3OYCA

Crystal structure of the prototype foamy virus (pfv) intasome in complex with magnesium and the insti pica
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
368
structure length
368
Chain Sequence
LDAELDQLLQGHYIKGYPKQYTYFLEDGKVKVSRPEGVKIIPPQSDRQKIVLQAHNLAHTGREATLLKIANLYWWPNMRKDVVKQLGRCQQCLITNASNKASGPILRPDRPQKPFDKFFIDYIGPLPPSQGYLYVLVVVDGMTGFTWLYPTKAPSTSATVKSLNVLTSIAIPKVIHSDQGAAFTSSTFAEWAKERGIHLEFSTPYHPQSSGKVERKNSDIKRLLTKLLVGRPTKWYDLLPVVQLALNNTYSPVLKYTPHQLLFGIDSNTPFANQDTLDLTREEELSLLQEIRTSLYHPSTPPASSRSWSPVVGQLVQERVARPASLRPRWHKPSTVLKVLNPRTVVILDHLGNNRTVSIDNLKPTSHQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular mechanisms of retroviral integrase inhibition and the evolution of viral resistance.
pubmed doi rcsb
source organism Human spumaretrovirus
molecule tags Recombination,viral protein/dna
molecule keywords PFV integrase
total genus 106
structure length 368
sequence length 368
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2010-09-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
A PF17921 Integrase_H2C2 Integrase zinc binding domain
A PF18103 SH3_11 Retroviral integrase C-terminal SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2300 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3oycA04
1.10.340.70 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Endonuclease III; domain 1 3oycA01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3oycA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3oycA03
4HVJA 4H4MA 1UA1A 4OLAA 3AV9A 3A2FA 3HPOA 1XI1A 1WJSA 1FXXA 3TR8A 4CFDA 3KLFA 4CFCA 1W9HA 3META 3EZ5A 4A4EA 2IAJA 4NCGA 5FDLA 4CJUA 1YVUA 3Q1JA 1HYZA 3LANA 4B3OA 4IDKA 1JLAA 5KI6A 1KLNA 4C8KA 4DLEA 5KCOA 4E7KA 1VSMA 1BQNA 1C6VA 2GUIA 2WACA 3HP6A 4EDUA 1NOZA 3V9UA 4HCCA 4MFBA 1CZBA 5D6XA 4TSXA 4CGIA 2XY7A 4CEEA 4CEBA 4W5RA 3AO4A 1N27A 2BGGA 4YFUA 4OKEA 1G15A 1ZBFA 3VQBA 4E3SA 4N5SA 3L8BA 1NK8A 2HHQA 4DU4A 3K5LA 4CHPA 5DMRA 4CJLA 3SV3A 3PNWC 1NJYA 1VSLA 3HVTA 4CJWA 4B9LA 3OS2A 4PLLA 3CG7A 1RBSA 2HNZA 3RMBA 4R5PA 1D9FA 4FJMA 3LZIA 2DTUA 5KGXA 4N41A 3AA3A 3LP3A 2FC0A 4B9UA 1YTAA 3P8DA 1J9AA 1VSHA 1ZBUA 1GOAA 1WGSA 4NS5A 5I3UA 3MP1A 5J26A 1WSGA 2HNDA 3F73A 2RHXA 2DAQA 1WSEA 1U49A 4FJJA 2FBXA 4KTWA 1C1BA 3HSTB 3JYTA 2HHUA 3DB4A 3SPYA 1KTQA 3KD5E 2KZMA 1VRTA 3HJFA 4KKOA 1HNVA 1TL3A 1WAJA 2ETJA 4LY7A 3MP8A 3EYZA 3NTIA 2KW4A 3ULDA 3VQCA 4I2QA 3KK3A 3MEUA 1EKEA 2P51A 2O4XB 1JXEA 1TKXA 3SZ2A 1NK0A 5J2MA 3AO1A 3AVHA 3EY1A 1TK0A 4UQGA 3AVBA 3GOXA 4E7LA 3O4QA 3QIOA 1L3VA 3SQ0A 1QSLA 5KGWA 2X4WA 3KLHA 2G8FA 1IO2A 4DMNA 2KFNA 4KTZA 4DLGA 4GW6A 4O4GA 4HUFA 3S3MA 4KAZA 3ZEHA 1IKVA 4FM1A 1TAUA 3DLEA 4FLZA 4CGGA 2ZE2A 4QW2A 1HMVA 2P1JA 3C94A 5KCHA 4RW8A 2K3YA 4KI4A 1VSKA 1JLBA 4WE1A 3QETA 4G1QA 2M0OA 1LW0A 4PL6A 2MWOA 3UT1A 3V9SA 4CERA 3QERA 4FJIA 2FBYA 2E4LA 3NNQA 3UWNA 3LYIA 2Y1JA 1RTJA 1VK0A 1X9SA 1DTQA 3HT3A 3V1QA 4OVAA 1JXBA 4CEZA 3OYEA 2L8DA 1KLMA 4IG0A 4CIEA 2HVHA 2GBZA 1RDBA 3D0PA 1U4BA 3VQPA 4DSKA 2IDOA 2OPSA 4CHYA 4OKJA 5IN1A 3NGZA 4ZTJA 1H3ZA 3OYAA 1S1VA 3CQ8A 4AHCA 1T8EA 3PO4A 3QO9A 4DQRA 2E6LA 4HUEA 2YNGA 1RBTA 1U48A 4C5GA 1S1XA 4ELTA 2LDMA 3P8HA 4FW2A 4FZYA 4J2BA 2XO7A 5CYQA 4DQQA 4HCBA 3M9QA 3P5JA 4JRQA 3DLBA 3DLRA 1WJQA 1S9EA 1RBRA 2O4XA 1ITGA 4CF1A 4AILC 4OPKA 3LP2A 2G8UA 3DRRA 1N5YA 1A5XA 4Z4EA 4DWIA 3VQEA 3KLEA 4DTOA 3VQ7A 3F70A 4QQ6A 3NBPA 4RW9A 3NDKA 4CGJA 5HROA 1A5VA 1QQCA 1RT7A 3VN5A 4DSEA 3NH2A 1C0MA 2YHBA 5FRNA 3V81A 3ZSZA 2HMIA 4DQPA 2HHTA 4DSLA 4KRFA 1EXQA 1W0HA 5KE3A 4BWJA 4FLYA 4KI6A 2KQ2A 1T05A 3UIQA 4PWDA 1QSYA 2HQEA 4CRIA 1KVAA 3B6PA 3DRPA 1SKRA 4PA1A 4B9MA 3AO2A 4FJ5A 4CESA 5HBMA 4Q5WA 4DTXA 2PYLA 3SYZA 1CXQA 3AVMA 1A5WA 4CF2A 4DSJA 3MEVA 2PZSA 3RR7A 4B9NA 4FZXC 2EQMA 1NOYA 1ZBIA 1BCOA 2G8KA 1OI1A 3OMGA 3RWUA 2XK0A 1S9GA 1ZBHA 4O55A 1JKHA 2EQJA 3HM9A 4LD0A 4FJ7A 4C8NA 2FBTA 4CF9A 1XWLA 5C6SA 1BHLA 1BGXT 1LWFA 1WSJA 2BE2A 2RI3A 4KFBA 5KRSA 3TAEA 4Z4IA 4CIGA 4F3TA 2D9TA 2OA8A 3RMCA 2K3XA 4IUQA 1Z26A 2Z1HA 4LH5A 1L5UA 2HHXA 2FHDA 4CIFA 4C8LA 1T7PA 3V9XA 4H8KA 4F4KA 1CXUA 1KFSA 4OVLA 1HNIA 4BWMA 4CGDA 3RR8A 5CIUA 2D0CA 4FVMA 4PLIA 4IBNA 3M8RA 2RHZA 3CEYA 3NGIA 1L3SA 1B9FA 3S9HA 1MHNA 3O8VA 3QEVA 3QEWA 2LRQA 1TK8A 1JLGA 1HPZA 4CJ4A 4H4OA 2OZSA 2XY5A 3TAGA 2BKDN 2E6MA 2HQXA 4CHNA 1TKDA 4B9WA 1BI4A 2RJCA 4ELUA 2EFIA 5IAYA 2B5JA 3ZT2A 3KK2A 4M3XA 1UA0A 4FJ8A 1BCMA 1RILA 5E41A 3FEOA 3TABA 3S3OA 4FW1A 4FCYA 5T7BA 3CFPA 3THVA 4Z4GA 2NLUA 2R7YA 4UC4A 4M45A 4CEOA 3SUNA 2E6NA 3E9FA 3NF8A 3OYLA 2E5QA 4DTSA 2G8VA 4NZGA 3SI6A 3M8SA 1VSIA 5C25A 3KD1E 1VRUA 2FBVA 3V6DA 4FJ9A 4OLBA 4FJXA 3V1RA 2QKBA 3TAMA 1YTUA 3ITHA 3K57A 5KTQA 3SPZA 4PY5A 3TAQA 1RT4A 3TAFA 4NCAA 1SKWA 1DTTA 3PX0A 1OZ3A 2DY4A 4XIUA 3RRHA 3QNNA 3VQ4A 1IH7A 4FU6A 4BACA 3I0RA 4Y1CA 3VQ9A 3NH0A 4KHQA 2KTQA 3NFAA 4KTQA 4FLUA 4J2DA 4KB0A 3KTQA 2VG7A 3DB3A 3E9GA 4ZTFA 2P5OA 3K5MA 2X6NA 2L89A 3AA5X 4Q0BA 4KHSA 4DTMA 4B8CA 2D0AA 4DQSA 1EX4A 3OYNA 3MXIA 3TI0A 5DK5A 4M3UA 1RDCA 4KV8A 1JLCA 1ASUA 4NCBA 3CM6A 4DU3A 1RT6A 1HQEA 1NK4A 2R5MA 3U6FA 4F2SA 4B9SA 4KHYA 1LW2A 4KPYA 4YNQA 1TAQA 3KJVA 3OYDA 4F2RA 2HNYA 4A4GA 3ZSQA 2VG5A 2HHVA 1NKCA 3OYGA 4ICLA 3AO5A 3LPTA 2RJFA 1WSIA 2YHAA 3DLGA 3ZT1A 4AHTA 4HTUA 4B9XA 4ZHRA 3LH0A 2F8SA 4O0JA 5KE2A 2VWKA 2BDPA 4FZZA 2RHUA 3RMAA 1QE1A 4N4GA 1Y97A 4N56A 1J5OA 2GV9A 2G8HA 2P5GA 1TV6A 3O4NA 1JL2A 4DF8A 3LWMA 5KH6A 5HRPA 3LAMA 4F3OA 2BANA 1NK9A 1WNSA 1RDDA 4NYFA 4E7JA 4IUVA 1ASVA 3SJJA 4CJ3A 1KFDA 1KRPA 5D3GA 1VSEA 1F21A 3LALA 4CHZA 4IG3A 2D5RA 4E19A 5J39A 4Z4CA 3LGLA 1NJWA 3C95A 3PUFA 3VQDA 4GY5A 3KKRA 2CKKA 3F9KA 1FKPA 3L2RA 1O1WA 3OS0A 3O3FA 1X9WA 4KB1A 4RW7A 5J2PA 2RHYA 4K8XA 2O4IA 2IS3A 4DTRA 3FDRA 3PX4A 3PY8A 4CCHA 1SSFA 2YNHA 4CK3A 3AVKA 1QSSA 3PFSA 2WONA 1LV5A 2OPQA 3MEWA 5KRTA 4BE0A 3TANA 4A4HA 4RW4A 4K8ZA 3TAPA 4ID5A 1RT2A 3SUPA 4RG8A 2HHWA 4E0DA 1X1PA 4CEAA 1L3TA 2X4YA 4IUTA 4EZ6A 3RTVA 4DTNA 2R58A 3MECA 2DFFA 4GVMA 2D0BA 3AVIA 4RW6A 4M3RA 4FLWA 3IAYA 2QQSA 3QLHA 3OYBA 1KHCA 2L3RA 2X4XA 2RI5A 1RBVA 2B8AA 4DU1A 5D6YA 1XC9A 2QKKA 1IKWA 3QEPA 4KREA 4Q5VA 4O5BA 4EP5A 1QTMA 3NE6A 4N76A 3G0ZA 1FK9A 1GOBA 4C5EA 3LP1A 1XNIA 2EQKA 4C5IA 3AA2A 4CEDA 2PYJA 4CECA 1I3AA 4II1A 1JLEA 3LGFA 1IKYA 1TK5A 2DIQA 3SD4A 3L3VA 4HUGA 3H08A 2YKNA 1S5JA 3NTHA 3AO3A 4FLXA 3VQ5A 1ZYQA 4AHSA 3VQ6A 3TARA 2XDPA 2XY8A 3BGRA 4LSLA 1RT5A 2YRVA 4FJGA 3OYKA 3ASKA 1TGOA 2IC3A 3AVLA 1CLQA 1HRHA 3IG1A 1D9DA 4N47A 1DLOA 3JSMA 4L59A 2LSNA 3NGYA 1L3UA 2P0KA 3MEGA 2QQRA 1KVCA 2OPPA 3ZT0A 3MXMA 3OYJA 1NJZA 1RTDA 3HP9A 4OGEA 3ME9A 4CE9A 3ALYA 3LWLA 4BE2A 2EX3A 4CJSA 1BIUA 1WSHA 3VA3A 3DM2A 3DYAA 3ZSOA 5J2QA 3CFOA 1RT1A 3HL8A 3NF9A 4CJKA 2QK9A 2EHGA 4C5HA 2G8WA 2HB5A 4QAGA 1YT3A 5J2NA 2RF2A 2EQUA 3I0SA 3FLGA 4M3YA 4FK4A 3AA4A 1U45A 1NJXA 2OZMA 4DTJA 4DFJA 4IUUA 4DQIA 3KLIA 4QQDA 4M3WA 2F8TA 4JRPA 4MQ3A 2ZQBA 3C6UA 2DFEA 3SQ4A 5I42A 4CK2A 3AVGA 4CFBA 1N6QA 2Y1IA 1JL1A 1D8YA 1SUQA 1EP4A 4M41A 2HHSA 5JS1A 4O44A 3K58A 4CEQA 1Z25A 2RJEA 5HP1A 2XHBA 4B9VA 3WNFA 1KCFA 1TKTA 1MU2A 4B8AB 4FK0A 4W5OA 2RHIA 2VG6A 1NKEA 2WOMA 1K6YA 3K5OA 4JS4A 4BDZA 2F5KA 1RTIA 3MO8A 3LX7A 2R57A 3OY9A 1UAXA 5C42A 3NF7A 2M1HA 2X78A 3AVNA 3RRGA 4IFVA 3HYFA 3BDLA 3VQ8A 1SL0A 2GFUA 2YKMA 4CJTA 2B4JA 5SZTA 4CJ5A 1NK5A 2YV0X 1Q8IA 3OYFA 4I7FA 2JLEA 2ATQA 4OJRA 1JLFA 4O0IA 3OJSA 4Z0UA 3S3NA 3DOKA 3L3UA 2QXFA 3SUQA 4CHQA 5SWMA 4AHRA 4Z02A 1C1AA 3QNOA 4BE1A 3NTKA 3ZCMA 4DTPA 4N4HA 3MAQA 1GOCA 3H6ZA 3K59A 3T19A 3ZSVA 4EP4A 3LAKA 1LAWA 4A4FA 3OYMA 1BISA 5HRRA 1BL3A 3VQAA 1LAVA 4CEFA 3DI6A 3DLHA 3HK2A 4DF4A 2G3RA 4CJVA 3O3HA 1S6PA 3DMJA 4IUPA 3OYHA 1KVBA 3V9ZA 1R0AA 4CGFA 1SL2A 3LPUA 4AHUA 3L2QA 5K14A 4I2PA 3DLKA 3V4IA 4B08A 3C4SA 4CJPA 4CJRA 1NK6A 2I5JA 1HYVA 1TVRA 4DFPA 3MEAA 4JS5A 3SQ1A 4BD3A 3EAEA 1FKOA 3DLMA 3C6TA 3MP6A 1C0UA 2Z1GA 2Z1JA 5HLFA 3OYIA 1S1UA 4OGCA 1WLJA 5CZ1A 3HVRA 4J2AA 1VSDA 3M8PA 2DIGA 3S6WA 4FXDA 2JZ2A 3L42A 1VSFA 1XHXA 4E7IA 3LLRA 3CYMA 4GMJB 1XHZA 1WN7A 3TWHA 4EZ9A 3HO1A 3LDSA 5CYMA 3PV8A 3T3FA 3OA6A 4I9QA 4Z4HA 4BDPA 3ZSRA 3U3YA 4DSFA 3OS1A 5FROA 1G5VA 4F8RA 2LVMA 1BIZA 5C24A 4IURA 2RPIA 3K2PA 1BQMA 4LH4A 5CY4A 4C8MA 3ZSWA 2A1SA 4CJFA 3I8DA 3PO5A 1LWCA 1RCHA 2RKIA 1T03A 1CZ9A 4OPJA 3NH1A 1VSJA 3OQ5A 1REVA 1WJRA 3HXMA 3QIIA 3QJ6A 4IFYA 3VA0A 3L2UA 3KKSA 1S1WA 1B92A 4NYNA 2OYQA 3MEDA 3RMDA 3WNGA 2M16A 1IG9A 3T1AA 2X35A 1HYSA 4DS5A 4FL6A 2PQWA 1Q9XA 4DTUA 1RI0A 5C0MA 3SV4A 4DFKA 2O4GA 2LTOA 3NCIA 4HHTA 4J2EA 4KHNA 4QCLA 5M9OA 2PY5A 4N4IA 1WAFA 3NAEA 3PMIA 4W5QA 1SKSA 4ELVA 4KHWA 3WNEA 3MXJA 4FJKA 2YNIA 3VQQA 2KZZA 4DS4A 3OYCA 1X9MA 4E89A 4CK1A 4M3TA 3L2VA 3H8ZA 3IRXA 2HVIA 2RI2A 4X34A 1IKXA 1NKBA 4DSIA 4M3ZA 1SV5A 3AVCA 1D5AA 3CM5A 3OVNA 4E1MA 3KLGA 4OKKA 4L8RB 4FJNA 4FM0A 3SCXA 4BDYA 1QS4A 3DRSA 3ZT4A 3NHGA 2F96A 3DOLA 2W42A 3ZT3A 3OB9A 5HRNA 4B9TA 2YNFA 3MEEA 3QINA 2RN2A 4FJHA 2Z1IA 1BI4B 2HW3A 3ZSYA 2KFZA 1HQUA 3D45A 3G10A 2X74A 4LD6A 4DFMA 4QOZB 2VYTA 1QHTA 3KK1A 3V9WA 4QQGA 2B6AA 3CFRA 1RTHA 3NF6A 2ITGA 3QESA 1ZBLA 1SL1A 4FLVA 4M42A 1RBUA 4QVZA 4IKFA 3E01A 4CHOA 2GF7A 1J53A 1J54A 4CJQA 4KHUA 1C1CA 4E1NA 3HPGA 1WSFA 4CF8A 3ISNC 4AHVA 4FYDA 5CZ2A 3OMCA 4CGHA 4FJLA 3HPHA 1RT3A 2JGUA 2IGIA 2MWPA 3LP0A 2OPRA 3QKJA 3AVJA 4ID1A 2BIVA 3PMTA 3P1GA 3SNNA 3O3GA 4W5TA 4LSNA 4W5NA 4E7HA 4CFAA 2DFHA 1HJRA 3U3GA 5FRMA 2X6SA 1EETA 1LWEA 1B9DA 3AVFA 3OJUA 3IS9A 2VWJA 4CF0A 2IOCA 2NUBA 3M8QA 4KO0A 1TKZA 1RDAA 3P83D 4JLHA 2R5AA 5JS2A 3WNHA 4AH9A 3LZJA 1Q9YA 3B6OA 2A1RA 1UWBA 3QEXA 2GFAA 3SQ2A 1U47A 1U04A 3ASMA 1S6QA 2ZD1A 1ASWA 1RNHA 2XY6A 3L2WA 2JTFA 2IG0A 3QEIA 1C0TA 2AJQA 4PQUA 2Q3SA 4C8OA 3KIOA 4Z4FA 4FLTA 3PX6A 5HRSA 4FK2A 4DG1A 2RO0A 3KUFA 3FC3A 2BUDA 5D6WA 1I39A 4FM2A 1OYXA 4PUOA 1TL1A 3V1OA 2G8IA 1OZ2A 4HCZA 3QBYA 4RG2A 1S1TA 3FFIA 2LCCA 3QIPA 5EU7A 3ZSXA 1KSPA 1UOCA 3BDPA 2RJDA 4Y1DA 1JLQA 2XRIA 3AVAA 4I9LA 2EKOA 3SUOA 1NK7A 4CJEA 3K5NA 5J1EA
chains in the Genus database with same CATH superfamily
1ULYA 4M3GA 1FXXA 5JR3A 1F4KA 3E3VA 3LANA 3I0TA 4M7AD 4KN4X 3REAB 1N27A 4DUYK 4AFUC 5E1XA 3EEQA 4PLLA 1WEIA 1N25A 2N8GA 4F7ZA 4ESBA 1K4US 4LNPA 1W0UA 3LDOA 1C1BA 3SBTA 1QP3A 5FKKA 2FPEA 4M7DE 3MWTA 3VQCA 1BI0A 4BGAA 2P7CB 4EW4A 1WHUA 3EY1A 1TK0A 4U67L 1VQMA 4B44A 3MQ0A 3RTRA 3BR5A 4B1WB 4DMNA 2FSNA 3CCRN 3CCEN 4R55A 5F04A 1TS9A 2FO0A 1N8RO 2D8HA 2QK0A 2XDDA 1Z9CA 4PL6A 1VQNN 4C0GA 2JN0A 2IA1A 2JWLA 1X9SA 1JJ6C 3JRGA 4DSKA 3DJCA 1LFBA 1E6GA 1WCMJ 1RBTA 3SWNC 3HRUA 3HGYA 2A3LA 1RBRA 4DA4A 3VQEA 3VQ7A 4M78D 3JRIA 4FWKA 3NBPA 4CCNA 2LF8A 5GAGJ 4I2OA 1I1JA 1QQCA 4OB3B 1L3UA 2CV1A 5AQVA 4YOUA 4DK9A 3PVQA 3L2CA 1RR7A 3TP3A 4G6DA 3JSPA 1ABQA 4CRIA 4PJOC 3B6PA 1SKRA 4BGBA 2GQVA 2M9UA 4CESA 3I3LA 2DTOA 2KLOA 2EQMA 3WT0A 5H6QA 3RWUA 2XK0A 2K27A 3HM9A 2K9MA 3J8AA 1TW3A 1BHLA 4Z4IA 3QPHA 1KFZA 4HOBA 1VUBA 5KYXB 2OPTA 4RAGA 2HHXA 2VV5A 2R7WA 1ZBXA 2XGXA 4L3QA 4F4KA 3VUBA 2VXEA 4C8QA 2E5KA 2KKZA 1K9MO 3TDUC 1UHCA 3QEWA 2KJCA 4H4OA 2OZSA 1GL5A 4CZFA 4ELUA 4LMYA 3OR1C 2AA4A 3L4IA 3JW4A 3BJOA 5LD2C 2NLUA 5GAMh 4FJ9A 2V1UA 2J7IA 1HJOA 4H0EA 2FBVA 1IO6A 4KULA 3CBPA 1T6SA 2J5OA 4PJMA 3VU3C 1RT4A 3I56N 1A36A 3K2ZA 2HBMA 1H0MA 2EH3A 4R0KA 3HXLA 4B9QA 4FYWB 1VYVA 1N78A 3FRNA 3JRAA 4KV8A 4A61A 2F5FA 2A69F 1VQNA 2Y9YA 2HNYA 1D4XA 2PJPA 1C6VX 2ENMA 1XGOA 1KC8C 1X2NA 3WGGA 2RHUA 1VQ8A 3MDQA 2Q0UA 1NLOC 3PLAA 3O4NA 1S5LC 5D7UA 3IRRA 3IHUA 1FNNA 3A5NC 1ASVA 4ZDOA 3CC4A 3G1OA 3ZL7C 2K4JA 2NOFA 4WTOB 4DEYA 1R5ID 2IGOA 1IAWA 2PUKB 1IXRC 5FU6B 3HHGA 3L2RA 3EH1A 3CC4Q 3GIBA 1TL8A 3VYHB 3CBOA 2P0QA 1QSSA 2OPQA 2G0EA 4RW4A 4ID5A 1VNDA 2CSQA 5AQGA 4LFUA 3C2GA 3QPTA 1VQPI 2E1MC 3VEPA 1Y64A 1QVFA 2EQKA 3OW2S 4HAMA 3G6EA 3VQ5A 5A2QZ 4IHVA 2Y4XA 3PNVA 1CLQA 3RZOJ 4ZDPA 2B9SA 2P0KA 3I9V2 2DT7B 2K9NA 2A42A 3F5TA 1S72A 2ZCFB 5E18F 2QK9A 1VQLI 4M3YA 4BY7J 1F1ZA 4EQQA 2YUOA 3BDDA 4N0AA 1WOQA 3V4GA 1T0FA 3K4KA 1QCOA 3DEWA 3CXCP 1RTIA 3T8TA 2HQ5A 3NWSA 3RRGA 2EBIA 3IUCA 5CPRB 2YV0X 1TH7A 4LN2A 1GVJA 1SPKA 4CVNE 2J4RA 1W0TA 3WXMB 3VYGA 3H6ZA 3K59A 4PKGA 3LAKA 3JYTA 5BN9A 4U87A 3MCAB 2MGQA 2QASA 2KLAA 3R2XC 1Z91A 3LSMA 4FWLA 1M2VB 5L3BA 2OJED 2CW0F 2O03A 1C0UA 1ZAOA 4DBFA 1R6RA 4CI6A 4K11A 2HDWA 5EG0A 4IL6C 4F3QA 3CJTB 3A1PA 1IGNA 1BQMA 4GV9A 4ZYHA 2RKIA 1P9QC 1ORNA 3WGHA 1LEAA 3L2UA 1B92A 5DM7R 2H94A 4X6AJ 1OH7A 3CHWA 4HBLA 4C30A 3X2QH 3TSQA 1RAFB 3MN2A 3DWLA 5GAN4 5DY9A 4F04B 2MW8A 1MH4A 2CRGA 3DU6A 4E1MA 3UA7A 4L8RB 3F0CA 3MMYB 4FWRA 3ZCOA 2YT6A 2VI6A 2QEXA 1OU9A 3D45A 2KISA 2X74A 3U21A 2P0PA 1VQKN 4IKFA 3IDHA 1VQMQ 3K1MA 3HPWA 3RPUD 4CGHA 4RTXA 1RT3A 4XK4A 3QUIA 2Y9ZA 1B9DA 5E84A 1T3SA 2LG4A 2E88A 2P9SB 4CF0A 1TQIA 1RDAA 1JE8A 2KSSA 1ASWA 2XY6A 1YWOA 3CO6C 2PEXA 4FIBA 1WHGA 1X19A 4CZHA 2NOZA 4NQWA 2KVQG 1SFKA 2WSCE 2DW4A 1YHQA 1VIFA 3T9NA 4BY6C 2KRNA 2OI3A 4IOXA 4BXXJ 1S9HA 3BEXA 3JCMP 4ILGB 1KLNA 2ELHA 2GQIA 3BC8A 3ZFJA 2BW3A 5D6XA 5IP7J 2VVKA 3H41A 4W5RA 5I11A 4UVCA 2RNGA 1VSLA 2VUBA 4YPRA 2HNZA 2OQGA 4GV6A 3LL7A 5GJWB 4JKBA 4CUGA 3KEQA 1E4GT 4AIAA 3BE3A 4WQ4C 2PAVA 3Q7BA 1J59A 3FZVA 1VRTA 5AQJA 1UELB 5LGUA 1E3PA 2FQ3A 4XOPA 3D2EA 3FXRA 2UUZA 1GVDA 2XB5A 4EMKB 3N0UA 2BEOA 4UY8O 3L1AA 1YW7A 1OMIA 4EEFG 5IOYA 1JLBA 1GXIE 4G1QA 1RGIA 2M4GA 3H9QA 2O8XA 2P9PA 1KLMA 3PFYA 2ZKZA 4JI4K 3VQPA 2HVRA 4OKJA 1HNWK 3S32A 4AHCA 3PO4A 3HJEA 2LNBA 4J2BA 1MUYA 3E9PA 3TL4X 3L2ZA 1EFNA 3TU4K 1PVEA 2FMYA 1EZZB 2JA6J 4RMOA 4OO1J 3ZPLA 5AQWA 2VQHA 2F5CA 5LJ5d 4MO5A 2Z99A 5CVUA 2W84A 4UY8I 1ACIA 2K9QA 1HKTA 2E64A 1ZBHA 2FB7A 4KBOA 2XHCA 5B8HA 3EG1A 1BGXT 1XMOK 2JA5J 2ZPEB 1N8RR 2VYPA 2O9VA 4CCOA 2NVXJ 1JXSA 4JI6K 2ZJQL 1HNIA 1XG7A 5BPMA 1EH6A 2CUFA 3HEFA 3FZHA 4XBFA 3S9HA 4Y15A 2R5YA 3W2VA 2XUBA 1YX5A 2DODA 3ZT2A 1IV6A 3L6QA 4FPAA 2HDCA 3VPZA 1VA7A 2DO7A 3CJQB 1ZGJA 3M0PA 1ZQ1A 2DOFA 1I50J 4L0ZB 5BR9A 2XKOC 5AQFA 2XC7A 4AI4A 3CCMT 1TQPA 1HA8A 4XIUA 3VQ4A 5CR2A 1QMCA 3GPLA 3K1NA 4MNUA 2XAJA 2QGGA 4Q4ZF 3EHRA 2EPDA 2HQAA 1N39A 2KI7A 3GTJJ 1ETVA 3I56A 2PFBA 3JCMX 2ASMA 4BNCA 4B9XA 1BW6A 2KIMA 1QQJA 1AOYA 3VEVA 4EMSA 2QA4I 5KH6A 3G1LA 2HBJA 2O7OA 4PSXA 1NJIC 3ROUA 2EV0A 2ZZDA 3BZCA 5FLXE 4F55A 4PFPA 4H0PA 4JP0A 2YRDA 1O3RA 1QVFS 3S16J 2JS0A 4BE0A 5KRTA 1W70A 2O5RA 1VHXA 3NVMA 4EJYA 2L5QA 3G3ZA 2HEQA 2QKKA 1YXQA 3QEPA 2EVRA 4BHPA 3SFMA 3WXIA 2FJ1A 4C5EA 2HSEB 2HVSA 3AA2A 1JLEA 3JR9A 2DPNA 3NTHA 2DJZA 1X1AA 3E66A 4EHTA 2A7YA 1R58A 5LL6Z 3JSMA 5C10A 1XGSA 5I22A 3LWLA 1WLPB 1N6AA 3CFOA 1H88C 3KBGA 1B3QA 2HAXA 2Z2SB 3W2AA 3AA4A 1U45A 1SVLA 1RIOH 2AXLA 4DQIA 3H0GJ 4JBAA 3T69A 3EUKL 3DXMA 2MFZA 4WF9L 1TKTA 4FK0A 1GXPA 2H3EB 1Y71A 3K5OA 3M6GA 4BR9A 4D8KA 3M3ZA 5C42A 2M1HA 3CCEA 4FVUA 5BQTA 1FMVA 4CZIA 4M78G 1YJNT 2X1CA 2Y30A 1JLFA 4O0IA 1VQMN 3W3DA 3THKA 2ZMEB 3NTKA 1QPMA 1MDUB 3T19A 1PNJA 1LB2A 4YTLA 3EG9A 2IJLA 4CJVA 3IC7A 4CGFA 5A2QK 1SSHA 1IG8A 5TJJA 2XPVA 2FOWA 3C6TA 2XICA 5GAN2 2VASA 1XHZA 2A3ZA 5KYNA 5GINA 2QWMA 3T3FA 4Z4HA 3LWIA 4L9JA 3LFKA 1BIZA 2JA8J 1LWCA 3K0LA 3H35A 2NUZA 2DPDA 2KKOA 4YIFA 4X62K 3CP8A 4CZGA 4BRFA 2K3PA 2MBFA 2XIGA 5KYYA 3WNEA 2KYBA 2F2XA 3H1VX 4ME7A 3IAM2 1NKBA 1MDMA 3F22A 1IBMK 1IV8A 3I0WA 3Q0VA 3ZT4A 5GAHP 2MA3A 3COAC 2W42A 3OB9A 5GTIC 4LD6A 4QOZB 4M42A 2XAQA 4QVZA 3JAMK 1T0HA 2O8FA 3MKZA 1JTXA 1WXTA 2EFOA 4FYDA 2UV1A 4H0YB 2PQ8A 1Y0MA 2BIVA 1XN7A 1M3QA 2LFBA 5JS2A 3ZX2A 4AM7A 2E71A 5D5XB 4H5TA 3UKGA 3QEIA 3FB9A 5IHKA 3JB9D 3A01B 1IG7A 3FJPA 1QO0D 3KP7A 1BU6O 1YJ9A 3F8NA 2A0FB 4CCJA 2IGKA 1Q86U 1OCCH 2QWRA 4YG2F 1BBYA 2LRDA 3KEYA 4NCGA 2OANA 2V9KA 1AZGB 1HD3A 1W2BP 2WACA 1I1SA 3NMZC 4LITA 3ZQFA 2RPNA 5GAN7 2M1BA 2CH6A 1YQMA 5KGXA 5CVVA 4J5YA 3C1DA 3F73A 4PJLA 4IRIA 3BP8A 2KZMA 4CO8A 4CZZA 2H6BA 3VTIA 4LY7A 1WAJA 5EY4A 3NTIA 3KK3A 3CCSA 1SQKA 5J2MA 3KYLA 2HKXA 4IDHA 1W2BM 3BCAA 1VQOT 1K4SA 4RTZA 2Y0SN 2X4WA 4DLGA 2R93J 1IKVA 3CC7I 4FM1A 2QA4N 5DTDA 4CGGA 1GLLO 1ERDA 5C4JJ 1QQIA 5GAN8 1DP7P 2XKOA 3LSHA 4Y33A 2W10A 2NUPB 4BY1J 2FBHA 3OYEA 4CIEA 3I55A 4MDXA 2IDOA 3IWFA 2QTDA 3SAGA 5F0XA 4GKKK 1U48A 3FHFA 3LSIA 3CMAA 1RAEB 4A2UA 4M77B 5CLSA 3CMEA 1K8AO 3HRSA 1KG6A 4M75D 2HTSA 2X3XD 3G4SQ 1X3NA 1QSYA 4GXOA 5F0CA 1V76A 5DM7F 2XGEA 4DSJA 3V42A 1ORKA 2XAFA 3F0ZA 1JKHA 3DLAA 3I9QA 4FO0A 2RI3A 2YX7A 3O9UA 2D9TA 1RESA 2HHHK 1Z26A 4JRIA 1WI9A 4C92E 3V9XA 1CXUA 1X6OA 3A0IX 1XX5A 3H46O 3CMEI 2OUMA 2RHZA 3UB5A 3TBIA 3S17J 2ZFUA 3CD6T 1ACMB 2EJFA 4H0OA 3TAGA 4AM6A 2VGNA 1YIJN 2B86A 3DEUA 2CYZB 3VGMA 3FEOA 3C7NB 4MQVA 4MO7A 1LNWA 2G8VA 3NF8A 2DL7A 2DCEA 4JX4A 4OLBA 4EGYA 5BREA 4FJXA 4LDUA 2QKBA 1YTUA 2JSCA 3N5BB 1YI2T 4JJNK 1MA9B 4OFHA 2DTHA 2DY4A 3N4PA 1Y56A 1AWOA 1BDGA 1UB4A 3JRBA 1GHCA 3NFAA 1TTHB 2E4HA 4J2DA 2VOPA 1MKMA 4J7IA 2L89A 3TDZC 3I33A 4RUGA 3TI0A 3D2FB 1LDKB 3CM6A 4NCBA 2R7TA 1WHJA 3OSVA 4C8QD 1X9JA 3MD2A 3ZSQA 3KP4A 1ENHA 2NOGA 4ICLA 3FK6A 3DLGA 1YF5L 3G2BA 5DS9A 5DLQE 4ELZC 2VWKA 1QZEA 1BA5A 1T6CA 1OOTA 3CLQA 2JXBA 3M53A 4F3OA 2BANA 3SJJA 1SAUA 5GANj 2CW8A 4K8XA 1X01A 4CCHA 3FFKB 5B3SH 4IZZA 4CK3A 3AVKA 3PFSA 3FHNA 4WXCA 3RDVA 5M3MJ 4UOBA 1RT2A 3SUPA 4I98B 5C2FA 4HEA2 2D0BA 3J80E 2QQSA 1YX3A 1YJ9I 2CZ0B 2XIDA 4CA0A 2A07F 1O3QA 4D9JA 4MZPA 5J1UA 1S22A 4HUGA 4HF0A 1LEBA 3NMUA 3K70C 1PKTA 1BOBA 3OYKA 1HRHA 3GLXA 4A5MA 2F7TA 4N0BA 2DF6A 1FYKA 5CHZA 3ZT0A 5LGTA 1IGUA 2KIUA 4BE2A 1YOVB 3I55Q 1BO5O 4C0FA 2EHGA 2WB1N 2RF2A 2FE3A 2UUCK 3I8BA 2BVLA 4CI0C 1ZG5A 2DFEA 1EP4A 4M41A 4TVRA 1J2XA 2YHWA 4DV7K 4B8AB 5F27A 3LX7A 1QLYA 2QWLA 3AVNA 1RUOA 1SL0A 1CGPA 4CJTA 4HDUA 3GTQJ 4YIIA 3MZYA 1OH6A 2X51A 3RERA 4Z02A 3ABTA 2CU7A 2IVMA 2LR8A 3TO9A 3GOIA 5D5VB 5LJ5h 2HMPA 2DTZA 1VQKA 1AWJA 4PJOB 5D6FA 2P4TA 1X3UA 2W82A 4KUDK 2VL8A 2JM8A 2HNIA 4I6MB 2MC4A 3ONQA 2PZ1A 4BYYA 1HYOA 3VENA 3CCQI 3DTKA 2MK5A 1BR4A 1GDTA 4D6WA 1TUCA 1VSJA 3A5OC 3RMDA 4FT4A 1MUZA 1RLQC 1YHQQ 3DXJF 5D4SA 3JTHA 1SRLA 3GF2A 2LTOA 4N4IA 1K6OA 4KIFA 3OYCA 5HS7A 1TNSA 4YOTA 4M3TA 4BUGA 4ORZA 3CM5A 3JTGA 4QS7A 4AWXB 1OPKA 5K5QA 3ZSYA 1G83A 3V9WA 2B6AA 3CCJI 5GJVB 3HTRA 2GWJA 2JPCA 3CCLI 5GP9A 1J53A 1SAXA 3QJYA 5FLVA 5FFXA 2PVOB 5FW9A 2IVWA 2Z33A 1WHMA 2HNHA 4WX9A 3D2FA 3O5ZA 2A28A 1UFFA 1TKZA 4WFBL 2ASPA 3J7YP 1HNXK 3QP5A 1S6QA 4H5VA 2Y48A 1DU0A 3VYRB 4ESJA 1SD5A 2PLYA 1T8IA 3S14J 5JFRA 1KIKA 3AGRA 4JI3K 4O3MA 4U0VA 2DXIA 3Q9SA 4AM3A 1R5GA 3I35A 1OISA 1UG0A 3E19A 3C7NA 2JA7J 3K5NA 4H4MA 1JJ8C 4J8FA 1D5VA 3QG1A 2JRMA 4ISEA 1W6XA 2LF7A 4KITB 5KCOA 1NWKA 1JGGA 2R5YB 3UF4A 3TW6A 3MCZA 3G6EI 3AA3A 1QKWA 1NGBA 1NG9A 3MP1A 1HUXA 2GELA 3SWNB 3J7ZI 2NOIA 1HKGA 1P7MA 3HJFA 4KIGA 3MEUA 2WAFA 3IHOA 1PUFB 1VQ8N 3EHQA 4EAHD 5ADXA 1R5HA 5H20A 4EJZA 2JS2A 1V4SA 3Q3SA 4S05A 4QW2A 4C3IJ 5C0YA 3VEZA 3BTIA 2M0OA 1D1AA 2V9VA 2MF2A 2FBYA 4ANJA 3CC4I 1UJYA 5ILSA 1JXBA 1HKBA 4PL8A 2L8DA 2RQTA 1HXDA 4ESRA 4DQRA 3G71N 4C5GA 1IHWA 3MN5A 2H56A 1R22A 3LM9A 4JRQA 3S15J 4RB1A 4DJAA 5LGNA 3DRRA 2D0NA 1YFHA 4JX6A 1M8VA 3EGDB 1VQ7A 4A6EA 1M4ZA 2CJJA 1JJ2M 1I5ZA 1IRZA 4KRFA 5KE3A 5AIPA 3NWTA 4NDLA 2O3FA 2LP0A 2NRXA 4BRKA 2ZJRF 1WXBA 1WZ2A 3MEVA 2JW4A 1OQYA 1W4MA 1N5ZA 2IS1A 4CF9A 4F3TA 4CIGA 3RZDJ 3O08A 4GV3A 1JRIA 1SRMA 3L4QA 1PP7U 2WUSA 1N77A 3M8RA 1B9FA 3M5AA 4IHWA 1HPZA 2D4WA 3BTJA 2M30A 3S2HJ 4MHGA 3JSOA 5CQGA 4J01A 3VRZA 1RILA 3K7AJ 3CMMA 4EM2A 3H3NO 4NHJA 3CPWP 5AQLA 2HTJA 3B73A 2IVNA 3M5RA 3G7ZA 5GADP 4KHQA 1DT9A 1FLIA 2FPFA 4GVEA 2M3AA 4OMLA 3CPFA 4F7UF 3KTQA 3DKXA 5AZJA 4OFAA 2E1HA 2X6NA 4NB5A 3VS4A 1A5JA 1RDCA 3OSGA 3A1YA 1YQRA 2VG5A 4EW0A 5D4RA 1Q81R 4C2TA 4A3DJ 2DETA 2VLAA 1ATNA 1FP1D 2BDPA 3GCMA 3OL3A 4N4GA 3VYTB 3LWMA 4OPHA 2JG6A 1OFCX 1KRPA 3F10A 3CVTA 1KFDA 2MYSA 1FKPA 2RKHA 2DL8A 1O1WA 1BG3A 1WJ5A 2E2IJ 3FDRA 2K5CA 3H1CA 3N97A 1FT9A 1IREB 2O01E 2IGNA 4A12A 3RPUA 1RPWA 3P9CA 1WDXA 3TANA 4CZKA 4IUTA 1V4TA 3RI4A 4GVMA 2DYBA 2L3RA 1HJDA 2C0OA 1HW5A 1A6IA 2E2JJ 1FK9A 2SRCA 3H0IA 1I3AA 5ED4A 2QCOA 5DV5A 1PG5B 3ZMUA 4AHSA 1U8RA 3BGRA 1NGGA 1RT5A 3HTUA 1XQOA 1RADB 4HA8A 2CFOA 5GAMj 5B1AH 3MXMA 3N5NX 2P7VB 4H5NA 3RKQA 1C0WA 4ATOA 4CC4B 1S72Q 4B47A 4DEXA 5LFAA 3FLGA 4DR3K 3GVAA 3CXCA 2L7FP 3CMAT 3VW4A 1OYWA 1R4NB 3LDQA 1K6YA 5IYDJ 1NU0A 3H36A 1WSUA 1X1BA 2Y90A 2L9RA 3FXOA 1IDYA 4B4CA 4HVWA 3CCMN 3M57A 5FKOA 1KXPA 4XKVA 3SJMA 3S3NA 4XU2A 3DOKA 4DV1K 5SWMA 3MAQA 1YI2N 1ZRDA 3GNGA 3ABLH 3DLHA 2G3RA 3V8JA 1B34A 4HNVA 2OTLQ 5C3EJ 2CP3A 1VQLT 4PJJA 3FBIB 3OYIA 3CPWM 2KZGA 4AVPA 4GMJB 2EYQA 1VSFA 3LLRA 3HO1A 4XN0A 3AG1H 4F8RA 2A1SA 2DZCA 5IP9J 1BOAA 4EMKA 3JCMf 1D3YA 2ZNZA 4OPJA 3DXKB 3OQ5A 3VA0A 2O2OA 1J0RA 3Q0UA 4XIDA 3GW2A 1NGDA 3FISA 3C12A 4DFKA 4KHNA 4XKWA 1X9MA 3EGDA 2D0OA 3GTGJ 2MCNA 4XH4A 1SV5A 3AVCA 3LAPA 3RSEA 3L9FA 1BM9A 2OAWA 3K1PA 2W57A 3DOLA 4FOEA 2EB7A 2YSRA 2IP2A 1LCKA 3FXMA 4HXJA 3RYPA 3EG0A 4EFHA 2YCHA 1KONA 5I2SA 2XF7A 2RQVA 1FTZA 3QDRB 1J54A 2HWVA 3TQ7P 1BIBA 4E1NA 2VBXA 2MOXA 4FJLA 5E1ZB 4M7AE 4NQWB 2CQKA 3FMRA 1HX1A 3CC7T 3K4LA 3AVFA 4KUMA 3U1DA 2DRMA 2R5AA 2OTJT 4AH9A 3U9ZA 3QEXA 3SQ2A 1U04A 3KWGA 5K7HA 1JUMA 3HSBA 2JTFA 1B72A 3HOVJ 4I6ZA 5D6WA 1XMKA 1W5CC 5EU7A 1KD1R 3FZLA 2IAIA 4Z2YA 3WTZA 4EGZA 4CJEA 3LDNA 2E34A 2AZVA 1UA1A 2QQ9A 3HOWJ 4DV2K 2BXZA 1HF0A 1BU1A 2K3FA 5FDLA 4Y4RA 4IRGA 5TISC 1VQ8Q 1NOZA 3BT9A 1GLFO 4N5SA 3L8BA 1NK8A 3M0SA 5DMRA 1P7JA 1NJYA 1Z7LA 3CG7A 2JTEA 2QSGX 4RCHA 2DTUA 2O6GE 5LEKA 2ABKA 3F8BA 2BYVE 4FJJA 2F5DA 2HHUA 4ZNXA 1BJAA 4V2SA 1HNVA 3MP8A 3CP2A 3BLYA 3J81K 3AVHA 4M75E 3LSKA 5LRRA 1IUFA 4E47A 4O4GA 2ZE2A 2P1JA 2LQWA 3QPLA 2WY8Q 5HVQC 2R7QA 2FUG2 1IN4A 3PE0A 3CMAI 3ABKH 1UTIA 3BG3A 5EOYA 3PIOA 1XCBA 4CEZA 4HX7A 2GBZA 3R6OA 4CHYA 4DYCA 2LCSA 2YNGA 3R6MA 2EYWA 2ZGYA 4HCBA 2TCTA 2O8CA 1K73U 2P9IB 3MN9A 1JEGA 2NXNB 1V1CA 1M1KR 3G6EQ 4WCGA 2F9TA 4FT8A 1MSFC 4AC0A 1OKRA 5HROA 4LDXA 3NH2A 3V81A 3B8AX 5BNGA 2QEXQ 1T05A 1J6ZA 3QBWA 1GLAG 2PYLA 1CXQA 5AQTA 1NOYA 1SANA 1NNEA 3GLLA 4JPBW 3EUAA 3QPSA 1SVMA 2QWOA 2GA2A 3RQIA 3MMVA 4KFBA 4AYBN 2OA8A 2K3XA 3VETA 5F1JA 5CQEA 4CCKA 3M8JA 3ZMSA 3VOEA 3O2PE 4LB6B 2I7PA 3E6CC 4PKHA 3O8HA 4CZEA 3M1CA 1UG2A 5LHHA 1HK9A 3MX2A 2J05A 2ROTA 4F9OA 3I4NJ 3T7ZA 4IXAA 4Q0BA 4OIQF 3BG9A 4YEJA 1QVFM 3O9TA 3TAMA 3ITHA 4OMNA 3HDDA 1UE9A 3PX0A 1TNTA 3JRHA 1NGAA 4XN3A 2V8JA 5FKMA 2CV2A 5H2FC 3DPTA 5ECAA 4B8CA 2AQFA 5IWAK 4NO7A 3CQXA 4B9SA 4F2RA 3CC7Q 3TU5A 3SWNA 3CUOA 1YHQI 4XQFA 2QENA 1WYXA 4F14A 1QVFP 5BPDA 4OIOF 2G8HA 2F2EA 1K9MU 5HRPA 3C7JA 4A2AA 4NNJA 3QAHA 5LY3A 3F9KA 1TBXA 4Y13A 3I5SA 4FSVA 1HC8A 1VAZA 3CQZJ 2RNJA 4HV6A 1GLNA 3CIPA 4RG8A 1GLBG 2HF4A 4B1RA 4E9HA 2FYKA 2CZ1B 2ELKA 3HG9A 3LA7A 2RB6A 5C44J 2NNYA 4CZLA 1M3BA 3NE6A 4N76A 1SZ2A 3LP1A 1U6GA 2X1EA 2YHYA 3BDUA 1K73C 5AQSA 2Z1DA 2GAUA 2ZJRL 3VRYA 4BEHB 4RTTA 5IT3A 3GFJA 1UHFA 3CC2T 2D0PA 3TSZA 3CMYA 3VTHA 2GXBA 3HRMA 3AL0C 3HL8A 2HB5A 2CGKA 2DL3A 1FZPB 4AQYK 1BKBA 2PMUA 3E0JB 5CAIA 1MMAA 2DYSH 4W1UA 2F5KA 1MZBA 5CHIA 4ZYGA 3RESA 5J4VA 1YJNI 2HBPA 4JKAA 1XMQK 1OEBA 2B4JA 1H1VA 1WQWA 2R3SA 3WEEA 4N4HA 1K0XA 5JLXA 1W7PD 1X3WB 3HBLA 4YFNF 2LNHB 4BY6B 3WTUC 2XF6A 4RGSA 5HLHA 2I5JA 1YYVA 3OSSC 1S1UA 3EG3A 2VQLA 3U9GA 3S41A 5ELZA 4AF1A 2RH2A 3S6WA 4JK7A 1J75A 5LEJA 3PV8A 4BDPA 4DGWB 3ERED 3PNTA 5C24A 3X28B 2EFNA 2RPIA 5CY4A 3IQLA 5JMVA 1KAXA 2DL4A 4XTUA 1QBJA 3RSEB 4RAFA 1HKCA 3MEDA 3R9PA 1K78A 4B3SK 2PQWA 1M8MA 4QS8A 5AQKA 4ZJZA 3JCMQ 3T1HK 1PC0A 1YVNA 2HVIA 4HZFA 4MDBA 4B1UB 4MIMA 3KYDB 3NHGA 4YOYA 2CSIA 2YNFA 3VKIA 2XGCA 4OB2B 1ZBLA 4WXDA 3HGGA 4L0YB 3IH7A 1MSEC 2X6OA 2H8HA 8ATCB 2QBYA 3GFLA 1NMNA 1Y8RB 3OMCA 5DEQA 4DNCA 2F4IA 3BR0A 3SNNA 3E7LA 3SHWA 3GTPJ 4FWMA 3ZMDA 4CFAA 1VQ6A 1V5GA 5DM6F 3DAWA 2RMOA 1IXDA 4NL2A 4RTVA 3ASMA 5L3GA 1YO5C 1IN8A 1REPC 3PTAA 2AJQA 3K69A 1OX8A 4FLTA 4EV0A 4BRNA 3HK2A 1S1TA 3MFKA 5KYYB 3CZ6A 1M90R 1R0BG 3BW1A 3V7CA 2DFUA 2AKLA 4RB3C 1J5EK 2HGCA 4KH0B 3A03A 3X25B 2NOBA 3H9NA 1W1WE 3META 1RETA 4CJUA 2OBPA 2RQQA 5AFUH 4QTRA 4AFSC 3VUZA 1CZBA 4GYGA 4YFUA 2KRHA 2EW3A 2VWFA 3FE1A 2EQIA 3ERMA 1ZGAA 5L3CA 2RHXA 4IO8A 2AIRB 4KTWA 4XICA 3CF5L 5CQXA 3SPYA 5EVZA 3HOXJ 5GMKi 3O80A 1QHGA 2UXBK 2ZXJA 1TZLA 3IMXA 2BE9B 4WQ5C 1VOMA 1HMVA 1K8KB 5MLCQ 1J09A 1PU8A 2K3YA 4WE1A 1ETYA 3G4SN 2QLZA 1I6HJ 3UT1A 2DJIA 4E9EA 5HKCA 3VOVA 2HMAA 3CC2Q 3UKRB 3HT3A 4XLCA 2K40A 1RDBA 2E36A 1BI3A 5FU7C 3G1JA 4XRMA 4FW2A 2Q0OA 4CXFA 1Z0XA 4HVVA 5EX5A 3M9QA 1I94K 1YITN 2R7RA 1KQSP 1U2WA 3J7AY 3VS7A 1N5YA 4CC7A 1M1KO 4AG1C 3KXTA 1A5VA 3VN5A 5DYMA 2FSJA 4DQPA 2QQBA 2V8IA 3MN6A 2UU9K 2DA6A 1TUGB 4KI6A 3UIQA 3JAMO 4B9MA 3BG6A 3NFCA 3AVMA 3DBLB 3EN9A 3PNYA 4ZZDA 4DV4K 4CC2A 3WG7H 1LWFA 2LQ8A 1ZUUA 4C9YA 1M30A 3JB9F 4CZCA 4C8QF 1QRYA 1I8FA 5CR4A 2ZSIB 3CCYA 1RAHB 4OVLA 2GXAA 1IJJA 3DP7A 3QOPA 4B6MA 3OW2M 3QEVA 2LRQA 1SAZA 3FLCO 2CT3A 3I64A 3W6JB 3TW7A 3S3OA 1H8KA 3GMEA 4NC6A 1SEMA 2XGDA 2ZJ2A 3J7AO 2VJ5A 2WADA 4PY5A 3TAQA 2WY7Q 4LG0A 3HOZJ 2DZ9A 4E6RA 3DV8A 3DB3A 3CF5F 2D0AA 3MXIA 2BHYA 2MD0A 4BU2A 3VJPA 4F7UE 1BA0A 4F2SA 4GLMA 3OYDA 3NVKA 5L23A 2D45A 5GANe 4AHTA 3LH0A 2CP6A 2P9KB 1TP4A 5KE2A 3RMAA 1H8AC 1NK2P 3UKUA 3JB9I 1Z21A 1HPMA 4TV7A 1RDDA 4CJ3A 1OH8A 2L4MA 4DKWA 2RK1A 3J7AF 3VQDA 1NBEB 1M2VA 2BW3B 3EGXB 4LLNA 2EINH 4CW7B 5AQXA 2NNWA 4C3JJ 2MPXC 4C92G 2RQPA 1XUPO 5BN8A 1DIZA 5E3NA 4J9IA 3TAPA 1WPKA 4OOIA 4XL9A 4DQ2A 2HBWA 4FETA 1W97L 1YCSB 4Q5VA 1SFUA 2ZPHB 3A5LC 3WQTA 4JX5A 5E1WA 2KT1A 1MPGA 4CEDA 1LWVA 2D5VA 2XRNA 4UUSA 4XORA 5J8CA 2M7BA 1IF1A 3ASKA 4ZYAA 3HUGB 2HL5C 4JI8K 3OYJA 2XSDC 1NJZA 4O8KA 3C2HA 2A6EF 2EWNA 1A35A 2D1HA 2GBQA 3V4IA 3DYAA 1N33K 2R7ZJ 2LOOA 4II2A 2EQUA 2NRHA 3AFHA 2ZQBA 3TP0A 3D7EO 2E6ZA 2ELJA 2ISYA 2RJEA 5HP1A 4B9VA 5D3GA 2H3JA 3PM1A 1YJ9T 1UAXA 1IXCA 2Y69H 1K8AR 2GFUA 3I59A 4IO9L 4L5IA 4JJBA 4OJRA 2V6CA 3L3UA 2K2MA 4BE1A 3BR6A 3ZCMA 2WTEA 5ICEA 1VQLA 1TW2A 3OYHA 5GAOl 1ARKA 3THXA 3W6VA 4I2PA 2EBPA 1NGFA 2ZXWH 3Q5FA 3MZHA 4J2AA 2O8DB 4FXDA 1RC9A 1WQ7A 3UA6A 4EZ9A 1F43A 3FDYA 2EYYA 4DSFA 3OS1A 4JZ4A 4BB7A 3DQVC 1U3OA 2HPMA 4C8MA 1KAZA 1H3HA 4A5BA 1KYWA 2DA1A 3NEUA 1REVA 3QIIA 4IFYA 4LXCA 2W6LA 2IPQX 3P7NA 4BRIA 3QU6A 4N4NB 3ULEB 1B9MA 4AMCA 1FW6A 3CCSI 4P5OA 1X1CA 1Q9XA 1A0NB 1QPIA 2H8RA 2DYRH 3SV4A 2VKVA 3I0XA 1R4MB 1WAFA 4CZJA 3WODF 2XASA 2Y2ZA 4BRDA 2YNIA 3I56Q 2GTOA 4B43A 2MI6A 1WHKA 4MFEA 4M7DB 1YTYA 3W0LA 2DX1A 4FJHA 2RN2A 2JMAA 1FX7A 1X4PA 2OCEA 1D0ZA 1HQUA 5HNFA 3NF6A 3DLLL 1HOMA 3MEXA 1RBUA 2ZNYA 3E01A 1IUYA 4C8QB 4IVNA 3KZBA 4OU0A 2JGUA 3LP0A 3HOSA 4QSHA 4W5TA 1MUNA 2VWJA 5EDNA 2C6YA 3RRHA 3M8QA 1NK3P 4OMMA 5CJ9A 2QWWA 4NXNK 2PMHA 1IV0A 5KPZA 1EH8A 3QO3A 5HRSA 2NRZA 4BKXA 1J9IA 3KP2A 2EKOA 3SUOA 2OTLA 2DKGA 3MZ8A 1KG2A 1BB9A 2RGVA 2GTJA 3EZ5A 1G59A 2GUIA 1BR2A 3HP6A 1QZYA 4CEEA 2CZ7B 2JVVA 5K1YA 2HQHA 4J6WA 4JV5K 4GNIA 1A31A 4R5PA 3M1FA 3B6AA 4B9UA 2KAFA 4RB2C 2HSTA 1WGSA 4KGZB 2COBA 2NS0A 4C0DC 3CCUN 1G4DA 2A36A 1C0GA 1TL3A 4M71A 4DR4K 1EKEA 1YJWN 2O4XB 3AO1A 2AO9A 3S93A 4AYBA 3DXMB 3SQ0A 4UUSB 4IHTA 1IO2A 3G4ST 4WFAL 3S3MA 2XROA 5LMUK 1KG3A 1GLJO 3OYYA 4KI4A 4NBQA 1VSKA 3J81E 2QM1A 1HU0A 2OFKA 4K42A 2HL3A 7AT1B 4FJIA 2OD5A 4IG0A 2LY9A 4CH7A 4LFCK 2K86A 3ASNH 1NTCA 1IBKK 1I1GA 5JLWA 2NRTA 4L9NA 5FO5A 4A2BA 5LJVA 3ZQIA 1Q7YU 2DMPA 3I56I 3M3YJ 2P9NB 5M1PA 4Z4EA 4XR6A 1KSWA 9ATCB 4QQ6A 1CKAA 3OBWA 4RW9A 3NDKA 1ZARA 2HMIA 1FOXA 2HXIA 3JRFA 2JHNA 4FLYA 2YHXA 2KQ2A 1P2FA 3SEMA 3RCOA 2DT5A 3DRPA 4PA1A 1O3TA 2BVMA 2E7XA 4DV0K 4XAXB 1YIJQ 5GTHC 2NS8A 1OI1A 5DLOA 1UGRB 4C1NK 4HPQA 5I2MA 4WXHA 4XTYA 1L5UA 2MG4A 4CGDA 3RVCA 2YR2A 1V54H 1QCFA 5FLXO 1VI0A 2X6XA 4M77G 4M3EA 4YDUA 4CBWA 5EEGA 3TSWA 2XY5A 1IW7F 1Z3XA 1N3CA 1IN7A 3LNQA 4KPYA 4A3GJ 2KFDA 5E8GA 5C25A 2ZGZA 3REBB 3AG3H 3TKYA 4ZN1A 2NVYJ 1DPRA 2HOAA 1YJ9Q 4CYCA 2GQQA 2YJEA 2QQAA 5JHFA 2KMTA 1MMSA 3CCUT 1YQLA 3E9GA 3K5MA 1R77A 1YITA 3S1MJ 4C3HJ 1PP8F 1H9GA 3CCUQ 3Q0WA 4E6KG 2YHAA 3I59B 4HTUA 2V7FA 4M7XA 4NLCA 3SDGA 4N56A 3A8GB 1MJAA 4WK8F 1WNSA 4NYFA 4JK9A 3JV3A 4E19A 3ZQCA 4C92D 3PUFA 1KHIA 1NG6A 4KB1A 4K0KK 2OAZA 3M4GA 2CUDA 4FISA 1T38A 2FOKA 3JCMV 1WHHA 2WONA 1SMYF 1UGVA 2FSKA 1L3LA 3LMMA 1K0SA 1VQ4Q 3CESA 4CEAA 2X4YA 2JT1A 1YCYA 3RTVA 2M8EA 1HSJA 2GWKA 4FLWA 3JB9H 2ZPBB 1DU6A 2X4XA 4DU1A 1VYTA 1D3BA 4A4KA 5LBQA 1HLVA 3VWBA 3IKTA 4C5IA 2QTXA 3ULEA 4JI7K 3L3VA 2IRFG 3LDPA 2JUGA 4FLXA 1ZYQA 2PFUA 3GP8A 1UJ0A 5EG0B 4A0XA 4K43A 5TKWA 4NOYA 3G1MA 2RE2A 1JKOC 3QWYA 1DLOA 2VJJA 2L9SA 2W85A 2LSNA 4DR2K 3C2BA 4B3AA 4EJUA 3P9IA 1F1BB 4M75C 3WU1B 4CE9A 4BRMA 1Z3YA 4AIKA 2EZIA 1YT3A 1J7KA 4BL0B 2VPLA 1N6QA 2XHBA 2FBKA 1XC3A 3HKZN 2AZSA 3HKSA 1BWFO 3BY7A 4IFVA 1FTTA 4M77C 2PBDA 4IXCA 2O8CB 2P9UA 3CCVT 4EP4A 5HODA 3UDCA 4CEFA 1BL3A 4C92C 1F5TA 3G0QA 3CTAA 1GV2A 4IHSA 3O3HA 2V26A 2M0CA 3T0YA 2GLOA 3PIOL 3CCUI 4DR7K 1VQ7T 1OLTA 1UEBA 5IOZA 2QA4T 4DFPA 3VSLA 4IWVA 4XM3A 3AG2H 1RAAB 1MWMA 3I4MJ 4RGUA 3T8RA 3A8MB 4HX8A 2CWEA 5FROA 3N4QA 4B09A 5CVIA 2DM1A 2DD5A 4LD5A 5AQHA 5LJ5g 1CZ9A 2GX9A 1ETWA 5FWBA 4PSWA 3KKSA 1B1BA 3LL3A 2LDUA 3WNGA 2ZCWA 1IG9A 4DS5A 5GAOq 1SF9A 1SMTA 2JM9A 5AIQA 4LDYA 1X3ZB 5M9OA 4HSRA 1F36A 2VWBA 4M77D 3VQQA 1ZA2B 3R3LA 1MBJA 5D6EA 1TWBA 2KRMA 1BBZA 4LFAK 1HNZK 3VMFB 1D09B 2QTVA 2BZTA 2HW3A 1QHTA 4C0ZA 3CFRA 4KH6A 2BE7D 1S72T 5I9EB 1TWAJ 2COYA 1U3EM 4FYXB 3SEQA 1MBGA 4HLYA 1Q1VA 1KG5A 4JJCA 5AFUA 4L9TA 4CJ7A 2OU2A 3K70D 5GMKl 2L2PA 1FY7A 3FZFA 2IG0A 2CGLA 1ZSZC 1FYMA 1J5YA 2DXUA 2RO0A 1TL1A 3V1OA 1TWHJ 4HCZA 2LCCA 4IOCF 4Y1DA 2Z9OA 3JB9G 1XI1A 2R7FA 2VKDA 1QGPA 1YITI 2IAJA 3VS1A 3SZGA 1BQNA 1C6VA 2FLOA 1JCFA 2GWRA 4ZDLA 2RQUA 4TSXA 1ABOA 4CHPA 3TSPA 4CJLA 2FD5A 2BY3A 4XLEA 4F91B 4IPAA 1HQCA 2FC0A 1KGSA 1GOAA 2RVCA 1Z6RA 2DK8A 2FBXA 3KTUA 3HSTB 1E17A 1PKSA 1ZG3A 4M7AF 2JPBA 4A0ZA 1TG0A 5KYWA 3K9KA 2IEKA 1AOJA 3GOXA 1NM1A 1U6ZA 2WSFE 5KGWA 2PVDB 1VYUA 1XTAA 3QYFA 2K57A 4HUFA 4BC2A 3H5AA 2OJ2A 4AG2C 1I5LA 3LCNA 3C94A 4C92A 4M3DA 2Z16A 2EIFA 3ATUA 1LW0A 4H5WA 3ZN0A 3V9SA 5FGMA 1UB9A 3LYIA 4M3FA 2JWKA 4XONA 5IP6A 2FSWA 3D0PA 1RABB 2OPSA 1IJWC 4OIPF 5IN1A 5M1QA 1H3ZA 3EUHC 2A3SA 3DBRB 5ADXH 2XO7A 1XC5A 3ASOH 4XH5A 3VYUB 4PIIA 1M3AA 3M0QA 2ZJPL 2IVPA 1PWTA 4BC5A 2BBYA 1BL0A 1NGCA 3PO3J 4J00A 1A5XA 3CUQA 3TSUA 1UGPB 2VQGA 1VQNT 2HHTA 2ZMEC 4J6XA 1X3MA 5EG2A 1BC8C 1MD0A 1N8RC 1KVAA 2P9IA 4BY9C 5M1OA 1K8AU 4BREA 2G8KA 2KNBB 3OMGA 4XH1A 1P4XA 2PJRA 1GT0C 1OCPA 3LM2A 1XWLA 2BE2A 3TAEA 5J3LA 1JJ2A 2Z1HA 2P4WA 2FXAA 4D5CA 4NC7A 4RLQA 3EUHA 4CIFA 3FIFA 4KYWA 4BWMA 2PX9A 1GBRA 1FSEA 3SQNA 3D4VA 3CEYA 4ZYDA 2HKQB 2IBDA 1X69A 2WAQN 5HS9A 1I3QJ 3QBXA 3CWTA 3A8OB 1BCMA 4FJ8A 2PN6A 4CEOA 2E6NA 3E9FA 2MD5A 2OCCH 4M6VA 3GTMJ 5E3OA 1V29B 4PFOA 2R7XA 2CP7A 1AWXA 1JBMA 2D1VA 3QNNA 3MKWB 4CSWA 4KTQA 1LDDA 4KB0A 4KRTA 4I99C 4F92B 1ZTRA 3OYNA 3MHXA 3CXCS 1ASUA 1RT6A 4DB3A 3IP4B 1LW2A 4OMOA 1NPPA 4FYYB 4IIOA 3INZA 3FBNB 4XLAA 3EZWA 1B4AA 4GFBA 1Y1VJ 4H5RA 3ZMZA 2E1CA 4PKCC 4M77A 2QA4Q 1TWCJ 3HHHA 3LGLA 4BRGA 2LMDA 2FRYA 2XB0X 1PM3A 1SSFA 3AL0B 4M7AG 4IX7A 3F3XA 4LB5A 3O1BA 1VQMI 3A02A 5CKTA 4E0DA 1X1PA 4M74A 1VQPQ 4EZ6A 3OOUA 4X1VA 1U1SA 3IAYA 1JUPA 1OVQA 3MKLA 5CE3A 3UNGC 3G0ZA 1I4K1 2ICWG 4A3LJ 3CLOA 3BROA 2C06A 5IH2A 3ABUA 2XAGA 3G71Q 4LF6K 3LH5A 2VE8A 5JVHL 4XTZA 3CCLT 1NEBA 1ZSZB 4DR1K 4PJ0C 2L7KA 4H4KC 3DBHB 3ME9A 1WI3A 1Y0UA 1BIUA 3VDXA 1VQPT 1VQ7Q 1RT1A 2EZHA 2NRRA 2E2QA 2FRHA 2M0YA 3CCSN 1P92A 4PGHA 4LOCA 4BS9A 2J5PA 5J1YA 4AIJA 1JL1A 5JS1A 1SUQA 4EATA 3CERA 4W5OA 1P4WA 1VQ5I 2HZYA 3SFZA 1X75C 3B02A 4WCEL 5EGOB 2Z3YA 1NGIA 3K2AA 2Y0SA 1IN6A 1AVZC 1XMAA 1KQ8A 1QP2A 2ABLA 2BV6A 3SUQA 4CHQA 5F0FA 1VQKQ 4HSTA 1OYYA 1G3SA 3F8FA 1KC8R 3MX5A 1IRXA 1R0AA 3H0HA 5ICGA 4AHUA 3DLKA 5HLTA 4A3BJ 3C4SA 1R59O 5FPNA 3GBQA 4FL9A 4M78A 3DLMA 3MP6A 1HBXG 1LJ9A 3VS5A 1VSDA 3M8PA 1RDUA 3BJ6A 2CH4W 1LPLA 4IURA 2G8UA 1JXOA 3AG4H 3PO5A 3PJRA 4DBHA 3KFVA 2HSPA 1FIAA 1JGSA 4NYNA 5TGTA 5GIPA 2X35A 1RI0A 5C0MA 2YU3A 4JZ3A 4X66K 2DXBA 2CMPA 1HR0K 3M7GA 1YI2A 3NCIA 5GAN6 3I5RA 5D5UB 2VT2A 2DXCA 3FXUA 4M9SA 4EA5A 3CMEQ 3KLGA 1EIFA 4M6XA 2ESWA 2YSQA 1ON2A 3BPXA 3MEEA 3LWHA 2Z1IA 2A61A 4BH9A 3C3WA 1S3XA 4QQGA 3WTSC 1ZHFA 4B1XB 3GO5A 3CVSA 2EK5A 5K5OA 1NHAA 1JO8A 1SD6A 2FX0A 2R5ZB 1HJRA 3G4SI 2KXCA 4C8QC 3IS9A 5JLFA 3OHRA 4JLHA 2RQRA 1SC7A 5A0LA 5CCAA 2QQ8A 3IH3A 3KIOA 3J80Z 2W0ZA 4DG1A 1SG5A 3BR2A 1NYFA 2YJFA 2O61A 3CJ7A 5FLXZ 1JLQA 3E9LA 4XTXA 4JOMA 3AV9A 3A2FA 1ETQA 3KP3A 3G6EN 5IYBJ 3Q1JA 1BI1A 4IQJA 4B23A 3BFMA 2CUBA 1IXSB 2XHKA 4HCCA 1MV3A 1O57A 4KH5A 4CEBA 3S2WA 3VF4A 5LRSA 1ZUKA 1GLDG 3OTOK 4N41A 1SS6A 5IT9K 2CW7A 1DGWY 5I3UA 1GFCA 2HNDA 1PYVA 4C92B 3W6KB 3QQAA 1LVKA 5KYXA 1RNLA 2CZ6B 4KT6A 4UQGA 2WSEE 3CC4N 1M5Q1 1RRQA 2G8FA 4AIHA 5AQZA 1IHVA 4RW8A 4C8QE 2A05A 4KH4A 4OINF 2LT1A 4GRIA 1GCPA 4YDUC 2PUOB 2EJGA 3RJPA 3LW5E 3JRZA 3C0BA 4U7DA 1Y6IA 5A2QO 3RUXA 2Q2RA 2E6LA 3P8HA 3VEYA 2KDZA 5GAOm 4X65K 1DP3A 1ATSA 2CS7A 2M51A 2F4MB 1W7PB 1K73R 4EMKC 2I2LA 4M3ZA 1RDWX 3QDFA 3CCQA 1LE8A 1SVOA 3I55N 1LFPA 3U4LA 4PWDA 2HQEA 3CCRQ 3AO2A 2G7UA 3VGLA 2EKHA 2XV4S 1YRNB 1R8OB 5KPTA 3DXKA 4FZXC 3CWSA 5BRFA 1S9GA 1U5TC 4HQEA 1FPQA 4DCHA 2QUFA 5C6SA 5LHGA 5GMKm 3FM3A 3S1RJ 3J7ZO 3V7RA 4LH5A 4BJ6C 3SK3A 1PCXA 4QLCU 2FHDA 4E9FA 2KRSA 2O8FB 1NGEA 1VQLQ 1KU2A 4QS9A 3NGIA 3BJAA 1ZYRF 4PL7A 1M90U 2ISZA 3TTCA 3GNFB 2W1OA 2W48A 1XSXA 4M7AC 4CHNA 2OTLI 3KK2A 3PT9A 3THVA 1RRSA 3CCQN 4IF4A 1S29A 2R7YA 1S3JA 3OYLA 2E5QA 3SI6A 2JTVA 3V6DA 5E3MA 3EKSA 2L01A 2DMUA 4LD9K 1SKWA 5CKHA 3NH0A 3RDIA 1E3MA 4XNFA 4BQLA 4R56A 3K0SA 3QSUA 3M58A 2OC6A 4EJWA 1NK4A 3CCVQ 1X58A 1A04A 4D5FA 2VC1A 3AO5A 3CPWA 1QHHD 4CCLA 1E7OA 4E1JA 4ZHRA 2COWA 2L3SA 3RBBB 1WBDA 2P5GA 2OX7A 4DF8A 1ZXOA 1FC3A 5L8RE 1K7AA 1GCQA 3VV0A 4FSXA 4IUVA 2JTMA 1KG7A 1HCRA 5AQYA 4Z4CA 1SFEA 2KQRA 5AONA 4GY5A 3ENOA 1CSKA 2GUPA 3WTXC 5J2PA 2IS3A 2EA4A 3A98A 1ZHIA 4DTRA 2NRWA 4RTFD 2P4RA 4R1HA 4IIMA 2Q1NA 5CQYA 1Q82C 4QPOA 3SJHA 3KETA 1AKHA 2DFFA 1OPCA 3IV5A 3QLHA 1R71A 2O9LA 3GX4X 1GOBA 3VEOA 2ZJQF 4XU1A 3MKDA 3X26B 2E3HA 2F6CA 3TARA 2WBMA 3QOEA 2YRVA 1TGOA 2XSJC 3TGNA 2QEXT 2CO5A 2L7MP 3OS5A 3HP9A 3JCMd 2VB6A 4MDAA 4LF5K 3CPWS 3A8HB 5IT9Z 2DE0X 1RAIB 4MLOA 1TT5B 3HRTA 2M5WA 1YFNA 3V7SA 3ECOA 3RSNA 3DKYA 3K58A 2X4JA 4BI3A 4DV3K 3WU2C 5ILVA 2ZAEA 4XMYA 2W25A 1VQKT 2CGJA 1MMGA 2CYYA 2YHTA 4Y52J 1ZGWA 1TYQB 4ILHA 2IIRA 1IZ1A 1NK5A 2OAUA 3QICA 2PMZN 4C92F 5GAMf 3QRFF 3M9AA 4DTPA 2DTIA 2QWPA 5GAN5 4A4FA 4R79A 3FGUA 5GANh 2W24A 3CCJA 1S6PA 2L7ZA 1QQOA 5C15A 1YE9A 3F72A 4G6TB 4DOWA 4CJPA 3HFNA 4CJRA 2ZMEA 4JS5A 1VQ6T 1LWWA 2Z1JA 2DMQA 3UATA 5HLFA 2V7YA 3R1XA 4U0YA 3EYIA 3J80O 3PUBA 1W2BS 3CF2A 4BR4A 2VQCA 5CYMA 2DA7A 4NL3A 2QZ8A 1YWPA 5LMNK 3UR3C 4FE7A 4CJFA 3CCLQ 2EFWA 3KEOA 2E1YA 1NG2A 1G99A 2E2OA 1ORPA 1NJIO 1QVGM 3HTSB 2UYTA 3T1AA 3CJ1A 3P38A 4KHPK 4B22A 1Q7YO 5GIOA 4XKBA 4LF8K 3P4IA 4C0DB 3O8GA 4E89A 2K7LA 3K4CA 2DEQA 3KHYA 2XRLA 4BDYA 3DRSA 5C12A 4JKHA 2HBKA 4RM2A 4BBRJ 1FN7A 2Q0RA 2ECZA 1X2KA 3CC2I 4DFMA 1WA7A 4BG9A 1QVGP 1SHGA 4G6QA 4KHUA 5JICA 1HKQA 5FKLA 1C1CA 1WFWA 4EJOA 3HPHA 4BRLA 3AARA 1LWEA 1M1KC 2H27A 3UPUA 1KJWA 2NUBA 1AU7A 2FU4A 1TUDA 2A1RA 3WQUA 4BRPA 2ZD1A 1DGKN 4RA2A 1OU8A 3OH9A 2ETHA 1YJNQ 5CKEA 5BPIA 2BXYA 4RG2A 1OKJA 3ZSXA 3QIPA 2KIQA 1ZR4A 4XSZF 3JREA 1MNEA 3QYBA 1I81A 3AAFA 4OLAA 3CCJN 4M4ZA 3TR8A 1W9HA 1OX9A 2M87A 4Z6YA 1YVUA 4EDUA 3R60A 2K9SA 4MFBA 2HR3A 3S1QJ 3VQBA 1G15A 4CYDA 1A6QA 4CJWA 4LLLA 1QZ6A 2DA4A 3WTTC 1YS7A 4KT5C 2YG8A 3FHGA 1R23A 1YIJI 1QZZA 2XMFA 2L3PA 2YLCA 1WSEA 4RAYA 4LC9B 2IT0A 1YHQT 1H641 4BVOA 2KDSA 2FMLA 3ULDA 2KW4A 3SZ2A 1JJ2P 1JXEA 4HNUA 1Y7XA 3G71T 1XGMA 1VQ9Q 1ZRFA 2E2NA 3O4QA 4A62A 3KLHA 2OV7A 2VKEA 4OAZA 5KQDA 1Y57A 4KAZA 4OMQA 4JQFA 4FLZA 4BJTA 1YQAA 2DPUA 3QHSA 5LJ5e 3JCMb 3F2KA 3QFPA 2ROLA 2Y1JA 1DTQA 3GEZA 3FM5A 2K3BA 2KRCA 1N75A 2DOEA 5DUKA 4LF7K 4ZTJA 5CO7A 1GRIA 2F9WA 3O1WA 5FWCA 3CMAQ 2A41A 4OMYA 4MO4A 2XU8A 2HOEA 5HDGA 4CF1A 4OPKA 1K9MC 2YX4A 1NMDA 3KLEA 1IBLK 2P84A 1Z1DA 1ON1A 1I07A 5DCMA 2V1QA 3ZSZA 3HL2A 2H1KA 5A2QE 5LJ5j 4PZJA 2ZGWA 3HSRA 2P9NA 1RAGB 2LC2A 2FL7A 3O8MA 3KE2A 1KO9A 1PRMC 2WC9A 3I56T 3DPLC 5BPLA 1ZKGA 1OCTC 3RIRA 2FZCB 5M1KA 2M34A 2X9DA 4QPQA 4H8KA 3RR8A 4J9CA 5KAFC 3ISPA 3VS2A 1WNLA 2R0QC 1Z67A 2XHIA 3CW7A 1TKDA 3ZMVA 4GYIA 3QZ5B 4Z4GA 5E17F 5EZGA 2KJBA 1VRUA 3LFUA 3V1RA 4AFZC 4B1ZA 4Q5SF 2P5VA 3K57A 3JCUC 1R1VA 4ZH4F 9ANTA 3SAFA 1OZ3A 3AHUA 2UXXA 4RLFA 4PKIA 2NRVA 2DA9A 1HDPA 2VXFA 4PGGA 1YHQN 3CCRI 1VQ9N 1E3HA 2QKMB 3AA5X 4LF4K 4M3UA 2CREA 4DU3A 1HQEA 3CMAN 5LHIA 2K4YA 4O6JA 2VXZA 3KJVA 3OYGA 5CVJA 3KLOA 1ITYA 2LKPA 4J19A 4P9FA 1VQNQ 2QYZA 2WAEA 1WB9A 2KYMA 1TUYA 1J5OA 2X9HA 5GAEJ 5E3LA 2DPPB 2FF3B 1VQMT 5B66C 1GFDA 3LALA 1TSFA 3CCSQ 4M77E 1XB4A 4B24A 1Q7YC 1X9WA 2RHYA 3OSFA 2QM3A 1Q81U 2JJ9A 2HQRA 4O5VA 1TWGJ 2QF7A 2L3DA 5DCMB 2LVSA 4RW6A 5KQ8A 3DPUA 4A3CJ 2R7UA 1K79A 2CSOA 4O5BA 4M73A 1N3AA 1ZRCA 4HSBA 1S8NA 1XNIA 2WV0A 1IKYA 1W5TA 2VUMJ 2YKNA 1S5JA 5EEAA 4KDPA 3WTWC 1T0JA 2DA5A 3E1SA 4L5EA 4LSLA 1VQ9T 3KWIA 4FJGA 5HK3A 2DA2A 4LG3A 4BR7A 3AT1B 4KA4A 4EVIA 4OAYA 1U5TA 1RTDA 4OGEA 2H6CA 2E2HJ 2JNGA 3EE9A 2OTJI 1K9AA 3ALYA 3ZSOA 3EYYA 4CJKA 4EPCA 3DEEA 1FP2A 4E7ZA 2PI0A 2OZMA 4D0PA 1NPRA 2FRWA 4M7DF 1FOKA 4OX9K 4XU3A 3IFRA 4FPBA 5FU7B 5LJ3g 4Y92A 3E5QA 1QVGS 5C2DA 1SKUB 3BG5A 3WNFA 3UKUB 3VS0A 2RHIA 2VG6A 4YPHA 5EEHA 1S1NA 4Z89A 1RKTA 1O4XA 1LE8B 3BDLA 4O8UA 3H0FA 1R49A 2FXUA 1Q8IA 4I7FA 2ATQA 1FBSA 5FKNA 3Q9VA 4A3EJ 1Y07A 2E8AA 5AQOA 3KD1E 1PU6A 1B07A 2JVGA 4JLGA 3DMJA 3ESWB 1JU5C 4M78E 3LPUA 3EAEA 1ZLJA 3RMQA 1MW7A 3R61A 2XG8D 4M78B 3EH2A 1VQ5A 1DDNA 1KU9A 3P31A 1MJ9A 1FSHA 1Q82O 1VQ5N 3LDSA 3OA6A 3ZSRA 1GCQC 5AQPA 3EETA 2NVTJ 2LVMA 4A3KJ 3K2PA 1VQOQ 2QW9A 1BW5A 2LP5A 1UHMA 4EJVA 1NJIR 2W7NA 1S6LA 1GXQA 4QCLA 4JKCA 2PY5A 3TCJA 4KHWA 1Q7YR 3DTIA 2CT4A 2FG0A 3FX3A 3IRXA 1D5AA 2I5WA 4FM0A 2HCKA 1MMNA 4BR5A 3NAUA 3FXKA 2JN6A 3K4NA 3EFRA 4B9TA 2AP1A 4FWQA 4BC3A 4DZJA 1SL1A 1RTHA 4MTEA 2P9SA 2HYFA 4FLVA 2O8BA 3JRCA 2O8EA 1YP5A 4M7AA 1CF7A 4DYRA 3HKZA 4CF8A 1TWFJ 3OH6A 3AVJA 3EO3A 4ID1A 3F9MA 4JUVA 3TQNA 4OB1B 1WVRA 3OJUA 1TC3C 4CFDA 3X24B 2JMWA 1RNHA 3L2WA 4H0VB 2W6KA 1C0TA 2I10A 1MDMB 4C8OA 4LDWA 2F5EA 4LUDA 2O8DA 2KL4A 1OZ2A 1XCVA 2FZGB 3AVAA 1ZBSA 1EWQA 1U9OA 3O6BB 5CYVA 3KLFA 2DAOA 1WEGA 4B3OA 5JVGL 4C8KA 3NQOA 4FQGA 4PCQA 3V9UA 1N32K 2CFXA 4OB0B 4DBQA 2E5LK 4CGIA 2XY7A 4OKEA 1ZBFA 4DU4A 2L02A 4LK1F 3HVTA 2PG4A 2B63J 2UXNA 3LP3A 2UXDK 3P8DA 4NS5A 4CBUA 3OIPA 4MMLA 3IRQA 3CDLA 3K4MA 1XNRK 1FMWA 1MUDA 5B1BH 3WUHA 2P51A 1EA3A 4JNEA 2DD4A 4JLIA 3URGA 5IT9E 4ESFA 2NUTB 5GAOn 1T3LA 4KTZA 4IJAA 1TAUA 3DLEA 2EGEA 1BJZA 2RN7A 3ER0A 4CC3A 4JDSA 3L0QA 2MWOA 1AEYA 3ZEUB 4CERA 4UNFA 2RF0A 1U0JA 3G6ET 5JVTA 2E4LA 4B3RK 1ZA1B 3TVTA 3O6WA 1EQYA 2QXLA 2LNVA 3ZQGA 4PJOF 1MNDA 4ELTA 2R7DA 4FZYA 3CJNA 2RHKA 1MV0B 3P5JA 4K2EA 1OYIA 2VQFK 1S9EA 2O4XA 1ITGA 3ULRB 1XQHA 3CQYA 3ENHA 1T2KA 1QZ5A 3K4BA 2ZSHB 5FRNA 1LVAA 2H3GX 1EXQA 2GM4A 3M07A 2QGFB 3F8MA 4OMZA 2E70A 4DTXA 3M0RA 4Q5WA 3SYZA 3R8EA 3BQYA 1D0YA 5A0DA 4ENKA 2CS3A 4O55A 2Z5UA 2LBFA 3ZMTA 5HDNA 1DJ7B 2EILH 4LD0A 3GZ5A 4FJ7A 1WSJA 2H1LA 3HZ6A 2JRTA 4Z94A 1XG1A 2VBZA 2WV1A 3BF1A 3ENBA 5AQUA 4A93J 2M7AA 2UZKA 4S0HB 4HF2A 3TO7A 3RNJA 5AQNA 4YOQA 2BKDN 2DI3A 2FA5A 2QVOA 3W2WA 4YFKF 1B7TA 2B5JA 2MH9A 3JCMJ 3CFPA 2Z0WA 4M45A 1KG4A 3I55T 1N9SA 3K6GA 3FXQA 4J6YA 1DTTA 1IZ6A 2KP6A 4J9BA 1IH7A 4Y1CA 2NAZA 3Q7CA 3M0TA 2P0WA 4NXMK 3CC7A 1BR1A 4ZTFA 1Q95G 4DQSA 1AA7A 1YNZA 2PBIA 3GUDA 5AT1B 2OTJQ 5DK5A 1Z9ZA 4ABZA 5GMKj 3SAHA 3TOAA 2Q31A 2J6KA 1AWCA 2ECBA 5IXBA 3CUQB 1U9NA 4AD9A 4P5NA 1QA6A 1XQPA 3BWGA 4IEEA 4JKGB 1E0EA 2HYJA 2X4HA 2E60A 5GAOp 2D5RA 4IG3A 4UXNA 1T56A 3FHZA 2VONA 3KKRA 2ZJPF 5LJ3e 3BG7A 3O3FA 1YUWA 1XGNA 3HOUJ 5HDKA 1HW2A 1NBWA 3VS3A 2YG9A 3M8EA 3JRDA 2V1DA 1XNQK 2YUNA 3MECA 3AVIA 1WEFA 2QWNA 5EGOA 2B8AA 2OQRA 4EP5A 3GBGA 2K5FA 2LH9A 1E6HA 2Y75A 2YUPA 4CECA 3LGFA 1NZ9A 3EPZA 2K9LA 1WJEA 4X9DA 1P59A 3R4KA 3AO3A 5DM6L 2IC3A 4I01A 4D1QA 2NVUB 3MVPA 5GANf 4BUPA 4H03B 1TTYA 2ECCA 3AAQA 3U23A 1WH5A 5D8KB 1FWZA 3QYHB 1Q1HA 1Y96B 4BBSJ 1RI7A 3ZETA 4M75B 4DTJA 1OR7A 5EZHA 1T39A 3TTDA 4L5GA 2Y1IA 5KYUB 5DDGA 1Z25A 1OCRH 5JLHA 2D6FA 3QERA 1JI8A 3MO8A 3OY9A 4DHYA 2L0KA 3KYCB 3ZQ7A 2JUFA 3FZMA 3VQ8A 3HYFA 3EFOA 2OFIA 5SZTA 4KT0E 4JD2A 2JLEA 4BXUA 4XTVA 2B0LA 2STWA 5F6FA 1YQKA 3EL2A 1BI2A 3N05A 1S7AA 3M59A 5EJCA 1LPQA 4M9XA 3PSIA 4CD1A 2E5ZA 2I0NA 2DXTA 1T3VA 1NK6A 3ZQQA 1D3BB 1N8RU 1HYVA 3CCJQ 3SQ1A 3I58A 4M9ZA 2Z1GA 2O8EB 1WLJA 3R0JA 4ENNA 3THWB 2JZ2A 3OIOA 2FVUA 1WN7A 2XVCA 2C0IA 1IC8A 2K4BA 3ZN1A 3NH1A 4R8HA 2LQNA 4Y0WA 3IKVA 2OF7A 4HX4A 4KMUX 1S1WA 1HYSA 3EKUA 2JWTA 2M8GX 1M3CA 3C18A 3ID8A 1O13A 4B3TK 2EJ9A 4FTHA 2PMZA 1SKSA 2YRCA 4RWTA 3BCBA 5M1FA 4G94A 3L2VA 2HQNA 1QVPA 1ATRA 4J9DA 4FJNA 1KAYA 2QSHX 2KEAA 1ZELA 3ZP5A 3ZBDA 4MMKA 3CJRB 2VYTA 4KFCA 4L18B 3WE2A 3OV8A 2GF7A 4CJQA 2P9UB 3FWEA 5IHNA 4CDGA 4AHVA 1IGQA 4YOXA 3HFOA 4UB6C 1SD7A 2X3WD 1Q82R 1OULA 1EETA 4KO0A 4FJMA 4DZPA 2HVQA 3WNHA 4AIDA 5KYUA 1Q9YA 3JSCA 3LOCA 4PQUA 4FOIA 4M7YA 2EGAA 4FK2A 3PX6A 4DR6K 2L54A 3KUFA 3HZJA 3CJBA 3ZRGA 5AZIB 2BTTA 3F23A 2HDDA 1G8XA 3RMSA 1W1FA 1ZR2A 2LBFB 1OV3A 4FX0A 2M9HA 3CQTA 1PRLC 1KG1A 2V8KA 3VSKA 1YJWQ 2J06A 4B1VA 3BUZB 1WJFA 2DDBA 3GXOA 2DERA 4YOWA 2KQWA 2HHQA 1QU3A 1I6XA 3SV3A 2V1RA 1Y1WJ 3OS2A 3RMBA 1D9FA 2KZVA 3BZ6A 3LDLA 1J9AA 2CQXA 2DAQA 4P96A 2DRKA 5HY6A 3DB4A 1Q81C 2ETJA 1WXUA 4I2QA 4FT2A 1P4AA 1ZC6A 2QI2A 4IEIA 4M7DA 4KGXB 3AVBA 4E7LA 4LK0F 2JMCA 2KFNA 2HZTA 4EVVA 5C4XJ 4PJOD 1X27A 5I21A 4CYCB 1VQ4I 1WRJA 2B7EA 1LWYA 2ITMA 2E5NA 3NNQA 1RTJA 2LJ0A 4KN7X 4OVAA 3CCJT 3V1QA 2HVHA 1STZA 2CP5A 3NGZA 1ETXA 1YLFA 2Y0MA 3JS6A 2SEMA 1KC8O 5ICCA 5KPRA 4RGRA 3BR1A 3EGXA 3E2UA 3HM5A 3DLRA 1WJQA 3LWFA 5F1RA 4HDVA 1UDLA 3LP2A 2OZUA 2K7AA 1M1FA 1USTA 2DTRA 2YPRA 3QYEA 3TEDA 1LJOA 3PIPF 2DVJA 3M4YA 4KBMB 3CCQQ 5HBMA 2YWWA 1LMZA 1U06A 2FF6A 5J3BA 4M75A 3H9JA 2DEUA 2LZ6B 4W97A 2WBNA 5KRSA 3BQZA 3CWUA 2DN0A 2VBYA