3OYDA

Crystal structure of the prototype foamy virus (pfv) intasome in complex with magnesium and the insti gs9160
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
368
structure length
368
Chain Sequence
LDAELDQLLQGHYIKGYPKQYTYFLEDGKVKVSRPEGVKIIPPQSDRQKIVLQAHNLAHTGREATLLKIANLYWWPNMRKDVVKQLGRCQQCLITNASNKASGPILRPDRPQKPFDKFFIDYIGPLPPSQGYLYVLVVVDGMTGFTWLYPTKAPSTSATVKSLNVLTSIAIPKVIHSDQGAAFTSSTFAEWAKERGIHLEFSTPYHPQSSGKVERKNSDIKRLLTKLLVGRPTKWYDLLPVVQLALNNTYSPVLKYTPHQLLFGIDSNTPFANQDTLDLTREEELSLLQEIRTSLYHPSTPPASSRSWSPVVGQLVQERVARPASLRPRWHKPSTVLKVLNPRTVVILDHLGNNRTVSIDNLKPTSHQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PFV integrase
publication title Molecular mechanisms of retroviral integrase inhibition and the evolution of viral resistance.
pubmed doi rcsb
source organism Human spumaretrovirus
molecule tags Recombination,viral protein/dna
total genus 108
structure length 368
sequence length 368
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2010-09-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
A PF17921 Integrase_H2C2 Integrase zinc binding domain
A PF18103 SH3_11 Retroviral integrase C-terminal SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2300 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3oydA04
1.10.340.70 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Endonuclease III; domain 1 3oydA01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3oydA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3oydA03
4RG8A 2LCCA 4FCYA 3AO1A 3VQAA 2ZE2A 5D6YA 1U45A 2RHZA 1RCHA 3LAKA 4WE1A 4LH4A 4FVMA 3PX6A 3K57A 4IKFA 2D5RA 1NKEA 4KB0A 1SKWA 3QNNA 4KTQA 4W5NA 1CXQA 1GOAA 1WAFA 2KZMA 1SL1A 1U48A 3OYJA 1L3SA 4KRFA 1CXUA 4O5BA 3G0ZA 4DSIA 1C0MA 4C5GA 1BCOA 1LAWA 1RT3A 2EKOA 1RDDA 1OZ3A 3V9ZA 3IS9A 4OGCA 4CGJA 4CF2A 4CJQA 1SV5A 4JRQA 2YNFA 1TK0A 4G1QA 2HB5A 3F9KA 3VQBA 1KRPA 2K3YA 4Q5WA 4FJJA 4DTNA 1TKTA 4DQQA 2E6MA 4M3WA 1WGSA 3DRSA 1Q8IA 4Z4CA 1BGXT 3PY8A 4CEZA 4KHQA 3TARA 4KHSA 4IG0A 3V9XA 2PZSA 4GVMA 3M9QA 4O55A 4EDUA 4CGGA 5KGXA 1ZYQA 3DRPA 2KTQA 3NGIA 3HP6A 2A1RA 4A4GA 1N5YA 4DU4A 4EP4A 1ZBIA 4R5PA 3TWHA 4N5SA 4CJPA 4CIFA 1OI1A 3KLEA 4CF0A 3SJJA 2OPSA 1A5VA 4DSEA 1NK9A 1I3AA 4KAZA 3NGYA 4A4FA 4KTZA 5HRPA 2HNZA 4BDYA 3U3GA 1KTQA 4Z4HA 3OYDA 3QEPA 4N4IA 4AHTA 5JS2A 3VQ9A 4CGFA 2RI5A 2KQ2A 2DIGA 3OA6A 2XY8A 5KCHA 4CE9A 1JLAA 4ELVA 3KD1E 4QQGA 3DOKA 3QESA 4DQRA 1L3VA 2VG6A 3SQ0A 1J54A 2LDMA 3PO4A 3O4QA 3NHGA 5SWMA 1U47A 4CJ3A 4KREA 3H08A 3LANA 4HUFA 4FLXA 4YNQA 3EY1A 3DB4A 3FDRA 5KE3A 4CJEA 4CIEA 4FK0A 5M9OA 1S6PA 4I9QA 2HQEA 1ZBFA 3SCXA 3OQ5A 4YFUA 3OYCA 4FK2A 3MO8A 1UWBA 4Z4IA 3SV4A 5DMRA 4CJ4A 4DSLA 4CEQA 1NK6A 4KHYA 3S6WA 1ASUA 2VG7A 1X9SA 1U49A 3RMCA 4CESA 3CEYA 5HBMA 3U3YA 3KUFA 3RR7A 4HVJA 2HHQA 1S1WA 3ME9A 1CZ9A 2W42A 3JSMA 3OYNA 1GOCA 3BGRA 2XY5A 3MAQA 1QHTA 2IAJA 4IUVA 4C5IA 1EETA 2DFFA 4CF8A 3HK2A 1SL2A 4ZTJA 4N4GA 2B8AA 2DY4A 3QBYA 2DTUA 3LP1A 3P1GA 1NK7A 1EX4A 2WACA 4CCHA 3K58A 3MP8A 1XI1A 4B3OA 3K2PA 3V1OA 5KTQA 3ZCMA 3DI6A 4E7HA 3I8DA 2CKKA 4RW6A 3V81A 3HO1A 3DOLA 4CHPA 3MXIA 2FBYA 1B92A 5J2PA 2BANA 2P5GA 2OYQA 3KJVA 2RI3A 4I9LA 4DS4A 3Q1JA 1HPZA 3L2QA 4TSXA 1VSKA 2G8FA 4Z4EA 3LP0A 2IGIA 1JLGA 2OPPA 3DLRA 5HLFA 1HYVA 4N76A 1WNSA 3MEUA 4LSNA 3FLGA 2YHBA 5C25A 3F73A 3K5MA 3AVHA 4CEFA 1T03A 2RN2A 5KRSA 3SUQA 3KLHA 3O3HA 1LWFA 1C0TA 4JLHA 4M3YA 3VQ4A 1T05A 1S1VA 4PLIA 4FJKA 4Q5VA 4CFCA 5HRNA 2LVMA 3DB3A 4KHWA 3HVTA 1QE1A 2XY7A 3L2VA 4DTUA 1QSSA 2RJFA 3KTQA 3LGFA 2D0CA 4H4MA 5D3GA 3P83D 4ICLA 4BACA 1VK0A 4CHQA 3DYAA 1QS4A 3MEEA 3VQCA 4C8KA 1HRHA 3M8PA 3OS1A 2M0OA 3PMIA 4DG1A 3V1RA 3OYIA 1W9HA 1MU2A 1LWCA 4E89A 4B9VA 4CEAA 4IUUA 4ZHRA 3G10A 2ITGA 3QERA 3OS2A 3NH1A 1R0AA 4H4OA 3TAQA 4ELUA 4PA1A 3QEXA 1ZBUA 4FJXA 4DWIA 3HPGA 4KI4A 2JTFA 2KFNA 4KHUA 4KO0A 1BQNA 3B6OA 2X4YA 4BE0A 4DTRA 4MFBA 1N27A 4E7LA 4B9WA 1KVBA 1RBUA 2JZ2A 4KFBA 3PO5A 1VSFA 1C0UA 5KCOA 4OLBA 4CGHA 5C24A 1A5WA 3OYMA 3OY9A 3SPZA 4M3UA 3EAEA 3OYKA 1W0HA 4CEBA 5I3UA 4O4GA 3V9SA 3MXMA 2R58A 4DS5A 4W5TA 4DLGA 4CIGA 1FKOA 4CHOA 1JLQA 5C0MA 2GFAA 3SUPA 1D9DA 3S9HA 4CFDA 4AHVA 1L3UA 4RW8A 4OKKA 2BGGA 4F2RA 3SQ1A 5J2QA 1TL3A 3HYFA 1MHNA 4QAGA 3ZSZA 4CJRA 2DFEA 3P5JA 3QETA 3OYGA 3SQ2A 4M3ZA 4IUPA 3NCIA 4OVAA 5E41A 3ASMA 2O4IA 3PFSA 3OS0A 2YNIA 4DTPA 3NTIA 3QEIA 3GOXA 3P8DA 2GFUA 2GUIA 3KIOA 1OYXA 4IFVA 3ULDA 5HROA 3K5LA 1UAXA 2RKIA 1NK0A 4AHUA 4N47A 4BD3A 1HYSA 4ZTFA 3S3NA 1RTDA 1B9FA 3BDPA 3T1AA 3HM9A 5HRRA 2O4XA 1DTTA 2P5OA 4QQ6A 3QO9A 1X9MA 2Z1HA 1ASWA 4B9TA 4Z02A 2K3XA 1YTUA 1SKSA 4FLUA 3L3VA 1CLQA 3AVLA 3OJSA 4CHZA 4E3SA 5KGWA 1C6VA 3ZSYA 3PX0A 4QQDA 3WNHA 4M41A 4FYDA 1XHXA 2HVIA 1U04A 2Y1IA 3E9FA 4FLTA 3ALYA 3OMCA 3AVCA 2F96A 4EP5A 1WJRA 1B9DA 2RHIA 3DMJA 3LDSA 2ATQA 3O8VA 4CJKA 4O0JA 4FLVA 4NYFA 2VG5A 2PY5A 2E5QA 1L3TA 2FBXA 3VQPA 2LRQA 3QIIA 4ELTA 3EZ5A 2BUDA 3DLMA 2E6LA 4FLZA 1D8YA 3LX7A 1NKBA 4CJFA 4PQUA 1KLMA 2BIVA 4C5HA 2Z1IA 2BDPA 4B9UA 3LWMA 3F70A 3PMTA 3LP3A 1RILA 1WJSA 2EQJA 4I2QA 3O4NA 1NJZA 1K6YA 1X9WA 3ZSXA 1L5UA 3META 3UT1A 1JXBA 5J26A 2E4LA 1VRTA 5D6WA 3OJUA 4KPYA 4B8AB 2I5JA 4DU1A 3CG7A 4RW9A 1RT6A 3S3OA 4DTOA 3K5OA 4KB1A 4W5OA 3TI0A 3AVJA 1TKXA 2FBTA 3OYEA 1SSFA 4E19A 4FW1A 1WSFA 2D9TA 1KVAA 3DRRA 3MEWA 2O4XB 3L3UA 3DLHA 5FDLA 4IURA 1WSIA 1QSYA 5IAYA 3OYBA 2DAQA 3CFPA 3PNWC 1WJQA 3BDLA 4CERA 5HRSA 4DFJA 4XIUA 2B5JA 3LGLA 1JLFA 2M1HA 3KKRA 3SUNA 3LZJA 4CJVA 1UOCA 4FJIA 4E0DA 2O4GA 4LD6A 3T19A 4CJSA 2RF2A 2R5MA 2VWJA 4N4HA 3VQDA 3E9GA 3NTHA 4DTMA 3TAFA 4CRIA 2LSNA 2X6SA 5HP1A 4IUTA 4X34A 2OZSA 3OYLA 5D6XA 1NJXA 1KLNA 2KW4A 4DF4A 2F5KA 1G5VA 2BE2A 2WONA 1IG9A 2YNGA 4M3RA 4AILC 4Q0BA 4GW6A 2P51A 3ZSRA 3AVFA 1YVUA 2BKDN 4N41A 2GF7A 3ZT3A 1WSGA 3VA0A 4KV8A 1LW2A 4CEOA 3UIQA 3L2RA 3V4IA 4GY5A 4B9LA 3NBPA 1OZ2A 3C94A 3ISNC 5EU7A 3QJ6A 4H8KA 3IRXA 3ZT4A 1LWEA 3AA2A 1ZBLA 5CZ1A 2AJQA 4C8MA 2G8WA 3OVNA 3AO3A 1YTAA 1RBSA 2FC0A 4CK2A 3ZSOA 1S1UA 4KKOA 3B6PA 3CYMA 4RW7A 3D0PA 4KTWA 1EP4A 2YKNA 1TK8A 1Q9XA 3RTVA 4E1MA 3O3FA 1D9FA 3LLRA 3NGZA 4BWMA 3ZSQA 1ZBHA 4Z4FA 2D0BA 2EQUA 2G8VA 3HPHA 2G8UA 4C5EA 2X4XA 1RBVA 4DSKA 1NJYA 4AHRA 4PUOA 1TL1A 2QXFA 3KLFA 1S9EA 4CECA 2KFZA 4M45A 3OMGA 2GBZA 3LPUA 1S1TA 3ZEHA 4RG2A 2RPIA 1TV6A 2P1JA 1IKVA 1JXEA 3K5NA 3AVGA 4OKJA 4W5RA 1C1BA 4DTXA 3O3GA 1HJRA 5KE2A 4DQSA 3WNGA 1FK9A 4UC4A 4KHNA 3RMAA 1VSHA 5FRMA 4EZ6A 1GOBA 2G3RA 3ASKA 2X6NA 1FXXA 2VYTA 4BDZA 4OLAA 5FROA 3KK3A 2MWPA 4HUEA 2EQKA 4MQ3A 3C6TA 3SUOA 4PL6A 3QLHA 2MWOA 1Z26A 1RBRA 3NTKA 3D45A 1A5XA 1REVA 2VWKA 4DF8A 3KLIA 3L8BA 2XY6A 3OYAA 4B9XA 2EQMA 4CGIA 3P8HA 3AA4A 4N56A 4ID5A 3EYZA 1DTQA 1KFSA 4DSFA 1XNIA 4JS5A 2L3RA 4K8XA 5CYMA 3LP2A 1EXQA 4NCAA 4HCBA 1WSJA 3IG1A 4E1NA 3SNNA 3NNQA 4A4EA 1C1AA 1VSJA 4DQIA 4FM1A 4CJUA 1BL3A 3SZ2A 3DLBA 3VQ5A 2HHWA 1UA0A 2YRVA 1RT7A 4FLYA 3NH2A 4NCGA 1HMVA 3V1QA 3MEAA 1JLBA 4NCBA 1YT3A 1O1WA 3C4SA 2IG0A 1NK8A 2IDOA 3S3MA 1I39A 2FBVA 4HUGA 2Z1GA 4LSLA 4CEDA 3LALA 2OPRA 4C8LA 3HSTB 4IFYA 3AVNA 2RHYA 3QEWA 1IKXA 1RTJA 3VN5A 2YV0X 2IOCA 1WAJA 1FKPA 3QNOA 4FK4A 1S6QA 5KH6A 3RMDA 4J2BA 2HNDA 3TAEA 4AHCA 2HHTA 1RNHA 4FJ9A 4CHNA 3H8ZA 3SD4A 4CEEA 3CM5A 3AO2A 2WOMA 2PQWA 4DU3A 1LV5A 1DLOA 4B9MA 1HQEA 4FM2A 4LD0A 1NOYA 1RDAA 1HQUA 2RJCA 1VSDA 4FJ5A 3DM2A 1VRUA 4FLWA 2PYJA 3QIOA 3KK2A 3HP9A 1RT5A 4HCCA 1Z25A 1CZBA 4DMNA 1TKZA 4O44A 3HJFA 4FXDA 4OGEA 4FU6A 3PUFA 3AVMA 4OVLA 4FZXC 1VSIA 1N6QA 1LW0A 1H3ZA 1LAVA 4FJ7A 1TVRA 2HHVA 4FJNA 3AVKA 1UA1A 4BE1A 3DLEA 2E6NA 2R57A 2L89A 1Q9YA 4IBNA 4CJWA 3NFAA 3FFIA 3SPYA 1G15A 1BISA 4DQPA 1BIUA 3KK1A 2HMIA 1JKHA 3K59A 5DK5A 1S1XA 5T7BA 3NF8A 3LH0A 2XRIA 3VQQA 4FJ8A 1WSEA 2DFHA 1C1CA 2YNHA 3AVBA 4E7JA 4AH9A 4FZYA 2XDPA 3OYHA 4Z0UA 3DLKA 3FEOA 4JRPA 3MEVA 2YKMA 2HW3A 4FJLA 1RBTA 1J9AA 3KLGA 2QKBA 3L42A 4J2DA 4II1A 1U4BA 3ZT0A 3VQEA 1X1PA 1Y97A 3AO4A 4FJGA 1RT1A 5J2MA 3A2FA 3LWLA 4OKEA 4CJTA 2NLUA 3LYIA 3NAEA 1F21A 1JL1A 1S9GA 3L2UA 4RW4A 1JLEA 2OZMA 3TANA 3M8QA 1T8EA 4CFAA 2KZZA 3HPOA 4E7IA 1IH7A 4CF1A 1IKYA 2HHSA 4JS4A 3SV3A 2Q3SA 3I0RA 1JLCA 2RHUA 3C95A 4GMJB 4EZ9A 4FZZA 4DTJA 2R5AA 4CF9A 3HVRA 2P0KA 3AVIA 4IG3A 4CJLA 2F8TA 3TAMA 4Y1DA 2HHUA 4B9SA 4OPJA 5IN1A 4DLEA 1J5OA 1QTMA 4DFKA 3AA5X 4FW2A 2R7YA 3NF9A 4B8CA 3ZT1A 1IKWA 4IUQA 3NDKA 1KCFA 1QQCA 2ZQBA 1RDCA 4NZGA 2QKKA 2GV9A 4FM0A 4PWDA 4NYNA 2ETJA 3QINA 3VA3A 4DFPA 1BIZA 4CFBA 1VSEA 1J53A 4AHSA 1XWLA 3WNEA 3LPTA 2X78A 3E01A 3HT3A 3AV9A 5SZTA 1RTIA 4QOZB 5I42A 1BQMA 1XHZA 3VQ6A 2QQSA 3V9UA 4CHYA 2HVHA 4L59A 1ASVA 3V6DA 4E7KA 5J39A 2B6AA 3HL8A 2Y1JA 3L2WA 4BWJA 1RI0A 1SL0A 3CQ8A 3TAGA 4BDPA 3KKSA 1IO2A 2RJEA 3WNFA 2FHDA 1NKCA 3MEDA 3QIPA 4O0IA 1TAUA 1T7PA 4PLLA 4ID1A 3QEVA 4OJRA 2L8DA 4I7FA 5JS1A 2EX3A 2XO7A 2NUBA 1HYZA 1TGOA 4QW2A 1XC9A 1RT4A 3UWNA 2XK0A 3M8RA 4PY5A 3SYZA 4IDKA 1VSMA 1ITGA 3RMBA 2IC3A 2A1SA 3AO5A 4FJHA 2JGUA 4DSJA 4CK1A 3AVAA 2RO0A 3CFRA 5J1EA 5CIUA 3RRHA 1KFDA 4FL6A 2OPQA 2RI2A 4DFMA 2Z1JA 3OB9A 4F8RA 4CGDA 1NJWA 2HHXA 4QCLA 3VQ7A 5C42A 4DTSA 3CFOA 3SI6A 3DLGA 2EHGA 2YHAA 4M3TA 4M3XA 5KI6A 4OPKA 3PV8A 4F3OA 1RTHA 2EFIA 4HCZA 5CYQA 3V9WA 3MP1A 1NOZA 2RJDA 3MP6A 3PX4A 1TAQA 4J2EA 5C6SA 1NK4A 4CJ5A 2XHBA 4HHTA 3TR8A 5FRNA 2LTOA 1RT2A 4LY7A 2G8IA 2QK9A 1BI4A 2X35A 3RR8A 3VQ8A 2RHXA 2IS3A 2HNYA 3ZT2A 3ZSVA 1SKRA 3NH0A 5CY4A 3SQ4A 4KI6A 3RWUA 4F4KA 2X74A 3NF6A 4J2AA 3LZIA 3TABA 4C8OA 3HXMA 3MXJA 5J2NA 1KSPA 1KHCA 1BCMA 2QQRA 3T3FA 3RRGA 3NF7A 2G8KA 4I2PA 4BE2A 2JLEA 1NK5A 1HNVA 4QVZA 3IAYA 2M16A 3THVA 2D0AA 1HNIA 1TKDA 4F3TA 1TK5A 3QKJA 1VSLA 1KVCA 4FJMA 1D5AA 1WSHA 3ZSWA 4CK3A 4HTUA 3H6ZA 3MECA 3ITHA 2HQXA 1S5JA 4L8RB 2X4WA 3C6UA 5K14A 4B9NA 3LAMA 2B4JA 2OA8A 4C8NA 3CM6A 3TAPA 1BHLA 3NE6A 4K8ZA 3I0SA 4Y1CA 1SUQA 4LH5A 1JL2A 3JYTA 2G8HA 3U6FA 1RDBA 1WLJA 3KD5E 2F8SA 4F2SA 5KRTA 4Z4GA 3M8SA 3FC3A 1QSLA 3OYFA 2DIQA 4A4HA 4NS5A 1WN7A 4W5QA 2PYLA 1EKEA 1BI4B 4M42A 3AA3A 4UQGA 2ZD1A 4B08A 3MEGA 5CZ2A
chains in the Genus database with same CATH superfamily
4Y3OA 2LCCA 4BR2A 3RQIA 4FCYA 4EAHD 4RAZA 1R4MB 4F92B 3VGMA 3J7ZO 2V1NA 1T0FA 2ACJA 1YCYA 4BI3A 3H41A 4P55A 4C8QB 2D2WA 4A5MA 4X1EA 1IBKK 1S3JA 4H0OA 1NKUA 1OU8A 2XIGA 4M7XA 3PX6A 3K57A 2QQ9A 4IKFA 3RESA 5GAEJ 1U6GA 2D5RA 1NKEA 1WQ7A 3MKDA 1WKMA 3VYUB 1ZGWA 1CXQA 3BTJA 5J6XA 1NGHA 4LDUA 3QFUA 1SL1A 3O80A 1ORNA 3BR6A 1L3SA 4A5BA 1LDDA 4BHBA 1B72B 3VS5A 4AFUC 2YU3A 1LAWA 1T39A 5IP7J 1RT3A 1YJ9T 2EKOA 2IVNA 4MZPA 3WUHA 4JRQA 1SV5A 3PJRA 2K9SA 3SZGA 4MNUA 1JGGA 1TK0A 4YDUA 1NGEA 1VQ6Q 1U9NA 4G1QA 5M5WJ 1S72I 4ZNXA 3CCEI 3VQBA 1VQLQ 2HVQA 1KRPA 2P9UB 2K3YA 4Q5WA 5IWAK 4M3WA 1JUMA 4NC7A 2K86A 1VQOQ 3SXYA 2VGMA 5B1BH 2DN0A 4KHSA 1OCZH 2NNNA 2W10A 1UEBA 2YSRA 1Z3XA 1BR4A 4NLCA 2YLCA 3DRPA 1XSXA 4JI3K 3HP6A 2L7MP 4HVWA 3S41A 1QU3A 3I4NJ 3E5XA 4LOCA 1IG8A 4CSWA 2O61A 1B9MA 3O9QA 1ZBIA 3TWHA 4N5SA 1VQ9A 2MLGA 3ZMZA 2NUTA 3M9AA 2Q0UA 2KK4A 3W3DA 3PIPL 4CZHA 2CV2A 1A5VA 3VENA 1NK9A 1VQMN 5FW9A 1K9MR 1ZRFA 2E3HA 4C0DB 3JCMQ 2DAOA 4Z4HA 2A7YA 3OYDA 4JD2B 4H5VA 3QEPA 2JA6J 1BC7C 3MJXA 4CGFA 1KG3A 2RI5A 1XQHA 2KQ2A 3ZP5A 1NMNA 1S72T 4KH4A 1F36A 1JLAA 4ELVA 3TMOA 3CCET 3I33A 1OYWA 2DT5A 1TNSA 4QQGA 2CDTA 3TQNA 1HLVA 2HXIA 1J54A 4QVCA 2F5EA 2DYRH 1MUDA 1LEAA 2MYSA 1U47A 1BJAA 3WXLA 3T1HK 3VF2A 5GIOA 5FKKA 3TBIA 5KE3A 3GP8A 4A6DA 1RFQA 4AM7A 2J5PA 4FK0A 1KGSA 1S6PA 5DD8A 2XGXA 2HQEA 1ZBFA 2RNJA 3O2PE 2NZTA 2PJRB 2NS7A 2KVQG 5GP9A 2JQ7A 4C3HJ 4XLPF 1UWBA 3QOEA 4DV4K 4M7DF 5JVGF 4JI5K 3F23A 2YUQA 7AT1B 3OBWA 3G3ZA 3VRYA 2W0ZA 2ZCFB 3RMCA 2LNHB 2HBMA 2KFDA 5E3MA 5LJ3e 4I0AA 3CBOA 5HBMA 3VEWA 4HVJA 2HHQA 1E3OC 4AFSC 1V3FA 1CZ9A 1UELB 5CYVA 1IZ1A 1VQLA 4BEHA 1GOCA 3BGRA 4EMSA 3EG0A 2ADUA 3MAQA 5LRSA 2NNYA 1QHTA 3RDIA 4UHTA 3HK2A 1VQOA 3FJPA 2R7RA 1YYVA 1SL2A 2RV8A 4KH6A 3X28B 1YI2I 4ZTJA 1MJAA 3F3XA 2WAQA 2K7LA 3PE0A 2FF3B 2P8TA 5CVVA 2DJZA 3C2HA 4H4KC 2ELJA 2W48A 1EX4A 2DX1A 3K58A 2HQRA 2VKNA 2IBDA 3K0LA 1EIFA 1ZREA 3SFMA 3MMVA 1VQ8T 3LSRA 5AQJA 2QWPA 2O8EA 2KT1A 1QHAA 3H0HA 4M75E 4WX9A 3WTTC 3FXMA 3CDLA 3RIRA 2XDVA 3HO1A 3SFZA 4B44A 6PAXA 1K78A 1YP5A 3C7NB 1IC8A 4CHPA 3D2EA 3DQVC 1OR7A 3SJMA 2FBYA 1E3HA 3DWLA 3CDHA 4BI4A 3G71Q 3PNVA 2LDUA 2XI9A 1WPKA 3HTSB 1C6VX 3ML6A 3M57A 2VJJA 1AZGB 4BR5A 2HPIA 1AWXA 4FM4B 2JS0A 3CJNA 3CCRN 1OCOH 2QEXQ 4DS4A 5C0YA 3QZ5B 2X51A 1HX1A 4H0YB 2L01A 3L2QA 1PUFA 3LWFA 1GLJO 3LP0A 1NGNA 1IBLK 2NNWA 1YI2T 2IGIA 2EZLA 1JLGA 2A41A 1HYVA 1XN7A 3NMZC 1WNSA 3WTVC 4CHUA 5DM7L 2X1DA 5J40A 1WJCA 2IIMA 2OX7A 4MQ9F 2F2EA 3Q7CA 1KEAA 3CPWA 2WBNA 3BCAA 2FD5A 4BC2A 3BY7A 3IRQA 4JLHA 4RAGA 4FJKA 4D8DA 3DXKA 1P2FA 1E7OA 4H5WA 3CMMA 3R0JA 2LVMA 2KQWA 4CBWA 1EH8A 5GAN8 1MMSA 4OMZA 3V7RA 1IHVA 2DI3A 2RJFA 3KTQA 3LGFA 1WOQA 2OTLN 2XDDA 5D3GA 3IP4B 1ZH5A 4WYBA 4BACA 3F0ZA 5LJ5d 1K4US 3DYAA 3CD6I 1UDLA 3COAC 2IA2A 4EHUA 4C8KA 4OB3B 3OS1A 1YITA 1KJWA 2LLKA 3GXOA 4DG1A 1N8RU 1N78A 4KT5C 5KHDA 2HOTA 3KBGA 3J7YJ 4M7DC 3O3KA 4CEAA 3OIQA 3G10A 2W57A 4N0BA 3OHRA 3F6OA 2RN8A 3TO9A 3OS2A 3CPEA 3NH1A 3JCMJ 1R0AA 3H1VX 2JMWA 1RC9A 2OQGA 5GAHP 2E1OA 2OANA 4PA1A 2NRZA 4Q4ZF 1BIBA 3QEXA 1MWKA 3HPGA 3MCZA 4KI4A 4KHUA 2VKEA 2R5ZA 4J19A 1ZBJA 1I0CA 3GNGA 1J5YA 2P6SA 1M3CA 4K2EA 2X4YA 4BE0A 4DTRA 1YW9A 3RI4A 2JHNA 4MFBA 5DEQA 3G71A 3EO3A 2DMNA 3T1BA 1C0WA 3I5UA 2D1HA 2F1LA 1RBUA 5HDNA 5CPRB 1M3AA 3HRGA 1Y1WJ 1VSFA 4JKHA 3CD6T 4IQJA 1BU6O 1R0BG 2DVEA 3HRUA 1OCRH 3TDZC 5HKCA 5KCOA 2LT4A 2QEXA 2PUOB 3LNQA 5J3BA 1A5WA 4DEXA 1GLFO 1Q1VA 2OTJQ 5IT9Z 2A6AA 3G1OA 1N8RO 3G4ST 5IT9O 1WJFA 3V9SA 1D0ZA 2FSWA 4MO4A 3HOUJ 4DS5A 4J6WA 3CCYA 4DLGA 4CIGA 4CHOA 1OPLA 3C2BA 5C0MA 1H1VA 1V4TA 2RKHA 4RGUA 1IUFA 2MLKA 3S9HA 2XG8D 4CFDA 3A98A 1L3UA 1RESA 4E9EA 4JNEA 4A93J 2ETHA 4M77A 3ZX3A 5DY9A 2DXTA 4J01A 3WODF 3SQ1A 3I54A 1HUXA 1MHNA 2CT4A 4H5NA 5J1YA 4ZYDA 4IZZA 4A3CJ 3OH9A 4M7DD 1JU5C 5AZJA 3QPTA 3OYGA 5DS9A 1H8KA 2XC7A 4HF1A 3H5NA 4M3ZA 2KR3A 4IUPA 1OR7C 2EA4A 3EKSA 4M72A 3PFSA 3CC4T 2YNIA 1OLTA 4DTPA 1VNDA 5D6EA 4AYBA 3NTIA 3LDNA 5A2QZ 4BYYA 1MV0B 5GAMh 1XSVA 3KIOA 3JAME 1OYXA 4IFVA 2PN6A 1P7IA 2F5TX 3J7AF 4N47A 2E4HA 3HOYJ 4C1NK 5GANd 4JRIA 4BQLA 2FVUA 2JHJA 2HVRA 3MX2A 3JCMf 2LF7A 3HM9A 4WFAL 2OU2A 4HNVA 1X01A 2QWLA 4FX0A 2E41A 5F6FA 2CS7A 5E79C 1HCRA 1ASWA 3N4PA 1KFZA 3NQOA 4D6WA 2CH6A 1E3MA 3JTHA 2XKOA 4FLUA 4N4OB 4XR6A 3CC2Q 3AVLA 4CHZA 1M90U 3DF8A 1T6CA 4EMKA 3ZSYA 3VS4A 2QWOA 5ICEA 4KIGA 3RPUD 1UECA 5M1FA 2HVIA 2Y30A 4C3JJ 2BZ8A 3E9FA 4CC2A 4FLTA 4CGZA 3CCQN 1WJRA 1B9DA 1I27A 1FX7A 3VESA 4CJKA 3HKSA 4JPBW 2CWEA 4XH5A 5ILSA 1QO0D 1F9NA 5KN8A 1WZOA 2E5QA 1YG2A 1XGOA 1YIJN 1L3TA 2OTJA 1NTCA 3VQPA 4LFBK 1HKGA 4DR4K 5JHFA 5F08A 1QZEA 4JV5K 2BUDA 4OP0A 3MN5A 3DLMA 2E6LA 1FJLA 4PGHA 4EVIA 1OULA 4C23A 4ESBA 4CJFA 3RVCA 4DOWA 4FSSA 2CT3A 1KQJA 3L7WA 3SFIA 1Z7LA 1PJRA 1VQKI 3PGGA 2NS0A 3I9V2 3CIPA 4I2QA 3ZN1A 2IS6A 2KY9A 4D7NA 4C30A 1WGXA 2EJFA 5E3LA 2CH0A 1A6QA 2O7OA 2HOSA 3UT1A 1JXBA 4JYAK 1MUNA 1F1BB 2B7EA 1Q95G 5D6WA 4A2UA 3AAPA 2DJQA 1M90O 4NNJA 3FKIJ 2HCKA 4B8AB 4BXFA 5GAOm 1LOJA 1PNJA 3M5AA 5JHUA 4RW9A 4DTOA 2EYZA 4Z88A 5HS8A 3AVJA 1TKXA 2FBTA 1UG1A 4X65K 5AQRA 1YHQT 2XAQA 2DO7A 3G6EN 2GELA 4FW1A 2CYZB 3B02A 3CJRB 1WSFA 6AT1B 3LDPA 2D9TA 1KVAA 4WQ5A 3RR6A 4M7AG 2LQWA 1OFCX 1T3SA 1QP3A 2EYXA 3MEWA 5AQMA 3OL3A 3L3UA 1SAXA 1TWCJ 4AU7A 1YX3A 2O8FB 1QA6A 1GRIA 3OYBA 1WPYA 2DAQA 5IT3A 3LA2A 3ATUA 2KROA 1VQKT 3EGDA 5I21A 3K4JA 3NWSA 2Z3YA 4DFJA 2HYJA 1UGRB 1Q86U 1D8JA 2CUEA 2LF8A 3LGLA 1NLPC 1XB4A 4E0DA 3CCVN 3HKZN 2V7FA 3VEYA 5AZIB 3I55Q 2E1YA 1OX9A 3QICA 2D1VA 2CW7A 4DTMA 3TAFA 2RB6A 2LSNA 2PBDA 5AQOA 1SD4A 1YQMA 4X34A 2DRMA 1R71A 5D6XA 1NJIC 2KW4A 3QDRB 4DF4A 2F5KA 4ON0A 2BE2A 3E6DA 1IG9A 2YNGA 1K76A 3FKJA 4ISFA 1FW6A 2L9RA 3ZSRA 3CMEN 2LP0A 1LVKA 1YVUA 1NH3A 3I5SA 4PL7A 1RIOH 3ZOBA 4Y52J 3ZT3A 4BJTA 3I56I 3GFLA 4ZDOA 4Y13A 5DPKA 3TSQA 1W7AA 3UIQA 4A3LJ 4B9LA 1USSA 5D5UB 1KAXA 3ISNC 3IRXA 4IO9L 4BUGA 2AJQA 1XC3A 1RADB 2G8WA 1WA7A 4JKFA 3PIOA 4HSBA 2MH2A 3CCMN 1RBSA 1WFXA 3CTAA 3KPHA 1S1UA 4BUPA 1Q86O 3QSUA 3D0PA 4FE7A 3ZQGA 4PDKA 2YKNA 5AQGA 5LBQA 4OFHA 3D2FB 1WHKA 2COWA 1Q9XA 5CQEA 2V4JC 1DIZA 1PCXA 1K83J 3LLRA 3NGZA 2LKPA 4BWMA 2LD5A 3K2AA 2ECZA 2D0BA 4C92C 4RWTA 1ZR4A 2G8VA 3HPHA 3ZCOA 4QS8A 2P9LB 4D5CA 1J59A 1WI7A 1HSQA 3R8EA 5JMVA 2FQ4A 3UR3C 3P31A 2BTFA 1FLIA 3PIOF 1RBVA 4L5GA 4E47A 2BZTA 2EQIA 2VQCA 1K73R 5GAMg 2QTXA 3BG6A 2K9GA 3KLFA 1S9EA 4CECA 2Z2SB 1P7MA 1VQMQ 4KBMB 4BAYA 2HOAA 2WFBA 1S1TA 4RG2A 2RPIA 1XC5A 5FPMA 1JXEA 3QWLA 3GTKJ 4MGRA 4OKJA 1MGTA 1C1BA 3VB2A 4YOUA 2VQLA 4FSXA 5LJ3f 1FWZA 2AHQA 2GWKA 4AIDA 5KE2A 4DQSA 4HTLA 2LY9A 1USTA 1X2NA 2CP3A 2AIRB 2W7NA 3RMAA 1X75C 1VSHA 3CJBA 4XU2A 1GOBA 4ISGA 1A5JA 1J5EK 4MTDA 2CP5A 1QQJA 3MPUB 1HKQA 1VQ4N 2DZCA 2VYTA 2J6FA 3BZ6A 2VI6A 4HV5A 4FL9A 2Q8KA 4ZGDB 3I55A 2MWPA 2M3AA 3EH1A 2EQKA 4HUEA 4F14A 3C6TA 4DV6K 1WJEA 3JRHA 2L54A 2MWOA 1PHTA 2PVGB 4NDLA 4IXCA 3DAWA 3CLQA 2HKOA 3NTKA 5HL7L 1PVSA 3V8KA 1K8AR 3M8JA 3KLIA 1AOYA 3IAM2 2E3IA 1VA7A 5BPNA 4AT1B 1ZHFA 5LEJA 3TCJA 1DTQA 3FF5A 4XORA 1B4AA 1HLUA 1J09A 2E1NA 2IS4A 1R49A 1S7AA 2EBPA 3BR0A 3LP2A 1EXQA 4NCAA 4M75A 3SBGA 1KG5A 1K9MU 3HZ6A 2G9WA 1VSJA 4WCGA 2RQTA 1XD7A 3VTIA 2E64A 4FM1A 4C92D 2HDWA 1N3AA 3DLBA 3VQ5A 4BROA 1UA0A 2ICWG 5IYBJ 1A0NB 3RKXA 2YRVA 4FLYA 1HMVA 2DXUA 3ELKA 4NCBA 4LDVA 3IAS2 3LDLA 2DK3A 2F5CA 3C4SA 1SFXA 3I59A 2IDOA 3BUZB 1ETQA 4M75F 5HDKA 2CV0A 2CP7A 3BC8A 3ZQQA 4JBAA 1PG5B 4HUGA 3BR1A 2ZJQL 2ZO4A 4LSLA 4BHCA 4ENJA 3LALA 3ABUA 3F0CA 2HL5C 1JBMA 4OMQA 1JJ2A 3IL2A 1Y96B 2A5YB 3RMQA 1A31A 2RHYA 5GADJ 4CBUA 3QEWA 1IKXA 3VN5A 2R3SA 3ULQB 1R6RA 4BKXA 2OF7A 4FT8A 4ZYHA 3I0XA 4B6MA 1FKPA 1X2KA 1Z77A 1XDUA 2K3PA 3EFOA 1BI2A 3FXQA 2W41A 1VQ6T 4F55A 2CSQA 2UUZA 3X25B 5KAFC 4MFDA 4AHCA 1HKTA 2A5WA 4CHNA 3H8ZA 2LX9A 3FXUA 3AO2A 4G6QA 1FSEA 3M07A 2AQFA 4XMYA 1TUDA 1O7LA 4TVRA 4KT6A 5DUIA 4FM2A 4ANJA 2HPMA 2LKXA 1PSEA 5AQIA 1HQUA 2DNUA 2RJCA 1CF7A 1VSDA 2R7VA 1K8KB 2XHKA 2VQEK 3IMXA 5AQXA 4HCCA 4E1JA 5E1XA 2QBYA 1ZG1A 3T1YK 1UB4A 3FK7A 2JXBA 4BXXJ 3A0BC 4O44A 2QDYB 3HJFA 4EW4A 1FEXA 4C0ZA 1XG7A 4FU6A 5A0DA 4S0HB 4OVLA 4MFEA 3UKRB 4JX4A 2HGCA 1YN8A 1N6QA 5FKLA 1NGJA 2Q97A 1UHWA 3WTUC 5E8GA 3JCUC 4XONA 2LJ0A 4PHTX 1FPQA 2JMAA 4BE1A 1EZZB 5C3EJ 3R6MA 4N0AA 2R57A 3EH2A 4HLYA 3V8JA 3GZ6A 1FYNA 2D8HA 4OFAA 1W70A 4JJDA 2GXAA 2E10A 1BISA 2OTLQ 1K61A 2JUCA 1JKHA 3K59A 3JB9G 2EH3A 3GTOJ 3K4KA 1S1XA 3HGYA 2MC4A 2K02A 1DP7P 1VHXA 2ASMA 2EFOA 4A0YA 3CPFA 1Y64A 4DGWB 4FJ8A 1WI3A 1UAAA 3DP7A 2DFHA 2DKGA 2J7IA 2V7ZA 1YE9A 2BW3B 3I3LA 4E70A 1Z1DA 2RGVA 4AH9A 5CKDA 4DBRA 3OR2C 4M7AE 2XDPA 2LX7A 1IXRC 1R1VA 4A6EA 1JKOC 5TKWA 2DO3A 2EZHA 1P9QC 2KDZA 4PJLA 1VQ5I 2MCNA 3EG9A 4M78C 2K5IA 2FPFA 4JLGA 4DR3K 1U4BA 2VONA 3EUHC 4FETA 4DBQA 4EJZA 4CZKA 4RGXA 3A5NC 3AO4A 2EV6A 1D3BA 3J81K 1KSWA 3VPRA 2DTOA 3DEEA 2K9NA 3A2FA 3LWLA 1LVAA 5DCMB 1B7TA 2DD4A 4WXCA 3LFUA 2XF5A 3Q9VA 4A61A 4A59A 1HF0A 1HQCA 2NLUA 3HZJA 2V1DA 3V7SA 4GKJK 4HX7A 4M9SA 2YRDA 5K5QA 2FXUA 2QXLA 3AFHA 4J9IA 3MX5A 4AWXB 3SK3A 4E7IA 1KC8C 3F2KA 4G6DA 1KAZA 4MEYF 5GAOn 4NL2A 1I50J 3HJEA 1JLCA 2NOZA 4GMJB 4DTJA 1VQ5T 3TSPA 4HOBA 5JLHA 4DZPA 2F8TA 1PDNC 3FXRA 3G7ZA 1ZUKA 3H9JA 1M2OA 3EZWA 4OPJA 4B9SA 5A0GA 1VQ8N 4ZDLA 3AA5X 2R7OA 3G71T 4B8CA 3ZT1A 1QMCA 2YCHA 5FKNA 1WFWA 1JHFA 2L4MA 3PFYA 3VGLA 3I8BA 4PJOB 5EOYA 2GCXA 1QQCA 4A3DJ 2Q2EA 3SDBA 4LJZF 1NGFA 3ULEA 4M78D 2X6WA 2GBQA 1ZGJA 4A0XA 3BF3A 2IP2A 5JVGL 2MABA 4CFBA 2V1RA 2CRGA 3EQLF 5DM6F 4F04B 2Y4YA 1N5ZA 2FZCB 2FRYA 2JA8J 2VPLA 1IO6A 4DUZK 2XGEA 4EA5A 3E01A 1BA5A 3HTRA 3LSGA 3RKQA 1RTIA 5I42A 5E1WA 3VQ6A 3CCUQ 1X6GA 2VBWA 5C10A 4EW0A 2STTA 1UJYA 1Z7UA 3KEYA 1FYLA 4B23A 5GAEP 1WI9A 2V1QA 5GMKm 2B0LA 4C8QE 3AT1B 1V5EA 2B6AA 1TQPA 2I7PA 3CQ8A 3TAGA 2V6EA 4BDPA 2RJEA 3CCLI 3H36A 2NOFA 2FHDA 1NKCA 4A63B 3MEDA 5K7HA 3QIPA 1APLC 2QKLB 4B3SK 2FQ3A 4DZJA 3AL0C 1TAUA 5M3MJ 3QEVA 5AONA 3INZA 2H09A 4CYCA 3N4MA 3EETA 3HI0A 2XO7A 2D0QB 2NUBA 2DETA 1TWFJ 4QW2A 1XC9A 4V19S 3IHOA 1RT4A 3UWNA 4XLCA 4UVAA 2RQPA 3FE1A 1R1UA 4JAXA 2VPRA 2P7VB 4KH0B 5LJVA 2IC3A 4FJHA 5DV5A 1TYQA 3WGGA 3AGRA 4CK1A 1ONVA 3AVAA 3CFRA 3W2VA 2EIKH 1W1FA 1KFDA 4OB1B 4DFMA 2K9LA 1VQPN 1NJWA 2K4JA 3VQ7A 4DTSA 1VQNI 1ZBSA 3Q0WA 3CFOA 1S3XA 1KU3A 2YHAA 3CXCS 1LWYA 1CKAA 2L5QA 2VJ5A 5FLVA 3DKMA 1BW5A 4F3OA 3EGXA 2YJEA 3BDDA 4U88A 5GAGP 5LLQA 1QZZA 1UG0A 4M6YA 4OMMA 1MIJA 1W5SA 4F9OA 5C6SA 1NK4A 2OTJT 1O3TA 2QQ8A 1KG7A 2XHBA 5AIPA 4BY7J 3JB9H 4HHTA 3TEDA 3TR8A 1RAIB 5M5YJ 4PJJA 1XCBA 4M4ZA 2LTOA 3HSBA 1PKTA 5FD6A 2VKDA 4K25A 2P9SB 2QASA 2X35A 1VQ7I 1T95A 4J9FA 3CHWA 3TSUA 1N34K 2JVHA 2ROLA 4J9BA 3ID6A 2DMUA 3G4SN 4KI6A 3IDHA 4A2AA 3CCUA 2KZGA 2LG4A 4V2GA 1O3RA 3QU3A 1XQOA 2Y69H 2HDAA 2UU9K 3CC2I 3VEOA 2HU9A 2UXDK 3ABMH 3ECHA 1NGDA 1IRZA 2ABLA 2HI3A 2YHXA 2DA5A 3HUGB 1VQNT 3O5BA 1Q82R 3NMUA 5EEGA 5J2NA 5A2QE 1KHCA 3C6AA 2RD1A 3LH5A 2CMPA 2DMTA 3NF7A 2G8KA 4BRKA 2LY1A 4PZJA 3D0SA 1M1KR 4UY8I 5CAIA 2CUZA 4CZCA 5M3FJ 5BQTA 4OIPF 2M16A 2IRFG 1QCNA 4P9UA 4RAFA 3THVA 3VETA 3CXCM 3ZQIA 4PIIA 1GV5A 3CC4N 2IVOA 3QP6A 3VEXA 4AI4A 3IUCA 3EL2A 1WSHA 1G8XA 5KYNA 1VQ7T 4WTOB 4QWQA 3QU6A 3FMSA 4XU0A 1IDZA 3LAMA 2B4JA 2OA8A 4JI4K 4B48A 4C8NA 1YJWI 1G2BA 3ZYYX 1U2VA 4EJTA 1IJJA 1YFNA 1BHLA 3WHCA 2KPMA 4NXNK 2QA4N 1TBXA 4Y1CA 3CC2T 2P9IB 3O6BB 3O4WA 2NUPA 4F2SA 2CO5A 4Z4GA 4AC0A 1EH6A 2PVOB 4LK1F 2VT2A 3LSPA 4YOXA 2KMTA 3C12A 2FNPA 4CC4B 2ESNA 2KRFA 1WXUA 2EFNA 4C0FA 2GWJA 1E6HA 4LDWA 4UQGA 4U0YA 2FBKA 4EGZA 4LXCA 1B34A 4OIOF 1D5VA 3CMAQ 3VQAA 3IRRA 3CCSN 1IRFA 5J3LA 5KYYA 1ZBXA 2R7DA 1QQOA 1NEGA 1ZSZA 1HSJA 3KZBA 4WE1A 3TO6A 1GFCA 1PM3A 2M4KA 4LH4A 2LZ6B 1YJWT 2CG4A 2PLYA 2ZGZA 4Y33A 3MN2A 4KB0A 1SKWA 3RCOA 2OZUA 1TXQA 2HWVA 2VV5A 3JCMV 3OSGA 2R5YA 1WAFA 2KZMA 3BF1A 3W6KB 3UNGC 1U48A 4M3BA 3J80K 5L3CA 1MMDA 3T0YA 1RKTA 1M3QA 5ADXH 4O5BA 1AD5A 1V76A 4DSIA 1SKUB 1Q81R 1Y1VJ 5D5WB 4EMGA 4AVPA 3CXCP 3CCJQ 1G3YA 3NARA 3V9ZA 1GLAG 3NGPA 4L6V5 4OGCA 4CJQA 1HJOA 2YNFA 3CCLA 1W7PA 3FM5A 3F9KA 2EK5A 1SS6A 4IEIA 1JE8A 2W03A 3PIPA 1X4OA 3FZKA 2YLBA 2DT6A 2H1KA 3BROA 1K73U 1YHQN 1QVUA 4FJJA 2DPNA 1TKTA 3AY9A 2ABKA 2HZYA 2VASA 4MEXF 1Q8IA 1MWMA 3TOAA 2LC4A 5EGOB 3PY8A 4CEZA 3TARA 3J7YP 4GVMA 2DBBA 2FRWA 4EDUA 1T44A 5KGXA 1ZYQA 1E0EA 4ATOA 2XROA 3HPWA 1NLVA 1LOTB 4KULA 3D7SB 1FIPA 1QCOA 1GXQA 3JCMP 3E6BA 4DU4A 3QAHA 4EP4A 1VRLA 4LF5K 4PUSA 3UB5A 5HS7A 3QRFF 1OI1A 3ZETB 2P4RA 3MDQA 4MLHA 1NEBA 5EEAA 2DPUA 4J7FA 2KIMA 3THXB 4CYDA 3IKVA 3VYGA 2X1CA 3GFJA 1KTQA 3KZZA 4GLKA 3GBTA 3LA7A 2LNBA 2VL8A 4N4IA 2K5CA 2DL4A 2XD0A 2F4OB 4BRCA 2DIGA 1VQMI 1LE8A 4GRIA 3OA6A 3JCMd 1K8AU 2XY8A 1I6XA 4KMUX 1NBWA 2ZXJA 1ZLMA 5I2MA 1NJIR 1R59O 3L6QA 1S29A 3FHZA 4O5VA 4IEEA 4D1QA 3E19A 5LL6Z 3KYDB 2VXZA 1PP8F 1N9RA 1K73O 3PO4A 4FWLA 3O4QA 2ID6A 2ZJRL 5SWMA 4CJ3A 3ZEUB 3H08A 3EY1A 3KP5A 2WC9A 4Y91A 4HZFA 3KYCB 2MG4A 1NG6A 2Y0MA 5CJ9A 1FN7A 2XASA 5GAN7 2KDSA 2HEOA 5LJ5g 3W6JB 5CKFA 4A69C 5E8IA 1MDMA 3OQ5A 4RCBA 2V9KA 3MO8A 4P1WA 2OQRA 4KJZA 5DMRA 1YJNQ 1YW7A 2H3EB 2YI1A 3CCJA 4CJ4A 4R1HA 4DSLA 4DQ2A 3GG4A 2NRXA 4CEQA 1M1FA 2VG7A 4DOZA 1R1TA 4CESA 3EN9A 4B3RK 1ETWA 5ELZA 3LSKA 4FPAA 2CS3A 3ME9A 1VQMT 1K9MC 3BE3A 4JYKA 3M0QA 1XGMA 3LFKA 3M0SA 2IAJA 4IUVA 1EQYA 1EETA 3RKYA 1K8AO 3H35A 4OMYA 4DBHA 3CVSA 1BBZA 3VUBA 3QOPA 4HEA2 2R7QA 4KBOA 4M7AF 2XICA 1BK2A 2OPTA 3I4MJ 2DY4A 3MK6A 4CW7B 2DTUA 2E8AA 4N9HA 1IN7A 3P1GA 1TUCA 5CQGA 2NUTB 1N77A 4CCHA 3P9IA 2KXDA 4UXNA 3BP8A 4ILGB 3FMQA 3M1EA 2H1LA 4BC4A 3DI6A 2W84A 5KN9A 1NM7A 4E7HA 2DOEA 4ITVA 2MFZA 3CUQA 2KHMA 2RNGA 3M1CA 2CKKA 1F43A 1KYZA 1BOAA 4JKGA 4S05A 3DOLA 4AIJA 3JB9I 3TQ7P 2E1MB 3QYHB 4A3IJ 1R0CB 3ATVA 4DR1K 3MXIA 2V8KA 2AO9A 5AFUA 1WXTA 5EG2A 5J2PA 1MDUB 1LFPA 2P5GA 1VQ9N 2DQLA 1JEGA 3PFIA 5AQPA 1FTZA 2VBYA 4FYVB 2K2MA 4J6YA 3QUIA 2ZBKA 3UA7A 1RGIA 3M4YA 3TU5A 4KN7X 3PSFA 5H1SQ 2PI0A 4DNCA 1HPZA 2A5XA 4TSXA 5AIQA 4E7SA 3FMRA 2OPPA 2HOEA 5JVHL 5F2RA 3CCRI 4N76A 1TUUA 3KNTA 4NQWA 3FXOA 3G1MA 3FLGA 3LSTA 2HKNA 4V2SA 3K5MA 4ESFA 5GMKj 3PIOL 5EEHA 2RN2A 5KRSA 1MKMA 3MQ0A 3KLHA 2HEQA 1C0TA 3VQ4A 3GO5A 4X9DA 4DB3A 4CC3A 2E2JJ 1R5ID 4CFCA 5HRNA 1GBRA 3DB3A 3L00A 2AZSA 3DEUA 2BEOA 1QE1A 2XY7A 2STWA 1TS9A 3JXUA 3M1FA 2ZJPF 1QSSA 4PKHA 4F17A 1H9GA 5GAN2 2D0CA 2XVCA 2XSDC 1JRIA 4GBQA 4Y7NJ 3CF2A 4ICLA 1TWHJ 3ZN0A 1VK0A 4CHQA 1QS4A 3U23A 2A07F 4Z2YA 3VQCA 1DDNA 3PQJA 5KAIC 2OTLI 1IHWA 4CUGA 4B3TK 2M0OA 1P6RA 2DLLA 5GAMf 5BR8K 5J8FA 4HYEA 5BNGA 2WWYA 4B1YB 1UB9A 2VODA 2RK2A 1JHHA 1KK7A 1HU0A 1VQ6N 1MNMC 3QERA 1H89C 3RUXA 1OQYA 1NPRA 3E9PA 5FO5A 1FOXA 1IREB 2O8EB 1VQLN 2ZMEC 1ZKGA 4L3QA 2GQQA 3Q0UA 4H4OA 3TAQA 3QPHA 2K6DA 4FT4A 4F91B 5EC7A 1VQON 4XTWA 1K78B 4ELUA 3D2EB 4BG9A 1PU7A 4UB8C 4YFKF 2WAQN 3DBRB 2JTFA 2KFNA 3A1PA 4KO0A 1IJWC 3B6OA 1OYIA 5FKMA 4ZJZA 4M7AC 5FLXZ 1K1ZA 1YOVB 4WXHA 3L2CA 1MGQA 1D5YA 1RRJA 2OTLT 5LJ3d 3CC7Q 3VWBA 4FTHA 2P7CB 2YR2A 2P5KA 2FEZA 5BRFA 1I8FA 3OYMA 3VJPA 2CJJA 3EAEA 3LM9A 4H5RA 1RR7A 2XMFA 3KFVA 4GVEA 3MXMA 3R4KA 4CCOA 4Z6YA 4Q47A 2HBWA 3OS5A 3DXKB 2IVWA 5KYWA 2NOHA 2GFAA 3MKYB 3SUPA 1W2BS 2LREA 3S1MJ 4MO7A 4XH1A 4FYWB 1Z05A 2HMAA 4RW8A 2KL4A 2CQXA 3QJYA 4F2RA 3WGHA 1MA9B 4HBLA 1ABQA 4QAGA 1JUPA 2A6TA 1FBSA 3SWNC 4CJRA 2DFEA 3P5JA 4BRIA 1BA0A 3K10A 3SQ2A 3PO3J 3VKIA 3CVTA 4JD2A 3E0JB 1ACIA 1REPC 4W1UA 2W1OA 1UG2A 3NCIA 1Z6TA 5FPEA 2O4IA 2HXOA 5GAN6 3OS0A 2YRCA 4QT7A 4BC5A 4N9IA 2Z0WA 4U0VA 5AT1B 1YRNA 3L0QA 2GFUA 5JLFA 3NAUA 3RZDJ 2OCEA 2D0NA 2ZWHA 3ULDA 1ZARA 1A6IA 3TP0A 1GV2A 2VJ4A 3K5LA 1UAXA 1WB9A 1NK0A 2E35A 4J9HA 1RTDA 3S3NA 2DQRA 4XTVA 4M7AD 1D4XA 4I0BA 5ICFA 3FSPA 4MLEA 5HRRA 4C92G 3ABKH 3K70C 2O4XA 3BR5A 3O1WA 2R5ZB 3HG9A 3QO9A 1X1CA 1YQAA 3A4CA 4FX4A 1NE8A 3CP2A 4Z02A 1SKSA 2M8GX 5KGWA 2DK5A 1YAGA 4UB6C 4LB5A 2KP6A 3VS6A 2VXEA 5LEKA 4M41A 3SAHA 2VXDA 2WV1A 1W2BM 4KN4X 1IXSB 2ZXHA 5FU6B 4EP5A 2A3LA 2V6CA 2RHIA 4F7UA 5IYCJ 2EAYA 3HOSA 2JRMA 5AQQA 2GIZA 1SQKA 1HXDA 3BG3A 1BIAA 1GCQA 1FJGK 1T98A 3CCQI 2VG5A 2YT6A 1XUPO 2QDLA 2FSJA 1HKSA 4UUTA 2FBXA 3QIIA 4K42A 3OR1C 4C8QC 4KGVB 3HOVJ 3G71N 1NBEB 1R7JA 3CJCA 3G25A 1QVGS 4LD9K 3HTVA 3F5TA 4ZZLA 1YIJI 2GXBA 3FK6A 1D8YA 3R1XA 1NKBA 1KQSS 2AHJB 3K7AJ 1O75A 2BIVA 4M77B 4BRPA 3JB9F 3QZ9B 3PMTA 2QEXN 3CCRA 1WJSA 2EQJA 4DIQA 4M71A 1K6YA 3JRAA 5AZJB 3ZSXA 3I53A 1Y57A 2XF6A 1LKXA 1PD0A 1JQQA 2H94A 2E12A 5FKOA 4IHTA 2YS9A 3JRZA 2DF6A 1RT6A 1G6NA 3X26B 3DPLC 4XSZF 3ID8A 3ZQCA 3K70D 3S17J 4XEIA 3JREA 3CJ1A 2RAEA 1AA7A 4PSWA 3G6EI 1M1KU 1RRSA 8ATCB 4KUMA 4DKWA 1YIJT 5FDLA 1JT0A 2QKMB 4IURA 1LCUA 4H0EA 1T2KA 4AYBN 4H0TB 3OOUA 1GBQA 3THWA 3BDLA 4CERA 5HRSA 4EMKB 2DYIA 1XMXA 4RS8A 2ELKA 4GO1A 3SB2A 3O9UA 1JLFA 4XAXB 4LUDA 3SUNA 3E1SA 4IZ9A 1QVGM 1T3LA 1W5TA 3RKWA 4B3AA 4AG1C 3TKYA 4OU0A 2ESHA 5AQFA 1CSKA 1KQSM 4C8QD 5I22A 4DR2K 2M7AA 4CVNE 4XKWA 1TT0A 2R5MA 2VWJA 4N4HA 2I0NA 3LSJA 2QZ8A 5KNLA 5ILUA 5BRDA 1G99A 3CCVI 4CRIA 2X6SA 3BQYA 2E1HA 3P4IA 2OZSA 3SMPA 4IF4A 4B1VA 1G5VA 1Z3YA 3T7ZA 5DM6L 1JKRC 1AWWA 1I1JA 3AVFA 1VOMA 2BKDN 4N41A 5D5VB 3DEWA 3K69A 3VA0A 2D5VA 4WQ4A 5JICA 3URGA 3G6ET 3ZXSA 1NNEA 4CEOA 3I0TA 4JHDA 3CMEI 4VUBA 2I8DA 3NBPA 2JG6A 1O7FA 3ZMTA 2M51A 2YUNA 1Z6RA 5EU7A 1YLFA 1LWEA 3AA2A 1O13A 1ZBLA 1WYXA 4CZEA 2JA2A 3KP2A 4OO1J 5E84A 2OTJN 3THKA 3AO3A 1YTAA 2MD5A 3B6PA 4KTWA 3PVLA 2EJ9A 2HNHA 2GLOA 1TK8A 3BW1A 3RTVA 3BJ6A 3I4PA 2NRRA 2EQRA 2ROTA 3CCMI 1P4AA 2DT7B 1ZBHA 2JJ9A 2RM4A 1Y8RB 3REOA 1ATNA 2KRCA 2G8UA 4C5EA 5DYMA 1M1EB 2IS1A 4IVNA 3CCVT 1WVRA 4U87A 2X4XA 2K9MA 4LITA 2YX7A 1G3SA 4CCKA 2H8RA 1NJYA 2PNIA 2LCSA 4PUOA 2JSPA 5LGUA 2QXFA 1W6XA 2X4JA 1L3LA 2FSKA 2KFZA 2XHCA 3MN6A 4PKIA 2KRMA 3OMGA 2ZMEB 4BGBA 4AF1A 1KQ0A 4C1NI 2MD0A 4BQQA 1MMGA 3BJOA 5CO7A 3EGDB 1G3TA 2P1JA 2DLPA 3HBTA 4QTRA 5CKEA 3AVGA 4HF0A 3CMET 3N0UA 4W5RA 4I02A 4FO0A 4B4CA 4XNFA 4Y15A 2RREA 4L9NA 2LQNA 3WNGA 3J8AA 5C15A 2QWWA 3BEXA 1NPPA 4OB2B 3H3UA 4ZDPA 2RQWA 3BQZA 1I81A 4M78G 5FRMA 4EZ6A 2G3RA 3RTRA 2OAZA 1KU7A 1IN4A 5HY6A 2UZKA 4AIKA 1IZ6A 4OLAA 4F93B 4JI0K 3CCMT 4MQ3A 4B21A 3SUOA 3VMFB 3QLHA 3VYRB 5IY5H 2CUJA 1MV3A 1BKBA 1VQ4I 2DILA 1RBRA 1SG5A 2CQ7A 2OUMA 2VWKA 1WXBA 4XLEA 5IT9K 3HRSA 2NUZA 3L8BA 3OYAA 1PUEE 1U84A 2F9WA 5F04A 4CGIA 4N56A 3AA4A 1YIOA 2ISYA 3P7NA 1OJLA 1KFSA 3QDFA 2EGCA 2L3RA 1XMAA 2PQ8A 4DR7K 3CCQA 3AAFA 3RQ4A 5BR9A 5IHKA 4E1NA 2BYVE 3CMAT 4A4EA 4R56A 5GINA 3O9SA 2E2OA 1KQ2A 1BL3A 1FBQA 2HHWA 4A3KJ 3SWNB 3JB9D 5DDGA 2NS8A 3K4BA 3V1QA 3VU3C 1NJIU 2FZGB 2JVGA 2F48A 4OPHA 2G7HA 2K3BA 1VYVA 2KRNA 4JZ3A 2IG0A 1PRLC 4ILJA 4PJOE 1TWBA 1W1WE 3T8RA 2ZGWA 1I39A 4CEDA 3GE1A 1ETYA 2NRAC 1YF5L 4BY9C 3SHWA 1IF1A 1M2VA 1YO5C 5A2QK 1WDXA 2CSIA 3AVNA 3X24B 4L5EA 4JKDA 3BT9A 1QQMA 2IOCA 4KNYA 1M27C 3KXTA 2ASOA 4ELYC 3VF6A 4OOIA 4B22A 2E5NA 3BPVA 5HOOA 2I5UA 3A0IX 1ZRDA 4E9FA 3QP5A 5F0XA 4FK4A 1B8IA 1SSHA 2HBLA 1WHHA 3TAEA 4PFZA 2YG8A 2KDOA 2DA1A 5KPTA 3A8HB 4FJ9A 4EJYA 4CEEA 3CM5A 3THYA 2K40A 5KYXA 2PQWA 4B3XA 1NG2A 3DV8A 2IVPA 4B9MA 2FB7A 2CP2A 3TTFA 2VBXA 3REBB 3J7AO 1NOYA 3MWTA 1RDAA 1V54H 1U1TA 1YX5A 3VRZA 2D6FA 4CICA 2AS5F 1AHDP 1UJ0A 3KK2A 1D1AA 4Z94A 4XK4A 2Z16A 1NJIO 2VB6A 1CZBA 4BQNA 1QWFA 1A36A 1QVFS 1RKWA 2PMZA 2X1EA 1WIEA 2VQFK 4OGEA 2F4IA 3TDUC 3REAB 2NRTA 1Y07A 2CREA 3FZFA 4LG0A 1VSIA 2M0MA 4XTZA 4RTYA 3BPXA 3ESWB 2FF6A 1LAVA 4G6TB 3VS3A 5JVTA 1RUWA 2F4MB 4M75B 2HHVA 2O03A 5FPDA 1S5LC 4C2UA 1WCMJ 1WQ2A 3KP7A 2DODA 2BZXA 2E6NA 3GNFB 1ORKA 3I55N 3N97A 1ZA1B 1MJBA 5E3NA 3C65A 3NFAA 2DPPB 1HNXK 2E88A 2IS2A 3SPYA 2BY3A 1J3TA 4HDUA 1NGCA 2EBIA 1RAHB 3H5RA 3KP6A 3I59B 3JW4A 1RDWX 2J05A 2NWMA 1WSEA 4BRQA 2LCLA 2FX0A 3I58A 1UHCA 1FOYA 4II3A 3J81E 2E70A 1XNQK 1O9SA 3I35A 1AHJB 3GCMA 5C2DA 1GLEG 1J75A 4OPAA 2EWNA 3DLKA 2RPNA 3E7LA 4M3GA 3DCFA 2HW3A 4FJLA 3R0AA 4LFUA 4HT8A 4OIQF 3TREA 3KLGA 1YJNT 4PKGA 2LNVA 3L42A 4I99C 4J2DA 2EPDA 1H0MA 3Q3SA 2KE9A 4YIFA 4KA4A 2E1CA 1EF4A 1Y97A 3O8GA 1QVFM 1LNXA 1NYGA 1BW6A 1RT1A 1ZGAA 3HOTA 1B59A 4KGXB 4RA2A 2W85A 4PJMA 4U7DA 3QWYA 3LSHA 4OKEA 3DKWA 1GVDA 1ZXOA 1WEGA 2Y31A 4XBFA 5GAN4 3F10A 3LYIA 2QBYB 3WU1B 4EJUA 5DCFA 4CH7A 2LK2A 4Y4RA 5LJ5j 2EYYA 1Z21A 4DV3K 2OZMA 1T8EA 1TH7A 1IH7A 3QFPA 4CF1A 2IIRA 4YRVA 3BFMA 2D0OA 2HHSA 3F6VA 1YJ9Q 4JS4A 4Q48A 2Q3SA 1R22A 2R7WA 2EGEA 2ITMA 2RHUA 1MBKA 3FZLA 2W04A 4FZZA 2R5AA 4CF9A 1PU8A 3ASOH 2FUG2 4M7DA 1HW2A 2XB5A 4GCVA 4CJLA 5M1KA 2VE8A 2CW0F 4EQQA 1LCKA 4LFCK 1VQ4A 1BI3A 2JTEA 4BH9A 5GAHJ 4MZMA 5IN1A 4AG2C 4DLEA 4DR6K 1J5OA 2A3ZA 4DFKA 4A3GJ 3J81O 5IOZA 2LTPA 3G1JA 2F2VA 4CCNA 3DLAA 4K11A 1RUOA 1VQ8I 3DU6A 3FWEA 2Y75A 2QVOA 1VUBA 1RDCA 2DMPA 4A5NA 2FOWA 1IG7A 2E71A 5HDGA 4FM0A 2ETJA 1SZ2A 2KMUA 2RDPA 4HG2A 1B07A 2LBFA 2V1UA 1TUGB 5EF6A 3ENHA 3FZHA 4HW0A 1VF9A 4AHSA 1ZELA 3EG9B 3LPTA 2BY2A 3E9OA 4FSVA 4KUDK 3JSCA 1YITQ 1FSHA 1QVFP 5DTDA 4X64K 5M1NA 3I0WA 4RMOA 1D3BB 2X6YA 3VEPA 4CHYA 2K85A 3RPUA 2HVHA 1S72Q 4FWKA 3CCEQ 4RTXA 3OH6A 4B3MK 4P5NA 1QRYA 4JX5A 3IHUA 3HL8A 4M78E 1XMKA 5HK3A 1YVNA 3QDKA 1EA3A 2Y1JA 3L2WA 4BWJA 1RI0A 3VSLA 1SL0A 1POGA 1XPXA 3C0CA 1IO2A 4C3IJ 3PQKA 1ZQ3P 4CCLA 1JCEA 1T38A 2QTDA 1XTAA 1MBEA 1M5Q1 1T7PA 3QYBA 4ID1A 3JV3A 2FOKA 2AP1A 4OJRA 5GAOp 3M56A 2ESWA 1HYZA 2CZ1B 4YHHK 4L0ZB 3M8RA 4NC8A 4PY5A 3DPUA 3SYZA 4UUSA 1QNTA 1YJ9A 3RMBA 2QM3A 4HF2A 1IDYA 2JGUA 2X6XA 2FE3A 4YIIA 1XMQK 2DEUA 1WWXA 1DPUA 1TSFA 2XAUA 1Y96A 4F3QA 3UKUA 1NGBA 2P5LC 2XF7A 2LJ3A 1E17A 3ZX2A 4FL6A 3QMLA 2OPQA 2NOEA 1ENHA 1BYMA 2V52B 4CGDA 2E5ZA 3FGUA 2HHXA 5GANj 4ENMA 4G7OF 5H20A 2QUFA 3C1DA 1H3HA 4EEFG 2Q2EB 2NOGA 1DPRA 4L9TA 1VQPI 1KZHA 4IHXA 2EA2A 3B6CA 3H3OB 3ULEB 3MP1A 1KC8U 4IFEA 5E26A 1BOBA 2RJDA 3CC7T 1KAYA 2CGPA 5AJ3K 3PL8A 1U6ZA 3FZMA 2WTUA 3PX4A 1TAQA 1ZSGA 2A36A 4XQFA 2Z9OA 1PWTA 3VERA 1UFMA 3UF4A 5KQ8A 4R0KA 1D1CA 1LWWA 1YUWA 2ZSHB 4JK7A 2UUAK 5J1RA 2BE5F 4RBOA 4RTWA 2G8IA 2QK9A 4XKBA 3PNYA 1K8KA 3FHGA 4XTUA 5KVRA 2RHXA 4AIHA 4JQFA 2ZJPL 1NZ9A 2HNYA 3H0FA 3ZSVA 1TNTA 3SQ4A 3ABLH 1M3BA 5H6QA 5JLXA 2F2XA 2GQIA 2RMOA 4XRSA 3JCMb 1NLOC 1S72A 3V4GA 3CCEA 2K4BA 1EWRA 3G4SI 1BG3A 3LZIA 1G3WA 5H2FC 3HXMA 1AU7A 4DV0K 1KSPA 1MBJA 3SQNA 3BWGA 3M0UA 4CCJA 2NVTJ 3T3FA 2NOIA 3T9NA 3RRGA 1CZAN 4B8XA 1YS6A 3IV5A 1VQPT 2YJFA 1YI2Q 2GA1A 4CYCB 1NK5A 2EV5A 4CZJA 4WK8F 2F2WA 2VE9A 4LMYA 1RUNA 4QVZA 4QPQA 5CHZA 5GJVB 1KC8O 2D0AA 1TKDA 4ISEA 1NU0A 2WAEA 2L3QA 2V75A 3EYYA 1TYQB 2JW4A 3IKTA 1KVCA 2BW3A 3SZPA 1PYVA 1D0XA 2RQVA 1WBDA 2XPWA 2XHIA 4CK3A 2O8CA 4A3EJ 1TZLA 3H6ZA 1SPKA 3ITHA 2B63J 3I9QA 4M77G 3CC4I 2FMLA 3HSFA 2QGUA 5CCAA 4B9NA 3QXEB 4JKCA 2OFIA 4J9GA 3TAPA 2QI2A 1V5GA 4XOTA 2JMCA 5CQXA 2V7YA 3BJAA 3I0SA 1F4KA 1BOTO 4KH5A 1MW7A 3H3ZA 3EGXB 1JCFA 3U6FA 3ONQA 3S2HJ 3KD5E 1G4DA 2V79A 4IOAF 1WUAA 3JCMg 2QA4I 1MNDA 3RYPA 3K4CA 3GLXA 2DIQA 1QSLA 1XG1A 1ULYA 2DDAA 1MUZA 2IGKA 5AR0A 3CJAA 4AM3A 3HSCA 5GAMd 4M7YA 4XTYA 1Q82C 4D7MA 5EXWA 1H8AC 2L9VA 1ABOA 4ENNA 1FMWA 4M42A 3GLLA 3AA3A 5D4SA 2I5WA 1M1KC 2A68F 3CWTA 2H6CA 2CH5A 1VQ8A 3MEGA 3J80E 5CZ2A 4RG8A 1PVEA 4CZLA 2L3DA 5EG0A 1T8IA 3D5RC 3AO1A 1IXDA 2KLOA 4JUVA 1U45A 5IP9J 4JI6K 1ZRCA 3N05A 2RHZA 4P9FA 3LAKA 5TGTA 4H0PA 2FZKB 4TV7A 3EE9A 2E36A 2HD0A 3A8GB 2H56A 4LD5A 3HRTA 4L18B 5FU7B 4FVMA 2EPFA 3CCSI 2A3SA 2O6GE 4W5NA 4AQYK 3VODA 1GOAA 4M73A 1WHGA 2NRHA 3GEZA 4QSHA 2QQAA 3OYJA 3H0GJ 3FR0A 3EFSA 1H92A 2QA4T 2D8JA 4B9QA 2DD5A 4OMLA 4E6RA 3DKXA 4Q5SF 2O9LA 1YI2A 3CCUN 1C0MA 2BTTA 4C5GA 3UPUA 2NYXA 2CFOA 2XRLA 1FZPB 3T69A 5B8HA 4HT9A 4D8KA 3MCAB 3V7CA 1RDDA 1OZ3A 2P9NA 4A3FJ 1QZ5A 1P90A 4HX4A 1FTTA 4CGJA 4CF2A 1RETA 2IPQX 2K9QA 4XLHA 4NC6A 4G7ZF 1HA8A 3K9KA 2DJNA 4R79A 1IN6A 4C92A 1MBHA 1K6OA 1AVZC 4DQQA 3KLNA 2M1BA 3EHRA 2E6MA 1WGSA 1PKSA 5GMKh 3DRSA 2R0QC 1B1BA 2DOFA 3FBNB 2PVDB 4E2FB 4J6XA 2W82A 5CVJA 1BGXT 4KHQA 1IRGA 4IG0A 1QQNA 4CD1A 2PZSA 2UV1A 1YTYA 3S2WA 1YHQI 5F64A 2OD5A 1BI1A 4O55A 3CCST 4CGGA 1WQWA 2HKQB 3BY6A 1RI7A 3CF5L 1I1GA 3NGIA 3EG1A 2A1RA 2DL3A 4KUIA 3VS0A 5M1OA 3HSRA 4MLOA 5HLIA 1O57A 4R5PA 4C92F 4CJPA 1KD1C 5AQSA 4CIFA 3M5RA 4CF0A 1AWCA 1KG1A 1YWOA 4B1WB 1AKHA 1OPCA 2RA2A 1B34B 4A4FA 1Y0NA 2Z1DA 1Q81C 3U3GA 3DBLB 2M34A 4AHTA 2K79A 3VQ9A 3JAMZ 1V5FA 4JLIA 3MWPA 1MZBA 4FE4A 2EVRA 3W2WA 3JAMO 4C2MJ 4MDWA 5KCHA 3DWLE 2B86A 3KD1E 3AG1H 3QG1A 2ZJRF 3JRCA 4BRLA 2Y48A 2DA4A 3DOKA 3QESA 2C0IA 5KK1A 3GPLA 2FBHA 2F5FA 2VG6A 5BREA 3SQ0A 4RGSA 1MH4A 1FYKA 3NHGA 3EUAA 2R5YB 1M8MA 4NLBA 3LANA 2NVQJ 4DV5K 3DB4A 3FDRA 3KEQA 5AQVA 4XU3A 3CD6A 1W97L 1ZG5A 3OL4A 3S14J 3L1AA 1LJOA 3H5AA 2W25A 5CHIA 4GKKK 3OYCA 1RRQA 2R4GA 3WTSC 3TSZA 3G4SA 3SEQA 5FFXA 1AEYA 1YQKA 2CUBA 4J9CA 2JWLA 1W7PB 2VLAA 4A3JJ 5ECAA 2FO0A 5HCKA 1YQLA 4K0KK 2UUCK 4KHYA 2CZ7B 3KHYA 2HBPA 2KGTA 3R6SA 3CEYA 2NAZA 1X2QA 1Q1HA 3U3YA 3OOPA 3KUFA 2AA4A 1S1WA 3OW2S 2W42A 4I6MB 3EE8A 4KH1B 3JSMA 3JRFA 3OYNA 1SVOA 2N8GA 5D7UA 3VGKA 3L09A 3U21A 1HNZK 2DFFA 1RAFB 2AKKA 4EV0A 2R7ZJ 2YWWA 4JEPA 5E1ZB 3R3LA 3WQTA 3DTEA 1SD5A 3JRGA 2V1XA 5D8KB 2LMJA 2WSCE 1N32K 2P5VA 4I09A 2GA2A 2B8AA 2VQHA 3ZLJA 2M7BA 3QBYA 4IXAA 1WH5A 4ZH4F 2BOLA 1KU2A 2VN2A 3CC4A 5HNHA 5CVIA 4B3OA 1NHAA 3M4GA 2YPRA 1NK3P 2O88A 3K2PA 5KTQA 2XV4S 3HUGA 2L7ZA 4AM6A 1YS7A 4AFZC 3E9LA 3P38A 3I8DA 5LJ3g 2KI7A 4FISA 3TPQA 3KLOA 2XPVA 4NBQA 4RW6A 3V81A 3WTYC 5LMNK 1LE8B 1MD0A 2VKHA 1ETOA 4PJOC 1TWGJ 4FYYB 5LL6S 2BANA 1M90R 1ZLKA 2OYQA 1U5TC 1VQKQ 4CZIA 4LGWA 3UA6A 2BXZA 3GFMA 4ZZDA 2JS2A 2RVCA 2MA3A 3O9TA 3KP4A 4I9LA 1VQ9I 3Q1JA 2J5OA 4HAMA 3KYLA 2HZTA 2LQKA 2G8FA 4Z4EA 2QYZA 1HSTA 3DLRA 5HLFA 1CKBA 3OW2M 2K7AA 2CP6A 1TG0A 1LEBA 1N75A 3CMAN 4C0GA 4A12A 3F73A 4PSXA 2P9IA 3AVHA 2KYMA 3WXMB 3GVAA 1T03A 3SUQA 2Q0RA 3U9DA 2COMA 4BNCA 2P4TA 3O3HA 1LWFA 1A04A 1QKWA 1T05A 1S1VA 4PLIA 4ABZA 1QWEA 4GXOA 2CH4W 4ILHA 4IHWA 2HR3A 3TTDA 2IGNA 2JT4A 1D8KA 4M77E 1MSEC 3RSEA 4C8QG 4H4MA 3CBMA 3FFKB 1ZN2A 2MBFA 4RM2A 5AQUA 2EWSA 1HW1A 1DGRM 5LY3A 3MKLA 1HRHA 3M8PA 4DYQA 3WQUA 1ZLJA 3LWHA 4FT2A 2M5WA 3PMIA 3CCJN 3V1RA 3OYIA 4OMOA 1VQ9T 1Z9ZA 3BZKA 4M78A 3U8XA 2YUOA 2PG4A 1OH6A 2CZ0B 4EM1A 4ZHRA 3GX4X 3EUHA 3NVMA 5IHNA 2ITGA 2LMDA 3CBPA 3VS2A 1X58A 1PSFA 2E2QA 4PJOD 3CUQB 1WH7A 2X3XD 1I07A 2BBYA 1JKPC 5IOYA 2KJBA 1VQ6I 4DV7K 2M0YA 4A0ZA 1VQLI 3OV8A 4RTFD 2W40A 4FJXA 4DWIA 3EUKL 4M78F 4HQEA 3BDUA 1BQNA 1AWOA 1VQOI 3I56Q 3S15J 3ZFJA 3SMSA 1IXCA 2FYKA 1A35A 4MDAA 2DE0X 4EM0B 2L02A 1N27A 1NG9A 4B9WA 5LHGA 2E7WA 1VQKA 1BU1A 2JZ2A 2PTKA 3PO5A 2OA4A 3DTKA 3OW2P 4OLBA 4CGHA 4NQWB 4ZGJB 1I4K1 3OY9A 2LY2A 1BUPA 3OYKA 4B1XB 3ULRB 3DLLA 2OV7A 5I3UA 1SEUA 4O4GA 2P9KB 3FHNA 4IO8A 1SFEA 1UHMA 4W5TA 1JLQA 1W0UA 2EFQA 3NEUA 2QTVA 4LLLA 4G12A 5CVUA 4JRKA 3ERMA 4AHVA 1Y7XA 4FWSA 2JK3A 4OKKA 2QYOA 1VQLT 3IQLA 2H8HA 3WTWC 2LQ8A 2JWTA 2FPDA 1TL3A 2PMUA 4XSXF 1MMNA 3HYFA 4G9YA 1O3SA 1TP4A 5L3EA 3DLLF 1K9MO 4AI5A 1VQOT 4WFNL 2FJ1A 1OCCH 2FL7A 1CGPA 4BHPA 1QCFA 2HYFA 4Y92A 1OMIA 1LB2A 5DUKA 4OVAA 3ASMA 4EA4A 4OF1A 2A6HF 4FASD 1YJNN 1R00A 1G59A 2CSOA 2DA9A 3QEIA 2IPOB 3GOXA 1YNZA 3P8DA 4QIWN 4LF8K 4BRDA 1GFDA 2V9VA 2VT3A 1M8VA 4F7ZA 2ZAEA 3ZEUA 3IFRA 2RQQA 1GDTA 4AIAA 4BD3A 1HYSA 3DXMB 4ZTFA 2CV1A 3JTGA 1U3OA 3A2KA 2BY1A 3T1AA 1I3QJ 1Y0UA 3WU0A 1DTTA 2P5OA 4I01A 5E20A 4QQ6A 3SDGA 4XN0A 4BRFA 2FU4A 4UNOA 2O2OA 3NPFA 1YITI 3P8BB 3RERA 1YTUA 3HBLA 1CLQA 3OJSA 2UXXA 5FLMJ 4AMCA 3I56A 2EB7A 1BBYA 3BG5A 2KYBA 1ILYA 5JFRA 4QQDA 3CQYA 1SAZA 3LAJA 1LPQA 2RQRA 4FYDA 2JM9A 1XHXA 2DTZA 2Y1IA 2C6YA 1RNLA 3KEOA 2H3GX 2A42A 4QS9A 2MC3A 3DMJA 2UXCK 2O8DA 2ATQA 1MUYA 4IEJA 3K4NA 4JI8K 4BVPA 1GLNA 4NYFA 4BC3A 2COYA 4DR5K 3UE5A 4S04A 4LB6B 3S16J 5IHIA 2LYCA 4L9JA 5AQYA 2LRQA 4ELTA 5KYWB 3EZ5A 5HLGA 2KRSA 3ECOA 3ZPLA 3VTHA 2A69F 3EG2A 4JJNK 4OX9K 3HL2A 5GAGJ 3D1NI 4PQUA 1KLMA 4PGGA 4C5HA 2FMYA 2HFHA 5FJ8J 2BDPA 3LWMA 3G71I 4CC7A 1QP2A 3CJTB 3VOVA 3LP3A 2GTOA 3O4NA 1NJZA 1TT5B 2ZSIB 3META 1YITT 3LSMA 4AVZA 4Y28E 1ESVA 4BQZA 1J7KA 3VOEA 2QEXI 1X69A 5J26A 2HNIA 3BTIA 5HODA 1VRTA 4GYGA 3FISA 1IN8A 2WV0A 1R58A 2R93J 4KPYA 2H27A 4RB1A 3D5LA 3ENBA 2QWQA 4E7ZA 2I5JA 5LD2C 1X4PA 1YRNB 1YXQA 4RCCA 1VYTA 3E6CC 4JI1K 3K5OA 2BXYA 3O9RA 2DXIA 3OYEA 2ID3A 2Y0SN 2DVJA 3A5MC 4E19A 5BPMA 3TO7A 1XTDA 1FYMA 3SJHA 4HSRA 4U7BA 3HGGA 2DA2A 1DT9A 1S9HA 5IXFA 3DRRA 1GXIE 5K1YA 2O4XB 2ZPBB 4U67L 2IXSA 1HDPA 3BTCA 2OC6A 3AHUA 3MN9A 3JCMW 3NFCA 1QSYA 1E4GT 3RYRA 3CFPA 1T33A 2Q1NA 1WJQA 2KHOA 1QZ6A 4HLXA 2CP0A 2DBKA 4XIUA 1KXPA 1WJAA 2M1HA 3KKRA 2KXCA 4GLMA 3L4IA 2E2PA 2BVMA 2P9PA 2HQ5A 2QEXT 4CJVA 4FJIA 3J7ZI 1VQ6A 4UY8O 4PCQA 1U5TB 4F7UB 2O4GA 5LGNA 3T19A 4CJSA 2RF2A 3CXCA 2HTJA 3VQDA 2EW3A 1T0FC 4IOCF 4IUTA 4ZN3A 3OYLA 4JK9A 1NJXA 2JT1A 4XKVA 4BRHA 3H46O 1MH3A 5FGMA 4PFOA 2WONA 4ASNA 1ERDA 1NK2P 2P51A 3MN7A 1AZEA 4E9HA 4MZTA 1GLLO 5HLHA 3Q5FA 3CDIA 2FXAA 2GF7A 3A0HC 4BGAA 2X3WD 2KIUA 2O3FA 3L2RA 4GV6A 1GXPA 3H3NO 3V4IA 4GY5A 3JRDA 5BOXA 1VQ5Q 4MIMA 5GAMe 3H45C 3CC7N 3C94A 3QJ6A 4H8KA 3ZT4A 2DMOA 3ZQFA 4BY6C 3S1NJ 4C8MA 4H0XB 1WJDA 4YOTA 1FT9A 1OISA 2XKPA 4P96A 1IN5A 1XX5A 4CK2A 4GDFA 4RW7A 1EP4A 2DA7A 4GFBA 3KP3A 2A6EF 2OTJI 2WB1A 2YX6A 4YDUC 4E1MA 4EMHA 1D9FA 3ZSQA 4XLAA 4HX8A 5EDNA 4FWRA 3E2UA 3UATA 2OAUA 5IXBA 2DL8A 3K4LA 3E5UA 5EY4A 4RM3A 4PL8A 2WBMA 4DSKA 4XRFA 8AT1B 3AG2H 4AHRA 1UMQA 5L3BA 4A4KA 3CO7C 4BRGA 1HNWK 5GMKe 4M45A 1EBMA 1OU9A 5M1QA 2HHHK 3M58A 4FPBA 3THWB 3P9CA 2FBIA 1TV6A 4A5AA 2DTIA 3K5NA 4YPRA 3ZMVA 3KWGA 4AD9A 3O3GA 5IT9E 1HJRA 3OSVA 3VW4A 1VTNC 2GM4A 4KICA 2MOXA 1FK9A 2OJED 2M87A 3AGKA 4XOPA 3A03A 3ASKA 4JZ4A 2ZFWA 1JXOA 4LE9A 4RCHA 4UOBA 2MH9A 3H9NA 2DXBA 2DERA 5FLXK 2JPSA 5CR2A 5GTIC 5FROA 4J9DA 3KK3A 1Z67A 2E1MC 2QSGX 1NGIA 3DU5A 4PL6A 4NB4A 2F5VA 1Z26A 3A5ZB 1XS9A 4K41A 2ZC2A 2E1ZA 3D45A 1A5XA 1OV3A 2IA1A 2YG9A 2EYQA 1WHLA 2KIQA 3K1PA 4DQ8A 2YUSA 4BBSJ 4LF4K 2XY6A 3K4MA 3H3VK 4B9XA 1LMZA 2KQRA 2EQMA 1QHGA 3P8HA 4ID5A 2ZB9A 4JHDB 2KBTA 2V26A 4IRHA 1XNIA 5CYMA 4BI8B 4IHVA 5CR4A 3U4LA 5LJ5h 4XIDA 5DM7R 1VQ5A 2DA6A 2G0EA 1NWKA 3JR9A 4A3MJ 4CJUA 4BBRJ 3SZ2A 4MHGA 4R55A 3WVEB 3S6IA 2DBMA 1RT7A 4X62K 1H88C 5AN4A 1JLBA 4UNFA 1NGGA 4QLCU 2DTRA 3H1CA 1O1WA 1YT3A 2DYSH 1NMDA 1NG7A 1NK8A 3H9QA 4D5FA 3S3MA 1LPLA 1VIEA 2QQBA 3ISPA 3CCLQ 4DUYK 3D5SC 1X3MA 2HL3A 4XH4A 1O3QA 1R9TJ 2Z1GA 3FHFA 1SEMA 4JOMA 1Y0MA 3CPWS 3O1BA 2GAUA 4XQ3A 1V4RA 4J5YA 1NM1A 3CJ9A 2QF7A 5LJWA 2Y90A 1XSDA 1LJ9A 3E5QA 3CP8A 2FF4A 1SD6A 2PFUA 1HC8A 4HKEA 5GJWB 2NYSA 2P84A 2MW8A 3MZYA 2E5LK 1RABB 3QNOA 3HHTB 2YXYA 4P5OA 4KYWA 3R60A 1S6QA 3M8EA 4RTZA 5KH6A 1B6AA 5LHIA 2X85A 4J2BA 1KYWA 2HNDA 1VI0A 1ORPA 2PMHA 3S32A 2HHTA 3SD4A 3ZL7C 2WOMA 1DLOA 3UDCA 3FIWA 4IOAL 1EV7A 1HQEA 2GTDA 2VQGA 4MTEA 2XIDA 3D4VA 1VQNQ 3TVTA 4NO7A 3ZGKA 2LFBA 1WBBA 3ZX0A 3GIBA 4FJ5A 3DM2A 3S2DJ 1Q7YC 1VRUA 4FLWA 5GMKi 5CVRA 3FJ5A 2CGJA 3CERA 2ZXIA 2OFKA 3FXKA 1I5LA 3CWSA 1GVJA 3KE2A 2O8XA 5BS6A 4E6KG 3I5RA 4M77F 2R7XA 4FXDA 1AWJA 1LUJB 4CDGA 2HMPA 1RZ4A 2VXFA 4FZXC 2KSSA 3OWTA 5A2QO 4JX6A 1QLYA 3IH2A 5KYUA 2DFIA 1W4MA 2K4YA 5E18F 4FJ7A 3CQTA 3FZVA 4FJNA 1UA1A 3C0BA 3DLEA 3BTLA 2ME0A 2L89A 1VQ7Q 4ESJA 1LDJA 1KD1R 3AARA 4GV9A 2QGGA 3CPWM 3FFIA 1ZHIA 1G15A 1TTHB 3C18A 1X19A 9ATCB 1BIUA 2LKSA 2HMIA 1JB0E 3I55I 3HDDA 3G2BA 2HZDA 4EATA 2Y4XA 1R5HA 4DW6A 1RDUA 1GHCA 1K0XA 3K0SA 2V9PA 1EH7A 1D3YA 5IPAA 1SHFA 5GPCA 4IRIA 4WWCA 5J4VA 2YNHA 3AVBA 2IGOA 1M2VB 2XB0X 3QHSA 1TL8A 5ILVA 3OYHA 3NWTA 1BC8C 5EX5A 4Z0UA 5GANh 2GX9A 3FEOA 3QPLA 3MEVA 1DP3A 1MSFC 2XRNA 4J00A 4CZGA 1YW8A 5BRHA 3WEEB 4YOWA 1J9AA 2G7UA 3QYEA 2QKBA 3IWFA 4CXFA 4II1A 1B8IB 3F8FA 2EFWA 2E2NA 4PK4A 4RB3C 3VQEA 3PUBA 3ZT0A 4MDXA 2E20A 3A5OC 4OAYA 4HPQA 3ZQ7A 2MF2A 2PZ1A 2L9SA 2YUPA 2HF3A 3GF2A 4G7HF 2OCCH 1U5SA 2KT0A 3THYB 3VF4A 2ECCA 4BXUA 5KYXB 1HJDA 2WTEA 5AQZA 4BR9A 1YJWQ 1JO8A 1BDGA 3F22A 5IP6A 3I55T 2VOPA 4CJTA 5J1UA 4DYRA 4DV2K 3O8MA 1VQNA 3NAEA 2J06A 1JL1A 1S9GA 1ATRA 3O08A 3L2UA 4FWMA 3L2ZA 2ECBA 2DM1A 3HFOA 5F0CA 4GGGA 3M8QA 4CFAA 4PFPA