3OYCA

Crystal structure of the prototype foamy virus (pfv) intasome in complex with magnesium and the insti pica
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
368
structure length
368
Chain Sequence
LDAELDQLLQGHYIKGYPKQYTYFLEDGKVKVSRPEGVKIIPPQSDRQKIVLQAHNLAHTGREATLLKIANLYWWPNMRKDVVKQLGRCQQCLITNASNKASGPILRPDRPQKPFDKFFIDYIGPLPPSQGYLYVLVVVDGMTGFTWLYPTKAPSTSATVKSLNVLTSIAIPKVIHSDQGAAFTSSTFAEWAKERGIHLEFSTPYHPQSSGKVERKNSDIKRLLTKLLVGRPTKWYDLLPVVQLALNNTYSPVLKYTPHQLLFGIDSNTPFANQDTLDLTREEELSLLQEIRTSLYHPSTPPASSRSWSPVVGQLVQERVARPASLRPRWHKPSTVLKVLNPRTVVILDHLGNNRTVSIDNLKPTSHQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PFV integrase
publication title Molecular mechanisms of retroviral integrase inhibition and the evolution of viral resistance.
pubmed doi rcsb
source organism Human spumaretrovirus
molecule tags Recombination,viral protein/dna
total genus 106
structure length 368
sequence length 368
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2010-09-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
A PF17921 Integrase_H2C2 Integrase zinc binding domain
A PF18103 SH3_11 Retroviral integrase C-terminal SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2300 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3oycA04
1.10.340.70 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Endonuclease III; domain 1 3oycA01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3oycA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3oycA03
4KB1A 4HTUA 5D6XA 3AA3A 4FK4A 4RW4A 3O8VA 4IUQA 1HRHA 1RDAA 4DMNA 4CJTA 1B9FA 4DTXA 5KCOA 1QE1A 4FLWA 1TK5A 4Z02A 1OZ3A 2NUBA 1Q9YA 5FRNA 4CGDA 3QEIA 2DFEA 1C1AA 3DOLA 1BIZA 3RRGA 3OY9A 3MO8A 2LVMA 2Z1JA 4N4GA 2X35A 1TV6A 5CIUA 1S1WA 4KTWA 3DLRA 3OJSA 1WLJA 4E7LA 5D6WA 1RT3A 4H4OA 4M3UA 3LP3A 2KZMA 2ZE2A 3TAGA 1VSFA 4O55A 1WAJA 4PWDA 4FJMA 2LCCA 3NF7A 1RTHA 3PNWC 1U4BA 4CGGA 3AVKA 4DS4A 5J2MA 4DLEA 2K3XA 2D0CA 3F73A 2D9TA 4A4GA 4CEZA 3L2RA 2A1RA 3KD1E 1IKXA 2G8IA 2KTQA 2EHGA 3UIQA 1WJQA 3PV8A 1RCHA 3AVNA 2PQWA 3DLEA 3I0SA 2L3RA 4LY7A 4KPYA 1WAFA 1FKPA 3EAEA 2G8KA 3KD5E 2HMIA 1NOYA 1NK5A 2EFIA 3VQQA 4OVLA 4C5GA 3KKSA 3KK1A 4CFBA 4N4HA 2Z1GA 1MU2A 3VQEA 4CJWA 2RPIA 1UA0A 4C8KA 4CFAA 3C6TA 4ZTFA 3LLRA 3DLKA 3VQ9A 4RW8A 3E9FA 3Q1JA 2P0KA 3K5MA 1Z25A 4O5BA 2QKBA 3KLGA 2O4XA 4B9VA 4E7HA 4LH4A 4FJKA 2DAQA 3L2WA 1T7PA 5HROA 3NF6A 2G8VA 2O4IA 2G8FA 4FJNA 3NH0A 2FC0A 2D0AA 3IS9A 5HBMA 1NK4A 4BWMA 4DSKA 1HMVA 3DLGA 4IUTA 3H8ZA 4OLAA 3M8SA 4W5QA 3K2PA 2QXFA 4PUOA 1VSIA 2ITGA 4UQGA 1JL1A 1VSEA 2P5OA 1TL1A 4CF8A 4FK2A 4OVAA 4DU1A 4DFKA 1NK7A 4QQ6A 1D9FA 4CK1A 3QIOA 4B8CA 4F3TA 3RMAA 1J5OA 3SV4A 4CHOA 2Z1HA 1L3TA 4AILC 3CM6A 3UWNA 3VQCA 3AVIA 2AJQA 2VG7A 3RR7A 1L5UA 4W5NA 3MEGA 1LW0A 1WSJA 4CJSA 3OJUA 4OPJA 4Z4GA 4E89A 2ZQBA 2P1JA 4M42A 2IGIA 4DF8A 3DLHA 1KVAA 4CECA 2FBTA 4OKKA 4IUUA 4J2BA 2A1SA 2LTOA 3NH1A 3FEOA 1CZBA 2VG6A 3AO3A 3HSTB 3IRXA 3ZSWA 3WNHA 3MXMA 1HPZA 3HPOA 3LZIA 3L8BA 3ZSVA 4KHUA 5J2QA 3KLFA 3NNQA 1N27A 1S6QA 4I9LA 4KI4A 3QEXA 4Q5VA 4ID1A 1RT6A 4M3RA 4KHNA 3C6UA 1JLBA 1ZBUA 1KFDA 4AH9A 1G5VA 4CERA 1QSSA 4RW6A 1VSHA 3OYGA 3AO4A 4FJ7A 1HQEA 2B8AA 4OKEA 2MWOA 3FC3A 1KLNA 1YT3A 4CGIA 3CQ8A 2X6SA 2JGUA 2IS3A 3D45A 3DB3A 2BDPA 2RHUA 3VA3A 3HO1A 2XO7A 2Y1JA 4HVJA 4GMJB 1RT1A 1HJRA 1X1PA 4M45A 3VQ8A 1KLMA 4E7JA 3V4IA 3RWUA 1WGSA 1C1CA 2X6NA 4FLXA 3TARA 1QHTA 2PY5A 3SNNA 5KRTA 3HL8A 1U49A 4C8OA 2QK9A 2O4XB 4NYFA 4LD6A 3SUOA 3NBPA 3MEWA 4Q0BA 4FZZA 4PY5A 3OYMA 3DOKA 1HYVA 4KHQA 3RMCA 3WNGA 5KRSA 2HNZA 3K5NA 2JLEA 2VWJA 3CFRA 3SQ4A 3TI0A 1A5XA 4UC4A 4IUVA 2E6LA 3PO4A 4BE1A 1TKTA 2P51A 4FL6A 3V6DA 2KW4A 4KTZA 3HP6A 1U47A 3KLEA 4OKJA 4CGFA 4FM2A 3K57A 2XHBA 1T03A 1JLGA 3K59A 1SV5A 2YNFA 4OGCA 1ZYQA 4KREA 1I3AA 4OLBA 3ZSXA 1B92A 4CRIA 1QQCA 3OS2A 1LAVA 3U6FA 2R57A 3PX6A 4FJ9A 1SL2A 5CY4A 2FBXA 1WSHA 1CLQA 3TAQA 1NKEA 3UT1A 3QLHA 4FLUA 4YNQA 4IDKA 3QNNA 4AHTA 2YNGA 4PLLA 1Y97A 3LPTA 3MEEA 3GOXA 1S1UA 3E9GA 1VRUA 3E01A 3LAKA 1FXXA 3RTVA 3ZT4A 3LZJA 3RR8A 2DY4A 1Q8IA 3QESA 4L8RB 3AVFA 4BE2A 5J1EA 2D5RA 3PUFA 2OPPA 1BI4B 4CIEA 1VK0A 4TSXA 2RHZA 1S6PA 3LPUA 2VYTA 4QQDA 5HRSA 1X9SA 3NGZA 2RJDA 3KLIA 1C0MA 1TKDA 4N56A 1X9WA 1NKBA 2XDPA 4CIGA 1L3UA 1HYSA 1C0UA 2IDOA 3L2UA 3AO2A 3VQDA 4W5RA 1REVA 4FLYA 2GF7A 4M3XA 1S1XA 2HHSA 4FJGA 4KHWA 2QKKA 1JL2A 4C5EA 3LALA 4OPKA 3KKRA 4DTMA 1RT4A 1TKZA 2X78A 5J2NA 3OYJA 3CYMA 4EZ9A 3O3HA 1RI0A 4Q5WA 1XNIA 3KIOA 2DIGA 1S5JA 4FYDA 3PO5A 1FK9A 1RBTA 4IG0A 1RT2A 1ZBHA 3LWLA 5KTQA 1NJZA 2HHWA 1S1VA 1NK6A 3AVJA 4BACA 2RI5A 2YNIA 1RNHA 5CYQA 4B9WA 2W42A 4N5SA 3THVA 4A4HA 3VQAA 2R5MA 4DQPA 2E4LA 3T3FA 3AO5A 4FCYA 2HHTA 1TVRA 1RILA 3B6PA 3VQBA 3TAEA 2L8DA 3AVAA 4LH5A 1MHNA 1FKOA 1JLCA 2R7YA 1EETA 3OB9A 1F21A 1JXEA 3F70A 1RBVA 2BKDN 3K58A 3ZEHA 2CKKA 4O0IA 4FU6A 2YNHA 3ASKA 1RTJA 3LP1A 1WNSA 1Z26A 4Z4HA 2F96A 4IURA 1NOZA 3TR8A 1BIUA 4CEBA 3I0RA 1D5AA 2GFUA 5I42A 1IG9A 1C1BA 4JS4A 4N47A 4CESA 2PZSA 4DU4A 1C6VA 2RJCA 3LAMA 4PA1A 3CEYA 3S3MA 4E0DA 1X9MA 5HRRA 3LYIA 4ZHRA 4BE0A 4B9MA 3U3YA 3BGRA 3DM2A 1XI1A 1Q9XA 4I2PA 3C4SA 4DSEA 2F8SA 4BD3A 2ZD1A 3MEAA 3QO9A 4NCGA 5KI6A 1KSPA 2RJFA 5IN1A 2GV9A 1JLFA 3G10A 4CE9A 1EP4A 3QEWA 5KGXA 4FXDA 1WJSA 3ISNC 3AA5X 3AVLA 4FJHA 3L42A 4DTJA 3L3VA 1LWCA 4X34A 3L3UA 1CXQA 3TABA 1IKWA 3ZSYA 4CJ3A 4B9UA 3LANA 3P5JA 3OMGA 4ELVA 3D0PA 3M8RA 1U45A 2BUDA 4DTNA 3OS0A 4DQQA 2EQUA 4CJ4A 1QSYA 4EDUA 4W5OA 1EKEA 3S3NA 2PYJA 3V81A 4FM1A 4J2EA 1OZ2A 4DWIA 3IAYA 1BHLA 3HM9A 4CJ5A 1RTDA 4KO0A 4HCBA 2BE2A 4CK3A 3U3GA 5FROA 4AHUA 1UA1A 4G1QA 3G0ZA 3DB4A 3SZ2A 4FVMA 1RBUA 4ICLA 2KZZA 4PLIA 4LSNA 2HHVA 4FK0A 4ZTJA 1RBSA 1TK8A 3ZT0A 3SUPA 2M0OA 3DLMA 1T8EA 3NF9A 3WNEA 4M3WA 1SL0A 1CZ9A 3NDKA 2EKOA 5FRMA 3M9QA 3KK3A 2P5GA 3OQ5A 2DTUA 1RT7A 2Y1IA 5SZTA 1XHZA 2D0BA 5D3GA 2RKIA 1HNIA 2YRVA 3RRHA 4NYNA 3H08A 4M3TA 4DQIA 4CFDA 2HNDA 2HW3A 2DIQA 4C5IA 3V9UA 4CHZA 3BDPA 4KKOA 4QW2A 2RF2A 1GOBA 1TAUA 2M1HA 4DTRA 3VQ7A 1UWBA 1U04A 1C0TA 3K5LA 1B9DA 4CHPA 1TGOA 1LV5A 2RO0A 2XY8A 1H3ZA 1BL3A 1YVUA 3SV3A 2OPRA 4CJUA 3NTIA 1J54A 2FHDA 4FW1A 3QBYA 1N5YA 3CG7A 1RBRA 1RDDA 2YV0X 2F5KA 4CJQA 5CZ1A 4CF0A 5KH6A 3MXJA 2HVHA 1UAXA 4DQSA 2G8UA 1TKXA 3PX0A 4DSIA 1VRTA 1R0AA 2NLUA 4C8MA 5CZ2A 5D6YA 3ZT3A 4CIFA 3TAPA 3ALYA 1XWLA 3AVGA 4L59A 3VQ6A 5HRNA 1VSLA 2EX3A 3O4NA 4CFCA 1HYZA 4B3OA 4XIUA 3SQ0A 5EU7A 1I39A 1KCFA 1ZBLA 3QEPA 4DF4A 2YHAA 4E3SA 1QTMA 5DMRA 3EZ5A 2WOMA 1XC9A 4DSFA 4Z0UA 4JS5A 5JS2A 4CJPA 1BGXT 4E1NA 4CJVA 3OA6A 3P8HA 3QEVA 3OYFA 1SKRA 2QQRA 4F8RA 3L2VA 1ASVA 4CF9A 4JLHA 2L89A 2RHXA 1KFSA 2XY5A 2XY7A 1JLAA 2GFAA 3OYKA 4N76A 3NF8A 1BQNA 3MEDA 5KGWA 4F3OA 3OYLA 4AHRA 2XRIA 2XK0A 1IKVA 1KTQA 5KCHA 2MWPA 4AHSA 4KB0A 3ZSQA 1S1TA 4DU3A 3NHGA 2IAJA 2KFNA 4A4FA 4OJRA 3PX4A 4A4EA 2HB5A 4QAGA 3EYZA 2DFFA 3NGYA 4DS5A 3PFSA 3AV9A 3TANA 4EP5A 4Z4CA 1L3VA 3QJ6A 4CEFA 4QVZA 3HVTA 1XHXA 4HUFA 4CEEA 1IH7A 4EP4A 2JZ2A 4FM0A 1WJRA 4EZ6A 2KFZA 3QNOA 3P1GA 2E5QA 2YKMA 1IKYA 3FFIA 3OYAA 3K5OA 3ITHA 3IG1A 4DTOA 4AHCA 4IG3A 4HCCA 3AVMA 1QS4A 5C42A 5I3UA 1A5VA 1ASWA 4H4MA 4NZGA 3F9KA 4ELUA 4R5PA 1LAWA 1BCOA 3DI6A 4B9LA 2YKNA 4O44A 2BGGA 3T1AA 3TWHA 4CEAA 1OI1A 3DMJA 4HUGA 4FZYA 3RMDA 4C8LA 4KHYA 3M8PA 4N4IA 1G15A 3V1OA 2M16A 5J26A 4C5HA 4C8NA 4HUEA 3JYTA 3ZSZA 2VWKA 3MP1A 1LW2A 4DSJA 2EQJA 3QERA 1LWFA 3V1QA 5JS1A 3SJJA 4F2SA 4RG8A 5IAYA 4CHNA 4IBNA 3KK2A 1JKHA 3SCXA 3LP0A 1NK9A 4CHQA 4Z4IA 1RDBA 1KVCA 4FW2A 4WE1A 4BDZA 2EQMA 4DTPA 4IKFA 3LH0A 3VQ4A 3SD4A 4DTUA 4W5TA 3O3FA 4B08A 4IUPA 4K8XA 1VSDA 1IO2A 1CXUA 3QINA 1NJYA 4YFUA 4FLVA 1NJWA 3C94A 1UOCA 1ZBFA 2JTFA 4DTSA 4MQ3A 4O0JA 2OA8A 2GBZA 4I9QA 1ASUA 3ZT1A 3NCIA 3NE6A 3OYCA 3QETA 3OYIA 4KRFA 4RG2A 4E1MA 1EX4A 2XY6A 1K6YA 2O4GA 3AVBA 4B9SA 3JSMA 3ZCMA 3TAMA 4PQUA 1NK0A 3M8QA 4O4GA 5HP1A 4RW9A 3AVCA 4CCHA 1GOCA 3VA0A 3V9SA 1VSKA 3QIPA 3SQ2A 4FJ8A 5KE3A 4Z4FA 2HHQA 4MFBA 3NAEA 1U48A 4I7FA 1RDCA 2R5AA 3MAQA 1ITGA 4BDPA 4ID5A 2YHBA 3SUNA 3SUQA 3P8DA 4JRQA 2KQ2A 5K14A 2Q3SA 5E41A 4HHTA 2X74A 5T7BA 4FJXA 5DK5A 1SL1A 3MXIA 2HHUA 3P83D 2HQEA 1GOAA 4KHSA 2G8HA 2HHXA 3MP6A 4NS5A 5FDLA 3MEVA 4M3YA 4DSLA 3DRSA 1TK0A 4BDYA 4LD0A 3RMBA 4ELTA 3AA4A 5C0MA 3NH2A 4OGEA 2PYLA 3OMCA 1S9EA 1DTQA 4CGJA 4IFVA 4F4KA 4E7KA 3META 2GUIA 4FJIA 4M3ZA 4Y1CA 3SPZA 4II1A 3O4QA 4E19A 3C95A 3LX7A 4DLGA 3CFPA 3SQ1A 2B5JA 3LWMA 1WN7A 1VSMA 1BISA 1LWEA 3MEUA 2RN2A 3CFOA 4FJJA 4CJRA 2FBYA 4CJFA 3NFAA 4N41A 4KTQA 3O3GA 2DFHA 3SI6A 2IG0A 1DTTA 3OVNA 3ZSOA 4K8ZA 3LDSA 3VQ5A 4E7IA 3FLGA 1KHCA 4F2RA 5KE2A 5J2PA 1OYXA 3LGLA 5C6SA 3SPYA 3S3OA 1WSIA 1L3SA 3DRRA 1BI4A 4HCZA 2IC3A 2RJEA 3HT3A 4CEOA 1T05A 4CEDA 4DFMA 2OPQA 4JRPA 3OYHA 2B6AA 1QSLA 4B9XA 1SKWA 1SKSA 3NGIA 4CK2A 3S6WA 2F8TA 1D8YA 2K3YA 3MECA 1ZBIA 1HNVA 3DYAA 4AHVA 2OZSA 1W9HA 3ME9A 1NK8A 4Y1DA 4M41A 4J2DA 3HK2A 2RHIA 1WSEA 4FLZA 1BCMA 4I2QA 3OYEA 4KAZA 2E6NA 4DQRA 4QOZB 2G3RA 5HRPA 1J53A 1A5WA 2ATQA 1N6QA 3PMIA 1RTIA 1WSFA 4NCBA 2WONA 4FJLA 4CF1A 1SSFA 3OYBA 2HNYA 2FBVA 4CJKA 3HYFA 4B9NA 2HQXA 2R58A 3FDRA 4GW6A 3H6ZA 2ETJA 1HQUA 1WSGA 1JXBA 2B4JA 3MP8A 3PMTA 4J2AA 1BQMA 2OZMA 3AVHA 2LRQA 3VQPA 4DFPA 5SWMA 3NTHA 3PY8A 2OYQA 4PL6A 2Z1IA 2G8WA 3NTKA 2X4YA 3HJFA 1D9DA 3SYZA 2LSNA 3DRPA 2LDMA 3OYNA 2BIVA 2IOCA 4DFJA 1YTAA 2E6MA 3AA2A 3ZT2A 1KRPA 4B8AB 3S9HA 4KFBA 3KUFA 2WACA 3L2QA 3HXMA 4KV8A 2X4WA 5J39A 5CYMA 5C25A 4NCAA 2RI2A 2EQKA 2X4XA 3AO1A 3TAFA 4QQGA 4FLTA 4B9TA 4GVMA 3OYDA 5M9OA 4LSLA 3WNFA 1EXQA 3BDLA 1JLQA 4CHYA 2OPSA 3V9WA 4FJ5A 3KJVA 4GY5A 3ASMA 2RHYA 3HPGA 3LP2A 3A2FA 1NKCA 3ULDA 3KLHA 1VSJA 3EY1A 1RT5A 1KVBA 1TAQA 2VG5A 5HLFA 3VN5A 3KTQA 3QKJA 3T19A 2HVIA 2BANA 3CM5A 3OS1A 1TL3A 3HP9A 4DG1A 1O1WA 1W0HA 4FZXC 3I8DA 3HPHA 3LGFA 1J9AA 3V1RA 4CJEA 3QIIA 4CJLA 4QCLA 1DLOA 5C24A 4CEQA 1NJXA 3V9XA 1SUQA 3B6OA 4KI6A 1YTUA 4BWJA 4H8KA 1JLEA 2RI3A 4IFYA 3ZSRA 4CF2A 1S9GA 3DLBA 4CGHA 4RW7A 2I5JA 4Z4EA 2QQSA 3V9ZA 3HVRA
chains in the Genus database with same CATH superfamily
3DLLF 4HTUA 4IHYA 2VBZA 3TEEA 3GF2A 5EZGA 2EW3A 2EJGA 4DYRA 3PNYA 4DMNA 4C0DB 4FLWA 4ILGB 2A05A 4Z02A 4P96A 1LOTB 1BR4A 3QEIA 4W1UA 3CCQT 1WPKA 2R0QC 5C10A 3RSEB 2JVVA 1BIZA 3CCET 1S72T 5E18F 1RC9A 3DPLC 2ESWA 3IMXA 2F4IA 3MO8A 4G6DA 2D2WA 2Z1JA 2AKKA 2ECCA 5J3LA 3PUBA 3PIPF 3A02A 1HW1A 3JSPA 3HG9A 4N0AC 2EFNA 4KTWA 3RZDJ 3OJSA 1WLJA 2K7AA 2H94A 5D6WA 1AKHA 4LDVA 4V2GA 1WHHA 4FOEA 3TAGA 1ZSZB 3FF5A 4PWDA 3OWTA 4OMQA 2IVOA 2W1OA 1NG9A 1RTHA 4CGGA 5C44J 2IP2A 1Y57A 4CJ7A 1ZUKA 4UOBA 3VYGA 2DLPA 2EIFA 5J2MA 2JHJA 4JK8A 3JAMK 3PSIA 2D9TA 3FXQA 3CD6Q 1TSFA 3WG9A 4NC8A 4BY6C 3ID8A 1YBYA 2NYSA 5EVZA 1WJQA 3CZ6A 3GW2A 3W2WA 3JCMJ 2VC0A 4DEXA 3AVNA 2F9WA 3DLEA 3GTJJ 2ZPBB 3I0SA 2L3RA 3GNGA 1EH6A 3EAEA 2ZPGB 1P4XA 4C8QE 9ANTA 1KQ9A 1APLC 2LJ1A 2IIMA 2XU8A 1HUXA 1EZZB 3BR1A 4EEFG 2YG8A 3HEFA 3EG1A 1N75A 5HVQC 5D5WB 3KK1A 5LL6S 1JRIA 2Z1GA 2RQVA 3BPXA 5KYXB 2LBFB 1MJBA 4HNTA 3LAJA 3C6TA 4ZTFA 5FLXE 5GAN5 3LLRA 1K73R 4RW8A 3Q1JA 3ZX0A 3CJNA 1Y8RB 2JMCA 3P39A 1PKTA 2O4XA 3G71Q 2DO3A 4K11A 2QUFA 2EIJH 4CYCB 1HKGA 1IUFA 3NF6A 3HHTB 2G8VA 3PQKA 2O4IA 2P4WA 1U6ZA 4Y3OA 3S1MJ 4S05A 2D0AA 5E3NA 3IS9A 3H1QA 3TO7A 5HBMA 4K25A 1NK4A 2OU2A 3P4IA 4C0DC 2M9HA 4I0BA 1FMKA 2EFWA 4RB3C 2JJ7A 2CZ7B 1XCVA 2QKLB 1Y0MA 5LBQA 2EZLA 3N4QA 2P0WA 4EHTA 2XAJA 1R23A 3TMOA 2R7WA 2JTVA 1AHDP 1OR7C 1IN6A 1Y39A 1EIFA 2DA4A 3SEZA 1RUWA 2HOTA 2QXFA 4PIIA 3UKUA 1HD3A 4JI0K 1FY7A 2EV0A 4CBWA 1JL1A 2IBDA 4OMZA 2E1NA 1TL1A 4CF8A 4OVAA 4DU1A 4DFKA 3H9GA 2HL3A 4BBSJ 4QQ6A 1NK7A 4FYWB 3N97A 4YHHK 4EM2A 1U06A 3LSPA 3HTRA 2CGLA 4JAXA 1C0FA 5GAHJ 1UJYA 1VQKI 1UHWA 1YJNT 3HB9A 2Z1HA 4GV3A 2YU9J 2QWWA 3GTLJ 1B1BA 2XV4S 4HT8A 3RR7A 1BM9A 1L5UA 4G7OF 2FEIA 4FPAA 5FKNA 3GTQJ 2JA8J 2MH2A 3H1VX 4BXUA 2FD5A 2GZWA 1XSXA 2HS5A 4CJSA 4Z4GA 2MABA 4ELZC 2P1JA 4BQZA 4DF8A 2W41A 2CREA 4IUUA 2DF6A 2R5YA 4I76A 3TSWA 2DTIA 2KZGA 3AG1H 3IH4A 4A61A 5BN8A 2P0PA 2HQ5A 3CDIA 2STTA 4AT1B 2PVOB 1CZBA 3ULRB 4DZJA 3AO3A 1VQNA 1OCCH 3JCMg 3HSTB 3QP5A 2WWYA 1FPQA 3W6VA 4IWVA 3I4MJ 2Q2EB 3G1JA 2NXNB 2XB0X 3AARA 3CCSN 4UUSA 1XGSA 3RQ4A 3CCRT 3LZIA 2EWSA 4BUPA 1ORPA 2P9PB 3L8BA 4XU0A 4KHUA 3C7NA 5J2QA 3F8CA 3BEXA 2DXTA 1N27A 2K4YA 4J9DA 2YLBA 4HSRA 1RT6A 2VQFK 2XICA 4KHNA 3C6UA 5HOOA 1JLBA 3I0WA 3IKMA 2DVJA 1MH4A 2KY9A 5B3SH 1RKTA 3VWBA 5ICEA 1VSHA 5M5XJ 4G6QA 3OYGA 3AO4A 4BGDA 4AYBN 3K2ZA 1N5ZA 2BV6A 2LKPA 1WJCA 1IN5A 1YJ9N 2BW3B 1Z6RA 3H41A 4M77F 2KRNA 2IXSA 3CQ8A 2X6SA 4KITB 3I55A 2MK5A 2K9GA 3FHZA 3DKXA 3HOUJ 5L3GA 1QZYA 3THXB 1KG4A 3ECOA 4HVJA 4GMJB 2EGCA 4RTYA 4JJCA 3VQ8A 3IDHA 1KLMA 2DPNA 2YUNA 2JTMA 3ABUA 5DM6F 3FMQA 3HTSB 3RWUA 3DKWA 1JJ2M 4RMOA 1SVLA 3CCJT 3ESWB 1LPLA 2GWKA 5KRTA 2VT2A 5D5XB 3GL1A 4C8OA 3RIRA 2JVGA 2GOMA 2O4XB 3I5RA 3A03A 3WTUC 2L9SA 3GXOA 5D7UA 4LGWA 2H1LA 1MMGA 2IGOA 1YQLA 3CVTA 1WNLA 3MEWA 4DHYA 4Q0BA 4FZZA 1WBBA 4PY5A 2E2PA 1OOTA 4CZMA 3OYMA 3DOKA 2K9MA 3HUGB 1YAGA 4P9FA 4KHQA 1A0NB 1ETOA 5KRSA 2HNZA 3HFOA 2VWJA 3CFRA 2SRCA 4QLCU 4CBUA 2FG0A 1ZREA 3TI0A 1KAZA 1KQSA 3AG4H 5FLMJ 4UC4A 4M73A 3I33A 1UG0A 3N5NX 4ESBA 4BC2A 5KYNA 1XGNA 2FE3A 4MMLA 2A6AA 2GGRA 5HLGA 4L6V5 3KLOA 2YDLA 3U1KA 3HSFA 3EKUA 4JI8K 2F4OB 3CXCP 2XHBA 2IVPA 1BI2A 4BI4A 2X51A 1P59A 3BZCA 2YNFA 1YJWA 5CK9A 2QVOA 1WX6A 4KREA 4DOWA 3W2VA 3ZSXA 3OS2A 3BDUA 3U6FA 2COBA 1BOTO 2NRRA 1QVUA 1CLQA 3TAQA 3UT1A 4MLHA 3A1YA 3QLHA 3HDDA 2HMPA 3CCSQ 2Z5UA 4YNQA 2LG4A 4L0YB 2CH4W 2YI1A 1VQOA 1R4NB 4PLLA 1NGGA 3JCMc 1BI3A 3GOXA 1S1UA 4XL9A 1KQJA 2ZJQL 3F3XA 1TT5B 2KAFA 4DJAA 2I10A 3I55N 2IS4A 4IHVA 4RB1A 2OFIA 1IV8A 2OA4A 3LZJA 5JR3A 3E5UA 1KQSM 2K4JA 2HEOA 1ZXOA 2ED0A 3M54A 3E6MA 4R55A 2KT1A 2COWA 2LTPA 3LL7A 1EF4A 3OIOA 3KTUA 1BI4B 3KZZA 1YJ9Q 4TSXA 3BQYA 3M4YA 5AQNA 3U8XA 2R7XA 2EYYA 1R59O 4QQDA 5HCKA 5HRSA 1DPRA 1Q82C 4F7ZA 1N77A 1C0MA 1TKDA 1X4OA 2K5LA 3QG1A 1K83J 4Q48A 3FFKB 3BC8A 1QGPA 2NZTA 1HKSA 2KSSA 1K73O 4J9GA 3L2UA 3M0SA 3AO2A 1OVYA 4QT7A 5M1QA 1ZTRA 2L01A 3I35A 3FXOA 2X6YA 2I7NA 2ZJ2A 4H0YB 3SK3A 3WXKA 4I0AA 4N9IA 2EGEA 3G4SI 5LHHA 3C1DA 1O3SA 2P8TA 4KHWA 2O8BA 4P5NA 2QKKA 1JL2A 1PC0A 2H8HA 4DTMA 2BZYA 1NGNA 2X78A 1MNEA 3FZFA 2Z2SB 3KNTA 4EZ9A 5HDKA 1Y1WJ 1YJWN 4EGYA 4A2AA 1YHQT 4DV7K 1ON2A 3LA7A 3G4ST 2FRHA 5FWCA 4EAHD 1U3EM 4BXXJ 2H56A 4IG0A 4MTDA 4JKAA 1ZBHA 2CZ6B 1WDXA 2AO9A 1KSWA 1WCMJ 2HHWA 2RI5A 2CRGA 3FISA 2QSHX 3DEWA 1N9RA 1WBDA 1X2NA 1VQ5A 2CW7A 3H3ZA 4JJNK 2JVHA 2LNVA 2HQAA 3O4WA 2R7UA 4BRPA 4C8QA 2K79A 4LH5A 1HNXK 3CMEQ 1JLCA 2LX9A 3BFMA 1EETA 3KEOA 3CUOA 2P9LB 1OCOH 2JUGA 1XJWB 2BKDN 2KKOA 3ZEHA 2CKKA 1VYVA 3JTGA 3C7JA 4XKWA 2KLOA 4BRNA 3K1MA 2YNHA 1NPRA 4J83A 2EIMH 4M3GA 1HJOA 3QBXA 1HJDA 1HDPA 2C6YA 4IURA 2NNNA 1MGTA 4BQNA 1AZGB 1ZG5A 5FPNA 3QZ5B 4YIIA 4XH4A 5I42A 4OF1A 3HKZA 1IW7F 1Y0UA 1PNJA 3OL3A 4M7AF 5GAN6 4IIOA 4ABZA 4CESA 1BL0A 8ATCB 1ZGWA 4KDPA 1K8AU 4E4HA 2CH6A 4LDXA 3E5XA 3LAMA 1QQNA 2FMLA 4N0BA 3S3MA 5HRRA 4H0VB 2OTLT 2VWFA 1N3AA 3BGRA 3DM2A 3THYA 4I2PA 1KG7A 3QXEB 2BXZA 1MWMA 4PUSA 4BD3A 4FT4A 3MEAA 2VGMA 4L0ZB 5KI6A 2P9KA 2A6EF 2DEQA 4YY3K 4JK9A 3O9RA 1R00A 4M6YA 1JLFA 5KGXA 3DPTA 1QQOA 3A4CA 2E3HA 3JCMh 4A4KA 1N8RR 1TWHJ 2NRVA 2OANA 3AA5X 4FWRA 2RKHA 4QPOA 4BRGA 4DTJA 3L3VA 3VGKA 1WVRA 2H09A 3R61A 2DODA 3TABA 3S8PA 4JI7K 1D3BB 4HOBA 3LDPA 4JKEA 1VQ4A 3ENBA 2LD5A 1Z7UA 3ASOH 1OLTA 3M8RA 1V29B 2ZMEB 5H20A 2QYZA 4LUDA 1RLQC 2QQAA 1SEMA 2DYBA 4KH6A 2KIUA 2WC9A 1X6OA 2FUG2 4L5JA 1AOJA 1ETVA 4NB4A 1M90U 2J6FA 2YG9A 2XUBA 3IAYA 2G7UA 5DM7L 1SPKA 2K3FA 5AR0A 3TO6A 2HNIA 3GIBA 1CZAN 3WVEB 1X3ZB 2M0CA 2E65A 2L7FP 4BY9C 3VTHA 3SFZA 5CQXA 3A5NC 2O8BB 3SZ2A 2E70A 1G3WA 2UZKA 2DERA 3QU6A 1H0MA 2OAWA 3NMUA 2F5FA 3ZEUA 2DMUA 4F04B 1JCGA 1ZBSA 2FSWA 2HHVA 3HKZN 3ZT0A 5JLWA 1P7IA 2RGVA 2ZGYA 1PKSA 4M78C 1V55H 4HX8A 3DLMA 2A28A 3X25B 4LF9K 3NF9A 5CHIA 4WQ5C 3CWAA 5GADJ 1CZ9A 1XGOA 3KK3A 3J81O 4AG1C 5KVRA 2DPUA 4GLKA 5GMKm 3QPTA 4QS7A 5KPTA 2JNGA 3FBIB 3CMAI 1GLBG 1YIJQ 3RMQA 1JT0A 2VJJA 4B3AA 4NYNA 1V5EA 3QBWA 5BRFA 1WI3A 2HNDA 3W2AA 2LJ3A 2DIQA 4RAZA 5A0GA 1QP3A 4QW2A 1GOBA 4AMCA 3WEEB 1KQ1A 4C8QB 1RACB 3BF1A 1KFZA 3K5LA 3J7YP 2JSPA 3E66A 4M7DF 3CMAT 4QPQA 2B0LA 3RYRA 3J7AP 2QG9B 3A8YA 2XY8A 5BPIA 5DEQA 1ZG1A 1GXPA 5KPZA 4A5MA 2E1CA 5KCMA 5TKWA 3H3NO 2KRFA 1BUPA 3DBLB 1Q81U 1DJ7B 1YCYA 4GLMA 4DW6A 1V76A 2LQWA 2F5KA 3LQQA 4Z8AA 1MBGA 4BR2A 1Y56A 5DM7F 5KN8A 3HKSA 3FK6A 2FNAA 1M8MA 1BIBA 1TUCA 5CQGA 4C8MA 5D6YA 3TAPA 2ZMEC 2HQRA 3N05A 3R3LA 3ZQ7A 1XWLA 4WXDA 4BNCA 5AQRA 3VQ6A 1TUYA 2RV8A 3BR6A 4BGAA 4VUBA 1RESA 2M3AA 1YVNA 3AGKA 4B3OA 2JT1A 2VQHA 3EHQA 4XIUA 5EU7A 4A59A 2IA0A 3HM8A 1T08B 2A5YB 3ZQGA 3BJAA 4DF4A 2VVKA 4PFZA 3CCVN 1W7PA 3VS2A 4E3SA 1VA7A 2DA1A 1QTMA 5LJ3j 5EF6A 2Q0OA 2BGCA 5KQDA 3TSUA 1M3HA 4CYDA 4A54A 5E26A 4JS5A 4Z0UA 3G73A 4M3FA 2EPDA 4CJPA 3LWIA 3LDLA 4JDSA 4OWRB 1U8BA 2PG4A 5E1ZB 5JVHL 3OYFA 4KFCA 2FSKA 1SAUA 3F10A 1SKRA 3HOYJ 2QQRA 4HDVA 1V5GA 3CCQA 1K8AR 3CETA 2L89A 1TH7A 2RHXA 2R4GA 1SAZA 2VT3A 3CCEA 3AFHA 4CZJA 1S72A 4XRSA 2L3QA 2R5ZB 5K7ZA 1JLAA 3PFYA 3NF8A 2JRTA 3JRFA 1M1GA 3FM5A 4H0EA 3L1AA 1T95A 2KMUA 4F3OA 3T9NA 2UUZA 3WVDB 4X1VA 4H03B 2XK0A 2QXLA 1TYQB 5LMUK 2FBKA 2Z9OA 2CDTA 4XU1A 1M1KU 5EC7A 2M5WA 1U9NA 2ASPA 4KB0A 3CP2A 1SHGA 1MW7A 2D1KA 4DU3A 1VQLN 3NHGA 3QFUA 4NUBA 1MIJA 4C0FA 2ASOA 3PX4A 4EMKA 3PTAA 4PL7A 2ELHA 3HRUA 3ZEUB 3NGYA 1VQMT 2PX9A 3KP3A 2V7YA 3CF5F 1OPKA 4KT5C 1XHXA 3VEXA 4CEEA 1YRNA 2E6ZA 3NWTA 2JZ2A 4FM0A 2GWJA 4II3A 3QNOA 5LJ3d 3H0HA 5AQIA 4I2OA 1ZQ1A 1NYFA 1P90A 2E5QA 2YKMA 1WEGA 5HK0A 2V6CA 3E6DA 2UXBK 3S1QJ 2EYQA 1NGDA 5J4VA 1VQPN 2HBJA 1GV2A 1QS4A 2MMPA 1JUSA 3VS7A 3CBMA 5C42A 3H6EA 3MMYB 3KEQA 1BR1A 4H4MA 2EZHA 4NZGA 2VOPA 3KZYA 5AQFA 3A1PA 3JTHA 1BOBA 2CYZB 3DI6A 1TQIA 2YKNA 1FJGK 2LC4A 4P55A 3TWHA 3FRNA 4CEAA 1OI1A 2L4MA 4XRSG 4CCNA 1IC8A 5TRDA 2HMAA 3M57A 4N4IA 4C5HA 1PUFB 1HA8A 1HNWK 2HZDA 2KR3A 4WCEL 1G4DA 3JYTA 1NGBA 3CCVQ 1MUNA 1NMNA 2BZTA 1OH7A 3ABTA 3DFGA 3AAFA 4B3SK 1N8RO 3K1PA 3QERA 3FE1A 2YU3A 5F64A 4KT0E 2PFBA 4MHGA 3JCMb 1NJIC 1USSA 1UB9A 3FJ5A 4RG8A 5JICA 2ZF5O 3FZHA 4HZFA 5IAYA 2YX4A 5ED4A 3R60A 2Q8KA 2K5FA 2NNYA 2CP2A 4IBNA 1JKHA 5KYWB 3M59A 1NK9A 2QA4N 5IOZA 4QS8A 2HDDA 1JHFA 5LEJA 2PU9B 1E17A 2NNWA 1YI2N 1IDYA 3X28B 3BE3A 2ZXWH 1AZEA 2LLKA 4YOWA 5J47A 3SWNB 1NPPA 1I50J 4MQVA 3DXMA 3RZOJ 5A2QZ 1KD1R 2GIZA 1VSDA 5KQ8A 5GAMd 1CXUA 3BQZA 2IGKA 1R7JA 1O3TA 1CQTA 4DR5K 5GPCA 2X6XA 1F1BB 3ATVA 1SC7A 2NOFA 1Y07A 3SMPA 1WXTA 4PKCC 4XTZA 1K9MC 1R22A 4B1ZA 1VQLQ 1AT1B 4I9QA 2DT6A 5EOYA 1ASUA 1IV0A 1USTA 5BPDA 2DOEA 3QETA 2FSJA 2OCCH 1S9HA 1J3TA 2XHKA 3M0RA 5IPAA 3JSMA 4NB5A 3U9GA 4CZKA 1GLEG 3JB9G 3QYBA 4O8KA 1FSHA 2KIMA 1VQKA 4RW9A 2CFXA 2KJBA 4CCHA 2AZSA 4WCGA 2YUSA 3ERMA 3ZRGA 1QO0D 4XK4A 1MBJA 5L23A 3D2EA 2HHQA 4BEHA 2LY1A 4MFBA 2K9NA 3O9SA 4KHPK 3KFWX 2W0ZA 4I7FA 1TW3A 4G9ZA 5E3MA 5FO5A 4BRFA 2RNAA 4WF9L 1I07A 1VQPQ 3DKMA 3GFLA 4IX7A 1TC3C 4ID5A 2BY0A 3J7YJ 1NGIA 3VV0A 1X1AA 1NEGA 2NUPB 5K14A 3K9TA 1N3CA 1EA3A 3PL8A 2Q3SA 2QQBA 1X01A 5E41A 2MFZA 4YDUA 2X74A 1TWBA 2ZJRL 5ELZA 1SMYF 4M9ZA 1U3OA 3MXIA 2HHUA 2EJ9A 3P83D 4PJMA 4IHSA 1EH8A 2H8RA 2O0YA 2G8HA 3MP6A 1VFCA 1YRNB 4HXJA 3VENA 4M3YA 4DSLA 4Y28E 1TK0A 5GANg 1LWVA 4ISEA 2CP5A 3RMBA 1LNXA 2D1VA 5GMKj 3PQJA 1JKPC 2FPEA 3TU5A 1W4MA 1M1KR 4IFVA 4E7KA 4M3ZA 1ATRA 2VJ4A 3SPZA 5M1OA 1VQ7Q 2JWTA 4MDXA 3KFVA 3SQ1A 2STWA 4RTVA 1WN7A 2QA4Q 2IAIA 1IHWA 3REOA 3CCLN 4JKCA 3ZMTA 1YI2Q 3F8FA 1BISA 3GTOJ 3SWNC 4CUGA 3MEUA 1I5OB 3CCUQ 5AQPA 1PU6A 1IXCA 3OOPA 4EJTA 4LFBK 3NVMA 3K9JA 3O6BB 1WXBA 3UKGA 2JJ9A 4EIKA 4CJFA 4HNVA 5F0XA 4HF1A 2HD0A 3CLQA 4CCLA 4BG8A 2DFHA 1IXDA 1Y64A 2IG0A 2WV1A 3WHBA 1BDGA 2YUPA 1E6GA 1TWAJ 3OVNA 1OH5A 4N4OB 1SD5A 1VQKN 3ZSOA 4XKBA 4PKGA 1BN5A 1B8IB 4BG9A 1FYMA 2VL8A 2QTVA 1N25A 1K4SA 2CH4A 4E7IA 2JS0A 4M3EA 1OYXA 4LG0B 3WTYC 5BRDA 2WFBA 3LCNA 3HRMA 1K8AO 1H1VA 4BRIA 3A5OC 3WHCA 2WUSA 3JCMW 1W2BS 3ULEA 1I94K 2YCHA 2ZJRF 4YOQA 1PG5B 2EQIA 2X1CA 3JRDA 2LF8A 1P8ZA 2Z0WA 2F6CA 4B9XA 4MEXF 3K6GA 3NGIA 3SB2A 3S6WA 3UE5A 2E71A 4RB0A 2VV5A 1VQ6I 2DI3A 2MLKA 3G1OA 5F0HA 2X0LA 1NK8A 3M0TA 1NGEA 2QLZA 4RGXA 3K1NA 1PCXA 1D1AA 1MMNA 1GVDA 1IAWA 2LZ6B 3E5QA 3HSRA 3BJOA 1GLLO 2G3RA 2A3SA 2DJZA 3WTXC 2ATQA 1VQ6T 1WSFA 2I8DA 4NCBA 1NG7A 2JPBA 3PT9A 4CF1A 3SDGA 2HNYA 2RK1A 2HI3A 4CJKA 3HYFA 5HLTA 4B9NA 3TSQA 4HQMA 4IQ4A 4XLEA 3ZMSA 1OKRA 1UHCA 4P5OA 3M7GA 4MIMA 2EQRA 3RBBB 3JREA 1UDLA 1IGQA 1D8JA 3H6ZA 4FWSA 4BEHB 3K4KA 4PJOE 1WSGA 3KHYA 4J01A 3OA9A 4UXNA 5CVRA 3MP8A 4J2AA 1F5TA 3L6QA 3MWMA 4HBLA 2D8HA 4DFPA 2OAZA 2E88A 1S1NA 1IRZA 5AIPA 2Y69H 1H89C 3NTKA 3CCLQ 3VU3C 5GAN4 3SYZA 1FN7A 3JR9A 3OW2A 2DL3A 2F9TA 2ESHA 1RKWA 1WPYA 3WU2C 1FNNA 2DCEA 5D4RA 2IOCA 5JLHA 2O8CB 1WXUA 4OB3B 4ZYHA 4A12A 4QTRA 1CF7B 1QVGM 5F0FA 3MN2A 2ZJPL 1ZR4A 5CYMA 4GKKK 2GNCA 5C25A 4U0VA 5M1NA 2IA1A 3DWLE 1UHSA 2X4XA 1Z77A 3CD6I 1WEFA 4LB6B 4GVMA 4LSLA 2BE9B 3JRGA 2JOYA 3G4SA 1WSUA 3MKYB 3VW4A 4KT6A 3V42A 2BVLA 1V4SA 1V4TA 4D5CA 2E36A 3F23A 1S7OA 4FSXA 3T1HK 5M5YJ 2Y30A 1JJ2P 2FRWA 3OSGA 4G8XA 3ML6A 4C2MJ 5GIPA 5DS9A 3CD6T 1O57A 3EY1A 1A35A 5J6XA 1RT5A 3DTEA 1KD1O 3DLAA 1J9IA 3LSMA 2BXYA 3KE2A 2ZNZA 1ESVA 1I1JA 2YS9A 3T1YK 3T19A 5BPNA 4MEYF 4CXFA 1MZBA 4RTTA 2LJ0A 1FOWA 2DYIA 4FL9A 4MMKA 4EA4A 5HS7A 1VQ8T 2FMYA 3ZCOA 4XTWA 3KBGA 4C8QF 3FM3A 2HZYA 1J9AA 5BN9A 5M5WJ 3DEUA 1Q1VA 3I56Q 3G71I 4CJLA 4QCLA 4CEQA 1NJXA 1UG2A 3V9XA 1SUQA 4HSBA 3E6CC 2D0NA 4M75E 3VDXA 5DD4A 3CJRB 2A41A 4H8KA 4NHJA 2ZC2A 2A07F 4O3MA 1I81A 5AFUA 4AU7A 4CF2A 1T44A 5LJ5d 2CGJA 3OTOK 4OIRF 3JCUC 2DA6A 3G71T 4V2FA 2WY7Q 3DU5A 4AVPA 3VETA 1ETYA 2JA5J 5HDNA 4KB1A 2ZJPF 3HSBA 4FVUA 3WGHA 3W6KB 4FK4A 2CV1A 4A62A 1OX9A 4A5BA 1IV6A 3O8VA 4IUQA 1HRHA 4CJTA 4Z2YA 4DTXA 1O7LA 5KCOA 1IN8A 1OZ3A 4XTVA 3ATUA 2DFEA 3DOLA 4XK8E 4RUGA 1HF0A 1ZHIA 2ZSIB 1VQNQ 1MBFA 2QBYA 2DK5A 2X35A 4EJVA 1FC3A 4F7UB 1TV6A 1XQOA 3FZMA 5AQGA 2VONA 1KQSP 1P2FA 5CIUA 3DLRA 2F69A 4FWNA 2X6OA 5DDGA 2J6KA 4A57A 3H3VK 2FOKA 4JYAK 2FBIA 3H45C 2JSCA 1ON1A 3CMMA 4O55A 1UGRB 3U4LA 4E1JA 1WAJA 1M1KO 2H6BA 2DMQA 4IJAA 2CS3A 2WTUA 3HSCA 2YHWA 2FX0A 4XLPF 5H6RA 2PJRA 5DYMA 3AVKA 4OMYA 4UNOA 4DS4A 3WXIA 2VXFA 4C3HJ 5F2RA 3K4LA 3G25A 5GP9A 3BTJA 3KXTA 4A4GA 1UB4A 4CEZA 4UB8C 2I0NA 4XOTA 1E3MA 5GMKi 2KTQA 4CD3A 5GANh 1GHCA 3CJBA 4DR6K 5LRSA 4RTUA 1NGCA 4H0PA 1RFQA 4WQ4A 2F5EA 2LOOA 5EGOA 2KQRA 4KPYA 2W57A 1WAFA 5CKEA 1FKPA 1EWQA 3QDKA 4FO0A 3HSEA 5BNGA 3R4KA 4PJ0C 1SFOJ 2LREA 1NGAA 3VQQA 1I3QJ 1TQMA 1IBLK 3BPVA 3CC4N 2NUTA 4C5GA 3KKSA 1IGNA 1UMQA 5LFAA 2XG8D 1AU7A 4CJWA 3GZ5A 1XQPA 4AI5A 3LOCA 1QWFA 2HKXA 2RPIA 1FMWA 2L5QA 1V54H 4CZGA 1SQKA 4C8KA 4CFAA 4JI6K 4A0YA 3CLOA 3DLKA 1KO9A 4JD2B 3VQ9A 1MDMB 1QCFA 2IVWA 2RN7A 3CCMN 2GWRA 2Y4XA 2P0KA 2WV0A 1FOYA 4LIVA 1Z25A 4LFCK 4J9CA 1P92A 3M53A 4LH4A 2DAQA 3VS3A 3I59B 5TGTA 3L2WA 5E1XA 4IZ9A 5DUKA 3NARA 4ZJZA 1UFFA 4DBQA 3EFRA 1ACIA 5GAGP 2F4MB 5E8GA 2A3LA 1ZRCA 3DLGA 3CMAA 4IUTA 4XLNF 3U9ZA 3CBOA 1B9MA 3KYCB 2O8XA 1HU0A 1Q82U 2V7ZA 5I9EB 4XKVA 1UGVA 3M8SA 4W5QA 4A3MJ 3GP8A 2ITGA 3WG7H 5CKFA 5M1PA 1M30A 1VSEA 3U1DA 3KEYA 2JUCA 3EG9A 4IDHA 1D9FA 4CK1A 3V8KA 4B8CA 4Y91A 1QZ6A 3E9LA 4F3TA 1JJ2S 4RMNA 1J5OA 4B1WB 4E7SA 2VC8A 2P9UA 1J6ZA 2JTEA 2QEXN 3GBQA 3OR1C 1R5ID 1GXIE 5EG0B 4B6MA 4AILC 1YF5L 4LFAK 1ZH5A 3R2XC 2AJQA 1P9QC 3RCOA 2K85A 4IXAA 3M1CA 2DK3A 4BKXA 1DKGD 4Y13A 2E8AA 5K5RA 2XAHA 2DJQA 1G2BA 1KU2A 4E89A 1D0ZA 4M42A 1DGKN 1ZAOA 1KVAA 5FD6A 3BG3A 4OINF 2W7NA 1RI9A 2A1SA 2LTOA 1YIOA 2ME6A 3D5SC 3A5MC 3O80A 4XEIA 3JCMV 4C92E 5LJ3e 1RL2A 1U5SA 1WJBA 3CCSI 3FEOA 5FJ8J 2EYXA 1T8IA 3CC4Q 3IRXA 2NOZA 4M7AE 1W1FA 3KWGA 2HQHA 3KP5A 3FXJA 3HPOA 2FU4A 2K02A 3RPQA 4FPBA 3GTGJ 1D1BA 1PHTA 1QZ5A 3NNQA 2NOBA 1R5HA 3HI0A 3PO2J 2EILH 1S6QA 3WTZA 3TPQA 2FSNA 1B4AA 3BT9A 3FHGA 1AA7A 3QEXA 1GLCG 3RSNA 4Q5VA 3CCMQ 4M3RA 3O5ZA 2ESNA 3LWHA 5F08A 2Y4YA 1ZBUA 4HTLA 1JE8A 1YJ9I 1G5VA 1SVOA 4G9YA 2H8WA 2X3WD 1PVEA 1Y6IA 2WSEE 4CC3A 5IT9K 3GDQA 2JHNA 1HQEA 2B8AA 1KQSS 2MWOA 2GUPA 3FC3A 2K9SA 1ZX6A 4CGIA 2E12A 4PJOA 3DU6A 2P84A 1M3QA 3SAHA 5J3BA 1YJ9T 3CXCM 1R4MB 3D45A 2CV0A 3DB3A 3VA3A 2BHZA 2XO7A 1HJRA 5JVGL 2AT1B 2IIRA 5EG2A 1GLAG 4M45A 2VBYA 4X9CA 2IA2A 4M71A 2LMJA 4E7JA 1UJ8A 1UFMA 2WAQN 4M78D 1QHTA 3M4OJ 2A3ZA 3UA7A 3HL8A 1U49A 2JT4A 2QK9A 4NYFA 2Q36A 3T5XA 3SUOA 1GUUA 4OFEA 5GAMe 4O8UA 3LSHA 4YEJA 1U8RA 1OEBA 1HYVA 3LA3A 3RMCA 1U2VB 2KFDA 3GTMJ 3M3ZA 1JEGA 2EB7A 3DWLA 3D4VA 3ZQHA 4OMNA 2JUFA 2KMTA 2BUPA 1A5XA 4B47A 4M77D 1WQ7A 4BE1A 1EH7A 1ULYA 1M9SA 4G12A 1LPQA 3HP6A 1OH8A 1VQ9N 1I27A 1U47A 2E5NA 4WCIA 4KH5A 3HOWJ 1WUAA 2A5XA 1T03A 3K59A 5L3CA 3A5ZB 2RA2A 2K2VA 1YE9A 4YRVA 4U88A 5ILVA 1SV5A 3JW4A 1YX3A 4OGCA 2CYYA 4HW0A 2QK0A 5IXFA 1ZYQA 1UUEA 1ZLKA 4OLBA 1QQCA 3VUZA 3LFKA 4FJ9A 3EFSA 2DPDA 1JU5C 3J80K 4D8KA 1WSHA 1BU1A 3ZQCA 3VMFB 4AQYK 4FLUA 3QNNA 2YNGA 2ZXIA 3NEUA 3L4QA 3ZL7C 3T8TA 1YN8A 3EGDB 2O01E 3LNQA 3ZX3A 1Q82R 2BY2A 2KT8A 2ZNYA 3W3DA 4YELA 2MCNA 3LAKA 5D8LB 3RTVA 3ZT4A 2NRHA 2HBLA 1Q8IA 3I55T 4M75A 3VODA 4AIAA 4AIDA 2XGEA 5J1EA 1W97L 4GDFA 2K27A 5FWBA 3E7LA 1WJDA 3H0GJ 4J7IA 3EN9A 1VK0A 2KVQG 3RR6A 4PSWA 4XRMA 3CO6C 1PUEE 2JWLA 1X9SA 2HVSA 1KGSA 1OX8A 3VEYA 2RJDA 2X6WA 4N56A 3FDYA 1BWFO 4KN7X 4RTZA 3OMYA 5AQUA 1ABOA 1FBUA 2CGPA 3OSSC 4DQ8A 2WSCE 1PSFA 1AWXA 3LW5E 3NFCA 4M6XA 4IZZA 4Q4ZF 5A2QE 2BVMA 4F9OA 1QMCA 4BRDA 4P9UA 2JWKA 3K10A 1S1XA 5IWAK 4A0XA 5GAGJ 3FZVA 5KK1A 2KT0A 5C12A 4PKIA 3SFMA 2E7WA 4C5EA 2E2JJ 3N4MA 1M1EB 5F1RA 3RPUD 4OPKA 3EPZA 3EFOB 3KETA 1SRLA 1XMOK 1TKZA 2KEAA 2XRNA 1T39A 4IIMA 1VIFA 1M2VA 1S5JA 4XAXB 4FYDA 4OPHA 2NVUB 4PZJA 1FK9A 1YJWT 1RBTA 1HK9A 3VS0A 4CBXA 1CSKA 3LWLA 4M77G 4EJUA 2PMZN 1PRLC 1VQ9Q 5KTQA 2HKOA 4DUYK 1NEBA 2MIOA 3AVJA 5IOYA 2VGNA 2M0YA 3B02A 4B3TK 2D1XA 2DD5A 4A4HA 3VQAA 4M75G 3ABLH 4DBFA 2V9VA 1VQOT 2XAFA 1MMDA 2E4LA 2P4TA 1S3JA 2ME0A 4FCYA 5GMKe 2V1NA 4KN4X 2RB6A 4BR0A 2WTEA 4ILJA 1REPC 2AS5F 5D4SA 2ECZA 4JHDB 2QCOA 2DO7A 2D4WA 2PTKA 1IB8A 2DTOA 4M7YA 3F70A 4PL8A 1RBVA 4DCHA 1RADB 3K58A 1DGWY 1Y8QB 2KRCA 1YTYA 1SFXA 4G6TB 4O0IA 1D1CA 4FU6A 2FLOA 2P9NA 3CJTB 4B44A 3ASKA 3S2DJ 3LP1A 4BC4A 3EG2A 1Z26A 1F1ZA 1WJAA 3CJ9A 2F96A 2EFPA 3FIWA 1HQCA 3I0RA 4B1VA 1D5AA 2RDPA 4X1EA 3ZMVA 4ZNXA 1WLPB 1ATSA 4HEA2 4JRKA 2NS7A 4XTYA 3PIOA 1J0RA 4JS4A 4N47A 2CQQA 1IG8A 4BRQA 3MCZA 2DAOA 2PZSA 2CG4A 1WHKA 4DU4A 1C6VA 3Q0UA 2WB1N 2MBFA 2RJCA 4D0PA 3EETA 1HDDC 1BOAA 5CR2A 4RAYA 3CPWA 3QOEA 4ENNA 3U3YA 1Q9XA 1XI1A 1A5JA 3C2GA 3C4SA 4DSEA 1ZK8A 4OMLA 4PK4A 3SJHA 2Z3YA 2ZD1A 2OTJN 2XASA 5A2QO 3G10A 4CE9A 1EP4A 3R8EA 6AT1B 3CCEQ 5K5OA 4CGZA 1WJSA 2GA2A 2M7BA 3FXKA 1G6NA 4X34A 3H0DA 1MV3A 2BTFA 2ZGZA 4CJ3A 2HBMA 3BDDA 3LANA 2ISZA 3J81Z 3GFMA 2P81A 4BJ5C 3D0PA 1U45A 3CWSA 4KMUX 5B66C 1VQ6A 3OS0A 1DEJA 2FBHA 4CJ4A 4YOTA 2B7EA 1G2HA 2CQXA 1EKEA 1ZGJA 4FM1A 4J2EA 2F48A 3D2FB 4E70A 1NU0A 4DWIA 4XBFA 2Y90A 3HM9A 1LVAA 1RTDA 1OCZH 5IYBJ 3CPWM 2BZXA 2RVCA 3LQRA 3S2HJ 4U7BA 2E2QA 1TL8A 5FROA 3FHNA 4J9BA 1UA1A 4C92A 1PDNC 1SFKA 2CGKA 4BQOA 4ICLA 1XMXA 5CQYA 5AQMA 1JTYA 4FK0A 4ZTJA 1FEXA 1HBXG 2LFBA 3SUPA 1FYNA 1F4KA 2PMUA 2M0OA 1Q7YC 1T8EA 5LJ3g 3WNEA 1SL0A 1BJZA 2RQWA 1E3OC 4MZTA 3NDKA 2EKOA 3DPUA 4NNJA 3M9QA 3CCRN 4B09A 2A69F 2P5GA 1SHFA 2HEQA 3BY6A 4A3LJ 4YTLA 1W36D 2GIVA 3ABKH 3O1WA 1XHZA 3LWFA 1ZA2B 3RDIA 1E7OA 2RKIA 1HNIA 2KROA 4BY7J 2CSIA 1K7AA 4NOYA 2R93J 2L0KA 2DJNA 5GAOl 3H08A 4ON0A 4CFDA 3A8HB 2HW3A 2K7LA 4PDKA 3QUIA 4C5IA 3V9UA 3IH7A 3O6WA 2R7VA 4CHZA 4P1WA 4KKOA 1U5TB 3SZPA 3TBIA 3VOVA 4DTRA 3HHGA 3VQ7A 2GQVA 3KZBA 1MA9B 4LJZF 2RO0A 3GBGA 4A3BJ 4H0TB 4B1XB 3GTKJ 2EBPA 1H3ZA 1Q82O 3CD6A 2QWQA 2YWWA 3NTIA 4CCJA 4X62K 2LF7A 4WYBA 3BWGA 4FW1A 1W5TA 3QBYA 3VF6A 4KYWA 3QZ9B 3RSEA 2X4HA 2UXDK 4BGBA 4FE7A 2YV0X 3ISPA 5GAN7 1N32K 2HVHA 1BC7C 1UAXA 1MV0B 3ELKA 3BOQA 5EEHA 1NYGA 3U21A 1VRTA 3HXLA 2SEMA 1W1WE 1S3XA 4GO1A 3H5AA 4LF6K 4L5GA 3ZT3A 4CIFA 3CCJN 4A93J 4C92G 4A3JJ 3AVGA 4R56A 1ZELA 4BU2A 1VSLA 3TKYA 1I0CA 4DOVA 5FU7B 2DN0A 3CCVI 1XQHA 3PNTA 4M7AG 1JXOA 3R6SA 1YJNQ 3VUBA 2KDSA 2KDOA 2A37A 3SQ0A 1HC8A 1KCFA 5GAMg 4A63B 4LK0F 1ZBLA 1N36K 4QVCA 2YHAA 2V75A 4M7DD 1YXQA 3LAPA 3G71A 2RNGA 2FJ1A 2KXCA 2CT4A 3CCVT 1XC9A 4DSFA 3S17J 1BGXT 3A98A 3CW7A 3ZMDA 1JUMA 4CJVA 3QEVA 4J6XA 2OQRA 4F8RA 4ESFA 4EM1A 4CF9A 2H6CA 1QVFA 2NS8A 5K5QA 2LT4A 3O9QA 3BCAA 4BHBA 1U0JA 2XY5A 1XSDA 1GCQC 2P6SA 3OYKA 2Y31A 4ZYDA 4N76A 1T0HA 1XGMA 2CV2A 1JI8A 3MKWB 3WUHA 1WQWA 2HR3A 4XR6A 3LDNA 4B3XA 3RI4A 2L3DA 3JRBA 2V51B 5KYXA 3CCRQ 3CJQB 2LBFA 1VQLI 5HKCA 1F43A 4LK1F 1I5ZA 2MWPA 2EVRA 4ZGEB 2OAUA 1JKQC 4AHSA 1YITN 4BI3A 4GNIA 5E17F 1S1TA 4J8FA 2VQGA 1U5TC 2WBNA 2IAJA 3PIPL 2GELA 4A4FA 1SD6A 3O1BA 2LCSA 4OJRA 2F5DA 1G59A 2DYSH 4BY6B 2DA9A 2AZVA 1FYLA 1VQLT 3EYZA 4HA8A 3UPUA 5GAN2 2DFFA 3AV9A 4NXNK 4CEFA 1ONVA 4RGSA 3HVTA 1PYVA 1TUUA 4EP4A 1QVFM 3LSGA 5D8KB 1QPIA 2E5KA 1VQPI 2RHKA 3C6HA 3FFIA 2JZYA 3ITHA 3CO7C 2JM8A 3IG1A 5FPMA 3IAS2 4BY1J 5CKDA 1WYXA 3CP8A 2NOJB 4DV6K 4XQ3A 3NAUA 4GFBA 3CCJQ 3A0IX 1YS6A 4LD9K 1IGUA 5FU7C 1VQPT 1S6LA 4ELUA 2JA2A 1NJIR 1LAWA 4TVRA 1YWPA 5EDNA 1SS6A 2PVDB 1UG1A 3JB9J 2CU7A 1NGFA 2A40A 8AT1B 2ISYA 3LSJA 4KHYA 4AG2C 3M8PA 1G15A 4JYKA 4BC3A 4C8NA 3KP4A 1ERDA 3E3VA 4ZYAA 3PO3J 2AQFA 1PSEA 2E1YA 4R79A 2G6FX 3MP1A 4M7DG 2BE7D 3F21A 3FKJA 2GXAA 4D7NA 3SAFA 1B9NA 2QA4I 3HOTA 3VYHB 1TNSA 3T0YA 1YI2I 3KPHA 4F2SA 4MQ9F 2QENA 4XLHA 3A2KA 3CCUI 2NVXJ 3KK2A 3FXRA 3LP0A 1K9MR 4CHQA 2DKGA 1VNDA 1X3NA 2QZ8A 3MMVA 5AIQA 5IH2A 4BRKA 2IRFG 4FW2A 2E2NA 3SAGA 1YO5C 1W0UA 4JLGA 4DTPA 3J7ZI 4X9DA 2QA4T 2Q2EA 3HTVA 2W04A 1IREB 4DTUA 2YRDA 1RABB 4AFUC 4W5TA 3O3FA 3CTAA 5E3LA 2P9PA 4B08A 1SMTA 2KIFA 1VYUA 4AM7A 2EH3A 4OAZA 3G6EN 3BTCA 1IO2A 5CJ9A 1Q18A 4M7XA 1NJYA 4LD5A 1JGGA 1D09B 4FLVA 3M55A 1OQYA 2V7FA 4BQLA 4RGRA 1PU8A 1UOCA 4ZC3A 1UE9A 2JTFA 4MLEA 4DTSA 1OISA 2FF4A 1YITQ 4RAFA 1QWEA 4LF4K 4RCBA 3HOSA 2RAEA 3ZT1A 3SEQA 3NCIA 4XICA 2H1KA 4EJYA 1R6RA 4A3KJ 3H9QA 1NH3A 3WE3A 2C0IA 2E10A 2O4GA 1WGXA 3MZYA 3ZCMA 2BW3A 4PQUA 1BW5A 4F17A 2I2LA 1GFDA 5TISC 4HF0A 2TCTA 3V7RA 3FJPA 3EQLF 2DPPB 2RK2A 2E5ZA 2CUJA 3AVCA 2OF7A 2L54A 1KC8C 2M4KA 1CKBA 1SSHA 3R6NA 1KU7A 1GOCA 2F2EA 3THXA 4AI4A 4IPAA 4FJ8A 5KE3A 2OTLN 2L7KA 3CBPA 4B3RK 5CVIA 2K5IA 5AQQA 1U48A 1LJOA 3H1CA 2KKZA 2VQCA 1RDCA 2DTRA 3DBRB 2R5AA 1QCNA 1WRJA 5LY3A 1P4WA 3MVPA 3MHXA 1QVPA 3SUQA 5LJ3h 4JRQA 4B9QA 1J09A 3GNFB 2ZB9A 1KXPA 3CCSA 1O3RA 2YRCA 3HUGA 4ZDPA 4B24A 2PJPA 3PGGA 1SL1A 3ZGKA 2PI0A 3VEPA 1RIOH 3S16J 3BUZB 2UWMA 2Z1DA 1GOAA 4JX6A 4IVNA 1YHQQ 2HHXA 1RPWA 2CUDA 1YS7A 1L3LA 3M1FA 5FDLA 3MEVA 2YR2A 1RR8C 1LEBA 2LP5A 2O8EB 5F1JA 1BKBA 1ZYRF 4LD0A 5FLXK 2NAZA 1KONA 2ZSHB 2Z33A 4DV3K 2PYLA 1X2KA 1S9EA 1DTQA 4AYBA 1L0OC 3CCLI 3Q9SA 3META 5EEGA 2AP1A 2GUIA 4FJIA 2VC1A 1YJ9A 4II1A 3O4QA 3FBNB 1D0XA 3C95A 3LX7A 4DLGA 1LCKA 4PJOF 2LC2A 2DVEA 2B5JA 3E97A 1I1GA 5DCFA 2O5RA 3MN6A 1H92A 2YUQA 1DIZA 1LWEA 1T0FC 3CFOA 4IO8A 1D3YA 4C1NI 2WADA 3V8LA 3CCLT 2FBYA 3O8MA 4OMPA 1FX7A 1ILYA 3K4BA 2DXIA 2ROTA 5I2MA 1K9AA 2ZPIB 3FX3A 3G6EQ 5H6QA 4B4CA 5GAOr 3DBHB 3ZETA 3JSCA 4K8ZA 4EJZA 1XX5A 1GVJA 1S5LC 1FTTA 5DM7R 5DM6L 3Q7CA 1VQKT 3VQ5A 1QCOA 4ZGJB 1KHCA 4F2RA 1QVGS 1JO8A 4CI6A 4D9JA 3PM1A 5HS9A 4A3GJ 3GUDA 1L3SA 1OCPA 1PP7U 1I8FA 1BI4A 4JI1K 2LH9A 5GAMh 5AQVA 2D1HA 3R0AA 4JI3K 1M3AA 2RJEA 2H3GX 1T05A 3X2QH 4S0HB 4CVNE 4RB2C 2FB7A 4ILHA 2DD4A 5LJ5g 2ECBA 1HR0K 4JRPA 2OI3A 4FM4B 1QSLA 5BREA 1QQMA 4F93B 2IVMA 1SKWA 3AHUA 1I1SA 4FX0A 2OTLQ 3MZHA 4IF4A 2VKNA 3JCMf 3MECA 3TU4K 5AQHA 1HNVA 2DL5A 2DT7B 2OZSA 2XDBA 4KICA 3I56I 1W9HA 2YSRA 5I21A 4Y1DA 4M41A 4J2DA 1N6AA 3TDUC 2RHIA 3WXLA 2JS2A 1WSEA 1O9SA 3IRRA 5M1FA 1BCMA 4I2QA 3OYEA 4FWPA 2E6NA 4QOZB 5HLHA 2XPWA 5CVJA 4PJNA 1K8KB 2XGDA 3J7AO 1X58A 5ICCA 4XORA 5GAEJ 3H3UA 4FJLA 3IC7A 3EUAA 1SSFA 4UVAA 1X69A 4KGVB 3OYBA 3B73A 1NM7A 2HQXA 4EFHA 3E1SA 2CZ1B 3SEMA 3U2RA 1W5CC 2LKXA 4M75F 2CP6A 3ABMH 3EDPA 2KGTA 1HQUA 2K9QA 3CMYA 1IXSB 3KCCA 3SBGA 4FETA 5AQLA 2CSOA 3PMTA 4XKCA 4DYQA 3MX2A 2OZMA 3AVHA 2V9KA 4ETSA 1BYMA 1OQKA 3NTHA 3TW7A 3CESA 3MPUB 1NJIO 1H3HA 1Y1VJ 1BB9A 3E9OA 2Z1IA 4F16A 2EV5A 1P7JA 2X4YA 2BOLA 2LSNA 1AEYA 5ADXA 1N39A 2P9LA 1O13A 1LE8B 4QVDA 5CO7A 1YTAA 2E6MA 5I2SA 3JRIA 2GA1A 3S9HA 3M5AA 2WACA 1M8VA 1XTAA 3NGPA 4WQ5A 3F22A 2X4JA 3OV8A 1KAYA 4C2UA 2XSDC 1B34B 2RI2A 3COAC 2GXGA 2HCKA 5CKBA 2EQKA 2Y9ZA 3AO1A 3OYDA 1XNRK 1EXQA 4L9VA 1BA5A 2QGGA 1JLQA 1N8RU 4UV8A 2MOXA 4NL3A 2OPSA 3CC7N 1K9MO 1YP5A 3V9WA 3KJVA 2ZPHB 1FP1D 1RUNA 4ZN3A 2RHYA 2RREA 1NKCA 3ULDA 3KLHA 1VSJA 1C0WA 4FSSA 4FISA 2HSPA 1BIAA 4M63C 3CMEN 2DU9A 4RWTA 1NGHA 2HKQB 3I64A 1VQMN 1KVBA 1ZBJA 4EVVA 4PNOA 2VG5A 4ENKA 1J5EK 5IP6A 2L0AA 3KTQA 5FLVA 1MBHA 1JGSA 2PNIA 2A5WA 4BR5A 2HVIA 3NVKA 2W85A 3SQNA 2BANA 1OVQA 3ZETB 2K5CA 1DUXC 2J5OA 3ASNH 3ZQIA 1YWOA 2OJED 3LGFA 1UZCA 4G7ZF 3BG6A 2D45A 5GMKh 1D3BA 3BG5A 3M0QA 3CIPA 3MN7A 2QYOA 2KQWA 2ZMEA 5B1AH 3X26B 4Z94A 3DCFA 4KI6A 2EFOA 3GX4X 4MDWA 5GAOq 3M58A 1JLEA 3SFIA 1LFBA 1KJWA 4LDWA 3BG7A 3P38A 1ZRDA 1LDDA 4A3FJ 2OV7A 4LB5A 1G83A 3DLBA 2KYMA 4C0GA 1HSJA 5DD8A 1PM3A 2GXBA 5FB2A 2HYFA 2QQSA 3HVRA 2HQNA 1M90C 3LM2A 3PIOF 3UATA 5D6XA 4BRHA 3MKLA 4Y4RA 3HOZJ 3P9CA 3AA3A 2IW5A 3FHFA 2K3PA 4RW4A 3BR0A 3HIFA 1FZPB 2EYWA 1B9FA 3VYUB 1TK5A 2CP3A 1Q9YA 4CGDA 2DA3A 1XSVA 1C1AA 3CPEA 1Y7XA 4LN2A 3RRGA 4L9NA 4QSHA 2LVMA 2AK5A 4C8QD 3ERED 1LB2A 2VE9A 3BP8A 4OOIA 5F04A 5JLFA 4OU0A 1RAFB 1OV3A 4H4OA 3KP7A 1R71A 3LP3A 2V1RA 2ZE2A 1ZGAA 1NLPC 2HDWA 4NDLA 1VSFA 3EE8A 3KWIA 4FJMA 1B6AA 1JTXA 2LCCA 1KU3A 3HRTA 5HK3A 1U4BA 1IJJA 2HTJA 2ACJA 3M0UA 5JLXA 3CC7Q 5J8CA 2G9WA 2Y0SN 1FP2A 1SG5A 4DLEA 4BRLA 2D0CA 3VS1A 4KUDK 1ZA1B 5A0DA 2A1RA 3WEEA 1D0YA 3KD1E 1BK2A 2MPXC 1IKXA 5H1SQ 4I6ZA 2ZBKA 3IUOA 4BL0B 3UIQA 1YOVB 1RCHA 1VQMQ 4CZCA 4EVIA 3VEWA 1H8AC 3CC4I 2PAVA 3SHWA 2OUMA 3MWPA 1OYYA 3O8GA 2HXOA 3CUQB 4M74A 3QHSA 5C4XJ 2QGUA 4M78B 2Q97A 2VASA 3M8FA 2IPOB 2O8FB 3BROA 4JPBW 1Q81C 2F5TX 4C92F 3J81E 4DR4K 1NG2A 2QF7A 1MU2A 3CCMI 2ZGWA 1YIJN 1UA0A 4GKJK 4XONA 2UYTA 1YX5A 4LE9A 2BE5F 2COYA 1U1TA 2M1BA 2O8DB 1K1ZA 3K5MA 2NRWA 3QODA 4J8OA 2QKBA 3J7ZO 4M77B 2V8IA 3QP6A 2I5WA 4FJKA 2M9UA 2V6EA 4WTOB 3CCMT 1T7PA 1XCBA 2QWPA 1O75A 2G8FA 3NH0A 2FC0A 3RJPA 1STZA 1W4SA 3CQXA 4BWMA 3R0JA 4KISA 3C0CA 2KISA 2K9LA 3ZPLA 1HMVA 2X85A 4OB0B 3Q5FA 3I8BA 4JBAA 4JJDA 2E64A 1D4XA 3Q7BA 2FF3B 2DMOA 3H8ZA 4OLAA 2QQ9A 5LJ5h 4AIKA 2KRHA 3E9PA 3AL0C 3F0CA 3CXCS 3K2PA 1VSIA 4AFZC 3JCMX 2Y0MA 5ADXH 2R5ZA 4C8QG 5F27A 4XU3A 2P5OA 4FK2A 3VYTB 2QEXI 1EQYA 2XPVA 2HBPA 1TU0B 2TRTA 1PVSA 2A08A 3F2KA 3R6MA 3AG3H 1AWCA 2X9HA 1OULA 3RMAA 3VERA 1TYQA 4DQ2A 1JT6A 1FTZA 1L3TA 1B3QA 1UAAA 3A0BC 2AKLA 5AZJA 4XNFA 2HOAA 3UWNA 1FW6A 3VQCA 3EGXB 3AVIA 5C2FA 4LLNA 2QEXT 1BU6O 4FWKA 3MQ0A 1SFUA 4OIOF 2EJRA 4I6MB 4CH7A 2JG6A 5AONA 3Q3SA 5M3FJ 2V1QA 1WSJA 3OJUA 3SXYA 1QBJA 1C6VX 2KRSA 3S1NJ 3CUQC 1YQRA 2L7ZA 3VEZA 3HHHA 3CQYA 2RQUA 3SZGA 3CCVA 4J2BA 4BC5A 5JHUA 4I02A 4YIFA 3NH1A 3IP4B 3LMMA 5J1UA 4H4KC 4KUIA 1EBMA 5AQJA 1B72B 3A8LB 3JCMe 2ABKA 1T2KA 2HAXA 2G0EA 2QM1A 3O3KA 3ZSWA 3RUXA 1TXQA 2EPFA 3WNHA 3EZWA 1Z0XA 3X24B 1UHMA 1GBQA 3EEQA 5LL6Z 2JN0A 3KLFA 3O5BA 1TLHB 4ENMA 3VF2A 4FWQA 1NG6A 4M77C 4I9LA 4GXOA 3E1YA 2M7AA 3HGYA 1ATNA 3I4PA 5HY6A 4KA4A 3CPWP 1KFDA 2XKOC 4CERA 1RDWX 5GANj 2EV6A 1QSSA 2Q0UA 2R7RA 3OBYA 4RW6A 4XU2A 2VKEA 4M75C 3E2UA 3QB0A 2HSTA 3THKA 3ER0A 2M4GA 1PUFA 1LDKB 4HG2A 2DZ9A 1KLNA 4X6AJ 1HW5A 4RGUA 1YT3A 1KD1U 1VQLA 4ZH4F 3SDZA 1W7PD 3PNVA 3TREA 4OFHA 4EMGA 4KIBA 2BDPA 2RHUA 1AWJA 3IRQA 1W2BA 2DL8A 3F6OA 4BRMA 3GWZA 2Y1JA 3I9QA 2ID3A 3T7ZA 1RT1A 1HCRA 3SHFA 1X1PA 4M6VA 5KYWA 2N8GA 4NO7A 4CO8A 1SKUB 2EZIA 1LEAA 2L9NA 1QQJA 3V4IA 3RKXA 1WGSA 3O8HA 1C1CA 4DV2K 2X6NA 5GAHP 4FLXA 1R0BG 4HF2A 2PY5A 4F7UE 3CF5L 3SWNA 4RTWA 1X3WB 2VBWA 3EGUA 2EJFA 1M1FA 3NBPA 3H0IA 2I5UA 1MH3A 1VQPA 4A53A 3WNGA 3L2CA 1VF9A 5JMVA 1VQ9I 3FLCO 3A01B 2L9VA 1F9NA 1LJ9A 2CQ7A 4HV5A 2DBMA 3I4NJ 4XN3A 2RN8A 2XDDA 4LNPA 1Z05A 2P51A 5B5EC 4FL6A 3AGRA 4KTZA 4X64K 3QWLA 3KLEA 4OKJA 4CGFA 2LKSA 5IP9J 3CC2N 4FM2A 3K57A 1UGPB 1JLGA 2YPRA 1VQ9T 2YHYA 5TKYA 3LL3A 2V8JA 1KK7A 3H5RA 1B92A 5L3DA 4CRIA 2EYZA 3UF4A 1LAVA 1X3UA 4CA0A 3PX6A 4PGHA 1JBMA 5CY4A 2FEZA 4B1YB 1WKMA 1WFWA 4FX4A 2IS2A 1VQ7A 4IDKA 2NOEA 4AHTA 5AZJB 3HOXJ 1XMAA 2QA4A 1Y97A 2HOEA 3RESA 1BJAA 3M4GA 2CH0A 3I5UA 1M3CA 1YI2A 3MFKA 3E9GA 1NK3P 4OMOA 2XGXA 2ABLA 3KLNA 1TUDA 1XS9A 3CCUA 4AM6A 2NUPA 1VRUA 1VTNC 2KRMA 4ESRA 4YFKF 2W25A 3RR8A 2DY4A 1EV7A 3JB9D 4K0KK 3OL4A 1FSEA 1IXRC 3ZOBA 1SVMA 2MC3A 3EG3A 4WFNL 4ZN1A 2XROA 1HKQA 2VXZA 3KYDB 5CKTA 4A0ZA 5BPMA 4XSZF 4KH0B 1S6PA 5IT3A 4E6RA 3EO3A 3H35A 3J7AY 3NPFA 4EIAA 3TL4X 2IPQX 1X9WA 1NKBA 4IOXA 1QP2A 2QWOA 1LWWA 1HYSA 1HW2A 4FYYB 4CZHA 2VKDA 2PBIA 1AOYA 2YHXA 3VQDA 2O03A 4DK9A 1KQ2A 5CKHA 1S8NA 1SAXA 1REVA 5CR4A 1PU7A 4FLYA 3FB9A 5BS6A 2ZXJA 4M3XA 3IWFA 3S93A 2GBQA 1XQSC 3QYGB 1KG3A 3JAME 2VOOA 5A0LA 3B6AA 2MD0A 1RT4A 4DOZA 2E1ZA 4AD9A 2QWRA 5J2NA 1ORKA 1QVTA 4JX5A 3OYJA 3CYMA 3VGLA 2VQLA 1UEBA 3CDLA 4LF7K 1B8IA 2DIGA 4NL2A 5FD5A 2W03A 4LG0A 3LM9A 1QVFP 5MLCQ 1RT2A 1R1TA 1G8XA 1IBMK 2AA4A 1VQ7N 3CC2Q 1S1VA 4E7ZA 2FZKB 3JRCA 4WXCA 5CYQA 4B9WA 4HV6A 2DNUA 4OAYA 4R8HA 3HTUA 5ILSA 2R5MA 5EY4A 3CCUN 2M87A 4FT2A 4WF2A 5EXWA 2HXIA 1IF1A 1W7AA 3CPWS 1MJAA 1FIAA 2LY9A 1RILA 3B6PA 3VQBA 2E5LK 1Y0NA 1WHMA 4C92C 3TO9A 1FKOA 1X6GA 2AXTC 1NLOC 1JXEA 2YSQA 2O9SA 4K41A 2FQ4A 1E4FT 4N4NB 1K78B 2J7IA 3JB9I 4M7AC 3CCLA 2P9SA 1RTJA 2ADUA 1VQ8Q 4DIQA 4Z4HA 3I3LA 4ZGDB 4OO1J 5HL7L 1NOZA 4U87A 3TR8A 3HBLA 4XQFA 2DYRH 4CEBA 1XC5A 1QZZA 2GFUA 4YORA 5LHGA 1MSEC 1OFCX 1A6IA 3THWB 1IG9A 1C1BA 3G7ZA 4M7DB 2MG4A 3R6OA 2KK4A 2L3PA 3EL2A 4I09A 2XF5A 4MZPA 3RKYA 4MLOA 4CD1A 3A5LC 2OTJI 3CEYA 1NK2P 2NS0A 1EO1A 4E0DA 1X9MA 5IP7J 4ZHRA 2KYBA 1PD1A 4B9MA 2OJ2A 4ME7A 2F8SA 2B86A 3QO9A 3EYYA 2RJFA 2V9PA 4LUEA 1E6HA 3O2PE 5IN1A 2DTHA 2GV9A 2M45A 4XLCA 3QEWA 2OTJT 2VKVA 3ZR8X 2BHYA 1W36C 3FXUA 3JAMO 3S15J 3L42A 3HZ6A 2NRXA 1CXQA 2W6LA 1YNZA 1BO5O 1R49A 2O8CA 1H9GA 3RQIA 4F91B 2E7XA 3SYTA 3P5JA 1YJNI 4X0GA 2CP0A 3OMGA 4BRAA 4ELVA 1CF7A 2BUDA 4XOPA 2DXUA 4JK1X 2FZCB 3K4NA 4JKGA 1NTCA 1ZSZC 5LGTA 2EQUA 5K7FA 3I56A 3RYPA 3J8AA 1G99A 4LF5K 2KXDA 4NQWB 2PYJA 3TDZC 3V81A 2VXDA 3S2WA 1OZ2A 3GTPJ 3H9NA 1Q7YR 5GANf 4DB3A 1BHLA 1U9OA 2XIDA 2BH1A 1FOXA 4HCBA 2BYVE 4DYCA 5IY5H 2HKNA 1QKXA 4AHUA 1XPXA 3AY9A 3G0ZA 3FZLA 2FNPA 3TOBA 1Z7LA 1WEIA 4FVMA 1WJFA 1RBUA 1M27C 4ZZLA 4PLIA 1K4TA 4CCOA 4O6JA 4GRIA 1NMDA 3CCRI 2OZ6A 3LFUA 1F36A 4RCHA 4Y17A 4KULA 4I99C 4IHTA 4L9TA 4Z89A 1AKHB 4L18B 1CGPA 4B1RA 5FRMA 2X3XD 1KG6A 4PJLA 3QJYA 5DLQE 1RT7A 2Y1IA 4RTXA 2O3FA 4M7DC 1JJ2A 5SZTA 3K7AJ 4ENJA 2D0BA 5D3GA 3LSIA 3C2BA 4M78F 4IHWA 1R1UA 3HM5A 5FLXO 1UECA 3VS6A 4DQIA 3ZMZA 4F3QA 3BDPA 3N4PA 3FKIJ 2KHMA 2LMDA 2M1HA 2E60A 1C0GA 1HPMA 1BI0A 3L4IA 1UWBA 1U04A 1C0TA 3QYHB 3WODF 1B9DA 4CHPA 1LV5A 4KGZB 1BL3A 1YVUA 2OPRA 2Y9YA 1RRSA 2P9SB 4RBOA 4J00A 1X9JA 1N5YA 2A36A 4GBQA 3CG7A 5AQKA 1KC8U 1D8KA 5HNHA 2E2IJ 2VCPA 3CCJI 4XRFA 3I56N 4CF0A 3KK7A 1QVFS 3MXJA 5KN9A 4DQSA 2G8UA 3W0LA 3HRGA 4F7UA 1JUPA 2D0QB 4ZZDA 3PX0A 3F9MA 4DSIA 4X66K 3BY7A 5CZ2A 5C0YA 2MC4A 5GJWB 2D8JA 3ALYA 1WWXA 4OB1B 3ZBDA 2CZ0B 4L59A 3H92A 4HQEA 2EX3A 2VPLA 3TCJA 2E34A 3O4NA 1HYZA 2CMPA 2DA2A 3I0TA 2E2OA 5CAIA 4NBQA 5KAFC 1LUJB 2MD5A 5FGMA 3QEPA 1RR7A 4V19K 5L3FA 4E9HA 5KAIC 2F1LA 2DOFA 5C15A 1YFHA 4JP0A 2QW9A 1S29A 2VLAA 2K4BA 1WFXA 2Y48A 2HBKA 4ANJA 1VQNN 3KZIC 5JS2A 2DL7A 4E1NA 3IWZA 4E9FA 3FMRA 4QS9A 2DA7A 4FYVB 3OA6A 1VI0A 1V4RA 2D6FA 3JS6A 2ROLA 5E84A 1XB4A 3L2VA 1ASVA 4BJTA 4JLHA 2LP0A 1A6QA 5GADP 3UKUB 3M56A 5FKKA 3CQTA 1KFSA 4C2TA 1WZOA 1R58A 4JKGB 3C12A 2GLOA 4M9XA 4E9GA 1BI1A 3OYLA 4AHRA 5AJ3K 3BY5A 2XRIA 1FIPA 1YITI 1KTQA 4WWCA 1Y96A 2EINH 5IHNA 3CDHA 3MDQA 3BTLA 5KCHA 4JD2A 1MDMA 1UTIA 1V5FA 1XUPO 3VPZA 3I71A 1TBXA 4F7UG 3ZX2A 1XTDA 4BROA 2E1HA 3I59A 2NOHA 1I6HJ 4OMMA 4CCMA 3GFIA 1YITT 1QKWA 4JI2K 3L09A 2QTDA 1M4ZA 2K86A 1Z9CA 4DZPA 4DS5A 1VZ0A 3PFSA 2LSOA 3OW2M 3TANA 2DK8A 1QPMA 4Z4CA 1L3VA 3GZNB 4QVZA 4JX4A 2R5YB 2CFOA 3VRYA 4S04A 3C2HA 3JRZA 1IH7A 4EZ6A 3KX2A 2KFZA 1U1SA 3P1GA 2RF0A 1QU3A 1QQIA 4ORZA 5KPRA 4ASNA 4MO5A 1FT9A 4IRGA 2RPNA 4E2FB 4DTOA 4UUSB 2I7PA 1NKUA 4AHCA 4IG3A 2UXCK 3OR2C 4HCCA 1J59A 1TP4A 5EZHA 3C7NB 2WC2A 2QM3A 3CC4A 5I3UA 3GG4A 1A5VA 1ASWA 1Q86C 3F9KA 1ORNA 4IEIA 1BCOA 1YHQI 2H3EB 4B9LA 4O44A 5AQSA 2BGGA 1BA0A 3T1AA 4CW7B 2VUBA 3PVLA 5EG0A 3DMJA 2DDAA 5EJCA 2DMNA 2GQQA 4HUGA 4FZYA 5HNFA 2HF3A 3RMDA 4C8LA 2LCLA 3V1OA 2M16A 2YT6A 3GCMA 4ATOA 2DILA 3CCMA 1K6OA 2ITMA 1K0SA 3ZSZA 2VWKA 3J7AF 2GTDA 5GMKl 1NGJA 4HX4A 4MO7A 1BA1A 3SBTA 5AQOA 1FBQA 3OSFA 2EQJA 4U0YA 4GV9A 2LK2A 1ZKGA 1FJLA 5JS1A 3HL2A 1NZ9A 3REBB 2RQQA 3VESA 2ZJQF 3AT1B 4ITVA 5M3MJ 1VYTA 4EW4A 3NHNA 4CHNA 3S1RJ 3G1LA 2VQEK 1VQON 1RDBA 2M8EA 1CKAA 1KVCA 3G6EI 4WE1A 2EQMA 3MN5A 3DF8A 2MH9A 3I53A 4IKFA 3VQ4A 1TUGB 2R7DA 4G94A 4IUPA 4M9SA 4K8XA 1R0CB 2EZKA 1Q7YO 4JQFA 2PQ8A 5K1YA 1KEAA 2FXUA 5J1RA 3QINA 1KC8R 2DE0X 3ENHA 3G6ET 5KYUA 3NWSA 3D5RC 3TEDA 4O0JA 2OA8A 1GL5A 3I55Q 4KH1B 2RQRA 2C06A 3EKSA 1RRQA 3NE6A 2QEXA 1IN4A 5D6FA 2XF6A 1ZLJA 3U9DA 1EX4A 2IVNA 1J75A 4KUMA 4B9SA 4XN0A 4DNCA 4RLQA 4CZIA 1QHHD 3KYLA 5GJVB 2OTLI 5GINA 2DBKA 2CO5A 4A5NA 2CT3A 4O4GA 2RQTA 1Q95G 2K3BA 2DW4A 1IRFA 1Z21A 3V9SA 4CHUA 1VSKA 4J7FA 4Z4FA 4LITA 2DRMA 1R36A 1K79A 3D7EO 3EUHA 4LG3A 4HVVA 1Y96B 3OS5A 4NLBA 1KG5A 4EPCA 1TS9A 3MAQA 3TGNA 4JEPA 1ITGA 2MSYA 4PHTX 1E4GT 3FGUA 5CVUA 2VUMJ 3P8DA 1OPCA 3CQZJ 2ICWG 4BAYA 5IHIA 2R7QA 1U2VA 5T7BA 2LVSA 1JJ8C 4HVWA 4JNEA 4HRIA 2XMFA 4DR1K 5L3BA 3FSPA 2GTOA 3ZMUA 3H9JA 5AQWA 4KHSA 2XGCA 4YPHA 1RGIA 3H36A 2AHQA 3KP2A 1KYZA 4U0WA 3NRVA 5GANe 1KZHA 4BDYA 1YJWQ 2WA0A 4TV7A 1VQ5N 4RM3A