3OYCA

Crystal structure of the prototype foamy virus (pfv) intasome in complex with magnesium and the insti pica
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
368
structure length
368
Chain Sequence
LDAELDQLLQGHYIKGYPKQYTYFLEDGKVKVSRPEGVKIIPPQSDRQKIVLQAHNLAHTGREATLLKIANLYWWPNMRKDVVKQLGRCQQCLITNASNKASGPILRPDRPQKPFDKFFIDYIGPLPPSQGYLYVLVVVDGMTGFTWLYPTKAPSTSATVKSLNVLTSIAIPKVIHSDQGAAFTSSTFAEWAKERGIHLEFSTPYHPQSSGKVERKNSDIKRLLTKLLVGRPTKWYDLLPVVQLALNNTYSPVLKYTPHQLLFGIDSNTPFANQDTLDLTREEELSLLQEIRTSLYHPSTPPASSRSWSPVVGQLVQERVARPASLRPRWHKPSTVLKVLNPRTVVILDHLGNNRTVSIDNLKPTSHQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular mechanisms of retroviral integrase inhibition and the evolution of viral resistance.
pubmed doi rcsb
source organism Human spumaretrovirus
molecule tags Recombination,viral protein/dna
molecule keywords PFV integrase
total genus 106
structure length 368
sequence length 368
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2010-09-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
A PF17921 Integrase_H2C2 Integrase zinc binding domain
A PF18103 SH3_11 Retroviral integrase C-terminal SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2300 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3oycA04
1.10.340.70 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Endonuclease III; domain 1 3oycA01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3oycA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3oycA03
1RTIA 4F2RA 1KFSA 2LTOA 4ID1A 5J2NA 3AVBA 1A5WA 4DTPA 4EZ6A 3M8PA 3K59A 3NF7A 1LAWA 1RT7A 3ZT0A 3LANA 4N76A 4JRQA 1KSPA 4H4OA 1NKEA 4OGEA 4L8RB 3L2VA 1BCOA 5E41A 3MEDA 1LW2A 4M41A 4W5OA 3PX4A 1G15A 1FKOA 4DTOA 3DB4A 3HL8A 3ZT4A 1L3SA 4OPKA 4CGGA 5KGXA 2X74A 4W5TA 3V9SA 4DS5A 4IUVA 1DTQA 2YHBA 4HVJA 1KRPA 4QCLA 3O3GA 3LZJA 4C8KA 1TAUA 5CIUA 2HHTA 1TL3A 2O4XA 4PUOA 3S3NA 2DFHA 1U49A 2WACA 1SUQA 4FU6A 2NUBA 1HPZA 4I2QA 3CM6A 3QO9A 4W5NA 1BL3A 4CJEA 4CHOA 2LSNA 2IAJA 3FC3A 1RBTA 1C1BA 1WSGA 4KKOA 3NHGA 3D45A 4EDUA 3AA2A 4IUUA 3ZSVA 3K58A 4O55A 4TSXA 2EX3A 4OVAA 3KKSA 3JYTA 4KAZA 1VSIA 4DFJA 1C6VA 2D9TA 4DTSA 1S5JA 1YTAA 5C6SA 5HROA 3LWMA 4FLZA 3GOXA 3AVJA 4BE2A 2L89A 3VQPA 4R5PA 2XDPA 1TL1A 3RWUA 3Q1JA 5JS1A 4CJVA 3T3FA 3P83D 4CEEA 4B9NA 2QKKA 3M8SA 2D0CA 2HNDA 2R7YA 1VSLA 1RT4A 4CJ4A 2XY5A 2FBYA 3TAEA 1EXQA 4KB0A 4E3SA 2DAQA 4BE1A 2FBXA 4CJQA 1UWBA 2RJFA 2YRVA 2HQXA 1RT3A 2M0OA 4IG0A 4CEBA 2PZSA 4EZ9A 4CHYA 2HNYA 3OVNA 5DMRA 1VSMA 3TANA 4OLAA 1T8EA 1D9DA 3HVTA 4NZGA 1HQUA 4KREA 4FM0A 3THVA 4M3UA 2HHUA 2KTQA 4HUFA 1HYSA 1WN7A 2P0KA 3KUFA 1REVA 4PLLA 1RBUA 4Z4HA 3SPZA 2JZ2A 3TABA 3KJVA 5D6YA 1WAJA 2RO0A 4E19A 3TAGA 3WNGA 1GOCA 1EETA 3M9QA 4CERA 1TK5A 3LAKA 3AA5X 1A5XA 2G8HA 4CGIA 4EP5A 4F2SA 3V1QA 3KKRA 3NGZA 1ITGA 3QERA 3O3FA 1RDDA 4FYDA 3UWNA 1NJWA 2OZMA 3ALYA 3NCIA 4Z4FA 3QEXA 4I2PA 4DFKA 1T05A 1IKYA 1BI4B 1IKWA 2ETJA 5HLFA 1DTTA 1I3AA 5KCOA 2VWKA 5FDLA 4FJMA 3KK1A 2X4YA 1NK9A 1QSYA 1B9FA 1QHTA 1KVCA 4KHNA 1VRUA 4OLBA 4RW4A 1NK4A 1L3VA 4AHUA 2XK0A 3HP9A 3CG7A 3IAYA 4LH4A 3B6OA 3SI6A 1F21A 3OB9A 3L2UA 4C5EA 5KH6A 4H8KA 2WONA 3ZSRA 4OVLA 5JS2A 3MXMA 1NK5A 3VQAA 1QSLA 4FJGA 3ZSQA 4BDPA 4M3ZA 2EHGA 4DTUA 4C5GA 4CFCA 4IKFA 4CJ5A 3MEGA 4FXDA 4MFBA 1QTMA 3OJSA 4KB1A 3KD1E 4CEAA 3MAQA 3V9WA 4I9LA 1Y97A 3CFRA 2M16A 3VA0A 3B6PA 5IN1A 2X6SA 2XO7A 4N41A 4AH9A 3HVRA 4DSEA 2HHWA 2P1JA 3HYFA 4AHSA 4N4GA 3NGIA 5HRPA 3SNNA 2HHVA 4FLYA 4LY7A 2IG0A 4GVMA 4ZHRA 4DSIA 3QNNA 3OYAA 4CF1A 4PLIA 4FK4A 3OS0A 2ZD1A 2K3YA 2RN2A 1J5OA 2EQKA 3AO1A 3T1AA 4E0DA 5CYQA 3SQ1A 2Z1HA 1VK0A 3QNOA 2FBVA 1X1PA 4E7KA 2HB5A 2RF2A 4CIEA 3HT3A 4E1NA 3DOLA 1NK6A 4LD6A 2DFFA 4Z4IA 1T7PA 1WGSA 1W9HA 3CFOA 1ZBFA 2ITGA 1TGOA 3TAFA 3NBPA 2PY5A 4CFBA 4N56A 4N47A 2RI5A 1B9DA 3QKJA 2RHYA 2R57A 1WLJA 2B6AA 3LPUA 4AHCA 4DTNA 4ELTA 3WNEA 3KTQA 1FKPA 1YTUA 2HHXA 4CK2A 1L3UA 1HRHA 2OYQA 2B8AA 2GBZA 2GF7A 2ZQBA 4RW6A 3RR8A 3S3MA 3V9ZA 3MEAA 3C95A 1S1VA 4AHRA 1L5UA 4DTRA 1N27A 1XHZA 4O4GA 5HRNA 3UIQA 3K5MA 2IOCA 4M3WA 1NOZA 3VQCA 3LDSA 3PO4A 4F3OA 4ICLA 2HVIA 2QXFA 2ZE2A 2RPIA 4DSFA 3HPGA 5D6WA 2PYJA 2KZZA 3SUQA 3I0RA 1XWLA 2R5MA 4BACA 2AJQA 3SUNA 4DSKA 3G10A 4OGCA 4PA1A 4CGJA 4QQ6A 3SUOA 4QOZB 4IDKA 3L2WA 4CEDA 1KCFA 1VRTA 4IFVA 3KIOA 3ZSYA 3OYMA 2X6NA 3ULDA 1LW0A 5FRNA 1XI1A 1NKBA 3V4IA 5KCHA 1TK8A 4BD3A 2X35A 1CZBA 1RBSA 4CJFA 1ASVA 3DB3A 4N5SA 4CECA 3O3HA 3KD5E 3G0ZA 1G5VA 2LVMA 3OYEA 1LWFA 4OKKA 1N6QA 4DWIA 3MEVA 3AVKA 3L3VA 3LYIA 3OS1A 4IFYA 1JLCA 3SUPA 4FJXA 4KHUA 4RW7A 4CJLA 4I7FA 1JLAA 1FXXA 4CGFA 3H08A 4FVMA 3AVAA 4OKEA 3JSMA 5C24A 4Q5WA 4J2BA 1B92A 4KHSA 3NAEA 4C8LA 4I9QA 3MP8A 4KHWA 5KTQA 3KK3A 3LP2A 3V6DA 4NCAA 2WOMA 4B9VA 1ZBIA 1U04A 4DLGA 1HYZA 3OYIA 4DQIA 4CK1A 2D0AA 3TAPA 1LV5A 4F4KA 3VQ5A 2BKDN 3P1GA 3LP0A 2VG7A 3RRGA 2RJCA 3VQEA 1C0UA 2QKBA 5CYMA 1WSFA 4KI6A 1ZBLA 1WNSA 2OPSA 2RKIA 3NGYA 4H4MA 3WNHA 1WJQA 3H6ZA 3NNQA 1FK9A 3F9KA 3DLHA 4HTUA 4L59A 3OYJA 1O1WA 2YV0X 4DQPA 4FJIA 4CIGA 3P8DA 4CESA 4CF9A 3SCXA 4FLWA 1NK0A 3DLRA 3OYCA 3OYDA 4FCYA 1ZBHA 1VSDA 1CLQA 4FZYA 3OYLA 3MP6A 3KLIA 3KLGA 1HYVA 4E7IA 1WSHA 2Z1IA 4WE1A 1SV5A 1RT1A 1RTHA 2FC0A 3O8VA 3C94A 2X4WA 4DFPA 1U47A 1RTJA 4PWDA 3FFIA 1QS4A 4B8AB 1WSIA 2Q3SA 4QW2A 1JKHA 1JLQA 3SPYA 3EYZA 3OYFA 2LRQA 3DLMA 2IDOA 1RT2A 2LCCA 4DQRA 1C1CA 4Y1DA 1S6PA 1EX4A 2YNGA 2K3XA 3RMAA 2PQWA 4M42A 4NCBA 3PMTA 1L3TA 1QQCA 4KTWA 4ZTJA 3ZT3A 5HBMA 2EFIA 1RDBA 1X9MA 1J9AA 3VQBA 3AO4A 2IS3A 1OI1A 3L3UA 4M3TA 4FW2A 2OA8A 2RHZA 3FLGA 1XNIA 1JL2A 1HQEA 2HNZA 3KLHA 3M8RA 3SZ2A 2KFZA 2RHXA 1ASUA 4JS5A 4Z4EA 4Z0UA 2YNFA 3MXJA 2MWOA 2LDMA 4C5IA 3AO3A 4CIFA 4DF4A 2Y1JA 1LWCA 4W5QA 3AVCA 3O4QA 4LH5A 4IBNA 3AA4A 2HW3A 4CEOA 3MP1A 3ITHA 3PY8A 3L2RA 3DLEA 2XRIA 4E7HA 1Z25A 5J39A 1BISA 3DOKA 4CJUA 2EQUA 4DFMA 1WAFA 4A4EA 3H8ZA 2VG5A 4CJKA 1NJYA 4N4HA 1ASWA 3C6TA 4C8NA 2P5GA 1Q8IA 3SQ2A 3TAMA 3EZ5A 3CQ8A 4N4IA 4CE9A 2KW4A 3SQ4A 1LWEA 3AVNA 3ASMA 3DRRA 3MO8A 4FZXC 4DTMA 1VSHA 2HHSA 2M1HA 3AVFA 2KZMA 3CEYA 3K5NA 2MWPA 4CJSA 1BCMA 3S6WA 4BDZA 1MHNA 1CXUA 2IC3A 4CHQA 4YFUA 3K57A 3S3OA 1Q9YA 2F96A 3NF8A 1S1TA 1W0HA 3IRXA 2G8KA 4BWJA 1TVRA 3DMJA 2OPRA 3ZSWA 4Q0BA 4J2EA 1BIUA 1H3ZA 1IKVA 1KVAA 1YVUA 4KV8A 4B9WA 2JLEA 4O5BA 4DLEA 3QEWA 3KLEA 4HCBA 4FK2A 4FLVA 3MEUA 1BIZA 3RR7A 3T19A 2BGGA 1J53A 4NYFA 1RBRA 4PY5A 2DTUA 2O4GA 3ASKA 4G1QA 3O4NA 3PUFA 4JRPA 3NDKA 1ZYQA 4CHPA 2DIGA 3LPTA 2XY6A 4UC4A 1IO2A 5KRSA 2BANA 4HCZA 3QEVA 4C5HA 3RTVA 4DTXA 2VYTA 4II1A 2QQRA 2B4JA 4ID5A 4M45A 3V9UA 2R58A 1GOAA 4DU3A 2RHUA 1JXBA 1NK8A 1NJZA 2G8WA 4KI4A 4KRFA 1S1UA 1XHXA 4M3XA 3K2PA 3LWLA 3RMDA 4LD0A 3C6UA 2KFNA 1IG9A 3OMGA 3NTIA 1WSJA 3EY1A 4LSLA 4DQSA 2Y1IA 3LALA 3I8DA 4FLXA 2EQJA 3RRHA 2QK9A 4B8CA 4HUGA 2F5KA 4DSLA 4CCHA 4CGHA 2Z1JA 3NFAA 1RDCA 4KFBA 4BE0A 1RT6A 2BDPA 3L8BA 2KQ2A 4CFAA 3MEEA 1NJXA 3PFSA 3PNWC 3NH1A 1Z26A 5KGWA 3VQ4A 4HUEA 4DQQA 3UT1A 5KRTA 3QIPA 4AHVA 2E6MA 4CJ3A 1DLOA 2YNIA 3NE6A 1R0AA 3OYKA 4FJ8A 4O0IA 4QQGA 4RG8A 3DLKA 4E7JA 3SV4A 1IKXA 3LP3A 3D0PA 5SWMA 4B9UA 3PMIA 1S9EA 1TKXA 3HPOA 3V81A 3AVMA 3TARA 3BDLA 3OS2A 1RT5A 3V1RA 2A1RA 4FJKA 4FK0A 3S9HA 4B9TA 4FJ7A 1BHLA 3AVHA 1T03A 3V9XA 4E7LA 3OA6A 4ELVA 1K6YA 3HK2A 2O4IA 4Z4GA 3ME9A 1MU2A 3BDPA 3V1OA 3HXMA 2XY8A 3LH0A 5I42A 1X9SA 1IH7A 4QQDA 3M8QA 1C0TA 3WNFA 3ZSZA 3HO1A 4HHTA 2GFAA 3SV3A 2RJDA 3TR8A 4K8ZA 2GV9A 4HCCA 2E6NA 1I39A 4PL6A 5I3UA 1QSSA 5D6XA 3ZSOA 2YHAA 3QETA 3HP6A 1UA0A 1SL0A 5IAYA 1SSFA 5C0MA 2OPPA 4RG2A 3U3YA 4FJHA 2XY7A 4FLUA 4JS4A 3L2QA 2PYLA 1RI0A 4Z02A 4FJ5A 4K8XA 4FM2A 4LSNA 4MQ3A 4W5RA 1TKDA 2W42A 4A4HA 4KHQA 5M9OA 3HJFA 4JLHA 1Q9XA 5KI6A 4IUQA 5CZ2A 2F8SA 3HM9A 3ZT1A 3DRSA 2HVHA 3QEIA 2P51A 3PV8A 4PQUA 3E9GA 3OYHA 3QIOA 4KHYA 2L3RA 3P5JA 5FRMA 2JTFA 2X4XA 3VA3A 1KLNA 1OZ2A 4B9SA 3DRPA 3DYAA 2D0BA 3P8HA 3VQ6A 3QESA 1UAXA 5FROA 5KE3A 4E89A 4OPJA 2DY4A 3FDRA 1VSJA 2BUDA 2BIVA 2RI3A 4CK3A 4UQGA 4CF0A 2I5JA 4DU4A 4FZZA 3LX7A 1U48A 3LGLA 5SZTA 1UOCA 3OJUA 2F8TA 4IG3A 3DM2A 5EU7A 3KK2A 4CJWA 3VN5A 4CRIA 3IG1A 4NCGA 1KHCA 1LAVA 3HSTB 1JLGA 1RDAA 3NF9A 4DTJA 3RMCA 5HP1A 5KE2A 4F8RA 3ISNC 4O0JA 3QJ6A 1KLMA 4KTZA 3DI6A 4RW9A 2IGIA 4ELUA 3VQQA 4Y1CA 4FJLA 3OMCA 1J54A 1SKRA 3QINA 4E1MA 4OKJA 3OYNA 3LGFA 2A1SA 1BQMA 3MEWA 4FW1A 2DFEA 4M3RA 2RJEA 1HMVA 1C0MA 1JL1A 1CXQA 2RI2A 3OYGA 5J26A 2QQSA 1RILA 1TV6A 4FL6A 2VG6A 2OPQA 2Z1GA 4CEFA 3NH2A 4FLTA 4FJ9A 4DF8A 2NLUA 4DG1A 1OYXA 5T7BA 1U45A 1KFDA 1VSKA 1NKCA 3C4SA 2DIQA 4O44A 2BE2A 4KTQA 2GUIA 4IUTA 1KVBA 4KPYA 2G3RA 5CY4A 1WJRA 1TKTA 1SKWA 2E6LA 3TWHA 4C8OA 2FHDA 2X78A 1WSEA 3AV9A 1N5YA 1JLFA 3SJJA 4M3YA 2EKOA 4B08A 3MXIA 4FJJA 1S9GA 3LP1A 5CZ1A 2O4XB 3LAMA 3I0SA 1X9WA 2YKNA 1ZBUA 3QEPA 5D3GA 1BQNA 1TAQA 3A2FA 1SL1A 4GW6A 1TKZA 4CGDA 3KLFA 4F3TA 1JLEA 3F70A 3SQ0A 4GY5A 1NOYA 4XIUA 2HMIA 4J2AA 5K14A 3RMBA 1YT3A 5C25A 2HQEA 1OZ3A 2E5QA 1RNHA 3VQ7A 3VQ8A 5HRSA 3ZT2A 3K5OA 4AILC 5J2PA 4DS4A 4B3OA 1RBVA 2R5AA 1HNIA 4CHNA 4CHZA 4RW8A 3LZIA 1KTQA 4GMJB 3SD4A 3ZCMA 2G8IA 1GOBA 1C1AA 2EQMA 4CFDA 2G8UA 3OQ5A 3NF6A 3NH0A 1CZ9A 4CF8A 3E01A 4DSJA 3CFPA 1BGXT 2RHIA 3IS9A 3MECA 1VSEA 1UA1A 1S1WA 3EAEA 1VSFA 4BWMA 4A4FA 2E4LA 3OYBA 4CJTA 1HJRA 1D5AA 4CEZA 4CJRA 3F73A 2CKKA 1SL2A 3QBYA 3QIIA 3BGRA 2G8FA 1RTDA 3DLGA 2ATQA 3ZSXA 4IURA 1EKEA 1RCHA 2B5JA 3AVIA 4KO0A 4QAGA 3NTKA 4DU1A 1D9FA 4AHTA 2GFUA 4B9MA 3HPHA 1JXEA 3CM5A 4EP4A 5J2QA 4FJNA 3L42A 3META 1A5VA 3OY9A 1QE1A 2YNHA 3AO5A 5HRRA 4FM1A 3VQ9A 1TK0A 4J2DA 2D5RA 4CF2A 2P5OA 3NTHA 3AVGA 3E9FA 1WJSA 3AO2A 3K5LA 4OJRA 2XHBA 3QLHA 3PO5A 1JLBA 2JGUA 3U3GA 5J1EA 1BI4A 4DMNA 4YNQA 5C42A 2VWJA 3LLRA 4B9XA 5J2MA 3TAQA 1NK7A 1XC9A 4CJPA 3U6FA 3FEOA 1D8YA 3CYMA 1S6QA 4NS5A 4BDYA 4B9LA 4CEQA 4C8MA 3VQDA 3AVLA 1S1XA 1U4BA 4Q5VA 4ZTFA 4A4GA 3SYZA 2HHQA 4QVZA 4Z4CA 4X34A 3TI0A 1EP4A 4IUPA 2FBTA 3AA3A 2YKMA 4NYNA 3PX6A 1SKSA 3DLBA 3PX0A 2OZSA 5DK5A 2G8VA 1HNVA 2L8DA 3ZEHA
chains in the Genus database with same CATH superfamily
1RTIA 1PJRA 3QYGB 2IA2A 2YUSA 3CMET 5E41A 2L3SA 4CGGA 5EYRA 2P4WA 4JI0K 2YHBA 4B1RA 4Z6YA 4NLCA 3D45A 5LLQA 1XQHA 2P9NB 3WTYC 1C6VA 3JCMP 2JTVA 3QYHB 1IGQA 2KLAA 3G4SI 1IXDA 3RZOJ 4E2FB 1KQSP 1CKBA 1Y71A 5AQSA 4NXMK 2VT3A 4BC5A 3JSOA 4F7ZA 4B3MK 1U9NA 3VWBA 3RKWA 3CMEA 1XC3A 2JZ2A 3LSTA 2VC1A 2E2PA 2EA2A 3A5ZB 2V8IA 3G4ST 2Q0RA 3NGZA 1M30A 3KEYA 2Q2RA 3H3VK 2HEQA 2JA2A 1JHFA 1QSYA 3R6MA 4XTUA 4KHNA 2FQ4A 1VRUA 1Q82R 1O3TA 4RW4A 1NK4A 1K0SA 4C0DB 3CC7I 1S3XA 4BRLA 2IS6A 4FJGA 3G1OA 5GJWB 4B43A 4L0ZB 1KD1R 3K4NA 2HZDA 3GL1A 4J9CA 3VRYA 3KD1E 1SVLA 2DBMA 5D5VB 3QWLA 3LSJA 2BEOA 2VCPA 4DSIA 4IQ4A 3C0CA 1R58A 5FWCA 2EV5A 2XAQA 5GAMf 5CYQA 4WK8F 3VV0A 2P5LC 4PJOA 1DQUA 2X6OA 3DOLA 5B5EC 4C92E 1S7OA 4KIFA 2GXAA 5H1SQ 2ITGA 1FPQA 3WE2A 1M90C 1H9GA 4XLAA 4CFBA 4B9QA 3FM5A 3I4NJ 4DTNA 4DR7K 1FYNA 1BK2A 3HGGA 2KGTA 4BXFA 5J1RA 3TREA 2HAXA 1OVYA 1DKGD 1KAYA 5AZIB 1L5UA 1MBHA 4LK0F 2A05A 2HVIA 3HTSB 2EW3A 5GAOr 2JM9A 3I0RA 2VBYA 3VESA 4W1UA 3S2DJ 3KFWX 1WZOA 1NKBA 1SFEA 5KVRA 2IS4A 1MSEC 4B44A 4IFYA 1NGFA 2YRDA 1P6RA 4DR3K 4NXNK 3KK3A 1DGWY 2DLPA 5KYYA 1EQYA 2L54A 2O8FB 3Q0WA 1YO5C 1ZGJA 2OQGA 5GANg 3VQEA 5JI6A 1YX5A 1Y1VJ 1YW9A 4LE9A 1OKJA 3MPUB 4DQPA 2EB7A 3KTUA 3FXKA 4M73A 1AOYA 1IN8A 3J7YJ 2Z1IA 2LKXA 4JX4A 2FC0A 4OMPA 4KUMA 5CCAA 1JKQC 3EYZA 3WU2C 3DLMA 2GTJA 5GAMh 2ASPA 4EQQA 3JSCA 4OX9K 1T0JA 5DD4A 4JI8K 1QQCA 2NUPB 5JMVA 5HY6A 2RHZA 2ZJRF 1HQEA 4Q47A 1QCFA 2E20A 5A2QZ 3AO3A 3J7YP 4G7ZF 3VS4A 3AA4A 3HFNA 5KYWA 2E2NA 5GANd 2RB6A 4XSXF 3ENOA 2P5GA 3BJOA 2PQ8A 4JKGA 2E12A 2V26A 4XSZF 2EBPA 3RTRA 3AVFA 1X1CA 4CJSA 1TLHB 1LVAA 3BQYA 3KLNA 1DPUA 4B9WA 2H8HA 2HNIA 2O61A 2BY0A 5BRFA 1JUPA 2AO9A 2KZVA 5CHIA 1V5EA 1VOMA 1TWFJ 3JAMO 1IO2A 4MQ9F 3DKMA 4M75C 2VYTA 1YIJQ 4KRFA 4QKUA 3CI5A 1S1UA 1XHXA 4BRKA 3J7ZO 3V8KA 5CO7A 3PFYA 1Y1WJ 3WTSC 1P7IA 4JK7A 2HI3A 4OMMA 3PNWC 3IRQA 4HUEA 3VQ4A 5AQLA 3QIPA 1QZ6A 3UKUB 3H36A 5EEGA 1NJIC 1VQ5Q 1KD1O 1XSVA 3W0LA 2FXAA 2CH4A 5BPNA 1QQMA 3M55A 4LG0B 1Z21A 1TW2A 2E10A 5AQWA 3CMEN 2E6NA 3T5XA 4PJOE 3O5ZA 4KN4X 2OPPA 2BY3A 3LA2A 2VL8A 2ASOA 4OB0B 4MQ3A 2FRWA 4JLIA 2P81A 4H0PA 3IUCA 4JLHA 2BE5F 1CKAA 2JHNA 3OYHA 2ED1A 2WY7Q 1VQKT 3GDQA 3EUAA 1KONA 1VSJA 1OISA 2ZNZA 4E9FA 3VOEA 2PLYA 5FU7B 5EU7A 1QNTA 1U06A 3SMPA 4AUXA 1K78A 2LY1A 2QWWA 4O0JA 2B7EA 4W5TA 1JL1A 2RI2A 1HBXG 2PVOB 1IRGA 3ISPA 1A0NB 2X4JA 3C4SA 1B72B 4LB6B 5FD5A 1GXPA 2LH9A 1W7AA 1XD7A 8AT1B 4D6WA 5L8RE 3LP1A 4BR7A 3N4PA 4Y33A 1RADB 2HMIA 2PG4A 5HLHA 2RE2A 1VQPA 3J81K 1SS6A 2ECZA 4M75E 5BRHA 2QM3A 3WTTC 1YJWT 2H94A 4F04B 3EKSA 1T8IA 1IRXA 4DV4K 3E01A 4XTVA 3ZRGA 4LF7K 1RUWA 4CJRA 4FX4A 3N5BB 4IURA 1TWHJ 4AHTA 1QZZA 2HD0A 1PYVA 4JI4K 3EE9A 2AK5A 2RPNA 3U23A 4HQMA 4OJRA 2DMPA 3OIQA 3BEXA 3FEOA 2LTPA 3M4GA 5H6RA 2NS8A 1GBQA 2FBTA 4NYNA 3DLBA 4M78B 2D0NA 3CF2A 2H6BA 1OPCA 4C92D 3ZEHA 1V55H 4PJOC 5J2NA 1NEBA 3M8PA 1K7AA 3K59A 1BM9A 2XDVA 2KMTA 4ISGA 1YITA 2DTHA 3A2KA 4XU3A 2OZUA 1M4ZA 2NOJB 1IGUA 1IUYA 3HL8A 3BDPA 4YY3K 1HQCA 4FPBA 4F91B 3LZJA 1RAFB 4RCBA 5CIUA 3GNGA 5E1WA 2NUBA 2JSPA 1G3YA 4IOAF 2EX3A 3GFLA 4EFHA 3C7NB 1EA3A 3CWUA 2XDDA 5GAN7 2VOPA 3ZX2A 3A0BC 4OMZA 1L0OC 3VMFB 3G71Q 1UWBA 3O5BA 4M78C 3VYRB 3CXCS 1GLEG 4QT7A 2DXUA 2KTQA 2Y0MA 1NZ9A 3QYEA 1MMNA 3M0QA 4BYYA 5F27A 2ZNYA 3M8JA 2JM8A 3BFMA 5E18F 4PHTX 4WYBA 4FYDA 3SDZA 3JCMh 5KPZA 5LRRA 5HLFA 1DTTA 4A93J 3SWNC 4GFBA 3JCMg 4CC4B 2DMUA 3F5TA 1O4XA 3SI6A 1PRMC 3OIPA 2VXDA 3TKYA 3ZSQA 3G7ZA 4BDPA 4CFCA 3G4SA 1K9MC 4YEJA 3FF5A 5C2FA 2H1LA 1FYLA 2M16A 4U0WA 2QWNA 2RN2A 1I27A 4EW0A 4E0DA 1HNWK 1ENHA 5F08A 2DOEA 4XK4A 3TSZA 2IVWA 2X48A 3LNQA 3TAFA 2VXFA 3SAFA 4JJNK 2R57A 5E1ZB 3JAMZ 1H1VA 3CC2A 1NYFA 4IQJA 4OPHA 1HRHA 2E2IJ 1WXTA 3M53A 2NRHA 3S3MA 1OYWA 2RQQA 4IHVA 3LDSA 3BCBA 4ICLA 3RJPA 1QVFP 3R61A 3UF4A 1TYQA 2OX7A 4QOZB 1VHXA 1NG6A 3KP6A 1BI3A 1CZBA 3MQ0A 1FJGK 4A6DA 2R7SA 4FOIA 2TDXA 3F10A 1XGOA 4J6YA 5L3CA 2DA2A 2A41A 1USSA 5GANe 1N8RU 1ZG1A 1O3SA 1EZZB 3SJMA 3KZZA 1M3BA 3HOVJ 1SD7A 2DBKA 1C0UA 2DW4A 4KAZA 1R6RA 2KEAA 4CF9A 3RQ4A 3IFRA 3VF2A 1SD6A 2G0EA 5IHNA 2X3XD 2ZMEA 2QWOA 1H3HA 3JCMJ 1UMQA 3J7AO 3HI0A 1VQMN 2XIDA 1KQ9A 1C1CA 1WOQA 2HKNA 5HDNA 1EV7A 3SZ2A 1LJ9A 2DVEA 2RHXA 2YNFA 1JKOC 3M4YA 5BNGA 2IGOA 1ZHFA 4ELYC 1OKRA 2DILA 5CKBA 3GCMA 3HG9A 2JNGA 4ZNXA 1HDDC 4JYAK 2E1MC 2JMWA 3CEYA 3CUQC 1QZ5A 4KRTA 5D5XB 2F96A 1NKUA 4IEJA 1M90R 2G8KA 2BBYA 2OPRA 4KV8A 5M1QA 4D8KA 1W7PD 1TWBA 2LY2A 5AQYA 2FOKA 2DIGA 4CI6A 1FMKA 1I1GA 3PFIA 1ABQA 3RMDA 1EH7A 4LD0A 3EQLF 4H0VB 5CHZA 1NM7A 2RQVA 2PUKB 1YJ9Q 3ZMZA 2Z1JA 4YHHK 3L8BA 2FZGB 3MEEA 4M75D 5J4VA 4IRIA 3BF3A 1IV6A 2LQ8A 4DR2K 1S72T 3CTAA 4BB7A 1N9SA 3ABTA 2EFNA 2XGDA 9ATCB 3TARA 1X2NA 4ZGDB 2CG4A 4NC8A 4X9DA 4ELVA 4M72A 4FWRA 3V1OA 1TU0B 1K1ZA 2Q8KA 3GTKJ 1JUSA 1ZQ3P 3VOVA 3DU5A 3L1PA 3U3YA 2DYRH 3L2QA 1WI9A 4FM2A 4LSNA 3IH2A 1Z9CA 3D5SC 3MZYA 1YJNA 2LCSA 4J9HA 3ZT1A 1M5Q1 2X4XA 4B9SA 4H5VA 2GQVA 4EHUA 2VQLA 2N8GA 2GNCA 4HTLA 2QKLB 4EPCA 5SZTA 2ZPHB 2XMFA 4IG3A 1GL5A 3DM2A 4A69C 5HP1A 1E3MA 2JPCA 4RW9A 4QS8A 4M3RA 1VQKA 1E4FT 2VE8A 1WQ2A 2F48A 1VUBA 3A8YA 4M6YA 1OYXA 2V1UA 2O88A 2V1XA 4BRFA 5EY4A 5CY4A 2E6LA 3O8GA 2X78A 2EYXA 1JLFA 3DTEA 4G12A 5LBQA 2A5XA 3A2FA 3S15J 2I5WA 4Q48A 4BRHA 3SBTA 2TRTA 4GRIA 2K6DA 4UXNA 3QBXA 2QBYA 2WA0A 2JWTA 1ETQA 4RW8A 2JTEA 5AZJB 3ZCMA 3NRVA 3BR5A 4XLPF 4CFDA 3OQ5A 3HTUA 1MUZA 1VQ5I 4A4FA 3OYBA 1WHMA 2ETHA 1NMDA 3CCLN 1R0CB 3S32A 4ITVA 4OMYA 2B9SA 3SAGA 3MVPA 1X75C 4AYBN 3HPHA 3L42A 3META 5HRRA 5KQDA 4AU7A 3EFOB 2D1VA 1PHTA 4BQAA 4L5IA 3ASOH 2XHBA 4X0GA 1XC9A 4UB6C 4CA0A 1XGMA 1LNWA 1KEAA 3AVLA 3VGLA 3D4VA 4IUPA 5DK5A 2G8VA 5JFRA 3LDQA 1T3LA 1Y8RB 1LAWA 3PNVA 3ZT0A 3QFUA 2V8KA 2FF4A 5LJ3e 1U2WA 4L8RB 4OGEA 4CHUA 3VUZA 3PX4A 3F23A 3EE8A 4IOAL 3R6NA 3IDHA 4AIHA 1TL3A 2HHTA 3TSQA 1YX3A 2BTTA 2L9NA 3H46O 1WHHA 2DFIA 3BTLA 3THKA 1C1BA 1RBTA 1ZXOA 3T1YK 3EKUA 4DTSA 3M54A 1ZG5A 4M77G 2LKSA 4CEEA 3T8TA 2HHSA 1AU7A 2M0OA 2BE7D 3ZX0A 1RAIB 1H89C 1I0CA 3IHUA 5HLIA 2VC0A 2WV0A 2OC6A 3CC4T 3VJPA 4BR4A 5IP6A 3CCEN 2G8HA 1BA1A 1ITGA 1RDDA 5GAHJ 4DFKA 2FG0A 4FJMA 5TRDA 1N34K 2G6FX 3FMRA 4OLBA 2E64A 2XK0A 1HK9A 4M77F 5GAMd 4CZJA 4DK9A 4C5GA 3SWNB 3O3KA 1KSWA 1N8RC 1BC7C 2XO7A 3DEWA 1LCKA 4N4GA 4EMGA 4M78F 1MIJA 1D09B 3JCUC 2XF5A 2EQKA 2Z1HA 2WAFA 4LD6A 3EGXB 5E26A 2P0PA 1ZBFA 1MMDA 3NBPA 2HXIA 3A0HC 3EUHA 4JK9A 1QMCA 2XGCA 3IUOA 5LD2C 2EGCA 4GBQA 2LBFB 1VQ6N 3WTUC 3K6GA 1KA8A 2DOAA 3GPLA 2UYTA 5GAEP 3CLQA 1KU2A 3LWIA 3RQIA 5GAN8 4BD3A 2FF6A 1D4XA 1IC8A 3TO7A 1KGSA 1PP8F 4BG8A 3CPFA 4C9YA 1PSEA 4RGXA 1GUUA 3EUKL 2ZFWA 3CCEA 3N0UA 3QYFA 1VTNC 4EJUA 3EETA 2HVQA 4RAYA 1ACMB 3F9KA 1FK9A 4HTUA 4LLLA 2BXZA 5D6EA 4XRSG 2ZJPL 4FLWA 4RTXA 4H5WA 2QWLA 2CU7A 3OYLA 4A61A 2CUEA 2O8CA 2XB0X 4DFPA 5EG2A 3BG9A 5CAIA 4DQRA 5I2MA 5LY3A 1ORKA 2K3XA 3RMAA 2QK0A 1ORPA 3M57A 5HLTA 1GV2A 2ZO4A 3CCMT 5HBMA 4QVCA 3CCVT 3BG6A 3HSRA 4JS5A 1ASUA 3LAPA 3B6CA 2MWOA 5EXWA 4UUTA 1CSKA 1X6OA 4KBMB 4GKJK 3MP1A 3H5AA 4CJUA 2ZKZA 4E6KG 1Q95G 3TAMA 3CQ8A 2QA4A 1RZ4A 4V19S 1MJBA 1YIOA 2K9LA 2HOAA 3J7AF 3MKLA 1X43A 1BCMA 4M7DC 4PSWA 3RMSA 3IWZA 3G71A 1W0HA 3CD6T 1QHHD 1KVAA 2HPMA 3KLEA 4FLVA 3KYCB 1LB2A 4IHTA 1U5TC 2WUSA 1WH7A 4JRPA 3NDKA 3QEVA 5EGOA 3ZETB 1QVUA 4A6EA 2QAZA 2RQTA 3OMGA 4LSLA 2LOOA 4LMYA 5E3MA 2RNJA 5ADXH 4HF1A 2C6YA 4HX4A 2BDPA 2KQ2A 3QOPA 1YJNQ 1K8AC 2DJNA 4RB2C 1RAEB 3S93A 3ATUA 4RTUA 2HDDA 4BY6C 3HYIA 5I21A 3V81A 1UFFA 4JI7K 2R5YB 3BTIA 3TOAA 2GTOA 2XICA 2ZPEB 3A8LB 4KT0E 1YI2Q 2ZJPF 3ME9A 1QVGP 4NC7A 3I56I 2XY8A 2XGEA 5GAN6 4BR5A 5FLVA 3CCLI 4HCCA 3FZVA 1VQLA 2F1LA 2DXCA 5C0MA 2JJ9A 4FJ5A 3JRCA 5HDGA 5E3OA 1ETVA 4DNCA 1UGRB 4AT1B 2XPVA 2V9KA 3SFIA 1Q81O 2BGCA 3F2KA 2IS2A 1W7PB 3VQ6A 1SFOJ 3CCVI 3MCZA 2ZAEA 3CCUA 3VS2A 2I5JA 3CVTA 4CZEA 1U48A 2XDBA 3OJUA 2V9PA 4XTZA 2KJCA 4HNVA 2ZMEB 4F9OA 3DI6A 1N32K 3VQQA 2KP6A 4F92B 2V7FA 2DFEA 3VEOA 3I8DA 1ABOA 4HDVA 1RILA 4CEFA 1OPKA 3O6BB 3WGHA 2PJPA 3WXIA 2P84A 4BJ5C 1KFDA 1VSKA 2HBKA 2WC2A 2G3RA 4IVNA 2FHDA 1GLLO 5E8GA 3LFUA 4RM3A 1VIEA 2P4TA 4E7SA 4DUZK 4IDHA 2HHHK 2W6LA 1BQNA 1TAQA 4R56A 2EQIA 4K42A 1Q82O 2IIMA 3CMAN 2HQEA 3DFGA 4DZJA 5DCFA 3EGDB 1K78B 3AT1B 4FYYB 1X19A 2ZM6K 3H0FA 2QDLA 4M63C 2G9WA 2EKHA 4D5CA 4CF8A 3F3XA 5K5OA 2DZCA 1HX1A 4C8QG 3NMUA 1D0YA 1XGNA 3QIIA 1P8ZA 3M1CA 4LD9K 3CM5A 2YNHA 2XB5A 2R7UA 2Q0UA 1J75A 3E9FA 3AO2A 4PJOD 1Z91A 1M9SA 3CMAT 1LOTB 2M8EA 1Y56A 2L3DA 3EG0A 5J8CA 1W2BA 4BNCA 1BIAA 1HNVA 2LVSA 2L8DA 5B1BH 2C06A 2LTOA 1A5WA 1VQKI 3BT9A 3D5LA 1KSPA 4FM4B 1YS6A 4XLEA 1KK7A 1VA7A 4K0KK 3MEDA 2KDOA 3CPWP 1LW2A 1B9MA 3I56N 4C2TA 4IUVA 2OANA 2DA7A 3L4IA 3O3GA 1S22A 1NBEB 1QBJA 4I2QA 1WJBA 1AWJA 1LV5A 3EG1A 4EDUA 3ZSVA 4CBUA 1IXSB 4OVAA 1R1TA 3GOXA 5AQPA 3T3FA 1OULA 3CPEA 2L2OA 2NOEA 4Y91A 1RT3A 3P9KA 4A3JJ 3QZ9B 5JHUA 3CCQA 1XPXA 1TL8A 2JZYA 3O1WA 4GV9A 3REBB 4WQ5A 2CDTA 4CGIA 3M9AA 3CCLQ 2X9DA 4F2SA 5CR2A 5IP7J 2UXXA 1PU8A 2DKGA 1E6GA 1IKYA 2JT1A 5IXBA 3I55I 2B86A 2MD5A 3BJ6A 3LFKA 3JTHA 3TU4K 3I54A 1L3VA 3SXYA 3CC4A 3B6OA 4PL7A 4C5EA 1W5SA 5KH6A 2RNGA 3RKXA 1J3TA 3HOYJ 2GA1A 3DKYA 2YCHA 1UE9A 3EFSA 4MFBA 1BR2A 3V9WA 3KP7A 4BUPA 1QVFA 3PLAA 2L4AA 1SMYF 4LB5A 1Z7UA 1E6HA 6PAXA 4X1EA 2L7FP 4JI6K 1J5OA 2D8HA 1ZSZC 4WTOB 1GDTA 4PSXA 3UPUA 2VASA 3MKZA 3OBWA 3A98A 4LF9K 4Q5SF 3BY5A 1B9DA 4FWKA 2GBZA 2IBDA 5ICGA 3KWGA 2ZQBA 3DP7A 3W2VA 3HKSA 1P92A 1BOAA 2EYYA 2MF2A 2R5MA 2X6YA 4RA2A 4XONA 4IDKA 3ZGKA 4LLNA 3KIOA 1FLIA 2VUBA 4C92B 2O8XA 2A5YB 1NGNA 1G5VA 4KHUA 1J7KA 3Q0UA 1ETXA 1BC8C 4I7FA 4FYXB 3CCMN 1YITT 5KAIC 4M7DB 3LH5A 5IOZA 7AT1B 1MDUB 3HTRA 1HYZA 1HKSA 2D0AA 1FJLA 1M90U 2YHXA 2DE0X 5F1RA 3HXLA 1WSFA 1DIZA 1GCQC 2O7OA 4L59A 3OYJA 2R5ZA 1OX9A 4CESA 1K9MU 4FZYA 1IN7A 5DYMA 4E7IA 4HBLA 4ATOA 3FLCO 3FKIJ 3C94A 2X51A 4LDXA 2FUG2 2RNAA 1JLQA 2ROTA 3KETA 4CD3A 3PQKA 1ZELA 4A2BA 1NLVA 2QG9B 1LWYA 5F04A 3CMEQ 1BJZA 2GCXA 2X9HA 4C92A 2OTJT 3L9FA 3O4QA 4LH5A 1WI7A 4E7HA 1BISA 3JB9D 2QEXN 1NJYA 1Q8IA 4BY7J 4Y17A 2COYA 3AVNA 1ZLMA 1KC8R 3HSCA 1MH3A 2K9NA 2KZMA 1N3AA 3L4QA 2HBJA 5F2RA 2X6WA 1FTZA 4BRNA 1H3ZA 2FJ1A 4W97A 1FIAA 2DA5A 3EYIA 3H9NA 4TVRA 5FWBA 1YQRA 3PUFA 2JG6A 1JJ2S 4J9IA 3SYTA 4C2UA 3V9UA 2R58A 1GOAA 2HSEB 4ILJA 3G4SQ 6AT1B 1WBBA 2NOLA 2CUFA 2Y1IA 2LKPA 4B22A 3RRHA 2MAMA 2FXUA 4CUGA 4FWLA 1LVKA 4HW0A 5JVHL 1ZLKA 4AM6A 3UT1A 4BGAA 3JW4A 3CC4N 2P9PA 2E34A 5J1YA 5DTDA 3DLKA 2L5QA 1M2OA 5B66C 4FJKA 4RMNA 2HBLA 2HYFA 1ARKA 3CP2A 4MQVA 3TTCA 2FQ3A 2HZTA 3M1FA 3R60A 2GFAA 5L3EA 5LL6Z 1MH4A 3GUDA 3VKIA 1QSSA 1TUYA 4FJHA 1FIPA 3HSEA 2IJLA 1D5VA 4W5RA 2W42A 1JEGA 4KICA 1Q7YC 4KT5C 3AAQA 3MX5A 1X3UA 1W5CC 2WAEA 4PQUA 1B4AA 3QIOA 1FNNA 2AQEA 1VQLT 1BBZA 4E89A 2OPTA 3FDRA 2DL7A 2BIVA 2P9UA 2E5ZA 3GVAA 4YDUA 2O01E 3TPQA 3VN5A 1LAVA 1P7MA 1KLMA 1Y64A 2Q36A 3TO6A 3OYNA 3KJVA 3CERA 2NOFA 4XRFA 1VQLN 2Z1GA 1P4AA 1VQLI 3U9GA 5T7BA 1SAXA 4OFEA 3MFKA 4LITA 5ICCA 4M78G 3KVGA 2Q97A 1T6DA 2KIMA 2CW0F 2I0NA 4U67L 4UHTA 2O9LA 4Z89A 4DW6A 5CZ1A 4P55A 1K0XA 3R9PA 1WEGA 1ZK8A 3QPSA 2DBBA 3CCVA 5HS9A 4E1JA 3IKTA 4QPQA 4CHZA 1WBDA 4N0BA 4N4NB 2LT4A 2GIVA 2MK5A 1U5TB 1NGBA 2RHIA 1F5TA 2YHYA 1BOBA 4NOYA 3CMEI 3X26B 5FJ8J 3CCEQ 5AQVA 2LNBA 3C2GA 9ANTA 1T08B 3RESA 1FX7A 2OTLI 3CCJA 4ISFA 3R8EA 5J1EA 2M4GA 3MD2A 4B9XA 1QVGM 4M77C 1WUAA 3P38A 4LDUA 3AKZA 2JS0A 3HSBA 1BBYA 4BDYA 4XU0A 2L3QA 3TI0A 2F5CA 5FKMA 3IC7A 3FK7A 2EQRA 2LD5A 3ZMSA 5FU6C 4FE4A 2FSNA 2D1KA 5D6FA 1Q81U 2JT4A 1G15A 3EFOA 2MSYA 2VYPA 3CMMA 5GTIC 3CZ6A 4N9IA 1T98A 1SUQA 1M1FA 1HPZA 1SPKA 3QO9A 1K73U 1W7PA 4M78D 3CUQB 1RETA 4D0PA 3P9CA 4JKBA 1W6XA 4JKFA 4WFNL 4BHCA 5GAEJ 3KZIC 5AQOA 1SF9A 3VGMA 1RKWA 2KPMA 1B3QA 4R5PA 3ESWB 3W3DA 1AKHB 4RTYA 3M5AA 3P83D 1N39A 4AQYK 2R7YA 4Y52J 1OCTC 4DEXA 2ZWHA 3TANA 2Q2EB 3THWA 2HHUA 1YI2A 5FB2A 3E9LA 1LPQA 2WSEE 2KZGA 4HVVA 3AA5X 2ZPIB 4EP5A 3KKRA 1ZC6A 1JXSA 1XMQK 1WKMA 1QVFM 2VWKA 5M5YJ 1M90O 4BHPA 5EEAA 4JI1K 2BHZA 2P5KA 4DLEA 4BL0B 3PNYA 4J8FA 4MGRA 4M3DA 2FL7A 2ELKA 5FU7C 2QXLA 2BOLA 3MAQA 5M3MJ 2P1JA 5HRPA 1RRSA 4ZHRA 2BY2A 2GWRA 2K3YA 3LM2A 1K8AO 3TW6A 1X01A 2GZWA 2HB5A 4CZFA 1WHGA 1BL0A 3CCMI 3F6OA 1J59A 2RI5A 2M0CA 4HF2A 4I99C 1RUNA 4DBFA 2GF7A 3Q9VA 1GLDG 2H27A 4AHRA 3K1NA 3FHZA 4Z94A 3FZMA 1XHZA 4IWVA 1NOZA 4R8HA 2R93J 2RPIA 3LDPA 3JB9H 3CCUQ 3G10A 4IFVA 1LW0A 3EGDA 4CJFA 2KROA 4CD1A 4N5SA 1WHJA 3KD5E 2KXDA 1BYMA 2VC8A 3OYEA 4RB3C 3WEEB 3LYIA 2FNPA 4GV3A 1WHLA 4CJLA 1NGEA 1I81A 2VJIA 4J2BA 2IPOB 3NAEA 3R0JA 4DQIA 3OYIA 3BR0A 1VQ7T 3TAPA 2DO7A 1K4US 2O8BA 5KYXB 3VS7A 4L0YB 1VQON 1QPMA 4CIGA 4DYCA 3COAC 3EN9A 2BXYA 3EG3A 2JN0A 4YIFA 2F4IA 3K69A 3FFIA 2DO3A 4QW2A 3EGUA 5DUIA 3DAWA 4QSHA 3QU6A 5F6FA 3D6RA 3CUQA 4G6QA 2Z0WA 1PU6A 3TQ7P 4ZN3A 3KZBA 1XJWB 2HW3A 3S1NJ 3IH3A 1R36A 4BBRJ 3H3UA 3JCMc 5J39A 3DOKA 2F5VA 1ETOA 1V4SA 1VQ6Q 3SQ2A 4DJAA 5GMKl 1NGJA 3ASMA 3CCQT 4M4ZA 4HXJA 2IC3A 3PL8A 4XU2A 2RK2A 3LAJA 3QFPA 4KHPK 1ATSA 3BLYA 1ZN2A 1UECA 4OMOA 3T7ZA 4BRIA 2M1BA 1NGIA 3GZNB 4F93B 3ASKA 2WSCE 1GLJO 1ZYQA 2YPRA 2BANA 3RYPA 4B4CA 4II1A 3CCLA 3LA3A 1EFNA 3M07A 2BZXA 3RKQA 4CJ7A 3VSLA 1WPYA 3ABMH 2FZKB 4IX7A 5AZJA 3PIPL 1W97L 1T56A 4EMHA 4YELA 3NARA 4E6RA 1IF1A 2HQRA 3FXRA 1KQ2A 4O0IA 5BPLA 3JCMb 3SV4A 5AQGA 1R23A 3DJCA 3UB5A 2M5WA 3J7AP 1WJAA 3E0JB 3ZQGA 4PJ0C 5GAGP 3P8BB 4M75B 1I39A 3JREA 4YFKF 1KYZA 1AT1B 3UA7A 1T95A 3O9RA 1WJFA 4ZDLA 5KI6A 4A3BJ 4IUQA 2KYBA 4JK1X 2W6KA 1ILYA 5F0FA 3CMAI 2W00A 5GINA 1WHUA 5FROA 2DY4A 1AWCA 3ZLJA 5GP9A 4M7AB 2V1RA 2JXBA 2YG8A 1RDAA 4F8RA 1UG2A 2ZSHB 4M7DF 4KH4A 2CGLA 3TDUC 2KFDA 3V8LA 4ON0A 1BQMA 2A1SA 2ABLA 1CXQA 5AFUA 2O8DB 3A5NC 1GLCG 2XAFA 1I1JA 1KD1U 1B6AA 4LLGF 4IFEA 4FYVB 4CXFA 5BRDA 2D1HA 2E65A 3V8JA 2K86A 2DA6A 5K7FA 2RKHA 4MDBA 3CD6Q 2L0KA 1SFXA 4LUEA 1RIOH 3THWB 3VB2A 2K40A 2PX9A 3GBGA 4GY5A 2F5EA 2E1ZA 4NLBA 2OAZA 4Z88A 2KKOA 1E3PA 1PD0A 2A6HF 1YVNA 1D0ZA 2HTSA 3MECA 1S1WA 1QO0D 1B8IB 2L7KA 3FISA 3OSGA 1IBKK 4D8DA 2LRDA 3WVEB 3A8OB 1PVSA 4B9MA 2CRGA 1QVFS 3SK3A 1QE1A 2EPFA 3JRIA 4HCKA 1KQ1A 4LC9B 3K4MA 1DEJA 1BI4A 3LLRA 4FWSA 1ZH5A 2XIGA 4XIDA 4IEEA 3SYZA 2EA4A 2CZ7B 5IOYA 1D1CA 1I3QJ 3PX6A 1YHQN 2OZ6A 2D5VA 1I4K1 1KFSA 2FYKA 3K9KA 1VQNQ 1GLNA 2JA8J 2DLLA 2YUPA 1NKEA 3DXKA 4DTOA 4X64K 5KGXA 4ENMA 3I3LA 1A36A 4C23A 2O4XA 3S3NA 2BHYA 2DCEA 1QVGS 2AXTC 5DM7L 1OH6A 2O31A 5DLOA 1YJ9T 2K9SA 3CC4I 2D9TA 2JQ7A 3FDYA 3ENBA 4BE2A 1NG9A 1YIJI 4CJVA 1VSLA 2B63J 4EZ9A 3QICA 4RDUA 2KNBB 1HQUA 5KHDA 4HV6A 2CH0A 2M0MA 4ABZA 2YUNA 1WN7A 4H0TB 5B3SH 4BVPA 1U84A 1MZBA 4LN2A 2UV1A 3RMQA 4U87A 2NWMA 2OZMA 3CXCA 4G94A 4GGGA 2RC4A 4JRIA 5GAN4 1T6SA 1I3AA 2NNNA 1JQQA 2IPQX 4WQ4C 2PTKA 3CC2Q 2IVNA 4X6AJ 2UWMA 2WONA 5EC7A 3QODA 4A5MA 1EJ9A 5LJ5h 3KEOA 1WZ2A 2I10A 3WE3A 4KB1A 4CEAA 1QVPA 1BO5O 2H3EB 2L7MP 4JZ4A 5LJ5g 1ETKA 2OCEA 2F7TA 3QNNA 4PLIA 5GADJ 1MBKA 2DT5A 3U1DA 1HKTA 3JB9F 1MBEA 5DV5A 2E2JJ 2DEUA 3QNOA 4JLGA 3E3VA 1XNRK 3ZX3A 1CF7A 3KK7A 2Y69H 3WG9A 3LSPA 4KUIA 3U4LA 5AIQA 2ZMEC 2B6AA 4LG0A 4XMYA 3C95A 1Q1HA 2ZJQF 2DX1A 5I2SA 2FEIA 3LSHA 1K8AU 3ZSYA 2M7AA 3THXA 5FRNA 1ZR2A 2X35A 4YDUC 4CDGA 3E5XA 4E7ZA 2ZCWA 5L3DA 4ZDOA 5FKLA 1LWFA 3I0XA 1W5TA 1G83A 1FXXA 5H2FC 2E35A 4Q5WA 1TG0A 1V4RA 4IHXA 4LNPA 3MZHA 2O8CB 1ZBIA 2I7NA 1NNEA 3VS3A 3VPRA 3VQ5A 3EDPA 3AG2H 4WXCA 3RRGA 2FPDA 2GEMA 4AD9A 5GTHC 5LHIA 2XPWA 1ZBLA 5JLHA 2YUOA 3P8DA 2NUTB 1J09A 2BZTA 4FCYA 3P7NA 1HYVA 2DA3A 4PGGA 2HPIA 1MNEA 2HVSA 2VQCA 3HPWA 3Q0VA 2KRMA 3VYTB 3PMTA 2LF8A 1MGTA 5MLCQ 3B6AA 1OI1A 1NJIU 4OOIA 1P7JA 2X1CA 2X6XA 2W7NA 5BS6A 3MXJA 2PVGB 2Y1JA 1O7FA 1TWAJ 4CEOA 4C3JJ 4A57A 2HKQB 1YITN 3SHFA 4A3DJ 4DOZA 4YOXA 2EQUA 1B9NA 1ASWA 1UELB 3EO3A 4FASD 2DL4A 1WYXA 2FMYA 3L2ZA 1YIJN 3CC7N 2RVCA 3IRXA 3WT0A 1ZA2B 4XAXB 3I9V2 4MLOA 1GLBG 4O5FA 4HCBA 2R5ZB 2AHQA 1UDLA 4DV7K 1M27C 3S1MJ 1PC0A 1X3ZB 4CYCB 2QCOA 2CMPA 3CC7T 4DTXA 2QQRA 1YJ9N 4DU3A 3O9QA 5GPAA 1M8VA 2I2LA 2FZCB 2FOWA 5DY9A 1OVQA 3NTIA 3JAMK 4BY1J 2QK9A 2DOFA 4FT2A 4CCHA 3NFAA 3V42A 1YHQQ 3QPTA 4M9SA 4QS9A 1NJXA 5KGWA 5KRTA 5GIPA 1SRMA 3G1LA 4WF2A 4FJ8A 2DA1A 4P96A 1IKXA 3D0PA 2CP7A 2VVKA 5F0XA 1Q18A 4II3A 3UKRA 3QDKA 3G6ET 4KGVB 2ED0A 4C0FA 2DMNA 3SMSA 3WVDB 1MKMA 3KXTA 5M1OA 2HWVA 1MUNA 1BR1A 5KK1A 3RZDJ 3U21A 4O6JA 5CZ2A 3SJHA 5FD6A 3QEIA 2VLAA 2EIJH 3PSFA 3UKGA 1KLNA 1M8MA 3THYA 1NE8A 2JN6A 3FXOA 2BUPA 4I0AA 1JBMA 4KGZB 4CJWA 3HSTB 3C12A 1W0TA 3SWNA 4FETA 1DUXC 1MSFC 5FPMA 3A1YA 4CC3A 1C0FA 1F4KA 4Y4RA 4FW1A 3CO6C 4B1VA 1TWCJ 4DG1A 4UUSA 5AFUH 2DIQA 4NC6A 3U2RA 2JVVA 3KZYA 3SJJA 1X4PA 1IJWC 5KYUB 3UA6A 4P5NA 1YN8A 1VQ4Q 5K14A 2D6FA 2CV1A 1OZ3A 2E5QA 3VQ8A 1PD1A 1U9OA 1FOYA 1XMKA 1V5FA 4RTZA 2A07F 1WCMJ 1VRLA 4A53A 5CQXA 4C1NI 1CZ9A 4DSJA 3MCAB 1U5TA 1D5AA 4OAYA 4LGWA 2KIFA 2CFXA 4XORA 1Y0MA 2PAVA 3BGRA 2HBMA 3J81Z 2DQRA 4KO0A 2K3BA 2GFUA 1HOMA 2YT6A 2CZ0B 3JRDA 2XHIA 3GF5A 3REAB 2E1CA 1OOTA 2IRFG 3QLHA 5LJWA 1FY7A 3U3GA 4YNQA 4DBQA 2QBYB 3TAQA 3QP5A 3X24B 3WQTA 2Y90A 1SZ2A 3I56T 2CQ7A 3TEEA 3M0PA 1DJ7B 1HA8A 2DL3A 1W0UA 4EZ6A 2OU2A 2NOBA 2UXNA 3LANA 2EIKH 3H41A 4BQZA 4EGYA 3E66A 4BRGA 3S8PA 4EMSA 2XHCA 3EHQA 1R9TJ 4ZZLA 5JLWA 3DB4A 1WNLA 5IT9E 2FU4A 3TSUA 4FU6A 2X4HA 2VOOA 4LUDA 3CM6A 4BBSJ 2JUFA 3IH4A 1X1DA 4IUUA 2G7HA 4TSXA 4NQWA 1I5LA 2F5FA 1S5JA 1V3FA 2BW3A 2XDPA 3RWUA 5DM7R 4B9NA 2D0CA 3TU5A 1IRZA 2YRVA 3OVNA 1XNQK 5DMRA 4ZZDA 3K1PA 3DU6A 2XI9A 4F7UG 5E3LA 1D1AA 1RBUA 3QMLA 3WXKA 3L7WA 1J9IA 4RMOA 4AFQC 3JB9J 4FOEA 2V9VA 3O3FA 1Y96B 4BR0A 3ALYA 1VF9A 2ETJA 1NK9A 2IS1A 4HVWA 4QWQA 3DXMB 5HVQC 1VI0A 3KWIA 1VQMI 1MV3A 2E88A 3ZSRA 4M7XA 3VQAA 4LF5K 1YJWQ 4X66K 1X27A 1OFCX 4ZC3A 1VQNI 1YQKA 4AH9A 1VQOI 2JSCA 3ECHA 3GNFB 4CF1A 1OCZH 3CCET 5IHIA 4KULA 1RAAB 4G7HF 1MV0B 3TGNA 2HMAA 2CP5A 4E7KA 3VS6A 1NK6A 1LEBA 4C0ZA 3CWAA 4H0YB 2IT0A 1TGOA 2RHYA 3LPUA 5KYUA 1V5GA 1V54H 5K5RA 4OMQA 1FKPA 4ANJA 1VQ7N 4CK2A 2MIOA 2B8AA 1FBQA 1HD3A 3V9ZA 5KYYB 2K3PA 4DR5K 4YOQA 2HF3A 2ZE2A 2VQGA 5J3LA 4M6XA 3DWLA 4M78E 3PNTA 5AQNA 4PA1A 3L2WA 2E1MB 1VRTA 4XQFA 3OYMA 2CUDA 1VQ9A 3ID6A 1SFKA 5CVRA 4JV5K 1VAZA 3G71I 3S2HJ 1N6QA 4DQ2A 5AQTA 4BRPA 4HSTA 4HQEA 4NB4A 1YRNB 3JRAA 1ZSZA 4AFUC 2WOMA 4B9VA 1R00A 1W1FA 4PKIA 2R7FA 5EGOB 1ZBSA 3I0TA 2YWWA 1WGXA 2FVUA 2CGPA 1TUUA 4EATA 2VG7A 3Q7CA 5GMKe 2BE9B 4JKHA 5AR0A 2RKIA 2OPSA 3NGYA 4H4MA 1A31A 3TP3A 2LT1A 4YIRX 2KIUA 3CF5F 3DLRA 1VSDA 4MLEA 1MWKA 4XH4A 4B1WB 4WE1A 1SV5A 2K5LA 5JLXA 4JD2A 4PWDA 2XGXA 4KMFA 1VQ9T 2JA6J 3SPYA 4K11A 2IDOA 1T0FC 3LSRA 4EMKA 1S6PA 1EX4A 2ZC2A 1L3TA 1ZGAA 1ZSGA 1BA5A 5C10A 3P4IA 3FMQA 2IS3A 3DLLA 2GAUA 3H6EA 4F55A 1S1NA 2OAWA 4GNIA 2XF6A 4NO7A 3ITHA 1Y7XA 2V52B 3CCJT 1J5YA 3MN6A 2MW8A 1Q7YR 4CE9A 1HF0A 4BXXJ 3B8AX 2D8JA 1EH6A 2WTUA 1D5YA 1TC3C 2MWPA 1CXUA 4CHQA 4Y7NJ 4PK4A 3BJAA 3ZSWA 4F14A 2EK5A 3ML6A 3MEUA 4PNOA 1N3CA 2ZGZA 4NYFA 3LWHA 1Q86C 1PSFA 5KRSA 4M9XA 4XBFA 2KISA 3GTLJ 4M45A 2JUGA 3BZ6A 2RHUA 4KH5A 2EFPA 1N36K 2AKLA 2KFNA 1N25A 2WTEA 2YJEA 2UUAK 1Z1DA 5H6QA 2EWSA 3CCUT 3F0ZA 1MNMC 3ZL7C 2AIRB 4BE0A 1HJOA 1MBFA 4I9QA 3FBNB 4UVBA 1BWFO 3DQVC 3CJCA 2E6MA 2YNIA 4J83A 4E7JA 3OL4A 5KNLA 1IN5A 2PBDA 3V1RA 2QWPA 1VIFA 3HHGA 2NOZA 2E41A 2E2HJ 4PKGA 5A0DA 5EVZA 5E79C 2NRZA 2OTLT 4DV2K 3H92A 4K8ZA 2QVOA 1FT9A 3CQYA 3ZSOA 3HP6A 1UA0A 1Q81C 5D4RA 2PYLA 2ACJA 3DTKA 3BR6A 2NOGA 3G6EA 1XQOA 3OW2A 3WTZA 1ACIA 3VA3A 3UR3C 3VEYA 1QZEA 3ULRB 1V4TA 1D3BB 4M77B 1UOCA 3WTWC 3AG4H 2MC3A 2JPBA 3NF9A 1D9DA 1JLGA 5KE2A 1WPKA 5GAOp 4JHDB 2LQWA 1Y0UA 3Q9SA 4JHDA 1GRIA 5D8LB 1P2FA 4DF8A 1NKCA 4E9GA 2NVUB 4KPYA 2QWQA 1WJRA 1JGGA 1XMXA 1RLQC 2DPDA 1OCCH 3VODA 3ZMUA 3W3CA 1OR7A 5LHHA 1ZBUA 1KG3A 3K0SA 2DK8A 4FQGA 3F70A 1NOYA 1U3EM 5BN8A 1D0XA 4JQFA 1TUGB 2NVXJ 2K9QA 2R5AA 1HNIA 2VPRA 2GQQA 2ZF5O 1OYIA 1R0BG 3BG7A 2E60A 3TEDA 2KRFA 1AVZC 1ERDA 2E1NA 2VUMJ 1UA1A 4LDWA 2G7UA 3F73A 4A3IJ 2R0QC 3ZSXA 1D9FA 3NTKA 2YHTA 4C30A 3OY9A 2LJ1A 3AO5A 4J2DA 3VQ9A 2I8DA 2XAGA 3K5LA 3JAME 1QLYA 3U6FA 4NNJA 3CP8A 1S1XA 3CC7A 2RH2A 3U9DA 3L00A 1SMTA 5AQZA 1HW2A 2R5YA 4EA4A 3AVBA 1H88C 4ME7A 2D1XA 4JRQA 4EM0B 4EJVA 3BUZB 1KQ0A 3HGYA 1GFCA 3I8BA 2YX4A 4XK8E 4RCCA 5C4XJ 3ZQIA 2O8KA 3S6IA 1IO6A 5M1KA 3M8FA 1B1BA 2WB1N 1WSGA 1L3LA 3KKSA 1YG2A 3QPHA 4KISA 1YTAA 1MDMA 2VGNA 2EIMH 3I5UA 2P6TA 1TL1A 3E6CC 4RAZA 1NJIR 2QKKA 2HGCA 3M8SA 3V7RA 4KH1B 5J47A 4YOUA 4RWTA 4M7AD 1JJ2M 4HWIA 2UXBK 4UY8O 3QDFA 4IOCL 3SPZA 4PLLA 5CQYA 1GOCA 3HM5A 4L9NA 3PIOA 2VXZA 4F16A 3QERA 2NVTJ 3H9JA 4B21A 2RD1A 2QUFA 4LJZF 1BI4B 5FDLA 3KK1A 2E2QA 1K83J 3HP9A 3IAYA 1WDXA 3OB9A 4OVLA 5J6XA 4IKFA 4KA4A 3VA0A 5IN1A 1T0HA 1TYQB 2FE3A 4AHSA 4RUGA 2SEMA 4FK4A 1R5ID 3GX4X 3OS0A 4EVIA 2HDAA 1YAGA 4NUBA 2OAUA 1LQ1A 4WCIA 3QBWA 1W2BS 1QKXA 2H09A 4I7HA 1QP3A 2EILH 3T0YA 3I55T 2J6OA 2CSOA 1ZX6A 5ICEA 5CKTA 2KT1A 3R4KA 2VKNA 2MGQA 4OU0A 4XEIA 4BQOA 1N27A 5IYDJ 3VQCA 2GXGA 4DUYK 1DU6A 4J9DA 4DSFA 4I02A 3VEVA 4KH6A 2DF6A 2GELA 5LRSA 5LGUA 4JDSA 2MI6A 2E36A 3H5RA 2YDLA 3VF6A 3E1SA 3O3HA 3URGA 4A5NA 2LVMA 4OKKA 3VPZA 3OS1A 3GFJA 4CGFA 4N0AC 1CGPA 1OX8A 4NQWB 3MP8A 3V6DA 1U6ZA 1VQMA 3JS6A 4H0EA 1S6LA 4X65K 3N05A 2R7ZJ 5GMKm 4HPQA 5CYMA 1P9QC 2QASA 1S29A 4OPJA 3HM8A 1RABB 1VQNA 3FXLA 1VQNN 2W0ZA 2YSRA 2HTJA 5AQMA 3SBGA 1FYMA 4BGDA 3UATA 2FBKA 2R7VA 3J81E 4XTYA 2Z16A 2K3FA 4M7DA 8ATCB 3H0DA 4DF4A 1AKHA 1PKTA 3O08A 3CVSA 5EG0A 1SAZA 1LPLA 4RGSA 2K4YA 1WLPB 4ENJA 2ZFUA 2DDAA 2F9TA 3MO8A 3ULEB 2NVYJ 3ZMTA 2QGGA 4PGHA 2V51B 2VQEK 4YFUA 4BDZA 4M78A 3I4PA 1KU7A 1S1TA 3CC2N 3G71T 3DMJA 2D2WA 1YVUA 2LX7A 1J53A 1UHMA 2MC4A 2LF7A 2ROLA 2E7XA 4YTLA 1OH8A 1TT5B 3ZYYX 1M1GA 3T69A 1UJYA 4AI4A 4PJOB 4J6XA 3LWLA 2Y30A 1J2XA 1T33A 1IJJA 4CCKA 5LEJA 1QGPA 4BXUA 3O9TA 4UUSB 3VYGA 2KBTA 1RDCA 4BQLA 1TUCA 1RT6A 3PFSA 1QA6A 3ZFJA 1BU6O 4CJ3A 1DLOA 1NGHA 2EINH 2QKMB 2DDBA 4L5GA 3OV8A 3F22A 2DTZA 3T1BA 2VWFA 3ULEA 1K6YA 1IAWA 4M7DD 3O8MA 1M1KR 2EFQA 4F7UF 1KYWA 3SEZA 1O13A 4AG1C 3KNTA 2K85A 2ISYA 2IAIA 3LM9A 4XTXA 4FLUA 4ZN1A 5FFXA 4L6V5 1U0JA 3LDOA 4BKXA 2LZ6B 4AM3A 2OTLA 1KAZA 3CDIA 4IRHA 3X2QH 2D0BA 5KE3A 1WJCA 3CCMQ 1VQPI 1YP5A 5A0GA 1F1ZA 1OCPA 4A5AA 1GVJA 2JVGA 1SC7A 4NCGA 4F7UE 3CIPA 2E3HA 3V7SA 2VJ4A 1E17A 2LJ3A 4P9FA 4OKJA 5J26A 3HUGA 3O2PE 1ITYA 4AMCA 2OPQA 1LUJB 3NH2A 1U45A 4MMLA 4O44A 5I22A 3CCRN 1TKTA 1SKWA 2R7RA 3TWHA 4LDYA 1OCOH 2YKNA 2DL5A 3QEPA 5D3GA 2JVHA 4DQ8A 3KLFA 1N8RO 2RHKA 3S16J 4E4HA 1VQ4I 3NEUA 3LL7A 3DLAA 1GLAG 3AGRA 4ZJZA 1RBVA 1WIEA 4B24A 4GMJB 3SD4A 3A0IX 3CJ7A 3TSPA 4G6TB 2P9IB 2K4BA 2XAUA 2ENMA 2STWA 1XSDA 1M1KC 4M7DG 1O3QA 1R22A 3C3WA 1VSEA 4BR9A 5HLGA 4CJTA 3NMZC 1YQMA 2VGMA 3D0SA 3ECOA 3QBYA 3BTJA 2WV1A 1FBUA 1NK3P 3NVMA 1NGGA 3C6HA 3MKYB 4A2UA 4FIBA 2D5RA 3DF8A 2P5OA 3HHTB 1GT0C 3AVGA 2F9WA 2YRCA 4ZYDA 1LCUA 2O9VA 4X1VA 4DMNA 1NK7A 1B7TA 1AEYA 1YI2T 4C8MA 3VQDA 2MLGA 3CCQQ 1YNZA 2GTDA 3AA3A 2YKMA 2IEKA 4MZMA 3NVKA 3CJNA 3FBIB 1YBYA 3GOIA 1UG1A 2DD4A 1JT6A 2DA9A 3GIBA 4H4OA 3D2EB 1FKOA 2W04A 4JKAA 3BPXA 4FWOA 1AOJA 2DMTA 4JK8A 3GE1A 1H8KA 2P7VB 5AONA 1RGIA 2P9KA 1N78A 1JJ6C 2B0LA 4KKOA 4RGUA 1E0EA 2QQAA 3MN7A 2W57A 1VSIA 2XU8A 4B8XA 2AT1B 4ZGEB 3GP8A 2J6KA 4B48A 1I5ZA 1S72Q 3WG7H 1JCEA 2FBYA 1EXQA 3I59A 4BE1A 2FBXA 4CEBA 2EBIA 4HAMA 3KUFA 2M87A 1K76A 1N5ZA 2WSFE 2RO0A 5AQHA 1P4XA 1M3AA 3M9QA 1YOVB 3HRTA 4KIGA 1BR4A 4HSBA 4JJCA 2DEQA 4J7FA 1NJWA 3QEXA 1X9JA 1W70A 1WI3A 2DT7B 3I71A 4YRVA 3IH7A 1NK5A 3MXMA 3NAUA 2BYVE 4KDPA 2E3IA 4CJ5A 4B3AA 5HK0A 4A59A 3NHNA 3A5LC 3ZXSA 3CFRA 4N41A 1VQ8Q 3J80Z 4QS7A 4H5RA 1VQ9I 5BR9A 2HZYA 1VQ7A 1TH7A 3HT3A 4BVOA 4C3HJ 4BRMA 1W9HA 3TBIA 2HS5A 1IV0A 3DEEA 5LJ3d 3RR8A 1I50J 4FYWB 3PO4A 4F3OA 1X2MA 2FF3B 1IBLK 1OMIA 2FSKA 1YLFA 1Y39A 1XWLA 2UUBK 4DSKA 4Y92A 3CQTA 2EFOA 4CEDA 1Z6TA 3ER0A 3V4IA 3I0WA 5M1NA 3GLXA 2GGRA 1IDZA 1LDJA 4BRCA 4XRMA 1R49A 2CZ1B 4EJTA 5CK9A 4FVMA 3FMSA 4MTEA 4KHWA 4BI8B 4DV6K 5GANh 5GMKi 3M3YJ 4IZZA 1YCYA 4XLFA 2CP3A 3JRZA 1JTYA 2RJCA 4BGBA 4O5VA 4KFCA 2EIFA 2GM4A 3SCXA 1CLQA 2VV5A 1OEBA 3OR2C 5JR3A 3DV8A 1QS4A 3BE3A 2LCCA 2MLKA 2Z9OA 2W03A 2XF7A 5LGTA 2PQWA 1VQNT 2JMAA 4ZTJA 4KTWA 3I58A 2Q31A 3QDRB 3VYHB 4FW2A 4PZJA 1XNIA 1BU1A 3IKMA 4I6ZA 4CIFA 2M8GX 3HKZA 2OTJA 1SKUB 1JKPC 1QCOA 3MK6A 4A4EA 4N4HA 2YUQA 3VSKA 4MNUA 3FZFA 2DTRA 3DRRA 3JR9A 3WXJA 2CV0A 1Y8QB 2YXYA 2A69F 4YOYA 4BUGA 3RPQA 3S3OA 2A7YA 2YSQA 4FK2A 3FXMA 1B07A 3O4NA 3CC4Q 2XY6A 2CSQA 1AWXA 3DXMA 3EGXA 2HDWA 1NK8A 4CCOA 2RK1A 4HYEA 4LIUA 4JKGB 3O9UA 4ILHA 4KMUX 3RYRA 3HRGA 5FFZA 2EZHA 1YJNI 5DD8A 2KT0A 3OYKA 2LK2A 4A62A 1DDNA 3PMIA 1TKXA 3H3ZA 2PJRA 2KDSA 5KN9A 1RT5A 4FK0A 2XG8D 5GIOA 2K5FA 4KUDK 2W48A 3K2AA 3ULQB 5FLXK 1C0TA 3WNFA 1LWVA 3TR8A 3CWSA 1J5EK 2FPEA 5LJ3h 5IAYA 1SSFA 3FX3A 1K4SA 2OJ2A 4R0KA 3AGKA 4BC3A 1TKDA 1LOJA 4IHYA 4A4HA 4KHQA 4IJAA 3C7NA 3TTFA 3ASNH 1QPIA 4XL9A 5C3EJ 3P5JA 5CQEA 3ZQFA 3P8HA 2TCTA 4DU4A 3MEXA 3ERMA 4FVUA 4CRIA 4OFAA 1VQMT 2R7OA 1M1KO 1E4GT 1NM1A 4ELUA 1G2HA 2E19A 2GBYA 1VQ5A 1TBXA 3MEWA 3HPGA 2E6ZA 1ZBXA 3OS5A 5DLQE 4FJ9A 3ZN0A 5M5WJ 4M7YA 3I53A 3PT9A 3CD6N 2GUIA 4IUTA 3MZ8A 4DOWA 2ID3A 2RDPA 4QLCU 1B72A 4K2EA 4FJJA 2XSDC 3CETA 1I07A 3LAMA 3KEQA 4KGXB 3E9PA 1IREB 3HRSA 4F3TA 3SQ0A 3F8FA 2L9VA 2P0QA 3D7EO 5J2PA 4DS4A 3SAHA 3BP8A 2A08A 1P4WA 2XKPA 3IL2A 1KTQA 1CQTA 3W6KB 1ON1A 4PDKA 2WAQN 3H9GA 1IXCA 3J80O 1KFZA 4A3MJ 1YJ9A 2V79A 2G8FA 1RTDA 2ATQA 3B73A 1NBWA 4QAGA 1FP2A 5DCMA 3FGUA 4FM1A 2JUCA 1WJSA 1KHIA 4DYRA 3PO5A 3F0CA 5D8KB 5J2MA 1VQOQ 3CYMA 5HKCA 2DXTA 1X6GA 2DN0A 4Z4CA 3PIPA 1EP4A 4UV9A 5LEKA 4IOXA 3CCRA 1IB8A 2O9SA 4FT4A 4RTFD 4DTPA 2ITMA 1WFXA 1VQPQ 1NG2A 2W41A 5DM7F 3ZT4A 2X74A 2QTXA 1KRPA 3KFVA 3NPFA 2DFHA 5LJ5d 3KP5A 3CCRQ 4A3GJ 1TTYA 5K5QA 1GCQA 2J5PA 1VQLQ 4CJEA 5HS7A 3GF2A 3TL4X 1TOVA 2DM1A 4A63B 3A02A 1XGSA 1NHAA 2FO0A 3EHRA 2M34A 3CCSQ 5EG0B 3Q1JA 3WEEA 3FRNA 1RT4A 4CJ4A 2DAQA 1UGVA 4J8OA 2F2XA 4M77D 4CHYA 1W36C 1REVA 2DTOA 3E19A 3QAHA 2HU9A 3WNGA 3UNGC 1K9MR 2FBIA 3N4MA 3PVQA 1OLTA 2Y4YA 1T44A 3DLLF 1KQJA 3NCIA 2WFBA 4HRIA 1M3QA 3GBTA 2F2WA 4GVEA 5AQXA 5J40A 2X3WD 1TSFA 2BZ8A 1J0RA 1NU0A 2P9SB 2P6SA 2RN7A 2CSIA 4FLYA 2ZXHA 2L02A 4ESJA 4AF1A 1K4TA 3I64A 1IGNA 3CCQI 3AO1A 4G6DA 1WQWA 2FBVA 4CIEA 2RF2A 3THXB 4NHJA 3M8EA 2A42A 3OH9A 1TQPA 3HUGB 1Q86U 3QKJA 1MBJA 4ELTA 4MHGA 1H641 4HEA2 3TSWA 2CP6A 2RREA 3F8CA 2H3JA 3BROA 4JJDA 3VFZA 2D0QB 5HODA 5GADP 1YIJA 3ZQ7A 2VI6A 1EO1A 3WU1B 1X6BA 1YCSB 3RDVA 2RMOA 4A2AA 3OOUA 3ONQA 2AJQA 1HLVA 3SUOA 2A40A 4PJLA 3D7SB 1XI1A 1U5SA 1HNXK 5KCHA 4HT9A 3G3ZA 4PJJA 4DR4K 2OF7A 4IO8A 4JKDA 2BVLA 1MPGA 3CPWS 1X3MA 3DXJF 4WCGA 4M7AE 4L5JA 3OL3A 3GFIA 1XDUA 2FMLA 5KTQA 1GCPA 3FWEA 4DLGA 5E8IA 2OQRA 4S0HB 3H45C 3V7CA 3P1GA 1I8FA 2QKBA 4HOBA 4KI6A 4EM1A 3MJXA 2P8TA 5GAN5 3NNQA 4FJIA 4F17A 3CQZJ 4X9CA 1ZTRA 1VQ8I 3HDDA 3CESA 1HDPA 4I76A 1M3HA 2J7IA 3ID8A 1KQSS 5GJVB 2YR2A 3I56Q 1U8RA 1DGKN 3OYFA 3BY6A 2DETA 2CQKA 3SFMA 2KHOA 5CVUA 2EFIA 3VQBA 2OA8A 4OAZA 2DTIA 1UJ0A 4Z4EA 4Z0UA 2KAFA 3I56A 3OWTA 1ZAOA 3GZ5A 1PU7A 4OMNA 3ERED 1A5JA 2HYGD 1ZA1B 4WXHA 1LNXA 1DPRA 2QSGX 1WAFA 3H8ZA 2E2OA 4DFMA 2QSFX 2GQIA 3IRRA 1YHQA 4FZXC 1QCNA 3ZETA 1AA7A 2Q1NA 3M0TA 3K57A 2M45A 4L3QA 2NZTA 4J2EA 1IKVA 4O5BA 1K61A 2NYSA 3E5UA 1WXBA 3T19A 3BR2A 3CJBA 3A03A 5LMNK 2J06A 2K2VA 4WQ5C 3PJRA 1BB9A 4A0YA 1SRLA 4BU2A 1AHJB 2C0IA 2LX9A 3RVCA 2G8WA 2XRLA 1NTCA 3CCLT 3K2PA 2EV6A 3D2FB 5AQJA 5EEHA 2QEXT 4JZ3A 1PCXA 2O3FA 1HPMA 4CFAA 1S9HA 3NH1A 1HW5A 1Z26A 3Q3SA 4BEHB 5CQGA 2A61A 2P9PB 3ABKH 1YQLA 3FIWA 4DV5K 3QOEA 5SWMA 3J7ZI 3S17J 4V2GA 3AVMA 2XPUA 5C4JJ 4PFZA 2EJRA 1WJEA 2LSOA 3ZQHA 4A3CJ 1YW7A 1ZG3A 2PNIA 1VQ7Q 1Z77A 2LYCA 3HXMA 3S2WA 3M8QA 2OFKA 4BI3A 3E1YA 5EX5A 2RJDA 5I3UA 5D6XA 4WXDA 3EG9A 4VUBA 2KKZA 2CP0A 1SL0A 4J9GA 4RG2A 3L0QA 5CKDA 1W1WE 4CZCA 5LFAA 5CVVA 2MYSA 2Z99A 3JXUA 3HFOA 3A01A 2RF0A 4CK3A 3BQZA 4XLNF 3OYYA 3FXJA 3E9OA 2NYXA 2VQHA 1VYUA 3QJ6A 4GLKA 5IT9O 2PFUA 2GLOA 3AAFA 4E70A 3LOCA 3QXEB 3MXIA 2MABA 4FL6A 1WJ5A 1D3BA 4I98B 3PIOF 4HNTA 2EGEA 3IWFA 4C8OA 5CLSA 3MAJA 4B08A 2XAHA 1QQOA 3FXQA 4DV0K 3C2BA 1H92A 4HA8A 5D4SA 3JCMX 3IAS2 4YPHA 2XD0A 2DPNA 3FK6A 1K6OA 1RNHA 3R6OA 1FOWA 4BREA 2Y4XA 4DGWB 2DZ9A 5AQUA 1HSQA 4CGZA 3E7LA 3NH0A 2DK5A 2COZA 4KBOA 1U6GA 2E71A 1BDGA 3EAEA 1KC8O 4BWMA 3QQAA 2CKKA 3HTVA 5LHGA 4M7DE 2B5JA 2OTJQ 5AQRA 4FJNA 2STTA 3OA9A 4XKCA 2ATCB 4AIJA 4AWXB 3QU3A 1SSHA 1SD5A 1Q7YO 2VWJA 2DYSH 2GWKA 1S6QA 4NS5A 3FM3A 1ODDA 2XKOC 2V4JC 2QA4N 3O8HA 4F2RA 3FJPA 3GG4A 4B09A 3H1CA 2HMPA 1I5OB 4W5OA 2VXEA 4DYQA 1L3SA 1E7OA 3SB2A 4K25A 4HVJA 4B6MA 1H8AC 3QG1A 1NWKA 2O8FA 4U0YA 2IAJA 3FC3A 4UB8C 1U3OA 3BR3A 1QQJA 4EIAA 1TQMA 4MIMA 3AVJA 5DM6L 2L89A 1UZCA 2HOSA 3FIFA 3MWPA 2HNYA 1TNTA 3HVTA 4KREA 4M3UA 2C0OA 3LQRA 1HYSA 5D5UB 1JI8A 4IO9L 2K9GA 2XAJA 4GYIA 4OF1A 4C8QA 3RSEA 4BJ6C 1EETA 4C92C 2P9KB 3V1QA 3QUIA 4MLHA 2KE9A 3RSNA 1IKWA 3M6GA 4ZDPA 1ZRDA 4PJOF 2NVQJ 4MDAA 3MMVA 1F21A 3L2UA 4AIAA 1F1BB 4DTUA 1VQ5T 3UKRB 4FSVA 2QQ9A 3JV3A 4I9LA 1VQ6A 4QPOA 2KRNA 1MA9B 2ZD1A 4EA5A 4C8QB 3O80A 2JTMA 3BF1A 2EJFA 2WWYA 2FD5A 4RKUE 1NLPC 3VS5A 3K4CA 4RCHA 2DI3A 3VDXA 4E47A 3VYSB 4WCEL 2LP5A 4KJZA 3HJEA 2ME0A 3WNEA 1REPC 3UDCA 3CCSI 3M0SA 2GIZA 2QXFA 4P1WA 4M3EA 1XDSA 2KZZA 3SUQA 2HBPA 3PUBA 1OH7A 4FISA 1JCFA 4CGJA 4BS9A 3J7AY 4J9FA 4NCBA 4FSSA 1QW1A 1TK8A 2HF4A 3CCSN 1KG6A 3DB3A 2MH9A 2E70A 2V6EA 1KG5A 3CJRB 5L3BA 3HC7A 1IBMK 3AG3H 2QGFB 2P9UB 4M74A 4KHSA 2E5KA 3LP2A 3LSMA 2ELHA 2ZZDA 2CREA 2OTJI 4JI2K 5L23A 1MJ9A 3VEXA 1U1TA 4HLYA 1F36A 3ELKA 1HR0K 5KAFC 3GTGJ 3E6DA 4PFPA 2EFWA 5BPIA 1VQOA 1WEIA 1UGSB 4DB3A 3OYDA 2XRNA 3HOTA 1BOTO 1OH5A 3HBTA 4NL3A 4JYKA 1W4SA 2LRQA 1LDDA 1O57A 3O9SA 1C0GA 4J01A 3A01B 3MMYB 3ZT3A 1RDBA 4I0BA 3J8AA 3L3UA 2EJGA 3DCFA 3FLGA 3PIOL 2LR8A 1VQ9N 1VZ0A 2DNUA 3AVCA 4HKEA 4MDXA 4W5QA 4V19K 2F69A 2DYBA 4JJBA 1Z25A 1PKSA 3KHYA 4YOTA 5GANj 1S8NA 2PN6A 4BC4A 2R7DA 4CC2A 4BQNA 3K1MA 1PM3A 4H0OA 1IHVA 5BPDA 3KPHA 2ECCA 2FX0A 4AVZA 3OW2P 1P59A 3B02A 5ELZA 1IN4A 2ZPGB 1BIUA 3GTQJ 3CCJN 1JXMA 5A2QE 3AFHA 1WHKA 1TQIA 3DKWA 1MJAA 2DTUA 1JXBA 2P9IA 4YORA 3FE1A 3LSKA 1RC9A 3VS1A 1WSJA 1JU5C 1RI9A 3EY1A 4FE7A 2L9RA 1WB9A 1LFPA 1MNDA 3DPLC 4CGHA 2JHJA 2YJFA 2ID6A 4OO1J 1HYOA 2O5RA 1NGCA 4AHVA 4XTWA 2PUOB 3CBOA 1E2XA 4XOTA 4LFAK 4RG8A 4CZKA 4B9UA 2I5UA 5BPMA 4EJYA 1LE8A 2X85A 4M3GA 3AVHA 1Z3YA 2A37A 1LE8B 4FHTA 2V1NA 4GYGA 2ESNA 4CZHA 2F2EA 2Y2ZA 1MUDA 5FPEA 1ETYA 2ZJ2A 1G59A 1K8AR 1YI2N 1YRNA 1QHGA 2NXNB 2VKEA 3G25A 2DRMA 3T8RA 3I55Q 4BG9A 1RDWX 1RI0A 3CJQB 3FR0A 2MFZA 2HQAA 3TP0A 1Q7YU 2P5VA 4A12A 2L2PA 2D45A 3DRSA 4FL9A 2P51A 4OPAA 1T38A 3AAPA 1BW6A 2KQWA 3QESA 2BUDA 2RI3A 1FW6A 3DWLE 1W2BM 4XN0A 4FZZA 3GEZA 5AIPA 4J9EA 2Z33A 4BHBA 2FB7A 5KCMA 5IYCJ 3RUXA 4JI5K 3I59B 4C2MJ 1OJLA 3W6VA 2RQPA 1C0MA 4UVCA 3RPUD 5KYXA 1Z0XA 3K0LA 2YHWA 2NLUA 1AWWA 3K9TA 1NEGA 1EF4A 5ADXA 3F8MA 1TP4A 2JS2A 4BQQA 5AZIA 4WFAL 2O4XB 4DV3K 1YE9A 1JUMA 4JOMA 1SL1A 4I2OA 2ZPBB 2NRTA 4XIUA 2W24A 3DBLB 3OMYA 3H5NA 1SEUA 1C0WA 4LXCA 1NG7A 1C1AA 5A2QK 1XSXA 3CFPA 3F21A 2HOTA 2HDCA 3QP6A 3H0GJ 2OUMA 2VBXA 3GTMJ 2RM4A 1JXEA 5CR4A 4EP4A 5EF6A 4BY6B 1TK0A 3G6EI 3WGIA 4CF2A 2M51A 4DA4A 1ZLJA 2JGUA 3QYBA 5C42A 2VN2A 4M75F 4CEQA 4U88A 1WH5A 2HHQA 1YWPA 2W1OA 4DV1K 4L18B 2OZSA 3C6AA 4CZIA 1Y57A 3K7AJ 2LBFA 3HOSA 2PJRB 3IKVA 1RR7A 5L3GA 1BI0A 2QEXA 3NF7A 1PVEA 1RT7A 2QSHX 1QVGA 4C0GA 4E9HA 5B8HA 3L2VA 4E9EA 5BR8K 4XN3A 4OIRF 2CZ6B 4QCLA 3KP3A 2QENA 4FWNA 2CQNA 4C8KA 4BI4A 1JCGA 1M2VB 2JOYA 1MMAA 1HNZK 2LSNA 3AARA 5HROA 2XROA 4A3KJ 1I94K 2K57A 4B47A 2KL4A 3TAEA 4Z2YA 2LC2A 1QHAA 4IXAA 4NZGA 1GV5A 4HUFA 1VNDA 3F8NA 2EZLA 1P90A 1WAJA 4E19A 2A6TA 1TK5A 2GOXB 2HQHA 4CERA 1NPRA 4IPAA 1SEMA 4QVDA 2X4YA 3CC2I 2Z3YA 3PO2J 1QRYA 2DPPB 4B3SK 2L9SA 2LNHB 4G9YA 4IIOA 3KYDB 3P31A 3EG9B 2DMOA 3MEGA 1QTMA 5LMUK 2LDUA 1VQ8N 1Y97A 1APLC 2X6SA 1T3VA 5JHFA 2QA4Q 1LDKB 2IG0A 4IHSA 3AY9A 4PFOA