3OYDA

Crystal structure of the prototype foamy virus (pfv) intasome in complex with magnesium and the insti gs9160
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
368
structure length
368
Chain Sequence
LDAELDQLLQGHYIKGYPKQYTYFLEDGKVKVSRPEGVKIIPPQSDRQKIVLQAHNLAHTGREATLLKIANLYWWPNMRKDVVKQLGRCQQCLITNASNKASGPILRPDRPQKPFDKFFIDYIGPLPPSQGYLYVLVVVDGMTGFTWLYPTKAPSTSATVKSLNVLTSIAIPKVIHSDQGAAFTSSTFAEWAKERGIHLEFSTPYHPQSSGKVERKNSDIKRLLTKLLVGRPTKWYDLLPVVQLALNNTYSPVLKYTPHQLLFGIDSNTPFANQDTLDLTREEELSLLQEIRTSLYHPSTPPASSRSWSPVVGQLVQERVARPASLRPRWHKPSTVLKVLNPRTVVILDHLGNNRTVSIDNLKPTSHQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PFV integrase
publication title Molecular mechanisms of retroviral integrase inhibition and the evolution of viral resistance.
pubmed doi rcsb
source organism Human spumaretrovirus
molecule tags Recombination,viral protein/dna
total genus 108
structure length 368
sequence length 368
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2010-09-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
A PF17921 Integrase_H2C2 Integrase zinc binding domain
A PF18103 SH3_11 Retroviral integrase C-terminal SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2300 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3oydA04
1.10.340.70 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Endonuclease III; domain 1 3oydA01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3oydA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3oydA03
3VQBA 3SQ0A 3P5JA 2B4JA 2A1RA 4AHCA 4BDZA 4E7IA 3O8VA 1RBTA 1UAXA 2FBYA 1VK0A 1IG9A 5CYMA 4ELUA 2DTUA 4IUUA 2E5QA 4N4GA 4KHWA 3AA4A 2P0KA 1WSHA 3AVAA 4K8XA 2RHIA 3KUFA 1BCOA 3ZT1A 1LWFA 2B8AA 2R5MA 4IG3A 4DMNA 1WN7A 2DIQA 3C4SA 1QTMA 4HVJA 4W5OA 4ZHRA 2X4XA 3GOXA 4E3SA 1YVUA 1C0MA 3ZSQA 3WNEA 4IUQA 4FU6A 3D45A 3TI0A 3OYGA 4RW8A 3KLGA 2CKKA 3ZSRA 1D9DA 5KTQA 1OZ2A 5J26A 2A1SA 3QLHA 2GFAA 4BDYA 3K5NA 3OYKA 2GV9A 1LW2A 2E6LA 1RT1A 4GY5A 2BUDA 3LGFA 2D5RA 4OGEA 4CRIA 1NKCA 1UA0A 4DTNA 1FXXA 3BDPA 3PMTA 1WSJA 2RJDA 2VWJA 1TK0A 1A5VA 2Z1GA 4KHNA 1TGOA 3G0ZA 2G8WA 4CGHA 1CLQA 3S6WA 4CJTA 1R0AA 1XHZA 1QE1A 2IS3A 4CJSA 3QERA 2EFIA 2YNHA 5EU7A 5C6SA 1FKPA 3CYMA 3QNNA 2PYLA 4J2EA 1QS4A 3SPZA 3QESA 2HHQA 2HHXA 4B8CA 3IRXA 4RG8A 2WOMA 5HP1A 2HQEA 4LSNA 2M0OA 3IG1A 4QW2A 4AHVA 4DWIA 3WNHA 4FXDA 3V4IA 4CGFA 3HK2A 2HHSA 4FVMA 1D9FA 3PX4A 5C0MA 3CEYA 1CZBA 1LAWA 4N76A 4L59A 1G5VA 4DTUA 2HHUA 2ZD1A 3WNFA 2B6AA 3OYFA 3DB3A 4CFDA 3KK1A 5FRMA 1N6QA 1CXUA 4F3OA 3B6OA 2X4WA 3ZT4A 4HTUA 4EZ6A 5KRTA 2YV0X 4RW6A 1RT5A 4E89A 1XNIA 1SUQA 4KRFA 1IH7A 4OVLA 2YNFA 4MQ3A 4CF2A 4CFBA 5KE3A 5J39A 2RO0A 1L3VA 4II1A 4AHRA 3NGZA 1VSMA 3V9XA 2QQRA 4CFCA 3L2RA 2D9TA 4PUOA 1OYXA 3OB9A 3NH1A 2RHXA 1S1VA 1U47A 2WACA 3AVGA 1WNSA 1WAFA 1RT3A 2HNZA 1KHCA 4N5SA 1OZ3A 3O4QA 1EETA 1TL1A 3L2WA 1S9EA 1TAQA 4E7LA 3OYNA 1BIZA 2RI2A 4BWJA 1QSYA 2HNDA 2NLUA 3HVRA 3VQ6A 1SKRA 3QNOA 3JSMA 3K5MA 3CFPA 4DQIA 4CHYA 4CGJA 3QBYA 3CFOA 3ME9A 2OPPA 4TSXA 5M9OA 4QQGA 4DSIA 1RBSA 4RG2A 1NJYA 2O4IA 4C5HA 1S1UA 3LP0A 2QQSA 1TKTA 2G8FA 4J2DA 3M8QA 1XC9A 4JRQA 2IGIA 2RN2A 4KO0A 4BE0A 3NE6A 1LAVA 2G8UA 5CZ1A 1RT2A 2LTOA 3RMCA 3MEWA 3PMIA 4CJ5A 3MEGA 4NS5A 3NNQA 3VQEA 3TAGA 1Z25A 4CEAA 3MXJA 1VSIA 4Z4CA 1LW0A 1VRUA 2OZSA 4M3XA 2OPSA 3ITHA 4HHTA 4CJ3A 4O5BA 3AO4A 3KLEA 2YHBA 3OYHA 2XK0A 4BD3A 1TVRA 1XI1A 2JGUA 2RHZA 1BISA 2OYQA 5D3GA 3FEOA 4DSFA 4H8KA 4MFBA 1NKBA 1B9DA 4C8LA 1J9AA 4GMJB 4DLGA 4J2AA 2EX3A 3LLRA 4EP4A 3OYMA 3SQ4A 1JLAA 2VG7A 3NTIA 3HPOA 4OVAA 4FLZA 3U6FA 4UQGA 4QQ6A 3VQ8A 3HM9A 4YNQA 1SV5A 5D6YA 3DRRA 4CJUA 4FJLA 2Z1JA 1F21A 3SYZA 2EHGA 3UIQA 1L3TA 2F5KA 2YNIA 3DRPA 4PLLA 3NF7A 4XIUA 4KREA 4B3OA 1KLMA 1MHNA 4FCYA 1S1WA 1IKWA 3OQ5A 3SUNA 4EDUA 4BE1A 3NCIA 2Z1IA 3QEPA 2FBVA 4CIFA 4CF9A 3OS1A 3DLEA 3KLFA 4PWDA 4IG0A 1W0HA 4M41A 2L89A 3RWUA 3LALA 4AHSA 3AO3A 3B6PA 3HJFA 1VSJA 4IKFA 1RT6A 3MP6A 3D0PA 4Y1CA 4FJHA 4A4EA 2XRIA 2YKMA 1Q9YA 3PY8A 3AO5A 4DQPA 5I3UA 3ZT0A 1KVAA 3TWHA 4IUTA 3AVLA 4CK2A 3M9QA 4GW6A 2VG6A 3FFIA 3RMDA 2EQMA 3BDLA 4KB1A 3I8DA 3P83D 4B9NA 5JS1A 1RILA 4DSLA 1WJSA 1ITGA 3VQQA 5C42A 3KK2A 3LWLA 3LPTA 3MAQA 1BQMA 4W5TA 4O4GA 1KRPA 4C5EA 4KTZA 1NK9A 3META 3DMJA 5D6WA 1RTHA 5J1EA 3OYDA 3K57A 1RDDA 3RMAA 3PV8A 3AVKA 2PY5A 3TR8A 2HMIA 1JLFA 4DTSA 2HQXA 3SUPA 1JL1A 1RBVA 1BL3A 3NF8A 2VYTA 1JLQA 3LAMA 5J2NA 1LV5A 4DF8A 1Y97A 2YNGA 1X9MA 2YKNA 2OZMA 1HYSA 4N47A 3EYZA 4A4GA 2E4LA 3DLBA 3HT3A 2XY8A 4OKJA 1NK6A 3NAEA 2RPIA 4QVZA 2DIGA 3SUQA 5KRSA 4DSJA 4FJMA 3VQ5A 4FJ7A 5KE2A 4M3ZA 1VSFA 3OS2A 4JS5A 4CHNA 3S3NA 2BANA 3HVTA 2X35A 3OYBA 2GF7A 4PY5A 4M3RA 1U48A 4Q0BA 4E19A 2KW4A 3QETA 4QAGA 1QSLA 4KAZA 2XY7A 4CF0A 2XY6A 4BACA 1REVA 1JLGA 4FM2A 4FM0A 4CCHA 4F2RA 3TAQA 1DLOA 3QIOA 3JYTA 4IFYA 3TAPA 3PNWC 1WSIA 4G1QA 5SWMA 4UC4A 2ETJA 1JLCA 4AHTA 2MWOA 3V9ZA 1VSEA 3LGLA 1NK4A 2KZZA 3FC3A 2K3XA 4B9VA 4B9XA 3ZSYA 3LX7A 2JLEA 2HB5A 1TKXA 2P1JA 3ISNC 4FLWA 1C1CA 2F8TA 3ZSVA 4CJKA 1KLNA 1CZ9A 1WAJA 4QQDA 3H6ZA 2X6SA 1JXEA 4RW9A 3M8RA 2KFNA 1C1AA 3K59A 3C95A 2HVHA 1DTQA 4FZYA 4ELVA 2E6MA 4NZGA 1RTJA 4FLUA 4PQUA 1JXBA 4KHQA 1RDCA 4CK1A 1D5AA 1HPZA 4KV8A 3ZEHA 4M3TA 4KPYA 3P1GA 3M8PA 3SI6A 4DSKA 4CHZA 1C1BA 2X6NA 3DI6A 4KKOA 3RR8A 3KD1E 1RBRA 2KTQA 3AVJA 5FDLA 5KH6A 4PL6A 2NUBA 1KVCA 4I7FA 4DTMA 3T19A 3NF9A 3ZT3A 4CJPA 4CHOA 4A4HA 2XHBA 4NCBA 2M1HA 2Z1HA 3ZSOA 1S6PA 3MEUA 3FLGA 1IO2A 3SV3A 2BDPA 2E6NA 2VG5A 3U3YA 2IDOA 4DFJA 3AA3A 1NOZA 4C8OA 1KVBA 1WJRA 3QEVA 1T8EA 4DU3A 3NGIA 3OA6A 4CERA 5KGWA 4F2SA 1BQNA 3MECA 4M3UA 2Q3SA 4E1MA 4KFBA 3VQAA 4OLAA 1FKOA 1LWCA 1T7PA 2XO7A 4F3TA 4A4FA 4DFPA 4FJXA 4CJQA 3KD5E 4FZXC 4Q5VA 2K3YA 2GBZA 5KI6A 1FK9A 2ZQBA 1BI4B 4PLIA 3L2QA 4FW1A 4GVMA 5HLFA 1IKYA 1SL1A 2OA8A 1XWLA 4CGGA 1WJQA 3FDRA 3NH0A 4J2BA 3ZCMA 3VA3A 3LDSA 3VQDA 4KHSA 4CIEA 4EZ9A 1QQCA 1NJWA 5CIUA 4BDPA 3OYCA 4M3WA 1BIUA 1XHXA 1NK8A 4N4IA 3UWNA 2LVMA 3NDKA 1ASUA 4CEDA 2R58A 3C94A 3G10A 4B9MA 3C6UA 5DMRA 4I9QA 3PX6A 2BGGA 2RHUA 1U04A 4AHUA 4L8RB 2GFUA 5IAYA 4CJLA 4HUGA 2G8HA 1U45A 2RI5A 1J54A 5J2PA 5DK5A 4R5PA 3V9SA 2D0BA 3RRHA 3NHGA 4KHUA 3SPYA 2WONA 2IAJA 3CM6A 3OJUA 4IBNA 4B9SA 3KLHA 2RF2A 3HP9A 3DOKA 4FJNA 1BGXT 2R57A 1A5XA 4OPJA 3ULDA 2O4GA 4K8ZA 2RJFA 3MEDA 3IS9A 1U49A 4O0JA 4FJGA 4HCZA 3I0RA 4C8NA 3KIOA 3HPHA 3TARA 4YFUA 4ELTA 1N27A 1VSKA 2YRVA 1HMVA 3AO2A 4CJWA 3QIIA 1EKEA 5CYQA 2O4XA 3KK3A 3SUOA 3SZ2A 4N4HA 4IUPA 3ZT2A 2ATQA 1GOBA 4B9TA 5IN1A 2GUIA 3QEWA 2HW3A 4Z4IA 3O4NA 3MEVA 4LY7A 3ZSXA 1ZYQA 1WSGA 4O44A 4DU4A 2RI3A 1J5OA 4FYDA 4C8MA 3V1QA 2LDMA 3H08A 2HNYA 4DLEA 1S6QA 1YTUA 4LD6A 2F96A 1MU2A 1RCHA 4E1NA 2X78A 4F8RA 2XDPA 5HRNA 4N56A 2QKBA 2R7YA 4CEQA 1NK5A 2FBXA 4H4OA 4CEBA 1S1TA 4EP5A 4CFAA 3LZIA 2HHTA 4Z02A 3Q1JA 4CGDA 1EXQA 3VQPA 4B08A 4DS4A 4DQRA 4CHPA 3M8SA 1RBUA 2JTFA 4Q5WA 1L3SA 1SL2A 1RDBA 1Q8IA 5C25A 3ZSZA 2O4XB 2P51A 4NYNA 3DRSA 4M42A 3TABA 3OYJA 2FBTA 4W5QA 2LSNA 3DM2A 1A5WA 4E0DA 1UWBA 4CJ4A 2X74A 3C6TA 3LZJA 2L3RA 5SZTA 4DF4A 1WSEA 2KFZA 3QIPA 3F9KA 3QO9A 3K2PA 4DQSA 3AVBA 3QEIA 4JLHA 3SNNA 4CF8A 2FHDA 1TKZA 3MEEA 3CQ8A 3E9FA 3OMGA 4IURA 2HVIA 3AVIA 4E7JA 1B92A 2DY4A 1QHTA 3BGRA 4DTXA 1RI0A 3NBPA 4Z4GA 5E41A 1UOCA 1ZBFA 3S3OA 3U3GA 4FJ5A 1X9WA 2RHYA 3V1RA 4CGIA 4C8KA 2G8IA 4WE1A 1NK0A 1KTQA 3LYIA 4FZZA 1SKWA 3LP3A 2ITGA 2QKKA 1H3ZA 1T03A 4FLVA 4HCCA 2EQJA 4JRPA 1G15A 3P8DA 4BE2A 4NCAA 4IDKA 3L3VA 3L42A 1W9HA 4CECA 3TANA 2W42A 4CESA 4BWMA 3EZ5A 4I2PA 3V9WA 2HHWA 4KTQA 4C5GA 3VN5A 3S9HA 5HRPA 4FJIA 2QXFA 2RKIA 4E7KA 5T7BA 1KFSA 1HQEA 3AVMA 3TAFA 3KJVA 2EKOA 4OGCA 3RRGA 4M3YA 1VSDA 3SCXA 4Z4EA 4FLYA 2BIVA 4FLTA 4F4KA 1JLBA 2IOCA 3QINA 3ZSWA 4AH9A 2R5AA 2PQWA 3AVCA 4IUVA 3VQ4A 3OYIA 5K14A 1HNIA 3DYAA 1TK5A 4DU1A 3WNGA 4B8AB 2B5JA 1EP4A 1RTIA 3SQ2A 4DTOA 4Y1DA 3CFRA 2D0CA 3UT1A 4C5IA 1N5YA 1RT4A 5HRRA 2KQ2A 3DLGA 3MP1A 2HHVA 1BI4A 1U4BA 3AA5X 5CZ2A 3RTVA 3NTHA 4FJKA 3DLMA 4OJRA 4LD0A 1SSFA 3T3FA 3MEAA 4KI4A 1VSHA 2I5JA 2P5OA 4OPKA 3DLRA 5CY4A 1LWEA 3V9UA 4JS4A 4DFMA 1S9GA 4W5RA 1BCMA 4KHYA 4CJFA 1C6VA 1UA1A 3OYLA 3SQ1A 4OKEA 3MXMA 1QSSA 2QK9A 1HQUA 1B9FA 1HRHA 3SJJA 1ASVA 3T1AA 1NJXA 3KKRA 3RR7A 3LANA 4W5NA 3AA2A 4ID1A 3O3FA 2DFHA 3THVA 4FJJA 4B9LA 5C24A 4H4MA 4HCBA 4NCGA 3MXIA 4I9LA 3NFAA 2EQUA 1HNVA 3VA0A 2IG0A 1ZBUA 4B9WA 3OY9A 4OLBA 3NGYA 1WGSA 3L2VA 1ZBHA 3P8HA 1DTTA 3HL8A 1IKVA 2OPRA 3DLKA 2AJQA 3PO4A 1ZBIA 4HUEA 3AV9A 4CJRA 1NKEA 2BKDN 4ID5A 3LH0A 3CG7A 1RNHA 2LRQA 3RMBA 3L8BA 4FJ8A 1SL0A 4M45A 4CEEA 3IAYA 4KB0A 2PYJA 1I39A 5KCHA 3S3MA 5FRNA 3VQ7A 4DG1A 3O3GA 2P5GA 3PO5A 4CEOA 3PFSA 3K5OA 3NF6A 1BHLA 4B9UA 5J2QA 1KCFA 4RW4A 4CK3A 2KZMA 3OJSA 1KFDA 1RDAA 3E9GA 4CEFA 1VSLA 3AVHA 5HBMA 2IC3A 2EQKA 1TAUA 3H8ZA 3HP6A 3K5LA 3K58A 3QEXA 1X9SA 1IKXA 3DOLA 3LP1A 1NOYA 4RW7A 3LP2A 4DSEA 4DTPA 5FROA 4X34A 5HROA 1GOCA 3KLIA 4NYFA 1O1WA 1RTDA 1HYVA 3MP8A 3EY1A 4N41A 4Z0UA 1NK7A 3CM5A 4QOZB 1L5UA 3SD4A 1TV6A 4CIGA 4DQQA 1TK8A 2BE2A 4AILC 1SKSA 1EX4A 4KTWA 3HYFA 1NJZA 3HXMA 1J53A 2D0AA 2FC0A 1OI1A 4IFVA 4O0IA 3OVNA 3ALYA 1ZBLA 5JS2A 4QCLA 3NH2A 2DAQA 3AVFA 3I0SA 3PUFA 3AO1A 2MWPA 3O3HA 4LH4A 1C0TA 3ASMA 3HPGA 2XY5A 3HO1A 3KKSA 2RJCA 3NTKA 3OS0A 4LSLA 1T05A 3VQCA 3OYEA 5D6XA 4ZTJA 3TAEA 2JZ2A 4E7HA 4ZTFA 2X4YA 3V1OA 3L3UA 1Q9XA 2Y1JA 5KCOA 1K6YA 1CXQA 1VRTA 5I42A 2DFEA 1TKDA 4O55A 4FJ9A 4I2QA 2G3RA 2M16A 4DFKA 3L2UA 4HUFA 3MO8A 1S5JA 3PX0A 1GOAA 1Z26A 3AVNA 1KSPA 1HYZA 2OPQA 2RJEA 1WSFA 4CJVA 4DTRA 1WLJA 3HSTB 1JL2A 1YT3A 1TL3A 4ICLA 1JLEA 3E01A 1ASWA 5HRSA 1RT7A 1I3AA 3LPUA 2LCCA 1YTAA 3LWMA 1D8YA 3A2FA 2VWKA 3V81A 4CF1A 3QJ6A 1L3UA 3QKJA 4FL6A 4PA1A 5J2MA 4CEZA 4OKKA 3OMCA 2L8DA 4FW2A 4CHQA 4KI6A 1S1XA 4DS5A 1HJRA 4DTJA 2F8SA 2ZE2A 3F73A 2G8VA 3SV4A 4LH5A 3V6DA 4Z4FA 3OYAA 3EAEA 3VQ9A 1JKHA 4CJEA 2G8KA 4FK0A 3LAKA 4FLXA 1C0UA 4CE9A 4FK4A 2DFFA 1X1PA 2Y1IA 3DLHA 3KTQA 5KGXA 4FM1A 3F70A 3DB4A 4FK2A 2PZSA 3ASKA 2YHAA 3TAMA 4Z4HA
chains in the Genus database with same CATH superfamily
5GAHP 3M07A 4M7DA 1TYQA 3TEEA 3FMQA 3SQ0A 1VOMA 5H1SQ 1RAIB 1BIBA 2FNAA 4BDZA 1N8RU 3CJBA 5LJ5d 1UAXA 2AO9A 2KE9A 4Y15A 1FIPA 1ZR4A 2PQ8A 4U7DA 2K6DA 5D6EA 1ZSZB 3GCMA 4RB0A 1ZN2A 1ERDA 1Z9ZA 1YJ9A 1WSHA 1YWPA 2K57A 5LJ3f 4FE4A 3KUFA 4W97A 3HXLA 5FO5A 5J8FA 1C0FA 4RM3A 4H5RA 3P31A 2R7OA 2GXBA 3OR2C 3GTPJ 4ZHRA 1X2MA 2X4XA 2JK3A 3RDIA 2Q1NA 4CO8A 3DF8A 1AEYA 1IV8A 3HBTA 3O80A 2RGVA 3H5RA 1LJ9A 2D1VA 4FSSA 1FYKA 1SQKA 2L01A 1NGIA 1F5TA 4OFAA 4BDYA 3OYKA 1NK3P 2E6LA 4M7XA 4C0DB 5FPNA 4FETA 4DOZA 1RPWA 1HJOA 1Y7XA 3C0BA 1OVQA 3EGUA 1NKCA 4ENJA 5D4RA 4DTNA 4LG0B 2QDLA 5EEAA 2KSSA 3BC8A 3JB9H 1TS9A 2HBPA 3H45C 3OS5A 3A8GB 2VUMJ 3CCLN 1TK0A 1YS7A 4LLGF 1W2BS 4LD9K 1A5VA 3F0CA 1TYQB 2Z1GA 2PN6A 2K40A 4KHNA 3SFMA 2DNUA 2R7DA 1X1BA 3U2RA 1KU7A 1UB4A 1TGOA 4FE7A 3CF2A 4GYGA 2M87A 3WE2A 3FSPA 1P8ZA 4A5MA 2EFWA 1HBXG 3S6WA 4QTRA 3DTIA 1NNEA 2F5EA 3MX5A 3A8OB 1NE8A 5DLQE 2DERA 1PNJA 3HTVA 1MJBA 3FJ5A 4CI6A 2EFIA 2OF7A 3UA7A 5C6SA 2LC2A 5EF6A 1V55H 4B1WB 2EJRA 2PYLA 1W6XA 3I71A 2IT0A 2VT3A 3QESA 1YF5L 2HHQA 2HHXA 2DA4A 1LCUA 3OW2S 4RG8A 3IRXA 3CJ9A 3OH9A 2CO5A 2D45A 3ULRB 3HZ6A 3L6QA 1K8AO 1OR7C 3CXCM 2V1RA 3PL8A 4RB2C 1HDDC 4QW2A 1NJIU 3HRGA 2PU9B 1ZQ3P 3BY5A 4Y17A 3BW1A 3CQZJ 2DJNA 2FO0A 2HHSA 4BRMA 2UUAK 2LZ6B 3BJAA 5FLXE 4A61A 5EYRA 2QG9B 1CZBA 4AU7A 1K8AC 1HPMA 2EFOA 2CGPA 4AIAA 4JYKA 3GNFB 3WNFA 4ISFA 1LUJB 4CFDA 3KWIA 3M9AA 1CXUA 3B6OA 5BPLA 3OTOK 1XNIA 4RAFA 2HZYA 2VPRA 3ZRGA 2BY2A 4MQ3A 5LJ5h 3CF5L 2XROA 3FRNA 4A5NA 3K0SA 1LNWA 5E26A 1ETKA 2MFZA 2W57A 2ZFUA 1IV6A 1XDSA 5JHUA 1S22A 4GKJK 3FIFA 2DYSH 4HT9A 3O9SA 1OYXA 1DP3A 3OB9A 3OHRA 4EM2A 1ZGWA 1S1VA 2QWWA 2QA4A 1YJ9Q 2FA5A 1Q1HA 1R23A 4D7MA 3T7ZA 3GTOJ 2DU9A 5CE3A 2ZJQF 3OYYA 4BC4A 3MKYB 3R2XC 2HNZA 4TV7A 2K2VA 2QWRA 2OQRA 2CZ0B 4JK8A 4IO8A 4BQQA 5BN9A 2V9VA 2YCHA 2M0CA 5AQFA 2H3JA 1GHCA 3TP3A 1R9TJ 3OYNA 4OMZA 3GFJA 1BIZA 3W3CA 1YITI 2BY0A 4CDGA 3HVRA 2NNWA 4BHPA 3VSKA 1SKRA 4DYQA 3K5MA 2GLOA 3QB0A 1OCOH 3QBYA 4I02A 2COWA 4DR6K 3ME9A 1MPGA 4LF6K 3WTXC 2W41A 4BRCA 1K61A 4IOAF 5AIQA 4RG2A 1M2OA 1Y56A 2QSGX 1D3BA 2O8DA 2QQSA 3G73A 2G8FA 1D09B 1XC9A 4JRQA 2LBFA 4RCCA 2QGFB 4CZEA 2WC2A 4BE0A 4M3GA 3NE6A 1V4TA 1RT2A 2LTOA 4DB3A 3RMCA 1P59A 3MEGA 4AF1A 2M1BA 4NS5A 5AQGA 5GANd 3TAGA 2DMNA 1YI2T 4RGSA 1K9AA 3CO7C 1LW0A 3S17J 4M3XA 2JWLA 2HEOA 3ITHA 4UB6C 2WAQN 1K0SA 5FKNA 1Q95G 4O5BA 3FMSA 4BRPA 2QCOA 3MN7A 3ZX0A 1RFQA 3P8BB 1S6LA 4A6EA 3LAPA 4LE9A 4MIMA 1FOYA 4RLFA 4LN2A 3MHXA 2JOYA 5EOYA 1XI1A 2F2VA 5AR0A 2RHZA 3WXLA 1EA3A 2OYQA 2WY8Q 1FYMA 1F1BB 5D3GA 3FEOA 5GAGP 3M0SA 2QUFA 1H8AC 4FM4B 2EX3A 3FLCO 3LLRA 5ICGA 1GDTA 4EP4A 5GAHJ 4O6JA 4XORA 2VXEA 5BPMA 5IHIA 4Z2YA 3EG1A 2LP0A 3BROA 3HPOA 4JEPA 2CQNA 5E3OA 3DXJF 1VQ4A 4HVWA 4QQ6A 3HM9A 3GTQJ 1D3BB 1SV5A 4CZJA 2XSDC 2O8DB 3OSFA 4CJUA 2PLYA 4FJLA 2Z1JA 2QZ8A 4ZC3A 1F21A 3SYZA 4FOIA 2LBFB 2F5KA 1I81A 2MG4A 2FZKB 4PLLA 3NF7A 4L5IA 4B3OA 1I3QJ 1K1ZA 4LF9K 1N6AA 1MHNA 4FCYA 5AIPA 1OX9A 1S1WA 3GEZA 4A3IJ 3SUNA 4YPHA 1WLPB 1VQ8I 4EDUA 1X1CA 1OH6A 3H3OB 4A5AA 2FBIA 4GY2B 4CIFA 1W2BA 2NRWA 2CUFA 4EHTA 2QA4Q 4XTVA 2CQ7A 5FPDA 2FSWA 1VQ5N 3MCPA 3TQNA 3RWUA 1M30A 3EETA 3B6PA 4V2FA 2MBFA 1OYYA 2WSEE 2ZPFB 1KQJA 1OMIA 5EG0A 1HDPA 1ZK8A 1KGSA 4PFOA 1J5EK 3AO5A 3A1YA 1VQKN 3OW2A 3TWHA 2IEKA 4IUTA 5F1RA 4LFUA 1K8AU 1GLFO 3OOPA 1KG7A 4RS8A 2BVMA 3AVLA 2EJ9A 5AONA 1KG3A 3RMDA 2RQTA 1JUPA 4B9NA 2CU7A 2RNGA 1N9SA 5JS1A 1ITGA 3HI0A 4AFSC 2CDTA 2X4HA 3M0PA 3E5QA 4OB2B 3GFLA 4ATOA 3O9TA 2EPDA 5C42A 3KK2A 4QPQA 1TUGB 1BQMA 4Y92A 2DD5A 4W5TA 4M72A 1LFUP 4JJBA 1W70A 4E9GA 2FXUA 4WXCA 4M7DF 4BGBA 5GANh 3HJEA 3CCQT 2AZSA 4B9QA 3SJHA 3CC4I 3GLLA 4B1UB 5FU6C 3JAMZ 2JHNA 1MH3A 5FFZA 3AVKA 2Z1DA 3CIPA 1AHJB 4Y4RA 4JD2A 4ESJA 4BH9A 2HMIA 1SVOA 2PBIA 3HHGA 3SUPA 2VYTA 5AQZA 2F1LA 2YUPA 1BJAA 2CP2A 4FO0A 3DTKA 3J80Z 1VQ6N 4DF8A 1N75A 4X64K 2H1LA 1X9MA 2YKNA 2OZMA 1HYSA 3I55T 3M7GA 3VETA 1E3HA 1Q82U 3C65A 4A54A 2YUNA 2FZCB 1MGQA 3G3ZA 3NGPA 3NAEA 2RPIA 5EG0B 2DIGA 3AGKA 3VQ5A 1QVPA 4FJ7A 4JZ3A 1VSFA 2W82A 1WFXA 2DK8A 3IC7A 3VOEA 2NOHA 5F04A 1BB9A 3HVTA 3P39A 4Y13A 4PY5A 1Z21A 2LREA 5CKEA 4XRSA 4YEJA 3BWGA 2EKHA 1YIJA 2VI6A 2ELHA 3Q0UA 3VEZA 3TO6A 2XY7A 3V7SA 3CCVT 4CF0A 2XY6A 4BACA 2ROTA 1PU8A 5AQNA 1AU7A 4XTUA 3F5TA 3KXTA 1UGSB 3P9CA 4X0GA 4FM0A 4CCHA 4F2RA 3TAQA 3MX2A 3REOA 3KEYA 3JYTA 3IH7A 4H0PA 3JRZA 2JXBA 1WSIA 1RRSA 2LJ0A 4AHTA 3FM3A 1BO5O 4JD2B 1HCRA 1ZBXA 1NK4A 5DLOA 5AQXA 1QW1A 1ETXA 5F1JA 2YWWA 4BROA 2BYVE 3RJPA 1WH5A 1V76A 3MD2A 3P4IA 3JV3A 4A3BJ 1LOJA 2AA4A 3QFPA 2VT2A 1Q86O 2JLEA 4JRKA 1RADB 4UY8O 1IZ1A 2L0AA 1JCFA 1FC3A 1OCPA 1P4AA 4FWKA 3L4IA 2K3PA 3CD6N 3TCJA 1WHMA 2F2XA 3EGDB 1CZ9A 2PJPA 2XAGA 1ZQ1A 1WHJA 3M54A 2F4MB 5J1RA 1YN8A 1UUEA 4PL8A 2QGUA 4BI4A 1Q86C 3J81K 3FHGA 2KMTA 4ILJA 2F4VK 2HVHA 2EBIA 5IP7J 4NZGA 1FMWA 2CSOA 3BF3A 1V4RA 4UHTA 1WPYA 4YHHK 2OTLN 4BY6C 2OCEA 4CK1A 3ONQA 3ZEHA 2DTOA 3RKWA 1S72A 4OMYA 3CMAI 2IXSA 3M8PA 4BRKA 3REAB 4DSKA 4RWTA 4XLCA 3NMZC 4CHZA 3WTYC 3ZFJA 2X6NA 2K9SA 1PUFA 2D0QB 3W2AA 1ZTRA 4E9HA 5KH6A 1KVCA 4I7FA 2OUMA 2HQNA 3ZT3A 2NRTA 3DKYA 4A69C 3LQQA 3HIFA 3IKVA 2H09A 1WJCA 2ZF5O 2E1CA 4DV1K 4NCBA 1UJ8A 4M71A 2IA2A 1K73O 1I0CA 2HNIA 1R49A 2ZKZA 3CJCA 4IRIA 3GP8A 3PFIA 2KHMA 1TWCJ 1NOZA 2KIMA 4C8OA 2GOXB 1KVBA 1WJRA 3QEVA 1JKOC 1WNLA 3ZN0A 4DU3A 5IHKA 3OA6A 4XLNF 1IJWC 2QEXN 5GP9A 4PJ0C 1SANA 4F2SA 1FTZA 3V8KA 2Q3SA 1FKOA 1K73C 3AGRA 1J09A 3CCEI 3MCZA 4A3JJ 2FMLA 1BDGA 4BY7J 3HHTB 2P0WA 2W1OA 4CJQA 1W1WE 4FZXC 1U3EM 2XC7A 4WXDA 2X51A 2K3YA 2XAFA 4M9SA 2P81A 4XK4A 3HRUA 1XMQK 1YIJQ 3KP7A 1W4MA 1TTYA 3BZKA 2IPOB 2PMZN 4I0BA 1IKYA 4C8QA 1SL1A 3DBHB 3TSQA 2ZWHA 1Y96A 2A5XA 2KMUA 4IOXA 4MDWA 1IXRC 3EFRA 4J2BA 4RTWA 5IT9E 1PUFB 3ZCMA 1MDUB 1WA7A 2VBYA 2COBA 4KHSA 4CIEA 1YJWN 2E20A 5CIUA 4O5FA 2IS4A 2YHYA 1M2VA 3CJTB 2MH2A 2P5KA 4N4IA 2VC1A 1ON2A 2HMPA 4BRLA 3UWNA 1JT0A 1M4ZA 2LVMA 1NGDA 4FPAA 1WBBA 1NPPA 2R58A 2OJ2A 2RH2A 3UA6A 4N0AA 3C6UA 3T8RA 1FJGK 4A93J 5IPAA 2COYA 4XAXB 5DMRA 3PIPL 2BGGA 3KP4A 2RHUA 2V8KA 3CI5A 1FP1D 4IIOA 1W2BP 3D5LA 1A6IA 2DEQA 2HWVA 4M9XA 2XHCA 5IAYA 4CJLA 2G8HA 1RC9A 2QKLB 4C92C 1I6XA 1S72T 2CGKA 5AQIA 3BZ6A 5DK5A 4XTYA 1FYLA 5HCKA 3MWMA 3NHGA 2F6CA 5HOOA 4LIUA 2L2OA 2KRSA 5EC7A 2HGCA 3OJUA 4IBNA 4F3QA 3KLHA 2EIKH 5FWCA 2RF2A 4IO9L 2EV6A 1UEBA 2R7XA 1BGXT 4KIBA 5CLSA 5BPNA 1P6RA 5KQ8A 3BG7A 3VU3C 3OW2P 3CCLA 4L0ZB 4A3DJ 2O4GA 1YJNT 4ELYC 4K8ZA 2HU9A 4RMNA 2HEQA 2M2EA 2RJFA 4JI8K 3IS9A 3J7YP 2LTPA 1B6AA 4XU3A 4FJGA 1NHAA 5DDGA 4B3SK 3FX3A 4C8QB 1N33K 1KD1U 3X28B 1MDMA 2BZTA 3A02A 2PI0A 3H46O 2K9GA 1R1VA 1EKEA 2ZGZA 4EM0B 3PT9A 2VKHA 2H8RA 1M2VB 3VS5A 2I7PA 1JJ2M 1AOJA 3H6EA 2ATQA 1KFZA 5AQQA 3ECHA 4Z4IA 1ZARA 1U1SA 4OIPF 3ZSXA 1K9MR 2UXCK 4GLKA 3LDLA 2HYFA 2ZJ2A 4GO1A 2RI3A 4C1NK 1QVUA 4FYDA 1UG2A 1WHGA 3CCRI 3I0XA 1ZBSA 5CKDA 2KNBB 2HYGD 2OAUA 3L1PA 1RCHA 2DL3A 2E1MC 1W4SA 1UGVA 4N56A 3ESWB 1IXCA 4M78C 3WHCA 3M3YJ 4H4OA 4LFBK 2M8GX 2NUPA 1Y0UA 1PJRA 4AWXB 3T69A 4EP5A 3SBTA 2DT5A 4BR7A 2Y48A 3Q1JA 4UNOA 3UKUA 2M0MA 2DILA 4CGDA 3QMLA 1X6BA 2XGDA 4KH0B 1VQ9T 1YFNA 3LSIA 4CHPA 1RAEB 3SB2A 2ZMEC 1MDMB 1HKCA 2VUBA 3LDPA 4B3XA 1C6VX 2FU4A 5F0XA 1RBUA 3KZBA 4JYAK 3O8HA 3ENBA 2P51A 1XDUA 2JRTA 2BVLA 4K0KK 3OYJA 2DOEA 1YE9A 2PMHA 2EZKA 3DM2A 1UGQB 1A5WA 2X74A 5J1UA 3WXJA 2QF7A 4HXJA 2L3RA 3ASNH 2QKMB 5C3EJ 1UJYA 3ZQQA 2Y90A 2V7FA 2X1CA 4S04A 1JU5C 4II3A 3QIPA 3F9KA 2DO3A 2Q97A 2VGNA 3KEQA 3QO9A 3DFGA 1WIEA 2KQWA 1VQMT 1Z3XA 3QXEB 3GZ5A 3SNNA 4CF8A 2FD5A 1TKZA 3CQ8A 2LNVA 4M77C 2LY1A 3OMGA 2HDCA 1OPCA 4BUGA 2LX9A 4BXFA 1RUNA 4E7JA 4HEA2 1UJ0A 1B92A 2NUPB 1N5ZA 1EO1A 2HKOA 2E2IJ 1KC8R 1B34B 1U06A 4PGHA 3PJRA 4DTXA 3BG5A 3PGGA 2VQGA 1RI0A 1RI7A 3CCLQ 4Z4GA 1RESA 1ZBFA 3R8EA 2F5FA 3UKUB 2HPIA 7AT1B 3U3GA 1FYNA 5HODA 1TUUA 4M73A 2G8IA 3FISA 3UF4A 1NK0A 3U8XA 5F08A 1SKWA 2KRFA 1W7AA 1N39A 4CICA 1D0YA 1ITYA 2ITGA 4LB6B 2B63J 2VXFA 4JRPA 2DEUA 1G15A 2F69A 1UFMA 2P6SA 1J0RA 4EFHA 4WFAL 3JR9A 4FSXA 1Q7YO 2NXNB 2OC6A 3EZ5A 2R7UA 3V9WA 2JPCA 1G3SA 2HHWA 4KTQA 2WAFA 4DW6A 2LJ1A 2QXFA 4WX9A 1FN7A 4CJ7A 2FQ4A 1ZBJA 1T33A 1HQEA 3AVMA 2XHIA 4M3YA 4PDKA 4KH1B 1VSDA 2X4JA 1Q7YC 2VJIA 1Z67A 3I3LA 3SCXA 5F64A 3ZMTA 3JAMO 1NGCA 4FLYA 2BIVA 2IGKA 3JB9J 5CPRB 2KK4A 4F4KA 4JP0A 2K9QA 3BLYA 2F9TA 2HZDA 3ZSWA 1Y71A 4AH9A 1HKGA 3D7EO 1X4PA 2XKOC 3BQZA 2KXDA 2MC3A 2PQWA 1G83A 4IUVA 4G9YA 2Y2ZA 2NZTA 3KETA 2KQRA 5ILUA 2CS3A 2KRMA 4B8AB 2B5JA 5JLWA 2X6XA 3EQLF 1WWXA 4KGXB 1HU0A 5LJVA 3AL0C 3H9GA 1RT4A 1G6NA 3AT1B 1ZLKA 2DLPA 4XL9A 4HKEA 3H36A 1HKSA 4DUYK 1R7JA 1X69A 2NRAC 3T3FA 1YX5A 5M3MJ 3SHFA 1VQ5A 1ZGAA 3ZQFA 1LWEA 1VYUA 4FWOA 2Z5UA 3TSPA 1AZEA 3BJOA 3GDQA 3E5XA 4W5RA 3IRRA 1IRXA 1JEGA 4B1VA 2JVVA 2A6TA 4P9UA 2NOJB 1Q81R 3EG9A 3H0IA 3OYLA 3TTFA 3SQ1A 3HPWA 1NKUA 4BEHA 1PUEE 3LSKA 1VQKA 4BKXA 5AZJB 2HKXA 1QSSA 2BE9B 2XU8A 1T8IA 4BJTA 2CMPA 3O3KA 1HRHA 3J7YJ 3KX2A 3MQ0A 5AQKA 5DS9A 3M56A 4YIIA 3KKRA 1B8IA 3ERMA 3AA2A 3HM5A 5M1NA 3HTSB 1XGSA 2PFUA 4JI7K 4B9LA 3A5LC 5C24A 4HCBA 4QS9A 3URGA 2G7UA 5HL7L 3NFAA 5LMNK 2A07F 2H27A 3VA0A 5M3FJ 2M0YA 4B9WA 2EZHA 2E7WA 3AG4H 2Q8KA 3ZQCA 3O6BB 1ETYA 3P8HA 1W0TA 4FSVA 2Y75A 4AUXA 3LSTA 2Z2SB 5F0HA 4C8QF 4A2BA 1VIEA 1NKEA 2BKDN 4U0VA 4ID5A 2E2PA 1LFPA 2YSQA 1GXPA 4EIKA 2KYBA 3A8YA 4M45A 3SEMA 4CEEA 1NGEA 4NC8A 5M5XJ 4KB0A 2E65A 1VQ6A 3PVLA 2DYIA 4MLOA 5KCHA 3S3MA 4H0YB 4JNEA 2Y69H 3VQ7A 4XSXF 2JMCA 3O3GA 2YHWA 1W0UA 3PO5A 3U23A 4CEOA 3TGNA 3EG9B 5I22A 1QP2A 1Z6TA 2NOFA 3E6DA 4JX6A 2GA1A 4B9UA 5J2QA 5CQXA 4BEHB 3CHWA 2K9NA 4H0VB 1VQLT 3OJSA 3M58A 4KISA 2KZVA 1ZH5A 1IZ6A 3HKZN 3THYA 2A42A 3MK6A 4I0AA 1YW8A 1TAUA 4J00A 5JR3A 3HP6A 2UXXA 2P8TA 1B8IB 2E1NA 5AQOA 3QEXA 3ZQIA 2VKNA 1IKXA 3DOLA 4KULA 3M1EA 4HDUA 2W6KA 4E7ZA 1FEXA 4CXFA 2V8IA 2DL7A 1GOCA 3JCMW 4M7YA 1LEAA 4CGZA 3E7LA 3S8PA 4GV6A 2JSCA 1RTDA 3IP4B 1N78A 3MP8A 1Z6RA 4Z0UA 4MEYF 1T3LA 4FYWB 4QOZB 1GLDG 4S05A 4HX4A 1T98A 5F6FA 2JUGA 1AZGB 1TK8A 4C3HJ 3JRAA 2NVXJ 2JWKA 4AILC 4HDVA 3G4SQ 1U1TA 2QQ9A 1DJ7B 1NJZA 2D0AA 3EZWA 2AHQA 5HS7A 1XSXA 1ZBLA 6PAXA 1X1AA 3M59A 3OMYA 3CMAN 2EJFA 3AVFA 4NXNK 4H0OA 1XGOA 1EZZB 1VQ5Q 5GAOp 1NTCA 2CZ7B 4AIJA 3H9NA 1GXIE 3CD6A 3C2BA 3HPGA 1NYFA 1V1CA 4H5TA 3PLAA 1O3SA 4C9YA 3F9MA 3QO3A 3OS0A 3O9QA 4LSLA 4QVDA 1VQKQ 3TDZC 4J9CA 3VQCA 5LL6Z 2FEZA 3THYB 4HF2A 1DGRM 3B73A 1FBQA 2OTJQ 4V2GA 3DU5A 3PE0A 4S0HB 1QVGS 4B47A 2VYPA 3QDKA 3KLNA 4M3EA 4JV5K 2JN0A 1M3QA 9ATCB 2OTLA 2E2HJ 1KQ9A 5KCOA 3K4CA 5FU6B 4IRHA 5AFUA 3SDGA 2O5RA 5JVTA 3CC2T 4EMKC 1UECA 1KG2A 3BPXA 3FZHA 2IP2A 1VRTA 2EWNA 3JCMQ 1XGMA 5I42A 2DFEA 2L4MA 4FJ9A 1RL2A 4C2MJ 4I2QA 1Y1VJ 4DFKA 4NNJA 1RKWA 2W0ZA 1JJ2P 1GOAA 3CCQI 3AVNA 1IAWA 1HYZA 2OPQA 2VODA 1WSFA 4DV3K 3W0LA 3CUQC 2K4YA 1U2VB 1U9OA 2A3LA 2KROA 1YT3A 4C92D 4ICLA 3SK3A 4OOIA 1XQSC 1I27A 5GAN6 2ZPEB 5HRSA 2GWRA 1M3AA 3JB9I 3LPUA 2L9SA 4ASNA 3G6ET 1VQ6Q 3VS3A 3TPQA 3QJ6A 4RTVA 2QEXA 4PA1A 5LEJA 3CJ1A 2EYQA 4ZYGA 4BRHA 5MLCQ 1VQ4I 3CZ6A 3I55I 1GLLO 3THWA 3PIOL 1CZAN 1QWEA 1S1XA 4M7DG 5BQTA 3CC7T 2V75A 2G8VA 1IGUA 1A31A 1JKHA 1HXDA 3L1AA 3QYBA 4FK0A 4AYBN 1G2BA 3W2VA 1BC8C 4CD1A 4FK4A 3VRYA 2P0QA 2A61A 1S3XA 2E5LK 4ZNXA 3DCFA 3DLHA 4J6XA 3RQ4A 4BBSJ 3C0CA 2E1YA 1YQLA 1QGPA 4FM1A 1JCEA 3ZMVA 2EW3A 2JHJA 2PMZA 3O8MA 3DB4A 2L02A 3T1BA 4DEYA 4JPBW 1PRLC 4AG2C 2OAWA 3WHBA 5J8CA 3WTWC 4OMLA 3I8BA 3UKGA 4B24A 4EV0A 1YJWA 2LVSA 1W7PA 3P5JA 4PKHA 2LT4A 2DVJA 4YFNF 2A1RA 4NOYA 1T56A 5CVIA 3ZPLA 4E7IA 3CCUT 2L5QA 4OIRF 1RBTA 4M7AA 4M6VA 5L8RE 2BXZA 3E2UA 2ME6A 2YR2A 1W5SA 4KNYA 1KEAA 2DTUA 3VF4A 5KYNA 3J81Z 2E5QA 1KJWA 1MBEA 4KHWA 1V5FA 2WV1A 2WAEA 3V42A 2RHIA 4KDPA 3H35A 3ZT1A 1XQHA 1LWFA 2B8AA 1TNTA 2R5MA 4M78D 4YOXA 5LY3A 2XB0X 4GNIA 1YXQA 2XDDA 2X0LA 1LDDA 2QW9A 3BF1A 3OGDA 3C4SA 3CD6Q 1QTMA 3THWB 4N9IA 4W5OA 3GOXA 1YVUA 5L23A 3QDFA 4LNPA 3E6MA 4FU6A 2EGEA 1ARKA 4J19A 2GBQA 4AIKA 3TI0A 3S1QJ 4RW8A 4PSWA 2EK5A 1KQ8A 4C3IJ 5CQEA 3W2WA 3ENHA 5J26A 2A1SA 2MPXC 5IP6A 4LXCA 4XOPA 1IGQA 4ILHA 3K5NA 4B4CA 3QHSA 1LW2A 3LMMA 4GY5A 3LGFA 4OGEA 3I9V2 2OTLQ 3ATVA 2K7LA 1ESVA 5GMKe 2DBBA 2GIZA 1GLCG 5FKLA 2VWJA 2QEXT 3J7ZI 3JCMP 1QMCA 3MN6A 2JNGA 3KYCB 4NXMK 1MIJA 2BEOA 3F8NA 2CV1A 4RB3C 2Z33A 4M7AB 2G8WA 1NGNA 4C92A 3HOZJ 1R0AA 1Z7UA 2XRNA 1WZOA 3ZXSA 3QERA 3OV8A 5BMZA 5L3BA 3FKIJ 3CYMA 3QNNA 1R5HA 4J2EA 2K3BA 1L0OC 1QS4A 3K4BA 2DXTA 1JHFA 2KT8A 5I11A 1P2FA 4B8CA 4B22A 4M77D 2V9PA 5KVRA 2HQEA 3T9NA 1R5GA 1IG7A 3IG1A 2E5NA 1QA6A 1XCVA 1LB2A 5FW9A 3I56T 1VZ0A 4M7DE 3FZKA 2KAFA 4FXDA 1JUMA 4UVAA 3EFOA 1YJWT 4KA4A 1F9NA 3MZHA 1D9FA 3TSWA 4BY9C 3CEYA 1BL0A 4KT6A 2DBMA 4JI1K 5AN4A 4V2SA 4DTUA 1OQKA 2HHUA 1OJLA 2ZD1A 4XU1A 3BY7A 2B6AA 1TL8A 5BRDA 3QUIA 5K7FA 1W1FA 4F3OA 2HQAA 5EJCA 2X4WA 4EZ6A 4B6MA 2E34A 4XONA 5KRTA 2YV0X 1ACIA 5FLMJ 2XV4S 1GRIA 1DDNA 3JCMg 5E79C 1IH7A 3O08A 4PKCC 4J9DA 3WG9A 1QHHD 4I6MA 4CF2A 4CFBA 1ZYRF 4ZDLA 5ILSA 1R71A 1UELB 2OPTA 2FMYA 1QVGA 3PNTA 2XICA 4II1A 4M7DC 4IIMA 1VSMA 2D0NA 3V9XA 2QQRA 4C92B 3SEZA 5IYDJ 4M3DA 2LQKA 2P5LC 1WX6A 1ENHA 2P84A 4PUOA 1G99A 3S93A 1ZG3A 2E2JJ 1X2KA 1U78A 4B21A 2CQKA 4H03B 4MZPA 3CMET 1LPLA 4H4KC 2NS8A 4M78A 1U47A 2A05A 3H3NO 4AI4A 2WACA 1WNSA 4PJOA 1T6DA 1RT3A 1KHCA 4N5SA 1WKMA 1OZ3A 1M3BA 2GGRA 4IOCL 1XG7A 4B09A 2DA6A 2FQ3A 4KICA 3FKJA 3DP7A 5L3DA 2A68F 4IEJA 1S72I 3INZA 2DXCA 3ZMZA 1TAQA 4DR7K 4L5GA 2ZXWH 3N5BB 2ASMA 4EATA 3EFOB 4JUVA 2RI2A 4BWJA 2VONA 1MUNA 1QSYA 2WSCE 2NLUA 4H5WA 3PO3J 5E8GA 3VQ6A 3OSGA 2CP7A 4UNFA 2YX6A 4KH4A 1OULA 4DQIA 4CGJA 2UXNA 3WXMB 3CFOA 4BQAA 1YCYA 2OJED 5ERIA 3HFNA 3JRDA 2CZ6B 2NVUB 4QQGA 2HSEB 2EYXA 2K7AA 1S1UA 1KU3A 4NDLA 4I6MB 1SHFA 2RN2A 2L0KA 4C1NI 3REBB 1YQRA 2QQAA 3CF5F 4IJNA 2G8UA 5CZ1A 2CH0A 1NEBA 2EYZA 2JG6A 2VOOA 3MEWA 4JJNK 3GMEA 1BW6A 2NVTJ 3NNQA 5B8HA 4XKWA 4RM2A 3AHUA 1EH6A 2JT1A 2E1MB 4IHSA 2OZSA 4M77A 2YT6A 4CZMA 4M78B 5I9EB 5D8KB 2FVUA 4AMCA 3MKDA 2HBJA 1VQ8A 3PQJA 5AQTA 4R56A 2PBDA 3AO4A 1AWOA 2YHBA 1HW1A 2YX7A 5GAOm 4RTTA 2QASA 4LIVA 4PL7A 2QWMA 2NWMA 5HLTA 4XQFA 5A0GA 4EQQA 1BISA 2L7FP 4CC7A 2ZSHB 2E6ZA 3BT9A 3VFZA 4E6RA 3E0JB 3HZJA 1B9DA 3C3WA 4B23A 2KT1A 2RK2A 1U84A 3SAFA 1M1GA 4F17A 3SQ4A 1KIKA 1N9RA 1F4KA 2DA2A 3NTIA 3EYIA 1ZKGA 1LDJA 4FLZA 1YCSB 1YITQ 4DA4A 2KY9A 3VQ8A 3TDUC 5CR2A 5KCMA 5E3NA 2JSPA 1QQMA 4LDYA 4B1XB 3M4GA 1TSFA 5D6YA 2YXYA 1NU0A 2ISYA 2JM9A 4J8OA 1NG6A 1J9IA 4F52A 1BKBA 5C0YA 4XIUA 4KREA 1SMTA 1ZXOA 4BC3A 2XPUA 1M3CA 2FUG2 1IKWA 1B1BA 2M3AA 2P9KB 3JSPA 3CERA 4BE1A 2L3SA 5GAEP 3GTJJ 3JCMe 3NCIA 2IW5A 2FBVA 2ME0A 3KE2A 1RAGB 2NNYA 5LGNA 4QIWN 4M77B 4GKKK 2PNIA 2ZB9A 3CC4A 2M4KA 3OS1A 3D2FA 2G7HA 4PWDA 4NBQA 5DTDA 4UUTA 2LYCA 4M41A 4A3CJ 5DY9A 3TREA 1TLHB 3VEXA 1PWTA 3AO3A 3IH2A 1YI2N 2LX7A 3SHWA 1YW9A 1YHQT 3ZQ7A 5DUIA 1LVKA 1VQMI 2GWJA 2ID3A 2X1EA 4HF0A 3MP6A 3D0PA 4Y1CA 2KGTA 1K9MU 1M3HA 1MBHA 2EGAA 5I3UA 4DQPA 1H9TA 2A0FB 1KVAA 3IDHA 3LM9A 2LSOA 3C6HA 3JCMJ 2YUSA 4I7HA 1G59A 5GIPA 4CK2A 4LB5A 4HSBA 2PAVA 4GW6A 2VQEK 2EZIA 4OFEA 4IHVA 4HYEA 4KB1A 2ICWG 5AQJA 4C2UA 1J59A 1QLYA 2QWOA 1WJSA 3VQQA 3DXMA 1F36A 4EJUA 4IFEA 3TU5A 1P9QC 3LPTA 3ZR8X 4CA0A 4O4GA 3A5MC 3IKTA 1WI3A 3K1NA 3COAC 3ZMDA 4PHTX 3N97A 5D6WA 4UB8C 2JS2A 1H89C 4M7AF 4L18B 2J6OA 4J83A 3OYDA 4XOTA 1QVFS 3K57A 4A0YA 3LL7A 2IGNA 1T08B 2VQCA 5HDKA 1PRMC 2PEXA 3TR8A 3GZ6A 4DTSA 3TW6A 3VGKA 5C44J 4I6ZA 1JL1A 1RBVA 1VNDA 3NF8A 1JLQA 3D2FB 2W7NA 4B3MK 1MW7A 4XRSG 3CPWM 5J2NA 1LV5A 2A3ZA 1VQ8Q 2K27A 1VA7A 2V1NA 1E3PA 2E1HA 3HKZA 2AXTC 4A4GA 3DLBA 2C0TA 5JVHL 1Y8RB 1X2NA 1AWWA 1T39A 3A8MB 2R7FA 4QVZA 2NUZA 1EWRA 4NUBA 5HDNA 4TVRA 3VWBA 5KRSA 3M8EA 1UDLA 2EV0A 5KPRA 3AL0B 1O9SA 2XSJC 3S3NA 3CCMN 4JJCA 2HTJA 2Y0SN 5J47A 2X35A 2YG9A 4RGXA 3OYBA 2GF7A 2Y30A 4LMYA 4QLCU 2A40A 4BNCA 1GUUA 3UATA 3JRCA 1JO8A 2CG4A 3IL2A 3RUXA 3DXMB 4JKFA 4KAZA 1XC3A 3ABTA 5L3CA 1SFXA 3IAM2 2P7VB 3JCMc 2EAYA 1AWCA 1LWYA 1KC8U 3AFHA 4E47A 3QIOA 5LJ5e 3FGUA 3CMAA 4IFYA 3I5SA 1E3OC 1QVGP 3WEEA 2R5ZA 4OB1B 4AVPA 1OU9A 3L0QA 1MNMC 2ETJA 4C92F 1JLCA 1MWMA 4CSWA 5D5WB 3EUAA 5HS9A 4ESBA 2AK5A 1LJOA 2K3XA 1OV3A 2JS0A 3QPSA 3ZCOA 3CC4Q 4B9VA 2L7ZA 3NEUA 4B9XA 3ZSYA 2HVQA 5BREA 3LX7A 2HB5A 3SDBA 2LY9A 1TKXA 5F27A 1MBFA 4A3GJ 5AFUH 1C1CA 4NHJA 2V51B 2FSKA 5KAFC 1FPQA 2UZKA 2ZJQL 2GELA 4F7ZA 3J81O 1U0JA 4B3RK 2LRDA 3VS7A 2I8DA 2LH9A 1ZLMA 3VS6A 3BDDA 4N4NB 3J80K 2X6SA 5AYFA 1JXEA 3K4KA 2JMWA 3IUCA 4NL2A 3I55N 4ILGB 3IH4A 2Q1ZB 1N77A 1AWJA 2HKQB 4FZYA 4ELVA 3A8LB 3CW7A 1MV3A 3CCEA 4CC2A 4GCVA 5JFRA 3C18A 2VKDA 5AT1B 2NRVA 1T0HA 5I2MA 1JXBA 1RDCA 3RPUD 4A6DA 4KV8A 2DMQA 4DKWA 4KPYA 3BY6A 2ZPBB 2L4AA 2E8AA 4XRFA 3SI6A 4FT8A 3VPZA 2E2OA 4EJYA 2ELJA 3OL4A 2F2WA 3KD1E 1RBRA 2KTQA 5FDLA 2DE0X 4WWCA 3I5UA 4GV3A 3T19A 3NF9A 5CVRA 2XF6A 4JKGA 3WEEB 2R5ZB 3OIOA 3CCVN 3J7ZO 3F8BA 2E60A 4HX8A 2M1HA 3B6CA 1VQON 3ZSOA 1WBDA 3IUOA 1S6PA 3MEUA 4I98B 2QENA 1IO2A 3IV5A 3SV3A 3KBGA 5KPZA 5FLXK 3NFCA 1IN7A 4DFJA 5AQLA 1GFCA 3KP5A 1A36A 4EAHD 2RV8A 3CJ7A 1ZHFA 1HD3A 4M78F 2ZFWA 2DDBA 1BN5A 4PJOF 3V7CA 1M90O 1E3MA 4PJJA 2LMJA 4K11A 3S2HJ 1HJDA 1RAFB 4C8QG 3LA2A 3OH6A 1N8RO 4L3QA 4AYBA 1VQLI 2E88A 4M3UA 2CH6A 3VQAA 2QTXA 2Y31A 1LWCA 3ZX2A 5IOZA 4EJWA 4BVPA 4IL6C 4PKIA 1Q81U 3GWZA 1M90C 1YAGA 3VJPA 2IVNA 1V3FA 4BRQA 2IJLA 2ZNYA 4CCJA 1N8RC 2GBZA 3HM8A 2YJFA 1ETOA 2BHYA 4XN0A 1STZA 2BXYA 4HNTA 3NAUA 1HKQA 5B3SH 5GAEJ 2K79A 5ADXH 1A04A 1LEBA 4IF4A 2QI2A 1RETA 3HTRA 5GINA 3EEQA 1WJQA 4WF9L 3H9JA 4M6YA 4BXUA 1T6SA 2EBPA 4DJAA 1POGA 5LFAA 3VYRB 2CUBA 2PUOB 2PZ1A 3WUHA 1QQCA 4BDPA 3OYCA 1UGRB 1DQUA 1NK8A 3CMAQ 3G4ST 4JKGB 1QWFA 2O9LA 2K86A 3NDKA 1NEGA 3O1BA 1WJBA 4Z6YA 1FY7A 4LITA 3G10A 4B9MA 5ICFA 3FK7A 2MW8A 3AAPA 1GLJO 3PM1A 2HKNA 4DV2K 2QTDA 4I9QA 2DK3A 1OH5A 1R5ID 3PX6A 4M77F 3TO9A 5K5RA 2PX9A 4DIQA 1X27A 3CP8A 5GPAA 4AHUA 4L8RB 5LRRA 2XAHA 2GFUA 4HUGA 2RNAA 1U45A 4DQ8A 3LFKA 1QVFA 3CMYA 1DGWY 2X3XD 3I64A 1O7LA 2VXDA 3MN2A 3CCRA 2M9UA 3E1YA 1MKMA 4XMYA 4CBXA 3QAHA 2OTJT 1A5XA 5BRFA 4M7DD 2XGCA 3M1CA 4MQVA 2CUZA 3ULDA 1GXQA 4CCNA 3CCEQ 5HDGA 1KAZA 3MEDA 1NJIO 4HCZA 3JCMd 3CETA 2YLCA 1QVTA 2H94A 3HTUA 3TARA 4YFUA 4ELTA 3QU3A 4F7UA 4IVNA 4IZ9A 2CT4A 3A5ZB 2YSRA 3MZYA 3CPEA 2CQXA 1FMVA 1JTXA 2O4XA 1NJIC 2NUTB 1JXOA 5GANe 3M0TA 1SD7A 3EHRA 3G6EI 5IN1A 2GUIA 3QEWA 3NRVA 2HW3A 2J05A 4LY7A 1KYWA 3I0TA 1ZYQA 4O44A 2LP5A 4WFNL 1RI9A 1J5OA 4Y28E 2MLGA 4CC3A 3I33A 1YW7A 2K5IA 3CC7I 3H08A 2KEAA 5GJWB 2KP6A 4QVCA 3LSJA 5AQPA 1S6QA 4C8QE 1YTUA 4AT1B 5A2QE 1HNWK 1VQ7T 4EJOA 5F0CA 2DCEA 2R7YA 1GCQC 1VAZA 1NK5A 2FBXA 2JA8J 4IEIA 4CEBA 4LUEA 3VENA 1S1TA 1NH3A 2H1KA 3LZIA 2HHTA 2HBKA 1QQOA 1NGHA 2KYMA 4DGWB 4Z02A 2XAUA 1TXQA 5GAOr 1UG0A 2CH5A 4B08A 1QZ6A 4CBWA 1O3RA 1SC7A 3M8SA 4J9BA 1TUDA 3CCUI 1T2KA 4XSZF 1F43A 3FIWA 2HL5C 1GLBG 1YJNN 3EKUA 2JTFA 1YG2A 2XI9A 1L3SA 3HOSA 5HY6A 2O4XB 1BI2A 3K0LA 4DZJA 5M1QA 1D1BA 3E9LA 2VGMA 4M42A 1X19A 2KRCA 2CV2A 1J5YA 2CFXA 4W5QA 3VYGA 3A03A 1O3QA 2GX9A 1RLPC 2MYSA 3VTHA 5E17F 4NO7A 2FYKA 4DR1K 4D1QA 4N0AC 3WTUC 3O4WA 2DZCA 2O2OA 1NGGA 5EG2A 3CXCS 2WBNA 1FOXA 3PUBA 3JCMX 3GXOA 4R1HA 4DQSA 3QEIA 4PNOA 2XB5A 5ICEA 2CYYA 3IQLA 3CCST 5DEQA 3NVMA 3CCRQ 3DPUA 1G2HA 1CKBA 3AVIA 1M90U 4ETSA 1YUWA 1LDKB 1QHTA 3A0BC 3JCMh 2R3SA 4C0ZA 2X1DA 3W6KB 2K85A 4OWRB 4EW0A 2UUZA 1TZLA 2EPFA 2QEXI 1WQ2A 5AQHA 2DA9A 1X9WA 3S2DJ 3TVTA 2WSFE 2A28A 1K6OA 1Z0XA 4ME7A 2IAIA 3VPRA 4FZZA 5CHZA 3A0HC 2RC4A 1ATSA 3LP3A 2AQFA 2ZCFB 3RTRA 1H3ZA 3RESA 2LG4A 2EILH 3CPWP 2EQJA 1P4WA 5E1WA 4DYCA 2C0OA 1VQ9N 2CWEA 1W9HA 3TANA 3F10A 4CESA 2QM1A 2GXGA 4HLYA 1K4TA 3VYUB 4I2PA 3BQYA 3E6BA 1T3SA 2WY7Q 3Q3SA 2M30A 2A3SA 2OX7A 4BBRJ 2FOWA 1N3CA 3E9PA 2RKIA 3KFWX 5LGTA 3PIOA 2J7IA 5T7BA 1TP4A 1KFSA 3S1MJ 4RTXA 4DV4K 3JSCA 1NJIR 4XTZA 2I7NA 3JRFA 3I56I 4CZKA 1E0EA 3TMOA 1WYXA 2KKZA 2NYXA 2EGCA 4OMMA 1YJWI 1BM9A 4AQYK 2IOCA 4IHTA 4JLGA 3LL3A 1MA9B 4M7DB 2D0PA 3KFVA 3H1CA 2DXUA 3KHYA 3QSUA 4AD9A 1XPXA 2R5AA 3TOBA 2FZGB 2V8JA 5LRSA 1OCTC 1VQMN 1XQPA 3OYIA 5CKBA 1ZRDA 3AAFA 1SPKA 2DOAA 1WJEA 1RR7A 3EYYA 2SRCA 3SYTA 1R6RA 3WU2C 3GFIA 1I8FA 4EIAA 3UT1A 2QYZA 2RQRA 1N5YA 2CW7A 1MSFC 4RCHA 3BR5A 4EMSA 2XVCA 4LF5K 2A5YB 1BI4A 1U4BA 4GBQA 3KWGA 3R0JA 3RVCA 2HOAA 1TUCA 3E6CC 3CMEI 4LD0A 4EEFG 1R58A 4KI4A 3DXKA 3DLRA 5DM7F 5LEKA 1TWFJ 3T0YA 3HDDA 4HVUA 2IPQX 1WHHA 4MNUA 1YI2A 4JI4K 1S9GA 1JB0E 3OBWA 5TJJA 2JJ9A 2LNBA 2JWTA 5M5YJ 4DV0K 3JRBA 4JI3K 3W6JB 4XH5A 3MJXA 4BC5A 1K76A 1U9NA 3MXMA 3CCJT 4ESRA 3ATUA 2FF4A 3F2KA 2NS0A 1A6QA 2E1ZA 2Q2EA 3WE3A 2ZXHA 1QVFP 3R6SA 3T1AA 1MMAA 2IGMA 1Z1DA 4OMNA 1LWWA 1FSHA 5JVGL 1BOAA 3L7WA 2OFIA 3UB5A 4W5NA 1AVZC 3O3FA 4P55A 1R4NB 3HRTA 5HS8A 3MXIA 5GAOl 5E8IA 4IQJA 2DRMA 4LF4K 1WJ5A 1JXSA 3E1SA 4YOWA 3A4CA 4OLBA 1Q82O 2QTVA 3GZNB 1DTTA 2XASA 4PKGA 3TL4X 3EH1A 1W36C 2VQFK 3DLKA 3F8MA 2CYZB 2EYWA 3PO4A 4FWSA 3CVSA 4HUEA 4HSTA 4Y0WA 3Q9VA 3C2GA 3CG7A 4DOWA 2LRQA 2QAZA 4B1YB 4FJ8A 3BR3A 1SEUA 3DAWA 3O5BA 3CQYA 3BCBA 3SAHA 4BUPA 4Z88A 1K78A 1Q82C 3DXKB 3M8JA 1I39A 2LKPA 2FSNA 4PJNA 4YOYA 1H641 1GVDA 5LD2C 3QZ5B 2P5GA 2K9LA 3VS0A 1ZX6A 3EH2A 1E6GA 1WJFA 2KKOA 2VJJA 3CP2A 1TQPA 4H0XB 1KSWA 2O61A 2J6KA 3LH5A 2AT1B 4L5JA 1UHWA 2LDUA 2HF3A 2KZMA 2IIMA 5IWAK 3PO2J 2YU9J 2K3FA 1KFDA 5HK3A 1YJ9N 3VS4A 1VSLA 4HTLA 5GAMg 1HW5A 2BUPA 5IT9K 4H5NA 3O1WA 1FZPB 1YP5A 2FX0A 3LP1A 3M0RA 4DSEA 3CXCA 3J7AP 3E5UA 1FIAA 5TGTA 1VQPT 3ML6A 5CK9A 5DCMA 1D8JA 1HYVA 2UUCK 4N41A 4AM7A 3MZ8A 4M75A 3VF2A 1HKTA 5GMKj 1ZRFA 3NARA 4Q4ZF 1ZRCA 2Q0OA 1SKSA 2X9HA 1MV0B 4Q48A 1EX4A 3U4LA 3HRSA 4YORA 4KIFA 1OI1A 4F7UF 4IFVA 2BY3A 1XOVA 3TEDA 4QPOA 2LK2A 2K9MA 1EH7A 3CCQA 4LFAK 2AP1A 1K78B 1ABQA 2RAEA 2R7WA 4F92B 4GYIA 1Q18A 4O8UA 3HSCA 2MWPA 3DKXA 3LSRA 1IBMK 4LH4A 4CZHA 2KR3A 3ASMA 1SVMA 4GV9A 2SEMA 3FJPA 2XY5A 3HO1A 1YHQI 3S1RJ 2EINH 4ZDOA 5FGMA 2HXOA 2RJCA 4ISGA 5IHNA 3ELKA 1TWGJ 5D6XA 3I55A 1QBJA 1IRGA 5CJ9A 2E71A 4BHBA 2GBYA 4EJTA 4ZTJA 4FASD 3A0IX 4AIDA 3HOVJ 3RKQA 1V5EA 2JZ2A 4E7HA 2QWLA 1K8AR 2Q36A 3IMXA 4ZTFA 4DBHA 2RA2A 3R1XA 2X4YA 3L3UA 5EZHA 1B59A 1IB8A 3VEOA 3J7AF 1VQLN 1VUBA 2RQPA 2HD0A 3MVPA 1HSQA 3NHNA 3WTZA 1MMGA 4Y3OA 5DCMB 3EKSA 2M16A 4A62A 5FD5A 4M75B 4HUFA 1JQQA 2V6CA 4BR4A 4YFKF 3KZYA 4D5CA 1Z26A 1UHFA 3SJMA 4IRGA 1KZHA 3CCVA 4YY3K 2K4BA 3VGLA 2XPWA 2GIVA 4F16A 4B43A 1IRFA 3QDRB 4IWVA 3H0DA 1KQ1A 5A0DA 1WLJA 1TL3A 2G0EA 2ZC2A 1JLEA 1BC7C 3CCMT 2D4WA 4MDBA 2V6EA 4F55A 1REPC 1FSEA 1RT7A 2LCCA 1USSA 1D8YA 3F72A 3V4GA 3V81A 2TRTA 4CF1A 4JBAA 4BHCA 5J2MA 3Q7BA 4G8XA 1S7OA 2LCLA 4CEZA 1RIOH 3OMCA 4RAZA 4FW2A 5CYVA 3I59A 1UMQA 4DS5A 2HHHK 1HJRA 2F8SA 3F73A 2YS9A 3F22A 2YPRA 3A2KA 3SV4A 4HV5A 3FXKA 4YTLA 5GTIC 2RN7A 3H3ZA 3VODA 1YFHA 3QU6A 3EAEA 3VQ9A 4M7AG 5GAN8 1FTTA 4RBOA 1KQSM 5EDNA 2HDWA 4CE9A 4CCOA 4W1UA 4WTOB 2CUEA 1JCGA 1VIFA 1NYGA 5KGXA 2EQIA 3L00A 5EX5A 3RZDJ 3ZX3A 3EUHC 2Z99A 5LJ3g 1P90A 1R0CB 3K9KA 2O8EA 1SD6A 2YHAA 1D1CA 1MUZA 3M0UA 1D5VA 3ZYYX 3FZVA 2DO7A 3VQBA 4YRVA 3T1HK 1KAXA 5GAMe 4Q47A 5ED4A 4AG1C 1WHLA 1IO6A 2RQUA 2YDLA 1NG2A 1WEGA 1OYIA 3EE9A 2X9DA 2W10A 1TW2A 1KU9A 1XSVA 3DV8A 1TH7A 3O8VA 2HQHA 1BU6O 2FBYA 1ZSGA 4FWMA 1IG9A 3CC2N 5CYMA 4ELUA 1KU2A 3S1NJ 2HS5A 4QSHA 4RMOA 5KN9A 2X6WA 3TQ7P 5C2FA 1Z77A 2CSQA 3AVAA 4K8XA 1IN8A 2KL4A 1HUXA 8AT1B 3CCQQ 3SFIA 1BCOA 4JJDA 4EW4A 4X9DA 4B3AA 4DMNA 1VQNT 4JK9A 2LR8A 4JX5A 1EH8A 1KD1O 1X1DA 2QVOA 1JGSA 2R7TA 4E3SA 3M5RA 1C0MA 3I35A 4JLIA 3PIOF 2JA5J 1GV2A 3BOQA 4N9HA 3G6EN 4XLEA 3OYGA 3SZGA 1IN4A 1VQ4Q 3I55Q 2O7OA 4C92G 2QLZA 3M1FA 1D9DA 4LLNA 1QHAA 4EMGA 1OZ2A 2HOSA 3QLHA 2GFAA 1KD1C 1VQOT 2GV9A 2Z3YA 4KGVB 4EVVA 2BUDA 4C8QD 5LJWA 5HNHA 3CC7N 1GBRA 5FLXZ 4CRIA 5EY4A 3DWLA 1WHKA 1USTA 4KBMB 4XR6A 2O8EB 5I2SA 3BDPA 3MKLA 3QOEA 3PMTA 1ETWA 2W84A 3CCYA 2MC4A 1U8RA 1PCXA 2E1OA 1SRMA 3L2CA 1RRQA 4BR2A 3R6OA 3MCAB 4J9EA 3KK7A 5KYWA 2GTDA 1JI8A 1XMXA 3G0ZA 2JVGA 3SWNC 1BUPA 2DPPB 4HQMA 3IFRA 3EFSA 3CCVQ 3GF2A 1XHZA 5L3EA 2LKXA 2HFHA 3RI4A 1QE1A 3RSEA 2XAJA 4CJSA 3VEPA 1RR8C 4DCHA 2TDXA 2BTFA 1FKPA 3BE3A 3ZLJA 2VWFA 4X65K 4AFQC 3SPZA 3CCUN 5BOXA 3RKXA 4MEXF 1B9MA 2R7SA 4A53A 3K4JA 2FJ1A 1N25A 5HP1A 4LSNA 3W3DA 4MFEA 5DUKA 3C7JA 4BL0B 2M0OA 3VV0A 4MO7A 2G6FX 2GNCA 1DKGD 4ON0A 5C12A 2DETA 4I99C 3VESA 2P9NA 4RDUA 2DL8A 3VS2A 3U9DA 2DKGA 4CGFA 3HK2A 3WG7H 4DR4K 1N34K 2HSPA 3G71T 1ZC6A 4M7AE 1QCNA 2M7AA 1RACB 5E20A 2JTEA 1LAWA 5D5VB 1G5VA 1IN5A 3K1PA 1HQCA 1WCMJ 4M78G 5FRMA 3KK1A 1N6QA 3ZT4A 4HTUA 2DODA 4PJOG 2V52B 1Y1WJ 4RW6A 1RT5A 2C6YA 3M0QA 3ZOBA 2JW4A 4V19S 3CXCP 4OVLA 1YJNA 1PD0A 3FWEA 4XLPF 2CT3A 5KE3A 2HDDA 5J39A 4FOEA 5KYWB 3NPFA 4OAYA 3O6WA 3KLOA 5ICCA 2WB1N 4A3EJ 2F7TA 3NGZA 5EZGA 2KVQG 3GO5A 4CFCA 2RKHA 5LJ3e 3GIBA 1BYMA 2D9TA 3RSEB 4M7AC 1P92A 3D1NI 2FSJA 1BR2A 5B1AH 2J5PA 5DD4A 1U3OA 2VLAA 1JJ2S 1GCQA 3AVGA 3C7NA 1IXDA 1G3TA 2HR3A 1WAFA 1CF7A 4E9FA 5HLGA 4A5BA 1EETA 1TL1A 4FWRA 4OMOA 1QKXA 1S9EA 2IS6A 2P9NB 2EFPA 3H3VK 3K4MA 2DPUA 3H41A 1JXMA 2WTUA 3LNQA 3EPZA 2FRYA 4C92E 2FPFA 3QNOA 3JSMA 2ZJPF 3CUOA 4CHYA 2K2MA 4MDAA 5C4XJ 3I56N 4M77G 3WQTA 3IRQA 3C2HA 5EGOA 2D1HA 3H1QA 1NJYA 2O4IA 2VBZA 4DZPA 2R7VA 2ZBKA 4BC2A 4J2DA 2FBHA 3NQOA 1D0XA 3IHOA 2H8HA 1KK7A 1NGJA 3MEXA 2B86A 1MUDA 1ZUYA 4AI5A 4HT8A 2NLXA 1LAVA 4J9IA 3VYHB 1GLAG 2R92J 4M75F 1VQ9A 1WEFA 2P4WA 3I4PA 5BPIA 3PMIA 4AIHA 4PFZA 1HNXK 1QO0D 2WA0A 3VQEA 3KVGA 1YNZA 1Z25A 2E19A 2HNHA 1YIJN 3GPLA 4Z4CA 5LJ5j 1VRUA 1X6OA 2OPSA 1PVEA 5LHIA 2KT0A 2A36A 3C7NB 2E36A 4H0EA 3K2ZA 4G6DA 1BU1A 1CF7B 3JRHA 3OA9A 3KLEA 4IQ4A 5CCAA 5KQDA 3M57A 4X1EA 1NMNA 1SMYF 2LY2A 5DPKA 5IT3A 4IOCF 3IWZA 4NB5A 3CMEN 4CI0C 1UZCA 3OSVA 2XF7A 4YIFA 4YELA 1TW3A 1RUWA 3JB9F 2ENMA 4H8KA 4WK8F 1J9AA 4GMJB 4DLGA 3THXA 1M5Q1 2W4SA 3OYMA 3VUZA 1Q86R 1VQMA 1S72Q 1W36D 1PHTA 3QG1A 1Y96B 2VG7A 3A01A 4UQGA 3FXOA 1ZGJA 5EGOB 1QHGA 2H8WA 4M78E 2WADA 2RPNA 4UUSA 4BB7A 4LC9B 2QBYA 2GUPA 1XX5A 4G7OF 4UXNA 4QWQA 4J7IA 3UIQA 5FKKA 1L3TA 1ILYA 1WXUA 1YJNQ 5DYMA 2WUSA 1HA8A 1O3TA 3P9IA 2GEMA 4H0TB 2OFKA 2VJ5A 3O9RA 2QYOA 1RGIA 4WQ5A 2J5OA 2HBLA 3KEOA 3H3UA 5F2RA 4Z94A 3FZFA 2FOKA 4J6WA 3FXQA 4CBUA 1RAAB 3DQVC 3BJ6A 2GZWA 2CP6A 4XLHA 4KUIA 1MNEA 3M3ZA 3DLLA 3NVKA 1BR1A 4GDFA 5B1BH 4FYYB 2L9RA 3JTHA 3BTJA 4IG0A 4PJOC 4XQ3A 5CKFA 4A2AA 3CO6C 4D8DA 1VSJA 3BEXA 4MFDA 2UV1A 1B72A 1RT6A 4EGYA 2YRCA 1K73R 3CCSI 2Q2RA 4FJHA 2XRIA 3PY8A 3THXB 2RVCA 1XD7A 5GAMd 4A59A 3R60A 3L2ZA 4FWNA 3B8AX 1MBKA 1S8NA 4YIRX 1KQ0A 2VG6A 4QS7A 3FFIA 3A01B 3I53A 2EQMA 3BDLA 5ILVA 4RKUE 2L9NA 5KYXA 2M02A 2XDVA 2AS5F 4M77E 3WU0A 5IYBJ 4UUSB 2ZXJA 4PJLA 4ORZA 2MAMA 3LWLA 2QBYB 1GFDA 3GW2A 1GLEG 4Y7NJ 2KISA 1QZZA 2BZYA 4HA8A 1KRPA 2DYRH 3ID6A 4BVOA 4KTZA 2GQIA 4DNCA 4CZGA 2UWMA 3GTLJ 4KIGA 3META 1VQ9Q 2DZ9A 3KNTA 2OZUA 3DMJA 3HSFA 2UU9K 1RTHA 1IW7F 2WBMA 2PVGB 2E41A 4C30A 2DMPA 2COZA 3PV8A 2ID6A 2RQVA 3X2QH 2Y4XA 1EIFA 3UPUA 2MIOA 2VBWA 4ZGDB 1YRNA 1R22A 3K4LA 2BW3A 3LAMA 1X01A 2XAQA 4JRIA 4A2UA 1KQSP 4UY8I 3EE8A 4XEIA 3KZIC 3G1MA 4XKBA 4JOMA 5CQGA 3QPTA 3LWIA 5JLFA 4CD3A 1EJ9A 2XY8A 4ZGEB 1D8KA 4KBOA 1M1KU 1NK6A 1B72B 2HF4A 3CJQB 1YWOA 2DPNA 1JJ2A 3RMSA 2A41A 3BZCA 1WUAA 4DBQA 3SUQA 4DSJA 5EXWA 5D8LB 1SS6A 5KE2A 3PFYA 4EM1A 4GRIA 4E1JA 1XTDA 4CHNA 1XJWB 4A4KA 1VQMQ 2F5TX 2CGJA 2G9WA 4IPAA 1YHQN 3F6OA 2IA0A 1YQAA 3ERED 2QK0A 1U48A 4OFHA 5KYXB 4E19A 4HX7A 4DBRA 3QETA 2ESHA 4HW0A 1QSLA 5CO7A 2WAQA 3LA3A 4YDUA 3ABKH 2HQ5A 1K83J 5KYYA 2MOXA 1REVA 1VYTA 1JLGA 3JAME 4FM2A 1R36A 1X6GA 1DLOA 3TSZA 2W25A 3TAPA 2D5VA 5CKTA 1KG6A 2CUDA 2H6BA 4G1QA 4FWQA 5SWMA 2HI3A 1T38A 2IS1A 4UC4A 3J80E 3QYFA 2MWOA 3VTIA 3LGLA 1XMKA 3FC3A 4BGDA 4L6V5 2DL4A 4OIQF 5GANj 2L3DA 1MBGA 1YRNB 1QNTA 2BW3B 3FZMA 1K79A 4LOCA 5D4SA 3I58A 2M4GA 4B44A 3D0SA 4BRGA 3X25B 3CCJI 4OIOF 4FLWA 2R7RA 4E9EA 3J80O 2Q0UA 3ZSVA 4CJKA 1KLNA 1LKXA 5GAMh 5FPMA 4MHGA 1ZLJA 4QQDA 3H6ZA 1XC5A 2DL5A 2V9KA 3KP6A 2ECZA 3M8RA 1VQLA 1C1AA 1T0JA 3MMYB 2ZCWA 4MLHA 3K59A 1SG5A 1H8KA 3K70C 1WI9A 3RYRA 4M63C 1B07A 4CHUA 3HEFA 5LJ3d 4PQUA 2ZM6K 4KHQA 3OIPA 1AOYA 3ZETA 5H2FC 4M3TA 2DJZA 3RZOJ 4FWLA 1BI0A 4CCKA 5GAOn 4LD5A 4UUVA 5KYYB 4K2EA 4LDWA 2KJBA 1E17A 4OINF 2JJ7A 1K7AA 2CP3A 1W5CC 1YJ9T 2VBXA 1MJAA 4KN7X 4DTMA 5FLXO 4CJPA 1YBYA 5IT9Z 2V1DA 1TQMA 4V19K 2XHBA 2Z1HA 1Y39A 4C23A 1U6ZA 3E66A 5JLHA 1N32K 2E6NA 2VG5A 2DX1A 3Q7CA 4HG2A 3CWTA 3H0FA 1IGNA 1F1ZA 5GPCA 1X3WB 4CERA 2PG4A 1T0FA 1QCOA 1PD1A 1BQNA 1H9GA 1ONVA 4PZJA 4E1MA 4KFBA 4KFCA 3OIQA 4NLCA 4X62K 4OLAA 2NOEA 2VV5A 2TCTA 1J75A 1BWFO 1HW2A 4WCIA 2IVWA 1NK2P 5AQMA 4FJXA 3KD5E 2VASA 2EVRA 2O8BA 4BRNA 4Q5VA 1WRJA 5KI6A 1BA5A 3H5AA 1VQPI 2ZQBA 1HKBA 3MAJA 2OQGA 1IUYA 1WOQA 2X48A 1QCFA 1ZREA 1W2BM 1P7JA 3L2QA 4FW1A 1YI2I 3ZETB 3RR6A 5KAIC 4GVMA 5HLFA 4FTHA 5TRDA 2PFBA 4EJZA 2OA8A 3CC2A 2XD0A 3E97A 2B0LA 4KHPK 4CGGA 3NH0A 3FF5A 3BG3A 3VQDA 1S29A 3HGGA 2E3HA 4DR3K 4ZYHA 4M3WA 5GAN5 3LFUA 3K69A 1XHXA 2DT6A 4XU0A 1K4SA 1Z91A 1CGPA 3HOYJ 1VFCA 4BI8B 3SFZA 1Z05A 3DEWA 2OBPA 4YG2F 3HOTA 5C10A 2VIXA 1LPQA 3G7ZA 2MA3A 2D0OA 4CEDA 3C94A 1LVAA 1V4SA 3M55A 3OW2M 5BR8K 2MSYA 1J7KA 3SQNA 4MO4A 5J6XA 3CBPA 3KTUA 2EFNA 2ZNZA 3F6VA 5GAN3 2HPMA 4HBLA 3MKZA 3EUHA 3GF5A 3BUZB 2O8KA 3G6EA 1M27C 4JZ4A 2FBKA 1J54A 3FM5A 1Y57A 1NM1A 4OX9K 1Q7YR 1SHGA 2P0PA 5J2PA 3CQXA 4R5PA 1S3JA 4PJMA 4F7UG 2D0BA 3GTKJ 3RRHA 4KHUA 3VF6A 3SPYA 2WONA 1SFKA 2IAJA 2VQHA 3CM6A 3CC7A 4B9SA 4BJ6C 2AXLA 3HP9A 5DM6L 1FX7A 2P9PA 1MZBA 1VQLQ 5LJ3h 4FJNA 2QXLA 2R57A 1TC3C 5FFXA 2O8BB 1FT9A 4OPJA 1W7PD 3X20B 2ROLA 4JKHA 3A8HB 3F21A 1U49A 2I5UA 4M7AD 4O0JA 3I0RA 4C8NA 1NLPC 4EGZA 4XRMA 5KNLA 2XF5A 5JMVA 1WPKA 1N27A 2RHKA 1XN7A 2R4GA 4P5NA 2F9WA 4YFXF 2B7EA 1ORNA 3A5NC 3QIIA 2QA4T 1LOTB 4FYXB 5CYQA 3CCMI 3KK3A 3SUOA 2YU3A 3SZ2A 3CCUA 3HYIA 1R59O 3P38A 1GOBA 1IC8A 5J4YA 2GQVA 4B9TA 4R0KA 4OAZA 3R0AA 1JE8A 3O4NA 3MEVA 1RUOA 4EA5A 2BV6A 1WSGA 2O8XA 2RQQA 5CHIA 3KYDB 4NC6A 3DLLF 1QU3A 1M1FA 2ZPIB 2NYSA 3G4SN 4F9OA 3MWTA 2LDMA 1EFNA 2HNYA 1OH8A 4DLEA 4PUSA 3LWHA 2DAOA 4LD6A 1G3WA 1W5TA 2N8GA 1MMNA 1PU7A 4E1NA 4A57A 4XTXA 2P7CB 1T95A 5LGUA 5HNFA 2XDPA 5HRNA 3SWNA 4CEQA 2ZJRF 2NS7A 4UOBA 1A5JA 2P9PB 1HC8A 2O0YA 3QBXA 4CFAA 1C0WA 4IXCA 3A5OC 4K25A 2WB1A 4DS4A 4DQRA 1OCCH 2E64A 3NWSA 1VI0A 3QZ9B 1JBMA 2OTJN 3CC2Q 4G6QA 4D5FA 4MLEA 4XH1A 2BHZA 2D1KA 3F8FA 1D0ZA 5IYCJ 2E3IA 1FW6A 1I1GA 3ZSZA 4I76A 4N4OB 3D6RA 3DRSA 1RDUA 3IWFA 5KYUA 2FBTA 3VEWA 4E0DA 1UWBA 2D8HA 1VQNI 1TT0A 4CJ4A 3K4NA 1ABOA 3ZP5A 4M3BA 4WFBL 1A35A 4OF1A 3HGYA 3WGHA 3LZJA 1WSEA 5JLXA 1KXPA 2KFZA 4KRTA 4OB0B 3M4YA 3J7AY 3G6EQ 1WQWA 2QM3A 5FJ8J 2P9UA 3DPTA 3HOXJ 5HLHA 2KPMA 3K2PA 3ZMUA 2DXIA 4XH4A 2HSTA 3K6GA 3AVBA 2DT7B 4JLHA 3MEEA 4F7UE 2PTKA 1FOKA 2XHKA 3CCVI 3P7NA 3E9FA 3LSMA 3BDUA 3I56A 3KYLA 3CBMA 3SWNB 1VQ4T 4IURA 1VQOI 2RK1A 3CC7Q 5GMKl 3VEYA 4JAXA 1QZEA 2P4RA 2DY4A 1KG5A 3QPLA 3EGDA 3GBGA 3PNYA 1VQ7N 1IRZA 2H3EB 2FRHA 2R7ZJ 4L9JA 1EF4A 1YIOA 2L54A 1B9NA 2RHYA 4JI6K 1UTIA 4C8KA 4MZMA 3JCMV 1KTQA 3LYIA 2OA4A 1WB9A 2RF0A 2DTHA 4D9JA 2VE9A 4KT5C 5M1OA 4PJOD 4FLVA 4HCCA 2DI3A 4L0YB 4E2FB 3P8DA 4BE2A 4NCAA 3L3VA 1MMSA 4FIBA 3CCUQ 2VWBA 4BWMA 5LLQA 4LDUA 4KN4X 1NGAA 5KYUB 1M8MA 3S14J 1WEIA 4BI3A 1B4AA 2JTMA 4DV6K 3VYTB 1ATNA 3CMEA 3N4QA 2JPSA 4E7KA 5JICA 2BTTA 1UAAA 1RLQC 1DPUA 4U67L 3TAFA 3KJVA 2EH3A 4BGAA 2KDZA 1N36K 2EKOA 4OGCA 4CH7A 1M8VA 2XRLA 4HRIA 4DV7K 3RRGA 2P9UB 3KCCA 2CREA 1R00A 3J7AO 2F4OB 5DM7R 4Z4EA 2GAUA 3G71I 1RDWX 3HFOA 3QWXX 4FLTA 1JLBA 2PJRA 2X3WD 1QRYA 3GTGJ 2XGXA 2PVOB 2EJGA 4DHYA 2V1UA 1LMZA 1W7PB 3FXRA 2EA2A 3BR6A 4KYWA 4CC4B 1QQJA 2MLKA 3AVCA 4GLMA 2DLLA 3Q5FA 2BZXA 2YUQA 3CCSN 1Y0NA 4DU1A 3TOAA 1QZ5A 1EP4A 3SQ2A 2LC4A 4DTOA 4Z8AA 3CFRA 4AFUC 4XU2A 2DFUA 2ISZA 4C5IA 3JTGA 2DMOA 5A0LA 5HRRA 1GT0C 1K9MO 2PMUA 3JSOA 4MO5A 3DLGA 2EQRA 3HB9A 3FHNA 3MP1A 2QEXQ 4FVUA 2HHVA 3AA5X 5CZ2A 1WI7A 2BE5F 4FJKA 4F04B 2FPDA 4ENMA 1HK9A