FA 3CG7A 1T05A 4CRIA 3SJJA 4QAGA 2OPSA 1BGXT 5D3GA 3NGZA 5KGWA 2O4XA 2K3YA 5KRSA 1S9GA 4BE0A 2E6MA 3RRHA 3NBPA 2Y1IA 4PY5A 1WLJA 3NF8A 4ZTFA 4CJPA 1L3TA 1S9EA 5KE3A 4BDPA 1U47A 4FLZA 2O4XB 4DLGA 4DWIA 1HMVA 2L3RA 3QIOA 4KHWA 3LPTA 4E7LA 4I2QA 2ETJA 4E7IA 4AHCA 1J54A 1LW2A 3LLRA 4DTJA 1ASWA 1KSPA 5KE2A 4DSFA 2F8TA 4C8OA 3QIIA 4CK2A 2E6NA 3HP9A 5C24A 1WSHA 3OS0A 5C6SA 3OVNA 2XO7A 4QQGA 3LP1A 3CFRA 1Y97A 5EU7A 5CZ1A 2BUDA 3K5LA 2YNGA 4RW6A 3JYTA 3RMCA 1GOAA 2B6AA 4I7FA 5J2MA 4FVMA 3KD1E 3MXIA 3OY9A 4FXDA 1BQMA 1BIUA 3V9UA 2FBTA 1VSDA 1BHLA 2HB5A 4K8XA 4DTSA 1HNIA 3NHGA 3MP6A 1KLNA 2OPRA 4XIUA 4OGCA 1JXEA 3LP3A 3BDLA 1WSJA 3TAFA 4AH9A 2KZMA 1L3SA 4CJEA 4LD0A 3NE6A 4W5RA 2E4LA 4Y1DA 4FJ7A 1NJXA 2EKOA 4H4MA 3KKSA 1XWLA 2DFEA 2QXFA 4OJRA 3HJFA 2YKMA 4Z4EA 2G8IA 4CEDA 4RW8A 3VQ9A 4CESA 4L8RB 1JLQA 1SKSA 1RDCA 4IURA 5CIUA 4C8LA 4QQDA 1VSEA 1VSHA 1IH7A 2IDOA 2IC3A 2HMIA 4H4OA 3CM6A 2GUIA 3SUNA 4B9NA 2NLUA 3K58A 4NYFA 3ZSYA 3OYNA 4G1QA 3L2VA
chains in the Genus database with same CATH superfamily
3ABLH 4LY7A 4FWOA 3MN6A 1BKBA 4HNUA 4CJQA 5IOZA 2M51A 1N39A 4YIRX 2ZJRL 5E8GA 2M2EA 3JAMO 4F8RA 3JTHA 4DR3K 2A36A 3NGYA 2LLKA 3RVCA 4HVJA 4GVEA 3QPSA 3ZQHA 1BW5A 4HW0A 3ZT4A 2LVSA 2OU2A 1N5ZA 4AC0A 1NK2P 3MWPA 2G8UA 2E8AA 3BZ6A 2R7UA 4M4ZA 1DTTA 5AQTA 4OP0A 3SUQA 1RAGB 4OIOF 1ASVA 1QSLA 2FU4A 1GCQC 1KC8R 3ABMH 1J5YA 2BXZA 2DOFA 1TW3A 4KHSA 1CGPA 1MH4A 1OI1A 1WQ2A 3I54A 1IGNA 3AGRA 5C3EJ 1ZKGA 4ENNA 4FJ9A 5DV5A 4JOMA 3VYTB 5CQXA 3SAFA 1VFCA 4IOCL 3KZYA 2XC7A 1Q9YA 2O8CB 3H5AA 3KFWX 4Y3OA 3WG7H 1HD3A 4BRMA 4LF6K 3A02A 2KZGA 5GMKl 1X9MA 4YELA 3IMXA 2A3LA 4M77C 4NQWA 1X3ZB 3V8LA 1FOYA 4QVDA 3ZMTA 4RLQA 3GXOA 2LZ6B 4LG0B 4FLUA 3PJRA 4D5CA 2HNZA 4KIFA 1Z7UA 5CYMA 5DDGA 3JSOA 2QF7A 2KZVA 3HP6A 2VC0A 3BG7A 1TYQB 1JO8A 1DPRA 4A4GA 2JLEA 2NUZA 2JUGA 2HZYA 5GIOA 4B3OA 1XDSA 4RS8A 2JM9A 1E17A 1IDZA 1QTMA 4IFEA 2BY2A 2CS3A 3CWAA 4NXNK 4OU0A 4XONA 2DY4A 1QQOA 1JXBA 1OKRA 4A2UA 1S29A 2XSJC 2DI3A 2WFBA 3GTGJ 3CM5A 1K0XA 3ZQFA 4RTZA 2A5YB 3QICA 4C0GA 2QWOA 1VA7A 4FYWB 2E12A 5AQXA 3PVLA 1LWCA 4KGZB 4CECA 3TW7A 4C5HA 3D7EO 4DGWB 4HCZA 4JI5K 1GUUA 2MA3A 3G4SN 1ETXA 1Q1HA 2HOTA 5IP9J 1HQEA 1RR8C 3I55A 5F08A 5BNGA 1BCMA 3GP8A 4U88A 2IS4A 2K9NA 3PIPA 5HLFA 2KRSA 1W1FA 1JBMA 4CHUA 2HKNA 3ZX2A 1W2BA 2E7XA 2FUG2 1GLDG 2DT7B 2Z2SB 4DW6A 1EV7A 4DV1K 4I9QA 3CMAI 4KT5C 3KP6A 4A5NA 1B3QA 1Q1VA 1EH6A 3ATUA 5LJ5e 1U5TA 1J9IA 4E89A 3BTLA 2GIVA 1T56A 4NHJA 5KPRA 1RPWA 3CEYA 3OB9A 1C1AA 3VYSB 2LKPA 3BROA 4F04B 4HVUA 3BTIA 1ATNA 3B6OA 4WQ5C 1KG6A 4JLHA 2O9VA 4KRTA 1XC3A 5E26A 1ZR2A 4MZPA 2EZIA 2BHZA 3PIPF 4C8MA 1EA3A 2LJ0A 1ORNA 3SK3A 3VQAA 3VA3A 4ILGB 3PQKA 3CMEI 2A61A 1NGBA 3F3XA 3S1RJ 1YQRA 3QO9A 3DRRA 3OW2P 4K42A 2OAUA 5JLWA 3E2UA 4FOIA 4C8QF 4CZZA 2ME6A 2HXOA 5H2FC 3AL0B 3TL4X 5J39A 1DP7P 1K8AO 3CC4I 5BS6A 3QIPA 2J05A 1RRSA 2LDUA 4BQOA 4PQUA 2IS2A 1REVA 5KH6A 3AVFA 4C0DB 2KKZA 3QETA 1IGUA 1SVMA 3BY7A 4HG2A 3CMAT 2K2VA 4DTXA 2E36A 1MWMA 4CEAA 3ZMSA 3J7YP 1X2MA 2EIFA 2NXNB 2XHBA 2YG9A 4Q5SF 1J5OA 1BIAA 3OYAA 3E9GA 2E7WA 2M8GX 4YEJA 1GLJO 5CQEA 4K8ZA 1ZLMA 4M3WA 4KH5A 1YIOA 3DPLC 3CMET 2W03A 1T38A 2EA2A 1RT5A 2M0MA 2YUOA 2V6CA 4C0ZA 1Q86O 5DUKA 1PSEA 2D8JA 2Q8KA 5IHKA 1P2FA 2WV1A 3ZSXA 1GXIE 5KNLA 4XOPA 3CBMA 3VF6A 3QG1A 3K70C 4OMZA 4PL6A 1JLBA 3HFOA 1HA8A 3CC4T 2QA4A 4AM6A 3LSKA 2K40A 1D9DA 3J81K 5K5QA 3S3MA 1YF5L 4QKUA 3AO2A 5GAMg 1X58A 2XF5A 1GLLO 1I5OB 5DM7R 4B9QA 5E1XA 3CCRI 5FD6A 4NOYA 3E9PA 3RPUD 2UXBK 4YRVA 1J9AA 5C10A 3BJAA 3SYZA 2YX7A 3TDZC 4X1VA 1Z21A 1VQKA 4M3RA 3AFHA 4XORA 3S16J 3G6EA 3FLCO 5JHUA 1BI3A 2CUDA 4Z4IA 1AKHA 2V4JC 2K2MA 4FK2A 1T03A 1QLYA 2EJ9A 3MEUA 1RT1A 2QSGX 4JI8K 2HWVA 1OX9A 2M30A 4M3GA 1T0FA 1KQJA 3RSEA 1WEIA 3LFKA 2IG0A 5IT9O 1FOWA 3V6DA 3N4PA 2C0OA 1NJIU 2ISZA 5LGNA 3AKZA 1KJWA 1VQ6I 1NBWA 2GUPA 4FJGA 3DWLE 5D6EA 1P4AA 4BQQA 2GWJA 1X69A 4XQ3A 1KG1A 3EHRA 3LSIA 2Y4YA 1QVGM 1TLHB 1U9OA 2R7VA 4WCGA 1F36A 3O9UA 4P55A 3SQ1A 4P5NA 1XMXA 1D3YA 3K9KA 1FZPB 4CZMA 1FXXA 4GV9A 2XAGA 4ITVA 3CCRT 4NXMK 2COBA 4B9TA 2V9KA 2K4BA 3VGMA 2MC3A 2HFHA 1RNLA 4LB5A 3HSTB 4BQLA 2EQKA 1TU0B 3VQQA 3HHGA 3TAPA 1USTA 3WTZA 4HX7A 1XI1A 3T1BA 2CYYA 1QO0D 4CSWA 2HSEB 3M07A 5EG0A 4ZN3A 1RC9A 2XAUA 2KK4A 4ICLA 1ZSGA 1RT3A 2F4VK 3J7ZO 3HBTA 4AHSA 4XTWA 1ASUA 1VQ6T 1JUSA 2Z1HA 4S04A 5EY4A 4I6ZA 1RUNA 4PWDA 4CJTA 3IV5A 1YJ9T 2DLLA 2ED0A 2GBQA 2M4KA 5E84A 2EGAA 4DFJA 5GAOl 2R0QC 3ZCMA 4EJTA 2LJ1A 1RADB 1XGMA 3K2AA 3M57A 4N4OB 1RAFB 3ENOA 2M0OA 1XN7A 3B02A 2GWRA 2RD1A 2GFUA 1IJWC 4FJHA 3WGHA 4XU0A 2PTKA 3EG0A 4CFCA 4FZZA 4ASNA 2PZSA 4LFUA 3H41A 3CJ7A 1RILA 1UJ0A 1WXUA 4JKEA 4NBQA 1QCOA 2GFAA 3CCEI 1OYWA 3HGYA 3LX7A 2VKEA 4EP5A 3LQQA 2A37A 4ZYAA 4DR5K 2PVDB 4PLLA 2VL8A 3GFIA 2E6LA 2O03A 3QU3A 3D4VA 3QJYA 4WFNL 4FTHA 2M9HA 2V1NA 2F1LA 3VV0A 2YSRA 4J9BA 1IG9A 3U9DA 2WAQN 3BP8A 3MWMA 5CK9A 5M5YJ 3CCQA 2Q0UA 4Z4CA 1NGJA 1RACB 1RIOH 4O8UA 4C0FA 1Y7XA 2JMAA 1WJRA 3IS9A 3HRUA 1U9NA 3GZ5A 3CD6N 4HV6A 5BPLA 3SCXA 4PJOD 2ETHA 1E3MA 4ZGEB 3HOSA 2FC0A 5F1RA 4C2UA 2PMHA 1KFZA 2NVQJ 2XMFA 3TW6A 1WI9A 3KP2A 4GCVA 3CCUA 1IBMK 4CCLA 1Q86U 1SZ2A 4OVLA 3ZEUB 5IT3A 2P9PA 2ZXWH 1XGSA 2DZCA 3LDLA 3WHBA 3RZDJ 3T1HK 2JN6A 2MPXC 3CCET 3UNGC 2EJRA 3R6MA 2QKKA 5MLCQ 4EGYA 3DEEA 5E8IA 4HTLA 3U1KA 1K6OA 3P8DA 1KXPA 1OOTA 1G2BA 3HHTB 3OTOK 1YWPA 1RUOA 3R3LA 1R0CB 5GAGP 4J9HA 1DIZA 1NKEA 4YOWA 3VQEA 2DDAA 5AYFA 1KU3A 3L2CA 2QQ8A 4M7AB 2WAFA 5JVTA 3DFGA 5GAHP 4XIDA 1QVUA 5LJ5j 4M3ZA 2FOWA 3K4LA 1NJIR 3K9TA 3CCMI 3OMCA 5AIPA 2Z1GA 3CXCM 3WQUA 2BVLA 1MPGA 5HDNA 3F6OA 2VG6A 3FWEA 3J80O 3KETA 5JMVA 1VQ5N 1XC9A 3GNFB 1Q8IA 1OH6A 1I5ZA 1VQMN 3BF1A 5A0LA 1SD6A 2D0OA 2MMPA 2RDPA 2XK0A 2HEQA 2RB6A 4LNPA 3WXKA 3FZKA 1BJAA 4KN7X 5CVJA 2D0NA 3OA9A 3UPUA 2HHVA 4XSZF 1X1BA 2LRDA 3P9KA 2OTLI 2CH0A 4CCJA 1BL3A 4FYVB 3FHGA 1LJ9A 3ZQGA 2R5ZB 2WWYA 2W1OA 1NOZA 2BZXA 3FM3A 2RAEA 2O8DA 1NGAA 4J2DA 2PUKB 3EH2A 4EVIA 2KFDA 1U4BA 4FJNA 1TZLA 2RJDA 3O5BA 2FOKA 3RYRA 2KQWA 1P7JA 3CUQA 3RJPA 2YJEA 2YNHA 2WACA 5A2QZ 3PVQA 4AIKA 2Z99A 2ABKA 2GTOA 1WAFA 2CGKA 1VQPA 2JA2A 4BR0A 1IO2A 3I0WA 3GFJA 1WI7A 4JX6A 3H0IA 2ATCB 2V7FA 1DJ7B 3WVDB 4GNIA 5C15A 2G7HA 3CCMT 1NTCA 4M7DD 4BG9A 2DK8A 3PIPL 3WNGA 1D8KA 5GTIC 1C1BA 2ZMEB 4XTYA 2OF7A 1W7PD 3KKRA 3CMYA 4CGHA 5A2QO 2DFHA 4RAFA 3CC2T 1XQSC 1GFDA 4Y15A 1SL2A 1S3XA 3M3YJ 5M3MJ 4RB3C 2L0AA 4GXOA 4LDYA 1XGNA 3M0RA 2MYSA 4CZGA 2V9VA 2OTLT 5DD8A 3OYJA 4CI6A 2JWKA 1Q82C 3QPTA 4M3XA 3E01A 3DPUA 4M78C 2A07F 2WY8Q 1RI0A 3NF6A 1IV8A 5FU7C 4F2SA 4ZYHA 1TG0A 3Q0UA 4K11A 4R8HA 2KIFA 5DTDA 2YUPA 3HKSA 5FKKA 4Z2YA 3CCVN 3QRFF 3QZ5B 2KIMA 4BD3A 1K8AR 2XF7A 3PFIA 5HVQC 4B1WB 2K9SA 5AQSA 3NF9A 2NRVA 4I02A 2ZF5O 2JOYA 4ZYDA 1SL1A 3CUOA 5TISC 4QOZB 2MLGA 1XMKA 1BC8C 3FE1A 1WQ7A 1OVYA 4LIUA 2BZ8A 4RMNA 3JCMJ 1L3LA 3AHUA 5J3BA 2HXIA 4ZYEA 1UG1A 2X51A 3EG2A 1VSKA 3K4MA 2D5VA 1WJCA 1HSTA 1ZC6A 2X4HA 4MDXA 2DLPA 2VYPA 5IYDJ 2FHDA 3L2QA 3GMEA 2M45A 5HROA 2E6ZA 2OANA 1M3AA 4F91B 4HCCA 1YOVB 4H0PA 3S3OA 1DGWY 3SQNA 1R6RA 4ENKA 4NO7A 4H5VA 2E34A 2Y4XA 4M75D 5F2RA 4YDUA 5KCHA 1E3HA 3E9FA 2QXLA 4R1HA 3VQ8A 2DO7A 1P90A 1Q86R 1D3BA 2DVJA 3WXLA 4OX9K 2IOCA 1WLPB 2QSFX 2RF2A 4KJZA 4LD9K 1R0AA 1CXUA 5LJ5g 2CSQA 3C6UA 1IV6A 3CDHA 4IF4A 2P81A 2NWMA 1PU7A 3FXKA 2EHGA 2ECBA 3P4IA 3U3YA 4AFQC 2N8GA 1JI8A 3AO1A 3DM2A 2QLZA 4A62A 4HLYA 1IGQA 3FRNA 4FLXA 2UXNA 2DXIA 2DCEA 4HLXA 4PJLA 4F92B 1OPCA 5GAEP 2QGUA 1I0CA 2FZKB 4A57A 4FWLA 3RKWA 5CKDA 2O5RA 4CCOA 1QVGP 1UHWA 3SMPA 3MDQA 4IRGA 4EIKA 5E18F 1QPMA 3OSGA 2PY5A 4W1UA 4DR4K 1KVCA 3WNHA 1CKAA 5F64A 2KIUA 5KYYA 4HZFA 1NWKA 3TAQA 4LC9B 3TOAA 4W5TA 2PVGB 3JCMc 2BTTA 2VKNA 4GDFA 2CP6A 3WU0A 1QVGS 1PSFA 3OJUA 5K7HA 3ME9A 2CFOA 1KD1U 1TV6A 1WUAA 2YNIA 2HD0A 1VHXA 1WZ2A 2JUCA 1MIJA 2YUNA 5LHIA 4C1NI 3VDXA 1CSKA 5C4JJ 4FT2A 4MZTA 1CZBA 4WWCA 1YX3A 3QYFA 4Q4ZF 3ML6A 2QK0A 1FEXA 2V7YA 4C30A 4ILJA 1RKTA 3KLFA 4B9VA 4LK1F 3N5NX 2JZ2A 2O31A 2E35A 1RT6A 4E6KG 2K5IA 1YTAA 3C0BA 2Q0OA 3HVTA 3PO5A 1K9AA 3RPUA 4AIAA 3UF4A 2CGLA 3A98A 4MZMA 4RG2A 3ZT3A 3KTUA 1O57A 3N0UA 3H0DA 3WT0A 4BKXA 1ZRFA 3BDUA 5L3FA 5J6XA 3A8YA 1QWFA 2UXDK 4XLEA 2RQVA 4DV6K 3RSNA 4NCBA 2ZPHB 1NGFA 1DGKN 5JS2A 3FFIA 2JPCA 4C8QC 1WGSA 4FK4A 3O9QA 2C0TA 4CE9A 3NH0A 1IUFA 1Q82U 4PHTX 2IPQX 1N32K 4EA4A 3P31A 1TOVA 4IZ9A 3FMRA 1N25A 2CW8A 4BJ5C 2L2PA 2CP0A 1YHQA 4JZ3A 1K4TA 3IRXA 3C65A 1FOKA 2JQ7A 2VWFA 5I3UA 3FDYA 2X4WA 1SEUA 3OH9A 1TT0A 2LX7A 4GW6A 2F5TX 3VPZA 1GVDA 1YIJN 4BXXJ 1I07A 1XNRK 3AVNA 4B9XA 5BQTA 1NNEA 5J8FA 3M8RA 2DW4A 4H8KA 2CREA 1RDUA 2ASPA 3FKIJ 3PY8A 2QM3A 3E5QA 2BIVA 4O55A 3S1QJ 4HOBA 4FJMA 4ZZLA 1YQAA 1Q81O 3REBB 2IA0A 2X0LA 3KZIC 4CC3A 4H5RA 4MFBA 2GV9A 3L09A 3KLGA 3SPYA 4TVRA 3M8PA 3A5ZB 4KPYA 4XLCA 4JS4A 2X1EA 2LBFB 2L3PA 1KHCA 4U7BA 1LCKA 3TR8A 3U3GA 2A41A 3LDNA 2V1XA 1MDMA 2QTXA 2DDBA 4I0BA 3FHNA 4XK4A 3CQZJ 1BQNA 3CMEA 4UC4A 1NK4A 4JI7K 4IQ4A 1KU2A 4DSJA 2RF0A 1JLAA 1BR4A 2B8AA 4BY9C 4DUZK 2ZBKA 2AQEA 5I2MA 2J5PA 4JKBA 1XD7A 3R61A 5SZTA 2W48A 2JT4A 2RHIA 1OYXA 2VWBA 4B9SA 3CFOA 3BCAA 2IGKA 4L18B 2HDAA 2W00A 2NRWA 3JS6A 4MEYF 1DUXC 3AY9A 4JDSA 5BOXA 3BG5A 5JFRA 3V42A 2HHTA 2PVOB 3DXMA 2XDBA 3EG9A 1GCPA 1S9HA 1ETOA 2OV7A 1VIFA 3M9AA 2L9NA 1I81A 1VIEA 3F2KA 1H8AC 3PUFA 3CXCP 2DPUA 3JCMh 2LCSA 3F21A 4KH1B 2WSEE 1E3OC 3UKRB 2LP5A 1POGA 3EFRA 3TMOA 4IHTA 2MWOA 3I3LA 3CJRB 3VENA 3OA6A 3I56N 2QDLA 4JKGB 2P5VA 4BQZA 4CH7A 1LPLA 1LPQA 3CXCS 1RT2A 1SF9A 3DLEA 2L01A 5HRSA 1XUPO 2BBYA 3ZN1A 2AK5A 3E5XA 1D0YA 1G3TA 3I4PA 3C0CA 1B8IB 4HVVA 2VE8A 2X6SA 3M5RA 3HJEA 5M1KA 4LK0F 3FHZA 1RAHB 4JI4K 4H03B 3PNVA 2RHYA 1KD1R 3HTRA 1H641 1WEGA 3VUZA 2P9LA 4M74A 3I4NJ 1FBUA 3HZ6A 3HBLA 1T0FC 1NKCA 1ZGJA 4P5OA 1NMDA 3NVMA 5AQIA 2JVHA 2Q1NA 1R22A 3D7SB 1N6QA 3PX4A 5I2SA 4CJ7A 4W5NA 5CHIA 4A4KA 2XKOA 2NOZA 1QW1A 1ZRDA 1AHDP 2DXTA 1FW6A 1U06A 5FU6C 2DILA 1IBKK 3BY6A 4PJOE 1KZHA 1FWZA 5EEAA 3R2XC 1MH3A 4DQPA 1QSYA 3TSPA 3KBGA 4BHBA 2UUAK 1PRMC 2HNDA 1VQPQ 1L5UA 4GRIA 2R3SA 2DD4A 3MCPA 3DEUA 5M5XJ 3FJ5A 3VQ4A 5DS9A 3SWNA 1HW1A 2HKQB 1WFXA 2OPQA 3EGXA 2QEXQ 5LY3A 3RQIA 4IPAA 2PYJA 3C95A 1FLIA 4F52A 3JCMQ 2GAUA 1OEBA 3ZMZA 1GLEG 5K7FA 3PUBA 2DYBA 3H08A 4IVNA 2CYZB 1YJNN 4HEA2 2RC4A 4FO0A 1NH3A 3PIOA 1NEGA 2MFZA 1KAZA 3JCMe 1VQ6A 2KHOA 1SS6A 1DTQA 4I01A 2O8FB 2HHHK 1VYUA 2XROA 5EVZA 3RDIA 2OZ6A 1PU8A 3JCMd 4X0GA 1JHFA 4YTLA 4BGDA 1HJDA 4C92G 1V55H 1YI2Q 1D4XA 1PM3A 4XRMA 4KHPK 3EDPA 3W2VA 4K41A 4KGXB 3K5OA 3CYMA 2HBKA 1T6CA 1YITQ 2CV1A 1K6YA 1NPRA 3ENBA 3SEMA 2KAFA 3F22A 3L1AA 1NU0A 2DD5A 3PIOF 4MIMA 3M54A 1BB9A 2DFIA 1W9HA 3UKUA 1PYVA 4M9SA 4HVWA 1RKWA 3H3ZA 3OL3A 2HQXA 1IF1A 3ZQIA 1KYZA 4QQ6A 4JRPA 1N34K 3CCST 2CT4A 4B1RA 1VQ9A 5CVIA 4FJ5A 2ID6A 3M1CA 3D5LA 2XGXA 4AG1C 5ICEA 2L3SA 1JKOC 3MAQA 4RM2A 2FBYA 2VBZA 3ALYA 2CQXA 1Q81U 4M7DA 4E7HA 1CF7A 4DQSA 2DL5A 4ELTA 4IHYA 3PSFA 3FGUA 5GMKe 1QVTA 4DBHA 1CZ9A 4KHQA 2IP2A 2K7LA 4F7UE 4RAYA 4LF9K 3BT9A 3OIQA 1WEFA 2RREA 2QM1A 4UQGA 3X28B 4WF2A 4BRFA 1YVUA 4DOWA 1R4MB 4H0TB 8ATCB 2NRRA 1PC0A 2ATQA 5AQGA 2ESHA 2V75A 2LY9A 2DAOA 3G1LA 4HXJA 1VI0A 3G71N 4M7DF 4KUDK 2BW3A 4YFXF 1PG5B 4KTWA 1LEAA 4BC4A 2ZJQF 1P59A 2Y30A 2RGVA 3CCEA 2HNHA 4KT0E 4E1JA 1ZG1A 3CO7C 4AT1B 1V4TA 2NOLA 1TP4A 3FEOA 1QE1A 3GWZA 4FYXB 1H9TA 1F5TA 2L9SA 3WGGA 1LEBA 2OPSA 3EGDA 5KRSA 2DEQA 4BRDA 2LP0A 1RABB 1ODDA 3ULRB 2MK5A 3ECHA 4PY5A 1LMZA 3CMMA 3NF8A 4ZTFA 3CC7N 3DTKA 1L3TA 5KE3A 4ME7A 1U47A 2W04A 2BY0A 1C6VX 2P5KA 1W36D 4UNFA 4UVBA 2QWNA 4BREA 3LPTA 3KYCB 5KAIC 2LQWA 1UHCA 4AHCA 3DKXA 4J6YA 3H3OB 1J54A 2BYVE 1OULA 4CO8A 2NNWA 4HF2A 2L0KA 4HBLA 4LFCK 1WI3A 3ZBDA 4E47A 5AZJA 3QIIA 4CK2A 3HP9A 1HX1A 1NGDA 4WCIA 1WSHA 1KYWA 2E2QA 2HBMA 2K27A 3SHWA 4J6XA 2HDDA 1WJDA 2YNGA 1R8OB 1HYOA 4RW6A 1X01A 1HPMA 3J8AA 3LDOA 3HEFA 1GOAA 1I8FA 4FVMA 3HFNA 3KD1E 3QWXX 3A2KA 2VE9A 2V8IA 4DBRA 1FNNA 5LL6S 2E2NA 5F0XA 4H0EA 5IY5H 1VSDA 2HB5A 4WFAL 4ESRA 1NGEA 2EILH 3GPLA 4UXNA 2E71A 5GAOq 1K4US 1QQIA 3CUQC 1VQMI 4KT6A 4XIUA 2TRTA 3DF8A 1IAWA 5F6FA 4S0HB 1LOJA 3LP3A 4OMOA 1FMWA 4F93B 2QCOA 4AH9A 2KZMA 4OMFB 4CJEA 2QGGA 4BG8A 4W5RA 3A8LB 2EZHA 4FJ7A 4Y4RA 1NJXA 4H4MA 1ZGWA 4EGZA 2KLAA 5F04A 1PP7U 3HJFA 6PAXA 5AQPA 3VTHA 4RW8A 2LG4A 2DXCA 2V8KA 4YOUA 2MBFA 4CESA 1IV0A 2HMAA 4XLHA 2QWRA 2FRWA 1SKSA 4WXCA 5AFUA 5CIUA 1S5LC 1L0OC 1KG7A 3CMAQ 1JB0E 1WZOA 4PFOA 2O3FA 1U5SA 3EKSA 3SUNA 2LQ8A 2EH3A 5HS7A 3OYNA 2Y0SA 3MVPA 5AJ3K 2KSSA 4MO4A 3FFKB 4D1QA 2HKXA 2FNAA 3K7AJ 3KLNA 4BY1J 1VQMT 3KK2A 3GLLA 4WTOB 1Q81R 1RL2A 4H4KC 4JRIA 2D6FA 3CMEQ 2MW8A 1C0FA 4X64K 1PNJA 2XY8A 1YTYA 3HK2A 2WV0A 1HQCA 5KRTA 2YR2A 4JKAA 4DR2K 2W24A 2B5JA 3I53A 2HOEA 4A3FJ 2I2LA 1WKMA 4B6MA 3O6BB 2E1MB 4E7KA 1TK5A 3CC4Q 5CKBA 1UHSA 4XNFA 4RG8A 3TAGA 3M7GA 1MBHA 4IDKA 4UUSB 2L8DA 5K1YA 4WF9L 3CCVI 3ZMUA 4XLNF 2W85A 2OPPA 4YDUC 4PSXA 5GPCA 2H8RA 1OX8A 4BROA 2O8CA 3LZJA 1O75A 4BEHB 3SEQA 2ZCWA 2IA2A 1BO5O 3ZR8X 1QHHD 2DA1A 3TWHA 4QS7A 3C6AA 3HSRA 3ZLJA 1R1VA 2VXZA 3H6ZA 4LG0A 2VC1A 4DFKA 4N5SA 2LMDA 4I99C 1R7JA 1I1JA 3K1MA 2DPDA 2D2WA 2FSKA 1YW9A 2WTUA 1O9SA 2QSHX 2DIGA 3SNNA 1TYQA 2NS7A 3GTJJ 1ABQA 4LMYA 4JHDA 2HBWA 2HBLA 3LA7A 4UUTA 4X9DA 3ZSZA 3MKLA 1GV5A 1T2KA 1S8NA 3MP1A 3D45A 2XY5A 3JCMP 3S2HJ 3VFZA 2JTFA 1QZYA 4KTQA 2YT6A 3QZ9B 4HT8A 5K5RA 1WIEA 2RQUA 4F2RA 1UTIA 3U23A 3ZMDA 2Z9OA 1TWGJ 1QZ5A 4DV5K 3UR3C 2M7AA 3MECA 5JICA 3TU4K 1YJWT 3HZJA 3D5SC 2PEXA 1S72A 1U8BA 2YLCA 5DM7F 2W82A 4JBAA 1JJ8C 3L7WA 4OLBA 4N4IA 5FWCA 3CCVT 2UUCK 4YFNF 2BVMA 3EGUA 3D5RC 4I6MB 2WTEA 1K4SA 1YO5C 1ZTRA 1BCOA 3OIOA 3VS1A 3CCRQ 2OUMA 1UOCA 3MAJA 4C3IJ 1TC3C 3UDCA 3HOYJ 3HSBA 3RMAA 3TKYA 3OWTA 4DV4K 4LG3A 2DRMA 2E2PA 2DOEA 2M8EA 3BZKA 5FDLA 5AQQA 3JRAA 1S1UA 4QS9A 2Y1JA 3EUHA 3KHYA 3BPXA 4BWJA 4PUSA 3G25A 1PJRA 2W6LA 4YOXA 4RA2A 4KNYA 4CGZA 3ZX3A 1A6QA 4RDUA 1DPUA 4XN0A 3AGKA 4RB2C 3VQ5A 4IQJA 4A0ZA 3HTUA 4MQ3A 1ON2A 1RBTA 3E1SA 2XDVA 1S22A 4X9CA 3KCCA 3QJ6A 1VYTA 1YJ9Q 3DOLA 1NG7A 2O8EB 4XEIA 3VS0A 2HL3A 3F8CA 3EFOB 5GMKj 3LFUA 3VMFB 4H5WA 2RHXA 3HSEA 1MJAA 1K8KB 4FVUA 5L3DA 3QEVA 1I4K1 3NHNA 3PIOL 2NVYJ 3I5SA 3LW5E 1SRLA 2V8JA 1L3VA 2K9MA 4CC7A 3GF5A 1KVAA 2DXUA 3O4NA 2BGCA 3A5NC 1B72B 2L7ZA 4MDBA 4ON0A 4E2FB 4M7DG 1OR7A 4L6V5 1O3QA 2AO9A 2MSYA 4AM7A 2W84A 2LNBA 3ZQLA 4B43A 3CPWA 4HUGA 4F4KA 3VEVA 1Z3XA 3DV8A 1UELB 4C92E 2Z33A 4OIPF 1TNTA 3V1OA 2EQRA 1O4XA 4XRSA 3GVAA 2MG4A 1MBGA 1Y56A 3IHUA 2A6TA 4FLVA 3HOWJ 2KW4A 1SD4A 1RAAB 4CI0C 1A5VA 1ZUYA 2BKDN 1A5JA 3OYGA 3GOIA 3M3ZA 3FC3A 3F72A 3L8BA 1RLQC 1JTYA 3KWIA 2F4OB 2O7OA 5ECAA 5BN8A 5L8RE 1FPQA 1T33A 1UG0A 4CVNE 1T3VA 2AKKA 3G4SA 4CK1A 3GNGA 4AVPA 4XTXA 1YIJI 1GBRA 1ZG3A 3QXEB 1IRGA 3G10A 1MUDA 2ZJQL 3E97A 1ZBHA 1HNWK 4O8KA 2EJFA 3DCFA 3I5RA 2WUSA 2B7EA 3KUFA 5KQ8A 1MW7A 1O3TA 4HSTA 2P0WA 1ZA2B 4KFBA 3H3VK 4K43A 4HUEA 5J26A 2DO3A 4I7HA 2R7YA 1KQ9A 3LGLA 1HXDA 4ID1A 3RTVA 2QWPA 5F0HA 3JAMK 2CKKA 4NB4A 4IHSA 1ZUKA 5CE3A 4FWKA 1JCGA 1D09B 5FRNA 3LDSA 3FSPA 4MQVA 5FKNA 2DL3A 5DMRA 3I55I 4BYYA 4B1YB 2CS7A 2FL7A 2RI3A 3AAFA 3WTUC 1U1SA 5KCMA 3H46O 2F2EA 3A01A 1E6GA 1SKRA 3IC7A 2BV6A 2KFNA 3I4MJ 4OFEA 4LFBK 2ELJA 4GO1A 3AAPA 4AD9A 3BR5A 2VC8A 4UY8O 3VRYA 2FXUA 1YIJT 3TQ7P 2VWKA 1LAVA 1PP8F 1ZA1B 1UA0A 1Q95G 3CPFA 5FPMA 4U87A 2Q0RA 2XRNA 1KQ8A 1U8RA 4DA4A 1X43A 2VPRA 3GTQJ 1QWEA 1HNVA 4BACA 1Y64A 1T95A 1GRIA 1XX5A 1RAIB 4U67L 1O7FA 3MD2A 3KD5E 3CO6C 4TSXA 4Z94A 2XKOC 4YPHA 5C0MA 3CCMQ 3LAPA 3I55T 2PQWA 1XSXA 1Q7YU 1LVAA 1M2VB 3RMBA 4F3TA 3J7YJ 3LDQA 3O8VA 1HW2A 5KYUB 1O13A 3O2PE 2M9UA 3CC2Q 3VEWA 2XIGA 3SWNC 4J8FA 1BR2A 4OKKA 2NVTJ 5E1WA 1V29B 2FSNA 1FKPA 4M42A 5FJ8J 2OTLQ 2UUBK 4PFPA 1I3QJ 4R56A 2O9SA 3SDZA 4P9FA 3OYKA 2A3ZA 3LGFA 1BOBA 3EG3A 3E5UA 2FF4A 3JCMf 4CZFA 4IX7A 1GHCA 3O3HA 3GIBA 1QNTA 4XMYA 2RM4A 2ZZDA 1BR1A 5JLXA 3P1GA 2QI2A 4JKFA 1OCPA 4PK4A 4KTZA 1C0GA 2M1BA 5B3SH 5J8CA 2EGCA 1Y39A 2GOMA 1I6HJ 3A0IX 1TWAJ 1T39A 4PJJA 3OYMA 4CJWA 1N5YA 4FYYB 2IRFG 2OYQA 4J9IA 5HRRA 4JK9A 2KQ2A 2C0IA 2X6YA 5LJ3j 1YLFA 3K59A 4JPBW 1HLUA 2MOXA 1GLCG 4N56A 3EL2A 1KLMA 3HGGA 1XOVA 4E7ZA 3VYRB 3JRCA 3SQ2A 1JKRC 2KE9A 1SKWA 3BDPA 3NFAA 3SFZA 1VQKI 3MN5A 3O1BA 3TP0A 1HYSA 3VERA 2VBXA 1ZYRF 2OA4A 5GAN6 1U1TA 1XMAA 1M1KU 2NS0A 2MI6A 1EX4A 2F96A 1T6SA 1Z25A 4E9HA 3TAEA 2XU8A 4WE1A 2F2XA 4M7DC 3ZEUA 5FWBA 2FBIA 2XSDC 2YV0X 2A1RA 3KP5A 4JI2K 4F3OA 3V8KA 3EH1A 1SQKA 1K83J 4DSLA 3NFCA 4AHVA 2AP1A 4PGHA 1J09A 2O88A 3G3ZA 2FQ3A 3ZT0A 3JB9J 5JVGF 1LWFA 4HRIA 1ESVA 2YKNA 3QEXA 4J9CA 4OAZA 2CH6A 1V54H 5LMUK 3O6WA 2CO5A 4FZYA 4XM3A 1WHUA 2P4RA 4M7AA 1J5EK 1KC8C 4Z0UA 1YTUA 3QERA 3HVRA 1TKXA 3OOUA 3QNOA 1G99A 3DP7A 1U78A 2P9UB 3EG1A 1VQKT 3Q0VA 2E5ZA 3LM9A 4DYRA 3G6ET 3HYIA 4JJDA 3D2EB 3VESA 2D1KA 3MXMA 1XB4A 2R58A 2DL7A 3LL3A 3K5MA 2XB5A 2O8XA 2RPIA 5DM7L 5J47A 3HOUJ 1S3JA 1VQOA 4QT7A 1R77A 1OH5A 4QLCU 3SDGA 2DTHA 4BRHA 4Z4GA 4M7AF 1GLBG 3MX5A 4IHWA 4CCKA 3SZTA 1V4RA 2E5LK 1D1CA 2YUSA 3G71I 1UE9A 1HDPA 4CEFA 1VQ7Q 2PBIA 2QVOA 1UJ8A 5IT9E 5K7ZA 5I21A 1BC7C 5HS8A 3ZSVA 3HL8A 2EX3A 2FRHA 3W0LA 4BY6C 2VT3A 4YIFA 3TO6A 2ITGA 1U2VB 3IWFA 2XPWA 1Q7YR 2I5JA 5C25A 4PJOB 3AV9A 3ULEB 2CP2A 4A3EJ 3L2WA 3C12A 4A4HA 2IGMA 3M0TA 1UDLA 3ESWB 3F6VA 4DTOA 3VS6A 1H92A 1UGSB 1QMCA 2K3PA 2KY9A 1I27A 1X1PA 5IT9K 4DF8A 2WADA 4NUBA 4DTNA 1YN8A 4BRGA 2OX7A 4KH6A 3CD6A 2KL4A 4L5GA 1RESA 2NUTB 1A36A 4FCYA 1NJZA 3I35A 3ZX0A 5J2QA 4EA5A 5LL6Z 1U5TB 5BPDA 1S1XA 3LM2A 1LE8A 2CGHA 1T8EA 1WSIA 3HIFA 5GAMe 3VEOA 5LJ3g 2P4TA 3G71T 3P83D 1QP2A 2V9PA 3MKYB 3CCQI 1N6AA 4DR1K 4A59A 4ZGJB 1QHGA 4XRSG 4IEEA 3DB4A 4M77D 3EUKL 2EFNA 3F0ZA 3LSHA 1M1FA 3IQLA 3KLOA 4JJBA 3G0QA 5DYMA 3K4NA 2KKOA 4DNCA 2MCNA 3MN2A 4A3KJ 5CAIA 4BGAA 4CF9A 3UA6A 3CCUI 4XQFA 2DFFA 3V9SA 5IOYA 1LDKB 1NK5A 4KGVB 2X1CA 4FETA 4FZXC 3EE9A 4B9WA 2LSOA 2QBYB 1VQ5A 4RAGA 3M4OJ 3DKWA 4XKWA 3C2BA 3VA0A 3FK7A 4MMLA 5LHGA 3R60A 5AQZA 4BRLA 1S1TA 2R7RA 5HY6A 1M1KR 2HF4A 3M0QA 4HAMA 4OIQF 2QYOA 4OB0B 1X1CA 3Q5FA 3VQDA 2VJ5A 1NOYA 2O9LA 2B0LA 3CCQT 2NYSA 4V19S 3NVKA 1RTDA 3L2UA 4ANJA 2RJEA 1KONA 2HVSA 1VQLQ 3ZCOA 3VODA 1ETQA 2EQJA 3IG1A 4ESJA 4M6XA 3ZETB 3UWNA 4X65K 3ZN0A 1P6RA 5J1EA 1BK2A 4F7UB 3DOKA 4LUEA 4CJSA 2DKGA 2YXYA 1MSFC 4FSSA 5H20A 5KK1A 1VQNN 1NK6A 1W7PB 1WQWA 1ONVA 1YQMA 3CCUT 1SUQA 1TT5B 3BR1A 3MP8A 5J4YA 1YUWA 3BF3A 2ZO4A 3ZL7C 5J40A 1K7AA 3L00A 3ZT1A 3J7AP 1FOXA 1QZZA 2KP6A 3OYBA 3BCBA 2EWNA 1I50J 2HYGD 1M90U 2JPBA 4O5VA 3X2QH 4NLBA 2IT0A 3BQZA 2D9TA 4IIMA 2L4AA 4ZJZA 5FPNA 1ZX6A 2FXAA 4IHXA 3P9IA 4XAXB 3HYFA 2HHUA 2DTUA 5B5EC 3QB0A 4A61A 4EP4A 1HRHA 1AKHB 1PDNC 3ONQA 3A1YA 2I5UA 2YX4A 4CBWA 2OZUA 3ABKH 3TABA 3NCIA 4AI4A 1R58A 1ORKA 2Y69H 3V7RA 4Q5WA 2XG8D 1Y57A 3HOTA 3O08A 2GA1A 2RK1A 3CCVA 4CZIA 4KI6A 5CQYA 3OYCA 2NVXJ 1I39A 1IRFA 2WC2A 4CYDA 3HTSB 3VEZA 3UIQA 3FIFA 2HU9A 2VKDA 3PX0A 4E9EA 1G3WA 2VLAA 3JW4A 3NDKA 4E3SA 1ZLJA 4V19K 1AHJB 4C23A 4Y1CA 3J80E 3K0SA 2VBYA 4X1EA 3JB9D 4BI4A 1J3TA 4Y28E 3QODA 4M75B 3HPHA 3AA2A 1W1WE 2CSOA 3V81A 2DOAA 5J3LA 5BMZA 3QMLA 2KI7A 1L3UA 1K9MU 2FPDA 3EUHC 1H3ZA 3T8RA 2ZXHA 4EQQA 3J80K 5AZIB 4LLGF 5LGUA 3FXQA 1IKXA 2NUPB 4I9LA 3CFPA 1QVFP 5FB2A 3K70D 1KG3A 1R1TA 4NDLA 1ZBSA 1BI4B 4EMHA 3T19A 4NC7A 3V1QA 2K57A 3GCMA 1KG4A 3RPQA 1C0WA 1I5LA 2ROLA 3OR1C 1YS6A 4F16A 3K69A 3F5TA 1MBJA 2RNGA 1FYLA 1Y8QB 2QQSA 4CGIA 1QVFS 2STWA 1EJ9A 1M4ZA 5IYCJ 2CV2A 3OJSA 3TBIA 1IN5A 2LDMA 4O5FA 4H0YB 1QRYA 2NRAC 4E1MA 2P5OA 1WXTA 2R7TA 3J7AY 2STTA 4K2EA 3AL0C 1GLFO 4FWQA 3U2RA 4WX9A 3CCSQ 5DLQE 4O4GA 4OB3B 4CIGA 1S72N 3CDIA 1QVPA 1YCYA 4DQQA 2LFBA 3LWHA 1HQUA 4DF4A 5DCFA 3QINA 1R36A 3K4KA 5DD4A 3KK7A 4C0DC 3L3VA 4LH4A 3ZPLA 4LXCA 5H1SQ 1JGGA 3WXMB 4W5OA 1OR7C 2LBFA 3THYB 1FBQA 1E6HA 1C1CA 2CUFA 1XSDA 4KAZA 4M63C 1K1ZA 4IXCA 3QEWA 4BC2A 5M1FA 3VUBA 4CXFA 2K4JA 3IH3A 1HF0A 4IHVA 4X62K 4L5EA 4DTPA 3I9V2 2QENA 4FK0A 5DY9A 4RW4A 5CYQA 4CZJA 2LSNA 2KYMA 4RW9A 4KMUX 3C6HA 4IKFA 2MC4A 1Y8RB 1JXMA 4ABZA 4DSEA 4E4HA 2F69A 4A3CJ 3ROUA 1YFHA 4M7AG 3ISNC 2DERA 1VQ8Q 3WXJA 2QEXN 4OGEA 4RW7A 2IAIA 3CF2A 3SAHA 2X35A 3T69A 4CEOA 3WTTC 3MPUB 3IHOA 5HLHA 2Q2RA 3LNQA 2O6GE 3MEEA 4DV3K 5JVGL 4DTRA 1CLQA 4ZHRA 1PCXA 3EEQA 2OZSA 4LF5K 4RCBA 4LGWA 1H88C 1W5CC 2OTJA 2JNGA 2JTMA 3PO2J 2IS3A 5ADXH 3ZYYX 4V2SA 4DV7K 4CC4B 5LJ5h 4C2MJ 4FJKA 3RCOA 4EJOA 4ESFA 3I0TA 3QPLA 9ATCB 3U6FA 3META 1M90R 1LW0A 1UGRB 2UUZA 1RNHA 4JKGA 1YI2N 4YORA 3JXUA 4ELYC 2CW0F 1YITN 3HUGB 4DS5A 1Y0UA 4B1VA 1KSWA 2LT1A 1B8IA 5GANj 3OYFA 2O4GA 5AONA 2VB6A 3Q9VA 2YU3A 3AVAA 1ZN2A 4OVAA 3JSMA 2VQHA 2QZ8A 2HF3A 2NRHA 3K4CA 4IFYA 3LAJA 2XAQA 4PJNA 3COAC 5GAMj 5AQHA 1NGCA 1YIJA 1ERDA 2X6WA 2XGDA 1HKQA 4ZTJA 3GF2A 3CVSA 3QDKA 4HNVA 1M1EB 2WB1N 2PFUA 1NJIC 4DEXA 1M9SA 3D0PA 2HPMA 3TGNA 5ILSA 2VOOA 2X48A 4BDYA 1NKUA 3CERA 1CQTA 3MEXA 3E19A 4A0YA 1D8YA 2D45A 1H9GA 1ZARA 3OGDA 3W6JB 3QPHA 5K14A 4CHZA 1YHQI 1FT9A 5GJVB 4ENMA 4AF1A 1K9MR 1D1AA 2ZJPF 4J7IA 2W4SA 1EP4A 3CQXA 1YP5A 3NF7A 4JK7A 5EOYA 4NNJA 1FJGK 2JZYA 4NYNA 4CF1A 2PMZN 2HOSA 2VQEK 3CCLQ 3I8DA 2E70A 1Z67A 2R5MA 2JGUA 4KO0A 5AIQA 3RWUA 3SZGA 4B08A 4E7JA 2O8FA 4RUGA 4IUPA 1Z0XA 1AWWA 3SZPA 4B48A 2R5AA 2IVWA 5D6YA 2KXDA 5JR3A 4C8QA 1QZEA 5LJ5d 2QKLB 1S1NA 2FSJA 4FX0A 3RR6A 1ATSA 4RGUA 1KAYA 2DYIA 2XPUA 1IREB 3FK6A 2R92J 1J53A 2RHKA 5KQDA 1TKTA 2MWPA 1W36C 5GPAA 3FDRA 1OCCH 3E6CC 4FSVA 2DL8A 2VYTA 4GGGA 3A0HC 3QEPA 2Y9ZA 1YHQT 2IAJA 3MZ8A 2ACJA 2GM4A 4ELUA 4KYWA 3JRZA 3F9MA 2OCCH 3IH2A 3I56A 1N8RO 1WPKA 1RDDA 2GQQA 1TWCJ 2QQRA 3HB9A 5GAN2 3R0AA 1VQMQ 1B34A 1VAZA 4A3LJ 4BUGA 2DTZA 2EV5A 2ELHA 1TWHJ 2GA2A 2V1DA 3JTGA 1IJJA 4B3TK 4C5EA 4C92B 1XHXA 4A0XA 1K8AC 5I9EB 1M3CA 1UAAA 2YWWA 3IAYA 1LWEA 4BRKA 2RHUA 1Y1VJ 1ETYA 1BBYA 4KI4A 5H6RA 4XK8E 3F8MA 2EZLA 4LD5A 5AQVA 2RO0A 1ZYQA 1P4XA 1TWFJ 2HEOA 3FMSA 4A3MJ 1OCZH 4IUVA 1FKOA 2VVKA 1F21A 2PI0A 4DQIA 2LQKA 4GYIA 3CCJA 3ZFJA 5HLTA 1UCRA 1R5ID 5ERIA 5DCMB 5GANg 1M5Q1 5KYWB 1Q18A 2HZDA 2VIXA 5J1RA 2PNIA 3OIPA 3OW2A 4R5PA 4BGBA 3V9WA 2ZGYA 2FA5A 1B9DA 4G7ZF 4Q5VA 2KDZA 4M9ZA 4OB1B 3SMSA 1D3BB 1NM1A 3AVIA 2D0CA 2JJ9A 2EV0A 5CKFA 4XTZA 4N9HA 2W7NA 3S41A 2DF6A 4BC3A 2K9GA 1N33K 4M71A 1RTHA 2ZFWA 1Q86C 4M77E 1YJNA 1APLC 4DMNA 1MUYA 4CC2A 2XRLA 1QKXA 2Q3SA 3HPGA 5FLVA 3A2FA 5E79C 1SKUB 1K76A 1PD1A 3LOCA 4CRIA 5AQFA 3QUIA 5IT9Z 2VOPA 4BE0A 3RRHA 1MNEA 4EJVA 4M7AC 5F0FA 2E2OA 1AT1B 3TDUC 3S2WA 1T08B 3LH5A 1YJWQ 3BG3A 1DQUA 3CLQA 1ACIA 3L4IA 4ZDPA 3OV8A 2RNAA 3DJCA 1UGQB 2DA6A 4LB6B 4DWIA 2WY7Q 1WJ5A 3FXUA 4FSXA 1HMVA 3DWLA 2ECCA 4KFCA 2VPLA 3CQTA 2ETJA 2XDDA 3IDHA 4M3BA 3UA7A 1LW2A 4U0WA 4GV3A 2CUEA 2HYFA 1KSPA 1NGNA 2RN8A 1XPXA 2Q31A 4G12A 2HQNA 1R71A 4B1UB 2AS5F 2ZPBB 2KT1A 5C24A 3DKMA 4PDKA 3OVNA 4UUVA 3LP1A 3CFRA 2EA4A 2ID3A 3CJNA 3H1CA 5EU7A 2IA1A 1WRJA 4JYAK 4MLOA 2V1UA 2EVRA 3JYTA 2KRCA 3V7CA 1W5TA 3TO7A 5CJ9A 4I7FA 2PAVA 5J2MA 2GNCA 3CC4N 4IZZA 4M78G 3MXIA 2ZSIB 3OY9A 4EM1A 3AG3H 1BQMA 5IHNA 3H5NA 3ATVA 2FBTA 5IYBJ 5FLXE 3AG4H 4K8XA 4XICA 1HNIA 5HCKA 3NHGA 2E1HA 4GKKK 3CBPA 1WH7A 1Y07A 2R4GA 1GXQA 3MP6A 3N5BB 1UFMA 3VYUB 3QYHB 2JJ7A 4N0AA 1VQ9I 2OPRA 4OGCA 1JXEA 2UYTA 4A12A 2ZMEC 3BDLA 4KH0B 1WSJA 4JKCA 2J6OA 2D8HA 2YLBA 1M2OA 4EMSA 2FEZA 3L4QA 3BR6A 3G71A 2KBTA 3K10A 1UFFA 1M27C 5FLXK 2EKOA 2ASOA 2M87A 4PZJA 3KKSA 9ANTA 4IOAF 1XWLA 2DFEA 5HDKA 2QXFA 3BY5A 3U4LA 2YKMA 2VQFK 4Z4EA 3M0UA 2G8IA 2DTIA 3SB2A 2CRGA 4AFSC 4AWXB 5M1NA 3CJQB 3VQ9A 3P7NA 4FASD 5B1AH 2QWQA 3IRQA 1VQON 1G8XA 3VOEA 2K5FA 2PJRB 1SFEA 1FYNA 2NAZA 4VUBA 4DUYK 3Q7BA 3FXJA 4IURA 3OR2C 4C8LA 4HQMA 1YYVA 1VSEA 1M3BA 3MCZA 2KJCA 2IDOA 3MK6A 4H4OA 3CC7A 2KRMA 3CHWA 1YAGA 4EV0A 2E2JJ 4B9NA 2ME0A 3KX2A 1HW5A 4LIVA 4HV5A 4A6DA 3ZSYA 1MBFA 1T0HA 4KICA 3CCRN 3QHSA 1G2HA 2ZPEB 1N8RU 3EPZA 3LWLA 1K8AU 2HW3A 4HDVA 1VQ9T 4J9DA 2EKHA 4UOBA 2JA7J 4J00A 5GIPA 3U8XA 1WDXA 2HOAA 2JWTA 3QWLA 1XNQK 2LYCA 3E3VA 3JB9F 2OAZA 4UUSA 3ASOH 2QKBA 1SC7A 4KHNA 5J2NA 3MMVA 3MZYA 2ZPFB 3UE5A 3C4SA 2DAQA 2QQBA 4BEHA 4CERA 1KC8O 2G8KA 3GZNB 1GDTA 1MHNA 4D8KA 1P92A 3DYAA 3GFLA 1M30A 2RJFA 2LH9A 1RTIA 2JSPA 2A0FB 2ABLA 2K9LA 2JW4A 4HCKA 1YJ9N 3VPRA 4A3GJ 3W2WA 2AXTC 1YQLA 3SQ4A 2BOLA 2KDSA 1JLCA 3M0SA 2VQLA 3G1MA 1ZQ3P 1X9SA 1WHMA 4DR6K 3H9NA 1YFNA 3VU3C 4M7AE 2G9WA 3DTEA 1IN4A 2R7WA 1N3AA 2H94A 4J8OA 1ZG5A 3DU5A 1YE9A 1STZA 4UNOA 3J80Z 3PO4A 1X6BA 4CYCB 2OJED 2DEUA 4JAXA 3NH1A 2R7FA 3WHCA 2QKMB 1WGXA 1HKTA 1JT0A 2VCPA 1DT9A 4I6MA 3VW4A 4M3FA 1ZBUA 1ON1A 4CJ5A 2OQGA 2ZKZA 2XVCA 3PL8A 2FG0A 4I98B 1QGPA 1W2BM 2L2OA 2VQCA 1TWBA 2CQKA 2KVQG 5FPDA 2CFXA 3GFMA 4L9JA 2BEOA 2VKHA 5HRNA 3KPHA 1VQNI 3HC7A 1WHHA 1ZXOA 2HHSA 3QYGB 3O3KA 2A69F 2OFKA 4JJCA 3DLRA 4WQ4A 4RTXA 3C1DA 2ZJPL 2H6CA 3MN9A 4N47A 1XGOA 3DI6A 3O8MA 1SFUA 1ITYA 1N9SA 4EFHA 2NOEA 4WFBL 1YW8A 1KD1C 4RLFA 4C8QG 3DU6A 1PKSA 3J7AO 1NHAA 4QTRA 3I55Q 1I1SA 4CBUA 5JHFA 4GLMA 2JT1A 3RYPA 2XAJA 4PKHA 3CJCA 2VUBA 3JCMV 2KHMA 1QKWA 4JEPA 1H3HA 5KGXA 5EEGA 3JCMW 1D0ZA 3C18A 4EZ6A 1ZHFA 1RI7A 2RI2A 2O8EA 4CJUA 3KWGA 5IWAK 3BEXA 3S1NJ 2KT8A 4A69C 2FMLA 1WHGA 3LSJA 3CESA 4B09A 3LWIA 3OQ5A 1BI0A 3K4BA 4AHTA 1MA9B 1NYGA 1K8KA 4BR7A 2DQRA 3INZA 3M5AA 4IWVA 4NL3A 3HM8A 3TANA 1RTJA 3K4JA 1IUYA 4HA8A 4YOTA 1VQNT 2D0PA 1SMYF 3PMIA 1M8MA 2FRYA 2UU9K 1JJ2A 1B72A 4ILHA 2YCHA 3CP2A 4L9VA 2OZMA 1JLGA 4JD2B 2LKXA 2EYWA 2EPDA 1DU0A 3THKA 3LDPA 2Q97A 4GY5A 4GV6A 5E3OA 5GMKm 4EMKB 2L7MP 2LY2A 3DEWA 4U7DA 1K73O 2Y48A 4QSHA 3OYYA 3HSCA 3W3DA 1HKCA 1TTYA 4ZN1A 2XKPA 3M8SA 4XLPF 4IO9F 1DLOA 1BW6A 1BU1A 4KN4X 1JCFA 3UB5A 3UT1A 3OSSC 2KISA 2DFUA 2EZKA 1N8RR 3GL1A 3OW2M 1J75A 4NZGA 1TGOA 3KK1A 1WSFA 1TTHB 1G5VA 1H1VA 2KYBA 4RAZA 1JKQC 1YS7A 3OYLA 1V3FA 4EIAA 2YI1A 3PO3J 4OPJA 1LOTB 4XU3A 4FLTA 2DMTA 3A5MC 3BPVA 5HKCA 1N3CA 1OH7A 4DFPA 1QPIA 2Z1JA 1XMQK 3C3WA 3H0HA 5GAN3 4A5BA 1Z6RA 4MEXF 2WSCE 1JLFA 3OS5A 1FMKA 1Y1WJ 2ROTA 1ITGA 1BUPA 3KLEA 4CZCA 3JB9H 3M1FA 2KXCA 4YOYA 5D6FA 1IRZA 2E60A 4IEJA 1WJAA 2CP5A 3CCMN 1SAZA 3R1XA 1HC8A 1G15A 1YT3A 1PUFB 4LD6A 2X9HA 1ETWA 1ZSZB 1FYMA 1XNIA 3ASMA 3GZ6A 1YX5A 2QA4Q 5FPEA 2O61A 1S72I 3CC2N 5FLMJ 1I6XA 3MN7A 1MGTA 1S6QA 4FWPA 3WUHA 4FJLA 4F17A 5E20A 5LHHA 5BRHA 1ZQ1A 4CJRA 4BRCA 2Y0MA 1G3YA 2RQRA 4M3TA 4EVVA 1A31A 2ZWHA 4NCGA 3W6VA 4GLKA 1VQKQ 1NE8A 4OFAA 5L3EA 3G6EQ 4KHUA 3E1YA 5J1YA 2RQWA 4PGGA 4LOCA 3A5OC 1IC8A 3ZP5A 5HRPA 1O3SA 4JKDA 4BE1A 4GY2B 3KP4A 1PU6A 2QEXI 1KK7A 5BR9A 2HTSA 2QQAA 1XG1A 3WTVC 2DT6A 1F43A 3M4GA 4DSIA 2VJIA 2YG8A 1RZ4A 2HNYA 2XHCA 3P9CA 1FSHA 2DMNA 2HMPA 1ZBXA 3ZSRA 1S72T 3BR0A 1ARKA 2KR3A 3FX3A 4IFVA 4DTUA 2P5GA 5IXBA 4EJWA 3DKYA 4GFBA 1TSFA 2RKIA 2WSFE 5CHZA 1MMGA 3H1VX 3IUOA 1YI2I 4BRPA 3DLLA 1M2VA 3TSZA 1R5GA 4LF7K 1GOCA 3H1QA 3IH4A 3ZGKA 1FIPA 3DLGA 1Z9QA 3QDRB 5KYUA 1NK0A 4JZ4A 2RA2A 5TGTA 4F9OA 1PD0A 2F9WA 2IS6A 5ELZA 4CIFA 4CD3A 5IH2A 1S6PA 4FHTA 3FISA 2E5QA 3WTXC 2OTJN 1IHVA 1QVGA 2Y2ZA 4M7XA 2F5KA 5E3LA 5FKOA 3G71Q 1JL2A 2TDXA 2RNJA 3DLLF 5D5UB 4IOAL 2FE3A 1BDGA 5J2PA 2KQRA 2F2WA 4XN3A 3RKXA 4M45A 1XCBA 2NOJB 5LJ5f 1SG5A 2F6CA 1X2QA 3JRGA 4M78E 4P1WA 2A6HF 5BPIA 2HPIA 4JK1X 1U04A 1HKBA 3CWUA 4EHTA 5CY4A 2XY6A 4BHPA 1R00A 3H3UA 1YI2T 5AT1B 1TUDA 1V76A 4B9UA 3THWB 1MV0B 1Y71A 3G4SI 1EFNA 3NPFA 3B6CA 3G1JA 2X4XA 4OO1J 4M3EA 3VQPA 2P9IB 2H09A 2NOFA 4G8XA 4RB0A 3SFMA 2XD0A 4A2AA 1J7KA 1WHJA 3K1NA 2YX6A 1KFSA 3VQ6A 4K0KK 3R6SA 2DX1A 3OYHA 1FK9A 3QFPA 1K73U 2Z1IA 3I59B 3LSMA 1VQ7N 2HS5A 4KUMA 5ICGA 4RTTA 4KH4A 3DLBA 2E3HA 2PUOB 4PL8A 2X6XA 2YNFA 2EYZA 3O3FA 4MFDA 2DMPA 1TL1A 2WA0A 4Y92A 2V7ZA 3CCQQ 2VODA 2G8FA 2C6YA 4CFAA 1OPKA 3PX6A 3EHQA 3ENHA 5JI6A 1P9QC 1WHKA 1T44A 4II3A 3T0YA 1ZREA 1SHFA 4HUFA 2ZXJA 2OI3A 2J4RA 1YXQA 1U2WA 2HL5C 4JP0A 2D1VA 3HPOA 1Q81C 3TEDA 2W40A 1R9TJ 3PQJA 4DQ2A 2F4MB 4F55A 1XSVA 1Y96B 1LUJB 4A5MA 5AQKA 1SMTA 5AN4A 3HKZN 3A5LC 5GINA 3CCUQ 2RQQA 3K1PA 3G4ST 4L5JA 3R6NA 4HNTA 5KAFC 4IUTA 2KDOA 3OHRA 5EGOB 2GIZA 3BR2A 4E0DA 2DU9A 3N4QA 2XASA 3TTDA 2A1SA 2WC9A 1SL0A 2HTJA 3E6BA 5AQJA 2VKVA 3SDBA 4DHYA 4LLNA 5F27A 2P9UA 3CJBA 4HHTA 1OQYA 2RHZA 1VQ4N 3AO5A 3D2EA 3TPQA 1D1BA 2G3RA 5BR8K 4BHCA 1QQCA 1SSHA 1W2BP 1YCSB 3AVMA 4I09A 2LNHB 3V8JA 4L0ZB 1NJIO 2P0QA 3G2BA 1T3LA 4CGFA 2VJJA 3V9ZA 4C3HJ 2D0QB 1TXQA 2E20A 4JLIA 5GAOm 4JHDB 3OS2A 4BR2A 3F0CA 3ER0A 2P8TA 2NOBA 1W2BS 2H56A 4ZGDB 3GBTA 2E10A 4J9FA 1MU2A 1A04A 3IWZA 3KEQA 5ED4A 5AQOA 3ZOBA 2GBZA 3ULDA 2QG9B 3Q9SA 4UVCA 1CZAN 5FLXZ 2IIMA 4RTYA 3LZIA 4JI1K 1X3UA 4M3YA 2EFIA 1U2VA 3HT3A 1X3MA 2J6KA 2IBDA 1WN7A 1RETA 3SD4A 1G6NA 1OPLA 2YHWA 4PJOA 4LSLA 3IFRA 3ULEA 4DJAA 2KRNA 4YPRA 2CH5A 2DM1A 2JWLA 1JJ2M 3RIRA 2WOMA 4C92D 4D5FA 5GJWB 5IXFA 2F8SA 5FLXO 2VBWA 3X26B 4EMGA 2F5DA 3OL4A 1VQLN 3CCJN 3CXCA 5EC7A 4N4GA 5HBMA 1OFCX 4BRAA 2NOGA 4ZDLA 4FT8A 2NUTA 5GMKh 4MGRA 2GXGA 4B4CA 3HPWA 1R49A 3D2FB 4B8XA 2HBPA 5FFXA 3ZSWA 4P96A 3RUXA 2HI3A 1BBZA 3TSQA 3NQOA 4PJOF 3V4IA 1U49A 2G8HA 1EZZB 4FM1A 3KXTA 3HL2A 3WE2A 2QWWA 1VNDA 1Z26A 3KLHA 4C8QE 2LTPA 1UECA 1SSFA 3AVKA 2AQFA 3DTIA 5GAOr 2E41A 1YQKA 2ED1A 1IXSB 2GEMA 1BA1A 3JSPA 4N0AC 4EDUA 1BOTO 1NGGA 3H0GJ 3AA3A 3MMYB 3H9GA 2I0NA 3KJVA 1LFPA 4BU2A 2YRVA 4RGRA 1C6VA 1XQPA 4IO9L 1Z6TA 3DBRB 4D7NA 1JKHA 2VGMA 1HDDC 1GXPA 3M59A 2ZNZA 3FZMA 3CW7A 3ZEHA 3CJAA 1RRQA 5D4SA 2H8HA 1EIFA 4QVZA 1G59A 4OF1A 1K73R 3OW2S 5KHDA 1RUWA 3HM9A 4KITB 2F4IA 2QBYA 1T6DA 3KEOA 2KEAA 1WNLA 3REAB 3M8QA 1KCFA 2HKOA 1YRNB 3LCNA 4DTMA 5GMKi 3FZLA 5DM6F 1MGQA 1Q9XA 4OFHA 1LAWA 2FZGB 1X2NA 3DXJF 3O1WA 4FE4A 4E9FA 3F8NA 2PBDA 2TCTA 4CW7B 4J6WA 3J81E 3CZ6A 4PKGA 2R7QA 2LD5A 5C4XJ 3H92A 3ZETA 3KE2A 4BE2A 2M3AA 2IS1A 4PSWA 4RCHA 4F7UA 1U6GA 3QOPA 2DZ9A 4XH1A 3DPTA 4CGGA 2R5YB 3GTMJ 3T1YK 1VQOI 4FWRA 3PGGA 4ISGA 1RAEB 2E1MC 1RDAA 1W7PA 1HSJA 2J7IA 4CGDA 2PG4A 3OBWA 1VTNC 2QASA 1D9FA 1WB9A 4KIGA 2R93J 2XY7A 2Q1ZB 3BFMA 1KU7A 1DGRM 3IAM2 1RBSA 1U45A 4BL0B 1LWYA 5AQYA 3FZHA 2XB0X 3EUAA 4LF4K 1S1VA 2ISYA 3QWYA 3VS4A 4EJZA 3DMJA 4F7UF 3LP2A 4AYBA 2QK9A 1MWKA 2E5NA 4FPAA 3NWTA 4KB1A 3CJTB 1SANA 3M55A 3CVTA 2X6OA 3RERA 5JLHA 5FRMA 4I2PA 2K3FA 5GAOp 3HM5A 4M77B 5HK3A 4IDHA 2RN2A 1KVBA 5GAN8 3G0ZA 3ABUA 1LNWA 3CCSN 4BVPA 3MFKA 2EFOA 3LL7A 1KG2A 1WAJA 4KMFA 4PKIA 1VQOT 2QWMA 3LAMA 3CD6I 3O9TA 5D5XB 4HDUA 1FTTA 1M8VA 3A01B 2K6DA 5KN8A 2JM8A 5CR2A 2DRKA 1YJ9I 2H1LA 2SEMA 3BZCA 2L5QA 1AOJA 2COMA 3RQ4A 3NGIA 2FBHA 2G7UA 2JN0A 2DXBA 2KZZA 2K02A 1WYXA 4M6VA 4M75A 3C7NB 1MBKA 4Y33A 3IKTA 3J7ZI 1JE8A 2DN0A 1YG2A 2NLXA 1RDWX 1TL3A 4J2BA 1A5WA 1S7EA 1SD7A 1WNSA 3PSIA 2UZKA 5D5VB 3MO8A 2ZB9A 3CIPA 1QHAA 4WQ4C 4KRFA 1UJYA 5LFAA 3THXB 1VQ8N 5AZIA 2RI5A 2O2OA 3CF5L 2NUPA 1S1WA 1ILYA 2R7ZJ 1E3PA 2GF7A 2HDWA 1KHIA 3VF4A 2CUZA 2GLOA 2HYJA 4FYDA 1NK8A 3E9LA 2J6FA 3DLLL 1VSFA 1BI4A 1NK9A 5HNHA 1QA6A 1BA5A 4M75F 3BE3A 3OSFA 1IG8A 3WEEB 3I58A 2YHXA 2X6NA 1FY7A 2XAFA 3CD6T 2P6SA 4BUPA 1UA1A 2ZNYA 4G94A 1VQ5I 1V5EA 3W6KB 5KYXB 4BQAA 1SFXA 1U84A 2L89A 2YHTA 2KFZA 4QVCA 2FMYA 1VQNA 1XTAA 4Q47A 1W7AA 3VWBA 1IB8A 3QNNA 2H6BA 2YPRA 4NB5A 2MLKA 3G1OA 3QYBA 1TUGB 1YHQQ 5E3NA 1A5XA 3ECOA 5LJ3h 1IN6A 1DP3A 1IW7F 4NS5A 3VOVA 1UEBA 2FYKA 4B47A 1KA8A 1IXDA 3O9SA 4AQYK 1EKEA 1SV5A 3VS2A 4XR6A 4D0PA 3Q7CA 1WBDA 4HPQA 2V79A 1WA7A 3THYA 2LQNA 3MKDA 2AZSA 2O8BB 3ULQB 3LMMA 5GAN7 1TAUA 1X27A 1VRUA 1OMIA 3DRSA 1BG3A 1QBJA 2P0KA 4OKJA 1LDJA 4EATA 4LDXA 4P9UA 3HHHA 2DYRH 2OJ2A 2NZTA 3C2GA 3EE8A 2HGCA 4XL9A 2R7XA 4EHUA 1ZBLA 2CU7A 3IH7A 2Q2EB 3BG6A 4RKUE 1VQ5T 2R57A 3DXKB 4FM4B 3GG4A 5BN9A 3RMSA 3TCJA 3HOZJ 2D0AA 5CPRB 4TV7A 2FF6A 2IVMA 1K78B 5HLGA 1GLAG 3AA5X 3OBYA 4HT9A 1B92A 4Y13A 2ASMA 4OMLA 1SVLA 4A93J 4YIIA 2P9NB 2MH9A 4M73A 2BTFA 3CCLN 3CP8A 3N05A 3WXIA 3FBIB 1JKPC 1JQQA 1OQKA 2PN6A 4XH5A 4Q0BA 4A6EA 4DBFA 4N9IA 4GKJK 1M1GA 5L3GA 1NG2A 4HYEA 5E1ZB 2G8WA 2DNUA 2KMTA 5LBQA 5JVHL 1FSEA 5KVRA 1SPKA 4CCHA 3HXLA 2ZFUA 3F70A 3FM5A 3OYEA 2EYQA 1TUUA 3HUGA 4BVOA 1JXSA 4G9YA 1TW2A 4X66K 4XOTA 4BB7A 3HSFA 2AKLA 1WJFA 4CBXA 5BRDA 3FZVA 5LJ3e 1RDBA 3NMZC 2RQPA 5LJ3d 4A4FA 3WGIA 2W6KA 2JVGA 2DK3A 4JI6K 3QU6A 3GUDA 4Z02A 4CEZA 1TAQA 4HTUA 4PKCC 2WBMA 3GTLJ 4PJOG 2ZE2A 2OFIA 3NTIA 3BOQA 1OV3A 1BIZA 2A5WA 1NEBA 2VXDA 7AT1B 1N36K 4CF2A 1KD1O 1TQMA 2COZA 1B07A 1DEJA 1JT6A 2LREA 3EQLF 1U6ZA 3VSLA 3B6AA 3M8EA 2KNBB 1JJ2P 1T8IA 4OMQA 3SUOA 3CC2I 2P9SB 3S6IA 1UGVA 2DA5A 2VXFA 5IP7J 3M8JA 1OCOH 2F5FA 4RTFD 3ERED 2FBXA 1UB4A 1TS9A 4PJMA 3REOA 3S8PA 2E2HJ 2HSTA 3IP4B 3V1RA 3FXMA 1Z7LA 5TJJA 1JJ2S 5BRFA 2BGGA 4XBFA 1HKGA 3VQBA 2FPFA 2HAXA 4A54A 2PLYA 4ZNXA 1G83A 4EW4A 1QZ6A 1KQSA 1N27A 4AILC 5E41A 3WNEA 2VJ4A 4JS5A 5M1OA 3LA2A 3V7SA 4E7SA 4EM0B 4DZJA 3X20B 1KQ2A 1QHTA 1D5VA 2A6EF 5FFZA 3H6EA 4G6QA 2K85A 3MEVA 4GYGA 5KN9A 1JUMA 3ERMA 2E1ZA 3B6PA 1SAXA 3AVLA 2HQ5A 1ETVA 2XGCA 2GELA 2QEXA 3BTCA 4W5QA 1Q7YC 4Z8AA 3EZWA 1Q82O 4O0IA 1VQ6Q 1O3RA 4R0KA 2XAHA 3MXJA 1B9NA 4WXHA 4IL6C 4JUVA 2JTVA 3WE3A 2ZPIB 3AAQA 4I2OA 4J19A 2IIRA 1E4FT 2IGOA 2E5KA 2EK5A 2OA8A 2FBKA 2MH2A 2P5LC 1LE8B 2JMCA 1HBXG 3OYIA 1HNZK