3OYCA

Crystal structure of the prototype foamy virus (pfv) intasome in complex with magnesium and the insti pica
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
368
structure length
368
Chain Sequence
LDAELDQLLQGHYIKGYPKQYTYFLEDGKVKVSRPEGVKIIPPQSDRQKIVLQAHNLAHTGREATLLKIANLYWWPNMRKDVVKQLGRCQQCLITNASNKASGPILRPDRPQKPFDKFFIDYIGPLPPSQGYLYVLVVVDGMTGFTWLYPTKAPSTSATVKSLNVLTSIAIPKVIHSDQGAAFTSSTFAEWAKERGIHLEFSTPYHPQSSGKVERKNSDIKRLLTKLLVGRPTKWYDLLPVVQLALNNTYSPVLKYTPHQLLFGIDSNTPFANQDTLDLTREEELSLLQEIRTSLYHPSTPPASSRSWSPVVGQLVQERVARPASLRPRWHKPSTVLKVLNPRTVVILDHLGNNRTVSIDNLKPTSHQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular mechanisms of retroviral integrase inhibition and the evolution of viral resistance.
pubmed doi rcsb
source organism Human spumaretrovirus
molecule tags Recombination,viral protein/dna
molecule keywords PFV integrase
total genus 106
structure length 368
sequence length 368
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2010-09-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
A PF17921 Integrase_H2C2 Integrase zinc binding domain
A PF18103 SH3_11 Retroviral integrase C-terminal SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2300 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3oycA04
1.10.340.70 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Endonuclease III; domain 1 3oycA01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3oycA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3oycA03
1WGSA 3DLMA 4H4MA 1LWFA 4N47A 5KE2A 4DG1A 4C8LA 4CEQA 1XHXA 3ME9A 1VRTA 2R5MA 4FZXC 4B9UA 1HJRA 3NH1A 4OJRA 4CEZA 2CKKA 2B8AA 4JLHA 3AO3A 3MECA 4X34A 2KZZA 4FJ5A 2DY4A 4I2PA 1DTTA 2WOMA 3SPYA 3PMTA 4E1NA 3SI6A 4ID1A 4QCLA 4NYFA 4MQ3A 2X35A 1JXEA 4Z4FA 2QKKA 4HCCA 3HO1A 3L42A 3OJUA 4N4HA 5KH6A 3V81A 3MEVA 5D6YA 1KFSA 1IKXA 4HCBA 5CIUA 3AA4A 2BGGA 3P8HA 4CGFA 3PX6A 4LSLA 2QKBA 1VSLA 2LCCA 2YNGA 5C42A 1NK5A 4DF8A 1XWLA 3IRXA 4OPKA 4FK4A 5J39A 3FLGA 3EAEA 3HM9A 4FJLA 1T8EA 1YTAA 3BGRA 3LP1A 3F73A 5KRTA 1OI1A 1D5AA 4YNQA 5J2PA 1Q9YA 3VN5A 1TL1A 1KLMA 5HRPA 1D9FA 4NZGA 4FJKA 4IUVA 2X6NA 4CJUA 3VQ6A 4HUEA 3CFOA 2G8KA 4AHUA 1EXQA 4IG0A 2FBXA 3OYHA 1VSDA 3E01A 1RTJA 2XHBA 3E9GA 4NCAA 3TI0A 4ELVA 3OS1A 2HB5A 1SL1A 2RHUA 1KRPA 3QIIA 1HQUA 2RHYA 2FBTA 1I3AA 1ZBFA 3CM5A 4CESA 1X1PA 5J2MA 1QTMA 4DQPA 4K8XA 4BWJA 4DFKA 4NCBA 2BE2A 1ITGA 1MU2A 5C6SA 3AO4A 1ZBLA 5KI6A 1L3VA 3VQ4A 1T05A 2O4XB 1LAWA 5KCHA 3PO5A 4OKEA 1EX4A 1RBVA 2X78A 3LWLA 3P5JA 2IAJA 3QEPA 2GFAA 4NCGA 1C0UA 4ID5A 4CJKA 4OLBA 1ASVA 1RT2A 3NE6A 3QEVA 1JLEA 3V9SA 2FBYA 4CJWA 4W5TA 2RF2A 1QS4A 4CF0A 4OGEA 1ZBUA 3KUFA 1TK5A 4KFBA 5FRNA 1TKXA 3ZSWA 1LW0A 1VSMA 1OZ2A 3B6PA 2K3XA 2IS3A 3TAMA 3V1RA 1T03A 1NKEA 3CFPA 1L3TA 4CIFA 3OYLA 4PLLA 2A1SA 3LP2A 4CJSA 3LLRA 4DLEA 1SKWA 4PY5A 3SQ1A 1X9MA 1KLNA 1W0HA 4E7JA 2VG6A 4AHRA 3DLBA 1REVA 1C1BA 3LYIA 4IG3A 1NK7A 2E5QA 2IOCA 3ZT4A 4JRPA 4N76A 4I2QA 2ZD1A 1WSEA 1WSIA 1ZBHA 4DSKA 4N56A 5CYQA 2M1HA 2JZ2A 3S9HA 1TL3A 1FK9A 1UAXA 3DLKA 1SKRA 3T1AA 1NKCA 4KI6A 3I8DA 4OPJA 3K5LA 4DFPA 3V9WA 3WNEA 3NGZA 3MAQA 2PZSA 3KLEA 4FLYA 3FC3A 4KPYA 1X9SA 2HHXA 4M3XA 3AVBA 3OQ5A 3C6UA 3MP6A 1F21A 3QIPA 3RRHA 2RI5A 5J1EA 2EQUA 3ISNC 1HNIA 4Z4HA 1NKBA 4J2DA 1FXXA 3TARA 4C8NA 2F8SA 4DS5A 4KHUA 2G8UA 3SCXA 2RI3A 3AVJA 2KTQA 3O4QA 3AA2A 5CZ1A 4JS5A 4FXDA 1JL1A 4DMNA 4FLWA 1J54A 3NF6A 2YNHA 3OYNA 5HRNA 3CYMA 5CYMA 3MXMA 5FDLA 3AVHA 5KCOA 4J2BA 5M9OA 1Z25A 3MXJA 3HSTB 1G5VA 5HROA 4E89A 4CJEA 1NK6A 3SZ2A 3M9QA 2G8WA 1JLFA 4I7FA 4QAGA 2VYTA 3MEUA 3VQEA 4KHYA 3ASMA 1G15A 4FJ7A 2I5JA 2L8DA 3QERA 2OYQA 4E7HA 3K5OA 4B9TA 3OYMA 4CK2A 2RO0A 1RT1A 1SV5A 3LAKA 2L3RA 4BE0A 4LD6A 4PA1A 2NLUA 1B9FA 3ZSVA 4CEEA 4CFDA 2P5GA 3C6TA 1CXQA 3QEWA 4FJNA 1LWEA 3S3NA 4C5HA 1HPZA 5KRSA 3V6DA 4AH9A 4B8AB 1HNVA 3PY8A 2XY8A 4OKKA 2B6AA 4DLGA 3U3GA 4C8KA 3D0PA 1BQMA 1Z26A 3ZEHA 1SL2A 3AVLA 1J53A 3ZSXA 1JLAA 2XRIA 3PNWC 4Y1CA 3HT3A 1NK0A 1BCOA 2YNFA 5J2NA 1ASWA 3IS9A 4O0JA 4OVLA 3SQ0A 1CLQA 3WNGA 4IUPA 4CFCA 3NH2A 1KCFA 4B9NA 5D3GA 1C1CA 4CF1A 5J26A 4FLUA 3IG1A 2HHQA 3ZT2A 4LSNA 4QQGA 1RDCA 1X9WA 3L2WA 2F96A 3PX4A 1WNSA 4M3TA 1HYSA 3L2VA 4E1MA 1NJZA 4Q0BA 1JLCA 4C5IA 1XHZA 3RR7A 2VG5A 4CECA 2PYJA 2D0CA 1EP4A 4EZ6A 1RNHA 3SQ2A 2PY5A 2G3RA 4DSIA 4OLAA 3O3GA 4FJXA 3WNHA 3LH0A 3HP9A 1RDAA 4KTQA 3NHGA 3OS2A 2OPQA 2KFNA 4KB1A 4C5EA 1MHNA 2HNYA 4CHNA 3JYTA 2OPRA 1VK0A 3TAQA 2LRQA 3V1OA 1U48A 1J5OA 4XIUA 2EFIA 4QQDA 1FKOA 3QNOA 3MEEA 4O4GA 4FM1A 2LSNA 3V9ZA 2R58A 4LH5A 3PFSA 2WONA 4CERA 1WSHA 3DI6A 4CJ5A 2ETJA 3OJSA 2RJEA 3ZT0A 3KK2A 1RTDA 2HHSA 1C0TA 1NOZA 4FCYA 1OZ3A 3HVRA 1CXUA 3C94A 4AILC 3AVCA 4KV8A 5CY4A 3ZSOA 1S9EA 2R7YA 4IKFA 5EU7A 4NS5A 4RW8A 1RTIA 5HLFA 2D5RA 4RW7A 3CFRA 4B9SA 3O4NA 3DOLA 4OVAA 1A5VA 2Z1GA 3QEXA 3CM6A 2HHTA 3PUFA 4N4GA 3U3YA 1L5UA 3TANA 3OYEA 1DLOA 4PUOA 1LW2A 3OYFA 4OKJA 5IAYA 1C6VA 2B5JA 4DS4A 5SWMA 1RT6A 4DTSA 3ITHA 1VSHA 3O3HA 5KGWA 2RJCA 1BI4A 2QQSA 3LALA 4CK1A 3KLGA 3SUQA 2EKOA 4CJQA 2XY7A 3C4SA 1BQNA 3MP8A 2YNIA 3DM2A 3OS0A 3DYAA 3L3VA 2RHZA 3KLHA 4IURA 5KE3A 4C8OA 4R5PA 4DQQA 3OB9A 4CFAA 2YKNA 4G1QA 3M8PA 4Q5VA 4RG8A 2QK9A 2MWOA 3ZSQA 3OYAA 4OGCA 3LDSA 4CIGA 3HPHA 3LX7A 3LP0A 4CF8A 3AO1A 1VSKA 2R57A 2OPPA 3NH0A 1NJXA 2P1JA 3RMCA 3UT1A 2LDMA 3H6ZA 5C25A 4JRQA 1U4BA 3T19A 3DLRA 1N6QA 3CG7A 4H4OA 3VQPA 4CEDA 3TWHA 2FC0A 3VQDA 3RMAA 2Q3SA 3SYZA 3TABA 4FLVA 1LAVA 4FJIA 1SUQA 2B4JA 4HHTA 4CGJA 4FVMA 3KD5E 3DRSA 1NK8A 3AVAA 4FJMA 1FKPA 2GFUA 3RMBA 1QSSA 4BACA 4B9WA 1DTQA 1JKHA 2X4XA 4CFBA 4DQSA 2DFFA 2XDPA 2E6MA 3AV9A 3FEOA 1S1VA 2RPIA 2VG7A 3KKSA 3NF7A 3NAEA 1QSLA 2G8HA 2G8VA 3DRRA 3RR8A 3AVNA 4FL6A 4Z4CA 1WJRA 3BDLA 4BE2A 3QKJA 1C0MA 1RDBA 1JLQA 3SD4A 2HNDA 2ITGA 2ATQA 1HRHA 4M3RA 4CHZA 1SL0A 3KD1E 4HVJA 2HQXA 1JXBA 4CJFA 3SV4A 1YT3A 3ASKA 1Q9XA 4CJ3A 4B08A 4W5QA 4DU3A 4Z02A 4RW4A 3O3FA 1TK8A 2PYLA 1S6PA 3AVIA 3RRGA 1R0AA 2A1RA 2D9TA 1BIUA 3ALYA 4K8ZA 4CJ4A 3NDKA 1K6YA 4QW2A 3VQ5A 2Z1JA 5HRRA 4E0DA 1TGOA 2D0BA 1S1TA 4CCHA 4A4FA 4KHWA 2IGIA 3HL8A 3RTVA 3T3FA 4PWDA 3KJVA 4DU1A 2E6NA 1S1XA 3AA5X 2DIQA 3NF9A 1RDDA 1T7PA 1L3UA 3VQCA 4FLTA 4FYDA 4HTUA 3NTKA 1S9GA 3LZIA 4F3OA 2FBVA 2IG0A 3SUPA 5JS1A 4O55A 2QQRA 3AO2A 1UA1A 1NK9A 1ZYQA 4B9XA 2M0OA 3DMJA 2O4GA 2ZQBA 1OYXA 4CEOA 3BDPA 4FU6A 1RT7A 4CHOA 4CRIA 2DFHA 3QLHA 2X4YA 2W42A 1S1WA 1SKSA 1HMVA 3IAYA 4LD0A 3VQ9A 3VQBA 2PQWA 3EYZA 4M3YA 2DIGA 3H08A 4IFVA 4EZ9A 1BISA 4C5GA 3ZSZA 4J2AA 4QVZA 1WAFA 3LAMA 3VQQA 1JLGA 3O8VA 2GUIA 4CE9A 4ELUA 3AA3A 1QSYA 3UIQA 2DFEA 3AVMA 1VSFA 3P83D 4DSFA 3V9UA 4LH4A 2XO7A 1U47A 3U6FA 2OZMA 3OMCA 3I0RA 4F2RA 3QINA 2MWPA 4AHSA 3M8SA 3MP1A 4F4KA 5KTQA 3FDRA 4AHVA 3OYCA 4CJVA 1KHCA 5HP1A 1CZ9A 4L8RB 4KTWA 2K3YA 2BKDN 2DTUA 2HVIA 3SUNA 1CZBA 4FJ8A 3SNNA 1TAUA 3MXIA 3CQ8A 5HRSA 4N5SA 2RJFA 1LWCA 1VRUA 2KW4A 4FJHA 2HQEA 1UA0A 4N4IA 3VA0A 4M3WA 2NUBA 2RJDA 3JSMA 3QEIA 3SJJA 1S6QA 3L2RA 2X4WA 1BCMA 1VSEA 4KKOA 5DK5A 2Z1HA 2E4LA 3V9XA 1NJYA 1BHLA 1J9AA 2RKIA 5CZ2A 3SQ4A 3KLFA 5HBMA 2XK0A 2LVMA 1WLJA 2BANA 3P1GA 4JS4A 4DTMA 4DFJA 5I42A 3LWMA 1RBUA 2G8FA 1EKEA 1IO2A 1H3ZA 1O1WA 1RT4A 3OVNA 5I3UA 4FLZA 3QETA 4KAZA 2XY5A 3S3OA 4LY7A 1WN7A 4CK3A 1IKYA 4RW6A 4HUFA 4B9VA 3D45A 1KVAA 1Y97A 3LGLA 3KK3A 4FLXA 4E3SA 3F9KA 3OYJA 4CJLA 3V1QA 2X74A 4O5BA 4CJRA 1RBRA 4IBNA 1UWBA 4CGIA 4E7IA 4B9MA 3A2FA 4FK0A 4EP5A 4F2SA 1WSGA 4CIEA 3HXMA 5D6WA 3DB3A 2YHAA 3MEGA 4FM0A 4BWMA 3PX0A 4PQUA 1TVRA 1XC9A 3DLHA 4CGDA 2EQJA 2QXFA 2OZSA 4GMJB 4KHNA 3CEYA 1ZBIA 3MO8A 4PLIA 1QHTA 2OPSA 4CEAA 5KGXA 3S3MA 2LTOA 4CJPA 2BIVA 4PL6A 5D6XA 3OYKA 4M42A 5FRMA 1TKTA 4ICLA 4DTXA 3PO4A 3K57A 1KFDA 4ELTA 3G0ZA 4L59A 4W5NA 2AJQA 2L89A 1KVCA 2P51A 4FJGA 4CHPA 4NYNA 2GV9A 3AVGA 1VSJA 3LANA 1VSIA 3NGYA 4DTJA 2EQMA 3TAFA 2P0KA 4M41A 4HCZA 1B92A 1XNIA 3AVKA 1RTHA 1BL3A 4ZTJA 2ZE2A 4FJ9A 4A4EA 3KKRA 4KO0A 4Z4IA 3DLGA 3EZ5A 1WJSA 4QOZB 1LV5A 1WSFA 3DRPA 3HVTA 4TSXA 4B8CA 1TKZA 1L3SA 3RWUA 1GOBA 1WJQA 1XI1A 2RHIA 2KQ2A 3K2PA 2EQKA 3UWNA 3NTHA 3VQ8A 4CF9A 2Y1JA 3HJFA 2HHWA 4AHTA 3META 4II1A 4IUUA 4FZYA 2R5AA 3PMIA 3QNNA 3ULDA 3GOXA 3E9FA 2Z1IA 3G10A 5SZTA 1RT5A 3QIOA 1QQCA 4YFUA 3M8RA 1GOAA 1A5XA 1YVUA 3SV3A 1NK4A 2HMIA 4CEBA 4CGHA 3HP6A 1HYVA 2F5KA 1EETA 3THVA 1WSJA 2GBZA 1TK0A 1U45A 2P5OA 1UOCA 1W9HA 3LP3A 2RI2A 2F8TA 4B3OA 3V4IA 1D8YA 3B6OA 2D0AA 4UQGA 4DSJA 3L2UA 3NBPA 3KTQA 3NGIA 4Y1DA 1GOCA 3RMDA 3VQ7A 4DTRA 1NJWA 2IC3A 1KSPA 1WAJA 3HK2A 2HHVA 3HPOA 2E6LA 2O4IA 2FHDA 1S1UA 4IUTA 3MEAA 2HNZA 4HUGA 3VA3A 4DTUA 3OYDA 4E7LA 3ZT3A 2EHGA 4ZHRA 3SUOA 4I9QA 1I39A 3MEWA 2RN2A 4Z0UA 3OYGA 2KZMA 3OMGA 4RW9A 5JS2A 4IFYA 4W5OA 2OA8A 4CGGA 1N5YA 4M3ZA 4GY5A 3OYIA 1BGXT 1SSFA 1RT3A 1TV6A 2YHBA 4E19A 3NFAA 4O0IA 4DTOA 4CJTA 1YTUA 2IDOA 2HHUA 4IUQA 3HYFA 3H8ZA 4FW2A 3K5NA 1RI0A 3LPTA 1C1AA 1RBSA 3VQAA 4KRFA 2HVHA 4BDYA 3TAGA 4BDPA 3ZCMA 1HYZA 4H8KA 2DAQA 1BI4B 3TAEA 4DSLA 4N41A 4KI4A 5J2QA 3DOKA 3P8DA 1TAQA 4WE1A 3K59A 3ZSYA 3NTIA 2BDPA 4Z4GA 1JL2A 4EP4A 3HPGA 1S5JA 4KHSA 4KTZA 3LPUA 3OYBA 2RHXA 3L8BA 3QESA 1D9DA 2HW3A 4F3TA 3LGFA 3F70A 3KIOA 4I9LA 4GVMA 5FROA 4CEFA 4FM2A 4DQRA 5DMRA 4AHCA 4BDZA 2YRVA 3I0SA 4DF4A 2VWJA 4GW6A 5K14A 3NNQA 1KTQA 4DTPA 4C8MA 2G8IA 3K5MA 2JLEA 4CHQA 4F8RA 3KK1A 1TKDA 1U04A 4BE1A 3QO9A 3NCIA 4DU4A 2O4XA 2EX3A 2YV0X 4MFBA 3DB4A 4J2EA 4M3UA 4DFMA 1U49A 3FFIA 4IDKA 3DLEA 4UC4A 3AVFA 3TAPA 3QJ6A 4FZZA 3OA6A 1QE1A 4O44A 4FJJA 3WNFA 3M8QA 3ZT1A 2KFZA 2JGUA 1N27A 4CHYA 4KHQA 3NF8A 2JTFA 1NOYA 2M16A 4Z4EA 1BIZA 4ZTFA 1RBTA 1KVBA 2WACA 4A4GA 3AO5A 3MEDA 3Q1JA 3LZJA 3OY9A 3K58A 5T7BA 4DSEA 4FK2A 2VWKA 4CF2A 3KLIA 4Q5WA 4KREA 4BD3A 2YKMA 2GF7A 1IG9A 2XY6A 4DTNA 3SPZA 2X6SA 3QBYA 4FW1A 3C95A 4KB0A 5C0MA 1RILA 3ZSRA 1ASUA 1B9DA 1Q8IA 3L2QA 1RCHA 4E7KA 3S6WA 5E41A 4RG2A 4DQIA 1IKWA 1IKVA 5C24A 2BUDA 4M45A 1IH7A 5IN1A 3TR8A 4A4HA 4W5RA 2Y1IA 3EY1A 4B9LA 4DWIA 1A5WA 3L3UA 1JLBA 4QQ6A 1HQEA 3PV8A 4EDUA
chains in the Genus database with same CATH superfamily
3KLNA 3ME9A 3S14J 4FZXC 1VYTA 5TJJA 2B8AA 1SHFA 2VVKA 1Z9ZA 2VYPA 4FJ5A 1V5EA 1IV6A 2E1YA 4BROA 4KBOA 3GOIA 4QCLA 4NYFA 2NOLA 3EG2A 4BUPA 3UKUB 2EFWA 3V81A 2M7BA 2MSYA 1CQTA 1WRJA 2CUBA 2DYBA 3HM9A 3BG7A 5E20A 1YS6A 4FJKA 3TSPA 1HW2A 3LDLA 5JLWA 5GPCA 3OOPA 4IIMA 1RTJA 2W1OA 3HTUA 4A2AA 2K9MA 2DERA 1MUZA 1M1KC 4JV5K 5LJ5e 4XOPA 1ITGA 4NLCA 4IZ9A 1JTYA 1YBYA 3RERA 4NCGA 4FHTA 4U0WA 1PCXA 3ZN1A 3KUFA 2K9NA 1N8RO 2HOAA 4XTVA 1V4SA 3ZSWA 2QA4N 4GLMA 2A61A 3OYLA 2KSSA 4CJSA 3MKYB 4E7JA 1YJ9I 9ANTA 1TTYA 1C1BA 6PAXA 2FG0A 4JRKA 5CYQA 1TZLA 3AKZA 1SKRA 2JRMA 3T1AA 3T7ZA 1S3JA 2XAGA 4A61A 3IUCA 4BRPA 3F9MA 4LG0B 4ESRA 3CP8A 3AHUA 2NUTB 9ATCB 4G7ZF 2DILA 2G8UA 1ZQ3P 2BY2A 3P8BB 1BG3A 4WCGA 5JVGL 2EGCA 1D8JA 3E5UA 2EJFA 2KEAA 5FPEA 2LFBA 1IXCA 3G71Q 2W48A 1WHGA 2KJCA 1Y64A 1ZLJA 3CCJQ 3OYMA 1X6BA 2PUOB 2FNAA 2W00A 4K42A 3HM8A 1JGSA 5F04A 2DTZA 2DO3A 1H89C 3ZEHA 3HT3A 4QVDA 3HRMA 2VASA 1KGSA 4RTTA 4F16A 3L7WA 1LE8A 4CF1A 3CCEA 3FM3A 1CF7B 2DL8A 4M3TA 1HYSA 3CCYA 3UNGC 2M7AA 3WTZA 1QVFA 1EP4A 2DPUA 4BS9A 4H5VA 3NARA 3G6EN 2E2QA 1ZG1A 3VEYA 2MA3A 2VN2A 2ZXWH 4JI0K 4PKIA 2R58A 3HOUJ 2ETJA 2DXBA 3QYEA 2ASPA 1X4OA 4XH1A 1ZX6A 2X0LA 2ZKZA 1E3MA 1X01A 1OX9A 3C65A 4DS4A 3K7AJ 4PY5A 1VSHA 4WCEL 2X4JA 1VQPA 1VIFA 3JRHA 1Y39A 3LDNA 3EGDB 5M3MJ 2CP7A 3HPHA 2B63J 3LP0A 2NYSA 2ZGWA 5HK0A 2XDBA 2P1JA 5BN8A 2LY9A 3DEUA 3L4IA 2HVQA 2D0NA 2FF6A 3T19A 3CG7A 1R6RA 3RMAA 3SYZA 4HNUA 3RIRA 3C6HA 4S0HB 4DQSA 3ZMUA 5HS8A 2JQ7A 3NAEA 4G8XA 3QDRB 1YJ9A 4BE2A 3A03A 4KT6A 1WEIA 2F2XA 4Z02A 1H641 5K7ZA 5BR9A 1R0AA 3M59A 3OW2M 4E0DA 1ZN2A 3BR0A 1N78A 2VI6A 3LA3A 2FRHA 2A6HF 3CCVQ 2JA7J 5LMUK 4QSHA 2F2EA 5F64A 3VQ9A 3VQBA 4M3YA 2DTOA 3CVTA 3GTPJ 3BTJA 1T56A 2FB7A 3I0WA 3BY5A 1RUNA 3GBGA 1XMAA 3KEOA 1VQ6I 1YITQ 4XKCA 5JI6A 5AQJA 1WH5A 5JFRA 1VF9A 3VOEA 2M1BA 2W4SA 4C0GA 3JSMA 2OA4A 3MWMA 1HLVA 5I21A 4B43A 4CO8A 1VQ7A 3WTTC 3REOA 3JB9F 1P2FA 3JCMb 3DXKA 4A3KJ 3HRTA 3V1QA 1RBRA 2QF7A 4IBNA 2O8XA 3I35A 3N0UA 2VOOA 3IHOA 4ZYEA 4O8UA 1M1KR 3J8AA 1ATSA 3PO4A 2VGMA 4FWQA 1ZBJA 2DVJA 2F6CA 1KC8U 1LWVA 3NHNA 1HOMA 3CF5F 3H3NO 1XSDA 1WJQA 4HX7A 2EQKA 3RJPA 2HHWA 1GUUA 1VQPI 3OMYA 2BE9B 1ZK8A 3FHGA 1IREB 1XG1A 1YVUA 3SV3A 5DYMA 1UOCA 2I0NA 2CGLA 3WVDB 5KYWA 4JD2B 4G6TB 2DQLA 5ERIA 3PT9A 2LNHB 4ZHRA 4RW9A 5ICFA 4GV6A 1BGXT 5L3CA 2NXNB 3NPFA 4IUQA 2DAOA 2DPPB 3VF2A 1Y0UA 4EA4A 3TAEA 1Q81O 1TAQA 4NBQA 3U9DA 4FWOA 2YX6A 1P8ZA 3O9TA 4XONA 1KAZA 1U04A 3UF4A 3EUHA 4PKGA 1XJWB 5E18F 4BL0B 3QJ6A 1LEBA 5DCFA 3KP4A 3BJOA 5J40A 4ZTFA 1UHMA 3OSVA 1PDNC 3JRZA 4I01A 1ORPA 4BD3A 4AUXA 1KQSA 2AIRB 1OPKA 2VBWA 1YJNI 1USTA 1P90A 3UATA 1IKWA 2R7TA 1PP7U 2VB6A 6AT1B 1VQKI 3EY1A 2A5WA 2MAMA 4DG1A 3JRIA 1BIAA 2KZZA 4X34A 1HX1A 1YFNA 2WOMA 2DF6A 4E1NA 4BRAA 4JD2A 3JW4A 1KHIA 4RTZA 2FXUA 3NRVA 4BXUA 3H1CA 3HRSA 3OSSC 2IGOA 1IV0A 2PI0A 5EXWA 1W7PD 4Q48A 3P8HA 3PIPL 2QKBA 4F7UG 3JXUA 2IIMA 4FK4A 3EAEA 3HG9A 1D5AA 3O8HA 4M4ZA 2KT1A 5HRPA 2P9PA 4AHUA 5KYYB 4DUYK 4YG2F 5A2QO 1D09B 5FW9A 4XRSA 3N97A 2FSJA 3JAME 2QI2A 2V1UA 4NC8A 3G6ET 3AAQA 1B4AA 5CKDA 2H8WA 2LK2A 2GA1A 2L2PA 5B3SH 1WX6A 2DLPA 2BW3A 5F0FA 1KYZA 4ASNA 1J59A 1TTHB 3K4KA 5FGMA 3JRFA 3FKJA 1VSMA 2Z2SB 3CF5L 3TAMA 1YHQT 2D0PA 3CO6C 1G83A 4DLEA 3LP2A 5CKHA 2L9VA 1JBMA 2FQ3A 1U1TA 3ZT4A 2O8BA 3H0IA 1ZH5A 3ZQHA 2L9SA 2M8GX 3ZMSA 1AT1B 4BG9A 2JA6J 4FLYA 2IA1A 1MNMC 3KYLA 2Q1ZB 2CH4W 3QIPA 3KP5A 3H6EA 2E5NA 3GO5A 1T0HA 1JI8A 3A0HC 1JL1A 5K5OA 4CZFA 5CYMA 1VQMI 3O80A 5J3BA 5D5WB 4M7DE 2VYTA 4DQ8A 1LWWA 1YW8A 4E7HA 4PA1A 5AQXA 2RMOA 3S3NA 4C5HA 2E2OA 3CD6A 4L9TA 4RAFA 4OKKA 4C8KA 3RUXA 4A3FJ 1JJ2P 1J53A 4J7IA 1WCMJ 3PNWC 2BE7D 2YNFA 5J2NA 3IS9A 4OVLA 1TP4A 1W2BM 4FVUA 4JKAA 5JICA 3HXLA 1W5SA 3M1CA 1BI2A 2PY5A 3J7AY 1G59A 1G3TA 2EIKH 1MMNA 1J5OA 1U0JA 1QPMA 2DK8A 4JZ3A 1DIZA 3FZKA 4CERA 3ZT0A 2ETHA 5ILSA 4AM3A 3F5TA 2E8AA 3E6MA 2DRKA 1TQMA 3PO3J 1S7OA 1KA8A 1LW2A 3OYFA 2CMPA 5HS7A 4RTXA 1HKQA 2OZ6A 2YJFA 4FT2A 1NWKA 3QPHA 1T0FC 4CFAA 1K9MR 3DTEA 4AIDA 3MFKA 2O9VA 3KHYA 3O6WA 5HDGA 3OYAA 4CIGA 2PQ8A 1TW3A 1VSKA 2HBLA 4WXCA 1VYUA 2K5LA 2A0FB 1FJGK 3OS5A 1FYMA 1FTZA 5GAOn 1VQ9Q 1Y1VJ 1T6CA 3TABA 1VQKQ 3S2WA 2HTSA 5FU6C 2ABKA 4CFBA 3WG9A 2IVNA 4ISGA 4C1NK 1QSLA 4DA4A 2P9KB 3A8HB 4OFAA 3C2HA 3R61A 5AQGA 3N05A 1O3QA 3ASKA 3RRGA 2NUPA 2MD0A 3EETA 3H3UA 3IUOA 2W03A 3DLLA 1KSWA 2ED1A 3SUPA 2XVCA 5FKOA 2ADUA 4CRIA 2W42A 2X4YA 3EYZA 5GAHP 3CDIA 3H08A 1NE8A 4ELUA 1T3SA 5B1BH 3AA3A 1YOVB 3LMMA 1VSFA 4H5WA 4MDWA 3QINA 1BJAA 3EG9B 1SKUB 1OPCA 4M6YA 3OWTA 5AFUH 1QNTA 3MXIA 4UVAA 1YI2N 1WH7A 2ZPBB 1BCMA 3MKDA 2E4LA 1W4MA 2NS0A 3JCMg 4DTMA 1R36A 4I09A 1OH5A 1M2VA 3I55T 2DDBA 1BKBA 4H0OA 2QEXN 3SXYA 4OP0A 1IGQA 1ZXOA 2DA9A 4K11A 3FLCO 3PLAA 2STWA 3CUQA 2E36A 4H0VB 1UWBA 3ZMZA 4RGRA 4BWMA 3LDPA 4BAYA 2COYA 4OFHA 5GAN8 4RGUA 2XGEA 4DTJA 1D0ZA 4DYQA 4FJ9A 2K6DA 5CVIA 5GAOp 2PU9B 2C6YA 2IPOB 1DGKN 5KYYA 3UWNA 2PJPA 4IUUA 4FZYA 3QU3A 4OFEA 2LD5A 1NG6A 2XGXA 5GAMj 1VHXA 4RAGA 1HYVA 3NVKA 4X64K 2RI2A 4DSJA 3KTQA 3L6QA 4J00A 4VUBA 2E6LA 1EO1A 2PNIA 5BREA 1EFNA 1DQUA 3VSKA 2EHGA 1TWFJ 3VS7A 4XTZA 1RI9A 3CCEI 4HW0A 1NHAA 2JVVA 4B1WB 4G7OF 3M0UA 4M77G 2R7DA 1OYIA 4KMUX 1RI0A 4C0ZA 4LJZF 1OYWA 4FE7A 1MZBA 3F72A 2ROLA 2DYSH 1QWFA 1KU3A 3FXLA 2VODA 3LAJA 3OYBA 3D2FA 4MMKA 4IIOA 3CCMQ 5AIPA 2M45A 1L0OC 1MBJA 1OR7C 3K5MA 4G9ZA 1TKDA 4AFUC 4L5GA 5FPMA 2R4GA 3QO9A 3CXCP 2A37A 4DV6K 2QENA 3C18A 2AHJB 3AVFA 1MWMA 2M8EA 3TAPA 5EZGA 1DDNA 2XHKA 1HUXA 3JSCA 4Z4EA 1OCCH 5AQMA 2EKHA 4KBMB 3OY9A 3JREA 2ZJ2A 1T33A 2P7VB 2WY8Q 1SRMA 2HKNA 1K8AU 1SQKA 2K5FA 3VS5A 4FX0A 2D1VA 3ZQFA 2Y1IA 1QKXA 2BTTA 1V5FA 4CEZA 4AC0A 3ZEUB 3MPUB 1MMSA 3H5NA 3OJUA 2A08A 1TQPA 5LFAA 3CPWA 2X9HA 2MC4A 3GTOJ 4BRCA 3FLGA 5KRTA 2YX4A 1YX5A 1TL1A 3ABMH 4HUEA 3I9QA 2DYRH 2NVTJ 3M4OJ 1KRPA 2XDDA 1H1VA 2J5OA 4LDWA 4F7ZA 3VB2A 3LWLA 2X78A 4D7NA 1SVOA 3A0BC 1ASVA 1CKAA 4H5TA 4CJWA 3E6DA 4L9JA 1WXBA 3BLYA 5KPTA 4U0YA 2NOBA 5IHKA 3LLRA 1SKWA 3SQ1A 2LQNA 3LWHA 1W0HA 1KLNA 1WSEA 2P81A 3CCUT 5HCKA 3WGGA 3QWXX 3OW2S 3KLEA 4NQWB 3NFCA 3BTCA 2WSEE 3RRHA 1KQ0A 3GP8A 2EV5A 3M6GA 2O61A 3CD6T 5HDNA 1U2WA 1APLC 1G6NA 1YI2A 1NG9A 4LE9A 3AVHA 4E89A 2XDVA 1NK6A 4DV2K 3EN9A 5HLHA 1UFFA 3ASMA 3CCLT 3HTSB 2ESHA 3DAWA 1X58A 1Y7XA 1WI7A 1OH7A 3Q7BA 2O8DA 3HOYJ 4M78F 5FLMJ 2XGCA 2HXOA 3GZ6A 2QWPA 3D5RC 1K76A 1BQMA 1AOJA 2OTJT 1WI3A 3WXMB 4FE4A 3FXQA 4LK0F 4LSNA 4I0BA 5HLIA 4XTWA 2TRTA 3CUQC 4L5JA 2F1LA 1I5OB 4C92A 4CECA 4EVIA 2D0CA 4M78C 2G3RA 3AG3H 1N8RU 3CCET 1QHGA 4ZDLA 3TL4X 3SDGA 5LJ5f 3CC4A 1VQLT 4BI4A 4QQDA 3MEEA 2ID3A 4ESFA 3OJSA 4CZGA 3E7LA 2GUPA 1CXUA 2CZ0B 1QVFP 5J4VA 5IY5H 5EU7A 4NS5A 4RW8A 4BR9A 1FNNA 1F43A 3I5UA 4C30A 3OW2A 4CCLA 3RKYA 1C6VA 4BR4A 2LQKA 3G73A 5KGWA 4J8FA 3SUQA 4JNEA 3C4SA 1G3SA 2BY0A 4RG8A 2NOGA 4NLBA 4LLNA 2V7YA 1XQOA 4JRQA 2Z5UA 1IZ1A 4JI1K 3F23A 4M7DB 4XRFA 1M3QA 3VQDA 5C3EJ 3BF3A 3ERMA 3VWBA 3PL8A 1NGBA 2X3WD 3E6BA 5I11A 2DXIA 4CZCA 2DFFA 2OTLN 1GLDG 1BW5A 1JHHA 4Y13A 4A3DJ 1ZA2B 3KLOA 5LJVA 1RIOH 4Z94A 1WQ7A 2EQIA 4Z88A 1TGOA 4XRMA 3X2QH 2FRWA 4AFZC 3CJCA 3T3FA 2HSTA 5L8RE 5LGNA 1BDGA 3LZIA 3J7ZO 5IOZA 2E64A 3JCMe 3OSGA 3DMJA 5J3LA 1E2XA 4FU6A 4E2FB 4M75G 5C4JJ 4QVZA 5H6QA 3O3KA 5CVVA 2NUZA 1QLYA 1UG0A 3OYCA 1L3LA 4CW7B 3SUNA 3FKIJ 1Q82R 3CQ8A 1VQOT 4GV3A 3NWTA 3VEPA 2J06A 4E9FA 1EIFA 2H8RA 1UAAA 1LVAA 4HXJA 3K4BA 1GLAG 2FUG2 4FLZA 1DPUA 3QETA 5GANd 3A8YA 5DUKA 1TWGJ 1B72B 1DP3A 1V76A 4A69C 1VQ7T 4FLXA 3CWTA 4M75C 2OBPA 1OU8A 1VI0A 1PD1A 1LQ1A 3A2FA 2KR3A 4ETSA 1TVRA 2DE0X 4YFKF 5D4RA 4HWIA 4LG3A 2EAYA 2VQGA 3C1DA 1G2BA 1E6HA 1YIJQ 3GF2A 3MQ0A 1L3SA 1T3LA 5HLGA 3DFGA 2R5AA 1ONVA 2Z1IA 3DBHB 1A5XA 1VQ5Q 4CGHA 4AT1B 3IDHA 1D8YA 3JRDA 3UKUA 4JI7K 2GXGA 3ZYYX 5CVRA 1NJWA 2VJIA 1VQ7Q 3HPOA 3CETA 3MVPA 4E6KG 4OOIA 2GLOA 4AMCA 1FSHA 2E1NA 3SEQA 2E7WA 2X4HA 3FJPA 3CERA 3VQAA 1AKHB 2HVHA 3G71T 4V19S 2RQUA 4P96A 4HF2A 4KTZA 2QBYB 3LGFA 4BUGA 5FROA 1N34K 2DOEA 5AQWA 4M77E 1KTQA 2P7CB 4F8RA 3R4KA 3PQKA 2GTOA 2FMLA 3EFOA 1IO6A 1X43A 2RHKA 3V8LA 1MKMA 1MW7A 2VOPA 3A5LC 2DW4A 1Y96A 4PFOA 4JPBW 2F7TA 2MH9A 2RNAA 4QIWN 3VEZA 3GVAA 4KREA 3MN2A 4HLXA 1AWCA 1NG7A 2NOJB 4DOWA 1U6ZA 3LQQA 3I9V2 3J81Z 3ESWB 2R7SA 1Z67A 1W1FA 4KT5C 2KRFA 3ABKH 5IHIA 2M9HA 3EQLF 4HPQA 4ID1A 2K9QA 2ZAEA 2HDDA 3MEVA 2KZGA 3L00A 2WADA 1ETYA 3AL0C 3AY9A 3S6IA 2RGVA 3VN5A 4IUVA 1EXQA 5DY9A 3ULEB 2XIDA 2Y2ZA 2GWKA 1LOTB 4LF6K 4F3QA 2DT5A 1ZBFA 4DGWB 2MABA 3CCQA 2BE2A 1JRIA 3CQTA 3OGDA 5GADP 3CF2A 3M57A 1T05A 5GAN3 1RBVA 1NM1A 2IS2A 1I1JA 2I10A 1QVTA 3WE2A 2D1KA 1B72A 3X26B 3H1QA 4CIFA 2BHYA 1OVQA 4B6MA 3CCVT 3DLBA 3VEWA 2XPUA 1REVA 4HEA2 4IEEA 1HSTA 3FMRA 4N76A 5E8GA 3DF8A 3ECOA 4CDGA 4CD3A 1TSFA 4G12A 2WY7Q 2O6GE 1MUYA 4B44A 2NNWA 3MP6A 4BY1J 4CBXA 4JJCA 4FPBA 4Z4HA 1H9TA 2F8SA 4KHUA 1W7PA 3K2ZA 2RI3A 4JEPA 2ZJQL 1U9OA 2RVCA 2KLAA 4KRTA 4UV9A 2V7ZA 2L0AA 4ENJA 1OCOH 4KHYA 5GIOA 2HSPA 4LOCA 2XD0A 1SV5A 2EZIA 2ZBKA 2E1CA 1MMGA 1HPZA 3HHTB 3G71A 3ID8A 4XLFA 1H8AC 5E17F 3PY8A 3U3GA 3FXMA 1ETXA 1NK0A 4OIRF 2RREA 1SFUA 5LY3A 4IUPA 1GVDA 3NMZC 4B9NA 3H9QA 4LXCA 1PRMC 2LOOA 5L3EA 1BR4A 4MEXF 2CSIA 4E9EA 4AF1A 3WNHA 4CD1A 2BEOA 1U06A 2XKPA 3REBB 2GIVA 1WHJA 3HGYA 3PFSA 2WONA 1RTDA 3CMMA 1TWHJ 4O5FA 3EGDA 3K4NA 1T2KA 3HVRA 3NAUA 3AVCA 1OCRH 2R7YA 5MLCQ 3HFNA 2KGTA 3CFRA 2P9PB 4HKEA 2E2IJ 1VQPT 3QEXA 5DCMB 2MGQA 4J5YA 3HKSA 1RT6A 3O3HA 5GMKe 2YU3A 1MSFC 2HCKA 3MP8A 3KLHA 2BUPA 4S05A 4DR4K 3CJNA 3IAS2 4M78D 2DCEA 3G0QA 2K2VA 5A0GA 3TVTA 1QVPA 3MX5A 2OPPA 1M1KU 3QFPA 1WDXA 4H4KC 2ZGYA 1ZSGA 4ELYC 3L2CA 2CJJA 5FU6B 3JRCA 4WQ5C 4E6RA 1W36D 1P6RA 2ED0A 3I0TA 4HSTA 3MDQA 3DRRA 2RF0A 4C92G 4M77F 2ATQA 1YWPA 5CKFA 1TWAJ 1Q9XA 5IWAK 4RW4A 1QVUA 5AR0A 2R5ZA 1QCNA 5E3NA 4CJ4A 3VQ5A 5HRRA 3N5NX 1ZGJA 2LJ1A 3I56N 2H27A 3RTVA 4A3IJ 3AA5X 5I2SA 1JJ6C 1T7PA 1ZRFA 4F3OA 1Q82O 1IRXA 1FMVA 2EYWA 3AO2A 3EFRA 3N4MA 2E60A 1FT9A 4IHVA 4CUGA 3TTDA 2DFEA 4DSFA 2FZCB 1U8BA 4HDVA 3K1PA 1MGQA 3FZLA 1AZEA 3CCMN 4YORA 3CCQT 1GLBG 2JSCA 4B1YB 1WHMA 1OULA 1RR8C 4X65K 1WBDA 4BC3A 2LF8A 2R7QA 1UGQB 3VA0A 2UXXA 1T0JA 1BIBA 2W04A 4J9DA 2CYYA 2HSEB 1J9AA 3O5ZA 2D6FA 2L02A 3F6OA 2XK0A 3P1GA 4R0KA 2G8FA 2D5VA 4ZYHA 1IO2A 1QHHD 2KT8A 2UUBK 2FRYA 1K4US 1MSEC 1XX5A 1Q7YO 4B1VA 4FSXA 3TGNA 4ZH4F 1YO5C 4BR7A 5DM6F 4A5MA 4B9MA 2YJEA 3INZA 2YHAA 3MZ8A 1W70A 2IXSA 4RCCA 3MO8A 1XDSA 2DRMA 3S3MA 5ILVA 4BC2A 3S17J 3OYKA 5D8KB 4W5NA 5LJWA 2L89A 4Y91A 2F5CA 1M30A 2V9PA 2CG4A 2P0KA 3KK7A 1RTHA 2HBMA 3TOBA 4GDFA 4C8QE 2AO9A 4LLLA 1YI2T 3DRPA 3CIPA 1MMAA 1BI1A 3K2PA 3GLXA 3HJFA 2XF6A 4CCOA 3VS1A 3FK6A 3FMQA 1RAIB 5J2PA 4ANJA 3AFHA 4ESJA 3DWLE 3QP6A 3JCMd 1NGAA 4IPAA 1M2VB 3B6OA 3NBPA 2JM8A 3ZN0A 4HUGA 4X9DA 1WQ2A 4LGWA 3UKGA 3K70C 4DOZA 4ZYAA 1QCOA 1VQNN 4AYBN 4JI5K 1X2QA 2YHBA 3CMET 1VQ8Q 3HYFA 4DZJA 3WT0A 3FXKA 4JK1X 2E34A 3U1DA 1TNTA 3KPHA 3P8DA 1HKBA 3L8BA 2ZCWA 4PHTX 3KVGA 4DF4A 4GW6A 1IN5A 4Z6YA 1KQSM 2FQ4A 2VC1A 4LUEA 3U4LA 4BE1A 3FDYA 3PIPF 4J2EA 5GAMe 4FZZA 4O44A 1Q95G 2AZSA 1N27A 4KHQA 4X62K 4J19A 4EMKC 4DR7K 4B1ZA 3LZJA 1W5TA 3I71A 3IKTA 3PIPA 5D5XB 1XMOK 1LNWA 3D7EO 4XLPF 1YJNT 3PFIA 3HBTA 5KPRA 2IIRA 5C0MA 5J8FA 2XG8D 3ZSRA 4KB0A 3L2QA 1FEXA 1F1BB 2EJRA 2HR3A 2ECCA 1RAAB 5HY6A 2NRXA 1A5WA 1VQ5I 3KZBA 4H4MA 2IAIA 4L6V5 2HOEA 2JS0A 4XLCA 3X25B 4J9BA 2LX7A 3RYPA 4WYBA 2P8TA 5CO7A 3CWAA 4GKKK 4EHUA 4A0XA 3ZX0A 1Z05A 3M1EA 2WFBA 2ZWHA 2Y31A 1IKXA 1M1FA 3PX6A 1KU9A 1QKWA 1NG2A 2P4RA 2YDLA 4FJLA 2Q0OA 2EYXA 1Q9YA 1MBEA 2HZDA 3CMEN 1YJWT 4KN4X 3WTYC 2BVMA 3R8EA 1SAXA 3TBIA 2DMNA 2VWFA 4JAXA 1Y1WJ 1EA3A 1FBUA 4IL6C 4JLIA 2F9TA 4RGXA 3PO5A 1N5ZA 2GIZA 1Y0MA 4LDVA 3AG4H 4IRIA 3V9SA 1I94K 2R7WA 1ZBUA 4QWQA 1X1DA 3WUHA 4GYIA 4DV1K 3H0GJ 2ZPHB 3DU6A 1GCPA 3RMSA 2JWLA 5EF6A 2DX1A 2ME0A 1RI7A 1VQLI 4E9GA 3PVQA 4HBLA 3LAPA 2MFZA 2QWWA 4RBOA 2RB6A 4D6WA 2L4MA 3VGKA 3M8FA 1I1GA 4NB4A 1UG2A 2KYBA 5GMKm 4B1XB 4EFHA 1ACMB 4JRIA 3O6BB 2OYQA 3HUGB 4LD9K 2QYZA 1FIPA 1B8IB 4LD6A 2WSCE 2NOFA 1PSEA 3K9TA 3R0AA 4M77C 4FYXB 4II2A 1VQ6T 1MBHA 2V1NA 4JX5A 4P9UA 5KYUB 2YPRA 3D1NI 5IT9Z 3IG1A 3L2WA 4UY8O 4E1MA 4UHTA 1XB4A 5CHIA 5BR8K 4KH6A 4M77A 1OV3A 1Y71A 1ATRA 4KB1A 1BB9A 4D5CA 2NRWA 1FKOA 4Y17A 5GJWB 4PJMA 4B9QA 3LCNA 4FCYA 1M2OA 1N75A 2ZPEB 2CQKA 1HD3A 4MEYF 4WXHA 4B9SA 4LF7K 2B7EA 2PVDB 2OPTA 2VXFA 5GMKj 5AQRA 1UHWA 2XSJC 1L5UA 3F3XA 1D5YA 4IZZA 1YI2I 2EKOA 2NS8A 2J05A 4Y92A 1YF5L 5K5RA 4BY7J 1SRLA 4G1QA 4JKFA 4GGGA 3A5OC 4D7MA 5A0DA 2FNPA 1WFWA 5GANe 2KMTA 2LBFA 2VKHA 4DB3A 1ZG3A 3GBTA 1D8KA 1Y8QB 4GO1A 1IJJA 2E2JJ 3MCPA 4BBRJ 1YITT 2E1ZA 2ZSHB 2Q3SA 1NK2P 1UGSB 2EYQA 2QK0A 4BACA 1KC8C 3S8PA 1SD7A 5DM6L 3AV9A 4MZPA 3QOPA 1ZUKA 1S22A 1KG5A 3NF7A 1YS7A 1BW6A 1R4NB 5AT1B 2W85A 3VS6A 1A5JA 2MC3A 2ITGA 2YWWA 4CHZA 4HVJA 4CJ3A 3AVIA 3VF4A 3GYHX 4B47A 1TU0B 1M3HA 2PBIA 2QXLA 2E6NA 5E26A 1S1XA 2HQ5A 5LJ3g 3CPWS 5DM7F 4O55A 4NOYA 4CEOA 3X24B 1ABOA 2K02A 4PJ0C 1YVNA 3O08A 2A3LA 4UNFA 3RKQA 3AGKA 3UDCA 3MP1A 4F4KA 2FPFA 1KHCA 3I3LA 3CDLA 4G7HF 4OB3B 2KIUA 3LSMA 1VSEA 1OH8A 5DK5A 2Z1HA 2K27A 5A2QK 2O8BB 2X1DA 5JVTA 4DFJA 5I42A 1UELB 1NYFA 2UUCK 3BFMA 5EEGA 3S3OA 3HSFA 2VQCA 1U9NA 2O5RA 4B9VA 4C92C 3CCQN 4M77D 4CCNA 2A6AA 2V6CA 3I8BA 3VW4A 3MEGA 4KULA 2VC0A 4L0ZB 1QZ6A 2BY3A 5D6XA 1YRNB 1TKTA 1K9MC 4N4OB 1NGHA 2P6SA 4PGGA 2GV9A 2VKVA 1VQ6A 4JK7A 2YHXA 1SVMA 2NLXA 1ZYRF 4RA2A 1JHFA 1R8OB 3LOCA 4JBAA 2RHIA 2GXAA 4ILGB 2WC2A 3GPLA 3DPTA 4V2SA 4RM2A 2VONA 3PE0A 4XLAA 3M8RA 1Z7LA 1SG5A 4JI3K 4JQFA 4M7AD 1FPQA 1FP2A 1HK9A 1JQQA 3S15J 2G9WA 1GOCA 4M7DA 1VQNA 2CFOA 4PSWA 3ZFJA 5DPKA 4LB5A 3MEWA 2EINH 4EIKA 1HKGA 4HNTA 1ETOA 1R00A 4CGGA 4DQRA 1JU5C 1RT3A 4DTOA 1BOTO 2PLYA 4FW2A 1C1AA 2OFIA 1QVFM 1Z9QA 4XKBA 1PUFA 1JB0E 1RUWA 1RRJA 4M7DG 3KWIA 2HF3A 1MBKA 2E1MC 3BOQA 2EK5A 4YFNF 2DPDA 2UXBK 2ESWA 2HL3A 3ZETB 1A36A 3GXOA 4XKWA 1K73O 5K14A 5IP9J 5KQ8A 3JTHA 4OMMA 4A3CJ 5LEKA 4FJJA 3WNFA 1VQNI 3H35A 3IMXA 3HB9A 1UGPB 1BIZA 2E6ZA 1FSEA 4Z89A 4RDUA 4FISA 4Q5WA 4F7UB 2OF7A 4DUZK 2DJQA 1P59A 3IAM2 4HX4A 3QBYA 3WXIA 2K9GA 2KL4A 5LJ5g 4HAMA 2Y0SA 2NRZA 1G99A 3CCRQ 3RTRA 1JLBA 1HQEA 4EDUA 1U3OA 2BYVE 4C8LA 3TEEA 1FOYA 4DIQA 5GANj 3SI6A 5E3OA 3E9OA 3O5BA 4N4HA 2AHQA 1X27A 3T8RA 3CW7A 1JKQC 1S8NA 4EA5A 3IRXA 5D6EA 3I55Q 2E41A 4CJUA 1R1VA 4EGZA 3HJEA 3GE1A 2EIMH 5IT9K 3G6EI 4A3MJ 4WTOB 3JCMX 1I3AA 4C2TA 4NCBA 4DFKA 1MU2A 3AO4A 2WAFA 2FD5A 1MDMB 4UV8A 3HHGA 2O2OA 2W6KA 2W57A 1JLEA 3C2GA 4YTLA 3D2EA 3K1MA 5FRNA 3Q7CA 4DHYA 1TKXA 1YIOA 2OJED 5CQEA 5BOXA 5EGOB 2AP1A 4FWSA 4M71A 3G2BA 4AHRA 4A5BA 3OBWA 3QP5A 2E5QA 4IOAF 2HS5A 5IT3A 1R58A 1FK9A 2LKSA 2AXLA 2WC9A 3FJ5A 2DTHA 5LJ3d 3ZRGA 2CGJA 4BHPA 4C2MJ 2D4WA 2NRVA 3QICA 3TARA 1VZ0A 3VERA 1N6AA 4AQYK 3SMPA 4PL7A 1HC8A 4M3DA 1R1UA 1NMDA 4EATA 1JKOC 1T39A 2EGEA 3D5SC 3FIFA 2G8WA 4QAGA 1GBQA 4KIGA 1WJBA 3QERA 4LFUA 2EZHA 4JJNK 4B22A 2OQRA 2NLUA 3ZSVA 4CFDA 5GMKh 4K2EA 4FJNA 3CI5A 2NRHA 3MCAB 4UVCA 2B6AA 2OTLI 3REAB 1K61A 1GDTA 4GXOA 3KNTA 1CLQA 3GNGA 5AZJB 4OINF 3OW2P 3ZT2A 4AFQC 5L3GA 2FL7A 1OQYA 3D2EB 2OC6A 5IT9E 5FKKA 1GV5A 3GEZA 1K4SA 3TAQA 2KRNA 4CZJA 1LFBA 2L2OA 4NXMK 4N4NB 1QP3A 3ISPA 1OZ3A 3CJRB 3MN6A 5DD8A 1HKCA 3J7AP 4BVPA 3HRGA 2OCCH 3U3YA 3L1PA 3OYEA 3MCZA 5K7FA 5DCMA 4OKJA 2KY9A 3ITHA 3DTKA 4IOCF 1BI4A 3HBLA 2R92J 4XIDA 4IEJA 2HOSA 3KP7A 4DQQA 2JWTA 1BR1A 4OGCA 5M5WJ 2K5CA 2FMYA 3CC7Q 2CH6A 1YX3A 3FXJA 1GFCA 2LT4A 2NUPB 2UUAK 4LF4K 2QEXT 2E3IA 5C10A 3QZ5B 4FLVA 5GP9A 3RMBA 4ZN1A 5CR2A 4B9WA 2P4WA 3IL2A 1YJWQ 4Y52J 3AVNA 3QKJA 3SD4A 5LD2C 4H5RA 1ORNA 3I53A 1WFXA 4XH4A 3VF6A 2DI3A 4BQQA 1D3BB 1K9AA 2KDSA 2QCOA 3AAFA 2DN0A 4AI4A 3SYTA 4A4FA 1NGDA 3GBQA 3NF9A 5IYDJ 3E5QA 1RDDA 3VQCA 5LHIA 1S9GA 4XSZF 1S72T 2QQRA 1UA1A 2X6XA 2F4OB 3PUBA 1YN8A 1SAZA 5FLXE 3CCSQ 1ZSZA 2QTDA 3G1JA 4H0EA 3TSUA 2IJLA 4XR6A 1VA7A 5EYRA 3V9UA 1GCQA 1ACIA 2KPMA 3FDRA 3EUAA 1CZ9A 2DTUA 1BC7C 2HKQB 5HRSA 2GQQA 1D3YA 3MEXA 2LNBA 1R4MB 4CCKA 2RKIA 2B86A 4JOMA 2RE2A 2DMUA 3DPLC 2GM4A 3R6SA 1O1WA 3G4SA 2PAVA 3OL4A 1DU0A 2ZGZA 3SZGA 3VS3A 2DT6A 1EH8A 3A8GB 3JB9H 5CQXA 4E3SA 3PNVA 2FX0A 3LFUA 1N33K 4CJRA 2N8GA 1B3QA 2HZYA 3WQUA 1JJ2S 2EQJA 3LSJA 2BVLA 2QXFA 4ON0A 1S1NA 3K69A 2YUNA 4M72A 2JJ9A 3SJHA 3TAFA 3C6AA 2ZO4A 4BRDA 1WIEA 4DBFA 2V1XA 5FKNA 4Z4IA 3GF5A 3EZ5A 2VJ5A 2JNGA 1MWKA 1SHGA 1D1BA 2A41A 4BG8A 4F91B 3M8EA 1EWQA 4NC6A 2MW8A 1TS9A 2H94A 4U7DA 4XN3A 5KQDA 4M78E 3K4CA 1R77A 1D0YA 1AHJB 2E65A 1SMTA 3CJ9A 2EQRA 4N0BA 1MH4A 3WODF 2XKOC 4HLYA 2KZMA 2Y4YA 3CXCA 3OMGA 2QWLA 2KIMA 4E19A 1W36C 4OMZA 2HHUA 2QKLB 2JTMA 3H8ZA 3CC4Q 1OX8A 4DNCA 4G6DA 2FBKA 3V7SA 2F5TX 4IVNA 2NRAC 1CSKA 3NTIA 1H0MA 2R93J 1JCFA 3HPGA 3QESA 1Y57A 3FGUA 4F3TA 4FM2A 1WKMA 3QRFF 5LJ5d 2DA2A 2OTJQ 2R5YB 1P7JA 3G1LA 4PJNA 3RYRA 2VBZA 2FU4A 1ZQ1A 2YV0X 1ESVA 1QWEA 1U49A 4EMHA 1RRQA 4AD9A 2P9UA 4XU2A 1XSXA 2IVWA 2ID6A 5FFZA 4A4KA 3IWFA 5LBQA 2O3FA 1YQLA 4YIIA 3QOEA 4RB3C 4M75A 4CF2A 1WOQA 3J80Z 1YITA 3SBGA 2K85A 3SPZA 4E7KA 2CP2A 4LDYA 4RG2A 5DTDA 2QASA 5IN1A 4B9LA 5KE2A 3CBPA 2HDAA 1I27A 4I2PA 3FE1A 3ENBA 3ZMDA 2X35A 3KP2A 3L42A 5LHHA 4OWRB 3THYB 3URGA 4HCBA 4CC3A 1IDZA 2ZXJA 1SFXA 2A07F 2X6NA 4IG0A 2F4MB 2ZJPL 1UFMA 3BPXA 3E01A 2BXZA 3U1KA 1WYXA 1A6QA 2V8KA 3CQZJ 2O8KA 1BBZA 2EIFA 2FBTA 4YFXF 1YJ9N 3JCMJ 2RAEA 5LHGA 4DYRA 4R55A 4L9NA 2E2NA 3THWB 5LJ3h 2KIQA 1TH7A 4CZHA 5HLTA 1TK5A 2ZPIB 1RAEB 4MZTA 1E7OA 1JJ8C 2LJ0A 4OF1A 3OIQA 4BRGA 3CFPA 2QLZA 2IGKA 2P6TA 2GX9A 4LFAK 1ETKA 1WSIA 3H92A 4N56A 2Q0UA 2Q97A 4EJWA 3S9HA 1UAXA 2JVHA 4ZYGA 2QZ8A 2HHXA 4GKJK 5K1YA 1PSFA 1MD0A 4CJ7A 2HEQA 4CA0A 1D5VA 3LA7A 2VBXA 4DS5A 3WE3A 2KTQA 3BG5A 2Z3YA 4JS5A 5CZ1A 1RKTA 4AIJA 4PJOE 4IOAL 2LZ6B 5FD6A 2Y75A 1YQMA 2A42A 3CJTB 1ON1A 5GMKl 5LJ3f 1Q1HA 1KG2A 1PC0A 3G25A 1RT1A 5ADXH 3M0PA 3ZPLA 4DLGA 3EE9A 3VS2A 1J2XA 2NRRA 3Q0VA 1BCOA 1YXQA 1OJLA 4A3EJ 1M90R 3TEDA 2RA2A 1LDKB 4FX4A 1RDCA 2G0EA 1FTTA 2K3FA 2FJ1A 4HQMA 2VKDA 4OLAA 1MDUB 2O8EA 1RLPC 1EV7A 4CHNA 3NGPA 2OPRA 3V1OA 4FM1A 2IBDA 1X6GA 4C92E 3V9ZA 1A6IA 1EF4A 3MWPA 1VQ4I 2QSGX 1JTXA 2Q2RA 4RLQA 2GNCA 2DBMA 3O8GA 2D5RA 1WNLA 2HHTA 4YRVA 2DETA 3VETA 4WXDA 3HZJA 4KTQA 2WBMA 4RCBA 5GAOm 2FA5A 5KE3A 5FJ8J 1ZHFA 2P4TA 4AWXB 4LMYA 3SAHA 2QA4T 3DLRA 1N6QA 3SQNA 3VRZA 2FC0A 3W2VA 4H0PA 3M5RA 4CGJA 1YJWI 1Z1DA 1FJLA 2QW9A 2DEQA 2GBYA 2E6MA 5LMNK 1UUEA 4D8KA 3TOAA 1R71A 4RUGA 1HRHA 1X1CA 1ZTRA 4B3MK 5L3DA 2MBFA 1WJ5A 4XORA 4RTVA 1EZZB 1S6PA 2K5IA 1YJNQ 1HDDC 5IHNA 2IGMA 1UHFA 3CVSA 3KJVA 5GTIC 3A8OB 3MN9A 2BV6A 3NTKA 2FBVA 2XU8A 4EMKB 1DUXC 4KGVB 2XHIA 3IAYA 3P9IA 4F9OA 1BISA 5FU7B 2GUIA 1SFKA 2QGUA 4UUSB 1GLCG 1O3RA 1PKSA 2KHMA 3I0RA 3KEYA 4AVZA 5ILUA 4A3JJ 5E3LA 5M1KA 4ILHA 3HKZA 2XAUA 3SNNA 1O3TA 3KXTA 5M1PA 3KE2A 2FOWA 1GVJA 1NGJA 3WHBA 3FXRA 4EMGA 4KKOA 3SJJA 2JPSA 2V51B 1ERDA 1NJYA 4BRKA 5EG2A 3SQ4A 3QJYA 3I56T 1D9FA 1M1KO 1ZLKA 3RZOJ 4IQ4A 3HZ6A 2DMTA 2O0YA 1Y97A 2DA6A 3CCSN 1WA7A 1T6DA 3K9JA 2LC2A 2PX9A 5E79C 3BR2A 3CJ1A 1ZBIA 3KP3A 2LTOA 1VQNQ 2L7MP 4MZMA 1BOAA 3AVGA 4BB7A 4XN0A 4J9FA 3W6VA 4HCZA 3GIBA 4KO0A 2ASMA 3M56A 3H3VK 3H41A 2HF4A 3HVTA 4TSXA 2UWMA 2LDUA 2Y1JA 3COAC 5CQYA 4A6EA 1UDLA 3BPVA 4AHTA 3CUQB 3TW6A 1K4TA 3QU6A 3E9FA 3G10A 1ETVA 4M78B 3EG1A 1YFHA 5AQHA 4RTYA 1BWFO 1NGGA 3LP3A 3QUIA 1N36K 5DS9A 4EIAA 4IXAA 2ZXHA 3MK6A 4XLHA 2IC3A 1WAJA 2HHVA 4IRGA 1YIJT 1R59O 5D5VB 4M3GA 1M3CA 2Y9ZA 4XLEA 3E5XA 5GAMh 5H20A 1TV6A 1VQLA 3G3ZA 2XRNA 4UY8I 4EJUA 5GANf 3TAGA 1HQCA 4CGZA 1FLIA 1JL2A 3CMAT 1S5JA 2LT1A 2QQ8A 2HW3A 3LPUA 2JZYA 3KIOA 4I9LA 1SPKA 1VQ6Q 1RDWX 1FC3A 1Y96B 4BQLA 1IBLK 2H3JA 1X3UA 4MFBA 1P4WA 1S7AA 1NLOC 3SZTA 5EY4A 3M8QA 2J4RA 3W3DA 4C8QA 2KFZA 1S72Q 3LFKA 3IWZA 3B6AA 4EQQA 3H0HA 3Q1JA 5T7BA 4DSEA 3R60A 5AFUA 5KYUA 1BBYA 1B9NA 4DQIA 1OFCX 5EG0B 1Z21A 4BY6B 4RLFA 4QQ6A 3PV8A 1ZBXA 2XICA 2P0QA 2KFDA 3RVCA 1X2KA 3GL1A 4X1EA 3WU2C 2E5ZA 4WWCA 2FSWA 1ITYA 5D6YA 5CIUA 2VKEA 4BHBA 3PGGA 1DU6A 3N4QA 3LP1A 3BG6A 1JJ2M 2H6CA 3VQ6A 1U1SA 1TWCJ 3RSNA 3E3VA 5BPNA 3DBRB 2X9DA 1RESA 4OB0B 4XU0A 5KI6A 2O4XB 2OTLA 5KCHA 3CCEN 3EYIA 2OAZA 4B24A 1Q7YR 3A5NC 4LB6B 3LSRA 2K86A 1M1EB 4KFBA 4M7AC 2J6KA 1VQ8A 2K4YA 1M1GA 5LRRA 1SEUA 2R7ZJ 3QQAA 5AN4A 2PG4A 3WGHA 2NYXA 1TUCA 2ZD1A 1WPKA 2QG9B 4A2UA 2H6BA 5LJ3j 1REPC 2CGHA 4CZIA 1Z91A 1NU0A 1HNWK 4QKUA 2JSPA 4DFPA 3Q0UA 3FC3A 4AU7A 3BUZB 5GAN6 4LITA 4KIBA 5GAEJ 1RLQC 1HXDA 1VQPN 4HSRA 5JMVA 1GLFO 3PFYA 4CC4B 2YNHA 5HRNA 1K8AR 4BBSJ 2A5XA 3CWSA 1ZSZB 4YOQA 2QWMA 3VV0A 1DEJA 4YOWA 4CH7A 3MEUA 3I55I 2YSRA 1SD6A 1B9FA 1RKWA 4XL9A 4GRIA 3AGRA 2HWVA 3QEWA 1S6LA 1JCGA 4BRQA 3QPLA 2XY8A 5GPAA 3H9NA 1HNXK 4M3BA 2IA2A 1JLAA 2D2WA 3JAMK 1IRGA 5CKEA 4BR2A 3QWLA 4FLUA 4LDUA 5CLSA 1R0CB 1OH6A 4A59A 3L2VA 1JLCA 1XHZA 1MBFA 2VXZA 2RQRA 4DR3K 3CD6Q 2XAQA 4DSIA 4JKDA 4KH5A 5LL6S 1IXSB 1ULYA 4CZKA 3J81K 1QP2A 5C0YA 2FF3B 3O1BA 4EM1A 1WSHA 3KK2A 1C0TA 1VQKT 3F8MA 1AVZC 1IBMK 1YJNA 1O9SA 5DEQA 1JXOA 1I07A 3JB9I 1MA9B 3LWFA 2KVQG 1GLEG 2XF7A 2CP3A 2GEMA 4JI4K 1I81A 3D0SA 3DYAA 3LDOA 5CE3A 3OB9A 2YKNA 4PCQA 4IHSA 2O7OA 3SBTA 3R2XC 1KD1O 1VQ7N 2EJ9A 3WQTA 4JX4A 4F92B 2X3XD 2UUZA 5BRDA 4BJ6C 1C6VX 5GAOq 5JVHL 2AA4A 3I64A 1R0BG 3TWHA 1D3BA 2UV1A 4FJIA 3KD5E 2KQWA 4RAZA 1QSSA 3VU3C 3WTUC 1T38A 4YPHA 2RPIA 2DTRA 4FL6A 4Z4CA 1WJRA 4FSVA 3CC2A 3KD1E 1OEBA 4M9ZA 3OH6A 4W5QA 4DU3A 3ZOBA 2R7UA 3CJBA 2VT3A 3HL8A 1HPMA 4JDSA 3F0CA 2HNHA 2LLKA 3GNFB 2KNBB 1U2VA 5EOYA 3CMEQ 1VQ8T 2F5DA 2LNVA 3WXLA 1W6XA 4LD0A 2JTVA 3TP3A 2M0MA 3HM5A 4KDPA 2DTIA 4J2AA 1S72A 2A6EF 4MO7A 1NEBA 4M74A 3ZX3A 2M30A 2XGDA 3WTWC 4C2UA 3M8SA 2ZM6K 4AHVA 2OTJN 4KTWA 4BQZA 2OTLT 4H03B 4DW6A 2VL8A 1RETA 4FETA 4FWPA 2YX7A 3CCRI 1HSQA 3K4LA 5IP7J 1EKEA 2HGCA 2HPMA 3WU0A 3SDBA 3CMAI 3KK3A 1LPLA 1N8RR 1C0WA 2ZF5O 4F17A 4XAXB 4F2SA 1WSGA 4CIEA 1WWXA 1U2VB 4GNIA 1TYQB 2DA5A 4BYYA 4JKGA 4JKHA 1NGEA 2VWBA 2ITMA 2BIVA 3VYUB 2LQWA 4ELTA 1NJIU 3G0ZA 1VQOI 2H8HA 2G7HA 4LF8K 1YIJI 3J81E 3GX4X 4EJYA 1GBRA 1SC7A 5AQTA 4QOZB 1Q7YC 4DKWA 3I5RA 1XI1A 3NTHA 5HODA 2CH5A 4J8OA 2VIXA 2OX7A 2JTEA 4HUFA 4RAYA 3QIOA 3T1BA 2CP0A 3HP6A 3RNJA 3THVA 4BRNA 4LFCK 3BTLA 2WV1A 1A04A 2DBKA 1I8FA 2K9SA 3G4SQ 1DKGD 4U0VA 4B4CA 4J9IA 3VYGA 1RAFB 4W5OA 2OA8A 1XD7A 2DL3A 1O7FA 4IFYA 4M3ZA 4GY5A 2HHHK 1B07A 4HNVA 2ZCFB 2MLKA 2A40A 2BE5F 4C0DC 4PKHA 3I59B 5J2QA 3K59A 4JI8K 1N77A 2CS3A 4KICA 3CC2I 3QHSA 4KHSA 1E17A 2YT6A 5EJCA 5IYBJ 4GVMA 1H88C 4HSBA 3QG1A 4B21A 2XAFA 1QQOA 4KH4A 5F0CA 3SFMA 2V6EA 4DU4A 1KFZA 4DFMA 3QZ9B 1UB9A 4ENKA 3EZWA 1TLHB 3ZQCA 1AWOA 4MFEA 1NOYA 2PVOB 2O8CA 3DKWA 3MEDA 5C12A 2LMDA 2VWKA 5CKBA 2XY6A 4LLGF 2NVYJ 1B9DA 1Q8IA 2CH4A 1RCHA 3DJCA 3G7ZA 4QT7A 1G3WA 3QPSA 2NAZA 2JS2A 4CJPA 5M1QA 4FPAA 1WGSA 4N47A 5E1XA 1AHDP 1FWZA 1XHXA 5LJ5j 1W0TA 1KD1R 4XICA 3JCUC 2CT4A 1VSLA 4DF8A 1USSA 1T8EA 4BC4A 1KQ1A 2E10A 5F1JA 2F4VK 1WI9A 4XU1A 5HKCA 3OS1A 3FWEA 4RB2C 1WPYA 2P9UB 3FB9A 1HYOA 1U3EM 3IP4B 4L5EA 1ZBLA 3VQ4A 3Q9VA 2KK4A 3CC2N 3NE6A 2FE3A 3GZNB 3ZQQA 4C23A 5C15A 2QAZA 1OZ2A 2DJIA 2HQRA 4PSXA 4PLLA 4E70A 1V4RA 1DGRM 1QQIA 3NQOA 1X9MA 1NK7A 2YU9J 4IF4A 4DSKA 2P9LB 2ZJQF 3CCJA 3DLKA 1K79A 3J7ZI 4GLKA 3MAQA 3NGZA 2DJZA 2B0LA 4CC7A 4M7DD 1X9JA 3AVBA 3OQ5A 3C6UA 1F21A 2ELHA 5J1EA 1HNIA 5L3FA 3AARA 4AM7A 1T98A 3RI4A 4I0AA 3P4IA 3O4QA 3WU1B 4FLWA 1FP1D 1PNJA 5KCOA 1K0SA 2VJ4A 4MLHA 4XM3A 3F22A 3F8CA 3K1NA 3G71I 1GT0C 3JCMf 3ZMVA 1NZ9A 5JR3A 4B9TA 1CZAN 1BU6O 3LAKA 4BE0A 5DDGA 3PSIA 4JK9A 2JW4A 3CCSA 4B8AB 1PRLC 5C4XJ 3H5RA 3ZSXA 1FMWA 3E9LA 4CZLA 2HQNA 1ZARA 4H5NA 2DL7A 3RQIA 4BREA 3G4SI 3J7AF 3CD6I 1WNSA 3VESA 4C5IA 1Q1VA 4HX8A 5BPLA 1RNHA 4CBUA 2DU9A 3BZCA 3W6KB 2KFNA 3ULQB 4P55A 2QUFA 3CDHA 3A1YA 1VK0A 1KQ9A 1IF1A 1OOTA 4O4GA 3N5BB 4LH5A 3H0FA 1IRFA 4A5NA 3AT1B 1Q7YU 3ZSOA 3RMQA 5FD5A 2RQPA 1N3CA 3DOLA 3TANA 2W24A 3NCIA 4AIHA 2R0QC 4CJQA 1BQNA 1PJRA 1RR7A 3OS0A 3L3VA 4FWMA 5F27A 4MLOA 3H9JA 2BBYA 2MWOA 2XROA 2CU7A 5EVZA 1HW1A 3WVEB 4M73A 1NBEB 4KUDK 1U4BA 3RPUA 2VE8A 1FZPB 2YI1A 1MJ9A 2O8EB 3QDFA 3VPZA 5M1NA 5GAOl 3UPUA 2GFUA 1FKPA 4CYCA 1XGOA 4PIIA 3G71N 4BC5A 3RR8A 2G8HA 2Q2EA 1JLQA 1X3ZB 3HC7A 3UB5A 2BZXA 2MI6A 1TG0A 3NDKA 1S1TA 2GOXB 3M7GA 3I4MJ 4YOVA 2EILH 1LOJA 2JOYA 4P5NA 1ODDA 4HV5A 1GLLO 4D9JA 1S72N 1AU7A 2HDWA 3BDPA 2DFHA 4DBQA 2V8IA 1S1WA 4B3TK 1HMVA 1VIEA 4EZ9A 4CE9A 4A6DA 3UE5A 2LCSA 3UIQA 3CC2Q 2OZMA 3CCJT 1YJ9Q 3CBOA 5KTQA 2EW3A 1YYVA 1J3TA 2C0IA 2GXBA 1VRUA 4FJHA 2HQEA 2GELA 2NUBA 3QEIA 1S6QA 1VQ4Q 3BY6A 2L3QA 3KLFA 1WLJA 1RT4A 2KP6A 1NTCA 3BCBA 1E3OC 4IO8A 4LY7A 3Q0WA 1KVAA 1RFQA 1U5SA 3RKXA 2DODA 1XQHA 2X74A 1H3HA 4E7IA 1Q86R 4QS8A 3KBGA 2OZSA 2QWQA 3BR5A 4J7FA 1QHTA 2J7IA 4UXNA 3HTVA 5GJVB 4M41A 1BL3A 2ZE2A 4A4EA 2RD1A 1JUSA 3TDZC 4NUBA 2JRTA 2CUDA 2IRFG 5AQIA 1D4XA 1HU0A 1F36A 3GOXA 4EJZA 2HKOA 2EH3A 1GV2A 4M9XA 1K8AO 3CCQQ 3R6NA 1X1AA 2DOAA 4EVVA 1IB8A 5J1RA 4XLNF 5GAN7 4IUTA 1FYLA 1TQIA 1BK2A 2BZYA 3VA3A 2CT3A 3ZT3A 4O3MA 1BU1A 4Z0UA 2L7FP 3CCMA 3VYHB 2E12A 4F7UE 3NFAA 2OU2A 3EG9A 4K0KK 2Q36A 4H8KA 4DSLA 3CQXA 2ZPFB 4WE1A 2BDPA 2NNYA 1FBQA 3IKMA 2KT0A 4H0TB 3NNQA 2F48A 5HL7L 1JGGA 2G8IA 3ULRB 3PJRA 2XAHA 1MDMA 3GTJJ 3CCUN 4ZC3A 3CWUA 4RTFD 3CPWM 1VQ4T 1Q81R 4NHJA 2F2VA 3M0TA 1QPIA 3IH7A 4BR5A 1N8RC 3ZP5A 5BPDA 1VQ5T 1GL5A 4XTYA 3QYHB 2NS7A 5GADJ 5GAEP 3K10A 4A0YA 4HYEA 4FW1A 4M45A 1Z9CA 1M8VA 1YITN 2K3BA 2DDAA 1BUPA 3NH1A 5E1WA 2CKKA 2Q31A 5GAOr 3GG4A 3MECA 3SPYA 3TO9A 4F7UF 4V19K 1RC9A 4YPRA 1XS9A 2PTKA 1I1SA 2DK5A 1KFSA 2K3PA 2L4AA 3LSPA 5J39A 3VGMA 1MUNA 4YNQA 2EBPA 1OKRA 3KFVA 1M3BA 4NZGA 1RABB 2DA7A 2R7XA 1QRYA 4Y0WA 2FBXA 3L1AA 2E7XA 3OYHA 5EEHA 2KJBA 5IP6A 1NEGA 3TI0A 1IGNA 4QS9A 3MJXA 2QQBA 1X1PA 3DU5A 3JCMV 3VTIA 2LRDA 4OKEA 5FWBA 2NZTA 2M2EA 2IAJA 2WWYA 1RT2A 2YUQA 4MIMA 4IO9L 1Q86U 1ZGAA 1IN8A 3I56A 3IFRA 3QWYA 3L9FA 2CUFA 3ABLH 4JKCA 2HZTA 3K2AA 3LYIA 2ZFUA 4OX9K 1A31A 2Y69H 3A98A 2LYCA 3KZZA 1TL3A 2KLOA 2P9SB 2ASOA 4M75D 2DJNA 2F5FA 4ZZLA 2RH2A 5B5EC 3I8DA 3WNEA 5IOYA 4XRSG 3TCJA 1BA1A 4J2DA 3EPZA 2HTJA 4A12A 4UUTA 3U9GA 4IOCL 3FZFA 3OL3A 4HV6A 5C44J 4CZZA 3HFOA 4IRHA 3ABUA 1LJ9A 3MXMA 4XTUA 4L5IA 2EV0A 3BJAA 2DXTA 1YIJA 4KYWA 2ECZA 3EGXB 2F69A 1OVYA 5ICGA 4MGRA 3TREA 1FW6A 3K5OA 3WG7H 1VQ5N 1UG1A 1ABQA 3BJ6A 3EO3A 2CV1A 3QB0A 4DR5K 1EH7A 5GAN2 5GANg 3AL0B 1SL2A 1NPPA 3BF1A 2E5LK 2CQXA 2ELJA 4FOIA 1KONA 3DP7A 1H92A 3M54A 4QQGA 4MQ9F 1FOKA 2P0PA 3SQ2A 4EZ6A 3JRAA 3O3GA 4OMLA 1XMQK 3HP9A 4W1UA 2OPQA 1IRZA 1OKJA 4M7DF 4XBFA 2XB5A 1O7LA 3DI6A 5J1YA 5CKTA 3WXJA 4KV8A 2L7ZA 3M0SA 5HLFA 3CC4I 1JKRC 3L0QA 1VQKA 1IXDA 3VUBA 2W0ZA 5IAYA 1UJ8A 2DY4A 3BE3A 2RJCA 3ZLJA 4AYBA 3DM2A 2I5UA 2HI3A 2YR2A 2RHZA 5BQTA 3I56Q 3M8PA 3JSPA 3BG3A 3BR6A 4XQFA 4CF8A 1NJXA 2BOLA 2COWA 3ZEUA 2VPRA 4DOVA 2XASA 3LM9A 1BM9A 2L3DA 1F5TA 1K78A 4PK4A 3IKVA 3THXB 2FZGB 4H0YB 1NK8A 1K9MO 2D0QB 3FF5A 4I2OA 2G8VA 2ZZDA 3W6JB 2YXYA 2VC8A 2P9NB 4M3RA 3AAPA 4IO9F 4A54A 4UVBA 2Z33A 4OMYA 3T1HK 3FBIB 1PU6A 4A5AA 1YHQN 3SK3A 1LFUP 3BTIA 2Z1JA 1IBKK 2JT4A 2W6LA 3FXUA 1DPRA 2ELKA 1J75A 4DU1A 2DIQA 1RNLA 2DNUA 3I58A 3J7YJ 3ASNH 3RKWA 2HQHA 2IG0A 4KHPK 2AS5F 2IS1A 1ZYQA 3G6EA 1MIJA 1OYXA 2V52B 2ZQBA 4L18B 3QPTA 1ZUYA 4DV7K 4IJAA 2KHOA 2DIGA 1X6OA 1FN7A 3D2FB 3OHRA 3VQQA 4E7ZA 4M7XA 3U9ZA 4C0DB 3P83D 4BY6C 2MWPA 2CQNA 1QQNA 5HP1A 2H1KA 2OZUA 3OYYA 2E88A 2QTXA 1I3QJ 2VLAA 1IN6A 4N5SA 2KISA 2CW8A 4XKVA 4M3WA 3F21A 1OQKA 1IN4A 5JLFA 2VQHA 3FX3A 3RZDJ 5CJ9A 1NK3P 3UR3C 4JLGA 3OVNA 3HHHA 3M55A 2JMAA 3U23A 2H09A 1F1ZA 3D45A 4WQ4C 1T3VA 2M4GA 4C92D 3OOUA 3FSPA 2BW3B 3OIOA 4KFCA 1BO5O 2KAFA 4C8QD 3E97A 2R7FA 1XC3A 3HEFA 2R3SA 4I99C 2D8JA 4ICLA 4FWLA 1KFDA 4OMNA 4CHPA 5GTHC 1KQSS 1VSJA 5A0LA 1WB9A 4JJBA 2W7NA 2IA0A 2L0KA 3DLGA 1WJSA 2QTVA 4B8CA 1VQ4N 4EW0A 5AZIB 4U7BA 4OO1J 3DXKB 3LQRA 1QA6A 4YOXA 3ML6A 2V8JA 2M87A 3V4IA 3MKWB 3JB9G 3PNYA 1PHTA 1PWTA 4DCHA 3S1NJ 5HNHA 3BZKA 4DR1K 5BMZA 1E0EA 2RN2A 2RQTA 2Y30A 2BGCA 5AQVA 2CZ7B 4EV0A 3T8TA 1I5LA 4IEIA 3RESA 3ZL7C 4OIOF 3H36A 3A02A 3SEZA 1FBSA 4DV4K 1J7KA 4ABZA 2V75A 4ATOA 3CCMI 1VQLN 1ZR4A 4J01A 2QWRA 1D9DA 3MZYA 1TUUA 4M75B 3J80K 2Z99A 3BT9A 4I6MA 2VWJA 2VQEK 3OR2C 2NVXJ 1WJCA 1HKSA 3JSOA 3KK1A 3F0ZA 3M0RA 2I5WA 3JS6A 3PM1A 4C1NI 4M3UA 5AYFA 3JCMP 3FFKB 4ZJZA 5DUIA 1MGTA 4M6XA 4G9YA 4ENMA 4CHYA 1ZBSA 5H2FC 2ZMEA 2JA8J 4Z2YA 4A4GA 3AO5A 4N0AC 1VQ9T 2QBYA 5AONA 2NOZA 3EKUA 2PZ1A 1Z6TA 1ZA1B 1LB2A 5DM7R 1ASUA 2CUZA 5E41A 3CHWA 1YNZA 1HJOA 4M6VA 4MDBA 4MFDA 2Y4XA 2R5MA 1HJRA 2OD5A 2AK5A 3QMLA 4JLHA 5FLVA 1DTTA 3GTLJ 3D5LA 2E3HA 1RADB 2ZJRL 4ESBA 1IW7F 1ATNA 1NK5A 3T5XA 2EZKA 1ENHA 4J9EA 3BG9A 2CW0F 1YTAA 4PFZA 3RDIA 3QFUA 3R1XA 4J9CA 3C7NA 3ZQLA 4D8DA 2LQ8A 1YITI 2HFHA 3VS0A 1KZHA 1Y56A 1B34A 2O01E 2R7RA 3OIPA 3NEUA 2GCXA 3CCSI 3BC8A 2PJRA 4CESA 3QAHA 2IT0A 3P9CA 2GTDA 3U2RA 5GAN4 1I5ZA 1NGFA 1C0UA 2Q0RA 1AOYA 2CRGA 4R56A 2RF2A 1D0XA 3ZETA 3EDPA 2YCHA 3SMSA 3B6PA 1NKEA 2IS3A 1VQMN 3F6VA 2VG6A 4ILJA 5IT9O 4JHDB 3ZQ7A 3PO2J 3FRNA 2ICWG 4A93J 2JZ2A 3TU4K 4KI6A 4PNOA 4XTXA 2PZSA 1NGIA 3H46O 2EB7A 3ULEA 1W0UA 3HGGA 3C0CA 1FXXA 1KQJA 3SCXA 2HYFA 4UUSA 1X69A 2CSQA 1J54A 3F8NA 2UXDK 2AQEA 2E1MB 1VQ7I 2PVGB 3B73A 3V7CA 3N4PA 1ZR2A 4QPQA 4B3XA 2PFUA 4OB2B 1E3PA 3LWIA 3SWNA 2L9NA 1XCVA 2WTUA 1YW7A 4A3LJ 2E1OA 2V4JC 3O2PE 4Q47A 2ECBA 5EG0A 1XMXA 2HL5C 1M90C 2LF7A 1J9IA 3BZ6A 5KNLA 2QEXQ 5AQOA 1ASWA 2Z16A 3NH2A 1FMKA 1VAZA 2XF5A 2A7YA 1C1CA 1LJOA 1X9WA 4KITB 1UB4A 2F96A 2YUOA 4OPAA 2QSHX 2KXDA 2D1XA 2VG5A 2UU9K 3ZMTA 1QVFS 4FJXA 3O4WA 3NHGA 1ZBHA 5EZHA 2LRQA 3CCQI 2F4IA 3J7AO 3EFOB 2HVRA 2XI9A 3SFZA 4KH0B 4HOBA 5GAGP 2VQFK 3VDXA 1MPGA 4M7AF 1N25A 2VV5A 3NVMA 4RW7A 1FOXA 1KD1C 3DV8A 2SEMA 3C7NB 1YQKA 1Q18A 3PUFA 4YHHK 1DLOA 2B5JA 1X3NA 2AT1B 4J6YA 2XAJA 5CQGA 4R5PA 2Y48A 1QVGP 4Q5VA 5F6FA 1LCKA 2V1DA 1K83J 5C25A 1IC8A 4P9FA 1KG6A 3ZXSA 1Z3XA 4QVCA 4NDLA 3A01A 3CC2T 4HVVA 1DTQA 2K57A 1J5YA 3O9UA 1XTAA 2KIFA 1WUAA 3KKSA 2KROA 2HNDA 2COMA 2QVOA 2COZA 2OUMA 3MD2A 4XOTA 2OI3A 1HCRA 4AI5A 4JI2K 4AIKA 2DXCA 1QZ5A 1U8RA 1M27C 4HTUA 3H1VX 3S41A 1NK9A 4B9XA 2M0OA 2BZ8A 3QLHA 3L2ZA 4ELZC 3K70D 4PJOB 3ZSZA 3O8VA 4MO4A 1U84A 4C8QG 2UZKA 4L0YB 4J9HA 4ZYDA 4LG0A 1RL2A 4CJVA 4L8RB 1R22A 3K4JA 2BH1A 1FOWA 2BKDN 1I4K1 2CS7A 2LY1A 2OAWA 1UA0A 4R1HA 2FYKA 2EA2A 3I56I 1MBGA 5J4YA 2KQRA 3ENOA 4HF1A 3ECHA 4II3A 5HBMA 5KN8A 4LN2A 2C06A 4KAZA 4EM2A 2JG6A 3W0LA 4RW6A 2JA5J 3HL2A 3OYJA 3CJAA 5H1SQ 1XQPA 5D6WA 2V1RA 4C8QC 2QDYB 2LCLA 2W82A 2P51A 3CCLA 5BN9A 2E5KA 4IHXA 1XNIA 3LSHA 4HG2A 5IH2A 5KHDA 3EUHC 5L23A 3BY7A 4L9VA 4MTEA 4JI6K 3RSEA 2P9KA 3IC7A 1UHSA 5KPZA 4DR6K 4IFEA 3ULDA 4BXFA 5AQSA 1NK4A 2HMIA 3HK2A 2F5KA 1WSJA 1U45A 2YG9A 4B3OA 1WJEA 3QBWA 3HSEA 5FWCA 2IS4A 4CSWA 4JYKA 4XU3A 1B1BA 3RPUD 2HNZA 3E2UA 4DTUA 3R0JA 3SUOA 4O0IA 4DYCA 4EGYA 2DOFA 4TV7A 4BGAA 4OMOA 3TSQA 3LPTA 4YDUC 4JHDA 4AVPA 2DT7B 3CCLI 2HBJA 3H3OB 3ERED 1P92A 2HKXA 3K0SA 4HDUA 1XGSA 3MMYB 1ETQA 3EYYA 2XHCA 4CEFA 3F70A 5F1RA 4BDZA 2YRVA 2HMPA 1K8KA 2V26A 5F1XA 4DTPA 3LA2A 2D1HA 1U78A 2O4XA 2NOIA 5IPAA 3FFIA 2QGGA 3DLEA 4UC4A 3MN5A 3CQYA 2FO0A 2O88A 2JGUA 2DFIA 1EH6A 1V55H 3I33A 1N39A 1P7IA 5AZJA 1QZYA 4K43A 2VPLA 4DTNA 2A5YB 4BR0A 4Y33A 5E8IA 2RPNA 3M4YA 1IH7A 4WK8F 2RN8A 2ACJA 2HXIA 3LSIA 2NOHA 4HZFA 4DV3K 3ZBDA 2L5QA 1EJ9A 1QCFA 2JK3A 1YJWN 4LFBK 5B1AH 5KH6A 2WUSA 3IRQA 4ZGDB 2IVMA 1GCQC 4JP0A 3EH2A 4P5OA 2VJJA 1HJDA 3ATUA 4OPKA 4LC9B 1KLMA 2LTPA 4HVUA 4BU2A 1LCUA 2PEXA 2A36A 3WXKA 2DK3A 1VSDA 1I6HJ 2RM4A 3CMEI 1ZKGA 2RHYA 4BWJA 3VEVA 5C6SA 2RV8A 1TC3C 2O9SA 3F2KA 1KIKA 3WTVC 2HNIA 4ZGJB 1YHQA 3QEVA 3FK7A 2JM9A 3SJMA 5I9EB 2R5YA 4XSXF 2FEIA 2DL5A 3V1RA 4FWRA 1XN7A 4HT9A 1ZELA 4LNPA 2K2MA 4L3QA 2VBYA 2ATCB 1MUDA 4G6QA 4E1JA 4JRPA 4BGDA 4I2QA 1JUPA 1HNZK 1ZREA 5LJ5h 1WHKA 1NKCA 3K5LA 2E2PA 5L3BA 4KISA 2H3GX 3PSFA 2YUSA 2RI5A 2E19A 5KYWB 3TSWA 3HDDA 3BEXA 3EGXA 1XDUA