3OYDA

Crystal structure of the prototype foamy virus (pfv) intasome in complex with magnesium and the insti gs9160
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
368
structure length
368
Chain Sequence
LDAELDQLLQGHYIKGYPKQYTYFLEDGKVKVSRPEGVKIIPPQSDRQKIVLQAHNLAHTGREATLLKIANLYWWPNMRKDVVKQLGRCQQCLITNASNKASGPILRPDRPQKPFDKFFIDYIGPLPPSQGYLYVLVVVDGMTGFTWLYPTKAPSTSATVKSLNVLTSIAIPKVIHSDQGAAFTSSTFAEWAKERGIHLEFSTPYHPQSSGKVERKNSDIKRLLTKLLVGRPTKWYDLLPVVQLALNNTYSPVLKYTPHQLLFGIDSNTPFANQDTLDLTREEELSLLQEIRTSLYHPSTPPASSRSWSPVVGQLVQERVARPASLRPRWHKPSTVLKVLNPRTVVILDHLGNNRTVSIDNLKPTSHQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular mechanisms of retroviral integrase inhibition and the evolution of viral resistance.
pubmed doi rcsb
source organism Human spumaretrovirus
molecule tags Recombination,viral protein/dna
molecule keywords PFV integrase
total genus 108
structure length 368
sequence length 368
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2010-09-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
A PF17921 Integrase_H2C2 Integrase zinc binding domain
A PF18103 SH3_11 Retroviral integrase C-terminal SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2300 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3oydA04
1.10.340.70 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Endonuclease III; domain 1 3oydA01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3oydA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3oydA03
1RI0A 3MP6A 4RW7A 2OA8A 4CGJA 3OS2A 4E7IA 4OLAA 3BGRA 3SJJA 4MFBA 3RR8A 2EQUA 1IH7A 2B5JA 2XK0A 3TABA 5CYMA 1RDAA 3E9GA 3MXMA 3MECA 4H4OA 2O4XA 3L3VA 1XHZA 4QCLA 4ZTFA 5FDLA 2G8FA 4R5PA 1WNSA 1TV6A 2RHYA 3AVKA 2KFZA 2FBYA 4DLGA 2F8SA 3O8VA 3I0RA 2GUIA 5KE2A 1REVA 1SKWA 3NTHA 4F2SA 1LW2A 4KV8A 4X34A 2G8KA 3ZSRA 3FLGA 1FXXA 1J9AA 4J2BA 5K14A 1KFSA 1XC9A 3AO5A 4NCBA 4QQDA 4CGHA 3OYLA 3PUFA 4FZZA 3ALYA 1RT6A 1RBTA 4C8MA 4BWJA 4RG8A 1H3ZA 5HP1A 1OI1A 3TAQA 1NKCA 1XHXA 1OZ3A 3NH0A 1LAVA 3P1GA 2BANA 4CF9A 3I0SA 1Y97A 4W5QA 3OJUA 1KVAA 1SV5A 4DQSA 3TWHA 5IAYA 2EQJA 3LH0A 2DFFA 3VQAA 4BD3A 2B6AA 2W42A 4N41A 1I39A 1NJWA 1RT4A 4KHNA 2KZMA 2RI5A 4N4IA 1D9DA 4N47A 3TANA 4EZ9A 1TK8A 3LLRA 1F21A 4BDYA 3LZJA 4CEZA 4DS5A 3DLKA 2VG6A 3S9HA 4BDPA 3D0PA 4FLUA 2HHWA 5CIUA 3OA6A 4OGCA 3OYNA 3KLFA 4FJIA 4CEFA 4QQ6A 3UWNA 2MWOA 2M0OA 4H4MA 3CQ8A 1NK0A 3AVIA 2BE2A 4LY7A 3LGFA 1ZBIA 3RTVA 5J2NA 5HRNA 2HHQA 3SI6A 4DQPA 1B9FA 1T03A 4DQRA 2XDPA 3OY9A 1B92A 3GOXA 4N5SA 4LSLA 1VSMA 2O4GA 3ZSZA 1X9SA 4OPJA 3OMCA 4DSFA 4DSLA 4FJ5A 2EFIA 4FJ8A 2IS3A 3DB3A 4AH9A 1ASWA 4DTNA 3LWLA 2YV0X 4E89A 1X1PA 4RW9A 4AHUA 3VQ8A 1S9GA 3NFAA 4B9MA 2OZSA 4DQIA 1JL2A 1ZBHA 4E1NA 4I9QA 3ZSXA 2D5RA 1Q9XA 1RCHA 3MO8A 4ICLA 4B9WA 4IKFA 1JLEA 2GBZA 4CEOA 4FLXA 2Z1JA 1OZ2A 3DLEA 1WSEA 4M3YA 2EX3A 4OKJA 1A5WA 3FC3A 3KKSA 1N6QA 3K2PA 2Z1IA 3H08A 1TL3A 4C8LA 4CK1A 4ZTJA 2X78A 4FJLA 3AVAA 1WSHA 4OKEA 1U49A 3KD1E 1YVUA 2A1RA 1T05A 1WSIA 1KHCA 2F96A 2JLEA 2PYLA 4F3TA 5IN1A 4F2RA 2BKDN 2E6NA 3VQ9A 3MAQA 3MEAA 1BCOA 5J2PA 3KLHA 1QTMA 2CKKA 5HRSA 4DQQA 4KREA 1O1WA 3MP1A 1NK7A 4C8OA 4E7HA 4FL6A 1RDCA 3AV9A 5J2MA 1S6PA 3AVCA 1HJRA 3V1QA 4B8AB 3OJSA 4HUGA 4Z4FA 3NGIA 3HJFA 2RJEA 2RO0A 2KFNA 4E7JA 1VSHA 4HHTA 4BACA 4CE9A 1RNHA 4IUTA 3NBPA 1JLBA 2GV9A 3PNWC 4CEAA 3HXMA 2NLUA 1NJZA 3KUFA 4Z4GA 3KIOA 3V6DA 2M1HA 2DFHA 3FFIA 1EXQA 1RT5A 1ASVA 2YNFA 3AO1A 1BCMA 2ETJA 1WAJA 3P5JA 4Z4HA 4IUVA 3OYGA 2B4JA 4DG1A 3VQ5A 3HM9A 3ZT4A 2HHTA 3P8HA 2DAQA 4LD6A 4KB0A 2VG7A 3M8SA 3K58A 3QEIA 5I42A 4M42A 5JS2A 4ELVA 4AHTA 3V9UA 4M45A 1BHLA 3SD4A 3LZIA 3ASMA 4DWIA 4YNQA 1LW0A 4ZHRA 3OYDA 2ZE2A 3ISNC 4OVLA 2R7YA 3SQ2A 3SCXA 4KI4A 3V4IA 2Y1IA 3ULDA 1GOBA 1RTJA 2D0BA 3HSTB 3AVLA 3NTIA 2RF2A 4CF2A 3SUNA 1EX4A 3U3YA 1JL1A 4O55A 1NJYA 4OVAA 1LWCA 4DTUA 2Q3SA 4CHPA 5SZTA 3OMGA 4L59A 3G0ZA 1UA0A 3DYAA 1TK0A 2XY7A 1TKDA 1NK9A 2K3XA 1UOCA 3AVMA 3JYTA 3SPYA 4K8ZA 4FJKA 4NS5A 4G1QA 4M3TA 4OJRA 4CHNA 3NGYA 4FVMA 5KRTA 3PV8A 3DLBA 5HRPA 4LH5A 2XY6A 3PMTA 4O4GA 4KKOA 1SUQA 2IG0A 2RHIA 3SV3A 2G8HA 4KPYA 2LVMA 4M3UA 3OVNA 3NH1A 2HHSA 3JSMA 3SUOA 1L3UA 1EP4A 4CEEA 4FK2A 3KKRA 2RJFA 5KGWA 3B6PA 4Z02A 2Y1JA 3QO9A 1U4BA 3ZSYA 4CJLA 5KE3A 3AVFA 1MU2A 1HQEA 3TAMA 4PL6A 3L2WA 3QESA 3RWUA 4FYDA 2E6LA 2PYJA 4CHOA 4CGDA 3SNNA 2BDPA 4CJ5A 1XNIA 2RKIA 3C6UA 4FJHA 3C4SA 2OPRA 1Q9YA 1IKYA 2HB5A 2VG5A 2JTFA 4I7FA 3OYEA 4BDZA 1C0MA 2FBXA 1RDDA 2YHAA 4IBNA 3QNNA 3VQPA 5SWMA 1W0HA 2DIQA 3MEVA 4C5HA 3WNHA 3L8BA 1QE1A 1BIZA 2HNDA 4CHQA 4PQUA 4FJNA 1W9HA 4Z4CA 3K5NA 3NAEA 3PO5A 4C8KA 1TKXA 5JS1A 4CGFA 3KJVA 4A4GA 3RR7A 4B9NA 3ME9A 3F70A 2FC0A 1VRTA 1ASUA 3DOLA 3QIOA 3VA0A 4JRQA 2DIGA 3E9FA 4C5EA 2ITGA 4YFUA 3PX4A 4CRIA 4AILC 4FK0A 3HYFA 4M3XA 3Q1JA 1UWBA 2YKNA 2QKBA 1NJXA 1VSDA 4E7KA 1NKBA 3CFOA 4CJ3A 4IFVA 5CZ2A 1RT1A 3O4QA 2XRIA 4BE0A 4OKKA 5C25A 4OGEA 1WAFA 3V9WA 3EZ5A 3S6WA 4B9UA 1NKEA 1HYVA 4CGGA 4CJRA 4DTOA 3P8DA 4Q0BA 4XIUA 4A4FA 4DFKA 1ZBUA 4UC4A 4FJXA 1HYZA 3DLHA 4QW2A 4C5GA 2FBTA 4CFAA 3ZSQA 3AVHA 1LAWA 4II1A 1QS4A 3ZT1A 4QQGA 1EKEA 4KHYA 1S1UA 3OB9A 3META 3IS9A 1A5XA 1S9EA 4CGIA 4PY5A 2OZMA 2HVIA 4DFJA 4FLYA 3HL8A 3M8QA 4C8NA 2LDMA 5KH6A 3QJ6A 1BIUA 3U6FA 1NOZA 3V1RA 4KFBA 4Q5WA 3QKJA 4AHRA 4CJUA 3MXIA 2PZSA 2WACA 4FM1A 5C42A 2B8AA 5E41A 4O0JA 4KHSA 4DFPA 4KI6A 1X9WA 4CJ4A 3CM6A 1HNIA 4NYFA 4CFBA 3AVGA 4DTMA 3LAKA 3QETA 4J2DA 3MEEA 5C0MA 4KRFA 1ZBLA 3F9KA 4DTSA 1I3AA 1RTHA 1T7PA 3FEOA 1WSGA 5D6XA 4EDUA 2OYQA 1BL3A 1HNVA 2F8TA 3H8ZA 3VQCA 4NZGA 4KHWA 1S1VA 2X35A 4N56A 4KAZA 4KTWA 4N76A 5C24A 4HTUA 4B9VA 1JXEA 3C6TA 4CJWA 2O4XB 3ZT3A 1CXUA 4B8CA 2VWJA 3RRGA 3LGLA 4B08A 4CJKA 4Q5VA 5KCHA 3O3FA 3PX0A 3L2UA 1UA1A 3S3MA 3NCIA 4FJJA 2PY5A 3ZCMA 2RHZA 4DTJA 4DTXA 2RHXA 4FK4A 4F3OA 1WJRA 1SKSA 1D9FA 3OS1A 1JLGA 2RHUA 4N4GA 4B9SA 1BQMA 1RBSA 2ZD1A 3AO4A 4LH4A 3FDRA 4DF4A 3SPZA 1KFDA 3K5MA 3OS0A 1RDBA 3IRXA 1RTDA 4UQGA 4DLEA 3THVA 4CECA 2G3RA 4A4HA 3AVBA 3SV4A 3RRHA 1L3SA 3L2QA 4KB1A 1KRPA 4Y1CA 5KCOA 3S3NA 4DFMA 1VSKA 2M16A 2KZZA 4W5OA 4Z0UA 3NH2A 1KSPA 4FJMA 4O44A 3KK2A 2HHXA 4FLTA 2IDOA 3IAYA 2X4WA 4EZ6A 4DU4A 3T1AA 3KK1A 4CF1A 3ITHA 1Z25A 1FKPA 4O5BA 2PQWA 4ID5A 1KVBA 2RI3A 2RPIA 2QKKA 4Y1DA 1YT3A 2R58A 4KTQA 1ZBFA 4H8KA 2DTUA 4CF0A 4FM0A 1VSJA 1B9DA 1VSLA 3LANA 4PLIA 5KI6A 4CF8A 4PWDA 3ZT2A 4PA1A 4J2EA 1TAQA 1VRUA 3HP6A 1VSEA 4J2AA 2A1SA 1U47A 1J53A 4CEQA 4CK3A 3ZEHA 3AVJA 1JLFA 3LP2A 4CJSA 1KTQA 3A2FA 4EP4A 5KRSA 4JS4A 4CEBA 3O4NA 2EHGA 3AA4A 1HMVA 2EKOA 3DOKA 3AA2A 2KTQA 3LP1A 4FJGA 3CM5A 4KHQA 4EP5A 4RW6A 4CFDA 1G15A 3ZT0A 4I2PA 3QLHA 1SSFA 3MEDA 4DS4A 1WSJA 3TAPA 5I3UA 5DMRA 3V9SA 1S1XA 2IAJA 3WNFA 3U3GA 1KLNA 2QXFA 1QSLA 4FJ7A 2IOCA 2LCCA 3VQ7A 2VWKA 4KTZA 4ELUA 1C1BA 1D5AA 2X74A 4CJFA 3TAEA 3RMBA 2E4LA 4B9TA 4K8XA 2IGIA 4GVMA 3ZSOA 3KLGA 1J5OA 1KLMA 3TR8A 5D3GA 3BDPA 3OYMA 2QQSA 4E7LA 4JLHA 4IG3A 3F73A 2QK9A 2KW4A 5KTQA 1HRHA 2F5KA 3QERA 3QINA 3RMDA 5M9OA 2R5AA 4N4HA 2HMIA 2X4YA 1TKZA 2YNHA 3LDSA 4BWMA 3C95A 4FLZA 2YKMA 3SUPA 1VSFA 2ATQA 3WNGA 3UT1A 1RT7A 3TAFA 5EU7A 4ELTA 4F4KA 3NF7A 3M8RA 2FBVA 4AHCA 1RT2A 1VSIA 3KD5E 3PX6A 2GF7A 4CERA 3RMAA 1ITGA 1RILA 2LSNA 2Z1HA 1SL0A 1SL2A 3DLGA 1TVRA 1QSSA 4KO0A 2HQXA 4MQ3A 5DK5A 3LWMA 1WLJA 4E1MA 1C6VA 1SKRA 2KQ2A 3NF6A 3AA3A 1FKOA 3NDKA 3AO3A 3EYZA 3SZ2A 3UIQA 4FM2A 5J39A 4RW4A 2G8IA 3KK3A 1S5JA 3MEUA 4E0DA 3OYHA 2YNIA 4Z4IA 1N27A 1IKVA 1CZ9A 2DFEA 3VQBA 4HUEA 1MHNA 2P5OA 1RBVA 3D45A 1TGOA 3TI0A 2EQKA 2WONA 2YHBA 3LPTA 1NOYA 1JKHA 3OYJA 3NF9A 1Q8IA 4DU3A 1S1TA 3VN5A 5HRRA 1NK5A 1DLOA 3OYBA 4JS5A 4FJ9A 3O3HA 2LRQA 2XY8A 5HROA 4LSNA 4GW6A 2P1JA 3HO1A 3VQDA 2YNGA 3SQ4A 3L2VA 2YRVA 1C1CA 2G8VA 2BIVA 1DTTA 3DB4A 3QBYA 2JZ2A 1HPZA 3AVNA 3MEGA 2ZQBA 2QQRA 3MEWA 4HCZA 4FW1A 2L8DA 1LWFA 3V1OA 5KGXA 4CIEA 2R57A 2X4XA 5D6YA 3HVTA 4CFCA 3IG1A 1BI4B 1BI4A 3KLIA 1C1AA 4RW8A 4I9LA 4DMNA 4F8RA 3HK2A 1N5YA 3K59A 4ID1A 2OPPA 3NTKA 3QEVA 3OYCA 2OPSA 3C94A 4PUOA 1JLCA 4HUFA 1G5VA 1J54A 1JLAA 1R0AA 3AO2A 4CJPA 3LX7A 3AA5X 4IG0A 3ZSVA 4WE1A 3V9XA 2Z1GA 4CCHA 3I8DA 1LV5A 4NCAA 1A5VA 3H6ZA 2G8UA 2EQMA 1XI1A 2HW3A 4AHSA 1C0UA 1QHTA 1RBUA 2IC3A 2MWPA 1GOCA 1HQUA 1CXQA 1UAXA 1Z26A 4CESA 3SQ1A 1U48A 4CK2A 3KLEA 2HNYA 1RTIA 4AHVA 3HVRA 3LAMA 2RJDA 3L2RA 5C6SA 2X6SA 2VYTA 1TKTA 1YTAA 3MXJA 5HBMA 4DSEA 4M3ZA 4B3OA 4CJQA 3L42A 4FLWA 4DSIA 2O4IA 3DLRA 3TAGA 4HCCA 4KHUA 4HCBA 3DM2A 2D0AA 3LP3A 1CZBA 1S6QA 1BISA 1XWLA 4GMJB 3SYZA 2BGGA 3QIIA 3CFPA 3QNOA 4M3WA 2BUDA 1T8EA 2D9TA 3EAEA 4IUPA 4FU6A 2X6NA 5J2QA 3PO4A 1KVCA 3EY1A 1KCFA 3DI6A 3OYKA 3TARA 1IKXA 3T3FA 1L5UA 1IO2A 3DRSA 4IDKA 4FZXC 1YTUA 3ASKA 3QEPA 1LWEA 2GFUA 4QVZA 4OLBA 4DTRA 1OYXA 4FZYA 1WN7A 1CLQA 1JXBA 2RN2A 4DTPA 3G10A 3PY8A 1NK8A 1C0TA 4I2QA 1WGSA 1JLQA 3M8PA 4TSXA 4O0IA 2P0KA 3V9ZA 4DSJA 4FW2A 2P5GA 1GOAA 4CJVA 1L3TA 2R5MA 3MP8A 2HHVA 2XO7A 3PFSA 4IFYA 4CJTA 2G8WA 2E5QA 4BE1A 4IURA 4A4EA 3HP9A 2RI2A 1QQCA 4CHZA 5FRMA 5J1EA 3QEXA 3HPHA 4E3SA 3LYIA 1NK4A 4E19A 3VA3A 4OPKA 4NYNA 1TL1A 3WNEA 3RMCA 3CG7A 3VQEA 4DSKA 2HVHA 1RT3A 2E6MA 1SL1A 3HPGA 3DLMA 3LPUA 2I5JA 4IUUA 3CYMA 5CZ1A 3NGZA 4PLLA 4FXDA 1HYSA 4GY5A 3L3UA 2HQEA 4RG2A 2WOMA 4Z4EA 1WJSA 3O3GA 4CHYA 3OQ5A 3VQ4A 3SQ0A 1IG9A 4DF8A 4M41A 3ZSWA 2XY5A 5FRNA 1WSFA 3T19A 4FLVA 2GFAA 3NNQA 1U45A 1U04A 3OYIA 1K6YA 5CY4A 4CEDA 1L3VA 2HNZA 4B9XA 4B9LA 2LTOA 5HLFA 3OYFA 3VQQA 4BE2A 1VK0A 4LD0A 3K5LA 3K5OA 1WJQA 4JRPA 3E01A 1D8YA 4L8RB 2DY4A 4HVJA 3LALA 1DTQA 3QEWA 2HHUA 4QOZB 2L89A 4W5RA 3M9QA 3KTQA 1FK9A 1NK6A 1TAUA 4W5NA 3CEYA 4IUQA 2P51A 5D6WA 4QAGA 5CYQA 4CIGA 3NHGA 3CFRA 2K3YA 4NCGA 4FCYA 1TK5A 4C5IA 1ZYQA 1EETA 3SUQA 3K57A 3DRPA 1BGXT 3B6OA 3DMJA 2L3RA 2FHDA 3S3OA 2RJCA 1S1WA 3LP0A 2OPQA 5J26A 3HT3A 2AJQA 4M3RA 5FROA 4CIFA 3NF8A 3DRRA 3QIPA 3BDLA 1RBRA 1BQNA 2NUBA 2XHBA 3VQ6A 3OYAA 4W5TA 3P83D 2JGUA 4CJEA 4DU1A 1X9MA 3NE6A 3PMIA 3V81A 3HPOA 5T7BA 1IKWA 2D0CA 1QSYA
chains in the Genus database with same CATH superfamily
4OIPF 4OLAA 3BGRA 2BZYA 3RZDJ 3CCSI 2E1MC 4BYYA 5I22A 1RKWA 5C4XJ 4QS8A 2F8SA 3MVPA 3OW2A 1QZ6A 1J9AA 5KYNA 3J7YJ 1KFSA 1SF9A 2QUFA 2LQWA 4QQDA 4C8MA 1QHHD 2OZUA 1RT6A 3TAQA 4D8DA 2K27A 2RQQA 4NC8A 4PL7A 4N41A 4WCEL 2FRYA 2XPUA 2MH9A 3HSRA 4YIRX 2PZ1A 4R0KA 1XG7A 2P81A 1ENHA 3RTVA 4PJOD 2HF4A 5J2NA 5IPAA 2KZGA 3MWPA 1NGAA 2HKOA 1JBMA 1KQSP 4LSLA 4DSFA 1ETVA 1X1PA 3FXRA 4PJOA 5AQKA 2H94A 1M3QA 1Q82R 1OYYA 3KE2A 1BIAA 3ZQLA 1EO1A 3CJCA 3VGMA 3PO2J 2CZ7B 1IUYA 5F04A 4HEA2 3AAPA 2HKQB 3K2PA 5AQFA 4OKEA 4G94A 3VQ9A 2A3LA 1RUWA 2CG4A 2MAMA 2LKSA 1TG0A 3R6MA 3BW1A 1VSHA 1POGA 2XKOC 4K41A 4B22A 4WXDA 2NLXA 3HXMA 2JZYA 1U9OA 2E65A 1O3RA 1K7AA 4KB0A 2EVRA 2QWWA 2LYCA 1LW0A 1K9AA 2JXBA 4B48A 3JCMb 3E97A 4DBRA 2X0LA 5FLVA 2E4HA 5E3OA 3OA9A 1ZRDA 2UXBK 1SSHA 1B4AA 1WI3A 1FBUA 5KGWA 5AN4A 4Z02A 2A28A 1MU2A 2RDPA 4A62A 1UJ8A 2HDDA 2E6LA 3ULRB 4M77C 4HAMA 2E34A 3FIWA 3U9ZA 3M56A 3IAM2 1JJ2P 4B1YB 5SWMA 3SHWA 4JOMA 3TREA 1QE1A 1RDWX 3MMYB 2NVXJ 1QPMA 1S1NA 2QM1A 5AQSA 7AT1B 1P4XA 3R8EA 2DF6A 3S6IA 1UWBA 2M3AA 4Y7NJ 3VEWA 4IFVA 3HOSA 3DWLE 2KKOA 2XRIA 5F08A 1O7FA 1BBZA 4RAGA 3SWNC 2D6FA 2ROTA 5FKKA 4ZN1A 2FBTA 3AVHA 3W0LA 2HVIA 2P9KB 1BIUA 2ZXHA 2ZPEB 4YG2F 2VQLA 3ASOH 3OBYA 2AKKA 4J2DA 4M4ZA 5D6XA 1IN6A 3J8AA 1YVNA 3JCMf 2OPTA 4HQMA 4KISA 3I9V2 3ULQB 4FT4A 2F2XA 3ML6A 2CUJA 1H92A 1N34K 1A0NB 2PY5A 1X2NA 3X24B 2RHXA 1D9FA 1JGGA 2P4WA 4LDVA 4K42A 4EMKB 1ODDA 2HDWA 2G3RA 1VQ9T 3K6GA 2DXCA 5DY9A 4LUEA 2F5DA 4FJMA 2ZNZA 1DJ7B 2EJ9A 2FRHA 5MLCQ 2NRXA 3CCVT 4J5YA 3C65A 1NGBA 2L2OA 5TISC 4LD5A 3VOVA 3THWB 1VRUA 2A3ZA 1QCOA 3FZFA 4CEQA 4WYBA 4B47A 1M30A 4W1UA 2HVQA 4OO1J 4CFDA 4I2PA 2LP0A 1ZG3A 2L9VA 3FHNA 1QSLA 3CCUQ 3JCMX 1D5VA 3RPQA 4ESRA 3RKYA 2V8KA 1XSXA 4R55A 4Y33A 2DEQA 3CMET 4M7YA 3QINA 2YSQA 2NVTJ 3QDKA 2DN0A 2YKMA 2YWWA 5J1YA 3CLOA 3FXQA 4FOEA 5AT1B 4XLAA 5AQNA 3PX6A 3RMAA 1MMDA 3R61A 3VOEA 1WEFA 2IRFG 5HL7L 1TQIA 1P8ZA 1FKOA 3D2EB 4FM2A 2JN6A 3KK3A 4OOIA 1S5JA 3CMMA 2A5WA 4Z4IA 2Y4YA 3CCQT 4QSHA 1LFBA 2ISYA 2WY7Q 2K5CA 2LX7A 2BV6A 1Q86R 4F7UA 5HROA 3HUGA 3A01A 1U3OA 1HPZA 3MEGA 2A40A 4H0OA 3CMAN 1NBWA 4GFBA 4HG2A 3M0UA 2XF7A 4KFCA 1JRIA 1EH6A 5KYUA 3CESA 3WE2A 2V4JC 2WSEE 3L2RA 1TKTA 1ABOA 3X20B 5KYWA 4FLWA 4CZFA 4YOWA 3VWBA 3EY1A 2O9LA 3JB9I 3SJHA 2O8EA 2XI9A 1G3WA 5ICFA 4M6YA 3HM5A 2FOKA 4I2QA 1JLQA 1EZZB 2EFQA 3QYBA 1ACIA 3O8MA 3VRZA 4BVPA 4JK9A 2IAIA 4CJTA 4B3SK 3CCLN 3QG1A 2I2LA 1GLEG 2PJRB 1ARKA 3DLMA 4YHHK 3NGZA 4FXDA 3JB9F 4RTZA 2RAEA 3TTCA 5EZHA 1NPPA 2HBJA 2KR3A 1F36A 4M78C 2IS6A 1ZSZB 1E3HA 5I2MA 4LD0A 4A5MA 4BU2A 5GMKi 4H0VB 4QOZB 3BE3A 2DA3A 2YI1A 1Q82U 1TAUA 1CKBA 5D6WA 3CPWM 3W2WA 5LBQA 1DPUA 1UGQB 3M7GA 1STZA 4M3RA 1VQ4Q 1K8AO 2QWPA 1KA8A 3HGYA 1GLDG 3A8OB 2IGOA 3VF6A 2XKPA 3H9JA 1FPQA 3QBWA 2XK0A 3F8MA 3DCFA 4I98B 1K4US 1J75A 3WG7H 4ATOA 1SEUA 1TV6A 4DBFA 4UUTA 3GBTA 5A2QZ 2NVYJ 2NNNA 3BZKA 1KU7A 3HG9A 3RPUD 4OF1A 5J4YA 1O3SA 5F64A 2KIMA 2DX1A 4FZZA 4NHJA 1H3ZA 2JQ7A 4BHPA 3RBBB 3LH0A 4BD3A 1TT0A 4LFUA 2B6AA 1UG1A 3D2EA 4N47A 2VT3A 2DK5A 3WTWC 4IF4A 4MQ9F 4FQGA 5BN9A 4NXNK 2M0OA 1IG7A 1ZBIA 2JTEA 2O88A 2K5FA 3FKJA 3SI6A 3EGDA 1JTYA 2M9HA 3RMSA 4H0PA 2L7ZA 5AONA 1X9SA 3CCRQ 4FWNA 1APLC 2YG9A 1FSHA 3K0SA 2WV1A 1WI9A 3M59A 1M3HA 1FOYA 1ZELA 4HSRA 4LIUA 4F3QA 2HMPA 1S29A 4CI0C 3THWA 1KHCA 1FZPB 4K43A 1RDCA 2GNCA 3OJSA 1EH7A 2V8JA 4QKUA 4ZJZA 2FZKB 3SLCA 1YX5A 3S8PA 3CUOA 3KP2A 4M7AG 2EQRA 4ILHA 4V19S 3D5LA 1UGRB 5TRDA 4AHTA 1NG9A 2W48A 3KYLA 2KHOA 2ZE2A 3BG7A 4CYCB 1VQ8A 1YHQI 2Y30A 1UOCA 1D0YA 5AQLA 5TGTA 1I5LA 3CCVN 1W5CC 5DLOA 4PGHA 1N9SA 4F9OA 3ZOBA 2RJFA 5E1ZB 2H8WA 3U1KA 1K76A 4CJLA 5A0LA 3TAMA 1VQOI 4CJ5A 1JKRC 2RF0A 2QA4I 1ATSA 2HB5A 3N4PA 1C0GA 3M5AA 4AM7A 4CHQA 1WXUA 5E1XA 1W9HA 2JWLA 2O8DA 1I50J 3QPTA 3ZQCA 2W24A 2LT1A 3GF2A 2BXZA 4JX5A 3GO5A 1SFKA 3EUAA 3BR2A 5AQQA 4BRFA 4E7KA 3G3ZA 3CFOA 5B1AH 1P92A 1GVJA 3LWHA 2QEXQ 4U7DA 1VQKN 3A8LB 4DB3A 4UC4A 4C5GA 2FXUA 4MIMA 1F1ZA 3OB9A 3IUCA 2O8EB 3FE1A 3JRAA 3QJ6A 2HQRA 1VQLI 2DXBA 4DTMA 2HHUA 5CK9A 3AVGA 1HUXA 3RMQA 3REOA 5D6EA 3CMAT 1NWKA 2Y31A 4IIOA 4AFZC 2FZCB 2FQ3A 5C24A 1X6OA 3JV3A 4BG9A 2RM4A 3RRGA 2OFIA 2W84A 3H35A 4J9IA 2EPFA 2CP3A 3NCIA 2E1OA 4M75B 1BN5A 2ME6A 3J80K 1RR7A 1B59A 1Q86U 2E5NA 2YDLA 2X6XA 3IRXA 1U5TC 3BCBA 5CJ9A 3RRHA 1PU6A 3L2QA 4FSSA 3S3NA 2L01A 1DUXC 4U0WA 1FEXA 3IAYA 4EZ6A 4BGAA 1AA7A 1UHCA 1SRMA 1SAUA 3DBRB 1JJ8C 1B9DA 4ABZA 2NOGA 5LJ3h 3SZPA 1KC8C 2A1SA 1BI0A 2DXIA 4CK3A 4OB2B 4F93B 3EG9B 2M0MA 2EYXA 5CQXA 2I5UA 2DT7B 3I58A 5K1YA 2F5CA 4H4KC 1KLNA 1X3ZB 5GAMd 2QAZA 1FYLA 1QCFA 4GY2B 1YXQA 5FJ8J 1BYMA 3NHNA 2L3SA 3B73A 2KW4A 3F73A 3CC4Q 2R5AA 3ULEB 4CZMA 4A53A 2YHYA 3WNGA 4CSWA 4AHCA 3PVLA 1RILA 2Z1HA 2PN6A 3QJYA 2WBNA 1YFNA 1EWRA 3BP8A 1Q81R 3D5SC 2H6BA 3L0QA 4K11A 3VUBA 2ZO4A 2BE9B 5D4RA 4PJLA 3PT9A 3H9GA 2P5OA 2QWQA 4M75D 1TGOA 1Q8IA 4Z88A 1K79A 5FPDA 4QIWN 3GTJJ 1HNZK 2G8VA 3DB4A 4EPCA 4CIEA 2X4XA 3PUBA 1X1DA 2FPDA 2P9PB 2FPEA 2EJRA 3ABMH 2C0OA 1X69A 3V9XA 2Y69H 1SFXA 1GCQA 1JXOA 1PRLC 4FO0A 1TNTA 1MSFC 3VS3A 4Y4RA 3EUHC 3KLEA 1BJZA 3ZN0A 1WHJA 2X6SA 5AQUA 2WC9A 4KHUA 4NC7A 3RPUA 2DE0X 4V2SA 3I4PA 2FQ4A 3QYGB 3CCET 1X1CA 2EGEA 1KVCA 1KCFA 1IKXA 1YTUA 2IIRA 3RKQA 3ZYYX 2X1EA 3DLLA 4H5RA 3V9ZA 4FW2A 1ZTRA 3M0SA 2YR2A 3HKZN 4JI8K 2RI2A 5FRMA 3DEUA 1EQYA 3TCJA 1P7JA 3BCAA 2X4HA 3L3UA 2M9UA 3HRMA 3R3LA 1GFCA 4BL0B 3HHHA 3F6VA 1RC9A 2DPNA 3J81Z 2QWOA 2LT4A 2RQPA 1YWOA 5GAMe 4IUQA 4NCGA 2OTJN 5AQWA 3FBNB 2L3RA 3CMEQ 2AJQA 5FROA 2P9SA 2LQ8A 4XIDA 2OAZA 1JU5C 2FSJA 4LG3A 4LOCA 1AWCA 4CGJA 4M7DF 1I4K1 1WEIA 2B5JA 2AZVA 4U0VA 1T8IA 5CKHA 3SBTA 3VJPA 5GP9A 1M27C 5CQYA 2NRWA 3HSFA 4BC4A 1YW8A 1GCQC 3S14J 3A5ZB 2FBYA 3NQOA 4BRDA 1S22A 4JI1K 4CGHA 3A5LC 2MW8A 1YITI 1OVYA 4BVOA 5AQJA 2QXLA 3MZHA 2MF2A 4C1NK 4N4IA 1X58A 5EC7A 2LDUA 3TVTA 1YJWA 4HT9A 4CEFA 4OINF 4MGRA 3WGIA 5GAN6 1WA7A 3CC2T 2CGJA 4J9GA 2FB7A 3O8HA 5GMKh 4IJNA 4H0YB 2WV0A 2J06A 1R7JA 2RQVA 1S9GA 2RK2A 5GAGJ 2FVUA 1TUYA 3JRBA 4OMOA 1Q9XA 1JLEA 5FO5A 4YFXF 5GTIC 1TBXA 4AC0A 3H08A 1GLNA 3P9IA 4J9BA 4F3TA 1KQ2A 2H8HA 1TUGB 4RA2A 4E7HA 4FL6A 2KJBA 2LY1A 3MD2A 4C3JJ 2LLKA 4IUTA 2DA9A 1NJZA 3V6DA 3VYRB 2UWMA 1XB4A 2ASMA 5H1SQ 4N9IA 2DAQA 2L7KA 2JRMA 4UVCA 1W36C 1W6XA 4OVLA 2R7YA 3MZ8A 1GOBA 4KHWA 2HF3A 4O55A 1YIJN 1UHSA 2JW4A 1UHWA 3VSKA 4E9FA 1KZHA 4G7HF 4C3IJ 5GAN5 3DXKA 4DOZA 1SUQA 4XSZF 4BUGA 1T6DA 2HHSA 2ESNA 3JB9G 3OIPA 1L3UA 3A2KA 2SEMA 2YHTA 1TU0B 2KIQA 3ZSYA 1HSJA 4BUPA 3RERA 3CMEA 3ATVA 2PYJA 4CZCA 1VQ8T 1NTCA 1XNIA 2L3PA 1KC8O 1ZBXA 2K85A 3E5QA 3C4SA 4BDZA 1BIBA 3WNHA 4BY1J 2IVPA 1BIZA 3CCMI 1W2BP 3T69A 4UUSA 5E17F 4J9DA 4A3JJ 3ME9A 1ASUA 3VA0A 4JRQA 2CH6A 1B8IB 5LGNA 2W82A 3H5AA 2OCEA 1JKPC 1LOTB 5CZ2A 3JAMZ 1RT1A 2P9IA 4B9UA 3BY7A 4DYRA 4MHGA 4JK8A 4ZGJB 1MSEC 1WPYA 1P7IA 1VTNC 3META 1GLCG 4CGIA 4IHVA 4KDPA 4LB6B 4AHRA 2MBFA 2KI7A 4EGZA 2WACA 1UB9A 3PNTA 3SZGA 1E7OA 5FKOA 4KHSA 2ISZA 1FTZA 3IH7A 5C4JJ 3CM6A 2X9HA 1KK7A 2BVLA 1UJ0A 2D2WA 3H8ZA 4NZGA 2W1OA 5FU7C 1S1VA 4HXJA 3KP6A 3KETA 1KG1A 1RR8C 2ASOA 5KCHA 2STWA 3H9QA 1U1SA 3PJRA 4A0XA 1MIJA 2ZJRL 1LDDA 1UCRA 1WPKA 3SWNB 4DCHA 2M4KA 2YT6A 4BJ5C 3TSZA 3O9SA 1ZKGA 2VC8A 2H8RA 1LE8B 4BRIA 1KYWA 2V9VA 4Y1DA 2LZ6B 1ZBFA 5IY5H 2GGRA 2XF6A 3WQUA 3RESA 4J2AA 1JT0A 4YPRA 1VQNI 1FMWA 3LP2A 1SS6A 4LC9B 4JS4A 1KU2A 2EKOA 4FSXA 4JLGA 1ATRA 2H56A 3BQYA 3CCJI 5DMRA 1M1KC 4B3TK 2F2VA 2ITMA 2VWKA 3F2KA 3RMBA 2HEQA 2Y9YA 1DPRA 4X65K 2ZJPL 3JREA 1BL0A 4N4HA 1Q7YU 2P84A 2E3HA 2OAUA 3BF1A 4NDLA 2BY2A 2M0CA 2BE5F 4CCNA 4PKIA 1PHTA 3AG4H 2YNIA 2QA4Q 3JCMc 5FLXZ 5HCKA 5CLSA 4DU3A 1NK5A 1T6SA 3M0RA 2IW5A 2LRQA 1KC8R 1S7AA 2CH0A 1W5SA 1WKMA 4XNFA 2CH4W 3J81O 1B9NA 3M53A 1QGPA 3FXKA 3H3UA 3OYCA 1G5VA 5IWAK 2BYVE 2NOIA 5GAN3 1LDKB 4X9DA 4Z6YA 1Z7LA 5HLGA 4RDUA 1CKAA 3A5NC 3RVCA 1G3SA 4RM3A 3DV8A 3OR2C 1KU9A 4CCJA 1RRSA 4DSEA 3AKZA 1FY7A 4M3ZA 5F0XA 1HD3A 3L42A 1W36D 3N4QA 5HS9A 3OOPA 3TAGA 5JR3A 4L5IA 3K4NA 2PQ8A 2BUDA 1T8EA 3EFOA 1QQNA 2M1BA 1IO2A 4C1NI 2GFUA 1GV2A 2EILH 2L4AA 3MKZA 1BWFO 1BW6A 3PVQA 4BRMA 4UB8C 5B66C 4IURA 2VXFA 3VGKA 1HKGA 4EVIA 3VA3A 4M7DE 1YJWQ 1T33A 4PLLA 4CCMA 1YI2I 5EG2A 1J59A 3SB2A 1YHQA 2H6CA 1BI1A 5GANd 1E6HA 3VQ4A 5GAN4 4M9SA 3ZP5A 3F22A 2D8JA 1T08B 1KAZA 2HOEA 3K5LA 5L3BA 2P9UB 2IVNA 4A3CJ 2HSEB 1TK5A 1E2XA 1ZA1B 2XAQA 5F0HA 8AT1B 3CP8A 2I10A 3LP0A 4R56A 4YORA 5M1FA 4GV9A 4FWOA 5LY3A 2QA4A 3HOTA 4DR4K 3UA6A 2FBIA 3AAFA 3MP6A 1OVQA 4ZN3A 3RUXA 3EG9A 2JA2A 4A54A 3RDIA 1NYGA 4BR4A 3MKDA 1LDJA 4FWRA 3R60A 1R5HA 5DYMA 2QTVA 2V6EA 2CZ0B 2J5PA 3I0RA 4IO9F 3VF2A 1BC8C 4XTVA 3LSMA 1K78A 4F91B 4BI8B 5H6QA 4A0ZA 2CWEA 1Q81O 4NCBA 4F52A 3ALYA 4BWJA 3BY6A 4RG8A 2CO5A 3Q0VA 1S72A 1IF1A 3W3CA 2QSGX 3HTRA 1FW6A 1CZAN 4PCQA 1F21A 4BDYA 1Z3XA 3M54A 2D1XA 3S9HA 3D0PA 4WQ5C 3DBHB 3QFPA 2O0YA 4N4NB 4UNFA 2HHQA 1N36K 4JEPA 1VQLN 2DZ9A 2VKNA 4KRTA 4OMPA 2HAXA 3F5TA 5BPDA 3C7JA 1ABQA 2ZXIA 3RNJA 4CEOA 2ZZDA 3FC3A 1PYVA 1N6QA 2JOYA 1HJDA 2NS7A 2GWKA 5A0DA 2EH3A 1Y39A 4F14A 1YHQT 2RHKA 2A05A 1GLBG 1I6XA 2RPNA 3ENBA 4EVVA 3V1QA 4L9NA 2RJEA 5DUKA 3WXLA 4RBOA 2R5YA 3PNWC 3W2AA 2QDYB 1VQ9I 2MMPA 2ETJA 3H41A 1YJWN 1GBQA 3I5RA 4LD6A 4OMQA 5HLIA 3VODA 3M6GA 4PHTX 2OF7A 1QLYA 5BPMA 3SCXA 2VT2A 2PMHA 5IXFA 4B9SA 2KKZA 5A2QK 4BI4A 5D7UA 2GWRA 2KYMA 1E3PA 2ZFWA 2V7FA 4AUXA 2XY6A 2CU7A 4M71A 3D7EO 1Z67A 3QUIA 1M3BA 1GCPA 1C0WA 3B6PA 4P55A 2W03A 3F8FA 3LW5E 2YCHA 3QESA 2B0LA 2GXBA 3KYCB 4FJHA 1K8AU 1RDDA 4KUMA 1IHVA 3G4SQ 4OB0B 1TKXA 2XPVA 2RKHA 2CS3A 1EF4A 4CRIA 4PNOA 2L9SA 3FKIJ 4CZEA 4E7ZA 3CZ6A 3CMAI 2LMDA 3K9TA 4FYXB 3MKYB 2DDBA 3EKUA 2DTZA 2E88A 1FMKA 2BHYA 2KRMA 4II1A 3C18A 1LB2A 4Y17A 4IRIA 4FWSA 2PI0A 1PD1A 1I1SA 3M8QA 4CJUA 2YUQA 4O0JA 3DPTA 2XV4S 1J6ZA 3CD6T 3G71I 2V1XA 2KLOA 3ECHA 1E0EA 3Q7CA 1NG2A 4DTSA 1RTHA 2OTLT 1V29B 3KZIC 2MFZA 2VONA 1W5TA 3QRFF 5C3EJ 2WWYA 3ZT3A 5K7FA 3IKTA 4MLEA 2DYBA 4DTXA 4B3AA 2KIFA 4C8QA 2GIZA 1K0SA 3K5MA 3OS0A 2XDVA 3F9MA 1VQ9N 2EYQA 4Q5SF 1XDUA 4XOTA 3UKRB 2QGUA 2A7YA 4CF1A 5CE3A 1Z25A 4MO4A 3QO3A 1IAWA 3PLAA 1TUUA 2V8IA 2JG6A 1NJIR 4BREA 4V2GA 2UV1A 3O6BB 3E0JB 5J40A 1SMYF 3E3VA 2FMLA 3CM5A 5I3UA 3I35A 1S8NA 1SAZA 1KG5A 2QXFA 2IOCA 1M90C 2CH4A 3CCLI 2HL3A 3BR6A 2NYXA 2COMA 2QGFB 5DS9A 3BY5A 1TKZA 3NMUA 3H0GJ 2A07F 3KD5E 2CYZB 2CYYA 2QYOA 4FX0A 3GMEA 1H1VA 2X48A 1N39A 4F7UF 1RKTA 3I59B 3FX3A 4AD9A 3K9KA 2E12A 1HKQA 4ORZA 4KJZA 3JAMO 1JKHA 2DYIA 3NF9A 1XDSA 4ZGEB 2DL5A 4M7DB 2VE9A 1FMVA 3FZVA 4DSKA 4JI6K 3EGUA 1Y1WJ 4HCZA 4F8RA 1QHGA 1UG0A 4AMCA 1OX9A 3PTAA 2F7TA 5LJWA 2ELKA 4EA5A 4XTUA 2NNWA 2CRGA 4CCHA 4XKWA 2A6AA 4M3BA 1A5VA 1WDXA 1WQWA 2G8UA 1QHTA 5FB2A 4HW0A 1CXQA 3KP7A 3K70C 1HW2A 2ZCWA 4HCCA 2QASA 2D0AA 3R0AA 3QYHB 3QHSA 4A5BA 3DI6A 1YRNA 1LWEA 3JCMe 1XMKA 5IT9K 2VPRA 1J2XA 3R6SA 4CJVA 3MP8A 4MQVA 3WTVC 3VU3C 1D4XA 1M1FA 4RTUA 1PCXA 4GKKK 1NH3A 4JNEA 2E6MA 3VEPA 1SL1A 2I5JA 4AM6A 1YHQN 2Z2SB 2WOMA 4M73A 2K6DA 2DMOA 2OI3A 1KQJA 3HHGA 3MKLA 1MMGA 1SHFA 3CCYA 1U04A 3LSGA 4ESBA 2ZSHB 1P2FA 2LTOA 3LSJA 1VK0A 5DUIA 2HDCA 5B8HA 2CV2A 1FK9A 1RADB 3CEYA 2H3GX 4OU0A 2P51A 1VQ4T 2F2WA 2L7MP 2C06A 1LNXA 1WZOA 2X4JA 1YO5C 2QA4N 4AI5A 4CC4B 3HHTB 1T39A 3EEQA 2Z1DA 3BR5A 4JKGA 3KYDB 2HBKA 1YITT 2OD5A 1RAIB 2JA5J 3TABA 2F5TX 2HXOA 3EFRA 2ELJA 1RAFB 1YWPA 2VBXA 1VQOT 2X1CA 3FMQA 3H1QA 1FSEA 2EIKH 2EZHA 3M4YA 2Y9ZA 1OCZH 3OS5A 3ZFJA 5LJ3g 4RAZA 5EEAA 4PKCC 1M90U 1MDMA 1OZ3A 3P1GA 3I0SA 1W7PA 2CFXA 3IH3A 2ETHA 2KZMA 1SRLA 4P9UA 4LJZF 1VRLA 1YF5L 3WEEA 2O7OA 4IHWA 1U0JA 2OJED 4MTDA 2HPMA 1NK3P 2IEKA 4AM3A 2IS4A 4EM1A 3E6DA 1PP8F 1JJ2A 5C15A 1JE8A 2PBDA 4B8XA 2XDPA 5LJ3e 2O4GA 2R7WA 1OLTA 1GXPA 3C7NA 1I5OB 2RQRA 4DZPA 1P6RA 3CCSN 2PMZN 2EJGA 1NLVA 1PUFB 4LLNA 3ZX3A 1IDZA 2D0NA 3CQTA 2K9GA 1J09A 3TTDA 3GTMJ 3AVAA 3J81K 4ESJA 4WXHA 2L4MA 2FL7A 4JZ3A 2PFUA 4HDUA 5HRSA 2X51A 2IGNA 1N77A 4LF8K 4CBUA 2WADA 1DQUA 2MC4A 3HRGA 1Q1HA 4UY8I 4Z4GA 2OUMA 2DKGA 2DFHA 5FKNA 3FFIA 2J6OA 2HL5C 4BR7A 3HM9A 4F7UE 4JDSA 4BBRJ 1VQPA 3WXJA 2GWJA 2NS8A 5LJ5h 4J7FA 5EG0A 3ROUA 3OSFA 3TTFA 3SQ2A 1NYFA 4KI4A 1TW3A 4ME7A 4LDXA 2D0BA 5FGMA 1NJYA 3U3YA 5AIQA 2XY7A 3M9AA 3JYTA 4IOAF 2ZXWH 4B6MA 1JO8A 4BY6B 3GX4X 2W0ZA 2DI3A 2LVMA 4LFBK 3OVNA 2W40A 3ELKA 1PUFA 2V1QA 1HQCA 1M2VB 4A57A 2A6TA 2YXYA 2Y1JA 3GZ5A 3QO9A 4C2TA 5GAOr 1HQEA 4HSBA 2W57A 5AQRA 4LF7K 4M78G 4JKFA 4CC7A 3I5UA 3OYEA 5LJ3j 1K9MU 2DIQA 4OMFB 5EXWA 3OWTA 1YJNN 4GLKA 1S3JA 1GLLO 2ROLA 4UV9A 3M07A 3L4IA 2MSYA 2XD0A 4RTTA 2XUBA 4J9HA 3HYFA 2UU9K 1W4SA 4NXMK 4PSWA 4CJ3A 1JHHA 5K7HA 4CJRA 3P8DA 1UB4A 4BQNA 3IKVA 1WJDA 4DR7K 4AIDA 4FX4A 3ZT1A 3FXMA 3CUQC 2RN8A 2AA4A 4C0DC 1VQ6Q 1NOZA 1VQOA 2PZSA 4FM1A 2ABKA 3NVMA 4X0GA 1X9WA 2VB6A 5FKMA 1IC8A 1ZLJA 2QG9B 3A4CA 5FKLA 5IYBJ 1NGEA 1P7MA 4BRCA 5E18F 1X1BA 1M90O 3UATA 1U2WA 3O3FA 2F69A 3L2UA 4JRIA 2VQHA 3ZCMA 2RHZA 4FK4A 2IVWA 5GAOp 1KQ1A 4UQGA 4CD3A 3VERA 4Y1CA 2P9LA 3A03A 2OBPA 5LL6Z 3JTHA 4LGWA 3DWLA 1V5FA 4N0AA 4JYKA 1JTXA 2M45A 1MA9B 1UG2A 3G1JA 1VSLA 3KZYA 4RWTA 3L7WA 2ZMEA 4J2EA 1SHGA 3FMSA 1Q7YO 3ZEHA 3AA2A 4JKGB 2KTQA 3WEEB 3I33A 2K3FA 4IOXA 4DS4A 3TAPA 4O3MA 4MDXA 2PNIA 4YDUC 2ATCB 1JB0E 5E20A 1I1JA 2QQSA 2NNYA 3LA7A 2L54A 3LDSA 2DU9A 3IAS2 3I0WA 1AWXA 5AQHA 2E1MB 1IHWA 1HKCA 2Y0MA 3CI5A 2CQNA 2LSNA 1K73C 2A5XA 3G25A 3FISA 2COZA 1VQ5I 5JVTA 3UIQA 5CO7A 5B5EC 3VESA 1K73U 1D1BA 2WFBA 4S0HB 2KFDA 4L18B 4LIVA 3S17J 2DLLA 4CZLA 3RR6A 4FJ9A 3KVGA 4OB1B 3HO1A 2YRVA 2LNBA 2Z9OA 2P9LB 3CCVA 2QQRA 2L8DA 3OIOA 5D6YA 4KI6A 2Q2RA 4U7BA 4DMNA 4RAYA 3CCEA 2OPSA 4PUOA 3C94A 1KYZA 3GZNB 2P8TA 2Z1GA 3EN9A 3KEOA 1GLAG 1MKMA 1UDLA 2EQMA 1XI1A 1T56A 4RGRA 2IC3A 1GOCA 1Z26A 5LJ5e 4IOCF 1RTIA 1PU7A 4M7AD 1UECA 2PVDB 3CJTB 1CZBA 3CFPA 2D9TA 2LX9A 3PO4A 4KIFA 4M6XA 4A2BA 2A0FB 1L5UA 4X62K 3C1DA 1WN7A 3G10A 2ECZA 1NJIU 3ZRGA 1VQ9A 3A1PA 5LMNK 1QQCA 3QEXA 3L2CA 1XPXA 2HZDA 4OPKA 3VQEA 1RT3A 1AWJA 3THYA 5HK0A 2ZMEC 2KPMA 4IHYA 1OISA 3O3GA 3OQ5A 3FM3A 4DF8A 2FNPA 2XY5A 1RRJA 4CEDA 3G4SA 3WTYC 1K8AC 1OPKA 3C3WA 3F72A 3LALA 2HD0A 1JUMA 3M1FA 2IA1A 1WSUA 3HTSB 3NHGA 2LBFA 2PFBA 3DMJA 2FHDA 5LHHA 3THXB 1IN5A 1HSTA 2DDAA 3HJEA 4I6ZA 1YLFA 1R6RA 2ADUA 4XK4A 1Y0NA 4B9QA 1HYOA 3MECA 4FASD 2YUOA 2QTXA 1UAAA 5FLXO 3CTAA 3CW7A 4HNVA 1KQSA 3LDLA 1K4SA 3AO5A 3OYLA 5FPEA 1RBTA 2MC3A 2JT4A 4YPHA 1WLPB 1XTAA 1KVAA 1DEJA 5I11A 2EQJA 3OV8A 1Q81C 1WX6A 2R0QC 3CXCA 1TK8A 1N8RU 5K5RA 3G71A 1EV7A 4FLUA 1HA8A 1ORNA 1HK9A 3CUQB 4LF9K 4DYQA 2BY0A 1Y6IA 5KN9A 1YIJA 3AG1H 1ASWA 1EJ9A 1QMCA 3S1QJ 1VQOQ 3SDBA 2DA1A 4PJ0C 4I9QA 4ICLA 2WAEA 3RDVA 4RLFA 4CZGA 1IB8A 1T3SA 2PJPA 1A5WA 1XQHA 3K4LA 4C30A 1QVGA 3DLLL 5GADJ 5GAN8 1AWOA 1XTDA 3CC2A 3MAQA 2XDDA 4FL9A 4IOCL 2UUCK 4NL2A 2KSSA 1Y07A 3CPWS 1KAXA 2KFNA 4JKBA 4OP0A 2P7VB 2O9VA 5AR0A 1WHKA 1SAXA 2A08A 2M1HA 4DR1K 1RT5A 4M3XA 1WAJA 2HHTA 4IUVA 3P38A 2R5YB 1WGXA 2VXZA 3WTTC 5EEGA 3KZZA 2LY2A 3B6AA 4FIBA 4QPQA 4ZZLA 2K3XA 3DLBA 3RZOJ 4HDVA 1HX1A 2JN0A 3HYIA 2E1CA 3NH1A 1GXQA 1UE9A 1J3TA 5KAIC 4FK2A 1SFOJ 3CPWP 2VQCA 4M3DA 1ZC6A 4FYDA 4YOVA 3EHQA 1M90R 4CHOA 1Q7YC 3LAJA 1MNMC 1QQIA 3A02A 3MEXA 4JN4A 4QT7A 3QNNA 1JT6A 1YCYA 3L8BA 2XHCA 4BROA 2W00A 1VOMA 2ICWG 3K5NA 2MA3A 3NPFA 4A4GA 3F70A 2FC0A 2YU3A 4OX9K 4YFUA 4CBXA 3Q1JA 4C92D 2E1NA 1VHXA 1DU6A 1A5JA 5LJ5g 1TYQA 1WAFA 1HYVA 4BR0A 5E79C 3S1RJ 3RQ4A 5JI6A 1BA5A 1PVSA 1LWVA 1S1UA 1A5XA 3M8EA 3R9PA 3GNFB 3E19A 1VQ6A 5F0CA 1H8KA 4HZFA 3FRNA 2H09A 1HLVA 3FJPA 3FDYA 5C0MA 4RGXA 3DKMA 2OYQA 4N56A 3M5RA 4M7XA 3VDXA 1GFDA 3HGGA 2WAQA 4J7IA 4M7DG 1V5EA 3FDRA 4C2MJ 2DEUA 2DL8A 3QDRB 3E2UA 3J7ZO 1R1UA 1W0TA 3NH2A 3K2ZA 1IBMK 4M3GA 4C92F 2QSFX 1FKPA 5CVVA 3G6EQ 4BRNA 2MLGA 3A5MC 2DTUA 5DV5A 2GQQA 2GM4A 1TUCA 5DEQA 1J53A 4TV7A 2XHKA 2V51B 1SKUB 3MZYA 4FJGA 1ZLMA 3QLHA 5FFXA 2XICA 1OKRA 3V9SA 2CT4A 2X74A 2FF6A 2E4LA 4GVMA 3KLGA 1KLMA 5D3GA 3CC4A 4CXFA 4JLHA 3G71N 2P5VA 4LB5A 2HMIA 3A0BC 2G8FA 3SPZA 3GFJA 4E9GA 2EYYA 3CUQA 3JRDA 4A69C 4LN2A 4ELTA 5EU7A 2JSPA 3E7LA 1H641 3WXKA 2JK3A 2VKHA 2Z3YA 3M4OJ 5DK5A 2NRRA 5BS6A 2EQIA 4M78E 4O5VA 5L3EA 3PIPL 2KP6A 3U1DA 3CERA 2DTRA 1K6OA 2KY9A 4L9JA 5LJ5f 1VQNA 2LC4A 1IDYA 3KFVA 2OJ2A 4JS5A 3G6EA 5EEHA 2O31A 4M77B 1DTTA 3CCJA 2WY8Q 2JZ2A 3MEWA 4NOYA 1C1AA 2P9UA 2E1HA 3CJRB 2KMUA 3VUZA 3LX7A 4IG0A 2GX9A 1R71A 3HSEA 3CQZJ 4A93J 2HW3A 2K2VA 1C0UA 4CESA 2HVSA 4X1EA 3TEDA 3CF5F 1AZGB 2RJDA 4M75C 2FF4A 4A3FJ 3QNOA 3PQKA 3IUOA 2I7NA 3GLXA 4Q0BA 4D0PA 2GTDA 2NUPA 4OMMA 3LOCA 3CCVQ 4BKXA 5L3CA 5KYYA 1K8KA 3QYFA 2N8GA 4BE1A 1WOQA 2R92J 2FOWA 3J7AP 5C10A 4HPQA 5ELZA 3EGDB 2EBPA 3RMCA 3ER0A 2CH5A 4KT5C 5BQTA 5GAOn 4GY5A 2DTHA 3F6OA 1XC5A 1AHDP 1BW5A 3SEZA 1VQ7A 1O9SA 2O8KA 4XEIA 3AAQA 1OQKA 3E01A 2DLPA 4EMKC 1LWWA 1OV3A 1YE9A 3CFRA 3GCMA 3A8MB 1TWGJ 1ZYQA 5E8GA 3B6OA 3IWZA 1LKXA 4X1VA 2FA5A 2BOLA 2RGVA 1BG3A 1O75A 3QIPA 5AQTA 3NGPA 2JGUA 1JEGA 4M72A 5M3MJ 4JJNK 5F27A 3HDDA 4ZTFA 1WNSA 1REPC 1ZLKA 1D0XA 1OCRH 2LC2A 1VQ8Q 3AVKA 3N0UA 3THXA 1IZ6A 2CJJA 3LM2A 2Z99A 2NUTB 2KT8A 4E4HA 1Z05A 5E3MA 1XC9A 1VIFA 4J19A 4M75F 3SWNA 1QHAA 1SV5A 1ZA2B 3VQAA 2VQEK 1H9TA 2STTA 1B72A 1U5TB 4MTEA 2EA2A 3Q0UA 1X6GA 1PNJA 2CREA 1FBQA 1DDNA 4PKGA 3DBLB 1Z9CA 3K9JA 2D5VA 1FIPA 1T0HA 5L8RE 3AVIA 2DA7A 1DP3A 1SMTA 4BRKA 4RB3C 1SD6A 2PJRA 3G71Q 4DQRA 2VC0A 2E2HJ 3QPSA 3HI0A 2JPSA 5AJ3K 1T3VA 3TP3A 3HRTA 4B9MA 2OZSA 1W1WE 5D5UB 4E1NA 2K86A 1QZZA 3NMZC 3L4QA 2QWLA 2OTLI 3DKYA 2NOZA 3PO3J 3EE9A 2A1RA 2PYLA 5J2PA 1B8IA 2VKVA 1NK7A 4QTRA 2CGHA 2HOAA 1A36A 4I02A 3U9GA 2YRCA 2ID6A 3NGIA 4JI3K 2RO0A 2QF7A 4YIIA 3CCEN 2HYFA 3G1LA 1U8RA 3KUFA 3AFHA 1JGSA 4HVUA 5GAMg 3G4SN 3CCUT 2G7HA 3TL4X 2QLZA 3BPVA 2XMFA 4DV2K 1T03A 1LJOA 3G0ZA 4BJTA 3AVMA 3CCLQ 3BJOA 4FJKA 4NS5A 2LMJA 4DV1K 4U88A 4LUDA 4PGGA 3KKRA 3CVTA 5BPLA 1KHIA 3SDZA 3EZWA 4QS9A 1NMDA 3SAFA 3CC2N 4B24A 1SZ2A 2YHAA 1HDDC 4J6XA 4XN3A 1ONVA 2Q0RA 1ORPA 3GDQA 2Z0WA 2P0WA 3O80A 4G9ZA 4Z4CA 2DERA 4XH4A 3FBIB 4YEJA 4WQ5A 3CJQB 1SD7A 1LOJA 4DUZK 1PD0A 4Z89A 3E9FA 6AT1B 2IS1A 2HSTA 1Y57A 1KC8U 2JTMA 4OKKA 4BE0A 4ISGA 2DCEA 4OGEA 2E6ZA 3GWZA 3M1CA 5GADP 3DLHA 4NLBA 5GAEJ 2E35A 4C8NA 1X43A 4KFBA 4Q5WA 2K4BA 2EIMH 4DR5K 3FMRA 4PJOG 2E1ZA 1YX3A 3QETA 5DTDA 1MWKA 1YQKA 3S41A 1A6IA 2X35A 4N76A 3J7ZI 2HNHA 3ZN1A 1JXEA 2P9SB 3JCMP 4B08A 4HCKA 4HF1A 2DD4A 2QI2A 4DTJA 2LBFB 3HRSA 3ID8A 3QZ9B 2QEXI 4BQQA 2KMTA 4LH4A 5C2DA 2Y75A 3CMAA 2QQ9A 4NB5A 3AVBA 5GAMj 5EGOA 3SMPA 5AQMA 4O44A 1G4DA 3I0XA 3ITHA 2F48A 3BPXA 1KVBA 1MGTA 1VQMQ 2QZ8A 1WIEA 4GYIA 3KZBA 4E9EA 3ZT2A 2D1VA 4PA1A 3TBIA 3U23A 2CP2A 1W4MA 1MGQA 2GLOA 3DF8A 3CWTA 3CVSA 4KGZB 1Z91A 3KCCA 3BR0A 1SSFA 4KBMB 3MEDA 3HOWJ 3CPEA 5M1OA 2XHIA 3URGA 3MN7A 4Y92A 1Q82C 4EEFG 3C7NB 1D5AA 2P4RA 1BKBA 3ZSOA 1J5OA 3RCOA 5KTQA 1M1GA 3SUPA 4BWMA 4GLMA 2ATQA 3ISPA 3PGGA 4CERA 1WI7A 1YJ9I 2KXDA 5GPAA 3I54A 2IS2A 5F1RA 4JKDA 1C6VA 1Y96A 2ESHA 2YPRA 5J39A 2G8IA 3THYB 1N27A 5GAOl 1TZLA 4EJOA 4IEJA 3R0JA 2JA6J 3D5RC 3DAWA 1IBLK 2CZ1B 1VI0A 2VPLA 1SFEA 3CCJN 2KNBB 1LMZA 4OFAA 5HODA 3G2BA 1J5YA 3FK6A 1XQSC 4CFCA 3IG1A 1BI4B 3KLIA 2RD1A 3K59A 3O5BA 3A1YA 1P4WA 4ZDOA 2O01E 3KP4A 2O5RA 3C0CA 2XDBA 4XKVA 2R7XA 3FZHA 2K40A 4XU0A 4CW7B 2HNYA 3HVRA 4D7NA 2Q0OA 3N5BB 2SRCA 1JCFA 4HCBA 1QVGM 5J2QA 4IUPA 2KBTA 2YLBA 3S1NJ 1ZG5A 2B7EA 4KRFA 2AO9A 1MZBA 4D7MA 3T8TA 1C0TA 5CVIA 5AFUA 1X3NA 4WFAL 4CHZA 5ICGA 5DDGA 1FNNA 2C0IA 4DR3K 3VYGA 1VQKA 3HPGA 5CZ1A 3H9NA 3AHUA 2OANA 3IL2A 2QQBA 3H45C 2V75A 4M41A 3ZSWA 4C92B 2K5LA 1DKGD 1NGFA 1RPWA 4B9XA 4B1XB 2XPWA 1R1VA 1ZH5A 2VXEA 1KIKA 4EIKA 3S93A 3WU0A 4NQWA 3CBMA 4XMYA 5GANf 1W0UA 5D8LB 4D5FA 4FCYA 4C5IA 3GTQJ 2JJ9A 3AGKA 4CIFA 6PAXA 3QMLA 4OMZA 2F1LA 3OYAA 3ID6A 4W5TA 1TWBA 5FU6C 3F0CA 2K02A 5T7BA 1LJ9A 1QSYA 5J8CA 3K4JA 2OCCH 3H0HA 4C8QE 5CYMA 1RDAA 2VYPA 3WXMB 3MXMA 5E3NA 5HK3A 2IPOB 1PKSA 2FSKA 3L1AA 2RC4A 2EINH 2DK3A 1S3XA 1G3YA 1DT9A 3VEOA 4X34A 2KJCA 3TO6A 1U8BA 1TQMA 3A5OC 2IT0A 1BB9A 2CW0F 3A8GB 2G7UA 3PM1A 3WE3A 1FJGK 2V79A 1I39A 1VQ6I 2WC2A 4BXFA 3HOZJ 5KAFC 1M1KU 4HLXA 4BB7A 2HHWA 4FJIA 1EH8A 2KLAA 3BZ6A 1XMAA 4RLQA 2VUBA 1AHJB 4M9ZA 3EUHA 4DSLA 3B8AX 4LDWA 5GPCA 3CDHA 4AHUA 3VQ8A 4F17A 5EOYA 1S7OA 4AIKA 2D5RA 1MNDA 3QP5A 4B9WA 5AZJA 1BOTO 1WSEA 2JHNA 4XOPA 4OKJA 3IRRA 4DIQA 5AQYA 4DZJA 4CK1A 2QBYA 4FJLA 2AXLA 3KD1E 2KDZA 4B3XA 1E6GA 1OJLA 2QVOA 4ZZDA 1OEBA 1M2VA 1D5YA 4TVRA 3AVCA 1M2OA 4I0BA 1WJEA 1Q95G 2VCPA 1NJIO 1RAAB 4Z4HA 2RREA 2FNAA 3VGLA 1QVTA 1WH5A 3IC7A 4PIIA 1CF7B 5KNLA 5EG0B 1K4TA 3A01B 4EATA 3ISNC 1I07A 4J8FA 4CF2A 1LWCA 4M7AA 4YTLA 3O5ZA 4L59A 3DTEA 3TSPA 3MDQA 2COBA 3CF5L 1WJ5A 2G0EA 4RGUA 2HOTA 4WFNL 3CCST 1TLHB 3WTXC 4E70A 1OYWA 1U4BA 3JB9H 2QBYB 3AVFA 2QKMB 2CW8A 3L2WA 1HC8A 4NUBA 1PWTA 3DLAA 3MWTA 5JLXA 2NAZA 3BTIA 3WHCA 4EJUA 1VQPI 4PQUA 1V76A 4OPHA 2FO0A 4B9NA 1VRTA 2JSCA 4M77G 3PX4A 3Q0WA 1JXMA 1ZUKA 5ICEA 5GAMh 3KTUA 5CPRB 5C25A 3Q5FA 3V9WA 3ZX0A 4MZTA 2JVHA 2EJFA 2PVGB 2ED0A 4NL3A 4H5WA 2OZMA 4Y3OA 3HOXJ 4PFOA 3MXIA 3GFIA 3UNGC 3GTLJ 2B8AA 1ETOA 4CJ4A 3M8JA 4NYFA 4X6AJ 1UTIA 4LNPA 3F9KA 3LH5A 3SEMA 1I3AA 1T7PA 4CCKA 3WVEB 3QFUA 2F8TA 1D1CA 1VYUA 4XR6A 2FD5A 2XAHA 2O4XB 4IO8A 1IO6A 4IFEA 1KQ9A 5L3DA 2EV0A 5KCMA 1QP3A 1QVPA 2BTFA 4ZDPA 2LQNA 5B1BH 4BY6C 1GXIE 1QVFP 4CECA 3QWLA 2BHZA 3V8JA 1U5SA 2LJ1A 4B1UB 1RABB 3G71T 4FLTA 2IDOA 1PSEA 2MPXC 4M7DD 1WJCA 2BZ8A 1P90A 4BHBA 2ZJRF 4GXOA 1AOJA 2GELA 5KI6A 4AT1B 1TWHJ 1OCTC 1FIAA 2HKNA 1YI2Q 2EBIA 3BTCA 3H46O 3EO3A 5EF6A 2VI6A 2GXGA 1NK4A 1OH6A 3LMMA 2DL7A 2ZJQL 4II3A 3FIFA 1WRJA 3LL3A 3T7ZA 4XTXA 1R49A 2ZPIB 2ZB9A 4GGGA 5M9OA 4FLZA 2OAWA 3TAFA 2RQWA 1RAEB 1FTTA 1ZHIA 1JQQA 3CXCP 1TVRA 4KO0A 2TCTA 3TKYA 4A2UA 2ZF5O 2CV0A 1B72B 3NDKA 1PDNC 1BR2A 3SZ2A 4RW4A 2KQRA 4HNTA 4NB4A 4KITB 2KGTA 1KD1R 2E60A 3H0FA 3O9UA 2EQKA 1N8RO 4ENKA 2GCXA 3QWXX 5AFUH 4VUBA 1YJWI 2M8EA 4DEXA 4H0XB 3I53A 1QKWA 2LY9A 5M1QA 3WU1B 2YNGA 3SQ4A 4YFKF 4OB3B 2ZQBA 2UUBK 5ADXA 3AL0B 4RW8A 3JCUC 1XNRK 1J54A 4RB2C 4CJPA 1XN7A 1ZUUA 3V7RA 5J47A 3I55I 1D3BA 3DKXA 1RBUA 2R7VA 2MWPA 1HQUA 2E2NA 2FLOA 3CJAA 5AYFA 3I56T 5C6SA 4B3OA 3BOQA 2X6OA 3KNTA 4CGZA 1XGNA 2AP1A 4XH5A 4DSIA 5LLQA 5GTHC 3RJPA 4PJOE 2JMWA 1M3AA 1VQPQ 3EAEA 3OYKA 1QU3A 4QVZA 3HUGB 1OPCA 1U84A 2P5GA 4KH5A 4DV5K 4KYWA 3CCVI 3EYIA 1Y64A 4E3SA 2IVOA 1PC0A 3OOUA 1O3QA 4MFEA 2CUDA 1M1KR 3CYMA 1TWFJ 2E10A 5D8KB 2F6CA 1IN4A 3OIQA 3I9QA 3SQ0A 1ITYA 1QVUA 1FLIA 2L3DA 2ASPA 1L3VA 2Q0UA 3EHRA 3SFIA 5HLFA 4YDUA 4IXCA 2DBKA 1MMAA 4IRGA 5ILVA 4L8RB 2RB6A 2PVOB 3VW4A 3KTQA 1GL5A 2JS0A 3IHUA 3G73A 3NRVA 3CMEI 3SUQA 4H5TA 5FLXK 3X25B 1Y8RB 4ZYAA 1BQNA 3OHRA 4RUGA 2CQKA 4CJEA 4DU1A 3QU3A 2OTLN 1TC3C 3VTIA 3G7ZA 1N33K 4KIGA 4C8QB 1UFFA 4PSXA 2H1LA 3G4ST 3OMYA 4BI3A 3AARA 3O1WA 3GTOJ 1W7AA 3O1BA 2RNAA 2DNUA 3BG9A 2O8CB 1SKWA 2DRMA 3LFUA 4D1QA 1ZREA 1VFCA 2GTOA 2A3SA 4MDWA 1R58A 3SMSA 1LAVA 2GUPA 3GFMA 4DQSA 3B02A 1BR1A 3OH6A 2FMYA 4FWQA 2EFPA 1HU0A 5KQDA 2V9PA 3TANA 3VRYA 4OIOF 1VQLQ 5LRRA 4DS5A 3CQXA 1TS9A 3I56A 3CIPA 1LVKA 2BY1A 2BE2A 1PJRA 2Z16A 2M8GX 4KMFA 4KUDK 5GJWB 3AY9A 3B6CA 4XTYA 2D0OA 2PUKB 1Y0UA 1T6CA 3O9QA 4DQIA 4RMNA 4XTWA 3CCUI 3DLEA 2JUGA 1YHQQ 4A3DJ 4P1WA 2M51A 5JFRA 3E5UA 1T2KA 2F96A 2YX7A 4OWRB 3V7CA 3TQNA 1V1CA 3T5XA 5IHNA 4B8AB 2KRNA 3VYHB 1RNHA 4S05A 3RKXA 5FPMA 2NOEA 2YJEA 5LMUK 2B4JA 3W6KB 3P8HA 2ENMA 2P9KA 4M42A 4DUYK 3V9UA 3SD4A 2NVUB 3LSRA 4YNQA 4WFBL 2MK5A 4LMYA 1YIJI 3CD6A 3V4IA 2RF2A 4C8LA 1EX4A 4PJOF 3DYAA 2E5KA 1K73R 1G6NA 3F8NA 4BBSJ 3GW2A 5L3GA 3EYYA 3PMTA 4KPYA 3ZL7C 4PK4A 4DKWA 3JSMA 3SJMA 1EP4A 1OH5A 4CH7A 1IW7F 4C92C 3TW7A 3GL1A 3O3KA 1I8FA 4PL6A 3ZMVA 3P8BB 3TGNA 4CGDA 2BDPA 4BHCA 3JCMg 4YRVA 1JI8A 2DOAA 1Q9YA 1EA3A 4DEYA 2J6KA 1HKSA 1ZR2A 2KRSA 2HTJA 3LAPA 4FJNA 4G7ZF 5GANh 5JS1A 1O3TA 3CMAQ 1OR7C 5ADXH 4JBAA 3C0BA 3ZQIA 1Q1VA 1YP5A 4A3EJ 4JI2K 2MABA 1YW7A 1N8RC 4IEEA 4C0ZA 4CGGA 4DTOA 4H5NA 2QQ8A 1WH7A 2XVCA 3EG1A 1HYZA 2ZGWA 3LA3A 4IRHA 2AIRB 3PIOF 3IS9A 2QEXT 3FGUA 4L6V5 2DA6A 3JTGA 1YJNT 4JD2B 3W6VA 1HNIA 4KN7X 3LAKA 3E6MA 3VENA 2CP0A 1MBKA 2RQUA 1XG1A 1IRGA 4HTUA 4B1WB 3C6TA 4B8CA 5KYUB 4HKEA 2EFWA 2EZLA 4CJKA 4IXAA 1VQKI 4FJJA 3RKWA 2HSPA 2R7OA 5J3BA 3OS1A 1LUJB 3JCMd 4GNIA 4DF4A 3IQLA 4EW0A 2YRDA 2R7UA 2HVRA 3C6AA 1MDUB 1QPIA 4MNUA 3WGGA 2FZGB 3KK1A 4E1JA 4LFAK 1PP7U 4PJJA 2EZKA 2PEXA 3L1PA 1W2BA 4V2FA 3H3ZA 1TAQA 1VQLA 4L0YB 2A37A 4EP4A 5KRSA 3M3YJ 2EHGA 1BA1A 1WWXA 3M1EA 2LP5A 5BPIA 3GBQA 1DGKN 1R4NB 2LKXA 4B9TA 4WCIA 3LWIA 2KEAA 1D0ZA 4WX9A 3X2QH 3INZA 5JLHA 1HRHA 2QA4T 2F4MB 4H03B 2X4YA 5GAOq 2E2OA 4F4KA 4O5FA 3GLLA 2V1NA 5D5XB 1WLJA 1SKRA 2LQKA 2F9WA 3SBGA 3HIFA 2OTLQ 4WWCA 4BRGA 3OYHA 1G2BA 1CZ9A 4J83A 2XKOA 5BRDA 3JB9J 3ZEUA 1YTYA 5IHIA 2HTSA 1VQNN 3NWTA 1WHUA 3P7NA 3EL2A 4JX4A 3FHGA 3SEQA 3AGRA 3UDCA 4M77E 4G6QA 4FETA 5M1NA 3HL2A 3NTKA 4KH4A 2PG4A 1VQ5T 4OIQF 2LFBA 2Q2EB 1KG7A 5L3FA 2EPDA 2V26A 5HDGA 3FB9A 2M87A 5AQXA 4HBLA 4IJAA 1YTAA 2J7IA 2OU2A 3RTRA 1S6QA 1PRMC 4M3WA 2AZSA 3EGXB 4XM3A 1QWEA 4FZXC 1W2BM 1BDGA 2I7PA 1IXRC 4K0KK 5BR9A 1RLQC 1OOTA 2LCSA 3VS6A 3M8PA 3G6EI 2DJQA 2KZVA 4AFSC 2HFHA 1A6QA 2GEMA 2G8WA 4NC6A 4A4EA 1V4TA 3LYIA 3ABLH 1J0RA 3A0IX 2L02A 3R2XC 5CKBA 1QVFA 1AT1B 2GA2A 1QQJA 4M7AC 4GYGA 3VEVA 2LF7A 2Q2EA 3K0LA 5AZIB 1D8YA 4LG0B 2DY4A 3K5OA 3K7AJ 1W1FA 3M9QA 1ESVA 1QVGP 4ENMA 1KQ0A 4W5NA 4JLIA 4KNYA 3CXCS 1AZEA 1R0CB 1BC7C 2WAQN 4WXCA 2B63J 4BR5A 5J26A 1KAYA 3NF8A 2XHBA 2R7RA 1RBRA 2YSRA 2VV5A 2IP2A 2K57A 3F0ZA 1A31A 3V81A 1QO0D 4RW7A 4XL9A 3ABUA 1GLJO 4MFBA 3SJJA 2CFOA 5F1XA 1MBFA 3FM5A 3TSQA 4D5CA 3PE0A 1RIOH 3V4GA 3QDFA 1XHZA 1WHGA 3D1NI 2CUZA 1UGPB 4A3IJ 2KFZA 4YOTA 1FJLA 4JPBW 1RGIA 4MDBA 1VQMN 4KV8A 2G8KA 2DYRH 2RQTA 1KQ8A 1IV6A 4MO5A 3NH0A 2AT1B 4JK7A 5DCFA 1Y97A 1R00A 3CPWA 2DTIA 5FU6B 1EBMA 2RI5A 3DTIA 2RV8A 4EZ9A 3LSPA 2BE7D 3LZJA 4CEZA 4CC3A 4BDPA 2E64A 2QENA 1XS9A 3D4VA 3OTOK 4I7HA 1JXSA 4AVZA 4BR2A 2EFOA 3ZSZA 4FJ8A 2M0YA 3PIOA 2FXAA 2P6TA 4WK8F 2D45A 3F10A 3LWLA 4M7AF 3QP6A 3N4MA 1K83J 3NFAA 2WAFA 1VQ5Q 4M78F 4RTVA 4G6DA 4S04A 2VODA 3GTGJ 1TL8A 4DW6A 4ZTJA 3ABKH 3U2RA 4ON0A 2QWNA 2KRCA 3KLHA 2O8XA 3MP1A 3WGHA 1S6PA 1HJRA 4Z4FA 5AQVA 2L5QA 5C2FA 1VQ6N 3TDZC 1O13A 3I3LA 3KIOA 4RS8A 3T9NA 2YNFA 3VEXA 5FD5A 1YIJQ 2PTKA 4GDFA 1RI9A 5A0GA 2VG7A 5FWCA 1KXPA 2DQRA 2ZAEA 2X6WA 3CDIA 1X4OA 2V7YA 2VC1A 3GBGA 2OTJQ 5HKCA 1JL1A 5LFAA 1VQPT 2HQHA 1Z9ZA 3NGYA 1S72N 1Z9QA 2OTLA 2XU8A 5HS7A 5LGUA 4M3UA 2RN7A 3JW4A 3IP4B 2QYZA 4M78B 3HOYJ 5JLFA 2W85A 3K1MA 3HSCA 3T1YK 4FE4A 3P31A 1YBYA 4DK9A 5EJCA 3C6UA 3ULEA 1XC3A 4BEHB 1NZ9A 3WHBA 1KEAA 1NJIC 4FT8A 1HBXG 4C5EA 2ITGA 5F0FA 3OBWA 5HDNA 2QSHX 3CCQI 3KX2A 4BQZA 4GV3A 4XIUA 4PZJA 2K9QA 4EQQA 2X3WD 1QS4A 1EKEA 1MD0A 4IQ4A 1YJ9N 2M7BA 1WXBA 2EV5A 5M1PA 1X6BA 4HT8A 4XH1A 2ELHA 3ABTA 1LPLA 4F04B 1C0FA 2VN2A 3MEEA 4ILGB 1BL3A 1HNVA 3JCMh 1UELB 1PUEE 2DPDA 4B9VA 3G6EN 2VWJA 2KRFA 2ZSIB 1Q82O 2M30A 3DLLF 2JNGA 5FWBA 1GT0C 2D8HA 1X3UA 3GG4A 4XICA 5KCOA 3LDPA 5IT3A 3IV5A 4W5OA 1FWZA 4Z0UA 4BNCA 4NBQA 4EHUA 2PQWA 5CHZA 2RPIA 2W25A 4H8KA 5LEJA 4CF0A 4FPAA 4MLOA 2HMAA 4PLIA 1OU8A 2OZ6A 4YELA 4I0AA 3CC7I 5HVQC 3T0YA 2XROA 1ON2A 1OULA 5KYYB 1K8KB 4BS9A 3PIPA 3F21A 3LP1A 1U2VA 3KHYA 1RDUA 3U8XA 1I6HJ 1VYTA 3H0DA 2ME0A 2JM9A 1S9HA 1YITN 5CVUA 3LQRA 4BGDA 3K4MA 1U9NA 1QZ5A 2M02A 1B34B 3MWMA 1RT7A 2FSWA 1H88C 3CCMT 2CGPA 1VSIA 1QSSA 1TTHB 2LVSA 2HQXA 2JVGA 3ASNH 1P9QC 2KL4A 3EYZA 4BY9C 1MMSA 2VKEA 4KBOA 3OGDA 1I94K 2GA1A 1DGWY 3CCQN 4YOQA 1IRZA 1S1TA 3I56I 1UMQA 4KMUX 3OYBA 3O3HA 3I5SA 1RRQA 1XGOA 2XAGA 4LSNA 4GW6A 2KZZA 1E4GT 4C8QD 3FF5A 4XLEA 3V1OA 1MDMB 3CC7N 3IDHA 1HSQA 5J4VA 2FG0A 4C0FA 5GMKj 5AQPA 4HUFA 3GZ6A 3P9KA 3BTJA 3O08A 4HWIA 2HOSA 1LV5A 4WCGA 4FTHA 1X1AA 1HF0A 3EQLF 3THKA 2VYTA 1TW2A 2V1DA 3OL3A 4EMGA 5GANj 3N97A 3BR3A 4EJYA 1Y71A 4PJMA 1V5GA 2Y0SA 2X6NA 3E5XA 2FX0A 4LK0F 2D1KA 1MH3A 3DRSA 3CCRI 4OLBA 4UNOA 2LNVA 2PMUA 2ESWA 4DR6K 1KONA 4CVNE 2GBQA 2ABLA 5GAN2 1MJAA 1N3AA 1M1EB 3SXYA 3L2ZA 2VGMA 2FRWA 3WNEA 3BG5A 3QZ5B 5C44J 4Z4EA 4CHYA 1XMQK 1IG9A 2Y4XA 4FLVA 2Y48A 3CDLA 4DV6K 3U4LA 2HNZA 2X9DA 2ZMEB 4G12A 2HI3A 3VQQA 5ECAA 1MWMA 3CWAA 5DM7L 2PMZA 1NU0A 2F4IA 2COYA 3LSKA 1VYVA 4I09A 3HZ6A 1BGXT 3HT3A 2RJCA 5LD2C 3CPFA 4IDHA 4ASNA 4DV0K 3BDLA 3VV0A 1IJWC 4KH0B 1YUWA 1NHAA 2D0CA 2P9NB 3UF4A 1QBJA 4E7IA 1TH7A 2EQUA 1IH7A 1K9MR 1LCKA 2RK1A 3IRQA 3E9GA 3S2WA 3WTUC 3SFZA 1VQMA 2GUIA 3ENOA 3JSPA 2JUCA 3H36A 2FE3A 3ZMSA 2ZC2A 5K5QA 4RCHA 2YS9A 3CP2A 1S7EA 3TQ7P 4KT0E 1NKCA 2UXXA 5E3LA 3ERMA 4HQEA 2DXTA 3FR0A 3Q3SA 5KHDA 1BBYA 1VIEA 4J6YA 1C6VX 4C0GA 3JRGA 3VS4A 3FK7A 2FSNA 1ZHFA 4RTYA 4AVPA 3FWEA 4HLYA 4FVUA 2VJJA 1VQ9Q 1VSMA 2L9RA 2ZFUA 3DEWA 2IS3A 4DTNA 2MOXA 2UUAK 3TSWA 1YJNQ 1ZBHA 3G0QA 1R5GA 4XLFA 2BZTA 3MO8A 2ZJQF 2Z1JA 4ZDLA 2EX3A 3HBLA 3KKSA 2XAFA 4KIBA 1YIJT 1WSHA 1IRXA 4XU3A 2BKDN 2CKKA 2DL3A 3ZETB 2GOXB 3D6RA 4LLLA 5E1WA 2JVVA 1MV3A 3ZQ7A 2CT3A 4HHTA 5BOXA 2GV9A 3VS5A 3QBXA 4Q48A 1SPKA 2R7TA 1AU7A 3VQ5A 2NOJB 1M4ZA 5BRFA 4EMKA 1HR0K 5I42A 2CZ6B 3HTUA 1BHLA 3U9DA 3OYDA 2DJZA 1RTJA 2DETA 1N5YA 2JPBA 4JI4K 1XGMA 5IP9J 4M3TA 4ZYGA 1QZYA 1D8KA 1TP4A 2DYSH 3H3NO 4CHNA 3KP5A 3TU4K 2XIGA 3DXMB 3COAC 4HX4A 1YQRA 2B9SA 1K9MC 1MJ9A 2O03A 1MBEA 1LEAA 2LF8A 3SNNA 2EB7A 2JTFA 4I7FA 1VQ7T 2FBXA 3ZMUA 5J1RA 1I0CA 4IBNA 3GIBA 4WQ4A 1W0HA 2VGNA 1ZAOA 1B7TA 3H3VK 3CCSA 4P5NA 2JA7J 4CCOA 2M4GA 2ZGZA 1O7LA 1FC3A 1X01A 2HBLA 4X64K 3EZ5A 2CQXA 3S2HJ 2O3FA 4QQGA 1VF9A 4KHYA 4XKBA 3HL8A 3V1RA 1YI2N 1TUDA 3C2HA 3V42A 2VOOA 3ZQFA 4B23A 5KYXB 1M5Q1 1ZR4A 3I55T 4MMKA 2XC7A 3EKSA 4MZMA 3JCMQ 4DV7K 2VBWA 3TEEA 5GMKe 5F1JA 1ETWA 1Q81U 3GEZA 4DV4K 4LITA 2EW3A 4ZYDA 1WJRA 3VYSB 5ED4A 4M75G 1JLGA 1USSA 1OMIA 4XAXB 1RTDA 1M1KO 2CS7A 5FW9A 1KRPA 4ZYEA 4P96A 1QVFM 5GMKm 1G59A 4FM4B 2VUMJ 3T1AA 1XJWB 4JKEA 3WTZA 3WVDB 2R58A 4KTQA 2GQVA 2QWMA 4FM0A 4CO8A 2AHJB 3GNGA 1VSEA 3DXJF 2E5LK 2E2IJ 5GIPA 1K9MO 1N6AA 1QCNA 2MD5A 1H0MA 4E2FB 1WSJA 1S1XA 4LD9K 4Y15A 1NMNA 4AI4A 3M3ZA 4CJFA 4K8XA 2QEXN 3QICA 4JUVA 2QK9A 3QERA 3BLYA 2IGKA 2MGQA 2PX9A 2JMAA 3M8RA 1WJFA 1BU6O 4QVCA 1SL2A 3DLGA 3CJ7A 5CKTA 2KQ2A 2OV7A 3OR1C 3AO3A 5KYWB 2RVCA 1KO9A 1X3MA 3WUHA 2E1YA 1IKVA 3W6JB 2NZTA 2DFEA 4LK1F 1MHNA 3E66A 2ZKZA 4YFNF 3S16J 2UXNA 4HVVA 4W97A 1AEYA 2E41A 3EDPA 3JRZA 3GTPJ 2X85A 2HZYA 3HKSA 3VS0A 4JI7K 4MZPA 2VJIA 1Q18A 3BT9A 4JKAA 4BQLA 2NXNB 5AQGA 1QNTA 1K1ZA 4F7UB 3I8DA 1ETQA 4OFEA 1NGHA 1BO5O 1USTA 3VFZA 1R77A 2UYTA 1FBSA 4AHVA 3I56Q 1G3TA 2O4IA 3UA7A 3CC2I 1U1TA 2BGGA 1XWLA 4Q4ZF 5DD4A 3H1CA 3JSOA 4FU6A 2Q36A 1RZ4A 4PWDA 1TTYA 4FWKA 1AD5A 1HDPA 4MFDA 1OYXA 1JJ2M 3O2PE 3K2AA 1GOAA 4FE7A 4C92A 3PFSA 4IFYA 2K2MA 1X2QA 3A98A 3HPHA 4HRIA 5BPNA 3GUDA 2XF5A 3CG7A 3V8LA 3VYUB 5HOOA 1KG6A 3FXOA 5DD8A 2L9NA 2E71A 2DQLA 3I55A 4LFCK 1WSFA 1NPRA 3VPZA 2MG4A 2DK8A 1K6YA 3DEEA 2NOBA 1NGCA 3UR3C 1ON1A 5CYQA 2HZTA 3J80O 2LRDA 5DCMA 4QLCU 1XSDA 4F16A 2NUBA 4E47A 1X9MA 3PMIA 1IUFA 4RGSA 4Q47A 4XTZA 3JRCA 4M78D 1G83A 2XGEA 3SQNA 2KAFA 4ZNXA 4A63B 4H4OA 5BNGA 2O4XA 4B43A 2OTJI 4R79A 2LNHB 1HNWK 3SZTA 2RE2A 2M34A 3KFWX 2HNIA 1W7PD 1LW2A 1J5EK 3MN6A 5H2FC 4J2BA 2EYZA 5J3LA 4XRMA 1KD1C 4IZ9A 4W5QA 3OJUA 3I59A 2LJ0A 3M4GA 3FHZA 4YY3K 4KHNA 1YYVA 1D9DA 1Y96B 2O9SA 1Q86O 4KUIA 3LLRA 4UXNA 2ZWHA 3R1XA 2O8DB 2BTTA 2GIVA 3OL4A 3KLFA 5B3SH 2LJ3A 2DRKA 4LY7A 3LGFA 3RSEA 2EKHA 3L9FA 5HRNA 3OW2P 3BQZA 1BUPA 4OPJA 3SDGA 2VBYA 3DB3A 2BH1A 4K2EA 4H5VA 2JPCA 4E89A 1K0XA 2DVEA 2VE8A 3WT0A 4ZH4F 5HNHA 1H8AC 2RNGA 4BRAA 3F8CA 1T44A 3V8KA 1QRYA 1VQ6T 1FOWA 3QOEA 5KPTA 4M3YA 4FISA 4XSXF 2MI6A 2K4YA 2NOHA 2R7FA 1WQ7A 1R8OB 1XSVA 1WQ2A 5J6XA 4F2RA 4DHYA 1BCOA 4KREA 4DQQA 5JVGF 4DGWB 2P0QA 3FJ5A 2W6KA 2M2EA 3HJFA 1QKXA 3CC7A 4CE9A 2LSOA 4NLCA 4A6EA 4CEAA 3LNQA 1NJWA 1BCMA 2ZBKA 2L0AA 3CJ1A 3K58A 4DQ2A 3EETA 4ISEA 4ELVA 4L9VA 1RUNA 3U21A 1Y0MA 3HM8A <