3OYDA

Crystal structure of the prototype foamy virus (pfv) intasome in complex with magnesium and the insti gs9160
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
368
structure length
368
Chain Sequence
LDAELDQLLQGHYIKGYPKQYTYFLEDGKVKVSRPEGVKIIPPQSDRQKIVLQAHNLAHTGREATLLKIANLYWWPNMRKDVVKQLGRCQQCLITNASNKASGPILRPDRPQKPFDKFFIDYIGPLPPSQGYLYVLVVVDGMTGFTWLYPTKAPSTSATVKSLNVLTSIAIPKVIHSDQGAAFTSSTFAEWAKERGIHLEFSTPYHPQSSGKVERKNSDIKRLLTKLLVGRPTKWYDLLPVVQLALNNTYSPVLKYTPHQLLFGIDSNTPFANQDTLDLTREEELSLLQEIRTSLYHPSTPPASSRSWSPVVGQLVQERVARPASLRPRWHKPSTVLKVLNPRTVVILDHLGNNRTVSIDNLKPTSHQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular mechanisms of retroviral integrase inhibition and the evolution of viral resistance.
pubmed doi rcsb
source organism Human spumaretrovirus
molecule tags Recombination,viral protein/dna
molecule keywords PFV integrase
total genus 108
structure length 368
sequence length 368
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2010-09-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
A PF17921 Integrase_H2C2 Integrase zinc binding domain
A PF18103 SH3_11 Retroviral integrase C-terminal SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2300 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3oydA04
1.10.340.70 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Endonuclease III; domain 1 3oydA01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3oydA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3oydA03
4Q5VA 3NH0A 1RILA 4FJIA 4OPJA 1WSJA 4CIEA 1S9EA 1MHNA 3L2WA 2BUDA 3B6PA 3ASMA 3OS1A 5KH6A 2I5JA 2YNGA 1RBVA 3OYDA 4B9XA 4OKJA 3VQDA 3V9WA 4DTNA 3HVTA 2X4XA 3P8HA 2IDOA 1WSGA 4LD0A 5C24A 5J2NA 3TAEA 4EDUA 1T7PA 1HYSA 2HMIA 1RBUA 4H8KA 2DTUA 1ASVA 3RRHA 4CGJA 4FK2A 1S6QA 2WOMA 4CGFA 2X4WA 1RDAA 3VQBA 4OLBA 1F21A 4DSFA 3NTHA 4QVZA 1XHXA 2HHQA 4RG8A 3V9XA 1WSEA 1U49A 4Z4EA 4J2AA 1ZBHA 4GVMA 4FLZA 3RTVA 5HROA 2HHSA 2AJQA 3V9ZA 4FW1A 4CFBA 3DOLA 4IDKA 4ELUA 2YRVA 4FM0A 4M3UA 1S1VA 1ASWA 3CM6A 4F2RA 4FXDA 4DU1A 1VSMA 3NGYA 3NE6A 5KCHA 3GOXA 1W9HA 4JRQA 3AVCA 4CEQA 3DLBA 3S3OA 2KZMA 1NOYA 1VSEA 4CF1A 1J5OA 2OZMA 1FKOA 2FHDA 4A4HA 4KV8A 3V9SA 4ID5A 1GOBA 2OPQA 3ZT3A 1U48A 2EQUA 2XY8A 3TAGA 3QINA 4DLEA 1U47A 1TVRA 4C8NA 1L3TA 3QEPA 3CEYA 3L42A 3AVMA 5HRRA 3NTKA 2RI5A 4DTSA 3ISNC 4DU3A 1JL2A 2D0BA 1X9MA 3AA2A 3BDPA 1ASUA 1Z25A 3C6TA 3WNFA 3SPYA 1Q8IA 3OJSA 3OS2A 1LAVA 1RTJA 3PV8A 4M42A 4DFPA 3SUOA 1BQMA 4B8CA 3IS9A 3VQ6A 5HLFA 1RT2A 2YNFA 1SL1A 3A2FA 3AVJA 2WACA 1S9GA 3VQ4A 5SWMA 4CJRA 1NK4A 3ITHA 3DLEA 1WN7A 2YNHA 1JLAA 2RHUA 2XO7A 3LZJA 3MEGA 3ZSQA 3U3YA 3V6DA 3RR7A 3KTQA 4A4FA 4CGDA 1SKWA 3MEAA 1BGXT 3PMIA 4CGIA 4HCZA 3M8QA 4IFVA 3OYJA 2VG5A 4CJ4A 1U04A 3FLGA 2HQEA 2P5GA 3SI6A 5CZ2A 5CYQA 1IKVA 3K5MA 1S5JA 4Y1CA 2EQKA 4OKEA 3ZSOA 3LWMA 4RW6A 1CXUA 1HYVA 3ZT0A 2XY7A 4B9VA 4C8OA 3HPGA 3S3MA 4LY7A 2HVHA 1LWEA 3NTIA 3LP0A 3TAFA 3CM5A 1NK5A 2OPPA 3PMTA 4ZTJA 4OGCA 4CESA 2KW4A 1RBTA 4C5EA 2DAQA 1DTTA 4II1A 3AVIA 4Z4CA 4BACA 2X78A 2RHXA 2IC3A 4ID1A 4KHNA 2X4YA 4PLIA 1UOCA 1RT4A 1RT5A 1VSIA 1WAJA 3L3UA 3T1AA 5K14A 4LSNA 3ZSRA 3AVFA 4DTOA 4N76A 4A4GA 4FZZA 2HNZA 2OA8A 3OJUA 3PX4A 3OYAA 3PO5A 3LP2A 2P0KA 4ICLA 1KFDA 3V4IA 1YT3A 3TWHA 1ZBLA 1C0TA 1KRPA 4UC4A 4C5GA 2RN2A 1BI4B 2RHZA 3SYZA 2W42A 5J39A 3C4SA 4FJNA 2G8WA 2DFHA 3IRXA 3OYLA 4AHTA 4CEDA 1JLQA 2G3RA 4NCAA 4KI6A 2HHTA 5KE3A 5I3UA 3QJ6A 3F70A 3S6WA 1G5VA 3C95A 4FJ5A 4HUGA 2ZQBA 3QO9A 3DLKA 2LDMA 2EHGA 1QSLA 2YHBA 3UIQA 3HL8A 4PL6A 3LAKA 3KK2A 3LYIA 4AH9A 3ZEHA 4Q5WA 4DQSA 1OZ2A 3PY8A 2LTOA 3ZSWA 3M8SA 5CIUA 1C1BA 1C0UA 1NJXA 3QLHA 2QXFA 3QIOA 4HUFA 3SNNA 4M3WA 3MECA 4DSJA 4BDZA 3CFOA 1LWFA 3K58A 4BE2A 4C8MA 1VSKA 3HM9A 2OYQA 4IURA 1RNHA 3NHGA 4Z4FA 2DFEA 4LSLA 3VQAA 4YFUA 3IAYA 4B3OA 4CFCA 1TKTA 3MEDA 3CFRA 3DI6A 5J1EA 4FVMA 4JRPA 4KI4A 4E0DA 3VQ9A 1CXQA 3WNHA 1QTMA 3OB9A 1RT6A 1TKZA 2IAJA 3AA5X 3KD5E 3LH0A 2HNYA 3VQEA 4CK3A 2B5JA 4E19A 3MEVA 1FK9A 3HVRA 4FJGA 4I9QA 4DF8A 2DIGA 3MEUA 4CE9A 4LH5A 3KIOA 3HPHA 2HVIA 2LVMA 2BDPA 3QNOA 3RMCA 2PYJA 5D6YA 4MFBA 3DRRA 3CG7A 3ASKA 1VRUA 4NZGA 3AA3A 4I2PA 4IFYA 3ULDA 4KHWA 3H6ZA 2HHVA 1HNIA 1KHCA 2JZ2A 2BIVA 4DS4A 1QSSA 4X34A 2YHAA 2PYLA 2WONA 3ZSVA 4BE0A 1C0MA 3KLEA 2R5AA 3I0RA 1LW0A 2R7YA 1A5WA 1KVBA 1EETA 2VG6A 2GV9A 3DM2A 4E7JA 4KRFA 5T7BA 4DQIA 1KLMA 3VN5A 4E1NA 4FYDA 2K3YA 4ZHRA 3SQ4A 1Z26A 4OVLA 3EAEA 1TL1A 4E1MA 4L59A 2GFAA 4HUEA 4FM2A 1EKEA 3B6OA 1Q9XA 4DSLA 3LPTA 4CEOA 4CJTA 3OYNA 4IUTA 1RT3A 1VSDA 4W5OA 3LX7A 4FLUA 2QQRA 2HHXA 3QKJA 3ZSZA 1S1XA 4RW7A 3ZT1A 1G15A 3F9KA 2IGIA 4IBNA 1LW2A 4IKFA 4KFBA 3U3GA 1T05A 3QETA 5KE2A 3O4QA 3SZ2A 4FLYA 1X1PA 4IUPA 2ATQA 4FJHA 3E9FA 4HCCA 4F3TA 3HXMA 4WE1A 1I39A 1UWBA 4E89A 3OYEA 1BHLA 3P5JA 4FZYA 4FJMA 3PO4A 4FJKA 2Z1HA 3AA4A 1WLJA 3L2VA 1L3UA 5D3GA 1RBSA 3OMCA 4XIUA 1D9FA 1LAWA 2Q3SA 1Q9YA 3IG1A 3VQCA 3MEEA 4O0JA 1NJWA 3BDLA 5C6SA 4B08A 1SKRA 3OYCA 2A1RA 3OYIA 3M8RA 3SUPA 2RI3A 4PWDA 1LWCA 1QQCA 3WNGA 3D0PA 3AO3A 4CF2A 4B9TA 4J2DA 4EP5A 1NOZA 2X74A 3VQ5A 3SJJA 2RHIA 4KHUA 4CRIA 3JSMA 1NKEA 1U45A 4J2BA 1O1WA 5FRMA 4CJPA 2L89A 1ITGA 3TAQA 4OKKA 4O55A 1ZYQA 3NNQA 1IH7A 4KKOA 4CFDA 4Z4HA 3RMAA 1R0AA 4N41A 1TGOA 3DRSA 4O5BA 3NH2A 3O8VA 3AO4A 1NJYA 4NCGA 4CHPA 5CY4A 4AILC 2PQWA 4CGHA 2MWPA 1T03A 1VRTA 4CEBA 1HRHA 3AVAA 5I42A 4CJSA 3EY1A 3O3FA 3EZ5A 2P51A 4W5RA 1RT1A 3F73A 4C8KA 2LRQA 3MP1A 2X35A 1T8EA 4M3RA 3MEWA 1NKBA 4OPKA 3EYZA 4M3TA 1JL1A 1OZ3A 3VQ8A 3RRGA 2HW3A 4CGGA 3SUQA 3O3HA 3Q1JA 2Z1GA 5M9OA 2RKIA 4N47A 5HRNA 1HMVA 1KVCA 4DTUA 2PZSA 1REVA 4CK1A 4OJRA 5KGXA 4KHQA 4M3ZA 5KI6A 1RTIA 4KB0A 4N5SA 3L2RA 2ZE2A 4B9UA 5HBMA 4DTXA 3KK3A 3E9GA 1VK0A 2KQ2A 3VQQA 2LSNA 3L8BA 1NJZA 2F8SA 4PY5A 1L3VA 4BWMA 1J54A 4CJ5A 4A4EA 4DQQA 1XC9A 1NK7A 1QSYA 2EX3A 2Z1IA 4DSIA 3MP8A 1TKXA 3MXMA 4MQ3A 1BCOA 3ZSYA 4GW6A 4CJFA 4IG3A 3U6FA 4W5QA 3MXIA 1KVAA 4E7KA 3OMGA 4CHQA 4HCBA 1CLQA 1DTQA 4YNQA 5IAYA 4CK2A 1BISA 3HK2A 4HTUA 3P8DA 4Z4GA 3KLIA 4PQUA 4CHNA 3K57A 3MAQA 2XDPA 3SCXA 2YKNA 3L3VA 4CHOA 3LZIA 3O3GA 1VSLA 3KKSA 5KGWA 3V1RA 2NLUA 5D6XA 4C5HA 3AVHA 2QQSA 4C5IA 4HHTA 2XRIA 2QK9A 4E7HA 1HQEA 3DLMA 5KCOA 3I0SA 3VQPA 3SQ0A 1D5AA 3KK1A 3H08A 5IN1A 3LGLA 3AO1A 5JS2A 3TANA 2EFIA 2L8DA 1EXQA 4CF8A 2ETJA 3NF7A 3ZCMA 1FKPA 3V9UA 4F4KA 3NAEA 1IKWA 1JLFA 1WSHA 3DLGA 4RW4A 3SV3A 3HPOA 1TK0A 1C1CA 2RJDA 2RJFA 4O0IA 2G8IA 1SKSA 2B8AA 5FRNA 3FDRA 3KUFA 4JLHA 3TAPA 4N4HA 4KB1A 4ZTFA 2FBYA 4CERA 3H8ZA 2VWJA 5C0MA 4IUVA 4Y1DA 2DIQA 4BDYA 3S3NA 2K3XA 1ZBUA 4E3SA 2R58A 3T3FA 1L3SA 1JLCA 3MXJA 5SZTA 1WJQA 4FJJA 2E6LA 3OVNA 1RCHA 4FJ8A 2O4IA 3LPUA 1QHTA 1IKYA 1NK0A 4L8RB 5KRTA 3QESA 1GOCA 2Y1JA 1QS4A 2R57A 1TK5A 2PY5A 5KTQA 3CYMA 4FJLA 4B9SA 4B9WA 4PLLA 4F2SA 4KPYA 1BIZA 4CJQA 2ZD1A 4BWJA 2JLEA 3SPZA 1WGSA 4CF0A 1SL0A 1JLEA 1HQUA 4NCBA 2DY4A 4CJEA 1JLGA 4PUOA 4CEEA 1EP4A 1N6QA 4DTRA 2GFUA 1FXXA 5J26A 2D0AA 5J2QA 1IKXA 3KLFA 2EQMA 3NCIA 4FLVA 3LANA 3V81A 1NK9A 3QERA 4FK4A 3LWLA 1YVUA 4DFMA 4KTWA 3ZT2A 3PX6A 4DQPA 3CQ8A 3QIPA 1TL3A 4F3OA 4B8AB 4RW8A 3DYAA 4O4GA 4FU6A 4FLWA 1J53A 1JXBA 2F96A 4I2QA 3VA3A 1B9DA 1KTQA 3PUFA 1OI1A 5C42A 3QEVA 3DB3A 1VSFA 2M0OA 1HJRA 4BD3A 1VSHA 3VQ7A 5FROA 1BCMA 4CF9A 1C1AA 4RW9A 4H4OA 4DMNA 4CJKA 4DFKA 3QEWA 5JS1A 4G1QA 1S6PA 4FW2A 2G8KA 3DB4A 3RMDA 4CEFA 2RO0A 1A5VA 4K8XA 2HNDA 5FDLA 1SUQA 3HP6A 4ELVA 2E6MA 3AO5A 3UT1A 1RDBA 3NF9A 3KLHA 4DLGA 3DLHA 1TK8A 3QNNA 2G8VA 1DLOA 4CJWA 4K8ZA 3KLGA 4QW2A 2Z1JA 3D45A 4UQGA 4KTZA 1KFSA 3P1GA 5EU7A 2EKOA 1H3ZA 1YTAA 1RDDA 2P1JA 1B92A 2KFNA 3RR8A 4C8LA 1S1TA 2G8FA 3V1QA 2IS3A 1N27A 3K5LA 4DFJA 4CIGA 1SV5A 4KREA 3MO8A 4FL6A 1EX4A 2GF7A 2F8TA 2NUBA 3KKRA 5D6WA 3HO1A 2FBVA 1HNVA 4KHYA 3OYGA 2O4GA 4DSEA 4FCYA 4FJ7A 4N56A 1RTDA 3OQ5A 3LDSA 5HP1A 3AVLA 2G8HA 3OYFA 3M9QA 2R5MA 4DS5A 1WNSA 4DTJA 1XNIA 4FJXA 4NYFA 1I3AA 3HJFA 2HB5A 4M41A 1K6YA 2M16A 3JYTA 3OS0A 2B6AA 3PNWC 1CZ9A 4AHVA 4RG2A 3K2PA 3NFAA 3TAMA 1LV5A 4B9LA 5CZ1A 3FC3A 2O4XB 3AVBA 2G8UA 3ZSXA 1D8YA 1UA1A 1BQNA 5J2PA 2VWKA 2BGGA 1OYXA 3ALYA 4E7LA 4CFAA 4FK0A 4KHSA 4CIFA 4LD6A 2OZSA 3LGFA 4AHRA 5HRSA 4R5PA 5DMRA 4QCLA 4N4IA 3P83D 2RI2A 1WJRA 4QQGA 3NBPA 4LH4A 4AHUA 3VA0A 4CCHA 4CECA 2X6SA 3DOKA 4DG1A 4QQ6A 2XY5A 3TARA 4HVJA 4DQRA 3AVGA 4QAGA 1RT7A 4BE1A 3QIIA 4CHZA 2B4JA 3SQ2A 3LP1A 4QOZB 2XHBA 3META 4M3YA 2F5KA 2KFZA 3E01A 2KZZA 4OLAA 2QKBA 3WNEA 2IG0A 2YV0X 4JS4A 2RF2A 3OYHA 4KO0A 1XHZA 1J9AA 4W5NA 2RHYA 1BI4A 1W0HA 4ELTA 4DF4A 1HPZA 2L3RA 4JS5A 1NK8A 2BE2A 2YNIA 4E7IA 3LP3A 4FLXA 2CKKA 3OYMA 2FC0A 4Z4IA 3K5OA 4AHCA 2BKDN 2DFFA 2GUIA 3AV9A 1TAUA 4OGEA 2QKKA 3OYKA 3THVA 2GBZA 4I9LA 1S1UA 1D9DA 4NS5A 1SSFA 3QEIA 1UA0A 1YTUA 5E41A 3NDKA 2HHWA 2IOCA 2D0CA 4CJ3A 3NGZA 4FLTA 3NH1A 2YKMA 1WSFA 4BDPA 3PFSA 3V1OA 1KCFA 1U4BA 2M1HA 1BIUA 3QBYA 2JGUA 2D9TA 4N4GA 1HYZA 3G0ZA 3LALA 4DTMA 3HSTB 4J2EA 4EP4A 1JLBA 4M45A 4CJVA 3S9HA 1L5UA 3SV4A 4W5TA 2O4XA 3TI0A 4DWIA 4FM1A 4TSXA 4CHYA 1C6VA 2BANA 3LLRA 3ME9A 4Z0UA 2D5RA 4OVAA 1NK6A 3TR8A 1QE1A 4B9MA 2FBTA 3AO2A 3RWUA 2EQJA 3HYFA 3NGIA 4IUQA 1N5YA 4GY5A 3DMJA 2HQXA 2ITGA 1WAFA 1TAQA 1MU2A 1VSJA 2MWOA 3T19A 1S1WA 2E4LA 2XK0A 3TABA 3FFIA 5KRSA 3HP9A 3SUNA 3LAMA 4IUUA 1JKHA 4CJLA 2XY6A 1BL3A 3C94A 4KAZA 3FEOA 1B9FA 2X6NA 2LCCA 3G10A 1WSIA 1SL2A 4FZXC 3KJVA 4DTPA 3NF8A 3OYBA 4CEZA 1KLNA 4KTQA 1NKCA 1Y97A 1TKDA 2RJCA 3SD4A 3RMBA 3MP6A 2JTFA 1RI0A 1CZBA 5HRPA 1IG9A 4NYNA 3I8DA 3K59A 1GOAA 3QEXA 1RTHA 3HT3A 4FJ9A 3DLRA 2A1SA 3M8PA 4H4MA 3UWNA 2OPSA 4PA1A 1JXEA 3PX0A 1XI1A 1X9SA 3DRPA 3AVKA 1WJSA 1RDCA 3OY9A 4I7FA 4DU4A 4B9NA 5DK5A 4AHSA 1IO2A 5CYMA 3C6UA 4Q0BA 3OA6A 2FBXA 1A5XA 5J2MA 1KSPA 2E5QA 4EZ6A 2E6NA 3BGRA 2RPIA 2RJEA 4O44A 3L2QA 2VYTA 1UAXA 3K5NA 3NF6A 2KTQA 2HHUA 2OPRA 3O4NA 4M3XA 1TV6A 4IG0A 1ZBIA 3AVNA 4F8RA 1ZBFA 4GMJB 4Z02A 4CEAA 5C25A 2P5OA 3KD1E 4EZ9A 4DSKA 2Y1IA 3SQ1A 4QQDA 3CFPA 4CJUA 2VG7A 1X9WA 3ZT4A 1RBRA 3L2UA 1XWLA
chains in the Genus database with same CATH superfamily
1X3NA 4OPJA 1S9EA 1MHNA 2DL8A 2K4BA 3J7YP 4LD0A 3MN7A 2O9SA 1FTTA 3VB2A 1P2FA 2QEXQ 4O8UA 5KYWA 2V7YA 4EJUA 1ETOA 4IL6C 3NARA 3A5MC 5ELZA 4IDKA 3J81O 2A41A 4XSXF 1S1VA 1V4TA 2CT4A 4EW4A 1U48A 2EQUA 3TAGA 2EV6A 1B8IB 4A53A 3GVAA 3KTUA 1VQON 2P9UB 3S16J 2WB1A 1PSEA 1MUZA 1NPPA 4KBMB 1NZ9A 1IV6A 4QIWN 1MGQA 2R7XA 4M75F 1YN8A 3L1AA 3QG1A 3P9CA 1TTHB 1X4PA 2HQEA 3TSWA 1IUYA 4HQMA 5ED4A 3SDZA 2RN7A 3H0GJ 4DR1K 1YIOA 2HVHA 4JZ4A 3D2FB 1I94K 1NG7A 2LQ8A 4KMFA 3CMEQ 1TL8A 5CVRA 1WAJA 1UOCA 1EV7A 1OX9A 2HNZA 1OLTA 1IG8A 4C5GA 4L3QA 3VYTB 3B73A 1QPMA 4XH1A 1MUYA 1V1CA 1NU0A 3ZEHA 4BROA 4OB3B 2HI3A 3IWZA 5GAMe 1K0XA 3HIFA 1RIOH 3SWNC 1P7JA 4A3GJ 2AHQA 2ZKZA 1TKTA 5AQTA 2R5YB 4AYBN 3WNHA 5CJ9A 3FXQA 3WTSC 4H0TB 2ZCWA 5BPMA 2V6EA 2LVMA 2VONA 3QU6A 2ASOA 4M7XA 3HFOA 3I0XA 2CW0F 3H6ZA 2BIVA 3ZSVA 4O8KA 2KRMA 1P4WA 2AXTC 4M78A 5T7BA 1KLMA 5AFUA 4ZHRA 1JBMA 4OVLA 1O7LA 2NOBA 1VQ5I 2R7FA 1Q81U 3DWLA 3QWXX 3MX2A 3JCUC 4CJTA 2ZZDA 4XH5A 3CCJI 2E19A 4HW0A 1FOYA 2IGIA 3OV8A 2NYXA 5J3BA 2G6FX 3CCVN 1KGSA 3QUIA 3U1DA 2F4OB 1E2XA 2JPCA 5GMKj 2PJRA 5EGOA 4J7FA 2BW3B 4KN7X 1MJ9A 3KP7A 4FX4A 1Z3XA 1M1GA 1E6HA 4B08A 4EJTA 2DOEA 1JEGA 3WNGA 3B6CA 3SJJA 3ZMTA 5DTDA 4CRIA 1ZUKA 4ILGB 2Y90A 2L4MA 4IQJA 3NNQA 2PUKB 1WIEA 4YOYA 3V7SA 1UHFA 1HRHA 4J7IA 1YJ9Q 2VBYA 4W5RA 2HVRA 1X4OA 4U67L 2AQFA 3UATA 4BHBA 3EYZA 3RRGA 2LQKA 5A2QO 1KFZA 2CO5A 2FLOA 1D4XA 2WV0A 3CC4A 3NAUA 1YFNA 2JWLA 4PKHA 1VQ5N 4JJNK 1S29A 5KYWB 3CC4Q 1ZSZA 5KCOA 3SQ0A 1LPQA 4JYAK 4FWMA 2YLCA 2P9LA 3NF7A 2DO7A 1KG3A 2RJFA 1SQKA 3K4NA 2F7TA 2ADUA 3IP4B 5GADJ 3T3FA 1BIAA 1APLC 2FEZA 1G2BA 1X3WB 1ZA2B 1VQ6T 3PT9A 4MTEA 1U1SA 2JLEA 4QTRA 2MAMA 1Z77A 3LWHA 2DMTA 1IN8A 4YOQA 4DTRA 2J5OA 3LANA 4CYCB 1EH8A 3O9UA 3A0HC 3VRYA 1X2KA 5CYVA 3GBTA 2P9IA 4I2QA 3C2GA 5A0LA 4DBQA 1IXRC 2BY0A 4CF9A 2YG8A 1C1AA 3FXLA 4DMNA 5DM7L 4XLAA 4LMYA 5BPNA 3HP6A 4KT0E 4DV7K 3UT1A 3ZEUA 1QVFM 5HODA 2W1OA 4ELYC 4J9EA 5EU7A 1CZAN 2X6WA 4LIVA 3TMOA 1VQPQ 1YCYA 4KBOA 2MC3A 2RN8A 4JYKA 3MO8A 5F0CA 1MH4A 3HO1A 3ZMUA 3CJNA 4ZZLA 4PUSA 3AG2H 2D8JA 5LJ3g 3JYTA 2L3SA 2V9PA 4RG2A 2G8UA 3ZMVA 4CFAA 1VQ7Q 3I5UA 4FWSA 3VMFB 1BR4A 3VA0A 4HSTA 1N8RU 3DFGA 5FKLA 4QQ6A 4BI8B 1JQQA 1HDPA 3CO6C 2W6KA 3LM9A 4XN0A 4J9CA 1O13A 1BDGA 2CGKA 2QKBA 1XUPO 2WC9A 3FGUA 4AFZC 3KEQA 3H1VX 4BQZA 4LF6K 1I27A 4EMSA 4LFBK 5IP9J 2GBZA 1JUPA 1NGFA 1OCRH 1RLPC 3CJ7A 1X1CA 2EKHA 3D5SC 4M45A 4CJVA 4CYDA 3S9HA 2PMHA 4XK4A 4CHYA 2Q97A 3O8MA 4Z0UA 4ZYDA 2XRLA 4PIIA 3S6IA 3NGIA 4F17A 4BGAA 2OTJQ 3VERA 3HHTB 2GOMA 5M1KA 1NKCA 1XCVA 2B63J 2WB1N 1BUPA 4M77G 3CCRN 3CCQA 2FG0A 3MN6A 1FN7A 3JSPA 2E88A 1XN7A 3C6UA 4ZGEB 2E6NA 5K7HA 2LC4A 2HEQA 3NF6A 4M3XA 2LLKA 1TTYA 2OC6A 2ZBKA 3CFPA 4LLLA 4JX4A 1ZRDA 4KH1B 4LD9K 1VQPI 5IP6A 2OPTA 2ASPA 4JI3K 5KH6A 2NOHA 4FWKA 2JTVA 4M78D 1M90C 4BY7J 5C44J 4DR2K 2KROA 1I3QJ 4MLEA 5B8HA 2QENA 1RUOA 4GVMA 1G6NA 1G99A 4AFUC 2FMYA 4FXDA 3HG9A 2HS5A 1X3ZB 2IA2A 2PJPA 5L3BA 1PKTA 2OTLI 3Q9SA 2C6YA 1GL5A 1E4FT 1B07A 3O9RA 4DNCA 2VKEA 1KSWA 2NOEA 4PL7A 1ASUA 3PV8A 2L2PA 1R00A 2CV2A 2DN0A 3I9QA 1NNEA 4F9OA 2UZKA 4HVVA 3LZJA 2RHUA 3M57A 1X2NA 1WJDA 3G7ZA 5DS9A 3SI6A 4LF9K 1OULA 1UG0A 1QVFS 2RK1A 1NK5A 4CESA 1SAXA 4R1HA 1RT4A 1Q95G 4CDGA 4LSNA 1QVFA 3PX4A 3L4QA 1WHKA 3RPUA 2P0KA 2OTJN 4BVOA 1KRPA 4DOZA 2RHZA 3A8MB 2ME0A 2KRFA 2ZQBA 3QO9A 5D4SA 1AZGB 2K4YA 2DD5A 4XOPA 4AU7A 1X75C 2X9DA 3ZRGA 4K43A 1Y07A 3CMAN 3M5AA 1C0UA 5H1SQ 1B34A 9ANTA 3M58A 3KP5A 4C8MA 2M34A 4M73A 3NHGA 2A3ZA 1I50J 2KIUA 2XF6A 4M7AA 3O3KA 1WRJA 3LWFA 4WFNL 4DYRA 1R22A 1KU3A 1PD0A 4PK4A 4I9QA 5HVQC 1Y39A 2HSTA 1GUUA 3CCQQ 3WEEA 2PYJA 2I7PA 4P5NA 1CF7B 1YQMA 2YHAA 3G71A 2VG6A 1FJGK 4CZKA 2DYIA 1O3QA 4Z6YA 3CCMI 3I4NJ 5IOYA 4DSLA 1Q9XA 3KYLA 4JEPA 1S72Q 2WAFA 1M3AA 2KI7A 2V7FA 3I35A 1S1XA 3F9KA 4J5YA 1UHMA 2LY1A 2LC2A 2KP6A 2ATQA 2Y75A 1R49A 3JRHA 2GLOA 2P4RA 4H0VB 2M0YA 1JGGA 2CQQA 1N75A 3VQCA 4S0HB 3PO3J 1WXUA 5AQRA 1NPRA 1U5TB 5EDNA 1F43A 1KQ0A 3D0PA 2IVWA 4EP5A 4C8QC 4M75A 5HK3A 3VQ5A 2RHIA 1Y96B 3E97A 5CKTA 1O1WA 3IKTA 2K9SA 3RMAA 1ZHFA 3P39A 1ZGWA 4AILC 4KH6A 4DUYK 1T03A 1VRTA 1PDNC 5F04A 3EY1A 3H9JA 1J2XA 2FSKA 1IRGA 3PE0A 3T69A 1HW1A 3F72A 3A8HB 1HMVA 2EYQA 4HBLA 4JKDA 2GEMA 2STTA 1NJZA 4K0KK 4B24A 3ASNH 5HL7L 1IDYA 1QSYA 1MBGA 2EX3A 4DSIA 3MXMA 2OZ6A 4GW6A 2LMDA 5FU6C 5IAYA 4HTUA 3OH6A 5AIPA 1YHQT 3KP6A 2KYMA 5D6XA 2LCSA 2HYFA 5J6XA 2IRFG 3CCQI 3F9MA 3DPLC 3EG9A 2ETJA 2HTSA 1IKWA 1TK0A 1C1CA 4V19S 2IVNA 5FRNA 2K79A 3RPQA 5KNLA 5M1NA 4E3SA 1L3SA 5SZTA 4FJJA 3MD2A 4LC9B 4HG2A 2XF5A 3RBBB 3M0RA 1BU6O 1PU6A 1NLOC 3JSCA 3I56Q 5M3FJ 2LF7A 2E64A 2OTLT 2JMCA 1TU0B 4BR7A 2DL4A 4DR6K 3I0TA 5CE3A 1YVUA 1NM1A 2E1ZA 3JAME 3CC7Q 1W7AA 3MK6A 1OYYA 3BR1A 1OEBA 4U88A 3TDZC 2XAHA 4FISA 1VYVA 3NF9A 4IHWA 3HKZN 3EUAA 5F1JA 1DLOA 2Z1JA 2I5UA 1YTAA 1RDDA 2DMOA 4HVUA 2DBKA 1N27A 4FYWB 2BUPA 2FRHA 3F6OA 3EUHA 1M2OA 4AC0A 2YX4A 4CZFA 4DTJA 4M41A 4B1RA 2GAUA 4FTHA 3BTJA 2AKLA 3FRNA 2BXZA 4LD6A 2L7FP 4LH4A 2XAGA 2O5RA 3GTMJ 2NUZA 1I6HJ 3V8JA 5KN8A 1A04A 3CJBA 3CCRT 1SFXA 2DNUA 2YHTA 4JS5A 1JE8A 3DJCA 1IRZA 2CKKA 2F5VA 2QKKA 3LQRA 1T98A 4J9FA 1IAWA 2DM1A 4FLTA 4JJDA 1RAEB 2HHWA 2JRMA 2YKMA 5ICFA 1Q1VA 4J9GA 1BIUA 4IO9F 3ABLH 3M56A 2CWEA 3QODA 3TI0A 3PSIA 2FVUA 4Z8AA 1WA7A 4O6JA 4XU3A 3ID8A 1FT9A 2ITGA 1A31A 3VYHB 4L6V5 4BR9A 3HJEA 4AYBA 5B1BH 3FEOA 1VQNQ 2HVSA 2A36A 2QSHX 1MMGA 4M6XA 2K9LA 2CGLA 4GV3A 1R1UA 3GZ5A 3CCVT 4X64K 1XG1A 4OWRB 3K0LA 4S04A 3M8PA 5F6FA 2TDXA 2EAYA 3F21A 4BRLA 1HDDC 1QZZA 1KK7A 5GAN7 2XDBA 3JR9A 2UYTA 2RJEA 2EINH 1ZARA 1Q7YR 5CLSA 1UHSA 5GMKm 2XIGA 1X69A 4KIFA 3HXLA 4OIRF 3ZT4A 2YUQA 1W7PB 2PI0A 2IVPA 3CI5A 1K61A 4Y3OA 5LRSA 4LD5A 2ZF5O 3V9WA 2OF7A 4HV5A 4RGRA 4XRFA 4LB6B 4CGJA 2VWFA 2RM4A 5FLXE 3OIPA 3OR2C 5HROA 3P8BB 1XCBA 4DZJA 3MCAB 2YRVA 1O3RA 3CC4N 3BY5A 4Y13A 1YX3A 3HL2A 2CJJA 1NG2A 4RLFA 1VQ5Q 3PVQA 1VQ4A 2L02A 4LLGF 2DTZA 3FZFA 3CEYA 3CMMA 5E3OA 1VQ5T 3CMEA 5F2RA 2W04A 5HLFA 5J47A 3DBHB 3G3ZA 1ZBSA 4HCZA 1Y96A 3SDGA 3OYJA 1U04A 1ATRA 1REPC 3F0ZA 5HCKA 2HYJA 1E6GA 2XY7A 3G0QA 1P7IA 1YWOA 2KVQG 1DTTA 2CW8A 2XU8A 3AVIA 4IOAL 2CUJA 2OAWA 1RT5A 5GIPA 1J09A 1ESVA 4Z89A 3I55A 2HOEA 4Y52J 3RMQA 2DXBA 1TXQA 2WV1A 2ESNA 2STWA 4RWTA 3CCJN 4CHUA 2HHTA 1KAZA 1XSVA 3C95A 4NLBA 2X1CA 4DV6K 3CCUN 2LCLA 3HL8A 1OR7C 3VJPA 3SNNA 3BG7A 1ETVA 3UKUB 2CUFA 4ISEA 2YX6A 2FF3B 4IHYA 3MEDA 1R1VA 3DI6A 2QGGA 2LKXA 4DQ2A 2CH6A 1NG9A 1YW7A 2E6ZA 4XTUA 3ZETA 2F5FA 2DZCA 3QP5A 4CCNA 1XPXA 4C0ZA 4I2PA 1GBRA 4LN2A 4DV2K 3JRZA 3EZWA 3HRGA 1OH8A 1JJ2A 3HI0A 4JI5K 3LPTA 4L5JA 2H1KA 3AAPA 2RE2A 2YG9A 3ZSZA 4BEHA 4KFBA 4IKFA 4B3MK 3O4QA 5LJ5j 3CCEI 4FJHA 1N34K 3E9FA 4WE1A 3RMSA 3A2KA 3G6EN 5AQHA 3K1NA 3OSSC 1ZR2A 4MMLA 2HF4A 1XMXA 1XGSA 1FSEA 4M63C 3OYCA 3M8RA 3SUPA 2Y9ZA 5D5WB 3L2CA 4C92D 2HDAA 5I22A 1UB4A 4C92E 5F1RA 2RF0A 5ILSA 4LDUA 3TSZA 1ZYQA 4AIAA 4FSXA 2UV1A 3O8VA 4CD1A 3GNFB 2ASMA 4F52A 5GAOm 4B1WB 1ZC6A 4AM7A 1T8EA 4XR6A 1JHFA 5JLFA 3CCMT 3VQ8A 4OPKA 3VS6A 2DA7A 2Z0WA 1KVCA 1REVA 4KHQA 3X2QH 3ENHA 3CCJQ 2E3IA 4JKGA 1I8FA 1SVLA 3WHBA 1SD7A 2KQ2A 4I99C 1XC9A 2L7MP 2QZ8A 4MQ3A 2K27A 2GXAA 2MA3A 4HX7A 1IN5A 2Q36A 2QAZA 2KR3A 2G9WA 2JG6A 2ZPGB 3JCMe 4CHNA 1USSA 4PFOA 1A0NB 4C5IA 4JI0K 1KG1A 1YJWI 1GBQA 2KK4A 3H08A 1H3HA 5C2FA 5A2QE 4EMKC 2D1KA 1K83J 3JRIA 1W36C 4A5BA 5CVJA 1ZR4A 4ZTFA 4XRSG 1AVZC 5GANe 2DBMA 4L8RB 1U9OA 2Y1JA 1QS4A 2FF4A 4FJLA 1LNWA 3M8JA 3VF2A 3NMZC 3VENA 4EHTA 2ED1A 1LCKA 1D1AA 3FR0A 3QERA 3GTJJ 5AQNA 4I7HA 5IH2A 5CVUA 1ZAOA 2QI2A 4B8AB 4FU6A 3MAJA 1VSFA 3S41A 2G8KA 4P55A 2R7RA 4OOIA 2XASA 4IIOA 3M7GA 5DM7F 2E6MA 4CUGA 1NGDA 4B21A 4EM1A 4ZJZA 3D45A 1DP3A 4MZTA 2FQ4A 1Y8RB 3LQQA 3DEWA 1FYNA 1YQRA 1QLYA 2QUFA 2JSPA 1K8KA 1IBMK 3OQ5A 4M7AG 3VUBA 1BI0A 2D6FA 4XIDA 1K6YA 4YTLA 1X19A 3PQJA 3QOPA 4B9LA 3VW4A 1WHLA 3ZSXA 1UA1A 4LK0F 4E7LA 4RB0A 1R59O 1ERDA 4XLNF 3TARA 3FM3A 3HBLA 4IOCF 3E9OA 4HAMA 4M3YA 3IHOA 3JCMV 2AZVA 1LEAA 1UGPB 1NK8A 3JXUA 2BKDN 3GL1A 1WHJA 3EG3A 1QKXA 2HOAA 2M1HA 1EQYA 1USTA 1Q7YO 5AQXA 5BQTA 2O4XA 1SC7A 5GAOl 2VCPA 5LMNK 3J80E 1N5YA 1NHAA 4KUMA 2NXNB 3A1PA 2QWQA 3T19A 3SB2A 2COMA 1HR0K 4KAZA 2NS0A 3TW6A 2KMUA 1WSIA 3THWA 1ZK8A 2YU3A 1PU8A 2L3QA 2RJCA 1U6GA 4B48A 5HRPA 2O8CB 3EDPA 1MV3A 3PX0A 4BXXJ 3DRPA 2LX7A 5FLXZ 3JSOA 2ATCB 1UAXA 3VSLA 3TOAA 3C0BA 3TSQA 2DPDA 3GW2A 2BE7D 2YR2A 1XG7A 4AG2C 2EJ9A 1NGAA 2NRVA 3CCJT 3JS6A 1RBVA 2EJRA 3V7RA 3HVTA 1NMNA 2IDOA 5J2NA 4LF8K 5AJ3K 2DTUA 4ETSA 5LL6Z 4DSFA 5EZHA 3VEXA 3ZMDA 3CMYA 3RPUD 2HAXA 1ZBHA 2QDYB 4A5MA 3O1WA 1MMSA 4XH4A 3UB5A 2E1CA 1R4MB 1R77A 2IVMA 3O6BB 1J5OA 2OZMA 1G3TA 2NRXA 2OPQA 3ZT3A 4D6WA 2XY8A 1FYKA 2M8GX 2CQKA 1X9MA 3ZQQA 2FRWA 3CMAT 2WBMA 1XS9A 1MDMA 3UA7A 5D7UA 5E8IA 4YELA 4BBSJ 4G12A 4CJ4A 1NGNA 5CZ2A 4DQIA 4UNOA 4C8OA 1V4RA 5EF6A 1QW1A 3NTIA 3TAFA 3CC2I 3ZQGA 2GELA 2P6TA 4C5EA 1WNLA 4KHNA 2COYA 2MK5A 2RV8A 3EYIA 4A4GA 3OJUA 5JHFA 1GLCG 1BI4B 1EBMA 2YSQA 2YUOA 2KE9A 3S32A 3WUHA 5I3UA 3F10A 3JW4A 3Q7BA 2LDMA 1JHHA 1N9RA 3DKMA 4C3JJ 1VAZA 4C2MJ 3I55Q 2M8EA 1OZ2A 5IYBJ 3FK7A 3MECA 4DSJA 4RLQA 2E1OA 4BE2A 5J4YA 1M90R 5AQZA 3OYYA 4AIJA 2P7CB 2CT3A 1YJNI 1CXQA 3OB9A 2IAJA 4YRVA 4BUGA 2HL3A 3HPWA 3HVRA 3MEVA 1FK9A 1K73R 2L5QA 3GF2A 2UUCK 2DIGA 4CE9A 1D3BA 4DR4K 2ZNZA 3EQLF 1HX1A 1P92A 5LJ3f 1SAZA 3LDLA 2R5AA 2R7YA 3CESA 4OMFB 1GV5A 1MMNA 4FWOA 3E6MA 3EAEA 3JRAA 2P9LB 5IT9K 1RABB 4RW7A 4J6YA 5A2QK 3L4IA 4HCCA 5GANg 4M75C 1T3VA 3FBIB 2DQRA 2DL7A 2ZPFB 3PO4A 3TU5A 2E20A 2AT1B 2Q31A 1T6SA 2DX1A 2Q3SA 1Q81R 1UB9A 2MF2A 4QKUA 3CF5L 1KD1U 3H36A 3JRBA 1J5YA 3AO3A 4F55A 3CUQB 3ZN0A 5FU6B 2QF7A 2W4SA 4ESFA 4DOVA 2KIFA 1QBJA 5HNFA 2QA4N 2PZ1A 5F64A 2HMPA 2X85A 3C2HA 4DBFA 2IA0A 9ATCB 3CD6T 2LRQA 2DOAA 2PUOB 1RL2A 5DUIA 2KQRA 2I0NA 5KGXA 3EN9A 4OJRA 3ZQHA 5IYCJ 4M7DG 3CETA 4IOXA 2ZSIB 2RQVA 4KMUX 1SVMA 1YVNA 3JCMf 2FZKB 3VYRB 1B59A 1ZLJA 3G1OA 3WODF 3WTUC 1IG7A 3PNTA 3BTLA 4NHJA 3C65A 2OAZA 3BF1A 2A37A 2GBQA 4RTUA 2DL3A 4C5HA 2QQSA 3CCRA 2LOOA 1C0WA 1XD7A 3KK1A 4FSVA 1SAUA 2E1YA 3LGLA 2PQ8A 3JRDA 4RW4A 5HDNA 4CW7B 1QRYA 3A5NC 3CC4T 3J7AP 2NNYA 1KA8A 2FMLA 4KB1A 4DYCA 5LMUK 4A93J 1JTYA 2JMAA 5KRTA 1QZ5A 1POGA 5KTQA 2ZXHA 1K6OA 2ABLA 5GIOA 1ZX6A 2IEKA 4JJCA 4E4HA 1DT9A 3G73A 4AQYK 2D0AA 3KLFA 4KNYA 1K73O 4ITVA 2EZHA 3N5BB 4H0PA 3EG9B 1CSKA 3OBYA 2P9SA 2EVRA 2M0OA 1BCMA 4M7DD 2DA3A 3EG0A 4IO9L 3RIRA 1W4MA 3CCUQ 3QNNA 2DLLA 1MDMB 2E4HA 2O9LA 2EKOA 2JXBA 1HLUA 2W6LA 2PJRB 2PAVA 1TW3A 3RR8A 1VQKN 2LG4A 2VVKA 1BR1A 3V8KA 2P9KB 4N56A 1RTDA 3H0FA 1WNSA 1XNIA 1MD0A 1HLVA 2VODA 5CZ1A 5DD8A 4HF1A 2VWKA 2V8IA 3UKGA 3LA7A 3ER0A 5ERIA 1T6CA 2RI2A 4RKUE 1P4XA 1ZLKA 4A3FJ 4QAGA 1RT7A 3LFUA 2ZNYA 2X3XD 3ATUA 2XICA 3E66A 2PLYA 1W0HA 2WFBA 3FF5A 3E1YA 2EA2A 2V6CA 2DT5A 4J8FA 1TAUA 2GUIA 2PU9B 4OGEA 5LJ3e 2DJNA 4I9LA 4LOCA 4RCBA 5E41A 3CJRB 3QBYA 3VTHA 4DTMA 2VL8A 2LBFA 4TSXA 3GFMA 2K2MA 3L00A 4IUQA 4A3LJ 4LE9A 3FFIA 1BL3A 2CW7A 2X6NA 1YI2N 5J40A 3QSUA 1Y97A 3CCUT 3QZ5B 1UFMA 4NL2A 2EYZA 2QG9B 3OOPA 4ANJA 3VYGA 1OOTA 1X1AA 2P9PB 3LL7A 1HKTA 4ILJA 1QGPA 5J2MA 2YS9A 2DODA 1S72T 5LJWA 3HUGA 5BMZA 4F8RA 2OV7A 4IOCL 3C7NB 8AT1B 4X65K 3THXA 1WSJA 2FBHA 2DF6A 3OW2P 3MHXA 3HTVA 1Y0NA 2XRNA 2VXEA 4PJOD 1HYSA 3JRGA 3TAEA 2BZ8A 5GAMd 2K7AA 1OH7A 2DAOA 3JCMd 2NOGA 3QWLA 4XAXB 4CI6A 1SKUB 1MNMC 1RRQA 5EOYA 4F2RA 1L0OC 2O8BB 4JRQA 5KYXB 4OP0A 2KZMA 3Q0VA 2FHDA 3V9SA 3HKSA 5FPNA 1L3TA 1NLVA 1HJDA 2K9MA 1SZ2A 2DJZA 5GANf 4DFPA 3SUOA 4B8CA 5CR2A 1S9GA 3U1KA 1D09B 2QWOA 4DGWB 1ONVA 3F6VA 4QWQA 3MEAA 3CUQA 2MC4A 5M1PA 2KLAA 2HZTA 2LJ1A 2VXFA 4OKEA 3DXKA 2HSPA 3HGYA 1CXUA 3HPGA 1MBHA 1TQIA 5GANh 3ISPA 2GTOA 3HHHA 2KW4A 3H45C 4II1A 3RSNA 2IC3A 2Z5UA 2DBBA 3ZSRA 4N76A 4FZZA 5M5YJ 4EGYA 2KJBA 1QVGA 3ESWB 3CBMA 2LTPA 3TEEA 1ABOA 5LGNA 3DPUA 2W42A 2HF3A 1AA7A 4FJNA 2DFHA 3F8BA 3QJ6A 4HUGA 3BQZA 2HEOA 3VEZA 4BC2A 4ZDLA 5LJ3d 3K9KA 4HLYA 1UHCA 2NRAC 2XSDC 4M3WA 4HUFA 4X66K 4NOYA 4B3XA 1V55H 3WE2A 3FK6A 1FX7A 4E1JA 1WQWA 1WJ5A 5KYYA 1GLJO 5GMKi 2DMNA 3BOQA 4KGZB 5FLMJ 2JS0A 4BY6C 4B3OA 1OR7A 2ESWA 5A2QZ 1N9SA 3NVMA 2CP5A 1NEGA 3LH0A 4OMYA 4B1ZA 1GDTA 4EPCA 2Q2EB 2A5WA 1Y57A 4LH5A 3KNTA 1YJWT 2LY9A 2FSWA 1ZG1A 5ILUA 4N9IA 2PMZA 4M77F 1YHQA 4KRFA 3GG4A 4FYDA 1TSFA 4HUEA 1Y71A 1PCXA 4FLUA 4BRNA 1FMVA 4IUTA 2D45A 5GAGJ 1VUBA 1F9NA 4BL0B 4GLKA 3PIPL 1LW2A 1T05A 1KC8R 3CCSN 3RESA 1D0ZA 2I7NA 1IRFA 3S2DJ 3DAWA 4E89A 3UA6A 3JB9F 3HBTA 2EZKA 4HNVA 3AFHA 3MEEA 1RI9A 2QYZA 1OYWA 1ZRCA 2NVYJ 5C6SA 4WFBL 3B8AX 4B9TA 3HOZJ 2RK2A 1U45A 1ARKA 4MZPA 4CBXA 2R7ZJ 2MWPA 5J8FA 3GTPJ 4C0GA 3GTLJ 2R7TA 3N5NX 3LH5A 4OB1B 4B1VA 2AQEA 4YOXA 3F0CA 1NKBA 4DBHA 1KXPA 4M3TA 2QWLA 3MN5A 3BZ6A 5M9OA 1K0SA 3W2AA 4KB0A 1IN6A 3CCLQ 1X58A 3CCEN 4Y7NJ 3MZYA 1EIFA 3RJPA 3K69A 3C7JA 4IG3A 3VS3A 5D5UB 3ZQCA 2R5YA 1L3LA 3FXJA 5HOOA 1VSLA 1FOKA 2D1VA 3HOTA 3AVHA 2DOFA 2Z33A 3HOYJ 4IO8A 3TTFA 4JP0A 1MDUB 2WSFE 5GPAA 3K2ZA 2MOXA 2VJJA 4BC4A 4AFSC 4WXDA 1SRLA 4OMQA 3J80Z 4N4HA 4DEXA 1S8NA 4XU0A 2DIQA 4BDYA 3UIQA 1QHTA 2QK0A 4PKCC 2XI9A 4KH5A 1QVGP 4B9SA 2IXSA 3ZYYX 4F2SA 4YHHK 1TUUA 4BWJA 3ULQB 3I71A 3I3LA 3ELKA 2EV5A 4KYWA 1LB2A 2EQMA 3BG9A 4ENKA 1ON1A 1WLPB 4IJNA 1LFBA 1J53A 3A02A 3G25A 5DCMB 4XICA 3CMAQ 1VSHA 2H56A 1SL0A 2GX9A 4RW9A 1MJAA 1FOXA 3N05A 3DQVC 2HDWA 4KA4A 4J6XA 2QM1A 1OPLA 4MDBA 2CQ7A 4WTOB 2QDLA 1NJIR 4M7YA 4KTZA 4EIAA 1W2BS 3GIBA 5E20A 2W03A 1WEFA 3HEFA 3HRUA 4FVUA 2O8XA 2NUBA 4WYBA 2FBVA 4BKXA 1HNVA 1I5ZA 5KAIC 4EATA 3AT1B 3VYSB 2K3PA 2R5MA 4C0FA 4J8OA 2O61A 3CCLT 3CXCM 2QTVA 2JSCA 5B1AH 1UE9A 2YXYA 5J2PA 3FJPA 2OZSA 1WJRA 4DG1A 2X9HA 3UF4A 3OL4A 1MNDA 5KHDA 3VGKA 5KK1A 1AOYA 2X6YA 2OTLQ 1ZSGA 2KFZA 3E01A 5CO7A 1A6IA 4FWRA 2DXIA 2CP6A 1BI4A 1IJJA 3AKZA 1GXPA 1W2BM 4BU2A 1JB0E 3JB9H 3I59B 2UXNA 2LQWA 5LJ5f 4MEXF 4DW6A 2VPLA 3NH1A 1M3BA 4OMOA 2O31A 4CZIA 3HSTB 1JLBA 2ME6A 1VQ6Q 4DV0K 1N6AA 5KQDA 1S22A 2E2OA 3LLRA 1FYMA 3IUCA 2YRDA 2R7OA 1W5TA 2RNJA 2XMFA 2MWOA 3GYHX 2E4LA 2LSOA 1XC5A 2QASA 1U8BA 4V2SA 4FZXC 3H0IA 4PJNA 1QVFP 1YX5A 2FXAA 3DLRA 4RGUA 4PA1A 1RDCA 4E47A 3TO6A 1VQNA 2FBXA 1BI1A 1YAGA 5FFZA 3CQYA 3P9IA 4HSBA 4JDSA 3QMLA 4EV0A 5CK9A 1IV8A 3SEZA 3RVCA 4EZ9A 2P6SA 4X1EA 2ZJPL 2OCEA 3X26B 3S1RJ 5LHGA 1XQHA 4YEJA 3M4OJ 2XUBA 1I1SA 2VN2A 5FPMA 4OKJA 3VQDA 1V5GA 1SMYF 5C24A 1VQ9I 4EDUA 1OVYA 1ASVA 4E9GA 1LMZA 2E10A 4ME7A 4ZZDA 5CKHA 4QVZA 1TWFJ 4KT5C 1RAAB 4QVCA 3RTVA 4ESRA 2ICWG 3R4KA 4G6QA 1KC8O 2EFOA 3CJAA 2KXCA 1Y1VJ 4JNEA 4CEQA 3N4PA 3RZOJ 1NOYA 1TNSA 2UUZA 1FKOA 5EGOB 1N3AA 1Q86C 1TVRA 3QEPA 2YU9J 5HRRA 3NTKA 3HGGA 1HQCA 1Q86R 1Q8IA 3OS2A 1UJYA 2CS7A 3SFIA 2YNFA 2BY2A 3NRVA 3FHZA 1XTDA 2Q0RA 4CJRA 4OIOF 1WN7A 4BJ6C 1CGPA 2HBPA 2JPBA 2RREA 4ENNA 4A2UA 3OWTA 4AIKA 1Z9QA 4Q48A 2ZPHB 2W48A 3GLLA 3QWYA 1LVKA 5GMKl 3WTTC 5DPKA 2FNAA 3P9KA 3CCQT 3GXOA 5GAOr 2P9IB 2GIVA 4Z4CA 3M4GA 2XAJA 4BACA 3LDOA 3CMET 3KFVA 1X3UA 1NJIC 1R36A 5DYMA 4PLIA 3CWUA 2A40A 4CCLA 2OA8A 1MWMA 3V4IA 4HCKA 1C0TA 4ZC3A 1GV2A 3C4SA 4CEDA 3OYLA 4AHTA 1UZCA 4JUVA 4Z88A 4FJ5A 1BW6A 2QBYB 4YPHA 1B6AA 1ZRFA 1UJ8A 3K4KA 3CF5F 3PY8A 4BHPA 1Y56A 1BN5A 1SMTA 1QP3A 3K58A 2A61A 2MPXC 3IAYA 2K9GA 3CF2A 3JRFA 2QWNA 3DCFA 2M02A 4DQ8A 2J5PA 4F16A 2J6OA 3G71I 3MEUA 5A0DA 4OPHA 2JK3A 5E3NA 2XKOC 4KHWA 2XHIA 3ULDA 4DUZK 1BR2A 1HNIA 2WBNA 1X1BA 3FZHA 1MBFA 2J6FA 3EE9A 1C0MA 1RACB 4HKEA 4UOBA 4KIBA 2YLBA 3CUQC 2E2JJ 1G4DA 1IZ1A 1BBZA 1YI2A 7AT1B 1VQ4I 3E6DA 3WU0A 3D7EO 3AAQA 4X62K 3BY6A 3WTZA 1M30A 1RT3A 5AQPA 1ACMB 2Y69H 2JHJA 1EO1A 3PNVA 4G9YA 3HXMA 2QEXA 2MMPA 1MBEA 1YJ9I 1XX5A 4HEA2 2CQXA 2RHKA 3HM5A 1UUEA 2A3SA 3M0QA 3IRQA 3EEQA 1SKRA 1ATSA 2A1RA 1TBXA 2JN0A 2K6DA 4OO1J 1NOZA 2I10A 1UHWA 1YI2I 3I64A 1WI3A 4H5VA 2HWVA 4O5BA 3ZEUB 3FXRA 4CHPA 3LM2A 3FE1A 3L6QA 5I42A 2W82A 2P51A 2ZPBB 4L18B 3FXKA 4JKFA 1AHJB 1JL1A 1RUNA 4ESJA 3KLOA 4M6VA 2HW3A 5LJ5d 4N47A 4Y4RA 3VWBA 3BR2A 1TW2A 2O8CA 3VEOA 2JVGA 3ZSYA 1MJBA 3OMGA 5FPDA 2NRTA 2HZYA 1HKGA 3KLIA 2EGAA 2JPSA 2XAFA 3N0UA 4NXMK 4CHOA 2NRHA 3Q7CA 1E0EA 4Y33A 4RDUA 3WXJA 1V54H 1D5AA 4IDHA 3D2FA 1R5HA 4OU0A 4BXUA 3LA3A 2CDTA 1EXQA 2OAUA 3NAEA 4X0GA 4Q4ZF 3URGA 3PIPA 4CBUA 4ENJA 4O5FA 3TAPA 2EWSA 2F5DA 3GEZA 1SEMA 2W10A 4FJ8A 1RCHA 1VQKI 4B1UB 3HRTA 3SDBA 5BPDA 4I2OA 3L2ZA 5CQGA 5CAIA 4Z2YA 3M1EA 3CD6Q 3WG7H 2B86A 3LNQA 2WC2A 1IKXA 4DFMA 2A28A 3PX6A 1K9MO 5KYUA 1PSFA 2AO9A 5FW9A 1TL3A 4HPQA 3THVA 4RTZA 5FROA 3EH2A 3QFPA 1N25A 1WFWA 3DB4A 3OA9A 3W6VA 1VQLN 3AO5A 3GOIA 1RFQA 4CJWA 4X6AJ 1IBKK 2R7SA 3MCPA 1VQPT 1HOMA 1B92A 3LL3A 1LFUP 3MX5A 1AD5A 4F7UB 1SV5A 2M30A 4D5CA 2CSIA 5HLGA 3P4IA 1Q86O 3AVLA 2E5LK 2VT2A 1I4K1 4OMPA 2M16A 1OH5A 2J6KA 1CZ9A 3PNWC 1FOWA 2HKNA 4MLHA 1LV5A 1YIJI 3K70D 4B3AA 1A35A 1IDZA 5AZJB 1IHWA 1OYXA 4FK0A 1UCRA 5DMRA 2YT6A 3TO9A 3V8LA 4HVJA 3OIQA 2IS2A 2EBPA 3META 4GKJK 2AK5A 1HCRA 4C92F 2RF2A 1J9AA 4ELTA 4DF4A 2L3RA 1GVJA 2M0CA 4U87A 1NMDA 2DFFA 2V79A 4JRIA 3CCVQ 1RAGB 1UJ0A 3NDKA 2D0CA 3PFSA 3QZ9B 1KCFA 3V1OA 5ADXH 1X01A 3QRFF 2KPMA 1X3MA 1BIBA 1T95A 1GVDA 4GYIA 2ZGYA 4DCHA 3OSGA 3SUNA 1LVAA 2E60A 5H20A 3RQ4A 2O8EA 1W0UA 2V9KA 2JTFA 1KZHA 1NGIA 4NYNA 3K59A 4GDFA 1VQ6A 1X9SA 4GRIA 2M9UA 3OY9A 2FNPA 4XKBA 5DK5A 4Q0BA 4D0PA 5K7ZA 3H9GA 1B4AA 4IHXA 2EW3A 4C8QE 1J3TA 3A4CA 5EZGA 3KE2A 4B23A 2FO0A 4CZHA 3NH0A 5HK0A 3WTXC 3O9QA 1YJNA 3IH7A 1O7FA 1DGWY 2BBYA 1U2WA 3W3CA 4H5WA 2WOMA 1QCOA 2F5TX 2FUG2 4ATOA 3REOA 5FD5A 2L3PA 2QA4A 1GLNA 1YJWA 2GXBA 4YIRX 2V7ZA 2PNIA 1KQ9A 3M6GA 5GJVB 1WQ2A 3DLBA 1HSTA 3CDIA 4KULA 2NYSA 4KV8A 3KYCB 2HMAA 3ISNC 3E5XA 3BDPA 2YHYA 5GADP 3IS9A 5I2MA 1RT2A 1ZTRA 4OFAA 1NK4A 1ORPA 1JLAA 1F36A 3KTQA 2ZXJA 3QBXA 1VQOQ 4UB6C 2JVVA 3O2PE 4ASNA 3FLGA 5LLQA 3E5QA 1S5JA 2IS4A 2LNVA 5ILVA 5H6RA 1MWKA 3FZMA 1J75A 2JM8A 3M3ZA 4B9VA 4GYGA 2QKMB 2OPPA 3K10A 2VOOA 4ZTJA 3PMTA 2DAQA 3PLAA 3BLYA 4A6EA 4XRMA 4BY6B 4BRPA 5K14A 2QSFX 3R6OA 5J4VA 3WGGA 1K9AA 4ICLA 1KQSP 2A6HF 2O6GE 1WJCA 5FFXA 3H0HA 1YF5L 2HBJA 3SHFA 2PVOB 1FJLA 3H1CA 1YIJA 2IAIA 1S72A 1BOAA 2EHGA 1QSLA 2YHBA 1FC3A 4CVNE 2VI6A 3RZDJ 4WK8F 3BE3A 2JHNA 1RC9A 1C1BA 3QXEB 3HM9A 4Z4FA 3ULEB 5HS9A 4CFCA 2KYBA 4BQQA 1Z3YA 2DTIA 4OFHA 3M55A 4NC6A 2FOKA 2XDDA 4PFPA 4BQAA 1YE9A 3CQTA 1FPQA 1KD1O 4IFYA 1M2VB 2JA8J 1VQ6N 2GQQA 5GAMf 2LYCA 3KLEA 1Z91A 1H89C 3I56T 1LW0A 2HKQB 3T1BA 2XIDA 4WQ4C 2ITMA 5AR0A 4DR5K 2A6TA 2K3YA 4E1MA 3B6OA 3NHNA 1VSDA 1XQOA 2HTJA 2EIFA 1U8RA 5KYYB 3ZT1A 3BDDA 1G15A 3H0DA 5KE2A 1OYIA 2OCCH 1R8OB 4E7ZA 4FLYA 5GAOp 1WQ7A 1YUWA 3ABMH 3F22A 4EVVA 1JKPC 2LZ6B 2PMZN 2PEXA 1E4GT 3QU3A 1UMQA 3BDLA 3WXLA 4CZZA 2DPNA 1GLLO 4HNTA 2A07F 2CZ0B 2M9HA 4NXNK 3THWB 4XTYA 3BZCA 4HOBA 2XPUA 3K4CA 5GAN3 2AP1A 4CJPA 4OKKA 4O55A 3VPZA 1LDDA 2NVXJ 2VJIA 4XN3A 2FPFA 4CGHA 4LF5K 5FKNA 4PSXA 3ZQIA 3MP1A 3ID6A 3TOBA 5CKDA 3GFIA 3VODA 1WVRA 3IH3A 2GUPA 4EM2A 1T2KA 4JQFA 3KK3A 4J9DA 1L3VA 3HSCA 3E6BA 3IAM2 3SZPA 2CGPA 2KT1A 4MTDA 1CLQA 1DTQA 2DRMA 1N39A 3THKA 2VBZA 3E19A 3MAQA 5DUKA 1KG4A 2CREA 4YORA 3IWFA 1WZOA 4JK1X 3REBB 1XGOA 4RTFD 3I0SA 3QYFA 1ZG5A 3VEVA 2L8DA 3J7YJ 4F4KA 3DLGA 3GTKJ 3RERA 1SKSA 4IHSA 1R23A 3AAFA 1BU1A 2FBYA 4N9HA 2OTJA 4VUBA 3MXJA 1MW7A 3LPUA 1S6LA 3E7LA 1AOJA 2R57A 1D3BB 3I5SA 2A5XA 2A5YB 1WPYA 3BTCA 4H0XB 4NCBA 3ZN1A 1FXXA 3NCIA 5JVTA 4EEFG 1IN4A 1KC8C 3ULEA 1R0CB 4F3OA 3MKYB 2XKPA 1VQLI 1DIZA 3HZ6A 3MKWB 2M87A 5E84A 5KPZA 1XGMA 2EFPA 5J1UA 1WH5A 3KLHA 2JT4A 4J6WA 1KFSA 3TKYA 5IP7J 1Q18A 2Y4YA 2G8FA 1I1GA 2GBYA 4FL6A 2Z9OA 2F8TA 3DXMB 1M1KO 1RDWX 2NRWA 2O4GA 3SMPA 4ZGJB 5C12A 4NYFA 3H9NA 2MW8A 3MCZA 3K2PA 4OIQF 3BR5A 3TGNA 5LJ5e 2EZLA 1QQMA 2WAQA 3BWGA 2XV4S 2V26A 3EGXB 4ILHA 2O8DA 4CCHA 4BBRJ 4XK8E 1YIJN 2X6SA 1TLHB 2P9PA 5A0GA 1JXMA 2F2VA 3FMRA 3U8XA 1HUXA 1VQ8I 4HX8A 4DV5K 2CP0A 1RRJA 1ZLMA 4A57A 4DK9A 1EWRA 4AHCA 3JREA 1M90U 3H92A 3U23A 4CJ3A 2O8FB 1WSFA 2ZGWA 4R8HA 4J2EA 1TH7A 1GRIA 2OTJT 4B9MA 3ME9A 4G8XA 3TR8A 1ZBJA 4M75D 2Q2RA 3RWUA 3DMJA 1JJ2S 2YHWA 5F0FA 3PO2J 4LDVA 5KRSA 3ZQFA 1MKMA 2AKKA 3F8CA 1N33K 1VNDA 1FP2A 3WU2C 4P9FA 3UWNA 3GF5A 1TUYA 3OA6A 2C06A 2F2EA 4O44A 2M5WA 1PHTA 1E17A 3AVNA 3K9JA 1KEAA 3JCMh 3KD1E 4DSKA 3KFWX 4CJUA 2VG7A 1Q1HA 2TRTA 2ZMEA 3QDKA 1GLBG 3MMVA 2HBWA 3G6EA 1LUJB 4H8KA 3VOEA 4OMNA 1S6QA 4M77B 4M7DA 2M4KA 4JI4K 3V9ZA 4IXCA 4CFBA 1BOTO 4ELUA 5HDGA 4FM0A 1VQ4N 2CUBA 3MKDA 2CH4A 1VSMA 4PJ0C 4JX6A 1P90A 5E3MA 4JI1K 4HDUA 2XGXA 3TL4X 1VQKA 4AIDA 4RMOA 3ZX2A 2F6CA 4DTSA 2RI5A 4PL8A 5AQIA 2D5VA 3AA2A 3SPYA 1LAVA 1EWQA 4PDKA 1BB9A 5FJ8J 3VQ6A 3QPLA 5L3FA 2VC0A 3A2FA 2E35A 1I07A 2YNHA 5GAOn 1RR8C 2VG5A 3EPZA 4RAYA 1QU3A 2LNBA 4RTYA 1FMWA 3GBGA 1VQPA 2F5EA 1JCGA 3ZT0A 4DV1K 1SANA 4H5TA 2E41A 3CPWM 4XM3A 1SG5A 3BPVA 2UUAK 2YWWA 3P31A 5AQGA 3TTCA 5AQWA 3T1AA 3CXCP 1XGNA 1ZQ3P 2JN6A 3E2UA 5F1XA 3LWIA 5KCMA 5K5QA 2HQ5A 3SYZA 1S72I 5J39A 4BG9A 5BRFA 5JR3A 5D6FA 1JLQA 1VQNT 2QYOA 1X6GA 3I55N 4C0DB 2YRCA 3M9AA 3BG6A 4XU2A 3LYIA 4AH9A 4B8XA 3CBOA 2A42A 4QPOA 3N97A 4DQSA 4B9UA 1NJXA 2COZA 5CIUA 3ZX3A 1SS6A 4WFAL 1HSQA 1VSKA 2M1BA 3L7WA 2HGCA 3UKUA 1RRSA 4K41A 4FVMA 4E0DA 1YI2Q 1RT6A 1BO5O 4YOTA 5M1QA 3X25B 1K9MC 1YITN 3QNOA 1VZ0A 4MFBA 2QQAA 2CH0A 3CPFA 1G8XA 5B3SH 4J9IA 4R55A 1IN7A 2DA6A 3CXCS 2DTHA 3EGDA 4E7JA 2HDCA 1FYLA 3VN5A 3SQ4A 1XB4A 4L59A 5AZIA 3HFNA 3T8RA 4ESBA 5GAHJ 2QQRA 1YJWN 2E70A 3PIPF 1YYVA 1I39A 5F0HA 5AQQA 5BN9A 3OMCA 2PVGB 4XIUA 1T33A 4A59A 4AM6A 1W4SA 4HT9A 3CJ1A 1KONA 2HNHA 2GOXB 3SJMA 2DMPA 4UUSA 1PVSA 1IJWC 2CH4W 3DRSA 3VOVA 2NLXA 2NNNA 1B72B 4QVDA 3R8EA 1K8AU 4CJSA 5LY3A 3EZ5A 2KGTA 4M3RA 3KZIC 3ZQLA 2L0AA 1YJ9T 2F9TA 2P8TA 4UUVA 3GTOJ 3DTIA 5LHHA 3CC7N 4F7ZA 3VEPA 4MHGA 4EJOA 4AVZA 4PY5A 1YITQ 4HX4A 5JVHL 4NDLA 2QQ9A 2FPEA 3MP8A 3C12A 3NWSA 3WEEB 4Z4GA 2E7WA 3CC2N 3L3VA 3LZIA 4HHTA 4BQNA 3BW1A 1DPRA 1QCFA 3QDFA 1X6OA 3V9UA 5E18F 2RJDA 2BY1A 2B8AA 1MUNA 4M75B 4ZDOA 2HVQA 2FE3A 1GLDG 3WXMB 1VHXA 5GTHC 2WUSA 3CCST 2H6BA 2HBKA 3EHRA 2LRDA 5AIQA 3QPHA 3M0SA 2YSRA 3ROUA 2KDOA 3MKLA 4D7NA 3DWLE 3Q0WA 3ZLJA 4JKGB 2FRYA 2D0PA 1IGUA 5MLCQ 4M3DA 5J26A 2XHCA 4CZMA 1OISA 3D5LA 3U4LA 5C3EJ 3OSFA 4O4GA 2DYBA 2ABKA 1B9DA 5FKOA 2KFNA 4BGBA 3E0JB 2X48A 3HOUJ 2LD5A 1P4AA 5FLXK 2PBDA 3QPTA 4DLGA 2VXZA 1TK8A 2I5WA 2QEXN 3L0QA 4GV6A 2FYKA 2NZTA 3P1GA 4GFBA 1YHQQ 3R0AA 1K76A 5E1ZB 2RB6A 2CSQA 5AQKA 1K73C 3O1BA 1Y7XA 1KQSA 3OMYA 2F48A 2G8HA 1YJ9A 3OYFA 4DS5A 2VLAA 2MYSA 4AHVA 4M77D 4RS8A 4DKWA 1VQ7N 2F2WA 1BQNA 1WSUA 5KYXA 3C18A 4BEHB 4R5PA 2WY7Q 4EA5A 2VGNA 2WTEA 3DOKA 4DQRA 3BC8A 3AVGA 3QIIA 3ZQ7A 3LP1A 2XHBA 3CQXA 4E6KG 1H1VA 2FEIA 5BS6A 4F7UF 1QQNA 4OAZA 1KD1R 1HPZA 2GA1A 1YCSB 4DA4A 2BE2A 3Q5FA 3E5UA 2RNGA 1HBXG 3AV9A 3CJTB 3NQOA 1S1UA 3NGPA 1Q82C 4FYXB 2WY8Q 1QCNA 4GV9A 1HYZA 2JQ7A 2DTOA 1YITA 3ZOBA 3CCJA 3KWIA 1WAFA 4BAYA 1VSJA 1KG7A 3LAMA 4CJLA 1TQMA 1B9FA 3NF8A 3GO5A 1K4TA 2NVTJ 1TKDA 3A8GB 1M90O 4BR2A 3RKQA 1YLFA 1KD1C 3G2BA 4XQFA 1TUGB 5L3EA 2BZXA 4EZ6A 2LT4A 3K4JA 1VQMN 2W0ZA 3L2QA 3JAMK 5CHIA 3DEEA 4CCJA 2ZJQL 1UECA 1R1TA 4E70A 2BUDA 3CCMN 1JXOA 1R6RA 1XDSA 4Y91A 4JZ3A 1NJIU 3DPTA 1XHXA 1HU0A 4Y17A 2DERA 4FLZA 1YJNT 2E2NA 4ZN1A 1ASWA 4DU1A 1PNJA 3NGYA 4XLEA 1N78A 2L7KA 4CYCA 1K1ZA 2BVLA 4A4HA 2BEOA 4G94A 4M78G 4C8NA 3AVMA 2G7HA 1TT5B 4FJ7A 1E3MA 1XMAA 2CRGA 4HZFA 3MQ0A 3I58A 4LDXA 3J7ZO 1R58A 1HNWK 3GTQJ 3NVKA 3M8QA 5L3CA 3KX2A 2P84A 3LWMA 5AN4A 3O8GA 3ERED 2MG4A 3CM5A 3P38A 3THYA 1MPGA 1RKWA 3UNGC 8ATCB 4AUXA 5J8CA 2X4YA 1AWWA 4BYYA 1X6BA 3PUBA 3NMUA 5HKCA 1JKQC 3PO5A 5GAOq 2HFHA 3CCSI 2AIRB 4WXCA 4MFDA 5AYFA 4DBRA 1BBYA 1GCQA 2G8WA 2XGDA 5AQVA 5DCFA 2OTLA 2LX9A 1OPCA 4C8QA 1G5VA 3QBWA 4V2FA 3DLKA 2ZAEA 1H92A 2ECCA 1YQAA 4GCVA 4F14A 5FLVA 1S9HA 3A5OC 4BDZA 2P5VA 4H5RA 4BGDA 3GP8A 3JV3A 2XAQA 3CWSA 4G6DA 3T7ZA 2H27A 4MEYF 3PIOA 4JHDB 3CPWA 1NK3P 2VXDA 4E19A 4FJGA 2JA7J 1ZG3A 2QQBA 3DRRA 2IP2A 4PKGA 2CU7A 1LDJA 4YOVA 1A5WA 1KVBA 4XLCA 4E1NA 3FB9A 4IEEA 4AMCA 4CXFA 1G59A 4W5OA 1W7PA 3TBIA 5JLHA 3QETA 4FM4B 1N8RR 3CP2A 2EFWA 3VS4A 1PD1A 4CBWA 1BHLA 4M3GA 2O9VA 4HXJA 3D6RA 4HTLA 1D9FA 1Q9YA 3IG1A 3I8BA 3CC7T 2VQGA 4CI0C 5LBQA 2VASA 1ACIA 2HQAA 2D8HA 2CQNA 2Q8KA 2GM4A 3KP3A 2ZJRL 4KKOA 4CFDA 3IMXA 4CZJA 1R0AA 5K5OA 3NH2A 3VS2A 2PQWA 3UPUA 3WE3A 2OFIA 1PJRA 1ZREA 2A05A 5IY5H 1UGSB 3DKYA 3E1SA 3EGUA 2DVJA 1RAFB 2PZSA 3HOWJ 1RTIA 3L2RA 1W2BP 2JZYA 1FIAA 2O88A 4DTXA 3FZKA 4FWLA 1CKBA 1FIPA 2BY3A 4UXNA 2EB7A 4EJYA 1KVAA 4QS9A 2H1LA 3NEUA 1LPLA 3CCQN 3EGXA 2YKNA 4MQVA 2O8DB 1S7AA 5KGWA 4L5EA 2JWTA 4I6ZA 4E9HA 1NWKA 4E7HA 1ZELA 1Y0MA 4YFKF 4IPAA 1OKRA 4DV3K 5F0XA 5D6EA 1WSHA 3HPOA 3INZA 2VYPA 1HSJA 4BI3A 1VQ9T 4U0YA 4CERA 4XKCA 5GAEP 2P4TA 2M7BA 2VOPA 1J9IA 3EO3A 3QESA 3ABTA 1ZBXA 4KPYA 4II2A 4AFQC 3SPZA 1D1BA 5IHIA 4LG0B 4NQWA 1DJ7B 4XTWA 3J81Z 4DR7K 5JI6A 2K9QA 4FYVB 2DA2A 1IC8A 3QHSA 3FX3A 1SHFA 3GZNB 1U78A 2NUTB 4PJOG 4LB5A 3B6AA 3OIOA 4MDWA 3F3XA 3K4LA 4HWIA 2J05A 2RVCA 3QOEA 3QDRB 1K4US 1H3ZA 1XDUA 4CA0A 3ENBA 4D7MA 3DV8A 3R1XA 2ZO4A 3VGMA 2L3DA 1ZUYA 1VQMT 3M1CA 3S17J 1SD4A 3M9QA 4YDUC 3OS0A 2DT6A 3J7ZI 4A62A 5IOZA 3EHQA 2OUMA 4UNFA 3CLOA 1ZQ1A 2F5KA 2M3AA 3O8HA 3TPQA 4DHYA 1AWJA 3OSVA 1FTZA 3ZFJA 1LJ9A 1YHQI 3A5LC 4QSHA 2KEAA 2CZ1B 3OYKA 5GANd 1I6XA 2E65A 3NGZA 2OI3A 3EE8A 5ADXA 3G0ZA 4FK4A 2R4GA 2RQUA 4UHTA 4P96A 4JJBA 1QZYA 2EWNA 4GXOA 4MDAA 3HYFA 4LIUA 4OX9K 3R9PA 2LP5A 2A0FB 3QB0A 3C94A 2GCXA 3RTRA 3IQLA 4P9UA 2BZYA 3PL8A 5AQUA 1UGQB 1VQ7I 3IC7A 2F4IA 2VQFK 3WG9A 1C0FA 3HK2A 1IW7F 1PVEA 2X51A 3VFZA 4WX9A 1K8AO 2X4HA 3VS1A 2E5QA 4PJOA 2VYTA 1LE8A 1M4ZA 4EAHD 1X9WA 2DXCA 3A0IX 4FJIA 4H4KC 1AEYA 4C92C 4I02A 4RTWA 2I5JA 4KN4X 1T7PA 3JB9D 1HKQA 4D8DA 4CICA 2KSSA 1F1ZA 2VJ5A 1R5GA 2COWA 1U49A 4Z4EA 4J2AA 4C9YA 3W6JB 1A36A 5DLOA 1Q86U 3DKXA 3TP0A 2KIQA 2V1RA 3KK7A 2QCOA 1WI7A 1VTNC 3L42A 1V76A 1M9SA 1X2MA 3AY9A 2DQLA 1GXIE 4L0YB 2NOZA 1PUFA 2E5NA 3J81E 3ITHA 3DLEA 3MEGA 4NB5A 2QEXT 2A7YA 1BGXT 4FT2A 2QXLA 3FHGA 1N36K 3ZP5A 4XLHA 4P5OA 3RYPA 2ZJPF 4JK9A 3QYGB 4I0BA 3K1PA 1ZSZB 4G9ZA 3CD6N 1VQ9A 3EYYA 3CCEQ 5K1YA 3RR6A 1P59A 3O4WA 2FQ3A 1GHCA 1ZBLA 3CC7I 1S7EA 4J19A 3U9DA 3TP3A 2G3RA 2A69F 1BC7C 1A5JA 3S6WA 2E1NA 2O7OA 1V29B 1BJAA 4A3DJ 1DKGD 3GUDA 2HBLA 4HDVA 2RD1A 3UDCA 2KBTA 1D1CA 2JTEA 4WF2A 1KJWA 4XKWA 3ZX0A 4A3BJ 2DFEA 1JKRC 4ZGDB 1T38A 5I21A 1M1KC 5IT9E 4KI4A 3JCMJ 4JRPA 5FO5A 1VQ7T 4EGZA 4IXAA 3ENOA 1KHIA 3ASKA 3VESA 4I76A 4DS4A 1Y1WJ 1XMOK 2E2IJ 2FA5A 1U2VB 1GT0C 2V1UA 2FSJA 4A3KJ 1EKEA 5LL6S 1JJ2P 4L9NA 1QP2A 4JLIA 4IBNA 4JHDA 2J06A 4PJLA 3E9LA 3O6WA 3HTSB 2DYSH 2VJ4A 3CC2T 3KZYA 5KN9A 5LJVA 1P6RA 3CPEA 1AU7A 2PMUA 2LR8A 5GMKh 1JI8A 4BC3A 5D4RA 4BREA 3JSMA 1NKEA 3VS0A 3KETA 3KBGA 3F5TA 4I09A 4E6RA 4NCGA 4J9BA 4E2FB 3BEXA 1Z6TA 4CEBA 3EFSA 3AVAA 4XTVA 2LVSA 2PN6A 5GAGP 2E2PA 3EH1A 4HF2A 2E3HA 4FOIA 3BR3A 1OZ3A 2EPFA 2EYXA 3LDPA 2CFOA 1HPMA 2HQRA 3G4ST 3VQQA 2LSNA 2OTJI 5H6QA 3FJ5A 4L5GA 1LWYA 1J54A 2UU9K 1TKXA 4D9JA 4CJFA 1ZXOA 4E7KA 2VKHA 3KP2A 1J7KA 3P8DA 5IWAK 1BM9A 2DKGA 6AT1B 3CCVI 3DLLL 2KHOA 1HKCA 3G6EQ 2D1HA 1XSXA 3HOSA 1X43A 1JLFA 2V4JC 3C2BA 4D1QA 3RKWA 1JU5C 1I5OB 2W40A 4O3MA 2VWJA 4Y1DA 2K3XA 3GNGA 4QT7A 2E6LA 2R7WA 1OQKA 4TVRA 1HNXK 3K70C 2Q0UA 5AQLA 2BE9B 3O9TA 3G6ET 2ID6A 1TC3C 1B8IA 4I6MB 4UY8O 5AONA 2KT0A 1JLEA 4L9VA 4L0ZB 5KPTA 2OTLN 3FM5A 5ECAA 1IXDA 3S1MJ 3ZT2A 4BRFA 5L23A 4H0YB 2F9WA 2IVOA 2WWYA 1S6PA 2Y30A 3FIWA 2HNDA 4NUBA 3G71T 3CPWS 3BZKA 2GA2A 1WJEA 3FXMA 4RAGA 3VGLA 1R9TJ 1VQPN 1VQ8T 2Y0SA 4C8LA 1S1TA 3D1NI 3DP7A 3VEWA 1YRNB 3N4QA 2M45A 2CZ6B 4WCEL 4A0ZA 3CCRQ 5DY9A 5D5XB 2QWPA 2XD0A 2QA4T 5FU7C 3HJFA 4FJXA 3SEMA 4Y92A 2Q1NA 1Y64A 2HB5A 3M3YJ 5IHNA 2B6AA 1NH3A 3BR6A 2BTTA 4PJOF 2O4XB 1D8YA 1G3YA 4EMGA 4AHRA 5HRSA 5EEAA 4RTVA 1YRNA 2F2XA 1OQYA 3A8OB 5EYRA 3M59A 2YX7A 1H9TA 1MMAA 2B4JA 1OJLA 3H3ZA 2IGNA 3JCMc 1NGEA 3CXCA 1F4KA 5CQYA 2L7ZA 2NOLA 2BXYA 4XL9A 5B5EC 1Q81O 1HW5A 4FLXA 2FC0A 3KEYA 3VS7A 5AQJA 1MSEC 1PU7A 5BR9A 2JNGA 4BDPA 2P9NA 4FE7A 1I81A 3ZL7C 2D9TA 2UXXA 5M5XJ 2R0QC 1VYTA 3SV4A 4KISA 3JRCA 3W6KB 1YJNN 1VQLQ 5E3LA 1TWHJ 2E8AA 1S1WA 4B09A 3WT0A 2KFDA 2V1NA 2P0PA 2H6CA 1AWOA 3C6AA 4OMLA 5LJ3h 2HDDA 5AQOA 3RMBA 3MP6A 2DYRH 1STZA 3A1YA 5JICA 4C0DC 3QEXA 1CF7A 2RQPA 5FPEA 3SMSA 1W6XA 5CYMA 3C1DA 3MN2A 2RPIA 3X28B 1ZBIA 3WU1B 4KGXB 4GMJB 5C25A 2IJLA 2Y1IA 3FZVA 3PSFA 4OIPF 2DFUA 3AG3H 2LKPA 2W00A 5M1OA 2ZB9A 3MPUB 4IQ4A 3G6EI 1KG5A 3L2WA 2MH2A 1ON2A 2PTKA 3W3DA 1IB8A 1RBUA 2XPWA 4FK2A 1MIJA 3O80A 3CDHA 1JO8A 1U5TA 2Q0OA 5KYNA 2CMPA 5D8LB 3GCMA 3CWTA 3FMSA 4LFUA 3LSIA 2DMUA 4CGZA 2HYGD 4AG1C 2IBDA 1MBKA 1WCMJ 4J01A 2E1MB 3CDLA 2EFNA 3ULRB 5GPCA 4F93B 3OS5A 1BW5A 1SHGA 4M42A 5HS7A 3LSGA 3DLLA 2KNBB 1VQ4T 2VQEK 3JTGA 3AVJA 3CERA 4B44A 2BVMA 4XKVA 3U3YA 4A4FA 4JRKA 4B1YB 4CGIA 2P9SB 1CKAA 3ML6A 2P5GA 1NBEB 3K5MA 2EQKA 1HYVA 3HZJA 4EHUA 4U7DA 3SHWA 2VUMJ 3EFRA 3R61A 3CCUI 5FU7B 4FX0A 1XQSC 3A03A 4I6MA 3S1QJ 1SD5A 1ZGAA 3DLLF 1YIJT 3FHNA 1SFKA 5FKKA 2RN2A 2O8BA 2Y31A 1QVGM 4ELZC 2ECZA 1QHAA 5KE3A 1NEBA 1U2VA 2B7EA 3ABKH 4JKAA 3KYDB 4GNIA 5AQSA 1SD6A 3G1MA 2OQGA 2FZCB 1NJIO 2L0KA 3FFKB 2LTOA 3M53A 1UAAA 3CFOA 5BPIA 2GQIA 1LWFA 2R7QA 3JCMX 4XEIA 2OYQA 1IUFA 5DD4A 3WVDB 4LSLA 3VQAA 2VBWA 5J1EA 4NQWB 2DD4A 3QO3A 1FZPB 1O4XA 1QKWA 4ZYHA 2XGEA 2G7UA 5D6YA 3AL0C 4CZCA 3LA2A 3KP4A 3EGDB 1VQLA 4PHTX 2NRRA 1YTYA 1WJFA 4D8KA 5GMKe 1Z26A 2GGRA 4M72A 2NOIA 2XG8D 2GFAA 5CVIA 1JGSA 1W7PD 3FISA 3OYNA 2HD0A 3BUZB 3SZ2A 1K78B 3WQUA 2EIMH 3OYEA 2P9NB 2KRNA 1X27A 4HYEA 4WCGA 2Z1HA 3DTKA 3I4PA 4BXFA 3KCCA 2KQWA 2RI3A 2Y0MA 4HNUA 2VV5A 4J2BA 1MA9B 3FXUA 5DM6L 2D4WA 4CZLA 5TISC 3Q3SA 4BQLA 2E1MC 1SSHA 3LOCA 3MEWA 4PGHA 3J7AY 4CGGA 3SUQA 3GMEA 2OBPA 5M3MJ 5HRNA 2QVOA 2ENMA 2XDVA 5KI6A 1O3SA 3WGHA 5BPLA 3FIFA 2F8SA 3COAC 2QM3A 3U6FA 5LGTA 4HCBA 3OR1C 1VQ8A 2FOWA 5GAHP 1C6VX 2WTUA 2EK5A 2Y4XA 2XDPA 1EH6A 5LEJA 3RNJA 4MQ9F 2MI6A 1YXQA 2OANA 4OPAA 3AO1A 2LT1A 2GWJA 1T3SA 1K73U 2RQTA 3H35A 4EFHA 3IUOA 3S3NA 3D5RC 2O4IA 1VQMI 1VFCA 5JLWA 1GOCA 3QFUA 1NTCA 3M5RA 2NUPB 1BIZA 4CJQA 3TEDA 1AKHA 1HQUA 2OJ2A 3RI4A 2A6AA 3ZCOA 5J2QA 2GFUA 2R7UA 4FLVA 2D0NA 1ODDA 4X9DA 3LSMA 2AS5F 1YBYA 2PX9A 1JXBA 2Y2ZA 1TQPA 1KTQA 4NC8A 1Q82U 3VQ7A 3QEWA 4H4OA 4BB7A 1BI3A 3MVPA 2M7AA 1G83A 4FW2A 3SWNA 1GLFO 5FDLA 1SUQA 2G8VA 3TVTA 2NOFA 2QGUA 1YJ9N 1JCEA 2QWRA 4C8QG 3R6SA 4FT8A 3CWAA 1AHDP 4CIGA 2P4WA 3HSBA 3A5ZB 1DEJA 3IAS2 3VTIA 2A68F 4BH9A 1JCFA 3NFAA 2IS1A 3BG5A 2ZFWA 1BC8C 5HLHA 2LY2A 4KHSA 3I56A 4PJOB 2KKZA 2XB5A 4GY2B 3WGIA 4B9QA 5I11A 1V5EA 2ZPEB 4QOZB 2JMWA 3HRMA 2NVUB 3WNEA 2YV0X 2Y48A 4EJVA 4IEIA 1JJ8C 4YG2F 1AZEA 2K2VA 3LP3A 4JPBW 3FKIJ 3JAMO 3HTUA 1D9DA 1UA0A 3JCMP 2IOCA 5IT9O 1BK2A 2QEXI 3PFYA 1T6DA 4N4GA 4KDPA 3J80O 4DWIA 3A01B 2D5RA 4EQQA 4OAYA 2HQXA 1MU2A 4C92B 3TABA 3LW5E 3CCLI 1LNXA 2KRHA 4PCQA 3G10A 1WGXA 3TW7A 4UB8C 2QTDA 4B47A 1W97L 1SFOJ 1RI0A 1Z1DA 3I8DA 4M7AE 2HMIA 1XI1A 1EZZB 2BZTA 4XNFA 1KQSM 4H5NA 1VQKQ 1A5XA 2FXUA 4BRGA 4ZH4F 2BHZA 3O4NA 1TV6A 1SFUA 3CCET 3L9FA 1XWLA 4FO0A 1DQUA 3SZTA 4C3IJ 2K3BA 4DIQA 1M1KR 5C0YA 2CUDA 3ASMA 4XTXA 1JUSA 4J2DA 2X4XA 2MCNA 1QWEA 3GFJA 1KIKA 4FWPA 3MN9A 1LOTB 1WHMA 3CM6A 1EA3A 3LSJA 3C6HA 2W84A 1W9HA 3CCEA 3H3UA 1BG3A 3SFMA 3S3OA 1RUWA 1K79A 4G7ZF 2HL5C 3CHWA 4DLEA 1WX6A 4FETA 2NRZA 2DDAA 3RDVA 2D0BA 1Z25A 5FD6A 2WSEE 1YHQN 4AI4A 1B34B 5GAMj 3CJQB 4B3TK 4BJ5C 2WACA 5ICEA 2E71A 2I8DA 1N5ZA 2KT8A 1H8KA 1SKWA 3PMIA 2R92J 2GTJA 1G3SA 1IKVA 4JK7A 4Y1CA 3ZSOA 4RW6A 5CCAA 3UR3C 5C4XJ 4QS7A 2PFUA 3EFOA 3FHFA 2JT1A 2R7DA 2UXBK 3BT9A 4RBOA 3TWHA 4UC4A 2GWRA 1Q81C 4RB1A 3IRXA 3OOUA 2EZIA 3F70A 1QVPA 4M9ZA 4M77C 3GDQA 4A69C 3LAKA 4PL6A 3ECOA 3KK2A 3SBGA 1DPUA 3S15J 4IHVA 2HXIA 4BUPA 2K4JA 1EF4A 1VQMQ 4XONA 5J1RA 1Q82R 2D0OA 2I2LA 2RPNA 1ORNA 2RQRA 3AA5X 3LAJA 4P1WA 4CK3A 3BJAA 1DUXC 3EFOB 5LEKA 5CQXA 3M0TA 1RNLA 3MWPA 4OINF 1Z7UA 3AA3A 1KU9A 1Y0UA 1DU0A 1RESA 2IW5A <