3OYCA

Crystal structure of the prototype foamy virus (pfv) intasome in complex with magnesium and the insti pica
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
368
structure length
368
Chain Sequence
LDAELDQLLQGHYIKGYPKQYTYFLEDGKVKVSRPEGVKIIPPQSDRQKIVLQAHNLAHTGREATLLKIANLYWWPNMRKDVVKQLGRCQQCLITNASNKASGPILRPDRPQKPFDKFFIDYIGPLPPSQGYLYVLVVVDGMTGFTWLYPTKAPSTSATVKSLNVLTSIAIPKVIHSDQGAAFTSSTFAEWAKERGIHLEFSTPYHPQSSGKVERKNSDIKRLLTKLLVGRPTKWYDLLPVVQLALNNTYSPVLKYTPHQLLFGIDSNTPFANQDTLDLTREEELSLLQEIRTSLYHPSTPPASSRSWSPVVGQLVQERVARPASLRPRWHKPSTVLKVLNPRTVVILDHLGNNRTVSIDNLKPTSHQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PFV integrase
publication title Molecular mechanisms of retroviral integrase inhibition and the evolution of viral resistance.
pubmed doi rcsb
source organism Human spumaretrovirus
molecule tags Recombination,viral protein/dna
total genus 106
structure length 368
sequence length 368
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2010-09-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
A PF17921 Integrase_H2C2 Integrase zinc binding domain
A PF18103 SH3_11 Retroviral integrase C-terminal SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2300 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3oycA04
1.10.340.70 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Endonuclease III; domain 1 3oycA01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3oycA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3oycA03
3QINA 1ZBLA 4DS5A 3KUFA 4QQ6A 1WSJA 1RTDA 1KLNA 5D6XA 4MQ3A 3ZEHA 4UQGA 3BDLA 1Q9YA 1RT3A 3FLGA 2JZ2A 4OJRA 4C8NA 4RG8A 3DMJA 3GOXA 4ZHRA 3LANA 2YV0X 3SCXA 1K6YA 3SI6A 4FZZA 2X6NA 4RW7A 1B92A 3VQ7A 5FRMA 4N5SA 3WNEA 4Z4IA 2Z1GA 2FBTA 5J26A 1HQUA 3KLHA 2Z1HA 4I9QA 2ZQBA 4E7JA 3K2PA 2X78A 4DG1A 5CY4A 2P0KA 3KLIA 3P1GA 4IUPA 4CF2A 3OVNA 4W5OA 3ZT1A 2EX3A 1T05A 3L2UA 2K3YA 4CHNA 4FK4A 1XNIA 4CJEA 4E7LA 2X4WA 4M3ZA 3OYHA 3DB3A 2VG5A 1MHNA 4NYFA 4C5EA 1BGXT 1TK5A 4LH5A 4DTOA 3VQ5A 3ZCMA 3EZ5A 4IG0A 5D6YA 3B6PA 3AO1A 1C1CA 1WSIA 3DRPA 1RI0A 1Z26A 1KLMA 4EDUA 3S3NA 1TKXA 4CECA 5C25A 4FJGA 4Y1CA 3VQDA 3RRHA 2DIQA 3HK2A 2XY7A 4HHTA 2BDPA 2GV9A 3OYAA 1LWFA 1S1WA 3NE6A 4PL6A 3NCIA 3NF8A 4KAZA 3NH2A 4M3TA 2QQRA 1NJYA 4BE1A 1CZ9A 4FJ7A 4R5PA 4YNQA 1WLJA 4E89A 1S1VA 4ELUA 4C8KA 3BGRA 1Z25A 4Y1DA 3HT3A 3KLEA 1KVBA 2E6LA 3OA6A 3BDPA 4DSLA 1VSJA 3V1QA 1RT6A 3MEUA 4J2BA 1LWCA 3DI6A 3O3GA 3CM6A 2G8KA 3QEPA 3PO4A 4CGFA 3VQQA 4CJ5A 1FXXA 1JLGA 4B9SA 3OQ5A 3DLHA 4DMNA 3QETA 3WNFA 2R5MA 3LYIA 3VQ6A 5C6SA 1QE1A 1QTMA 4DFJA 4OLAA 3QBYA 3L2VA 3OYJA 3LLRA 1NOZA 2QQSA 3SUPA 2EHGA 4K8XA 2G3RA 3HPHA 4KHYA 3LALA 1T03A 3NH1A 1RNHA 1QQCA 2B5JA 1U4BA 3LP1A 3OYDA 3LH0A 2RN2A 1BQNA 3Q1JA 3C6UA 3O3FA 4CJUA 3KD1E 4CIEA 2QKBA 4FJXA 4MFBA 4DSKA 2A1RA 1TV6A 3DLBA 2BKDN 4QAGA 2RJEA 4LD6A 4KTZA 3M8QA 3UT1A 2G8FA 3O8VA 4TSXA 2XK0A 2E6MA 1N5YA 4CGIA 2JGUA 3OS0A 2BIVA 1A5XA 1A5VA 1SKWA 3QLHA 1D9FA 2KFNA 4CE9A 3DLEA 2Z1JA 1ASUA 3C94A 3CYMA 2KTQA 5IN1A 5KCOA 2QK9A 4CHPA 3MEWA 4CEEA 2RKIA 3ISNC 1NK6A 3IS9A 4HTUA 1SL2A 3V9UA 3AO4A 4LY7A 1U45A 1F21A 3MEVA 4O0JA 1NJZA 4FJKA 3O3HA 3MP6A 3NF6A 5IAYA 5K14A 1FKPA 4CEBA 2BGGA 4NCGA 1X9WA 3META 4FXDA 4B9UA 3SUNA 4IKFA 3V6DA 3SD4A 2HHWA 2L8DA 2G8VA 4CESA 3MP1A 3M9QA 3FC3A 4JRPA 4GY5A 4GMJB 2HW3A 3I0RA 4CHQA 2R57A 4DTMA 1RBRA 3DLGA 1CZBA 3SV4A 2FBVA 4KI6A 4I9LA 3KKRA 4CGGA 3TWHA 2ZE2A 2G8IA 1TK8A 4OVLA 4IFYA 2LTOA 1N27A 2GFUA 4QVZA 1VSFA 4A4FA 4FJ5A 4FJIA 4Q5WA 1NOYA 3DLKA 4BD3A 3KLGA 1W0HA 4E1MA 3KJVA 4W5RA 3T1AA 4FM2A 5D6WA 2IS3A 3NF9A 2PYLA 2P5GA 3SPYA 1WJQA 3OJUA 2D0CA 3OYGA 4YFUA 3KIOA 3A2FA 3MEGA 4DLGA 2HNZA 2Z1IA 4FW2A 4I2QA 2Q3SA 3NTHA 3NHGA 3RMDA 1C6VA 4E7HA 2RPIA 2F96A 3RTVA 3P8DA 1VSEA 1GOAA 5JS2A 4CJRA 4HUEA 2WOMA 4JLHA 2M1HA 3AO5A 4DTXA 2BANA 1ASWA 2HVIA 5J2NA 2XY8A 1BI4A 3K5NA 3H6ZA 4ZTJA 1X9SA 3AVAA 4F8RA 5KGWA 3KK3A 5FRNA 2RI3A 4Z4GA 4O4GA 4ELVA 1D9DA 1D5AA 1B9FA 2EKOA 1SSFA 3S9HA 4Q5VA 4ZTFA 1RBSA 4CK1A 2LDMA 4O44A 1XHXA 2Y1IA 4KTQA 4C5GA 5J1EA 3QNNA 5CIUA 4XIUA 3PX4A 3SQ0A 2RJFA 1KFSA 1JXEA 1C1BA 4ID1A 4FJMA 5M9OA 2OPPA 4PUOA 3U3YA 2KQ2A 4KKOA 5KE2A 4H8KA 2DFEA 4B9LA 3AVKA 3TAGA 1TKDA 4IURA 3M8PA 1TGOA 1HYZA 3MEEA 2B6AA 4HCZA 1U48A 2RHXA 2WONA 4DF8A 2E4LA 1YVUA 3OYMA 4CERA 1WJRA 1J9AA 3PMIA 1L3UA 1JLEA 2EFIA 4QCLA 2R5AA 3QEXA 2IGIA 1NKBA 3PFSA 3PMTA 1SL1A 2MWPA 3D45A 1WN7A 1XI1A 2D5RA 2RO0A 1TKTA 1BHLA 1RILA 1DTQA 3OMGA 3OMCA 4GW6A 1LW2A 4B8CA 1O1WA 2G8UA 4E0DA 4CJVA 4PWDA 4LSNA 4N4IA 3C4SA 4NCAA 4CF1A 3NAEA 4CJFA 1HMVA 2HNYA 4KB0A 4O5BA 2XO7A 3HM9A 3V9ZA 5T7BA 1JLCA 2HHTA 3QKJA 1YTUA 5KI6A 2DFHA 3U6FA 2O4XB 3VN5A 2B8AA 3RR8A 4CHZA 3OB9A 3HXMA 4CCHA 3OYEA 4DSFA 2QKKA 3HP6A 2XY6A 2DIGA 4CF8A 3DLMA 3MXIA 2WACA 1IKWA 4B9XA 3QEIA 3MP8A 3MEAA 3WNGA 3U3GA 3HPOA 2HHSA 1BI4B 4FLXA 1RT5A 3ZSVA 4DQRA 5SZTA 1U47A 4DQPA 2ITGA 1JLBA 3PUFA 1HRHA 1W9HA 3OS1A 3G10A 3LDSA 3ZSOA 3TAPA 2IDOA 3DOKA 2Y1JA 3IRXA 4CGJA 3VQBA 3TAQA 2IC3A 3OS2A 2B4JA 2X74A 3EAEA 3JYTA 4O0IA 4FM1A 2FHDA 2HQXA 4F3OA 4I2PA 2OZSA 4O55A 3VQPA 3KLFA 4FZXC 1XWLA 3AVCA 3P8HA 1TAQA 5KRTA 4HVJA 4FW1A 1S6QA 4DLEA 3CFRA 3HJFA 2HHUA 3DOLA 4BDPA 4BE0A 2KW4A 4LD0A 4UC4A 4A4GA 2OPQA 5I42A 4RW8A 4JRQA 4KHSA 1SKRA 1RDBA 3RMAA 1X9MA 3RWUA 4DTJA 4AILC 1D8YA 4C5IA 4Q0BA 4CHYA 1KVCA 1OZ3A 2RJDA 3OYNA 1RDCA 3HVTA 1TVRA 3MXMA 2X4XA 2DAQA 4CJLA 3S3OA 4IUQA 3TAEA 3DYAA 1VSMA 1NKCA 4JS4A 4PLLA 5KRSA 1VRUA 3ALYA 4IFVA 2L89A 5J2MA 4AHCA 5HRSA 2F8TA 4M41A 3LPUA 1X1PA 1RDAA 2OPSA 4DSIA 3AO3A 1RBTA 4PA1A 2X35A 4M3UA 1YT3A 4BE2A 3AVNA 3L8BA 3L2QA 3UIQA 2O4GA 3QIOA 4IUUA 3VQEA 4KREA 4B9WA 1IG9A 3LZJA 4DTRA 1R0AA 4OKKA 3DLRA 1L3TA 1HNIA 4CFAA 4DTNA 4E1NA 3NGZA 4CIGA 4N41A 2LRQA 3H8ZA 1RDDA 4KI4A 1L3VA 3CFPA 2XY5A 1ZBUA 3CM5A 3HPGA 3ASKA 4FU6A 1NK7A 2VWKA 4KHQA 4N4HA 3E01A 3LP2A 3F70A 4FLTA 3ZT2A 1RT2A 3NH0A 1VSIA 3CQ8A 2PQWA 5KE3A 1J54A 1JL1A 2HHVA 4HUFA 1G5VA 3FDRA 1ASVA 1A5WA 4EP4A 2RHUA 4HUGA 2XRIA 4NS5A 4OKJA 4PY5A 4II1A 4FLYA 3SYZA 1IKXA 1WSEA 4PLIA 4DU1A 2AJQA 3VQAA 3NGIA 1KVAA 1S1TA 1U04A 2E6NA 3VA0A 4CJWA 5HRPA 5HRNA 1WNSA 4L8RB 1S9GA 1LW0A 1WGSA 3V1RA 3OY9A 3AVMA 4AHVA 3LX7A 3L2WA 4F2RA 3MO8A 3CFOA 3DM2A 3IG1A 3P83D 1J5OA 4F4KA 4F3TA 3NGYA 1VSKA 1HPZA 3LAMA 5CYMA 3OYCA 2F5KA 3CEYA 3AA4A 2KFZA 1BL3A 4FLWA 2D0BA 4OVAA 1ZBIA 2EQMA 3QEWA 3NNQA 4DS4A 4RG2A 3ASMA 4QQGA 1DLOA 3V4IA 3SUQA 5SWMA 2VWJA 1IKVA 2MWOA 5J39A 1G15A 4Z4EA 4M45A 1TK0A 3QNOA 4N47A 2GF7A 3VQ9A 3O4QA 4CF9A 3TR8A 1NK9A 1YTAA 1ZYQA 2K3XA 3AA3A 1HQEA 5C42A 4AHRA 1LAWA 3PY8A 1JLFA 2FBYA 3QO9A 1SUQA 3SQ2A 3QESA 4FL6A 1S5JA 3M8SA 1I39A 3NF7A 1WJSA 5HP1A 1KFDA 2M0OA 4I7FA 2EQJA 2EQUA 1NJXA 3RMCA 3KK2A 3T3FA 4FM0A 4FCYA 3AO2A 2D0AA 1Q8IA 3SZ2A 5HROA 3RRGA 2YNHA 3MECA 3K5OA 4J2DA 5FDLA 3FFIA 2KZMA 2DFFA 2M16A 3DB4A 4EZ6A 2HQEA 2D9TA 4CEOA 3V9WA 1NJWA 5CZ1A 1MU2A 2F8SA 1VSLA 2OYQA 4BWJA 2IOCA 1FKOA 3K5LA 4M42A 4M3RA 4Z4FA 4DU4A 5KTQA 1HNVA 3IAYA 3ZSYA 1FK9A 2RHIA 4FVMA 2NUBA 1S9EA 3CG7A 4N56A 3DRRA 4DU3A 3HL8A 4KHUA 3LWMA 2E5QA 4OGEA 1UA0A 3L2RA 2VG6A 1KRPA 1VK0A 5HRRA 1NK4A 3QERA 1L3SA 3TI0A 1LV5A 2PYJA 3PV8A 4KHNA 2G8WA 4B9NA 4W5QA 4F2SA 4WE1A 4M3XA 1BIUA 2P51A 2YKMA 4EZ9A 4CEQA 4E19A 2GFAA 2FC0A 3K5MA 2X6SA 4Z02A 4FYDA 3KTQA 3K58A 3ZSRA 3SQ1A 4A4HA 3TABA 5J2QA 3H08A 2VG7A 2A1SA 1RBVA 2XDPA 4X34A 4KO0A 2G8HA 3V9XA 4DQIA 3SV3A 1EX4A 2KZZA 3I8DA 4FJJA 4BDYA 1CLQA 2R58A 3LZIA 4KFBA 4C8MA 1RTHA 3NBPA 1KSPA 1JL2A 2HHXA 2OPRA 5FROA 2JLEA 1LWEA 4KHWA 2LCCA 2HB5A 2L3RA 3LGLA 4CIFA 4IBNA 3SUOA 4CF0A 2QXFA 3ZSXA 3E9GA 2GBZA 5CYQA 3LAKA 3LWLA 3V81A 3S3MA 5KCHA 4NZGA 1C1AA 2FBXA 1ZBFA 3AVFA 3KKSA 2RHYA 1J53A 1C0MA 5E41A 3O4NA 4CHOA 3OJSA 3LGFA 2HMIA 3K59A 4Z4HA 1CXUA 3TAMA 3HYFA 1C0UA 2JTFA 2P1JA 4OPKA 3QIIA 4B9TA 1ZBHA 1KCFA 1HJRA 1U49A 2YNFA 2IG0A 1JLAA 3OYKA 2OA8A 4OGCA 3G0ZA 4CEZA 1C0TA 3RMBA 3K57A 4DFKA 4W5TA 3TAFA 4CJ4A 3AVJA 1SV5A 1REVA 4CK3A 4RW4A 3UWNA 2I5JA 2YHAA 1EXQA 2RHZA 5DMRA 4NCBA 1S1XA 1BQMA 1WAFA 1BCMA 3NTKA 1BISA 4CK2A 1H3ZA 3OYBA 4CEFA 3SPZA 1GOBA 1EKEA 1WSGA 1WSFA 4DFMA 1KTQA 3C95A 1TL3A 2R7YA 3AVHA 4FLZA 3EYZA 2PY5A 1OYXA 4DTUA 4CFBA 1Y97A 1S1UA 1JXBA 2RF2A 3ZSQA 4B9MA 4DSEA 1HYVA 1WSHA 3VQCA 2RI2A 2EQKA 5KH6A 4QOZB 3RR7A 4RW9A 4OKEA 1DTTA 4CEAA 1RT7A 2DTUA 1NKEA 4FJNA 3PO5A 2GUIA 3OYLA 2YKNA 1T8EA 2LSNA 1XC9A 4DTPA 5J2PA 1RBUA 4B3OA 3DRSA 3MAQA 4DQQA 3SNNA 1XHZA 2OZMA 4QQDA 3T19A 4NYNA 1RCHA 1RTJA 3FEOA 3THVA 4FLUA 4B08A 1NK5A 3AV9A 3D0PA 4J2EA 5KGXA 3C6TA 4B9VA 5HBMA 1NK0A 4KPYA 4CFCA 1WAJA 3HP9A 2PZSA 3S6WA 3SJJA 3F9KA 1ITGA 3PNWC 4QW2A 4K8ZA 4RW6A 1B9DA 3OYIA 3HSTB 1RT4A 4E3SA 2RJCA 5DK5A 4FJHA 4H4OA 2ETJA 1IH7A 3PX6A 2ATQA 1UOCA 4A4EA 3VQ4A 4ID5A 4CJ3A 1KHCA 4AHUA 3HO1A 1BIZA 3ZSWA 1SKSA 3NTIA 2P5OA 4DF4A 1EETA 1QSYA 5C0MA 3NFAA 4FJLA 3KD5E 4OLBA 3I0SA 1EP4A 2BUDA 1OZ2A 1CXQA 4CJPA 4BWMA 3V9SA 1TL1A 3AVBA 3LP3A 2X4YA 4FJ8A 4ELTA 3JSMA 4IG3A 4DFPA 4W5NA 3M8RA 4LH4A 1NK8A 3QJ6A 2LVMA 4CJTA 4C8OA 3ZSZA 4CFDA 3QIPA 3LP0A 3AVIA 1VSHA 3KK1A 3L3UA 4GVMA 3ZT3A 4CJQA 1RTIA 1TKZA 4G1QA 4Z4CA 3P5JA 4KTWA 4IDKA 2RI5A 1IO2A 3B6OA 2HNDA 4FJ9A 4AHTA 1I3AA 3MEDA 1QHTA 4DWIA 1JKHA 4FLVA 4AH9A 4KRFA 3AVLA 4BDZA 4IUVA 4C5HA 1UA1A 2XHBA 1L5UA 1RT1A 4N76A 4EP5A 5EU7A 5C24A 4H4MA 4CEDA 3VA3A 3ZT0A 3MXJA 1N6QA 3HVRA 4CJSA 1TAUA 3ULDA 1S6PA 2O4XA 3EY1A 1UAXA 4KB1A 2IAJA 4J2AA 2HHQA 3ZT4A 4CGHA 4IUTA 4ICLA 2BE2A 4FZYA 5JS1A 4N4GA 2YNIA 3E9FA 4FK2A 3F73A 4DQSA 3AA2A 1VSDA 1LAVA 3TANA 3AVGA 4C8LA 2YHBA 2HVHA 4HCCA 3WNHA 1QSLA 4E7KA 4M3WA 1IKYA 3SQ4A 4JS5A 4HCBA 3AA5X 4DTSA 3VQ8A 1Q9XA 5I3UA 1HYSA 3ME9A 4PQUA 3PX0A 2CKKA 3OYFA 5CZ2A 3TARA 3ITHA 3QEVA 1JLQA 4DSJA 1BCOA 3LPTA 4LSLA 4CRIA 4BACA 5HLFA 4FK0A 1T7PA 4E7IA 2DY4A 1VRTA 1OI1A 4AHSA 4OPJA 2W42A 4B8AB 2VYTA 1UWBA 4Z0UA 3V1OA 2YNGA 1QS4A 4M3YA 3L3VA 4CGDA 4CJKA 5D3GA 2NLUA 2ZD1A 4L59A 1SL0A 1QSSA 1GOCA 2YRVA 4KV8A 2O4IA 3NDKA 3L42A
chains in the Genus database with same CATH superfamily
4XTWA 2DYRH 4Y3OA 2YU9J 2EK5A 3LAJA 5GANh 3WTUC 4YPHA 3KUFA 1ETOA 1RTDA 1KLNA 3I55N 3G71Q 1KC8R 5D6XA 3EGXA 3DWLA 1NYFA 4BY7J 1RAFB 1KD1U 2DQLA 3BDLA 1VQNQ 2W84A 4NC6A 3AAQA 2VQCA 1S72T 4B3XA 4RG8A 1WEFA 3S8PA 2YV0X 3SCXA 4GVEA 4XRMA 4XKWA 5BPMA 5AQNA 3Q7BA 2DE0X 5KAFC 5CJ9A 3MCPA 5BR8K 3EGDB 1QVFP 4KIFA 3A8HB 2F5TX 3K2PA 1Y07A 4KIGA 4B3RK 3EDPA 3KLIA 3HHHA 1ZN2A 2GXAA 4PDKA 3H41A 3CLQA 4XSXF 3OVNA 5AQLA 1VTNC 1BA1A 5CKDA 3TU4K 2YG9A 1IJWC 3PO2J 1XNIA 4WF2A 1IUFA 4R8HA 2BE9B 1HSQA 3TMOA 3AHUA 8ATCB 2X4WA 1W4SA 1VQLA 3QG1A 1RUOA 2R7QA 5HS8A 4DV6K 1NGIA 2HKOA 3GZNB 2XGEA 2K2MA 3EYYA 3CCRA 1NGEA 3M5RA 1TK5A 1H1VA 4EJVA 2UZKA 2HMPA 3TGNA 3VQ5A 3ZCMA 4HA8A 3H1CA 3ZQHA 2NRHA 2V7ZA 5AIPA 2O9LA 1QP2A 4DCHA 3FXKA 1I5ZA 4G94A 6PAXA 1Z26A 3THXA 4BROA 4GRIA 3S3NA 4CICA 3JB9H 4CUGA 5FWCA 4CECA 4FJGA 4M75B 4MDWA 2WSEE 4KGXB 4O6JA 3HK2A 5ADXH 1D3YA 2NVUB 1IUYA 1FT9A 3M3ZA 4BI4A 2GV9A 3RKWA 4RB3C 5LJ3h 4PL6A 4KIBA 3ONQA 3QDKA 3BFMA 1YIJN 2LBFA 4KAZA 3NFCA 4M3TA 3M0PA 2QQRA 5C2DA 1YJ9N 4BE1A 1X2NA 4FJ7A 2DILA 1JT0A 4YNQA 1WLJA 1YUWA 1Z6RA 2CUFA 3JAMO 4C8KA 2R7OA 3X20B 2JHNA 5CCAA 4Y1DA 3QWLA 3HT3A 1OCCH 1GCQC 2GXGA 2M3AA 3S2DJ 3OYYA 4B09A 2P84A 2VQLA 2OC6A 5F0XA 4PJ0C 4DIQA 3V1QA 2VI6A 1RT6A 4BY1J 3MEUA 4CI0C 2C0OA 5GAOq 3IHUA 5CQEA 3DI6A 2MLGA 3O3GA 2OFKA 3CM6A 2G8KA 5AQJA 1T3LA 4JYAK 4KT5C 2LKSA 4B1WB 2X1EA 1UHWA 1JCFA 1VQ8I 3DAWA 1K83J 3Q3SA 4L0ZB 5EGOA 1JJ8C 4BC3A 3QETA 4GLMA 1FYKA 1HC8A 4WXHA 5IYCJ 3TSUA 1U5TA 2O01E 5AR0A 4B1UB 2GTDA 5C6SA 4JQFA 4H0VB 1PVSA 1BW5A 2IGMA 4BRDA 4AM3A 3EGXB 4XKBA 2NRRA 3L2VA 1YHQN 3M57A 1R59O 3FLCO 4M4ZA 1WX6A 2QQSA 1Q81R 3SUPA 2G3RA 3M0TA 1Y0MA 1NGGA 4LUEA 3NH1A 3U1DA 3J80Z 1RNHA 2LQKA 4IOXA 2K57A 3ZPLA 2EWSA 3CC4I 1PNJA 2LT1A 1ENHA 2XI9A 3NMUA 2RN2A 1WH5A 2F6CA 5F08A 1CF7A 1IRZA 2Q0OA 3IAS2 3G1JA 3KD1E 1JUMA 2ZGYA 4CIEA 4CD3A 4FJXA 2BZYA 2A3SA 4A2UA 3BOQA 2GM4A 2L9VA 3VV0A 3OA9A 1VQON 1J3TA 1D3BA 1G83A 3CMET 4A59A 4LLLA 2P81A 1YJNQ 2CP5A 1RRJA 2G8FA 2ESWA 1T6CA 1VQPI 2JMCA 2L3DA 2E6MA 4CGIA 3OS0A 3NWTA 2YDLA 1A5XA 4W1UA 2LDUA 2VPLA 1SKWA 3QLHA 3G6EA 3ZL7C 2P9PA 2JA7J 3R9PA 3C2HA 2RN8A 1X6BA 3CYMA 2KTQA 2L9RA 1SKUB 3CCUA 4C23A 1BK2A 1H8KA 1M2VA 4WWCA 4CHPA 4GDFA 4DV0K 2RKIA 1NK6A 4ZGJB 1GLNA 4HTUA 1JB0E 1Y8QB 3CCQI 1IN8A 1NJIR 3CVSA 2PMZA 2VBWA 2KZVA 1WRJA 1I1JA 1NTCA 1VQ4T 2C6YA 1YW8A 2AO9A 1YITI 2HQAA 2IS2A 4UUTA 2FSKA 5K14A 4J9BA 1X9WA 4FXDA 4G9ZA 4MLEA 3JB9I 4B9UA 5FKNA 2YXYA 1TWCJ 2EAYA 3V6DA 3ATVA 1HU0A 5IP7J 2D1VA 1ABQA 2HQ5A 4X1VA 5LJ5h 2KL4A 1H9TA 1W1FA 2L3PA 2KZGA 4GMJB 4HWIA 4OB1B 4C2MJ 1AWJA 4CHQA 4BEHB 1HCRA 1FPQA 1FEXA 2R57A 3OW2A 1SAUA 4J01A 2IA2A 2RPNA 4EQQA 3SV4A 3MWMA 1MDMB 1BI3A 2KY9A 1MV0B 4KI6A 4OMYA 2DJNA 3JRFA 4I9LA 4UXNA 1VAZA 1LMZA 3BQZA 4CO8A 2ZE2A 2BW3A 2GX9A 1TK8A 4OVLA 2OTJN 2EBPA 2LTOA 5JLWA 3E97A 2P9UB 1U5TC 4YOVA 1S3JA 5F0CA 3W2WA 1ARKA 2W00A 2A41A 4Q5WA 5FKMA 2HMAA 4BD3A 3I0WA 4E1MA 3KJVA 2DAOA 3TREA 2IS3A 2PN6A 3PGGA 2OI3A 2ZGWA 1WJCA 3EE8A 5DEQA 2MYSA 3OJUA 1F1BB 3ULQB 2QTDA 2D0CA 3OYGA 4XONA 3KIOA 1MV3A 1U6ZA 4DLGA 4DZPA 1VHXA 4Z2YA 1AEYA 3WT0A 4FWMA 4ZH4F 4I2QA 1K73O 4DYRA 2NOBA 2AA4A 2P9SB 3PIPL 4CHUA 4NQWB 1F4KA 4XH4A 4DNCA 2EIMH 3W6VA 2RQRA 1ZHFA 3E0JB 5J4VA 4ZGEB 4A5BA 1X27A 2VQGA 5J2NA 2YJFA 3ZQFA 1BI4A 1SD5A 1VQ9I 1J09A 4Q47A 5IHKA 4ZTJA 1X9SA 3O80A 4IZZA 2VGNA 4XTUA 1SHGA 1D3BB 3CPWP 4NL2A 4XR6A 1YVNA 4YORA 1KQSS 2XDDA 3ZMUA 3COAC 1D5AA 2QQ8A 1QWFA 2HFHA 4QTRA 1RBSA 3VOVA 4MTEA 4CK1A 1UE9A 1GHCA 2LK2A 2IS6A 3GNFB 2Q1NA 3A01A 2FMLA 3MN6A 4KTQA 5J1EA 1RNLA 3M59A 2E8AA 1NMDA 3QNNA 4M7AG 2O8DB 5CIUA 3TO7A 3A8GB 3PX4A 3CCLN 2RJFA 4QS8A 3CMAI 1Z3YA 2OPPA 4PUOA 4BHPA 2QG9B 4CCOA 4PUSA 2VVKA 3U3YA 2EZKA 4JI8K 1ZUUA 4AF1A 3PQJA 3CCST 2KRCA 3TTCA 3TAGA 3ZBDA 4KNYA 3RMQA 1O75A 4IURA 4BL0B 1IGNA 1V5EA 2O7OA 3VF4A 2CO5A 2CQ7A 3Q5FA 2VBXA 2XGCA 4BI8B 2WONA 3GZ6A 1YVUA 2AKLA 3O1BA 3TCJA 1WZOA 3CCRN 1Q95G 1J9AA 3OSGA 4OAZA 2WSCE 2Z0WA 1IN7A 5C4XJ 3CCEQ 4E7ZA 2VBYA 1QVGP 3OBWA 1R7JA 5GP9A 5M1KA 4Z89A 5I9EB 1JJ2M 3U4LA 3VGLA 3UDCA 3LDOA 3U23A 2DPUA 3FMRA 3TVTA 2NOJB 4NB4A 4XTXA 3D45A 1YJWI 4A93J 2ME0A 4DZJA 1TKTA 3D2FB 3E1SA 5FPEA 1CKBA 4IHVA 2VJIA 3OMGA 3OMCA 1S3XA 5GJWB 4IO9L 1LW2A 2LR8A 4I02A 2G8UA 3ECOA 5E1XA 2DLLA 3C4SA 4PGGA 2EA4A 1D0YA 5EJCA 4JHDB 1JCGA 2BVLA 2M2EA 2QUFA 4O5BA 5HODA 4KB0A 4WCIA 3HSBA 2XO7A 2PTKA 3V9ZA 1QBJA 3R3LA 1JLCA 2CH4A 3FZFA 1VUBA 2DCEA 5I11A 5B1AH 4LIVA 3E9PA 1EH6A 4RMOA 3KWIA 1LNWA 2HSEB 4RAZA 3WEEA 2E2OA 1VFCA 2JS0A 3JCMe 1R1TA 1R77A 3CCLT 2ZJQF 4KUDK 1N32K 5FU6C 3I59A 4BKXA 1L3LA 3RZDJ 5M1NA 4B9XA 2FLOA 4AT1B 3SDBA 1WJAA 3HKSA 3MP8A 1FIAA 2CGHA 1UGSB 3HPOA 1BI4B 3OBYA 2NOFA 1WA7A 1U47A 1RACB 2ITGA 4LMYA 1XNRK 1YCSB 4JLIA 1DT9A 1D1CA 2JPCA 1YFNA 2CUEA 1EJ9A 1S72I 3SJHA 1YW9A 2NUTA 3NQOA 2DL3A 3G10A 1TWHJ 4J00A 1RC9A 5AONA 2CT3A 2K6DA 3IRXA 1ITYA 2O31A 3ENHA 1E3HA 3TAQA 2IC3A 3MVPA 3VGMA 3QYGB 1ZG3A 2QTVA 4FM1A 3K70D 4IOAL 1KIKA 2E5KA 4D5CA 4F3OA 1ZYRF 3WUHA 3VQPA 1K6OA 1HD3A 4KT0E 3MMVA 4EJUA 2I2LA 1YBYA 3P8HA 2HBLA 4DV1K 3CUQA 5KRTA 4CBWA 1N78A 2HHUA 3DOLA 4BDPA 3PIOL 3OW2M 1SD4A 3E6CC 4BE0A 3RI4A 1ZKGA 3RQ4A 2KW4A 1OR7C 1NG9A 1KAXA 3WODF 1ZSZA 1UAAA 1UTIA 5HL7L 1SKRA 1VA7A 4PKGA 4AILC 5JLXA 4JKDA 1D8YA 4BXXJ 2JSPA 4G7OF 2HSPA 3JR9A 3VOEA 2XICA 3O2PE 1OZ3A 3TEDA 3G6EN 1UJ8A 4CC3A 1RDCA 4PK4A 4J9GA 4LDWA 2FJ1A 1FSEA 2D1KA 3S3OA 2UXXA 4IUQA 4RGXA 4CCMA 1O9SA 3F72A 3DYAA 5KYWA 1VSMA 3SK3A 3ALYA 4B3MK 2Q8KA 5JVGL 2IA0A 2VN2A 1K73U 2QWRA 3LSKA 1X1PA 1RDAA 2DXUA 4DSIA 3RKQA 1BR1A 1M9SA 3EETA 1K7AA 3QOPA 3LL7A 5L23A 1OCTC 3L8BA 2R5YB 4I98B 4MLHA 2O4GA 3CXCS 2PX9A 4J6YA 2HZTA 2E1ZA 4KICA 3QXEB 1MSEC 4X9DA 1OLTA 2WA0A 2EQRA 3JCUC 5DD8A 2KYMA 5IOYA 3HFNA 2IA1A 2UUCK 1M30A 1NM1A 4J19A 1DGKN 4Y52J 3H8ZA 2JJ7A 4HOBA 1XG7A 3VTHA 2Y31A 3C18A 1CZAN 2EILH 2FRWA 4UNOA 1IAWA 2Z9OA 2QEXT 3ASKA 3A0IX 4KMUX 4ZC3A 2E1MB 2A3LA 2XKOC 1LEBA 2HF4A 3F70A 4FLTA 3I59B 1RT2A 2HHVA 2PQWA 1J54A 1ZHIA 4J9FA 3JRZA 4HUFA 3K9TA 2F5EA 4ENMA 4M77B 2C0IA 1DDNA 3H5AA 4JKEA 3LDQA 2E12A 4NB5A 1V4SA 1J5YA 1UCRA 4LLGF 2ISYA 3H3OB 4FLYA 1IV0A 2CW0F 5LBQA 2DW4A 1EZZB 4O3MA 1IKXA 3U9ZA 2NUTB 4PLIA 4AI4A 5LMNK 3CC2A 2AJQA 5LRSA 4PL8A 3VRYA 5H1SQ 2CUZA 1KVAA 5DUIA 3GTGJ 4PFOA 4QWQA 4L8RB 4CI6A 1ZSZC 1WGSA 1D09B 3CXCA 3VERA 3E9OA 2PUKB 1MJAA 1TUDA 4GGGA 3CMEI 4A61A 4EM2A 1LKXA 3DM2A 4X1EA 1YWOA 1XC5A 2KR3A 3CUQB 3R60A 1HQCA 2J5PA 5AQFA 5TKYA 4PGHA 2QA4A 5F1RA 1WWXA 1H0MA 2EW3A 1ULYA 3OYCA 3KNTA 5AQSA 4CXFA 3KLNA 3AA4A 1QQMA 2CP2A 3EPZA 3P38A 1UDLA 4ZZLA 1DKGD 4EGZA 3VESA 1IB8A 4QQGA 3V4IA 4NXMK 1SFUA 4F7ZA 5GTHC 4RTVA 1Z9QA 4MO7A 3WTZA 3QNOA 1T6SA 1JGGA 3LL3A 2BY0A 1J2XA 3S1RJ 3GTKJ 1R6RA 3OL3A 2QGFB 1VQ4I 4K41A 2K3XA 4M7AD 4DA4A 3AA3A 1WHMA 5FO5A 3J80K 4XKCA 4DHYA 4AHRA 3G71T 4L9JA 3PY8A 1S8NA 2YRCA 4PJOE 1P8ZA 4JI3K 2HYJA 1P9QC 1SG5A 1VQNT 3SQ2A 4HDUA 3T69A 1BDGA 2FUG2 3SWNC 1ZR4A 5DM7R 1NM7A 1OPLA 1KFDA 3J81O 1O3TA 5FLXZ 2LT4A 4ZN1A 3RMCA 4MLOA 3R6MA 3KK2A 3T3FA 4FCYA 3LNQA 1NBWA 5L8RE 1Q8IA 1NKUA 2KEAA 1HKBA 4BJ5C 3W0LA 3K5OA 5FDLA 4JZ4A 3DB4A 5A2QO 2HQEA 2D9TA 1MNMC 1NJWA 5CZ1A 2CV0A 1LVAA 2O0YA 3HOVJ 2K9NA 2JRTA 4RM3A 5LHHA 4LF9K 1FBQA 4Z6YA 5KTQA 3IAYA 1VQ7Q 1PU7A 3ZSYA 1BG3A 3M9AA 2DYSH 2NUBA 2YCHA 3I9V2 2I7NA 1BR4A 4OGEA 1KU9A 2M02A 2DPPB 2VG6A 4IQ4A 2NRXA 3M58A 4E70A 1RAEB 4HNVA 1S29A 2P9LA 2E65A 3IH3A 2RQVA 1LPQA 1E4FT 3NWSA 4BRHA 3QERA 3BY5A 4KUMA 2KRFA 4JJNK 2QSGX 2DL8A 1B3QA 4B9NA 1ZA2B 2WC2A 4MFDA 2X6OA 4PJJA 1Q7YO 1YJNN 4B44A 3IHOA 1AWOA 2GUPA 2CH4W 1TTHB 4CEQA 3GFMA 2E41A 2KK4A 3AG2H 4E19A 2FC0A 2XKPA 3K5MA 3J7ZI 3H46O 2BZTA 3BW1A 2DA4A 2HBMA 2HCKA 3KTQA 3K58A 3ZSRA 4FASD 4MQ9F 2NRZA 1OOTA 1ETYA 3G4ST 2W4SA 4CZIA 5HS9A 1PU8A 3TABA 5J2QA 3H08A 2VG7A 2XPWA 3R6NA 2CJJA 1SANA 4KO0A 1KQ9A 2P6TA 3IFRA 1YI2Q 4DQIA 3WU0A 3I8DA 1ACMB 1RDUA 1CLQA 1OH5A 2R58A 1O3RA 3LZIA 5CQGA 1MA9B 3R2XC 3OSSC 2HHXA 2FBIA 1IG7A 3JB9J 1D5YA 5FROA 1QHGA 4KHWA 3E9LA 1RRSA 2HB5A 4H0YB 4YOYA 1FTZA 4FETA 2L4AA 4CIFA 3T8RA 5J40A 3SUOA 4CF0A 3MKLA 3ZXSA 5KYUB 5KCHA 2W57A 3KZBA 2FBXA 2HD0A 2A61A 2I8DA 4BY6B 2K3BA 4LDXA 1S7OA 4OB3B 3LGFA 3CCSI 2HMIA 4L3QA 4HYEA 4NUBA 5CYVA 3FXJA 1K4US 3W3DA 3M3YJ 4M3DA 1C0GA 1FC3A 2QK0A 3PFYA 1TUGB 2JTFA 1Y7XA 1W7AA 1WYXA 4N4OB 3I56T 3EG9B 5EZGA 1ZBHA 1KCFA 4HNTA 5LL6S 2IG0A 5E8GA 3QFPA 2EJGA 2XPUA 3FE1A 1W36C 4XLNF 1QZ5A 1YW7A 2HL3A 5B8HA 3CZ6A 1LUJB 2O8FA 1YO5C 2NRAC 1QU3A 3I8BA 2OA8A 1W2BA 5GAOm 2KRSA 1VQ8Q 4IRHA 4DFKA 4CJ4A 1SV5A 3LSGA 3PTAA 4BXUA 3QP6A 3UWNA 2X0LA 3HZJA 2K02A 3RSNA 1KQ0A 1HDPA 3FF5A 2P5KA 1KAZA 4FHTA 4BC5A 4M7DE 2FPDA 1BCMA 2O03A 3P9KA 2R7SA 4WX9A 4CK2A 2EJRA 3OYBA 3SPZA 2Q31A 1EKEA 4MGRA 4FE7A 1W97L 1TL3A 5FPMA 2R7YA 4IRIA 2PY5A 1OYXA 4ATOA 1AVZC 1TTYA 1ZG5A 4BUPA 4DTUA 3CCMI 1Q86R 2WBMA 4XOPA 4CFBA 3RNJA 1S1UA 4MMLA 1Z3XA 4YG2F 3K4BA 2PVOB 3Q9SA 4B9MA 4L5JA 4DSEA 2RI2A 2FYKA 3PL8A 2EQKA 2NWMA 3P31A 1KGSA 2UYTA 5EY4A 1EO1A 2FB7A 1VQPQ 1BM9A 4LJZF 1DTTA 2L7ZA 4CEAA 1RT7A 2CDTA 1NKEA 5HY6A 4FJNA 4F55A 4PJOF 2GUIA 3PO5A 3CCLI 1P7JA 2YKNA 4CJ7A 3VS1A 5DM7F 2ZM6K 5IHIA 3QFUA 4B3OA 1YAGA 3DRSA 1VI0A 5DY9A 3VEWA 3RCOA 4BY9C 4HV6A 1ERDA 4YIIA 5BPIA 2FSWA 1T08B 4PJOD 2JNGA 1NK5A 3EKSA 1IHVA 3CCQQ 1EA3A 4J2EA 2FSJA 4E9FA 4V19S 4JI2K 2EWNA 2JUFA 1YITQ 4NBQA 5M5YJ 3HP9A 3S6WA 4ESFA 4ZDLA 1ITGA 3CC2N 4QW2A 1IJJA 3WXJA 3X26B 2LQNA 4RW6A 2CSQA 3IV5A 2VE9A 1QZZA 3HOSA 4XLCA 1RT4A 3JTHA 4E3SA 4EIKA 4FT8A 1IZ1A 4R0KA 3MN2A 3M6GA 3K9KA 1DUXC 4I99C 4M6VA 4ID5A 2OF7A 3HO1A 1BIZA 5DD4A 1WFWA 2Y4XA 4C1NK 3QJYA 4A3IJ 1F1ZA 3CCEN 3E1YA 2AXTC 2QA4N 4LFUA 1M1FA 1QSYA 5C0MA 1A6IA 1ZBXA 4BR4A 4C8QE 1NJIO 3N5BB 2ZXIA 1BYMA 1HKQA 1WQ2A 3NHNA 4EJZA 5CVVA 2XAQA 2E7XA 4F7UE 1Y0NA 4OIOF 2EJFA 2DA6A 3JSMA 4DFPA 4W5NA 5FGMA 4M7AC 5KN9A 4CJTA 4FYVB 3JB9F 2K9SA 3WQTA 3KP4A 4J6XA 2IAIA 1UMQA 1I81A 1SAZA 3LP0A 3KK1A 1KQJA 3D2EA 5FU7C 1QVFS 4H5TA 4XEIA 1KC8U 1R58A 1UJ0A 1KYZA 1POGA 3P5JA 1K4TA 1UZCA 3JB9D 1KQ1A 2RI5A 1IO2A 3B6OA 3ASOH 3JCMh 4A0YA 4HVWA 3DKXA 1RI7A 5LD2C 3MEDA 5EVZA 4YOXA 2CP3A 5KHDA 3R6OA 2OQGA 1UA1A 4J7IA 3D1NI 1RT1A 3V7RA 3ABLH 1VQ6T 4H4MA 3VA3A 3VS5A 3O9UA 5AJ3K 3M4OJ 2Y9ZA 2QBYB 2CZ6B 5IT3A 1M3CA 4CJSA 1S6PA 2O4XA 3BE3A 2KPMA 2EIKH 4BGAA 3ZLJA 2W6LA 2HHQA 3ZT4A 4CGHA 1AOJA 2E4HA 2DOFA 2EB7A 2AK5A 4UVBA 2VYPA 2YNIA 1G3WA 2QEXI 3AA2A 3DKWA 3UR3C 4M3WA 1IKYA 4CCLA 4YOQA 5K7FA 4A62A 5AN4A 4JS5A 3AA5X 3PSFA 3R61A 3HSRA 5I2SA 1BI1A 4PQUA 5E26A 1N33K 2GNCA 2K9GA 4LDVA 3FX3A 1B07A 3ITHA 3FZLA 4Y7NJ 1BB9A 3LSMA 3UKRA 4AM6A 3CMAQ 1LWVA 4XM3A 1X69A 2B63J 3K7AJ 4BACA 2HNIA 3H3NO 1O13A 3FZKA 3AG1H 4UB6C 2PVDB 1YRNA 3T1HK 4BRMA 2QSHX 4AWXB 4I2OA 3MN5A 1QVFA 2Z99A 3QPHA 4CGDA 2KLOA 4M7DF 5EDNA 2RN7A 4ZDOA 4L59A 1SL0A 1QSSA 1GOCA 1JCEA 2YRVA 5GJVB 4C3IJ 2VJ5A 2KIFA 5DCMA 3VYTB 1Z67A 2PFUA 3EH2A 4GKKK 3LFUA 4IHSA 4UUSB 3V8KA 2CP6A 4DS5A 1W2BM 2Z3YA 2ZC2A 3EKUA 4WFBL 1YJWQ 4PJOA 2RQWA 1M1GA 5AQTA 1Q9YA 1RT3A 2DTHA 3FSPA 3KP3A 4C8NA 5GINA 4LLNA 3JSCA 4GV9A 3I71A 4XRSG 3DMJA 1X3NA 4ZHRA 3LANA 1U06A 4CCNA 2P0QA 2YLBA 4IDHA 1BA5A 4N0AA 2DPDA 4FZZA 3HTUA 2CUDA 2X6NA 2Z1GA 3PUBA 2O9SA 2GTOA 4CC4B 3C6HA 4JDSA 5GAOp 4AIAA 4E7JA 3CC4A 2QWLA 2JMAA 3S15J 3G71I 3VDXA 1HPMA 2P0KA 3P1GA 1OQYA 4IUPA 1VQNI 1M90C 2OCEA 3D2EB 4CF2A 2A5YB 3ZOBA 3ZEUA 1XTDA 3ZT1A 4EEFG 2EX3A 2H3JA 1X3ZB 3L2UA 7AT1B 2P9KA 3HSCA 1Y64A 2KJBA 1RKWA 2BZ8A 3B6CA 3K4NA 4FL9A 2XSJC 3OYHA 2E70A 4Y0WA 1SD7A 1MHNA 3BCAA 2LOOA 9ATCB 3DXMA 4UY8I 1BOAA 4NYFA 2QQ9A 1BGXT 4LH5A 2PQ8A 4B9QA 4DTOA 2DODA 4MEXF 2M0YA 3PE0A 4A0ZA 4M74A 3BZKA 4FX4A 5GAMd 2W6KA 3B6PA 1W7PD 3J80E 1C1CA 2ZJRF 3MHXA 3DRPA 2WY8Q 4QT7A 2FMYA 3DTEA 4L6V5 1KLMA 3CCQA 4IJAA 3I54A 3OMYA 4I6MA 2FNPA 2H1KA 3INZA 2B7EA 2JWTA 1USTA 4OU0A 5C25A 1J6ZA 4XH1A 3EFSA 3VQDA 3RRHA 4JX5A 2DIQA 4OF1A 2KDOA 4C8QF 3BC8A 1SVLA 1VQLT 4A6EA 1KQSP 2G6FX 2BDPA 3OYAA 9ANTA 1LWFA 5EYRA 2R7DA 3NCIA 4C92G 1K9MC 3NF8A 3M1EA 5HDGA 2FZGB 4F7UF 4NLBA 5DV5A 1DPRA 1CZ9A 2NOZA 3E66A 4JI7K 1UGVA 1NJIU 1A6QA 4E89A 3WXIA 4B1RA 4C8QD 3FZHA 4M78G 3KE2A 5FLXK 4KGZB 1WPKA 4JNEA 3BPVA 2V8JA 3KVGA 2E6LA 4JPBW 1YIOA 5CQYA 3BDPA 4IPAA 4DSLA 2M4GA 3PSIA 3FZMA 2F69A 4M3EA 1IZ6A 4B8XA 3G4SI 4UUVA 1LWCA 5J1RA 4DEXA 2F5DA 2PU9B 4OX9K 4WCEL 3QYBA 1V29B 3PO4A 2ZZDA 1FXXA 2Z33A 1NEGA 3LWFA 1K8AR 2R5ZA 4C0GA 3TSQA 1GXQA 4LFCK 3I5SA 4CBXA 4ZGDB 2ZJPL 2OAWA 2HI3A 2QM3A 3HB9A 4Y33A 5ILVA 1HLVA 1WJEA 3LLRA 3A5ZB 1NOZA 1TXQA 1ZRDA 4XLHA 4KHYA 2B5JA 4M7YA 2X3WD 3LP1A 3OHRA 1QCOA 3OYDA 1PRMC 3CF5F 2FL7A 4B1VA 4WXDA 1J59A 4ZN3A 2ZCFB 3REAB 4DR5K 2DA9A 1ZARA 4MFBA 2BY2A 4C2UA 1I07A 5E3NA 2CW8A 2BKDN 4QAGA 2LY1A 3E6DA 4KTZA 3UT1A 3WTYC 4QS9A 1VQ9A 2ITMA 2D0OA 2XK0A 3I56I 4BH9A 2JGUA 4M7DA 1IV8A 1R9TJ 4EW0A 1MBFA 4CVNE 4DOVA 2HEQA 5GANd 1GLDG 5ICFA 1GXIE 2KFNA 3GWZA 2YUPA 3HG9A 1T3VA 2VQFK 1PD0A 2BY1A 1ASUA 3EFOB 3BT9A 1IXCA 3RMSA 1ETKA 1L0OC 2VQEK 3SDZA 1PM3A 2QK9A 4P96A 3SZTA 1LCKA 4CEEA 2L01A 3QU3A 3IS9A 1NZ9A 1EIFA 1YX3A 3CVTA 5DDGA 5LL6Z 2WSFE 4A3BJ 2V52B 5LHIA 1VYVA 3CMAA 1VQ5Q 4RGSA 2IS4A 1XTAA 1M1KC 2V4JC 4RM2A 3KBGA 3MP6A 1M90R 1S22A 3HRMA 3H1VX 5IAYA 2BGGA 3VEZA 5J3LA 3CC7Q 4DR2K 2RM4A 4BRAA 1Z77A 3KZYA 1HNWK 4KUIA 5JVHL 1I94K 2DYBA 3FM3A 4CESA 3MP1A 1K9AA 2VJ4A 3FRNA 3HGGA 3CDLA 2DEUA 4JRPA 4GY5A 1W6XA 4PNOA 4YDUC 5FKOA 3GBTA 4HTLA 3FXUA 1WHGA 2BVMA 2VQHA 5DS9A 3MFKA 3CMEQ 3A8YA 3HUGA 2Q1ZB 3N4MA 2NRTA 2LMDA 2UUZA 3FBNB 5E84A 4KMFA 2D0QB 4WQ4A 2FBVA 1HKGA 3BP8A 2HXIA 1IF1A 1IXDA 3ZETA 4NNJA 5DM6F 4M75E 3CCVA 4FOIA 2G8IA 4B6MA 3S6IA 2E5LK 1N27A 1TWGJ 5E3LA 1YJWA 4JAXA 4RB2C 4QVZA 1W7PA 3HM5A 4A4FA 2LFBA 5C10A 2JJ9A 4HT8A 4FJIA 4R56A 2QTXA 3DBRB 3KLOA 3HBLA 1ODDA 3CPWA 4MIMA 4KRTA 2R7TA 1FMKA 4L18B 4DJAA 1F5TA 1DP3A 3F0CA 2KP6A 2P5GA 3F10A 1VQ4Q 2R5ZB 2VWFA 2EGEA 1XN7A 5TGTA 3A2FA 4IX7A 3H5RA 3VSLA 2Z1IA 4FW2A 2HAXA 2I5UA 4J7FA 5LJ3d 3VS4A 4I0AA 1D1BA 2ZMEA 3QBXA 1QWEA 1FN7A 2OZ6A 1OULA 2HNHA 4H03B 1VQ7T 1KD1C 1BO5O 3FXOA 4BC2A 1LFBA 3NHGA 4C8QA 1P7IA 2RPIA 2CGJA 2EFPA 4JI5K 4JRIA 2O8BA 3QPTA 1GOAA 4BJTA 4HF1A 2HPMA 4CJRA 2K3FA 2BXYA 4F7UA 2WOMA 3SAHA 4L9VA 3SMSA 4DTXA 1DEJA 2DTOA 4NHJA 2J4RA 2NXNB 1I3QJ 2HVIA 2XY8A 1HKSA 5LEKA 1RAAB 1FNNA 1B6AA 3B6AA 2FEZA 3HI0A 1G8XA 5GMKi 3WTSC 5KGWA 3KK3A 3CCYA 5LEJA 5BRDA 2L3QA 2FVUA 1B4AA 1QZ6A 4IEEA 1VQ8N 1T39A 5L3CA 4O4GA 1N8RO 1B9FA 1SSFA 4ZTFA 4M7DB 2KDSA 1QVGA 2XRLA 4O44A 1XHXA 3ZQIA 1S72A 1KSWA 1KQ2A 2JA2A 1K0SA 3DU5A 5CVJA 5FFZA 2CQXA 4A3DJ 2HDWA 2F48A 5EC7A 1IRGA 3J7YP 1R5GA 2HTSA 3CC4N 1R5ID 3ASNH 1YI2T 1LB2A 4JD2B 2KQ2A 3OIQA 5KE2A 3AY9A 4H8KA 2E3IA 2FZKB 3ZR8X 4D1QA 2K79A 1MW7A 4B9LA 4JN4A 1F43A 5GMKm 3AVKA 1J7KA 1RUNA 1OX9A 3H1QA 4OPHA 1GLLO 1VQPN 4HCZA 2A40A 1X3MA 2ASPA 2RHXA 1NK2P 2PBIA 1B7TA 3CJCA 1VQ6I 3D4VA 4B1ZA 3FXMA 2YUQA 4CERA 3BY6A 1VF9A 5M1OA 3A8MB 1WJRA 3PMIA 1BJAA 2DFIA 1EH7A 1XCVA 1JLEA 1L3UA 2DA2A 4QCLA 3JW4A 3CTAA 3ECHA 3FMQA 4LNPA 3QEXA 2IGIA 1Y1WJ 4XTYA 3HUGB 1NKBA 3FKJA 3PMTA 2DMQA 3C65A 1SL1A 1K8KB 4CC7A 2STTA 3CQXA 2L7FP 1B9NA 1WN7A 4DGWB 3QSUA 2OV7A 4J8FA 2JA6J 3CCQN 1R1VA 2GWKA 2RO0A 2FU4A 1BL0A 4EJWA 3L2ZA 1BHLA 1Z1DA 1UB4A 1B72A 3CPEA 3E6MA 1M1KR 5JI6A 5B66C 5D5UB 4GW6A 1YITN 2ABLA 1O1WA 2OJ2A 1W7PB 1UUEA 4PWDA 1Y71A 1RLPC 1KAYA 5LGTA 2IRFG 1RI9A 3UKUB 1ZGAA 3NAEA 3KP6A 4CJFA 4LB6B 2NUPB 1MWKA 2HNYA 2VLAA 4RLQA 5EF6A 3HM9A 3ULRB 3I55A 3M54A 3CCSQ 5T7BA 2HHTA 2ZO4A 3DXJF 3ROUA 5KI6A 3T1BA 4WYBA 4ILGB 4M71A 3U6FA 1ZREA 4EMKC 3AG3H 5IYBJ 1TYQB 5LJ5d 1XS9A 2GEMA 3RR8A 3WGHA 2MC4A 3BTJA 1SQKA 1G3YA 2ZMEB 1B8IA 4FWSA 5D6EA 4CCHA 3OYEA 3BQYA 3FB9A 3D7EO 2E3HA 2XY6A 2JA8J 2CSOA 4CF8A 1WBDA 5A0GA 2OCCH 4ELZC 3GFLA 3X24B 3BR1A 1R4MB 2HGCA 1OVQA 2BOLA 4FYWB 3QEIA 5EOYA 1WI7A 3WNGA 1ZK8A 3U3GA 2HHSA 2FOWA 2FBHA 3V8JA 2HOAA 4DQPA 1VQPT 2E1HA 3ID8A 1PP8F 1ZLJA 3EL2A 1JLBA 1XOVA 5AIQA 3PUFA 1T0JA 2EFQA 4IIMA 1QNTA 4RBOA 4EV0A 3TAPA 3FXRA 2E34A 3AARA 3VS0A 4G6QA 2ZFWA 1UELB 1KD1R 2RHKA 2FQ3A 2D6FA 4HLXA 4JKAA 1PU6A 3EAEA 1JTYA 3QDFA 4RKUE 1RLQC 2QWMA 4RAYA 2O9VA 2FHDA 5KYXB 1EBMA 3KYDB 4C2TA 1SFKA 2HQXA 4BRQA 2OBPA 3CCMQ 4I2PA 1MD0A 2HU9A 2KRMA 4FVUA 3LDNA 4M75D 3KLFA 5IPAA 4ENNA 1ATNA 2D0PA 1H92A 4P1WA 1GLFO 1W0TA 1X2MA 4HVJA 5AZJB 2R7ZJ 1WOQA 1OQKA 4HX7A 3CMEA 1VQ9N 4BBRJ 4K43A 2E1YA 2VOPA 2WC9A 2M0CA 2OPQA 4JRQA 4A3GJ 4ASNA 3JSOA 3RWUA 2RQTA 1G59A 4DTJA 2CH6A 3HOUJ 3CCJT 2VODA 4DYCA 2J5OA 2HYFA 3OOUA 3K9JA 4IIOA 3BJAA 2DAQA 2HKNA 2LCLA 4BQZA 4K42A 2FPEA 3HIFA 1WHJA 4KJZA 1NKCA 1LE8B 1VRUA 2F2XA 3CPWM 2XASA 1GBQA 3EFRA 5J2MA 4AHCA 1X6GA 5HRSA 2HWVA 4V2GA 2F8TA 5A0LA 2Q97A 3LPUA 2CP7A 1Q86O 3RSEB 4ELYC 3CMAN 4ISFA 3AO3A 1IGUA 2V26A 1P7MA 1U8BA 1JJ2P 2X35A 2ABKA 1VQ4A 1MJBA 4M3UA 1S5LC 4M72A 2PNIA 4MDAA 3I9QA 3OSFA 1B72B 1T38A 3UIQA 3QBWA 3HJEA 4PKCC 1VQLI 1YE9A 1GFCA 1SD6A 3QIOA 3VQEA 1ESVA 3QODA 4X65K 3CETA 3H0IA 3A8OB 3LZJA 4DTRA 4BUGA 1DIZA 2LF7A 1DPUA 4WF9L 3LSPA 3DLRA 3I33A 5GAN2 4N9IA 2EBIA 1A0NB 1HNIA 2ME6A 4DTNA 1N8RU 4E1NA 3I3LA 1ZUKA 2LLKA 2AXLA 3NGZA 2O5RA 2YR2A 2A69F 3FIWA 1PKSA 2FXUA 1JGSA 1SFOJ 4BR0A 3JRGA 2QW9A 1BWFO 4IRGA 1U84A 3GX4X 3CI5A 3H36A 3CFPA 1N34K 3A0HC 4HG2A 1ZBUA 3EYIA 1YJWN 3HPGA 2QASA 1U78A 1NK7A 3QPLA 3I4NJ 4PKHA 3S1QJ 4XNFA 2K5IA 4RA2A 4DUYK 4OINF 3V8LA 4ENJA 2COWA 2EV0A 1G5VA 3O1WA 4VUBA 5E1WA 5J1YA 1A5WA 4G9YA 3M56A 2E1OA 3GG4A 2RHUA 2XRIA 1MJ9A 3EG1A 1IBMK 2RH2A 1W5SA 2CZ1B 1KHIA 4OKJA 5FLXE 2MI6A 3OOPA 2D2WA 4NC8A 2Y2ZA 3R6SA 2G0EA 2ZNZA 3HL2A 1TOVA 3UA7A 4O8KA 5HK0A 3T8TA 4IJNA 3BG3A 1RZ4A 3ATUA 2IJLA 1FLIA 2XVCA 1U04A 3EGDA 4CJWA 3CD6Q 4AG1C 1WNSA 2QI2A 4FTHA 5B3SH 3DEWA 1I8FA 3VF6A 1IRFA 3GBGA 3U9DA 3MEXA 5BREA 1NHAA 3RPQA 2VT2A 4A3JJ 5EXWA 1D5VA 1ETQA 4OIPF 1JKRC 2P9NA 1J5OA 3SJMA 1MUYA 1VSKA 3L4IA 2V1NA 5FU7B 3H3VK 1OCOH 2F5KA 3CEYA 1BL3A 4DR3K 4KHPK 3MDQA 1OKRA 4BAYA 3FK7A 1AZGB 3EE9A 4RG2A 1S72N 1O7FA 1Q18A 2HQHA 5SWMA 3KHYA 3QYHB 3W6JB 3MCZA 4HPQA 3PQKA 3LA7A 3PIPF 1TK0A 2ZJ2A 3O4QA 3TR8A 4UOBA 1ZYQA 1RL2A 4HVUA 2EV5A 3A5LC 1HQEA 5C42A 2H8RA 4A5AA 1LAWA 1UHSA 2P4RA 4M6XA 1JLFA 1H8AC 2FBYA 1YN8A 3RUXA 3G25A 1SUQA 4M75A 3CCSA 2HOTA 1NGDA 3QESA 5E79C 3FDYA 1S5JA 3G0QA 2HVSA 2M0MA 3M8SA 2AQFA 1U5SA 3EUHA 2KI7A 1WJSA 2K9QA 5HP1A 1AHDP 4X0GA 4ON0A 2EQUA 3PM1A 4U88A 2CZ7B 2W24A 2NLXA 1KG1A 1HNXK 3WTTC 3SZ2A 5HROA 3CCUI 4J2DA 1GDTA 2KZMA 1USSA 2DFFA 4MEYF 2M16A 2F4IA 2KIUA 4DV4K 2C06A 2MFZA 1TNSA 3CESA 4CEOA 2ESHA 2F8SA 1VSLA 3IH7A 2OYQA 1LFUP 4EA5A 4YFXF 3K5LA 5AQIA 4IVNA 3MZHA 2JM8A 3R8EA 4Z4FA 4DU4A 3KFVA 1G3TA 4ZYGA 5IT9Z 2COZA 5CKHA 5GAN7 1OU9A 1FK9A 1OV3A 2WY7Q 4L0YB 4HSBA 4FVMA 3DBHB 3GTQJ 4CDGA 1S9EA 2CQQA 4ETSA 2K86A 2DXBA 1XGMA 3HL8A 1FYLA 3HM8A 4KHUA 2NVQJ 2E5QA 3CP8A 1ETWA 5LRRA 1MGTA 1KRPA 2R7UA 3LSIA 2PJRB 4C92C 4GY2B 4QPQA 4IHTA 4QS7A 3LDLA 3QP5A 1LV5A 3DFGA 3PV8A 1AKHB 4KHNA 5A0DA 4DBRA 2P4WA 4XLAA 4M78C 4B23A 1VQ7I 3P39A 1JQQA 1E6GA 1UB9A 4W5QA 4M3XA 3H3ZA 1BIUA 1BIBA 3S41A 3H92A 1TUCA 2M8GX 2P51A 4EZ9A 1TQIA 2CG4A 3TW6A 2GFAA 5IY5H 4ZYAA 1QA6A 4EJOA 3HRGA 2EYWA 3CCLA 4E4HA 1QPIA 4M77E 3SHFA 2DMUA 1GRIA 4DV3K 4XTZA 1Q86U 3M55A 2H8HA 2F7TA 4HEA2 3K4JA 4IO9F 4B4CA 2L0KA 4X34A 2OUMA 2G8HA 4HX8A 1M8VA 4K11A 1O3SA 1JHHA 2P9NB 1S6LA 1PDNC 4BDYA 4KFBA 3NBPA 1KSPA 2ADUA 1WI9A 2JVVA 4D6WA 2ECZA 2CYYA 3T7ZA 1LWEA 1Z9ZA 3DBLB 2JTMA 2DXCA 1VIFA 4OMFB 5FD5A 3E5XA 1MZBA 3BG6A 1VQ5N 2QVOA 1T6DA 1BU6O 4YOWA 3TSWA 2L3RA 5AQOA 5CVIA 5EZHA 3UPUA 4EATA 4IBNA 3AT1B 4CC2A 3E9GA 2GBZA 3CQTA 3EHRA 3LAKA 3LWLA 2DBMA 4NZGA 5AQWA 2A6EF 1YI2I 2GQVA 4CW7B 2F2VA 3AVFA 3KKSA 2RHYA 4RLFA 5LMUK 1C0MA 4P55A 1KZHA 2KSSA 4CHOA 4DW6A 2WTEA 3TO6A 1K78B 2CP0A 1K73C 4YTLA 1U9NA 1PUFB 4CYDA 3CMEN 4V19K 3K59A 2VC0A 4Z4HA 2A6TA 2M51A 4Y92A 1CXUA 4E7SA 4BG9A 3A5OC 1Y56A 2R4GA 3LOCA 4FE4A 1IHWA 1EWRA 5JMVA 3D5SC 1QVUA 1HJRA 3G4SQ 1N5ZA 4BEHA 3J80O 4N4NB 1JLAA 4M9ZA 1TQPA 1T44A 2JM9A 3I64A 3K6GA 3VETA 2ISZA 3V7SA 3L6QA 2DMOA 2XUBA 3IKMA 2MW8A 1MDMA 3CJBA 4GFBA 1AA7A 1K4SA 3TAFA 4DBQA 3D5RC 3CWAA 1U3OA 1REVA 4LF8K 3VS3A 4IOAF 2YHAA 4HXJA 2P9UA 2YUSA 3T5XA 4WFNL 1H9GA 1YLFA 5F1JA 3C7NA 2A5WA 1VQ4N 2BZXA 1BQMA 1WAFA 1AWCA 4HSTA 3NTKA 2XC7A 3CDHA 2KLAA 3KTUA 3M4YA 1H3ZA 1I1SA 4OIRF 1QHHD 2FF3B 1MH4A 3S14J 1MPGA 1KTQA 4DFMA 3C95A 3PIOF 1XGOA 3PIPA 5K7ZA 3L4QA 5DUKA 2B0LA 4HDVA 1T0FA 2DTIA 1JXBA 1M3QA 2RF2A 3HHGA 3VMFB 3K0SA 4BJ6C 3G1MA 3F21A 1Z6TA 1VQ5T 4FSXA 3N97A 1N9SA 2P9SA 2PUOB 3FISA 3H9GA 3B73A 4NQWA 5D8LB 2JPSA 3U2RA 3I56Q 1K8AO 1ORPA 2WBNA 3VEOA 2DTUA 3CC7T 2J6OA 5JVGF 5E17F 4J9EA 1XQSC 2E71A 2LSNA 3KYLA 3IMXA 2QEXA 3D5LA 2MA3A 3AGRA 5A2QK 4LDYA 5LJ5j 1XHZA 2OZMA 2CMPA 1GLBG 2Y0SA 2WAQA 1BU1A 4JOMA 4OMPA 5HDNA 3FEOA 4FLUA 2R0QC 1QQJA 5AT1B 2RNAA 3GIBA 4B08A 3JRCA 2NZTA 2CGLA 3K10A 2AHJB 5M5WJ 2EIJH 2F1LA 2UU9K 2HKQB 5KGXA 3C6TA 2Z16A 3DU6A 2OTLT 1HW5A 4MFEA 1WAJA 1Z9CA 3S32A 4IQJA 1CSKA 2OPTA 2AHQA 3BWGA 4FQGA 3GLXA 1JKPC 4FM4B 5BS6A 2O8DA 3BJOA 1MIJA 1KG2A 3IWZA 1P92A 2MH2A 1PJRA 3OYIA 1W0UA 5M1QA 3QOEA 1WPYA 2Y9YA 2P7CB 5DK5A 1KU3A 3N0UA 2CS7A 1KJWA 2ETJA 1IH7A 2ATQA 1F36A 4BGDA 3CJTB 2VT3A 1LQ1A 2E10A 2BV6A 4CYCB 3THYB 1YQLA 4JK1X 3NTIA 4LF6K 2P5OA 1WLPB 4DF4A 1GVJA 3OWTA 4FYXB 1M3HA 1EETA 3J7ZO 2COYA 3CO6C 4FWRA 2RKHA 2EPFA 4OLBA 5IWAK 1C0FA 3CCJI 3I0SA 1EP4A 2BYVE 1R1UA 5L3DA 2BUDA 1WFXA 5D8KB 4L5GA 1BN5A 1TL1A 3UKGA 3AVBA 1WHLA 1UG0A 2ZPFB 5J6XA 3VFZA 2PG4A 3S16J 1TP4A 4ITVA 3M8RA 2VE8A 4NOYA 3KP5A 2RQUA 3QJ6A 5EX5A 2KE9A 1RFQA 4RGUA 4C8OA 1YJ9Q 4M77F 8AT1B 3QIPA 1N6AA 4PSXA 3AVIA 2VXDA 3TW7A 4PIIA 1VSHA 4GVMA 5GAOn 1RTIA 3D2FA 3J7YJ 1TLHB 4IWVA 2M7BA 1PWTA 1PVEA 4ZYHA 3G71A 1K73R 5BPNA 2PFBA 3CCSN 1LDKB 3C7NB 1QKXA 1ETVA 4M77D 2HNDA 4AIDA 4X6AJ 1VQNA 4JYKA 1I3AA 4FPBA 1TWFJ 1QHTA 2GBQA 2LJ3A 3ZGKA 2TRTA 5ICCA 3JCMW 4JHDA 5F2RA 2UXDK 1FYMA 2M8EA 2O8KA 3J7AP 2ZPEB 3QRFF 2XHBA 4Y91A 4G12A 3GLLA 4N76A 5FPDA 5C24A 1M3BA 4ESJA 4CD1A 1X1BA 2JTVA 4AYBN 3ZT0A 5J8FA 3R0JA 4PJLA 4B3TK 1SS6A 4YHHK 3ULDA 2QYZA 4OOIA 1V54H 2E36A 2FOKA 2RQQA 1UAXA 3KZIC 4J2AA 1QPMA 2W82A 3EH1A 2JWLA 5JVTA 5H20A 2DXTA 1KQ8A 4IZ9A 4N4GA 5C3EJ 3E9FA 3ID6A 4DQSA 2M87A 4EHUA 1YHQQ 2DA1A 2L0AA 2H3EB 2HVHA 3GFJA 1KG4A 4F92B 4HCCA 3VEVA 1QSLA 4E7KA 1HXDA 3VYRB 1VZ0A 1FMWA 1TWAJ 2HQNA 3WQUA 1JXMA 4EAHD 5KQDA 4J9DA 3BG9A 3V42A 3A2KA 2CKKA 3E19A 3L0QA 3KXTA 3TARA 2CV1A 3C7JA 4CZCA 1MMSA 2M5WA 4H0PA 3GF5A 4DSJA 1Y57A 1HUXA 4GV3A 4CH7A 2FQ4A 4CRIA 3MKWB 3CCMN 2DJZA 3HDDA 2WWYA 3N4PA 5ERIA 2V9KA 3UF4A 2DY4A 4B8AB 4AFZC 2L9NA 1I5LA 2K5FA 2VJJA 4EW4A 4FWOA 1QS4A 3PIOA 1SC7A 1RABB 2ASOA 3KK7A 2PMHA 2W10A 4WK8F 1VQ6Q 2LP5A 1HDDC 4CJKA 1NNEA 4D9JA 5D3GA 1JKOC 4FISA 1ZGWA 2NLUA 2BGCA 4RGRA 2FD5A 2A6HF 4CA0A 4K25A 1WJDA 3L42A 2PEXA 3OSVA 3ISPA 1ZBLA 1TW2A 1W70A 3U9GA 3HEFA 3CJRB 3PLAA 4G6TB 3LW5E 1Q1HA 5I2MA 1GUUA 4MQ3A 4M63C 2H94A 2QQBA 2M1BA 1OPKA 3FLGA 2GGRA 3BR6A 1Y96B 2JZ2A 4OJRA 2NNNA 2FSNA 4NDLA 3FXLA 1FW6A 1VNDA 3GOXA 2VIXA 3SI6A 2ROLA 3MKDA 2KDZA 4E2FB 1B92A 4P9FA 2TDXA 2DO3A 3VQ7A 5FRMA 3T9NA 4N5SA 4Z8AA 4Z4IA 5GAOr 3WHBA 5L3GA 1HQUA 4I9QA 2ZQBA 1IDYA 1K8AU 2ACJA 2ZKZA 2X78A 2JRMA 3CMMA 4ISGA 5EG0B 4F14A 4HVVA 1V5GA 2DPNA 1QRYA 1KQSA 1OJLA 2R5YA 2OTJQ 5CPRB 5HCKA 4CHNA 4FK4A 3GVAA 3KX2A 5AQMA 4M78F 5H2FC 2UXCK 4E7LA 4OB0B 1T56A 4M3ZA 3WE2A 2V1UA 1AD5A 5MLCQ 1NG7A 1U2VB 1Y8RB 4LF4K 3CCMT 2FF4A 3VYSB 3ZN0A 3ZX3A 1UFFA 3DF8A 2O61A 5AQUA 4YIRX 4KISA 2HF3A 3HRUA 3EZ5A 4Y15A 4IG0A 1NG2A 2MF2A 3OH6A 2KNBB 3AO1A 3DEUA 3HTRA 3Q0UA 1YJNA 2YHWA 4X62K 1NH3A 2L5QA 3UATA 1K76A 2LH9A 4EA4A 4EMKB 2JTEA 4EDUA 1TKXA 2LY9A 5J1UA 4WQ5A 3JCMg 3ERMA 5GAGP 4Y1CA 1LCUA 3G3ZA 2BTFA 2X1CA 2IVOA 4HHTA 4BHBA 4KBOA 1T2KA 1E2XA 1STZA 1X3UA 3I4MJ 4B3SK 3O8GA 4M77A 5LLQA 5AFUH 3K4KA 3R1XA 3JCMd 2A42A 1MBEA 2DYIA 3C0BA 1NJYA 4R5PA 2BEOA 2Y30A 1IN6A 4BRFA 3BTLA 1S1VA 4B43A 4BR2A 1J0RA 4ELUA 5GADP 2DMPA 1Z25A 3KLEA 1FYNA 1TNTA 1TQMA 1M90U 2R3SA 1KVBA 1UG2A 2VXZA 3TP0A 3AAFA 5TISC 4KT6A 1QHAA 1VSJA 4JI1K 1OCPA 2QEXN 3NMZC 3M1CA 1TZLA 3M8JA 1SZ2A 1JUSA 2CQNA 2EJ9A 2YRDA 2PI0A 2Y0SN 4B22A 3WXKA 4CJ5A 2WAQN 4DR1K 3OQ5A 3BZCA 3JV3A 1HX1A 5HLHA 3DLHA 4LXCA 5AQRA 1OPCA 2W40A 4DMNA 5IT9K 2VXEA 4UV9A 4OPAA 1E3OC 4JI0K 3B02A 3WNFA 2EQIA 3LYIA 3DLLL 2O8XA 3Q0VA 2K2VA 2MABA 4WTOB 4DFJA 2YX4A 3WXMB 3QBYA 3DJCA 3M5AA 4ORZA 3K1PA 2M30A 2EHGA 5IOZA 4K8XA 2JW4A 1VQLQ 3RQIA 1T03A 3U1KA 1FX7A 3SB2A 2NYXA 4XMYA 1A35A 2EVRA 1SEUA 1U4BA 1GFDA 3CCRQ 2D1HA 4OMLA 2V1XA 3LH0A 3BTCA 3Q1JA 3L9FA 2DETA 2QDLA 3O3FA 5F64A 2A1RA 1TV6A 2H56A 5GAN5 1NGNA 2NOGA 3VF2A 1Q7YC 1KU2A 3IRQA 1WXBA 2G7UA 3L1AA 3TP3A 4KITB 2Q2EA 3O8VA 4S0HB 1N5YA 4XKVA 4BRNA 1E4GT 2IIRA 4V2FA 1AWWA 1XMQK 2NS8A 3SAFA 1A5VA 3ERED 4PJMA 3CD6T 5KN8A 3M7GA 4CE9A 3DLEA 5GMKj 1HJOA 5D4RA 3VSKA 4BRGA 1R4NB 1W5TA 2ZWHA 2XDBA 2V6EA 1JJ6C 3ISNC 2RNGA 1SL2A 3AO4A 4LY7A 2V1RA 2DD4A 1WDXA 4KH6A 3TSZA 2Q0UA 2VKDA 1F21A 4O0JA 1SAXA 1APLC 2LP0A 2E2HJ 3G71N 4PJOG 1BIAA 3BDDA 2CT4A 5D4SA 1VQMT 1YQKA 3NF6A 4CEBA 2HS5A 3META 1VQNN 3M8FA 2YUOA 4U0YA 1PUEE 2EZHA 3BPXA 3UB5A 1EV7A 1TBXA 3FK6A 3SD4A 2HHWA 2DTZA 2BY3A 2G8VA 5IP6A 1WB9A 5GAOl 2FNAA 1SMYF 5CR4A 4BU2A 2HW3A 3I0RA 1ZH5A 5M3MJ 4DTMA 1RBRA 2O8CA 3DLGA 3CHWA 4PCQA 2LTPA 1VQ5I 2KIMA 3A5MC 2WFBA 2QKMB 3KKRA 4HV5A 3CUQC 3CC7I 4H5NA 1D0ZA 1WZ2A 1JRIA 2V7FA 4IFYA 1QZEA 3O6WA 1OKJA 3RZOJ 4UY8O 5F27A 3C6AA 3BZ6A 2EPDA 2GFUA 4I7HA 1JHFA 4IOCL 4FJ5A 2E2IJ 2V8IA 5FLXO 1NOYA 2OD5A 4BQNA 2JMWA 4Q5SF 3KLGA 4HKEA 3GTPJ 3IWFA 2K5CA 3TPQA 3ZMDA 5D6WA 3CQYA 3CCEA 4JJDA 2PYLA 1J9IA 3REOA 2YHYA 3JCMV 2OTLI 2MK5A 1WJQA 3SBTA 4BR7A 5E20A 2W85A 4YFUA 2OJED 2XIGA 4XU0A 3PVQA 4BC4A 3MPUB 2DT6A 3CCVT 2XU8A 2Q3SA 3NTHA 1KG5A 4F17A 1K1ZA 2DL7A 3RMDA 5BPDA 3JRDA 1OFCX 2YT6A 1NGFA 5KYUA 3DXKA 1VSEA 3G6EQ 3CJAA 1DU0A 2KHOA 4HUEA 4JLHA 2M1HA 3JB9G 3CCUQ 3IH2A 2SRCA 3G4SN 2LSOA 1ASWA 3V4GA 3GP8A 2QSFX 3K5NA 2MPXC 4L5EA 3H6ZA 4KH4A 1VQKT 2CGKA 2XGDA 5K5QA 5FRNA 2NYSA 2HSTA 3OV8A 2IP2A 4BQOA 2HDDA 3EG9A 2Q2EB 4ELVA 2XGXA 4HSRA 2CH0A 2EKOA 3S9HA 2ELJA 2X85A 3QAHA 2LDMA 2ZXJA 3O5BA 2Y1IA 4A6DA 4C5GA 2AT1B 2YG8A 1WHKA 5HDKA 3VUBA 4XIUA 3SQ0A 3N4QA 1SRLA 1Y1VJ 2QYOA 4Y4RA 2EKHA 5AQGA 3TBIA 1JXEA 3MZ8A 1YXQA 4H0TB 4ID1A 4FJMA 5M9OA 1Q82O 2EV6A 1YYVA 4FT2A 5AQVA 3GCMA 2JN0A 5KQ8A 1XB4A 1GCQA 2DFEA 2EFWA 4RCHA 3VTIA 1Q7YR 4B24A 1TKDA 1NLPC 1BOBA 1RAHB 1U1SA 4XLPF 2V51B 4A2BA 2X4HA 1HYZA 2K40A 3V7CA 3RVCA 3MAJA 4CBUA 3RTRA 2E1NA 2AS5F 2OAUA 3TL4X 5TKWA 3I56N 1WVRA 4DF8A 3O08A 2ZXHA 5FB2A 2ZPBB 3MWTA 2M9UA 4KH5A 1K0XA 2TCTA 1WUAA 2YX7A 5FD6A 4XK8E 3F9MA 2CRGA 2VKVA 2CW7A 2XF5A 3E3VA 5CKTA 2O8CB 1E7OA 4C92B 2CFXA 1ZUYA 2VGMA 1X9JA 1NJIC 2MWPA 1R00A 1X01A 1D0XA 2YSRA 4F52A 2X6XA 2D5RA 5CO7A 1MNDA 4C0DC 4M78B 4QIWN 1KC8O 4XQ3A 1RILA 5KYNA 1JE8A 4M7DG 2W1OA 3BF3A 3DV8A 1X19A 4MHGA 4B8CA 5CLSA 3H9NA 3AL0C 1MMDA 1WCMJ 4A12A 1JJ2S 4CJVA 3F22A 3IDHA 2YHTA 2IBDA 4N4IA 2RB6A 5JHUA 1KYWA 2DL4A 4IHWA 1D8JA 5F0HA 4XICA 1KU7A 4CF1A 2F2WA 2RC4A 2XMFA 2HPIA 1YP5A 5GAN6 5FLMJ 4AUXA 2KIQA 4J9HA 5GMKe 5J47A 2KHMA 4BY6C 3QPSA 1YTUA 4BS9A 2HOSA 4YOUA 4DV2K 3CJNA 3VN5A 4U67L 1V55H 3K70C 2LX9A 4CHZA 1WNLA 3OB9A 3DQVC 2UUAK 4DSFA 4GLKA 2IXSA 2QKKA 3TQ7P 5ELZA 3LSRA 3HP6A 5HOOA 4A63B 1XQHA 2P5VA 2GTJA 3DXKB 1T8IA 1V76A 2BHZA 3UNGC 3LA2A 2FZCB 2WACA 3SZPA 4BQLA 1JEGA 3HOYJ 2F5FA 3EUAA 2C0TA 3VW4A 4BRKA 3MEAA 2KKZA 2A6AA 1T3SA 4CZGA 4FLXA 4QVCA 1RT5A 5L3BA 3CP2A 2E20A 4A3MJ 3H6EA 4DQRA 3I55T 4BRIA 2QM1A 2E1CA 2JWKA 3TKYA 3BG7A 3OS1A 2BHYA 1MDUB 1JXSA 1IW7F 5GAN8 1NLOC 2IDOA 2FRYA 3M0QA 3DOKA 2Y1JA 2XB5A 4CGJA 1YS6A 2DZCA 3GW2A 4A3CJ 2Y4YA 5IYDJ 1SFXA 4IEJA 5JLFA 3GEZA 2B4JA 4GO1A 2A28A 4XU2A 3H45C 4O55A 2LRDA 1JJ2A 2LNBA 4CZMA 1XWLA 1N3CA 2K4BA 4D0PA 4J8OA 3AVCA 4KA4A 2Y69H 2EZIA 5IP9J 3JCMf 2A08A 2M4KA 4FW1A 2PLYA 2UUBK 1S6QA 4AFSC 4RWTA 3CFRA 3C2GA 3S2WA 1IREB 3GL1A 4FYYB 2I10A 2V75A 4A4GA 4FIBA 1RDBA 5ICEA 4C8QG 2RDPA 1QGPA 4Q0BA 5M3FJ 1KVCA 3MQ0A 2ZJPF 2QBYA 2RJDA 3OYNA 3CLOA 3HVTA 4A5NA 4F7UG 1GL5A 3MXMA 2X4XA 4XLFA 3DPTA 3ML6A 2IPQX 4YELA 4J9CA 3GTJJ 1P90A 3OW2S 1XQOA 4JS4A 1VIEA 4XN3A 4PLLA 3WGIA 5KRSA 2XROA 3CXCM 2EYZA 4IFVA 4BG8A 5TJJA 1N9RA 2XF6A 2Y90A 4IXAA 2K3PA 3JAMZ 1TS9A 1BOTO 4M41A 4FOEA 1X4OA 2FRHA 2LMJA 2JVGA 2R7WA 1R8OB 1FP2A 1QCNA 3X28B 4AIKA 4BE2A 5KNLA 1P2FA 3AVNA 3IUOA 2LNHB 4JX6A 1WI3A 3E6BA 4IUUA 2NOEA 2V1QA 4KREA 1Q81O 4XIDA 3REBB 4C1NI 4O5FA 2VL8A 2JT4A 3QZ9B 1YIJT 4OKKA 4II2A 4ZDPA 5KPRA 1VQ6N 1YJ9T 1O7LA 1XD7A 2G9WA 1NPPA 1E3PA 1WXTA 4ILJA 4HX4A 2WV1A 1P6RA 4CIGA 4N41A 2WV0A 3AGKA 3BR3A 2LRQA 1RDDA 3FWEA 1C0WA 4KI4A 5K7HA 2VC1A 2ECBA 1L3VA 2XY5A 4DQ8A 3JRBA 3CCJQ 2KGTA 3VS6A 3SBGA 3THXB 2VPRA 4DR6K 3HRSA 2VWKA 1Q82U 5HNFA 3I4PA 3CJ9A 3ZT2A 1DU6A 3FHNA 1G2BA 1VSIA 5KE3A 4UUSA 4JJCA 1ZQ1A 5HKCA 3I35A 4HLYA 2GQIA 1ASVA 1IBKK 4EP4A 3SEQA 4HUGA 4JJBA 3C1DA 4H4KC 2LBFB 4CCKA 4NS5A 1Z7LA 2F5VA 3ZQGA 2GWJA 2BXZA 2FO0A 4PY5A 1UHFA 1YHQT 1PSFA 2ZSHB 1KXPA 4BGBA 1WSEA 1HK9A 4M3BA 1XX5A 3BLYA 4DU1A 3HOWJ 4HQEA 3VQAA 1VQ7A 1R71A 1ZELA 3KEYA 3NGIA 1S1TA 2E6NA 3VA0A 1MGQA 2JSCA 3GOIA 2SEMA 2CV2A 4MZPA 1YG2A 1LW0A 1ZBSA 1GCPA 3V1RA 3OY9A 4YEJA 3AVMA 1VQOT 2IVNA 1RAGB 2PMUA 5F1XA 5IT9E 4AHVA 3LX7A 4ENKA 2I7PA 3L2WA 1KEAA 4F3TA 3WU2C 5DTDA 4XLEA 4E6KG 4ZYEA 5EGOB 1OMIA 5CYMA 3JREA 3WTVC 1N3AA 4YFKF 2JA5J 1YNZA 3FXQA 1U5TB 4XU3A 3SFIA 3DEEA 5E1ZB 4HRIA 3OGDA 3CD6I 2NOLA 3NNQA 4A53A 3ASMA 1DLOA 2VWJA 5E8IA 3MMYB 3LMMA 1IKVA 4JK8A 3TDZC 5AQZA 4UVCA 1MSFC 4Z4EA 4FSVA 1NPRA 4M45A 2X6WA 4N47A 1G6NA 2GF7A 3VQ9A 5CKBA 4CF9A 3M0SA 1NK9A 2STWA 1YTAA 1X43A 2HQRA 1CF7B 1YQMA 1YI2A 2V6CA 1RESA 1VQMI 4C30A 3QO9A 4ME7A 3CERA 3P7NA 4LN2A 4OB2B 1HA8A 4II3A 1HBXG 4G7ZF 4FL6A 4EVVA 1XC3A 1I39A 1GLJO 2QENA 4H5RA 2M0OA 3L7WA 4I7FA 3LM2A 5IH2A 1HKTA 5LJWA 3ZMVA 1NJXA 1KG7A 1U9OA 2PBDA 4FM0A 1HJDA 1OYWA 2ZBKA 2HBKA 1X58A 2D0AA 3SEMA 4PKIA 1GLCG 1UEBA 3RRGA 1YTYA 4OMQA 3MECA 1LVKA 1F9NA 3DKMA 3FFIA 4XORA 2P9PB 2XHKA 1ZQ3P 2UXBK 1M2VB 3FKIJ 5C44J 2LC2A 5HVQC 1T0HA 1BBZA 3IUCA 2OTJT 4CCJA 2EGCA 4RCCA 2IOCA 3J8AA 4BWJA 3W6KB 1LDJA 3CC2Q 3DP7A 1HNVA 5LHGA 4CGZA 4F91B 2RHIA 4OFHA 2H8WA 1N39A 3CG7A 1XUPO 3DRRA 5GAGJ 1VOMA 2FA5A 1VQLN 4HAMA 1NGJA 2ZGZA 1UA0A 2LG4A 3L2RA 4M7DD 2QZ8A 4ZJZA 2AP1A 2ECCA 1NK4A 3LQQA 3C0CA 2DK3A 4K2EA 1VQ8A 2GBYA 2L3SA 4D7NA 5AQKA 1L3SA 3TI0A 3GFIA 4RUGA 2QA4Q 1OR7A 2BTTA 4AFUC 5AYFA 3CCVI 5ED4A 3AFHA 3QYFA 2DA3A 5GADJ 2ICWG 3J7AF 3GMEA 4Y17A 3T0YA 3MX2A 5BQTA 2CUBA 2ATCB 3F6OA 2OQRA 3WVEB 1ORKA 2BW3B 2JOYA 4Z02A 4HNUA 4CZHA 2MOXA 3W2VA 4A4HA 2XHIA 4CZEA 3CWUA 2R7RA 3RYPA 1D4XA 2LQ8A 3HPWA 2E35A 1FOXA 4FX0A 1VQKI 3W3CA 4MO5A 4EM1A 4YFNF 3SV3A 4MNUA 3EG3A 1EX4A 2KZZA 5D5XB 4XBFA 2QDYB 1Q81U 1RTHA 3GF2A 1VQPA 2A5XA 1JL2A 4D7MA 3KETA 2ID6A 3VJPA 1I27A 1JUPA 4WXCA 3GE1A 2DKGA 2JLEA 4C0ZA 2LCCA 1HSJA 1D8KA 2EYYA 4IO8A 3K1NA 5GAMg 5DPKA 2GELA 3EFOA 5C0YA 2X6YA 1RADB 4M7AE 1ZX6A 3LGLA 3CJQB 2JUCA 2W48A 2GIZA 2XPVA 1ZSGA 5CYQA 1ORNA 4XQFA 2YS9A 2PVGB 1C1AA 2CFOA 1ZBFA 1PC0A 2IVMA 1ZLKA 2KFDA 4IF4A 4PFPA 2J6FA 1EQYA 2F9WA 2QXLA 2DVJA 3OJSA 1R36A 3LWIA 1AZEA 3HSFA 5BN8A 5CK9A 3Q7CA 2ZFUA 1NK3P 3MKYB 1SVMA 3QICA 4DQ2A 1YITA 3HYFA 1C0UA 3JCMb 2I5WA 4IEIA 3LQRA 3PNTA 1LDDA 4M7XA 4OPKA 3LAPA 3QIIA 2XKOA 4B9TA 1V3FA 4JBAA 2IGOA 5FU6B 1LJ9A 2J05A 2YNFA 3CCRT 1IN4A 3CCJA 1REPC 5ECAA 1RKTA 3QYEA 4AMCA 2FX0A 3A01B 4OGCA 3G0ZA 1C0TA 1TH7A 3RMBA 1C6VX 2F9TA 1JU5C 4FT4A 3LA3A 3EHQA 1RRQA 1N8RC 2NVXJ 1Z0XA 1QVPA 5GMKl 4CZKA 4CK3A 1OX8A 4RW4A 4CZFA 4RS8A 2DNUA 2I5JA 4DEYA 2RHZA 3P8BB 2XAGA 2MD0A 3WG9A 1S1XA 3LM9A 3JS6A 4HT9A 1J75A 1KFZA 1I50J 4PJOC 1BISA 3KCCA 1MKMA 1GOBA 2E19A 1WSGA 1WSFA 5LY3A 5KCMA 5D6FA 3AVHA 4FLZA 3UE5A 2QKLB 2HL5C 3EYZA 1NWKA 2Y48A 5LGUA 3ER0A 4N0AC 2E88A 2Q0RA 5AQYA 3OR1C 5E18F 5CHZA 1X3WB 5JFRA 3VYUB 1LWWA 3ZYYX 3PVLA 4S04A 3CCUN