3OYDA

Crystal structure of the prototype foamy virus (pfv) intasome in complex with magnesium and the insti gs9160
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
368
structure length
368
Chain Sequence
LDAELDQLLQGHYIKGYPKQYTYFLEDGKVKVSRPEGVKIIPPQSDRQKIVLQAHNLAHTGREATLLKIANLYWWPNMRKDVVKQLGRCQQCLITNASNKASGPILRPDRPQKPFDKFFIDYIGPLPPSQGYLYVLVVVDGMTGFTWLYPTKAPSTSATVKSLNVLTSIAIPKVIHSDQGAAFTSSTFAEWAKERGIHLEFSTPYHPQSSGKVERKNSDIKRLLTKLLVGRPTKWYDLLPVVQLALNNTYSPVLKYTPHQLLFGIDSNTPFANQDTLDLTREEELSLLQEIRTSLYHPSTPPASSRSWSPVVGQLVQERVARPASLRPRWHKPSTVLKVLNPRTVVILDHLGNNRTVSIDNLKPTSHQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular mechanisms of retroviral integrase inhibition and the evolution of viral resistance.
pubmed doi rcsb
molecule keywords PFV integrase
molecule tags Recombination,viral protein/dna
source organism Human spumaretrovirus
total genus 108
structure length 368
sequence length 368
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2010-09-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
A PF17921 Integrase_H2C2 Integrase zinc binding domain
A PF18103 SH3_11 Retroviral integrase C-terminal SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2300 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3oydA04
1.10.340.70 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Endonuclease III; domain 1 3oydA01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3oydA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3oydA03
3SQ4A 3HK2A 1WNSA 1NK0A 1L3SA 4CFDA 4RW6A 1H3ZA 4B9WA 4CHZA 4AHUA 1L3UA 3SV3A 4CE9A 3NF8A 3NFAA 3PX0A 2E6MA 2RI5A 4KB0A 2B8AA 1SV5A 4J2EA 1D9DA 3KLFA 2FBXA 3ZT0A 4CEFA 3NDKA 4QCLA 3O3FA 3JSMA 1JXBA 1FKPA 3DRRA 3TI0A 1S1XA 4CHYA 3AVAA 4QOZB 1LW0A 3LZIA 2ETJA 4E19A 1S5JA 4NZGA 4FZZA 3QEPA 4CF1A 3SPYA 3UIQA 1RNHA 3AVJA 1QS4A 3L2RA 3IRXA 2X6SA 3RR7A 1VSIA 4CJRA 5J2NA 5HRRA 3E01A 3WNHA 1N27A 3VQ8A 4E1NA 3O4QA 3QIPA 2YNFA 1WJSA 4BDYA 3S3OA 3LX7A 5CIUA 1S9GA 4BWMA 1JLBA 4BE1A 4FM0A 1KVBA 3B6PA 2GUIA 3AV9A 3DLBA 1XI1A 4CF0A 3RMDA 4A4FA 2A1RA 2JZ2A 1JKHA 4Z4CA 5D6WA 2O4IA 3F9KA 2QKBA 1EKEA 4PA1A 3DLHA 2KTQA 4PLIA 4KRFA 3VA3A 3HYFA 4FVMA 3NNQA 3AA2A 1RBSA 1O1WA 4TSXA 2B6AA 1JL1A 3ZT3A 3ASMA 3K59A 3VN5A 3NTHA 1FXXA 1BL3A 4DSFA 4JS5A 2BIVA 1SUQA 4BWJA 1RTIA 4NS5A 3RR8A 3S9HA 4H4OA 2O4XB 1REVA 3HP9A 1TAQA 3RTVA 1IKXA 4PY5A 1RTJA 3VQDA 3KIOA 1VRTA 4E89A 3NAEA 3FDRA 3G0ZA 2E6LA 3L2VA 3ME9A 3VQAA 4DLGA 3VQCA 2K3YA 2XHBA 3SV4A 3LAKA 4O4GA 4F3TA 4QQGA 3MECA 3LP1A 4B9LA 1Y97A 4HCZA 3ULDA 2R57A 3OYKA 3QEIA 4FLYA 3SYZA 2NUBA 5E41A 4KTZA 3ZT1A 3OYBA 2OPSA 3O4NA 3NTIA 4KPYA 2RN2A 4CGIA 4DLEA 1KLMA 4CJSA 3H08A 2RJCA 3ZT2A 3AVKA 2OPPA 1JLFA 1LWEA 2DFHA 3SNNA 2HHWA 5KGWA 3L3UA 4XIUA 1WAFA 4JS4A 4J2BA 2D0AA 5CZ1A 3DM2A 4I9QA 1CXQA 3VQBA 5FRNA 4EP4A 3NBPA 1T7PA 4KTWA 3TABA 3LZJA 1SKWA 2P51A 1HRHA 4LY7A 1G15A 5C0MA 4CJQA 4DFMA 3V9SA 2L89A 3BDPA 1TKZA 1NK6A 1TKXA 3AO2A 4M3ZA 2G8IA 4CK2A 4OVAA 3OYAA 4CEOA 3DLRA 1BISA 4PLLA 2EQUA 4I9LA 4OPKA 3NH0A 4IG3A 4OJRA 4BACA 4YFUA 1W9HA 2YV0X 5J1EA 4KHWA 3C4SA 3T19A 2HHTA 1RTDA 2FHDA 2PZSA 4B8CA 1WJQA 1FKOA 3PFSA 3QEXA 1IKWA 3L8BA 4DQSA 2EX3A 1JLEA 4B9SA 3CYMA 4KKOA 4ZTFA 3OYNA 3ZSRA 1A5VA 2XY7A 4Q5WA 1KFSA 1RBTA 4HTUA 1W0HA 4CCHA 3D0PA 3QESA 4FJGA 3ZSWA 3DMJA 1S9EA 3TARA 2RI3A 1LAWA 4O5BA 4W5NA 1VRUA 3TAMA 1WSHA 3NGIA 3KKSA 3OMGA 1NJWA 4CGJA 1S6QA 3OY9A 1I3AA 2LDMA 1U4BA 1B9DA 2XY8A 2F5KA 3VQ6A 4B9NA 1WSGA 3HPOA 2YNIA 4C8OA 3C95A 3H8ZA 1S1UA 4Z4GA 3META 4GMJB 3O3GA 5FDLA 2BE2A 3QEVA 4F4KA 3LWLA 2EHGA 4C5EA 4CJFA 3C6TA 4FJ9A 3ZEHA 4KREA 1TK0A 3AA3A 4FLUA 3QERA 3L2QA 3K5LA 4DQQA 4K8XA 3AVHA 3E9GA 1U47A 1MU2A 2Z1IA 1C1BA 4M3YA 3H6ZA 4AHRA 4Q5VA 3ZCMA 4CGHA 5C6SA 3EAEA 1QSSA 3RRGA 5FROA 4CIEA 5KRSA 3ZSXA 4JRPA 4OGCA 1D9FA 4QVZA 1KFDA 4RW4A 4CHPA 4IDKA 2KQ2A 4F3OA 1RBVA 2OYQA 3ZT4A 2HHVA 2IS3A 4NCGA 5J2MA 5I42A 1SKRA 1EXQA 4YNQA 3TR8A 3ZSQA 1J5OA 3M8RA 3CEYA 3P1GA 2YNGA 2DAQA 4ELVA 4M45A 1VSLA 2KFZA 4M42A 2OZMA 3WNEA 3DLEA 3V1OA 3DYAA 3OYCA 4M3XA 3CG7A 3HPHA 3SCXA 3SI6A 1VSFA 2Y1IA 4N47A 1HPZA 4KHQA 3KLIA 2M16A 3AVLA 2KFNA 2RPIA 2E5QA 2ATQA 3QNNA 1HYZA 2Q3SA 4RW9A 4DTXA 4N5SA 5HBMA 2D0BA 4KHUA 3HPGA 1DTTA 1YVUA 4IFYA 4CJKA 5KRTA 2IC3A 4B08A 3U6FA 3OS1A 5CYQA 4DTRA 2XRIA 2IOCA 3CFOA 2A1SA 2IDOA 1IG9A 1DTQA 4MQ3A 5C42A 3QJ6A 1C1CA 1XWLA 2VWKA 3WNFA 4R5PA 2DFFA 2FBVA 3AO5A 2VG7A 4AHVA 3BGRA 3AVCA 4C5GA 2X74A 3QIOA 3V9XA 3VQEA 3I0RA 1X9WA 4AH9A 3LP3A 3OYIA 4CF9A 2RHUA 3MEGA 1L3VA 4DWIA 4HHTA 3V9WA 2GV9A 1U45A 4A4EA 3MEVA 2HW3A 2NLUA 2FBYA 3KKRA 3MEWA 1ITGA 1XNIA 3NF6A 4DMNA 2YKNA 5KE3A 4X34A 4KV8A 4CF8A 4HUEA 1LW2A 4CIFA 4CGDA 4Z02A 3L2WA 2VG6A 2GFAA 2WOMA 3AO1A 4Y1CA 5T7BA 2RO0A 3DI6A 3LPTA 1EETA 4DSIA 4J2DA 1QHTA 1HQUA 4A4GA 3HJFA 3KK3A 2FC0A 4FJIA 3KJVA 4DF8A 3VA0A 3IG1A 3IAYA 1CZBA 1HNIA 2QXFA 3DOLA 3M8PA 3NGYA 3LPUA 3FEOA 4CERA 1X1PA 1RDBA 3QIIA 3OVNA 3CQ8A 4ICLA 4CECA 3LYIA 2EFIA 3DLKA 3C6UA 4N4IA 3SUQA 5JS1A 1WJRA 4J2AA 4IURA 4CFCA 2XY5A 2F96A 2YRVA 3HVRA 3LDSA 5J2QA 2HHSA 4FJXA 5HP1A 2RHXA 1Q9XA 2EKOA 4Z4FA 1UA1A 1C0TA 1RBUA 3K2PA 1XHZA 2RHIA 4FLWA 1NK8A 4M3TA 1JLCA 1YTUA 4PWDA 2M1HA 1KVCA 4FU6A 4L8RB 3MP6A 3OQ5A 3SQ2A 1IO2A 2RHYA 3HO1A 4JLHA 1K6YA 3T1AA 3I8DA 3QLHA 4CEQA 3LP2A 1D5AA 4OKEA 3O3HA 1FK9A 3OB9A 3LGFA 4KB1A 4M41A 4DS4A 1BQMA 4DTPA 3QEWA 2JGUA 3EY1A 4HVJA 2G3RA 3CFPA 5D3GA 5SZTA 1KCFA 2IGIA 3NGZA 4LD6A 2EQJA 4CJLA 3V9ZA 2HVHA 3AVIA 2AJQA 3HSTB 2XDPA 4E0DA 3PV8A 1NK7A 3K57A 2PYJA 5CZ2A 1KRPA 3V4IA 4GVMA 4C8LA 1SL0A 3UWNA 3U3YA 2KZZA 1F21A 1B92A 3TAGA 1BI4A 3MXMA 1JL2A 1A5XA 4E1MA 4NCBA 3ZSOA 1WSFA 3NTKA 4DQIA 3SZ2A 4E7JA 4CHOA 1WSJA 2JTFA 4H4MA 2X4YA 3VQ5A 1NKBA 3P8HA 3OYJA 4RW7A 4ZTJA 2LSNA 1WGSA 3AO3A 4UC4A 3MEDA 1JLQA 4NYNA 5KGXA 2XK0A 4DTMA 4HUGA 4GW6A 4QQDA 4EZ6A 4E7KA 3PMTA 3K5OA 1BCOA 3AA5X 5C24A 3AVFA 4C8MA 4M3UA 4O0IA 1IKVA 2O4GA 5KH6A 4AHCA 3P8DA 3NH1A 3RWUA 4CJ5A 1RT4A 3WNGA 2G8FA 4N41A 1HJRA 1X9MA 3QINA 1OZ3A 4CJUA 1RT3A 4LH5A 2B4JA 3DOKA 1RT6A 4CEBA 3SUOA 1BI4B 5SWMA 4ID5A 2GF7A 3OS2A 4FM1A 1NK4A 5D6XA 4I7FA 2QQRA 3CM5A 4DTUA 3BDLA 4I2PA 1WN7A 4DTOA 3SPZA 1TL3A 2CKKA 4B8AB 4IUTA 3PX4A 2BANA 3KK2A 4KTQA 3Q1JA 2YHAA 1S1TA 3SQ1A 1I39A 4FCYA 3V1QA 5J39A 1VSKA 3EYZA 2HHUA 3DRPA 4Z4EA 1KTQA 3FLGA 1ASVA 3V6DA 3ALYA 4WE1A 3VQ7A 1JLGA 1CXUA 3V81A 1J54A 3NHGA 1TAUA 4CEZA 3NE6A 4N76A 2PY5A 3K5MA 1RT7A 3SUPA 5CY4A 4CK1A 2HMIA 2HHXA 4DSLA 4IBNA 1T05A 2QK9A 1L5UA 3CFRA 3OYLA 3VQQA 1RT5A 2HNZA 2PQWA 2P0KA 4CEDA 2P5OA 2L3RA 5KE2A 2ZE2A 1RDAA 2YKMA 4B9UA 4L59A 1JLAA 1KVAA 2P1JA 1SL1A 4FM2A 4KO0A 3OJSA 2JLEA 3G10A 2XY6A 4DQPA 2D5RA 4FJ8A 1OYXA 3SUNA 2K3XA 4O44A 3OS0A 4DTJA 3MEUA 4CF2A 3P5JA 3KK1A 4E7IA 3LALA 3MAQA 1DLOA 4CGFA 3OYHA 1NK9A 4FJ5A 4I2QA 2G8WA 2RHZA 3TAQA 1UA0A 2RJFA 4N4GA 3ITHA 1U48A 4CFAA 2R5AA 1SKSA 4EP5A 4CJVA 5KI6A 2R7YA 5HROA 1ZBIA 1RCHA 3LGLA 4QW2A 4OKJA 2HQXA 3HVTA 1MHNA 1A5WA 4M3RA 1Z25A 2BDPA 4DU4A 3AVMA 3VQPA 2RF2A 4CHQA 1NKCA 4DU3A 4CRIA 3ZSVA 4IUVA 4HCCA 3OYMA 4OLAA 1N5YA 3TAEA 4K8ZA 2DFEA 3HP6A 3TAFA 4IUUA 4BDZA 2R5MA 4PUOA 4CESA 4LH4A 1R0AA 4FW1A 4CIGA 1S6PA 2OPRA 3OJUA 4ELTA 3K58A 3F73A 2DIGA 3QNOA 4PL6A 3NF9A 2G8VA 4DSKA 4QQ6A 3K5NA 4IUQA 4FJKA 3ZSZA 5KCHA 4CHNA 2ZD1A 2G8UA 3SQ0A 4LD0A 2F8TA 1ZBUA 3KTQA 3LP0A 3MO8A 2DIQA 2DY4A 2LRQA 3M9QA 1X9SA 4IG0A 4QAGA 5IAYA 4FXDA 1QSYA 4FJNA 3KD1E 3OA6A 5FRMA 4RG8A 5DK5A 4W5OA 3VQ4A 2O4XA 5HLFA 2W42A 1SL2A 4ZHRA 1D8YA 4FL6A 4W5TA 3OYEA 1WSEA 1B9FA 4H8KA 3QBYA 3SJJA 1LWFA 2B5JA 3ZSYA 4KFBA 3B6OA 2Y1JA 4ELUA 1HYSA 4DSEA 2WACA 3JYTA 2EQMA 4CJPA 5J2PA 2HVIA 3C94A 3EZ5A 2QKKA 4DTSA 1JXEA 1BHLA 4Q0BA 3MEEA 5M9OA 3NF7A 4DFPA 3AVGA 2Z1HA 4KHSA 2HB5A 1J9AA 4E3SA 3MXJA 3SD4A 1NOYA 5I3UA 3AVBA 4CJ3A 3M8SA 1BQNA 4FJHA 3RMAA 1QQCA 1BIZA 1C0MA 1SSFA 4B9TA 2RKIA 2FBTA 1KLNA 2YHBA 3HXMA 1IKYA 4OLBA 5CYMA 2Z1JA 1BGXT 4RW8A 1GOAA 2X4XA 4KI4A 3PY8A 2DTUA 3GOXA 1ASUA 1GOBA 3OMCA 1T03A 1NK5A 2G8KA 1EP4A 3LANA 1HMVA 2GBZA 4E7LA 4IKFA 1NJZA 3T3FA 1Q8IA 3PNWC 1U04A 3M8QA 4KHYA 4JRQA 4FJJA 5J26A 4Z4HA 4CGGA 1QE1A 2E6NA 4FJ7A 4C8NA 1KHCA 4OPJA 4F8RA 2LTOA 4FK4A 1CZ9A 3KD5E 2X35A 4DU1A 2Z1GA 1TK8A 3THVA 3I0SA 2YNHA 3NCIA 2X78A 3QO9A 1VSEA 1WSIA 4FLZA 2ITGA 2VG5A 1RTHA 1S1WA 3AO4A 4N4HA 1LWCA 4DSJA 4FJLA 2M0OA 4Z4IA 1TKDA 3OYGA 2X4WA 1L3TA 2KW4A 4C8KA 4II1A 4CJEA 5JS2A 5HRNA 2G8HA 4UQGA 2HQEA 2ZQBA 2BGGA 1NJYA 1TKTA 4C5IA 2LCCA 1UWBA 3RMBA 1RT2A 2VWJA 3U3GA 3NH2A 4CJ4A 1OZ2A 2F8SA 4W5RA 3UT1A 3ISNC 4DTNA 4F2SA 3ASKA 2RJEA 1VSDA 1QTMA 2EQKA 2XO7A 3HM9A 3V1RA 1VK0A 1TGOA 3IS9A 4GY5A 4AHSA 4EZ9A 1LAVA 1ZBLA 4LSNA 3MP1A 4DS5A 1KSPA 4G1QA 1Q9YA 4B9XA 5D6YA 4N56A 3PO5A 4OVLA 2MWOA 1TVRA 5K14A 1RILA 2WONA 4BE0A 3RRHA 5HRSA 1C0UA 4B3OA 1BIUA 3OYDA 2PYLA 1TL1A 4CEAA 4CJWA 3VQ9A 1WAJA 4FLTA 2X6NA 4B9MA 1XHXA 3MEAA 1UAXA 4DFKA 1ZYQA 2R58A 4DG1A 3L42A 1GOCA 4FZXC 3LH0A 3D45A 1ASWA 3HL8A 4BD3A 4MFBA 2MWPA 2VYTA 1YT3A 2KZMA 4RG2A 3FFIA 3S6WA 4ID1A 4HUFA 3S3MA 3FC3A 2LVMA 3MXIA 4FW2A 3LWMA 2GFUA 4FLXA 4BE2A 4DQRA 5IN1A 3L2UA 3HT3A 4FJMA 1RI0A 3DLMA 1C6VA 1S1VA 4CJTA 2I5JA 4M3WA 2IAJA 3A2FA 1C1AA 4CK3A 3DB4A 5EU7A 3AVNA 3KLEA 3QETA 1NOZA 5KTQA 3LAMA 2OPQA 3CM6A 3OYFA 2QQSA 1ZBFA 2HNYA 3PX6A 1TV6A 1EX4A 3TANA 1IH7A 1U49A 1RT1A 1OI1A 4KI6A 3L3VA 4KHNA 4F2RA 4DFJA 4DF4A 1VSJA 1T8EA 4C5HA 3P83D 4LSLA 3F70A 1Z26A 5C25A 4B9VA 3DLGA 2L8DA 4O0JA 1XC9A 1TK5A 1RDDA 1LV5A 4NYFA 1HQEA 4BDPA 1BCMA 1CLQA 3S3NA 5KCOA 4FK2A 2RJDA 3RMCA 4W5QA 3O8VA 4IUPA 3V9UA 4AILC 2D9TA 2RI2A 4CFBA 1RBRA 2OZSA 1QSLA 4OGEA 4O55A 3DRSA 4E7HA 1VSMA 2BUDA 3E9FA 4FK0A 3PMIA 1RDCA 1G5VA 4CEEA 3KLGA 2P5GA 3LLRA 4Y1DA 1J53A 4AHTA 4Z0UA 3QKJA 4FYDA 2D0CA 4FZYA 1YTAA 3TWHA 2IG0A 4OKKA 4NCAA 2BKDN 3TAPA 4IFVA 3KLHA 4PQUA 2E4LA 4EDUA 4A4HA 1UOCA 3DB3A 1NKEA 5HRPA 2HNDA 3PUFA 1ZBHA 1HYVA 3KUFA 3PO4A 1NJXA 2HHQA 4HCBA 3MP8A 1HNVA 5DMRA 4KAZA 1VSHA 1WLJA 1N6QA 4FLVA 3AA4A 2OA8A
chains in the Genus database with same CATH superfamily
2BHYA 3SQ4A 4A69C 1NK0A 1L3SA 1YJ9A 2QWMA 1VQMT 4LDXA 3CCSN 4L9TA 1UHCA 2HOEA 3ZQQA 4CHZA 1YHQA 1WLPB 4E1JA 4AHUA 2JM9A 2VB6A 3A5OC 2QYZA 3N05A 1IG8A 1USSA 2CH4A 2E3IA 2E12A 1SS6A 3PX0A 2E6MA 4C3IJ 2B8AA 1SV5A 2QKMB 3KK7A 4M75F 4NNJA 1VQOT 1D9DA 4DV0K 1QZYA 3GZ5A 1G3WA 4JKFA 3RSNA 4CYCA 2QVOA 2HHHK 1IV0A 1WJEA 4YIRX 1T3LA 1RDWX 3CJAA 2MIOA 4CHYA 3AVAA 1BJZA 2DM1A 1XSVA 3OOUA 2VVKA 5BNGA 4NZGA 3QEPA 4IOCF 2GCXA 1MUZA 5EEGA 3EETA 5DY9A 2YJEA 3L2RA 1PUFA 1BJAA 2YSQA 3WNHA 1VQ4T 2COZA 2PMUA 1T6DA 4Z88A 1I94K 3PQJA 4IVNA 5FJ8J 4E1NA 5GAMj 3O4QA 3QIPA 2DA5A 2K5FA 1RR7A 1FW6A 4RUGA 2AT1B 2E2QA 5JI6A 2OTLT 4HSBA 3JRCA 2DBKA 1B4AA 4G6DA 2PAVA 1ZSZC 3VS5A 2JVHA 3U1KA 2FL7A 4A54A 2GUIA 1XI1A 4CF0A 5GANe 3JCMW 2V1DA 2VPLA 4OB1B 3ECOA 1KD1R 2FF6A 4B22A 2O4IA 4H5WA 3MN2A 3W6KB 2OQGA 1UJ8A 2WB1A 2KTQA 1NYGA 4OB3B 3QU6A 2UYTA 3RKYA 1W70A 5HLGA 4M75A 4KITB 1AKHB 1K8AR 1O1WA 3BR0A 2XC7A 4J9IA 3ASMA 3ZT3A 1NGGA 4LD9K 5CK9A 2HZTA 1FXXA 1BL3A 2CFOA 1WZ2A 3M0QA 2HGCA 4BWJA 1RTIA 4NS5A 4IOAF 4YOYA 2O4XB 5AYFA 3IQLA 4BU2A 4M71A 4UY8I 1TAQA 4C92C 4PY5A 1RTJA 4M7AE 2GBQA 5CAIA 1O9SA 1QNTA 2ATCB 2K5IA 2OBPA 4Z89A 3HHGA 4MZTA 2X9HA 3S16J 4JQFA 2E6LA 3ZGKA 1HNXK 1K0SA 3L2VA 3VPZA 1RADB 3VQCA 2KP6A 3M0RA 2A5WA 1DJ7B 2DBMA 2EBPA 3LAKA 4K43A 4O4GA 1YJWI 5CR4A 4PDKA 1ACIA 1FMKA 5LJ3f 4B9LA 4MEYF 4HCZA 2LNBA 3SBGA 1GV5A 4EMSA 3ZLJA 4U87A 1O13A 1ZUYA 3IRQA 5J47A 4KTZA 3ZT1A 2FBKA 4LFCK 3OYBA 1QVFS 4JJCA 3I55I 4BB7A 1GLAG 4EIAA 1KQSS 3FHZA 3ZFJA 1K8KA 1HF0A 3M58A 4DR2K 3WG9A 5LJ5e 5LJ3g 1KLMA 3UR3C 2KT1A 2OUMA 3BG3A 5L3GA 2WBNA 1LWEA 1QMCA 3W6JB 1Z0XA 4M3EA 4AD9A 5EC7A 1L0OC 2WWYA 4YIFA 1KIKA 2FEZA 1YI2T 1VQPA 5I11A 1TL8A 5KVRA 4I9QA 4KJZA 1OVQA 1D8KA 4F17A 1XJWB 3I55Q 5A2QE 4B1WB 5IYDJ 3WVDB 1GLFO 1EJ9A 2P51A 1XPXA 3O8MA 4FWKA 1R36A 2OC6A 3JB9D 3SZGA 3TU5A 1LVKA 4FYXB 2L89A 1M1FA 1NM1A 1TKZA 4JBAA 2CQNA 3VSLA 3AARA 3LSGA 2PTKA 2JQ7A 3OYAA 1R00A 4A4KA 2X48A 4YPRA 3NH0A 5M1NA 4D8KA 2PZ1A 4OJRA 2IVNA 1DEJA 4BACA 3LDNA 3K4KA 4YFUA 2CREA 5GAN6 3CMMA 1SZ2A 1U5TB 3MKDA 2EFPA 2XRLA 5J1EA 3BJAA 3C4SA 1RTDA 4LF4K 2VJJA 3JCMb 3IWFA 4DR7K 1WJQA 4NXMK 5LGTA 4JKGB 2P84A 3F72A 3B6AA 5AFUA 3PFSA 4BRIA 3LSMA 2Z5UA 5GAN3 4KH4A 3QYGB 2EX3A 1N32K 1JLEA 3G25A 4GLMA 1ZUKA 1JEGA 2ZAEA 2JG6A 3ZSRA 1A5VA 1IO6A 1KFSA 4IEIA 1BU6O 3ABKH 5CVJA 3D0PA 3TO7A 5AQZA 3ZSWA 5JMVA 2RNGA 4WQ4C 1E6GA 1S9EA 1PKTA 1V29B 4RAGA 2RI3A 1LAWA 3CD6T 1VRUA 3TAMA 3HFNA 3CCQI 3NGIA 4EGYA 1NJWA 4CGJA 3CCJT 3G1LA 2I10A 2KPMA 1B9DA 2A3ZA 3PIOA 4M9ZA 1OLTA 5GPCA 1WSGA 1RRQA 5KQDA 2YNIA 3HPOA 3HOTA 5FW9A 2K40A 2P9SA 3IAM2 4MEXF 3H8ZA 4KT0E 4HRIA 2KE9A 5HCKA 5DM7F 4ZYDA 2BE2A 4F4KA 3LWLA 1K8AU 2LD5A 3E5XA 4FWQA 1K9MO 1X1CA 3ZEHA 3CCQQ 2L9VA 4IHYA 1HC8A 4PKIA 2ED0A 2MD5A 3AA3A 3L2QA 1F4KA 1TTHB 2NOIA 1SHGA 3GG4A 1J09A 2ZXJA 3E5UA 1S1NA 4K8XA 3AVHA 2DPUA 1MU2A 2HU9A 3BG6A 1C1BA 1APLC 2LH9A 3W6VA 3ZCMA 2VGMA 2ZWHA 3CWAA 5E3LA 2KIQA 4OMQA 2DXTA 1QSSA 1K8AC 3RRGA 5FROA 1YVNA 3GYHX 4GBQA 1ETKA 1D9FA 2OCCH 3MHXA 7AT1B 2B0LA 3I56I 4AG2C 4RW4A 1RBVA 3ZT4A 2X6WA 1R1TA 4NCGA 2BZYA 1P59A 1TBXA 2CGPA 3MCAB 3K70C 3MWTA 2WTUA 1EXQA 4YNQA 2PG4A 5DLQE 3TR8A 1TZLA 3A5LC 3ABMH 1BIBA 1PD1A 5BR8K 2W10A 4CC2A 2DERA 3P1GA 4IRGA 4XH5A 1UMQA 2BY0A 2YJFA 3BG9A 1Y96B 2H8WA 3I56Q 4M42A 3K7AJ 2Q1ZB 2JN0A 2LQKA 1QU3A 2HDCA 8AT1B 1M27C 1SHFA 3DLEA 2CUBA 2YHYA 3U21A 3HPHA 1VSFA 2W00A 4NDLA 3W2AA 4BVPA 4X66K 1OH8A 2CGJA 2Y9ZA 2ZFWA 2BVLA 3E2UA 2X1DA 2M16A 1STZA 3AVLA 2V1UA 2LYCA 3FXOA 5KPTA 3MMVA 3DLLF 1N75A 1M3BA 1HYZA 2OU2A 4RW9A 4DTXA 1VQNT 1ETOA 3ZCOA 3CPEA 5ADXA 2V1XA 1XGNA 1K7AA 4IHVA 2VXEA 4BAYA 4J9FA 2EGAA 4IFYA 5KRTA 1S7OA 3R60A 1VQ7I 3CCSA 1S72I 5L3FA 3OS1A 4IO9F 2MFZA 1X6BA 1IG9A 1DTQA 2XHIA 5C42A 4R5PA 3UDCA 3IUOA 4OF1A 3QFUA 2V26A 4X6AJ 3ZL7C 2BZ8A 3AVCA 4LLNA 3JCMJ 5B8HA 1CF7B 3QIOA 2NYSA 4FWLA 3LOCA 1X9WA 3CBMA 2LG4A 3W3DA 1Q81U 2RHUA 1LVAA 1YXQA 1VQ7Q 1L3VA 5HK3A 1S72Q 4XN0A 3TSZA 2GV9A 2X3WD 1U84A 3MEVA 3JRIA 3MCPA 5GAMh 1FSHA 2XDVA 3IFRA 1EH8A 3NF6A 2CH5A 5DPKA 2OJ2A 4BRNA 5KE3A 2EIMH 2HOSA 4BR2A 4CF8A 1VQ6I 4J9BA 5LFAA 1GDTA 3V8JA 5GAOq 3E1YA 2NRVA 3I5RA 4E47A 3D5RC 2VG6A 3DLLA 2O7OA 5GAGP 2LX9A 2EV6A 5I2SA 3CCUA 1PUEE 2K79A 1I4K1 2R92J 4KDPA 2KNBB 4DB3A 2ID3A 1LDKB 4J2DA 4FT2A 1AWOA 2HL3A 4HF1A 2BTTA 4Y33A 3KK3A 1F43A 1G99A 3RPUD 3KJVA 4MQVA 3IAYA 3QDRB 1CZBA 1ZSGA 1HNIA 4X62K 1VQKQ 4M78G 2OX7A 4LUDA 3I9V2 3CCLT 5HOOA 2LQNA 3ISPA 3FEOA 2P9KA 3E3VA 2ZPEB 3WU2C 4A93J 3LYIA 1EWRA 3DLKA 3WTSC 1VQOA 1PVSA 3G4SN 4X1EA 2YLBA 3CCMN 1MMNA 2FRYA 3EGXB 1P6RA 2MBFA 4BRFA 2F96A 3HM5A 2EIKH 3S1NJ 3HVRA 3LDSA 2HHSA 2RH2A 1XQOA 1QHGA 5HP1A 2JA5J 1Q9XA 3GE1A 3JCUC 4II3A 1C0TA 1Z67A 4IFEA 4XK8E 1XHZA 2F5EA 1A0NB 2NVUB 5GAHP 1TNSA 1W2BM 2I5WA 1X2MA 4M3TA 1JLCA 4GY2B 1YTUA 2QA4Q 2F5DA 2WY8Q 5DD4A 1PM3A 3K0SA 1KVCA 4UOBA 3MP6A 4N0AA 3KP4A 1XD7A 4LUEA 3HO1A 4JP0A 1U8RA 1VQ4A 4NXNK 1BYMA 1K6YA 3T1AA 5AZJA 1PDNC 1JXSA 4UVBA 4CEQA 1YCYA 1D3YA 4M6XA 4XNFA 1WA7A 1QQJA 3H1VX 3SFMA 4BH9A 1T39A 2ME6A 1FK9A 3BY5A 3OB9A 1XNQK 2HPIA 2NRRA 2M51A 4M41A 3J7YP 3NEUA 1WCMJ 4JI4K 3THYB 4C8QE 4KISA 3E5QA 2G3RA 4DEYA 3CFPA 3DTIA 3TU4K 1BUPA 4ZGJB 3BPXA 2EQJA 2CDTA 3V9ZA 2EFOA 1WPYA 1NGDA 3JTHA 3RDVA 3JS6A 3AVIA 3ERED 2IBDA 2AJQA 2STTA 3HSTB 1X3NA 2XDPA 4OIRF 5AONA 3CO7C 3KHYA 2DYSH 3BOQA 2G0EA 2PYJA 4MNUA 2HYJA 4ON0A 4GVMA 3HG9A 3T0YA 3RR6A 4Q5SF 3U3YA 2KZZA 1F21A 1WOQA 2GXAA 5A2QZ 3H5RA 2KLAA 2CUZA 3GZ6A 3EG9A 1GCQC 2UV1A 3UATA 1TW2A 3P9IA 4E1MA 1PD0A 3EKUA 5C4JJ 1G3YA 3TTDA 4IHSA 1WSFA 2G6FX 3NTKA 5KYXB 1KZHA 5GJWB 3LA7A 2W7NA 1GRIA 4HNVA 1DUXC 1HW5A 1FYLA 3JRAA 1SAXA 4ILGB 1RAAB 1ZR2A 3SZPA 1Y0UA 5LRRA 3F2KA 2VPRA 1SD5A 4ZTJA 2CH6A 1E4FT 2LSNA 1BM9A 1Z7LA 1GUUA 3UKRA 4UC4A 1Y71A 3MEDA 1PYVA 3BC8A 3AG2H 1JXOA 1PHTA 4DTMA 1S8NA 1G3SA 4PZJA 3PMTA 2PJRB 3IKTA 1BCOA 5C24A 1K9MU 4YRVA 4M3UA 1JJ2M 4KH1B 1IKVA 2O4GA 3O1WA 2X85A 4LG0B 2P9NA 1SMTA 3CMAN 3HC7A 2QWNA 2HNHA 1QGPA 3BW1A 3RI4A 1X9MA 1HQCA 3H9NA 3BZCA 2KJCA 2W84A 4M9XA 2H3JA 4CJUA 4ORZA 1W4MA 4QKUA 1T3VA 4WFNL 2B4JA 2BBYA 1RT6A 5ILSA 3BG7A 1BI4B 4QTRA 4XK4A 3BF3A 1NK4A 5D6XA 2F5FA 1ZARA 1FZPB 1GL5A 3AY9A 5DUKA 5JR3A 4DTUA 3VESA 4I2PA 4DV2K 4KT5C 2E35A 4DTOA 3M0SA 2ZJPL 1Y56A 1NK2P 2BANA 2LBFB 3HTSB 4D1QA 5KCMA 5LEJA 4ENMA 4IZ9A 2OANA 1S1TA 3SQ1A 5GAOn 2EJ9A 3GBQA 2D8JA 1WFXA 1YQAA 4OMLA 3DTKA 5KPRA 3EYZA 2HHUA 1MMSA 3DRPA 2BOLA 2W82A 2KSSA 1JLGA 4ITVA 1D4XA 2KZVA 4D9JA 4JK8A 5BOXA 3V81A 5GAMe 1TAUA 3G6EI 2MGQA 3V8LA 3VF6A 4FYYB 3NE6A 1LPQA 2K85A 2PY5A 3QYHB 2D0OA 5D8KB 2ZPIB 2ZFUA 4CK1A 4UNOA 1MV0B 5FWBA 2KI7A 3KEQA 4JX4A 1NMNA 1D3BA 2HNZA 2IVPA 1E3HA 2P5OA 4RAFA 1REPC 5KE2A 4WXDA 3JW4A 3EKSA 2YKMA 2Y69H 4CO8A 4A12A 4L59A 3OHRA 1KVAA 1OH7A 3RERA 4J01A 3IWZA 3L9FA 4FM2A 1ODDA 1QRYA 5FU7B 3G10A 3CC2I 1WKMA 3J8AA 4KRTA 4FJ8A 3K4MA 5L3EA 2ABLA 2E5KA 4O44A 4DTJA 3GLXA 4A6EA 1TC3C 3P5JA 4BQOA 4WWCA 4S05A 4GDFA 2MK5A 4E7IA 5LGUA 3F8FA 3MAQA 3GFLA 2A37A 3CDIA 2G8WA 1UA0A 4N4GA 4IWVA 1EBMA 1D1CA 3BROA 1O3SA 3PNVA 4KBOA 4JPBW 3BTLA 1IGNA 4Y7NJ 4EP5A 4LD5A 5E79C 3T1YK 3CC2Q 2QBYB 2A5YB 2FE3A 1OV3A 4BC5A 4B09A 4CCLA 4H0YB 1UFFA 3JCMh 4H5NA 4OKJA 2HQXA 3LNQA 2QEXN 3G2BA 1MDMA 1ATRA 2YR2A 2FMLA 4KUDK 4ILJA 2ID6A 3REAB 4PJMA 1AOYA 2F48A 1K79A 5E1WA 3MVPA 3EO3A 1SC7A 4KULA 4HCCA 4K8ZA 1HK9A 3RBBB 3TAFA 5GMKi 4BDZA 2R5MA 5BMZA 5GTHC 4IJNA 2DXIA 5D7UA 1JKPC 3VF2A 3WTWC 4LH4A 2FXUA 4ZYAA 3CJBA 3RSEB 4ESJA 1S22A 1S6PA 2DIGA 3OBYA 2JMAA 3I4PA 1U3OA 1DP7P 4QQ6A 2CV1A 1YJNN 4IUQA 4BL0B 5ICEA 5IOYA 4FISA 3J81O 2LREA 2WAFA 2JPCA 4DOWA 1V4RA 4A6DA 3H5NA 2QCOA 2ZCWA 1ZBUA 3JRDA 4PKCC 5AQNA 3MO8A 5FKKA 2DIQA 4Z8AA 3M9QA 5FPMA 4M6YA 1X9SA 4QPOA 2PX9A 4M3FA 2CT4A 2DD5A 2FSKA 3KD1E 1A04A 4K2EA 2P9UA 3OA6A 1UEBA 5FRMA 2E1YA 2JT4A 5L23A 2OQRA 1EIFA 1GCPA 5DK5A 2CG4A 1BA5A 1T0FA 2IVWA 2YX6A 5ICCA 4IQ4A 3KYLA 3EGDB 5HLFA 3A01B 4E4HA 3D2EB 1NG7A 4ZHRA 4PUSA 2QDLA 2DETA 1D8YA 2NXNB 2E70A 2Q36A 5K5QA 2ZJRL 4H8KA 3U23A 3SJJA 2XAFA 4BY1J 3ZSYA 2DMNA 3MMYB 1R5GA 1W5TA 3H9QA 3SDZA 2P9IB 4DSEA 2WACA 4B4CA 1HKGA 3MD2A 5J2PA 4DZPA 3G4SA 3EZ5A 4ZNXA 1ZHFA 1WXUA 5LJ3j 2F4OB 2DX1A 1JXEA 4ATOA 3WGHA 4G6TB 5M1FA 4Y91A 3MEEA 1VF9A 2PUOB 3H1CA 3GZNB 3TOAA 2HDDA 4E3SA 3K1MA 1X2NA 3GBGA 1I81A 2DPPB 2FOKA 3LCNA 1Y1VJ 2K9QA 2R7SA 2PJPA 1OOTA 1JXMA 2J06A 1WJFA 1BIZA 1C0MA 4B9TA 1VQPI 4MDBA 2QQAA 5D5UB 3HRMA 1WHHA 1NGHA 3UF4A 3HXMA 4O6JA 1IKYA 4E6RA 2VKNA 2DF6A 3COAC 4M78D 3UPUA 4L0ZB 1TNTA 3L1PA 2DL8A 1VQ8T 5A2QO 3FJPA 4L9JA 3OMCA 1X69A 1NK5A 3CHWA 1VQPQ 3OW2M 4ZDOA 2GBZA 1TLHB 3RVCA 2QQ8A 1NJZA 1OYYA 3GF2A 3M8QA 4KHYA 4KIFA 4G6QA 3BP8A 1XNRK 5KK1A 1K83J 1E6HA 5J26A 2Y9YA 2EFWA 1QE1A 2WUSA 2E5LK 2VLAA 4XTUA 4RDUA 3I0XA 5JLFA 3HRSA 4LMYA 4C8NA 4FWMA 1VYVA 2LTOA 1ZR4A 3V4GA 1IJWC 2F4IA 3KD5E 5IP9J 2X35A 2HBMA 1XC5A 4DU1A 4B3XA 5DD8A 1ZREA 5E3OA 1TYQA 1VI0A 2KIMA 5J40A 2CSOA 3ZQFA 2FA5A 1YW9A 3ESWB 4BHPA 3E6DA 5GADJ 1RTHA 1Z7UA 2DQRA 4M7AB 1N9RA 1WHJA 3WQUA 5C4XJ 1IC8A 4L9VA 1ZRFA 5FU7C 1H1VA 1TKDA 1KONA 1P4WA 5GTIC 1IGQA 5LBQA 4KUIA 4IEEA 2DOAA 3HOZJ 4CZJA 1UECA 2AO9A 2CGHA 2RMOA 4GYIA 5HRNA 4G8XA 3L2ZA 4IOCL 3RESA 2DK8A 2P9PB 2VWJA 1TWFJ 5LMUK 3NH2A 1J0RA 1EH7A 5IOZA 2LTPA 1V55H 3V7SA 3BE3A 1IN5A 2K4BA 4F2SA 4OFEA 1UB4A 4Y92A 3ASKA 1SFXA 1QTMA 2XO7A 4JKAA 3HM9A 4I7HA 2A41A 2R7FA 5ICFA 1VAZA 5HDGA 3CMAA 1LAVA 4M7DB 3HI0A 3MP1A 2CJJA 3D4VA 4DS5A 3JRGA 1J75A 4DBFA 1U1TA 1Q9YA 3C2BA 5CKBA 4BI4A 3KP7A 2NVXJ 1GLJO 2NRZA 2O8CB 4XU0A 2YG8A 5A0LA 2O9VA 3G0QA 3CJ9A 1H9TA 2V7YA 3SBTA 2G7UA 1YIJI 3RRHA 3VU3C 1ZBJA 1WNLA 4C92E 3BJ6A 2RE2A 4U88A 4BEHA 3D7SB 4BC4A 3SK3A 4IOAL 3JCMe 4HF0A 2FBHA 4HPQA 3CC4T 2EZIA 3R2XC 2KT0A 3CPFA 4E9FA 3ELKA 1WAJA 3GUDA 1ZC6A 1QZEA 4LXCA 2AKLA 3ZMZA 1VQ9T 4DFKA 4YDUC 5J4VA 1DKGD 1ZYQA 2PVGB 2R58A 1YIJQ 1GOCA 3HL8A 2OTJT 3DXMB 3RYPA 4FT8A 3TP3A 4BRQA 3GF5A 4FE7A 5BPDA 2E3HA 2G7HA 3WXLA 4M73A 2YDLA 4PJOB 1X3WB 5AIPA 2M0YA 2HQAA 4FW2A 4WF2A 2Q97A 2ROTA 4BE2A 3PVQA 1PSEA 3MFKA 1IXRC 3L2UA 3SDGA 4FJMA 1RI0A 1MBGA 3I55N 4CJTA 2EJRA 3FF5A 5J3BA 3EGUA 3D6RA 3WXKA 4XRFA 4CK3A 1HR0K 3ZQCA 2EWSA 5EU7A 1MWKA 1Q1VA 5KTQA 3LAMA 2DJZA 1M3HA 2DYBA 3T5XA 3OYFA 2HF3A 2QQSA 1WJAA 1I8FA 4QS8A 2D1XA 4IHWA 3K9TA 3CWUA 1OI1A 4KHNA 5IT9E 2O31A 3EUHC 2GA1A 4AFZC 2LP0A 3SWNB 2EILH 5FD6A 2UUAK 3PL8A 4C2MJ 3P83D 1PJRA 1PSFA 5AJ3K 2QTDA 3H41A 1BR2A 2GOMA 3SQNA 1Z26A 3IAS2 3GWZA 2DZCA 2BGCA 1LV5A 4OB0B 2O8BA 4EMGA 3G71T 3ULEA 1P4AA 4X9DA 2ZSIB 1BCMA 3M55A 5E8IA 4ISEA 4FX0A 2CQ7A 4R55A 2WADA 3S3NA 2L2OA 1NHAA 5KCOA 2RJDA 4W5QA 5TKYA 2GLOA 2E4HA 1GV2A 4IUPA 2ED1A 1X3ZB 1RKWA 3R0JA 1MSFC 4CFBA 4HV5A 2OZSA 1OPLA 4FYWB 1R1UA 2Y30A 3E9FA 2OFKA 2HI3A 1IG7A 4ENNA 3KLGA 1U1SA 3CCUI 4JDSA 1IN6A 1KU2A 4A3CJ 2NUTB 2WC2A 4G7HF 4OIOF 3SYTA 3QKJA 2ZGWA 4C9YA 1SVOA 1H8KA 4WCIA 2EK5A 4J9GA 4J9DA 4JKHA 4HVUA 2JPBA 4NCAA 3DF8A 3TAPA 3VPRA 1FBUA 3G1OA 3O9QA 4ZH4F 1BK2A 3CCQN 4CYDA 4R0KA 2I5UA 3CETA 4QVCA 4MLOA 3CZ6A 3CCUQ 1VQMI 3LQRA 3CWSA 4A4HA 4BUPA 4A5AA 2K9SA 1NKEA 1V4TA 4PJ0C 2HNDA 4EHUA 2IGKA 4H5TA 4IHTA 4M7AG 3MWPA 2DD4A 5F08A 4HCBA 1YJNA 1WSUA 1VQOI 1VSHA 3KZZA 4EJWA 3ATUA 3AA4A 4A2UA 3QPTA 4RAZA 3EUKL 3OIQA 3CO6C 3D2FB 4CFDA 4FYVB 2X9DA 4M7AC 4RW6A 4A62A 3TMOA 3CUQB 1HDDC 2HPMA 1J7KA 1VQMQ 4DZJA 2OV7A 1M90O 5DM7L 3SV3A 4CE9A 2F5TX 3NF8A 1M1KO 3K4BA 2KKOA 1IZ1A 2KMUA 1V3FA 4JI5K 4HXJA 4CC7A 2FNAA 2N8GA 4RLFA 5IXFA 1VQOQ 3DXJF 5E1ZB 2R7ZJ 4V2SA 4ILHA 4BROA 5LJ3h 1HX1A 4UVCA 4JLIA 3I56N 3DFGA 3ASNH 1VQ4I 5C2FA 3DRRA 3HZJA 2FSWA 1XB4A 3VEVA 2VE9A 4MDAA 3ZP5A 4NHJA 3TW6A 2ETJA 1HD3A 4CCKA 2HFHA 1GFCA 4W1UA 2GQVA 5EEAA 1TWAJ 3UIQA 3QQAA 5JVTA 1WZOA 3AVJA 4XTWA 2VT3A 2OTLI 3VS6A 4AYBN 1Q7YO 4M7DC 6AT1B 2EYWA 3L4IA 3IRXA 3ABLH 2X6SA 3VTIA 3RR7A 5J2NA 4OU0A 1KJWA 4A5NA 2YUNA 4C2UA 3SLCA 2O8XA 2W04A 2W41A 3O9TA 1VQ4Q 4YEJA 3GTLJ 4BDYA 1NE8A 5CIUA 4QVDA 5GIPA 1NGFA 1UHSA 1Z6TA 1KVBA 3HUGB 1YX3A 5MLCQ 4KBMB 1RUOA 3B6PA 5HDNA 3NVMA 2OTLQ 3AV9A 3DLBA 1I6HJ 3B8AX 3VS1A 4I98B 3M57A 4E9GA 4C30A 1JKHA 5D6WA 2VN2A 4J7IA 3CERA 2QKBA 4PA1A 3IH2A 3OSFA 2R7VA 1E17A 4PLIA 4KRFA 2K27A 1PU8A 1Y6IA 2L3SA 1BBYA 4PJOG 4FVMA 5GAOm 4QS7A 4J8FA 1RBSA 1KYWA 2LDUA 3K59A 1VQ7N 3PFYA 1S72N 5CYVA 2M0MA 1ZG3A 1E0EA 4JZ3A 2BIVA 4M78F 3LFKA 3PTAA 2CP2A 4J9CA 1N8RR 4PJOC 5BS6A 1OULA 2KRCA 3M5RA 1WHMA 5A2QK 2LLKA 4BI3A 2R0QC 1H0MA 1ARKA 1UJYA 2Q31A 1NWKA 3VQDA 3VKIA 4ZJZA 1CGPA 1A36A 2HDAA 2K9GA 5LY3A 3NAEA 3WT0A 4JK7A 4AC0A 2DTZA 3FDRA 5ELZA 1XGMA 1WHKA 4KH5A 2IIRA 2HWVA 4OAZA 2DXCA 1NGBA 5EG0B 1SFOJ 4JRKA 4C0DC 4OINF 2MMPA 1D1BA 1MJ9A 1WQ2A 3CCYA 1Y97A 1U5TA 5KYUB 2FRWA 3ULDA 2QI2A 1VQ6N 3SWNC 4L3QA 3CCVT 3CCET 2IA0A 5JVHL 4FLYA 3SYZA 3TSQA 4JKGA 3NMUA 2MC3A 3KP3A 5LEKA 3KX2A 1YI2I 2WC9A 2OPSA 2XICA 1UHMA 1Q86O 3H1QA 5AQKA 1DP3A 4CGIA 3JAMO 3VGKA 4CJSA 4O8UA 3H08A 4BBRJ 5IYCJ 3AVKA 3SEMA 2XSJC 1RL2A 4M78A 1VQ5T 3JB9I 4DKWA 2ZXIA 3FZVA 3M0UA 1OQKA 1BOTO 4HNTA 5IH2A 2M9UA 4XIUA 5KAFC 2CSIA 4JS4A 2L2PA 3IH7A 5CZ1A 3DM2A 2NOZA 4XLCA 1CXQA 5FRNA 2RAEA 1T7PA 4KTWA 3TABA 2BTFA 1SKWA 2CWEA 2JVGA 4XLPF 1G15A 1J9IA 2OZUA 4UVAA 5C0MA 3J7ZI 1QCFA 2RKHA 4N4NB 5ED4A 3BDPA 1NK6A 4CK2A 2QA4N 2HOTA 2HD0A 4OVAA 2Y90A 2A08A 4CEOA 1FTTA 1UHWA 1BISA 2EQUA 4I9LA 2E34A 4OPKA 3EL2A 2XAJA 1TU0B 2DOEA 5F0HA 4RGSA 5GAGJ 2F2XA 1N3CA 3T19A 1IBKK 3ZN1A 5E3MA 2ITMA 2MI6A 2PZSA 3A1YA 2HBKA 1XC3A 4B8CA 4ZDPA 3HRUA 2E1MB 2L7MP 2JRTA 5K5RA 3HJEA 1YJWA 4DQSA 4CHUA 3HTUA 1QQNA 3J7ZO 3CYMA 3CCJI 4KKOA 1MD0A 4ZTFA 4Q5WA 3CUQC 1W0HA 2VQLA 4M77B 4CCHA 3QOPA 4FJGA 2HBLA 3DMJA 1K73U 3H3UA 4Q4ZF 2FSNA 2BE9B 3LSKA 1FOWA 4W5NA 1LE8B 1WSHA 3KEOA 3OS5A 3I55A 3E6MA 4C1NK 3OMGA 3I3LA 1T8IA 1VQLT 3S8PA 2X4HA 1I3AA 3OY9A 5FLXE 2XY8A 5KAIC 5AQOA 3CCJQ 3OMYA 1PCXA 4B9NA 4E70A 2GM4A 3OL4A 2CT3A 1IXDA 1XMQK 1GCQA 2PMZN 5CVRA 3C95A 4J5YA 1P90A 4DV5K 1IJJA 1IV8A 1S1UA 5B3SH 2LKPA 1LWYA 2MAMA 2XAGA 4HX8A 1UELB 1K73C 5FDLA 3QEVA 3I4NJ 2EHGA 3CIPA 2YXYA 1P9QC 2A40A 3C6TA 4XTVA 1JE8A 4AIHA 5CHIA 5K7HA 4KREA 3VEPA 3C65A 3HOWJ 2NVQJ 4FETA 4M74A 3MWMA 1AD5A 1TK0A 5IY5H 3JSPA 4FLUA 3QERA 1N8RU 3CDLA 4XM3A 2WAQA 5IT9Z 3DEUA 1WJCA 3HOVJ 4K11A 4JI1K 3U9DA 1TT5B 5LJ3e 1LDJA 4AHRA 2IW5A 4Q5VA 2MSYA 1NLOC 4CGHA 5AQLA 2EYZA 1P7IA 2DXBA 3S93A 1H641 2QF7A 2X1EA 3J7YJ 4A3DJ 1KFDA 2Z0WA 3RKQA 4IDKA 1ON2A 1WX6A 3FMRA 2OYQA 1N8RC 2H27A 3NFCA 4AFUC 3G3ZA 4HT8A 2IS3A 1N25A 3W2VA 2RGVA 2WBMA 4LDUA 5I42A 2OTJA 1SKRA 3O5BA 4IL6C 2CRGA 3HYIA 1LCUA 4PHTX 4B1RA 1CF7A 1J5OA 2FF3B 3LM2A 3BT9A 2DMUA 4WFBL 4UB8C 2YNGA 1R6RA 1RFQA 1VSLA 2P8TA 2DMPA 2KFZA 5LJ5j 1K61A 3ATVA 1ZKGA 2CV2A 5GINA 4DYRA 1LMZA 4I01A 2QWLA 3MX5A 3M1CA 2OZMA 3KFWX 1VQNI 2KXDA 3WNEA 3OYCA 2A07F 3HB9A 3EE8A 1Z91A 1ZQ3P 2DBBA 1KU9A 3E6CC 1HPZA 4RWTA 1QQOA 2PI0A 4GLKA 5EVZA 2KFNA 5FO5A 4P1WA 1YO5C 3WHBA 1QVGP 3BDDA 3QNNA 4F7ZA 3BR6A 9ATCB 1UGPB 1IBLK 3EUAA 2HAXA 4KHUA 3M5AA 2D1VA 1DTTA 4G12A 2YSRA 1WPKA 3HOYJ 5DCMB 2AKKA 4CC3A 4U0YA 5KYNA 1RUNA 2XRIA 3CFOA 4XU1A 1WHUA 4L5EA 3NQOA 4MQ3A 4QSHA 3FHFA 3LDPA 1QCOA 3RZOJ 3KWGA 3WNFA 2KAFA 3G71A 4EFHA 2FBVA 3KBGA 3CP2A 4XH4A 3THWB 1RKTA 1RIOH 3TSPA 1I3QJ 2LCSA 1YTYA 4JLGA 1ZTRA 3V9XA 3VQEA 1BR1A 2IA2A 1E3MA 3QXEB 4AH9A 1M3CA 3LP3A 3OYIA 3OW2A 5C0YA 4HHTA 1KG3A 3I56A 2KK4A 4XICA 3KTUA 3H3NO 1QVTA 5CQEA 2JS2A 2DPNA 3ZX0A 2HW3A 4C8QG 4GKJK 2R7DA 3EGXA 3L2CA 4KH0B 3WG7H 2L9RA 2OFIA 4M7AD 4CZGA 3A8GB 3R8EA 1UUEA 1BWFO 2YKNA 1Q82R 4AYBA 4IXCA 1ZLMA 3C7NB 2FG0A 4HUEA 4JV5K 1IDZA 2GOXB 1EO1A 1X01A 2ZKZA 4EGZA 1ERDA 4MFDA 4UUTA 2GFAA 3CC2N 3LL3A 3MQ0A 1ZGWA 2NVTJ 1XQSC 3CCLI 2NWMA 4BJTA 1UGVA 4Y1CA 1OCZH 2RO0A 1LOTB 4QLCU 4DSIA 4W97A 1HW1A 1F1BB 5AQTA 2RN7A 2HS5A 2KIFA 2O5RA 3HSBA 4XLFA 3VA0A 3IG1A 4OMYA 1U2VB 3RDIA 3QPHA 1KU7A 2QXFA 3I53A 2O8DB 3NGYA 1WEIA 1WH7A 3UNGC 5GJVB 4OPHA 1VQ7A 1X1PA 3CCLQ 1BBZA 4GO1A 3QBWA 1JUPA 3EG2A 2FZKB 4RCCA 4K25A 3OVNA 1S72A 1T3SA 3EZWA 4ICLA 3H0IA 4CECA 5LL6S 3DQVC 2E64A 4M77C 2R7OA 3EG0A 5EEHA 4DJAA 2HSTA 3ROUA 3CC7T 3RPQA 2Z2SB 4CFCA 2OPTA 5J2QA 1WEGA 5ILVA 4BY9C 2QASA 4FJXA 2L3QA 2RHXA 5H6QA 2P5KA 2B86A 3ABUA 4Z4FA 2HNIA 4MQ9F 2M5WA 1RBUA 3K2PA 4MTEA 4M3BA 2QTXA 2A61A 2PBIA 2WB1N 2KBTA 4FIBA 2H1LA 3PIPF 3DEEA 1PUFB 4FU6A 5KYYB 4CZCA 5KYXA 1IO2A 2GXBA 1K4US 2RHYA 4XTZA 5IP7J 3EH2A 2H09A 2R5ZA 2Y48A 2RF0A 4PJOD 5LHIA 1VQ6A 1ZBSA 4BGBA 3KLNA 1EA3A 2LQWA 4J7FA 4PJNA 4DR5K 1D5AA 3ZMDA 3K2ZA 1Z3YA 4OKEA 3C18A 3O3HA 4FPAA 4NO7A 3CW7A 4KB1A 2ZJ2A 4DS4A 4AM6A 3QEWA 3HKSA 2PJRA 3EY1A 2B9SA 5JHFA 4HVJA 3REBB 3NGZA 1ABOA 1POGA 2F2VA 3GNGA 2L9NA 4B48A 2P5LC 4LG0A 4IZZA 2L5QA 4M75B 2HVHA 2WY7Q 3TSUA 1ETQA 1BI0A 3CWTA 1OX9A 3ONQA 3FMSA 2MYSA 3CQXA 2AZVA 5E3NA 2CH0A 3K57A 3GTQJ 1IF1A 1TWHJ 3ZMTA 2DILA 1KRPA 3J7AO 1GBQA 1SF9A 3UB5A 1YQKA 1NJIU 3F5TA 3UWNA 2W03A 3GTJJ 2UXCK 5J1UA 2AZSA 5ERIA 3CXCP 4OPAA 1BI4A 1BC8C 2DYIA 3J80E 1YWPA 1RAFB 5F27A 4Z6YA 4BG9A 2MH9A 3PIPA 2P5VA 1KQJA 4DQIA 2LMJA 3KZYA 2AHQA 2X51A 3VOEA 1WSJA 3KLOA 4F55A 4AF1A 3K4JA 4H4MA 3RIRA 2ESHA 4XH1A 4FOEA 4NC6A 1MNMC 3T1HK 1RI7A 3FXJA 3LWFA 5GMKl 4UUSB 4MO7A 4DYQA 3LSIA 4XOTA 1VQPN 1EFNA 2KFDA 1X1DA 2XPUA 3BR2A 1Q82U 4EZ6A 3LQQA 3K5OA 5FWCA 1QVGA 2QWRA 3AVFA 2XV4S 2P0QA 3G1MA 2J6FA 1ORPA 5FLVA 2RNJA 1SVLA 5KH6A 5AZIB 2NRTA 2ZC2A 3H3VK 4RTVA 1K8KB 5IT9O 3RWUA 5F1JA 4CJ5A 2W40A 2ZNYA 1YLFA 1BL0A 3WNGA 4DHYA 4LB6B 1ZRCA 1HJRA 3H36A 1ZSZB 1SFKA 2JWLA 4DOVA 1Q82C 3BJOA 3FZLA 5J8CA 5CPRB 3DOKA 4B6MA 4EJOA 2ASMA 1Y64A 4CEBA 3C0CA 1JTYA 1ATNA 1JO8A 3ML6A 2UXBK 3HRGA 3ER0A 3K1NA 5FLXZ 4A63B 3L1AA 4PJJA 3OS2A 2LKSA 1I5ZA 1JQQA 2F9WA 3N4MA 4I7FA 2QQRA 1YUWA 3CM5A 2MCNA 4B47A 5BPIA 2V8IA 1SAUA 2JT1A 2VUMJ 3TPQA 3SPZA 1TL3A 2FZGB 1H3HA 4DOZA 4ESFA 2DT7B 4KTQA 3VB2A 4A3FJ 3CPWA 1I39A 2JUGA 2PMHA 2AK5A 1LB2A 3GL1A 3EHRA 4C92B 4XTYA 4Z4EA 2JUCA 3OW2S 3FLGA 2RDPA 2JM8A 2NOHA 1ASVA 3WEEA 3ALYA 2QBYA 5FKOA 1LPLA 1S7AA 2E71A 1CXUA 1HKCA 1Y8QB 4PJLA 1M30A 3CCRT 1U2WA 3K5MA 1FLIA 4DEXA 3AAPA 2KRSA 1XDSA 3SUPA 1B34B 3I5UA 3NGPA 2ZNZA 1E4GT 1T05A 4KGXB 1L5UA 2C0TA 3PT9A 1ZA2B 1FYNA 3VQQA 2PQWA 3VRZA 2VOPA 5F0XA 3OA9A 2L3RA 3A4CA 4B9UA 3F0ZA 1ORNA 3KP5A 1JLAA 2IAIA 4M9SA 5AQGA 1I50J 3ZMSA 1SL1A 4AQYK 1RAGB 3RSEA 1VQLA 3OJSA 2JLEA 1KC8R 1NG9A 1OYXA 5KPZA 3X28B 1R7JA 2FSJA 4CF2A 3KK1A 3LALA 3K10A 1YIJN 2CQKA 3EFRA 3OYHA 1NK9A 2EFQA 4FJ5A 4CZFA 1KG7A 2LJ1A 1U48A 3TAQA 3ITHA 1K8AO 2AQFA 4BUGA 4EA5A 4DBQA 1J59A 4CJVA 1N6AA 5KI6A 2HMPA 2XUBA 1VYTA 2W6KA 2E10A 5CLSA 5HROA 1ON1A 5I2MA 4JRIA 5HNFA 3QP5A 2MG4A 5HL7L 4EM0B 2V9VA 1MHNA 3ULRB 1MBFA 1N77A 4CCNA 1Z25A 2BDPA 3H0GJ 4FWOA 4YHHK 3AVMA 4IXAA 2NOBA 2DYRH 1CQTA 5CCAA 4CHQA 1NKCA 4BGDA 2PFBA 3EGDA 4IUVA 4L6V5 4OLAA 4M75G 1N5YA 2RVCA 3TAEA 1SD6A 3ZYYX 1BC7C 3WVEB 4IUUA 3G6EA 3BCBA 1TXQA 1T98A 1R0AA 4TV7A 2O9LA 5FB2A 1QVFM 4M75C 3ZBDA 1XMAA 1KQSM 3EUHA 1KG5A 1VHXA 2OPRA 2K7AA 2IS6A 2M2EA 2PU9B 2L7FP 2IA1A 1TQIA 4PL6A 2UXNA 2DTRA 2Z9OA 1PU7A 1D0XA 4KGVB 2ROLA 3GTMJ 2XAHA 4FWPA 4A0YA 2GQQA 3L7WA 1TQMA 1KO9A 5CVUA 4LD0A 4M7AF 3OTOK 3CC2A 2OAUA 2DY4A 4ZZLA 2HYGD 3ZX3A 1QQMA 3RJPA 3CXCA 4F93B 3GTGJ 2XGCA 4QAGA 5IAYA 4FXDA 4A3MJ 4EV0A 2ZMEB 4GGGA 4RG8A 2FU4A 2XIDA 2JNGA 3CLQA 4RTTA 5DM7R 4GV3A 3RUXA 1WBDA 4KMFA 5CQXA 2W42A 1TWBA 1UZCA 3H9JA 2A0FB 4UNFA 1AZGB 1NGEA 4HEA2 3OYEA 4C8QD 5AIQA 2R4GA 2GTDA 5B5EC 2JSCA 1R0BG 3B6OA 1VQKT 2FZCB 2HVSA 3JYTA 1S3JA 2HVIA 3NRVA 1X1AA 1BA1A 1KQ1A 4AVPA 1XMKA 1Z05A 2XASA 3CCUN 1XCBA 1U3EM 3N4PA 2FPEA 1BHLA 4Q0BA 4PSWA 4CI0C 4HV6A 3MN5A 1Q81O 1WYXA 1OQYA 2J7IA 3FBIB 4XONA 2ASPA 3D5LA 3LAJA 4HG2A 3WUHA 1NOYA 3QODA 3A0BC 1YCSB 5C10A 3VEWA 4XSZF 3M8SA 3H45C 4BC2A 5AQPA 4NQWB 4C23A 3RMAA 1VQ8I 3FXUA 1QVGS 1EZZB 2ZGZA 1SSFA 5CQGA 5CKEA 2RKIA 4M7AA 4ESRA 1VQMN 4EW4A 4JN4A 2A3SA 3JV3A 1IN4A 2YHBA 5EY4A 3DJCA 1ZELA 2Z1JA 1LEBA 4ASNA 4C92G 1HOMA 4JI2K 2QA4T 2WTEA 1AT1B 4RW8A 1UG0A 2NOGA 1CZAN 4HVVA 5H1SQ 1MV3A 1OR7C 4KI4A 1W36C 1VQON 3SEZA 3OOPA 1Z9ZA 3HSCA 1K6OA 1GOBA 2VC0A 4CZMA 1T03A 2NUPA 5K5OA 1VQ8Q 3THXB 4UV9A 1HU0A 1UGSB 2DA3A 2ME0A 1SKUB 2ZXWH 2D1HA 1HMVA 2YX4A 3I9QA 5GAMf 5HNHA 1FP2A 4E7LA 4BXXJ 5LRSA 4L5IA 3PVLA 5BPLA 3T3FA 3B73A 2OJED 4B44A 4X1VA 1U04A 4JRQA 4EATA 2LSOA 1NGIA 4XU3A 3ECHA 2XKOA 1WJBA 4LN2A 1KC8C 2E6NA 4XKCA 3ZQ7A 4LF8K 1M90R 4KFCA 1KHCA 4JKEA 1VQ4N 3CPWS 3VYGA 3IRRA 4RS8A 3QG1A 2O8CA 1M1KR 5GAMg 3H0DA 4UY8O 2DMQA 2X78A 3KYCB 4J00A 4BRHA 3X25B 2JA6J 1MW7A 1HNWK 2WV0A 4O3MA 4HVWA 2OTLN 2D8HA 2M0OA 4M7DE 2V8JA 2CW7A 2X4WA 3SAHA 1YJWQ 3J80Z 1VIFA 4II1A 5JS2A 4UQGA 2HQEA 2YUOA 3I59B 4F3QA 1BN5A 4QT7A 3VS7A 1NJYA 2DA4A 2JS0A 4C5IA 1NGNA 1UWBA 3RMBA 3DBHB 2M4GA 4HSTA 2YX7A 5FLXO 1MIJA 5GPAA 4Y0WA 1Q7YR 1WJDA 4I6MB 3UT1A 4GNIA 2VV5A 5IWAK 3PIOF 1U9OA 3CMET 4II2A 2RJEA 4NB4A 1SVMA 4PJOA 1VSDA 4RTUA 3DLAA 1VK0A 3IS9A 1VUBA 5M1OA 3AG4H 4GY5A 5CHZA 1G3TA 3BR3A 3ABTA 2JA7J 2CS3A 2QLZA 3WTVC 3OGDA 1X6GA 4LSNA 3FISA 1RLQC 3AGKA 1X27A 2QWOA 3CC4I 2CUJA 5D6YA 4OVLA 2MWOA 4CA0A 1Q1HA 1MKMA 2FF4A 3HGGA 2C06A 4PJOE 4JEPA 4QIWN 1IW7F 3K0LA 2W4SA 1VQ9I 5IT9K 4XAXB 2JOYA 2P4TA 3DCFA 3ZQLA 1YITT 2JPSA 1OVYA 5HRSA 1C0UA 5M3FJ 2OCEA 3WXMB 2A6TA 2OTJI 3OYDA 1BKBA 5D5VB 4BRGA 3ZXSA 3SWNA 5IHIA 4D8DA 3CC4Q 2YCHA 4CEAA 3DP7A 4XQ3A 2DTIA 3VQ9A 3JXUA 5HLHA 2I2LA 4AFQC 3LSPA 3BY7A 5DYMA 1PP8F 1WXBA 5BQTA 5E84A 4CZLA 3KVGA 1VQ9Q 3FHGA 3K9KA 4DG1A 1YNZA 3L42A 1VOMA 1ASWA 1HXDA 4BD3A 1WHGA 2MWPA 2VYTA 2OTJQ 2KZMA 4LNPA 3HSFA 4RG2A 4HLXA 3FC3A 5EGOA 3V8KA 2M34A 3GBTA 2WSCE 3MXIA 2E8AA 1BW5A 3LWMA 4KH6A 4FLXA 1KD1U 3BR5A 4KN7X 4Y28E 1FBSA 3UKRB 2K5LA 4DQRA 5FPDA 2ZMEC 3Q3SA 3DLMA 1C6VA 5A0DA 1O75A 2IAJA 3HSRA 4FVUA 4JJNK 3JSCA 2NUTA 5IHKA 1KXPA 3TEEA 3QETA 1NOZA 2Y2ZA 4C0GA 2OPQA 3A98A 4MDXA 2DO7A 1IB8A 2O8EB 5L3DA 2HNYA 3U9GA 1EX4A 2O6GE 1KD1C 3HTRA 3G71I 3P31A 1U49A 1RT1A 1Q86R 2VODA 3L3VA 3CXCS 4F2RA 4JUVA 2RQTA 4MMKA 4DF4A 1OCCH 3EE9A 2BY2A 1OU9A 4BRDA 4C0FA 3A02A 4JKDA 5C25A 4B9VA 3FIWA 4E7ZA 2L8DA 1XC9A 1RDDA 2ISZA 1YIJA 2EJGA 3VUBA 2A6EF 3OBWA 3KNTA 3G71Q 3SMSA 4YORA 4JHDB 1P4XA 1YJ9T 1YHQT 4FK2A 1LJ9A 3BR1A 3CUQA 4AILC 2VJ5A 4CC4B 2O8FB 2QQBA 4OGEA 3UKGA 4O55A 3DRSA 4E7HA 4V19K 2BUDA 2ACJA 4OMFB 2RD1A 2F4VK 1B72A 1PVEA 2QXLA 2FQ4A 1G5VA 3TQNA 4RB3C 4CEEA 1CKBA 5K7FA 3SB2A 3DAWA 1NG2A 3FZFA 3I0WA 2A3LA 3CCJN 4Y1DA 2EA2A 4AHTA 1Y57A 4Z0UA 3IDHA 1X4OA 1N3AA 4FYDA 2D0CA 4B23A 1U5SA 4H0VB 3TWHA 1XCVA 1IV6A 1W5SA 2F1LA 1R23A 3WGGA 4RM3A 2J5OA 4PQUA 4EDUA 1D3BB 2H1KA 2RQQA 3OV8A 3U9ZA 3JRHA 2DFUA 5CJ9A 3DB3A 5HRPA 4ZGEB 3LWHA 1HPMA 3KFVA 5DM6F 4L18B 4HOBA 1N5ZA 4XN3A 4PNOA 2DDBA 2Z1DA 3BTCA 3MP8A 2ZM6K 1OKRA 3WTYC 2JJ9A 3DKWA 1HNVA 4YY3K 1I1GA 3EFSA 1X1BA 2MC4A 3JSOA 4FLVA 4WK8F 3HUGA 2PNIA 3WQTA 1YN8A 1WGXA 1I27A 3FJ5A 2QGFB 4JX6A 1PC0A 2JJ7A 1H3ZA 3P7NA 1QZZA 4CCJA 3EG1A 2P9LA 2VT2A 3GPLA 1D0YA 3ID6A 2ECBA 3WGIA 2FVUA 1QWEA 2CH4W 2RQRA 2DL4A 4M75D 3ZETA 2YU3A 3O6WA 4R1HA 1Y07A 1P7JA 1AA7A 4GRIA 4BS9A 1B7TA 1QCNA 5TKWA 2E65A 3MZYA 2CGLA 3NDKA 2DA6A 2DXUA 1WHLA 2CP0A 2BE7D 4XU2A 1FKPA 1HKTA 3TI0A 3R6MA 2W0ZA 3C0BA 1S1XA 1LFPA 1LW0A 3LZIA 2FJ1A 1HKQA 1AZEA 4E19A 4JK9A 1O57A 4FZZA 4KICA 2HF4A 2VQCA 3SPYA 1Y1WJ 2PUKB 1LKXA 2RV8A 1QS4A 4FPBA 2E88A 1QPMA 4C8QF 4EVVA 4YOQA 2Z16A 2L9SA 4CJRA 3VYRB 3HM8A 1QA6A 4D5CA 5HRRA 3E01A 3L09A 1N27A 2F6CA 3VQ8A 3SAGA 1WVRA 3N5NX 4L5JA 1D09B 1Y8RB 3IH3A 5EG0A 4LJZF 1WJSA 4DQ2A 4RGUA 1VQ6Q 1VQNN 5KN9A 1NBWA 3S3OA 2DT6A 2VI6A 1S9GA 1SANA 1FEXA 1JLBA 4BE1A 1YFNA 5GAN7 1QKWA 3JCMf 4MGRA 3EEQA 1VQMA 5KYUA 2CGKA 3EPZA 4KMUX 4A4FA 4MZMA 2JZ2A 4E9EA 4B3MK 4N0BA 4Z4CA 2F5CA 3F9KA 4FT4A 1EKEA 3QDKA 3SAFA 3VA3A 4IIMA 1X6OA 2EQIA 2EVRA 4LFUA 2A36A 3AA2A 1NM7A 3N97A 1RAIB 5B1BH 3JCMg 3NTHA 4RGXA 4PKHA 4DSFA 4JS5A 2O01E 4HLYA 4HWIA 1SUQA 3RR8A 3VYUB 4H4OA 3J80O 3X26B 1REVA 4IRIA 4O5FA 2Q0UA 4ZYHA 2EFNA 3HP9A 1WRJA 3RTVA 2XDBA 1IKXA 1YW7A 1Q86C 1K78B 4ELZC 1KHIA 1QZ6A 1VRTA 1OH5A 1TTYA 2EKHA 4C8QA 3G0ZA 1YS6A 3CCVI 1PG5B 3CCEI 4FX4A 3VQAA 2X3XD 3TCJA 1XUPO 3BTIA 3GEZA 4F3TA 4C92D 4QQGA 4TVRA 2OTLA 2AP1A 3LP1A 5BN8A 3V42A 4A0ZA 3QDFA 2IPQX 3FM5A 1YP5A 2AIRB 3U1DA 2R57A 2MLGA 4MIMA 3GFMA 2HSEB 2RN8A 3OYKA 3VERA 1ZAOA 1VQ5I 4FL9A 3GCMA 3CCVQ 3CCEQ 5E41A 3F8NA 4R8HA 2EIJH 3O4NA 5IHNA 1AHJB 3C2GA 3JRFA 2K86A 3CCLN 3NTIA 1SAZA 1E2XA 2EH3A 2HQNA 4LG3A 2FRHA 5H6RA 2G9WA 2ISYA 3ZT2A 2OPPA 1G4DA 3FXKA 2P0WA 3J7AY 2KROA 4MTDA 2CP6A 2DFHA 3SNNA 2L7ZA 5KGWA 3VENA 1VQ5Q 2VL8A 2KQRA 1W5CC 4I0AA 4RTWA 5FLXK 3OSSC 2ECCA 1LE8A 3LSRA 4RMNA 3S17J 3K2AA 3VQBA 4EP4A 1TG0A 1HRHA 5GANd 4CJQA 1IRXA 4DFMA 3UKUB 2E2JJ 4F7UE 3JB9F 2QSFX 2G8IA 4UUVA 4M3ZA 4B24A 3AGRA 3FZHA 2B7EA 4M77E 1JJ6C 4PKGA 5CVIA 3TO6A 5M5YJ 2LC4A 4JAXA 2O9SA 4XOPA 2P6SA 4G7OF 3DXKB 1YBYA 1W9HA 2CZ7B 3LDOA 2COBA 1ITYA 1UCRA 2COMA 3C7JA 2HHTA 2FHDA 3I35A 5GAOl 4BQAA 2D0QB 2ZPGB 4MLHA 2VWBA 4EJUA 4A3BJ 2P7CB 3W3CA 3QEXA 2VXZA 2QQ9A 1IKWA 2XG8D 2STWA 5J3LA 1O4XA 4A3GJ 1VQLI 4GCVA 4J8OA 2LRDA 1BG3A 4BXUA 3OYNA 2MLKA 4DV7K 2XY7A 4S04A 2J5PA 4AUXA 2C0IA 1M8VA 1RBTA 3SDBA 4P55A 2IGNA 3PIPL 2KEAA 3BF1A 3Q7CA 1U0JA 3TARA 5KYWB 2VQFK 4A3KJ 1YI2A 4XL9A 1B07A 1S6QA 3KYDB 4BQLA 4IOXA 4BR7A 1Z21A 1B3QA 1VQLQ 3VQ6A 3MZHA 5HS7A 4ENJA 1M1EB 1BOBA 1SFEA 4ME7A 4C8OA 1MJAA 1EH6A 4DR6K 4YFXF 3S14J 3META 3V7RA 2JA8J 4GMJB 3O3GA 2VJIA 1LQ1A 3K4LA 2O2OA 5D6EA 4G94A 3QSUA 4Q47A 3GTPJ 3P9KA 2E5NA 2AHJB 5LJ5d 2Q2RA 3E1SA 3CJNA 3FHNA 1YRNB 2RPNA 3TOBA 1Z6RA 3VFZA 3K5LA 4DQQA 1JHFA 2VCPA 4HZFA 4H0XB 1YITA 3E9GA 1R58A 1U47A 4FWRA 4P96A 4HW0A 4DR3K 4WTOB 5GAEP 1RAHB 3U8XA 4ESBA 1OPKA 2CFXA 4B8XA 3EAEA 2ZBKA 3CCST 5DCMA 5KRSA 3ZSXA 1HJDA 2E2HJ 4MMLA 4OGCA 4KA4A 5A0GA 2YU9J 4BRKA 1C0WA 4F3OA 2V52B 4GV6A 2HHVA 2BE5F 4RBOA 1MH4A 3LL7A 3G6EQ 3ZOBA 5JLHA 2COWA 3THWA 2H8RA 2A28A 3CD6A 3WHCA 3ZSQA 4FM4B 1WQ7A 1MBKA 1C6VX 3CCJA 4JK1X 3M8RA 3CEYA 3H46O 2DW4A 3OSGA 1WUAA 2DAQA 3K9JA 4OMOA 3GTKJ 1RI9A 1UG2A 3FR0A 4B3SK 2DEUA 4KNYA 5GMKh 3T7ZA 1T0FC 1Y0NA 2L4AA 4AM7A 3V1OA 2R3SA 4M3XA 3K70D 3CG7A 3SI6A 3TTFA 5DCFA 4OMMA 5I21A 1JTXA 2Y1IA 1X2QA 2DRKA 1IZ6A 4KHQA 3C7NA 3CVSA 4BQQA 3T1BA 2E36A 1E3PA 3BQZA 2E5QA 3HSEA 4KUMA 2QWQA 2CP7A 2D6FA 4LF7K 2Q3SA 3M9AA 5D6FA 3A5MC 4N5SA 1S9HA 3J7AP 2JN6A 1MMAA 2TRTA 2DMOA 1ZRDA 2IC3A 6PAXA 3M07A 4B08A 2AXLA 1NNEA 5HS9A 3U6FA 5GADP 3CLOA 5EG2A 3VYSB 3ZQHA 4NL3A 2K9NA 4A61A 3QJ6A 1C1CA 1XWLA 2VWKA 3FE1A 2JWTA 3DBLB 3E9OA 3URGA 1WBBA 4AHVA 3Q0WA 2LNVA 3A0IX 1U2VA 3TL4X 2O8DA 1LFUP 3AT1B 1GBRA 3I0RA 4R56A 2EIFA 1QVUA 1ATSA 4O8KA 3WODF 5FU6B 2JRMA 2OAZA 4LFBK 1GLNA 2LX7A 3V9WA 3SHFA 3MN9A 1DQUA 4RTYA 1FTZA 1U45A 4PIIA 1LEAA 1J5EK 4I2OA 4KT6A 2NLUA 5I22A 5KNLA 2OAWA 1ITGA 3KZIC 5AQFA 1NGAA 1XG1A 2AXTC 1YOVB 4DMNA 1DPRA 2VXFA 3T8TA 1SD4A 1ZLJA 3H0HA 1LW2A 1HKSA 1RLPC 4CIFA 4Q48A 4Z02A 2YLCA 4FOIA 2E1ZA 1MNDA 2IGMA 4U7DA 3QICA 1Q95G 2KL4A 5HDKA 5F0CA 1VQNA 2PEXA 2VGNA 1U9NA 2ASOA 4BGAA 1QO0D 5KYYA 2WOMA 3FXQA 4OMZA 1QLYA 5T7BA 3SZTA 3DI6A 1XDUA 3VJPA 1HQUA 3CJQB 3HJFA 2A6HF 4H0EA 5CE3A 2LJ0A 1T95A 4DF8A 2HEQA 4EJYA 5LMNK 2Q0OA 3BZ6A 5JLXA 1RABB 2ETHA 3CC7I 4A5BA 2HDWA 3DOLA 5AR0A 3DV8A 4FSSA 3M8PA 2NOEA 1MUDA 1VYUA 2FB7A 4CERA 4ZN1A 1KAXA 1Z9QA 1C0GA 1RDBA 4OMPA 1N78A 3CQ8A 4XKBA 4QPQA 2EFIA 1KSWA 5FPNA 5LHHA 3C6UA 1P92A 2PLYA 4N4IA 2YHXA 2CYZB 2E1CA 2D1KA 3SUQA 3KETA 5JS1A 3J81E 3P8BB 1R5ID 1MPGA 3O9UA 2VBWA 4ZGDB 3CC7Q 1V1CA 4LF9K 2ZJQF 4V2FA 4Z94A 4OIPF 3INZA 3CDHA 1FOXA 2M7AA 2O0YA 4DCHA 2EKOA 2XF7A 3J80K 2F69A 1UA1A 1H88C 4MO4A 2RHIA 2FPDA 1NK8A 2HYFA 4LF5K 4M75E 4G9YA 1UGQB 1XGOA 1ZG1A 2HOAA 3O80A 2M1HA 2R7TA 1RACB 1X3MA 2R7QA 3FX3A 3OQ5A 2NRWA 4I6ZA 3SQ2A 2H56A 1IRZA 2CS7A 5KN8A 4RCBA 1R1VA 1USTA 2XU8A 2XI9A 4FWNA 3JCMX 4C0ZA 1ZQ1A 2K5CA 4F16A 1KA8A 1NZ9A 4C92F 5IT3A 5M3MJ 3HL2A 3RPUA 4LIVA 4F14A 4UUSA 3I58A 1IXCA 1B9NA 1BQMA 1AHDP 5LJWA 4J83A 2JGUA 3CCLA 4JI8K 3N0UA 1ZBXA 3AKZA 2JK3A 3LM9A 1W2BP 5D3GA 1MH3A 2IGIA 3ZN0A 2PFUA 4LD6A 3J7AF 4CJLA 1FYKA 4HT9A 5TGTA 5AZIA 1XTDA 4E2FB 4B3AA 1RGIA 1R49A 4XRSG 1GFDA 4RMOA 4FHTA 3M8JA 4PK4A 2VASA 3PSIA 2KYBA 4UV8A 3AAFA 3PV8A 1NK7A 2HBJA 3TKYA 2DJNA 3F8BA 1ZSZA 4Y4RA 2LOOA 3VYHB 2HR3A 2O61A 2E2PA 3FFKB 2DRMA 2L0AA 1ZHIA 4OOIA 3L00A 3MN6A 3WTTC 2DI3A 3TAGA 1SEUA 4MFEA 1JL2A 3GTOJ 1A5XA 3TTCA 4F91B 5FGMA 1MNEA 5B66C 3LH5A 2O3FA 1GVJA 1R5HA 3IP4B 3M3YJ 1YIOA 2XRNA 1KK7A 4ETSA 1SPKA 1D1AA 3SZ2A 4RB2C 1Z1DA 4CHOA 2JTFA 3BFMA 1OR7A 1Y7XA 3P8HA 3OYJA 4IIOA 1WGSA 1VQ8N 5F2RA 3GMEA 2R5YB 1JLQA 4NYNA 4C92A 3OIOA 1CKAA 3VSKA 1CSKA 2BW3A 4GW6A 2UZKA 4E7KA 1Q81R 1O3RA 1IRFA 2QYOA 4JYAK 3AA5X 3HKZN 3U2RA 5GMKe 1KAYA 1MSEC 1KAZA 4C8MA 1M1GA 4ABZA 3S32A 1FJLA 5E17F 4A3LJ 4YOWA 5AFUH 4C1NI 2D0PA 4AHCA 2PBDA 1LWVA 3P8DA 4CJ7A 5AQJA 1B34A 4DYCA 1RT4A 2DL3A 2G8FA 4JZ4A 1ESVA 3KWIA 4B9QA 3QINA 3CI5A 4XR6A 3A2KA 1RT3A 4M78B 4BG8A 3B02A 4WQ5C 3CJ7A 5FU6C 4GKKK 3SUOA 1WWXA 2QKLB 5ECAA 3VGMA 4A3EJ 5SWMA 2V51B 2FMYA 1JKOC 3JCMc 4FM1A 1NYFA 2IS2A 1YQMA 1MBJA 4NL2A 3MKYB 1B59A 3BG5A 1JJ2P 3R0AA 2DDAA 1YJWN 2YRDA 1HSQA 1TWCJ 1J2XA 3VGLA 3MPUB 2FXAA 3EYYA 3VETA 3E6BA 2R7UA 3OH9A 3RMQA 2ZF5O 3M8FA 3TP0A 1AVZC 4LGWA 4IUTA 3PX4A 2FUG2 3OSVA 3ZX2A 3KK2A 3Q1JA 3BEXA 2E60A 1TUUA 3CCRI 3M54A 4FCYA 5BRFA 3F22A 1KTQA 3FZKA 5L3BA 3V6DA 1JB0E 1PRLC 4WE1A 1W0TA 3PLAA 2E7XA 4HAMA 4CD3A 2QAZA 2P0PA 2HVRA 1J54A 2M1BA 4CEZA 4N76A 4EMKB 3F6OA 4J6WA 1RT7A 3CCRQ 4C0DB 3F9MA 2HHXA 2E1NA 3GXOA 1T56A 4DSLA 4IBNA 3CTAA 2DCEA 2QK9A 2XF6A 4CBXA 4MLEA 2KDZA 4RM2A 1RT5A 2P0KA 4CSWA 3JCMV 4ZYGA 4HTLA 2K3PA 2YRCA 2Z3YA 1XN7A 2H8HA 1K73O 2WAQN 1YWOA 2L3PA 2CSQA 2P1JA 3CJTB 2BY3A 3PIOL 2M0CA 3CC4N 2XY6A 4U0WA 1JKRC 5F04A 1OCTC 1UE9A 2K3XA 4HDVA 2YUPA 3MEUA 3K6GA 2E5ZA 4LC9B 1FY7A 1VQ9N 3FXMA 4E6KG 3Q5FA 4OAYA 4CGFA 4U0VA 1O3TA 1DPUA 5D4SA 4WQ4A 4B1ZA 2RHZA 4A3IJ 3WXJA 2OTJN 2R5AA 1SKSA 2E1OA 3MEXA 4D7MA 2MH2A 1ORKA 3REOA 2R7YA 2UXDK 1N8RO 1ZBIA 2EZLA 2EA4A 2NS0A 4FSVA 2OA4A 2ZMEA 3PO3J 3V7CA 3LGLA 4FE4A 3I0TA 3HVTA 2EZKA 2O8KA 5ADXH 1WXTA 2COYA 4DU4A 1VZ0A 1SFUA 4XKWA 4NLBA 1KEAA 2XPWA 4CRIA 3ZSVA 2QGGA 2IS4A 2DK3A 5J6XA 3IH4A 2DFEA 3HP6A 2YHTA 2JHNA 3CQTA 1HUXA 1XGSA 4PUOA 4M63C 3BTJA 5LGNA 2LZ6B 3H9GA 1SD7A 4HNUA 3G4ST 5GAOp 3TGNA 2EYXA 4FW1A 3ENOA 4FO0A 4OX9K 3CCMT 3VF4A 4HYEA 1BI3A 4Y15A 4DGWB 1RUWA 1W2BA 3OJUA 3FK7A 4ELTA 2HKOA 3QNOA 4CUGA 4NLCA 4WCEL 4LB5A 5GAMd 2G8VA 3JCMQ 3ID8A 4DSKA 2F2WA 3K5NA 4FJKA 3ZSZA 2ELJA 5KCHA 3G71N 2ZD1A 4AIAA 3SQ0A 4NQWA 4BC3A 3NWSA 3I5SA 1Q18A 2F8TA 5FPEA 3KTQA 1FMVA 4K0KK 3LP0A 1TT0A 1K9MR 3HXLA 1Q81C 5KQ8A 2VONA 1AKHA 2UUZA 1Z77A 3QZ5B 4BR4A 1QSYA 3E66A 2GGRA 1IHWA 1VQKI 5IXBA 1BDGA 4M7DG 1J5YA 4W5OA 2L54A 1NEBA 3VQ4A 2DFIA 2O4XA 3QWLA 1KFZA 3THXA 2FBIA 4ANJA 2LT1A 1U5TC 2WA0A 2KY9A 4AFSC 3B6CA 1I5OB 1D5VA 2RQUA 1B9FA 4RCHA 3L0QA 4BHCA 2VKDA 3QBYA 3SFIA 1OEBA 1UG1A 2B5JA 2DMTA 1HYSA 2EQMA 4CJPA 3MKWB 5FFZA 1VA7A 2VYPA 1PU6A 4DTSA 3D0SA 2R7WA 4B1VA 2GIZA 1T6SA 1AEYA 1FIAA 5DS9A 5GMKm 4LLLA 4B21A 2X1CA 4I02A 3X20B 5M9OA 3NF7A 2EPFA 1M2OA 4BRAA 4KHSA 2HB5A 3J81Z 4M78C 3EFOB 1NH3A 2JZYA 3PQKA 2QA4I 4H03B 3CBPA 1S7EA 5I3UA 4WF9L 3AVBA 3EHQA 1SQKA 3LDQA 2ABKA 3KCCA 3M0TA 2KT8A 3WXIA 4C2TA 1BOAA 5EZHA 3ULQB 5FKNA 2ESNA 2BY1A 2V6EA 2JXBA 4OLBA 3DLLL 2E2OA 2RQPA 5DDGA 2CMPA 3O8GA 4XIDA 3I59A 3UA7A 3PY8A 2Y4YA 2L7KA 2QGUA 1K9AA 3MDQA 3GOXA 1ASUA 4BJ6C 4CCMA 1JJ2A 3M4YA 2QW9A 2VKEA 1LOJA 2K57A 1X2KA 3LANA 5DM6L 2DJQA 1FX7A 4A5MA 4YFNF 4RTFD 4I6MA 1HDPA 4IO9L 2D5VA 3E9PA 3GO5A 1IN7A 1T33A 2JTMA 5D8LB 4N4OB 1ETWA 4XBFA 3TDZC 4JI3K 4IKFA 2KXCA 4BRLA 4BR5A 1X58A 2JWKA 3QB0A 3CF2A 4EMKC 3CMAT 4YPHA 2DJIA 3H3ZA 3VEXA 3R6OA 3TQ7P 1F36A 2HQRA 3IUCA 4CGGA 5GAN2 4C3HJ 4H5RA 1M2VB 2CO5A 1I1SA 1PP7U 4OPJA 4JD2B 1HYOA 2DAOA 4DV1K 1B8IB 1T6CA 3QYFA 4FK4A 3QWXX 5GAN4 2Z1GA 3F10A 2EV0A 3THVA 4RKUE 4BR0A 3QO9A 3OW2P 2A05A 4FLZA 4BRPA 4PFOA 3EDPA 4XKVA 1S1WA 1KQ2A 4N4H