3OYGA

Crystal structure of the prototype foamy virus (pfv) intasome in complex with magnesium and the insti compound1 (compoundg)
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
368
structure length
368
Chain Sequence
LDAELDQLLQGHYIKGYPKQYTYFLEDGKVKVSRPEGVKIIPPQSDRQKIVLQAHNLAHTGREATLLKIANLYWWPNMRKDVVKQLGRCQQCLITNASNKASGPILRPDRPQKPFDKFFIDYIGPLPPSQGYLYVLVVVDGMTGFTWLYPTKAPSTSATVKSLNVLTSIAIPKVIHSDQGAAFTSSTFAEWAKERGIHLEFSTPYHPQSSGKVERKNSDIKRLLTKLLVGRPTKWYDLLPVVQLALNNTYSPVLKYTPHQLLFGIDSNTPFANQDTLDLTREEELSLLQEIRTSLYHPSTPPASSRSWSPVVGQLVQERVARPASLRPRWHKPSTVLKVLNPRTVVILDHLGNNRTVSIDNLKPTSHQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular mechanisms of retroviral integrase inhibition and the evolution of viral resistance.
pubmed doi rcsb
source organism Human spumaretrovirus
molecule tags Recombination,viral protein/dna
molecule keywords PFV integrase
total genus 106
structure length 368
sequence length 368
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2010-09-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
A PF17921 Integrase_H2C2 Integrase zinc binding domain
A PF18103 SH3_11 Retroviral integrase C-terminal SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2300 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3oygA04
1.10.340.70 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Endonuclease III; domain 1 3oygA01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3oygA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3oygA03
1NK5A 4KHSA 2R58A 1FKPA 1HRHA 3LX7A 1FKOA 2WOMA 4W5RA 3JSMA 1VRTA 3AA5X 3O8VA 3AA2A 2R5MA 2RHXA 1S1XA 4ZTJA 1TL3A 3LP1A 3QKJA 1KTQA 4ZTFA 3CG7A 1SSFA 1WAJA 3L2RA 2RHZA 1CZBA 1LW2A 1T7PA 3E9FA 3MXJA 3KK2A 1J9AA 4O0IA 3L2UA 2O4XB 1JLFA 2EX3A 3T1AA 3VQDA 1ITGA 1TVRA 1VRUA 1YVUA 4FJXA 1Q8IA 3FFIA 3VA0A 3OYAA 3M8PA 4OKEA 1A5VA 5D6XA 1RBUA 4CHQA 4B9WA 2RPIA 1TK5A 5HP1A 4FLZA 2YKNA 1WGSA 1RCHA 3G0ZA 3QJ6A 3SCXA 4I9LA 3TARA 3V1RA 3EZ5A 2E4LA 3MAQA 1T03A 4J2AA 4PLIA 2A1RA 5D6WA 1KHCA 2RI3A 3LP2A 4GW6A 3OYMA 3V9UA 1Z25A 2R5AA 3NFAA 4X34A 3KKSA 1C1AA 4W5NA 1J54A 1DTTA 3I0RA 1J5OA 4JS4A 4HUEA 5HRRA 1S1TA 2RN2A 1UWBA 1H3ZA 3AVMA 4B08A 3HVRA 1C1CA 3I0SA 1NJWA 3PMIA 2BE2A 1TKDA 4FLYA 2OZSA 1D5AA 3OYIA 3ZSWA 2ZD1A 3DMJA 3QEXA 4CJ5A 3OJUA 1JLBA 4EZ6A 4F3TA 1NK0A 4QOZB 5C0MA 4MQ3A 5HRSA 5C24A 1SV5A 1I3AA 2RHUA 3OYKA 3SUOA 1NK9A 3SQ0A 4NYNA 4ELVA 2VG5A 2RJEA 2GV9A 2CKKA 2YRVA 4DFKA 3VQBA 1ASWA 3CEYA 4CESA 4JLHA 3WNGA 4KKOA 3TAFA 3OYCA 5KCOA 1YT3A 4CE9A 4A4HA 3LP0A 3F70A 4UC4A 4FJJA 4E7JA 4FJIA 4BDPA 1FK9A 3AVJA 1RTIA 3KK1A 4DU1A 1U47A 2G8UA 2O4IA 3DRPA 3QIOA 2M16A 3EAEA 4CJ4A 4ZHRA 2HNZA 2NUBA 1QHTA 4FLVA 1HNIA 4FXDA 4AH9A 3HO1A 2DFEA 2FBTA 3OYJA 2OPQA 2HHUA 4Q5VA 4E0DA 1RNHA 3LH0A 1RT4A 4OKKA 3RMDA 2O4XA 1CXUA 1JL1A 1VSIA 1LWCA 2LRQA 2GF7A 2QQSA 4DTJA 4Z4IA 2WONA 3HPOA 4FVMA 2KTQA 4OLBA 4IUQA 1BCMA 4BD3A 4LH5A 4FZYA 1CZ9A 5CYQA 3SUNA 4F2RA 4N5SA 4K8XA 2DTUA 4IFYA 4QAGA 3ZT3A 1BI4A 1LAVA 4AILC 3KD1E 2VG6A 3MO8A 4FJLA 4DF4A 2P51A 3DOKA 3SUQA 3SV3A 1XC9A 1HPZA 5J1EA 2DAQA 1ZBUA 4CJ3A 4M42A 4FJGA 3CM5A 1ZBHA 3GOXA 1JXBA 4CGHA 4DLGA 4ELTA 3NH0A 4AHCA 1SUQA 4JRPA 1VSDA 4QCLA 4CK2A 4FW2A 4CJLA 4CEQA 3QESA 3HPGA 2BDPA 3KD5E 2YNHA 1WSGA 4CJVA 4J2DA 1KRPA 1TGOA 1RBRA 4W5QA 5CY4A 3T3FA 1NJZA 4N76A 4NCBA 3M8QA 3TABA 2A1SA 2DFHA 3VQQA 3OJSA 1I39A 2E6NA 4CF2A 3PMTA 2EQKA 4CJKA 1JLGA 3V9WA 3VN5A 4DSEA 3B6OA 4LH4A 4B8CA 5EU7A 2EQUA 3CFPA 1SKRA 2X78A 3SZ2A 3QEVA 4FJ8A 3MEWA 4FU6A 3LALA 2L89A 5SWMA 3DLHA 4DTNA 4DQPA 2IOCA 4CGGA 3NGIA 4Q5WA 4YFUA 1RI0A 2KFNA 2M1HA 4I7FA 3EY1A 3DB4A 2B6AA 1D9DA 2VWJA 4CEOA 4UQGA 3OYFA 1BISA 1U4BA 1N6QA 2NLUA 1KLNA 5JS1A 4FM1A 3K58A 1A5WA 1RTHA 1QSLA 2G8HA 2HHVA 3VQ4A 1X9SA 4C8KA 1VSFA 4DSIA 2IDOA 4NCGA 1NKBA 5J2QA 3IS9A 2Y1JA 4QVZA 1GOBA 3KJVA 1LWEA 5J2PA 1QS4A 1NJXA 1YTUA 3DLBA 5KRTA 4E19A 4C8MA 4FJ5A 1NK6A 3OYHA 4HCZA 2Z1GA 4KI4A 1IO2A 1HMVA 5D3GA 2LDMA 4BDZA 2RI5A 3ZT1A 4FM0A 2XHBA 4DS4A 1U45A 2D5RA 4WE1A 3E9GA 2GFAA 1HYZA 3TANA 2RKIA 3L2VA 3B6PA 3K5NA 4C8OA 3O3HA 2HQXA 3K5LA 5SZTA 3OYGA 1XNIA 2B8AA 3KLIA 4E7HA 1VK0A 1X9WA 2XY7A 4HTUA 4C5GA 3QO9A 5J2NA 3E01A 3O4NA 2XO7A 1W0HA 4M3UA 4LD0A 3HYFA 3O3GA 1TKZA 1N5YA 3M9QA 3HP9A 3AVGA 3S9HA 4KB1A 2P5GA 1WJQA 4CRIA 4FJNA 4OGCA 4M3XA 3ZT0A 2L8DA 1HQUA 3RMAA 3VA3A 1XWLA 3HM9A 3OYBA 3K2PA 4CCHA 2G8KA 4QQDA 3NH2A 4CHZA 1WJRA 3QIIA 4CJSA 3LPTA 1SL0A 4CFCA 3AO3A 4CGIA 4EP4A 4OPKA 4DSLA 1S1VA 3AO5A 3S3NA 3U3YA 1JLQA 4KI6A 2XRIA 2HB5A 3KLFA 2OYQA 2HNDA 4B9UA 3QBYA 3LP3A 3KK3A 4OLAA 3OYDA 4GMJB 1HYSA 2RHIA 3FDRA 1EKEA 5C6SA 2FC0A 3DRSA 4BE2A 1MHNA 3QIPA 4N47A 3LLRA 3VQAA 4CEFA 3P83D 4RW6A 3NBPA 2QQRA 5DMRA 3IRXA 3TAGA 2YHBA 4CEDA 2EQMA 4HCCA 3OB9A 1WSJA 1JLAA 1WAFA 1Z26A 3AVLA 2G3RA 2X6NA 3ITHA 1R0AA 4PUOA 2HHXA 2P5OA 3MEAA 1TK8A 4B9XA 3C6TA 5K14A 5T7BA 3HT3A 3L8BA 2FHDA 2XK0A 1O1WA 1QE1A 3NE6A 4DQRA 3SI6A 4PY5A 2D0AA 4E1NA 4E7IA 1RT6A 1BQMA 4AHTA 3WNFA 2F8SA 1VSLA 3HSTB 3SQ1A 2E6MA 4CIEA 3THVA 1QSYA 3HVTA 3RWUA 2HVHA 2G8FA 4PWDA 1KVBA 1NJYA 1NKCA 2DIGA 1REVA 2Z1IA 3AA3A 2FBXA 3VQ9A 3OVNA 4FK4A 1VSMA 4IG3A 1JLCA 3SD4A 3U3GA 4CEBA 3TAMA 4L59A 3MEVA 2W42A 2ZQBA 3AVBA 1JXEA 3QNOA 1X9MA 2BKDN 2YHAA 4IUVA 3OYLA 5D6YA 1BGXT 1RBVA 1Q9XA 2JTFA 1KCFA 3ZEHA 3WNEA 5C42A 1TKXA 1SKSA 3K5MA 3ULDA 4M3YA 4FYDA 4Z02A 1RT7A 3UIQA 1BL3A 1BCOA 2IG0A 4NZGA 4CJUA 4B9VA 1SKWA 3I8DA 2L3RA 1B9FA 1ASUA 1S9EA 3DI6A 3VQ5A 4DSFA 3RRGA 2RJDA 4QQ6A 4KHYA 4B3OA 1S1UA 3CYMA 1W9HA 3AA4A 4CHOA 4KFBA 2OZMA 4CF1A 4FK2A 2HHTA 2G8WA 4CF8A 4CHNA 5M9OA 1TL1A 3ZT2A 4B9TA 2AJQA 1OZ3A 1ZBIA 1RT3A 4DG1A 2X4XA 4JS5A 1D8YA 1WNSA 4FM2A 1B9DA 3SJJA 4FJMA 2F8TA 1HJRA 4CK3A 3C94A 4KHNA 2HHQA 3MP1A 2K3XA 3VQEA 3H8ZA 4B9SA 1U48A 1L3VA 3LAKA 3NAEA 2PYJA 3AVIA 2IAJA 3F73A 3AVAA 1HQEA 4BE1A 3DLRA 4FZXC 3HP6A 3OY9A 4K8ZA 2P1JA 2DY4A 1UAXA 4FK0A 4A4FA 4BWJA 1F21A 3OYEA 1TKTA 2OPSA 3C6UA 3NDKA 4A4EA 4E7LA 2RO0A 1LV5A 4IG0A 2LSNA 3S3OA 2QKKA 5IAYA 1S6QA 3PO5A 3UT1A 2RF2A 1IKWA 3V1QA 1EP4A 3ZSOA 4LY7A 3MXIA 1IG9A 4N4GA 5KI6A 1JKHA 1X1PA 3K5OA 3V6DA 2GUIA 2D9TA 2OPRA 4W5OA 1NK8A 2P0KA 1SL2A 1ZBLA 3TAQA 4KTQA 2XY5A 3NTHA 3OMGA 5J39A 3NH1A 3V81A 2Z1JA 4II1A 4C5IA 4BACA 4FLTA 3G10A 2X4WA 3LYIA 3KLGA 4H8KA 5HLFA 5CYMA 1QSSA 4LSLA 3BDLA 2IC3A 1C1BA 4NCAA 4OKJA 1WSEA 4KPYA 4A4GA 2HMIA 4IUPA 5KTQA 1TAUA 3AVNA 2G8IA 1HNVA 2VWKA 3Q1JA 1ASVA 1LWFA 1NOZA 3ALYA 3VQ6A 2KFZA 4CFAA 5IN1A 4AHVA 1S1WA 2RJCA 4OVLA 3VQ8A 4DFMA 1TK0A 4FJ9A 4Q0BA 2E6LA 4B9MA 1KVAA 1RT1A 4GVMA 3TR8A 3PFSA 2LTOA 4DSJA 1K6YA 1ZBFA 2PQWA 4Y1CA 4KHQA 5FROA 3KKRA 4PQUA 5FRMA 1RT2A 4CGFA 3P8DA 2PYLA 2PZSA 2DIQA 4L8RB 3S6WA 4B9LA 1G5VA 2BANA 3DM2A 3SPYA 1XI1A 1L5UA 4FLUA 1DTQA 1KSPA 3FC3A 3MP8A 4OVAA 3OMCA 3ZSZA 4F3OA 4O4GA 3FEOA 4IUUA 4H4OA 4CJEA 3PY8A 4DTRA 3QEPA 2IGIA 1VSHA 1WLJA 4JRQA 3SV4A 3RMCA 4M45A 4FLXA 1NK7A 3NCIA 2MWPA 4CEEA 4CGDA 2K3YA 5J26A 3OA6A 1RTJA 2X74A 3DLKA 3KTQA 4DU4A 3LZIA 1BIUA 4CEAA 1GOAA 4IBNA 4HUGA 1C6VA 3C4SA 5J2MA 1T8EA 1YTAA 4CJWA 5KE2A 4O5BA 1KLMA 1WSIA 3PX6A 3RMBA 3ZSVA 2EKOA 3MEUA 4NS5A 1LAWA 2EFIA 1IH7A 1RDAA 3PV8A 1UA1A 4R5PA 3H6ZA 1N27A 2KZZA 3O4QA 4BDYA 1WSHA 3TAPA 3META 1IKVA 5HROA 3NF8A 1RDDA 2M0OA 4C8LA 3MEEA 1B92A 4RW7A 5FDLA 3LZJA 2XY8A 4CF0A 3AVHA 3DLMA 5C25A 4LD6A 1S5JA 5CZ1A 2KQ2A 3MP6A 1C0TA 4Z4HA 2DFFA 3RRHA 3TI0A 2LVMA 3V1OA 3RTVA 4Z4EA 2ZE2A 3PX0A 4E1MA 5KCHA 3QETA 1U49A 4RG2A 1RBTA 4C5EA 4EDUA 1WSFA 4DTOA 4KRFA 4FW1A 2JLEA 3P1GA 3ZSXA 1JL2A 1U04A 3P8HA 3QEIA 3LWLA 4ID1A 4KTZA 2R57A 4OJRA 2RI2A 3AVFA 2OA8A 3NGYA 3DRRA 1UOCA 5CIUA 3V9ZA 4DWIA 2GFUA 3OS2A 3NF6A 1ZYQA 3F9KA 3SUPA 3ZCMA 4RW8A 5KGWA 3NTKA 3LAMA 4E89A 3KLEA 4DFJA 3VQ7A 3JYTA 5HBMA 4H4MA 3ZSQA 3O3FA 4I2PA 1KFDA 4KHWA 4Z4CA 4NYFA 3CFRA 3MXMA 1RTDA 4W5TA 3LANA 4CECA 3HK2A 5KGXA 2O4GA 3BGRA 4CFDA 3M8RA 1SL1A 3HXMA 4HHTA 3UWNA 4OPJA 3VQCA 4DU3A 3SQ2A 1L3UA 3NHGA 2HHSA 3S3MA 3L2QA 4GY5A 4DTUA 1TV6A 1S9GA 4AHUA 5FRNA 1NKEA 4CIFA 4YNQA 2ETJA 3NF7A 1OI1A 5JS2A 1D9FA 1OYXA 2B4JA 2ATQA 3QINA 3OS1A 1KVCA 3IG1A 4CHPA 4DS5A 4I9QA 3DLGA 4KV8A 4RW4A 2MWOA 4B9NA 3QNNA 1Y97A 4ELUA 4DTPA 4ID5A 4IFVA 3L3UA 4CHYA 3BDPA 3L2WA 2BIVA 1RDBA 5KRSA 3PX4A 4N41A 2B5JA 3MEDA 1UA0A 1RILA 1EXQA 4BWMA 1CXQA 4CEZA 3SQ4A 1XHZA 3ASMA 2R7YA 4PA1A 4KO0A 3K57A 2F5KA 4M3TA 4LSNA 1JLEA 4E7KA 3WNHA 4IKFA 3CFOA 1EETA 3C95A 3OQ5A 3T19A 3QEWA 1RDCA 4PLLA 2F96A 3AO4A 3EYZA 4DFPA 3LDSA 5HRPA 1T05A 3TWHA 4N4IA 4CERA 2YNIA 1VSKA 1WJSA 2HQEA 3ZT4A 3L42A 4O55A 4HUFA 3RR7A 3ME9A 4M3RA 4AHSA 4CJPA 3HJFA 3NNQA 4QW2A 4QQGA 2LCCA 3LGFA 1C0UA 2EHGA 2HNYA 1HYVA 4DLEA 4DTSA 4M41A 4CJRA 1QQCA 3DOLA 3ISNC 2X6SA 2YV0X 5I3UA 3DLEA 1KFSA 5CZ2A 2IS3A 3CQ8A 1QTMA 4KAZA 4Z4GA 4B8AB 3NTIA 2BUDA 4Y1DA 3K59A 3KUFA 3OYNA 4OGEA 1OZ2A 3AO1A 3KIOA 3V9XA 3SPZA 2RHYA 4IURA 3U6FA 4EZ9A 5KE3A 3A2FA 3ASKA 4C5HA 4MFBA 3DB3A 5DK5A 2X4YA 3CM6A 1Q9YA 3AO2A 3FLGA 4Z0UA 2ITGA 3SYZA 2X35A 4TSXA 2Y1IA 2KZMA 3HPHA 3AV9A 4EP5A 2QKBA 4FJKA 4J2BA 2E5QA 4RG8A 4XIUA 4RW9A 3LGLA 4HVJA 3NGZA 4CK1A 4DF8A 2HW3A 3NF9A 4FZZA 2GBZA 2HHWA 3LPUA 1RBSA 3DYAA 4KTWA 4PL6A 3AVKA 2YNFA 2QXFA 4FL6A 4CJQA 3IAYA 2HVIA 3V9SA 3QLHA 1MU2A 3LWMA 2I5JA 1VSEA 3ZSYA 1BQNA 5HRNA 4HCBA 5I42A 3M8SA 3P5JA 2VG7A 3PO4A 3AVCA 4N4HA 1S6PA 2Z1HA 4C8NA 2D0BA 2XY6A 2FBVA 5KH6A 3MECA 1TAQA 1L3TA 4Z4FA 2EQJA 2BGGA 3ZSRA 4N56A 4CJFA 4FCYA 3V4IA 3L3VA 4FLWA 2YKMA 3SNNA 3OS0A 1VSJA 4ICLA 3PNWC 4BE0A 4AHRA 2FBYA 2YNGA 1J53A 1A5XA 4O44A 2D0CA 4G1QA 4I2QA 4DSKA 3H08A 4DTXA 3D45A 4DQQA 2JGUA 2QK9A 1IKXA 4IDKA 3HL8A 1DLOA 2KW4A 1XHXA 3KLHA 4J2EA 3MEGA 1EX4A 3QERA 4DQSA 4M3WA 1FXXA 1LW0A 4FJ7A 4F2SA 4O0JA 2RJFA 1IKYA 4DTMA 2PY5A 1BI4B 4F4KA 3PUFA 3TAEA 4KB0A 4FJHA 1G15A 4DMNA 2WACA 3D0PA 4F8RA 1CLQA 4CGJA 4E3SA 1L3SA 4CIGA 4M3ZA 2XDPA 2VYTA 2Q3SA 4KHUA 1NK4A 2G8VA 3RR8A 1C0MA 1WN7A 5E41A 4IUTA 3VQPA 4CFBA 1RT5A 1BHLA 1NOYA 4DQIA 4KREA 1GOCA 2OPPA 1BIZA 4CJTA 4CF9A 2JZ2A
chains in the Genus database with same CATH superfamily
1FKPA 2E2NA 4XU0A 2F2VA 2OD5A 3CCVI 2V1UA 2JJ7A 2RHXA 5D6FA 3KWGA 4DR1K 4BRHA 4JQFA 3IFRA 4JK8A 3A01B 3R8EA 1TVRA 2EV5A 3Q9SA 1QZEA 1YS7A 3JCMb 3EGXB 4EJVA 3F21A 3RYRA 2DVEA 3PNTA 3ZYYX 3N5BB 4PJOD 1PG5B 4HUEA 3BR6A 4YOVA 2M9HA 4M7DG 3OYIA 2CGHA 5LD2C 1U2VA 1YQMA 1NEBA 5DM7R 2HBKA 1F36A 3OR2C 2YRVA 2L02A 5MLCQ 2E1MC 5FKNA 4DR7K 1WQ2A 3GP8A 4F14A 1XUPO 3O4WA 3F70A 4DU1A 1S7EA 3REAB 5K7ZA 1F5TA 1K9MR 1MPGA 1UFMA 4DV3K 4ATOA 1HKBA 3HO1A 1DP7P 2OPQA 1RNHA 4A3BJ 5L8RE 4RGRA 4M7DA 1BCMA 2K4YA 2RPNA 1NM1A 4LH5A 4B3MK 4F2RA 2I10A 1M3HA 2DA3A 4HWIA 3A5ZB 1HPZA 1YI2N 4FJGA 1JXBA 3BWGA 3K6GA 4OMMA 2KKZA 4WXDA 3KE2A 4FW2A 3QESA 3MEXA 1BG3A 1WSGA 2YNHA 2F4MB 3E6CC 5CY4A 1KD1O 4CCLA 1YW7A 1ZUKA 3HXLA 3G4SN 4M7DE 2KIQA 2P9PA 3VN5A 4J7IA 2LF8A 5TRDA 2C6YA 4F7UB 1RZ4A 4W1UA 4YFUA 4JNEA 3CXCA 2EFWA 4N0AC 4C92G 2D8HA 3MD2A 1JXOA 2OFIA 1VSFA 3ASNH 3BROA 1GOBA 1YX3A 3D2EB 1GV5A 2RHKA 3GW2A 3QU3A 2HQAA 2VPRA 3CCVQ 1S72I 3VETA 4DS4A 3KYDB 4JHDA 5AQXA 4FM4B 2Q2EB 5FLXK 1GBRA 2ZJQF 2DFUA 4KISA 4E9FA 1XNIA 1I5LA 3ENBA 1X9WA 1TL8A 2CJJA 1HLUA 1VQ6A 2COWA 4QLCU 2K79A 1BUPA 3DXJF 2O31A 4K42A 2HZYA 3HM9A 1N32K 1O3TA 2DTRA 3FMRA 1HR0K 4KI6A 3VSKA 2HNDA 4B9UA 2PEXA 3I5SA 4GMJB 2XAJA 1QPIA 2FZKB 1T3VA 1WI3A 2NRZA 4DQ2A 4LNPA 1XQOA 2OTJT 1ORKA 4B9XA 2GX9A 4XKVA 4H0TB 1RT6A 5L3BA 5A0DA 2HSTA 3OHRA 1KGSA 3QMLA 1YIJA 3O9QA 3ZBDA 3OYLA 1BGXT 3GWZA 1TKXA 3OWTA 4NB5A 1J5YA 5KN8A 4NOYA 2P9KB 1FNNA 2M7AA 4NDLA 3A8HB 2WV0A 1OCZH 5GJVB 5GAOl 3RDVA 2QGUA 4C2TA 1KAYA 3L6QA 4YOTA 3J7AO 3ZT2A 3B6CA 2AJQA 3L9FA 4P5OA 4WQ5A 4L5IA 4JS5A 2QEXN 5DPKA 4WCIA 5C4XJ 3I56A 3NAEA 1KU2A 2KYBA 4OPHA 5DS9A 3MHXA 1KYWA 3OY9A 4KRTA 1VQKN 1UAXA 5IYDJ 1HJOA 1LV5A 2J6OA 3I0TA 4BVPA 2RF2A 1W7PB 2GEMA 2K57A 3K5OA 1NGDA 3BG3A 2JSCA 4N0BA 5GAMf 2MA3A 5J3BA 5GANe 4HF1A 1IW7F 2JG6A 1WVRA 4M7AB 1OVQA 1TAUA 3AVNA 1HNVA 1XNQK 1LWFA 4KT5C 2EVRA 5E26A 2I8DA 2BE7D 4EVIA 2K9MA 2JN0A 1ZLJA 4LB6B 1U8BA 3OMCA 2MWPA 2ZNYA 5J26A 1G3SA 2A0FB 1KIKA 2ISZA 5DCFA 2K27A 1MMGA 1RDAA 1LAWA 5KN9A 3TAPA 4FO0A 3M57A 4CZEA 2ZE2A 2WC2A 2QWOA 1ZUYA 4K11A 5FPMA 3Q0VA 3OV8A 5BMZA 4DUYK 2XF6A 2EJ9A 1SL1A 1X1AA 1MDMB 2AHJB 2Z33A 5F0HA 4YNQA 2ATQA 3O6WA 3R6NA 1YAGA 1KC8C 3X24B 2HDWA 2BIVA 2B5JA 3EYYA 3MEDA 1G4DA 3EGXA 3SEZA 1NYFA 3QEWA 3N97A 4F04B 4D1QA 2KISA 1RDCA 3LDSA 3H3NO 4CERA 3I4NJ 3JCMc 4HUFA 3VYTB 5D4RA 3HJFA 2EAYA 3GLLA 4LXCA 3JAMZ 2EHGA 4JKDA 4DLEA 4XTZA 5LEJA 1J6ZA 3CERA 1G2BA 1X2NA 1XS9A 3FK7A 2O2OA 5L3DA 4HG2A 1KD1C 1HK9A 4FZZA 5H20A 1MD0A 4JKFA 4ZYGA 2DRMA 2MBFA 2NAZA 2M0MA 2D0BA 1XTDA 4JX4A 3HSEA 2NOZA 1VQ5A 4AHRA 3DWLA 2VC1A 4CZFA 4MFEA 3CD6A 3HKZA 1LFPA 3QERA 4DOVA 1B9MA 5IT9E 2FOWA 1L3LA 3EG1A 5AQPA 1C0MA 1WN7A 3M3ZA 3ULEB 1GOCA 1OYWA 2NOJB 2RAEA 1S1XA 2E1ZA 4GV9A 1WAJA 4XN3A 3PL8A 5LMNK 1FLIA 3FFIA 3M8PA 1OVYA 1WJCA 1VQPQ 3SCXA 1WJDA 2E4LA 1U06A 4IO9F 3S16J 3FJPA 4J9BA 3M1EA 4Z2YA 4ESBA 1DGKN 3LDPA 2DYBA 1M2VA 2C0TA 1HSQA 1D4XA 4YIIA 2XI9A 3GFIA 2X6YA 2W82A 2V9VA 5AONA 1O7LA 2HMAA 2PLYA 4KKOA 3H9JA 2IGKA 1RAGB 4WFNL 1RTIA 2O4IA 2Y75A 3PNVA 1R0BG 2O8DB 4CJ4A 5AQIA 2HNZA 4BQAA 4BI4A 2AA4A 3LH0A 3VV0A 1JL1A 4JD2A 3ZT3A 4DBFA 4FJLA 3KD1E 1ZGJA 1YI2I 5CQYA 4FVUA 1ZBUA 3ATUA 3DXKA 3CM5A 5E1XA 3ZN0A 1XMQK 3TP0A 3Q3SA 4LG0B 2M30A 3OGDA 4LDXA 2D2WA 2FBHA 4LITA 3EFOA 3VQQA 3V7CA 3RBBB 3M0SA 3WEEA 1YJWN 1QVFS 3B6OA 2K5FA 3GCMA 3DLHA 1RI0A 3EY1A 5M1NA 3S17J 2NS8A 1R8OB 3SFZA 1O57A 2BY1A 3DLBA 4L9VA 5GP9A 1KQ8A 1HNZK 3GFMA 2LDMA 4DIQA 1P4WA 2M87A 4BDZA 4A63B 4FM0A 1SRMA 2MI6A 2V4JC 1GXIE 2HQXA 3X2QH 4GGGA 3E01A 4M3UA 4M77A 2K4BA 4MTEA 3S32A 4M3DA 4YIRX 2L8DA 3VA3A 3G4SQ 3EHRA 4Q5SF 2G0EA 3BJOA 4J00A 3LPTA 2KQWA 3K1PA 3M53A 3RKXA 4OPKA 2LP5A 1R5ID 2OYQA 1JT6A 1N25A 3QBYA 3EGDA 1ABOA 1XSXA 3ITHA 3CPFA 3A8MB 2XK0A 2NOGA 1GBQA 2LMJA 3SQ1A 2FNAA 4ISEA 2ZSHB 4YPHA 5KQDA 3D4VA 4I09A 2HYFA 1SFOJ 2HYJA 4A3DJ 1PC0A 5F0CA 4IUVA 1VRLA 4E6KG 3WNEA 1WHLA 2CFXA 2R7OA 4JV5K 2A05A 3RRGA 3D2EA 3C7NB 1K78A 3JR9A 2SEMA 2G8WA 4B1VA 3F0ZA 3J80Z 2R7FA 1J2XA 4RAFA 1ZN2A 2JS2A 4LK0F 2OJ2A 4DHYA 3TSPA 3H9QA 2H3GX 3INZA 5GJWB 2KRMA 4KHNA 1P7IA 4DOZA 3NEUA 4LFUA 2X6OA 3AHUA 4M3BA 3OYEA 1N8RR 3J7ZI 1O3RA 4AUXA 3V1QA 2Q2EA 5JR3A 1LVAA 2F4OB 1SL2A 3TAQA 3VPZA 3NH1A 4JN4A 3GFJA 5F64A 3G10A 3I55I 3BDLA 2QA4A 4UV8A 4C30A 2VT3A 2XRNA 2XHKA 3MVPA 4FJ9A 4YFXF 2EIKH 4KHQA 1V76A 3BY7A 1FSHA 2HOSA 4L8RB 5LLQA 3TKYA 1VYTA 4OVAA 2ECBA 2M34A 1M3AA 2HXOA 1VSHA 3I4PA 3VUZA 2X74A 3T8TA 5C3EJ 4DBRA 1BA5A 3C4SA 1YTAA 4EIAA 2JQ7A 4UVBA 3G3ZA 1UG0A 1LDJA 5FU6B 1YRNA 2ZJ2A 2EFIA 3WODF 3O4QA 2EJFA 2P0QA 2A42A 3MEEA 1ZSZC 3G4ST 5C25A 1YHQI 4DSJA 1IRZA 1U47A 1DUXC 3VPRA 3VYGA 3RTVA 2UU9K 1RBTA 3A1YA 4EDUA 2ZGWA 1V4SA 3W6VA 1U04A 5I22A 2Z99A 2RNGA 5LL6Z 4HZFA 1DDNA 2XB0X 2YI1A 3FF5A 2E20A 3O3FA 4KYWA 3AG1H 2MLKA 1KJWA 2F69A 2AQFA 4DTUA 1NGGA 2EV6A 3O9SA 2EFQA 4HAMA 1WLPB 3LDQA 3ZXSA 2VBZA 1HA8A 1V55H 3PUBA 4KT6A 3L2WA 3M6GA 1WBBA 2HSEB 3C0CA 4KFCA 3BTCA 4KO0A 1QQIA 3RYPA 3R9PA 4HX8A 1Z9QA 1SAZA 4AF1A 3EYZA 5D8KB 4BRPA 4GXOA 2HNYA 1VQLQ 2ZM6K 2RF0A 2L7FP 3S2WA 1KD1R 3IH4A 2Q0RA 3ZGKA 3S8PA 4EJWA 1KQJA 3C12A 4YOQA 3AO1A 1S22A 1IN8A 5GAN6 4A62A 4CZGA 4MMKA 1Z91A 2OZUA 2RB6A 3FLGA 3E5QA 3IWFA 2V7YA 1OX8A 2GBZA 3CLQA 3BR5A 3E1SA 2HVIA 1PVSA 3CCJQ 3V9SA 3J81Z 4CVNE 1J7KA 3D2FA 4M6YA 2EGAA 3M55A 1M90C 3V4IA 3ABKH 1FYNA 1SG5A 3JCMh 2QQBA 3VS5A 1YYVA 1AZEA 3CCLN 1GLFO 1ORNA 4LDVA 1BYMA 3EG3A 1YITA 1QQOA 4M3WA 1U5TA 3NARA 4A3MJ 2VXFA 1G15A 2YCHA 2IP2A 2HNIA 1C6VX 4IUTA 3VQPA 1JCFA 2ME6A 2A6TA 3MN7A 3MAQA 4LY7A 1FKOA 2FE3A 4BS9A 2R5MA 3I71A 4EPCA 2PBIA 1NK3P 1IG7A 4IJNA 1CZBA 3WTWC 2EX3A 1Q8IA 2JWLA 4OKEA 1A5VA 4B1WB 3VOVA 3C2GA 1Z67A 3TQNA 3W6KB 3CCRN 2HQHA 3VS4A 3M07A 4I9LA 4CZLA 1QA6A 3X25B 4GW6A 3OYMA 3KKSA 1ZBXA 2D1VA 3H5NA 1EZZB 2QF7A 1ZKGA 3I55N 4AU7A 2DYIA 2LKPA 3SUOA 1B59A 2Z16A 2YX7A 3HGGA 3L2CA 3RIRA 3FKJA 4E7JA 2F9WA 3L09A 4RAZA 2DZ9A 4XTVA 1IRXA 3K4CA 2GF7A 3WTUC 1MJ9A 4OLBA 1Z05A 3CCLA 4ME7A 3SUNA 4RTWA 4RTXA 2CYYA 2DAQA 2YUPA 3LDOA 2IPQX 5FKMA 2IJLA 4JRPA 4CK2A 1NPRA 2CQ7A 4J2DA 2HQRA 3WGIA 4F93B 1JTXA 1TT0A 4V2FA 4BC4A 4M78E 3I56T 1K4TA 3THKA 5EU7A 2QSGX 3EFOB 2X78A 3FXOA 4FJ8A 5FLMJ 1M27C 1XN7A 1MIJA 4I7FA 1KU7A 3DB4A 1MGTA 4JKBA 3OYFA 3CCRA 2LJ3A 2IGMA 4MDXA 1H641 1NKBA 1KA8A 5J2PA 4AI5A 3CCEQ 4B1ZA 2Z1GA 2CGLA 1R4MB 2FF3B 2JMWA 3HZJA 5HK3A 3Q7BA 1NK2P 1HD3A 1RFQA 1D1AA 2H09A 4HTUA 4FWMA 3RMQA 3MDQA 3AVGA 1WJQA 1K1ZA 2GXAA 5IXBA 3OYBA 4EGZA 2AKKA 3LSJA 5FW9A 1OX9A 5EVZA 1WCMJ 1HNXK 5ADXA 4DQ8A 3CC2A 4BYYA 4YELA 4JI5K 4X9CA 2JM9A 3VW4A 3PM1A 3RCOA 4I02A 2JVVA 4OIQF 1O1WA 1YI2A 2E6ZA 2L01A 4I01A 4E1NA 3R61A 4XICA 2FEIA 1IJJA 1NJYA 1NKCA 4V19S 3M5AA 2PG4A 2FBXA 1ZA2B 4IG3A 5K7HA 1ZG5A 1X9MA 2RQUA 5HLGA 1KCFA 3ZEHA 4LOCA 1OCOH 2R93J 3VU3C 1SKWA 4J5YA 3VQ5A 5FU6C 3WTVC 2RN7A 3QODA 3ABLH 4IO9L 2OZMA 1UEBA 2KRHA 1U3EM 2K3PA 1XPXA 2VKNA 3J7YP 1ETYA 3K70D 2OAWA 4CK3A 4JDSA 1B6AA 3CCJA 2DY4A 4BWJA 1S7OA 4IOCF 3CTAA 2LSNA 3UT1A 1KU9A 1ZRCA 1YJWA 3PFIA 3D7EO 2JT4A 3CCSN 5BN8A 3G1OA 1PKSA 1UHWA 2Z1JA 5CYMA 2HNHA 3MFKA 5D5UB 3R3LA 2A41A 2VWKA 1QVFM 4B3XA 4AHVA 2DTOA 2E7WA 4EMHA 3UA6A 2EYXA 1MUNA 3VF6A 2XDVA 4DV4K 4IHWA 4E47A 5ICGA 4GVMA 1PHTA 4LJZF 4GYIA 3P7NA 3DM2A 4JI0K 4C3JJ 1L5UA 2CG4A 4RTZA 4DTRA 3CCMN 2K3YA 2E1HA 1N34K 1VQ5I 4L0YB 1VQNI 4EM0B 2AXTC 3JB9F 3CCJT 2WADA 4OPAA 1HKSA 1SVOA 2ED0A 1IH7A 3O8GA 3META 1J09A 4C8LA 5DD8A 1IUYA 3AVHA 3CMEA 2OQRA 4FYXB 1Q1VA 3K2AA 4A57A 5L23A 4FW1A 4B48A 3H0IA 1JL2A 1VQ8T 2FRHA 1UTIA 2PN6A 4OJRA 2O7OA 4D9JA 3NGYA 3V9ZA 4DFJA 4YOXA 1OISA 2GTOA 4Y7NJ 1JU5C 4BGDA 3JCMX 2O4GA 3BGRA 1R77A 4J9DA 3UWNA 2EZIA 1B1BA 2O8XA 1K8KA 2AKLA 2K40A 4KV8A 4RW4A 3L00A 1BJAA 2IPOB 3GTQJ 3CC4N 1UA0A 2JTMA 4G6TB 4BWMA 1ARKA 2ETHA 4HVVA 4DFPA 1X01A 4N4IA 4UUVA 5IYCJ 1ETQA 2D6FA 3M3YJ 5IH2A 3SLCA 1JB0E 2DA4A 1K7AA 2ZF5O 3V9XA 2JOYA 1G3YA 2VQEK 5KE3A 5A0LA 4Q4ZF 3NGZA 2JK3A 1QP2A 3DU6A 1KK7A 4CJQA 1QQJA 2P9IB 1VTNC 3OR1C 1SF9A 1NGIA 3PO4A 5KH6A 2Q1NA 2FO0A 3CC2T 2QSFX 1KG1A 4OX9K 4ENMA 2F9TA 2QG9B 2MG4A 4DQQA 5GAGP 2CREA 2E2QA 2P6TA 5B3SH 3I5RA 2LP0A 4DEXA 2W10A 4KB0A 5GAOr 3ENHA 1FBUA 4CBXA 2VYTA 4PJOA 3TTFA 5IP7J 3AVMA 2JZ2A 4KHSA 3M0QA 2IVOA 3LX7A 4W5RA 2AZVA 1IO6A 1MJBA 1J0RA 3S41A 1OCTC 3VENA 5FB2A 3LP1A 4ZTFA 2MW8A 5LJ3e 1VQ8I 1YIOA 4CXFA 1YVNA 2GUPA 4CCOA 4J9IA 5D6XA 2E41A 1O13A 2LJ0A 3RZDJ 1LPLA 1XGSA 3CUOA 3H36A 2A1RA 2NRTA 1X4OA 5E3LA 2I5WA 2XGDA 1N9SA 1C1AA 3T9NA 1S1TA 2XAQA 4B1YB 3GZ6A 3L4IA 2NUTB 4HRIA 3WXMB 2A68F 4HNTA 4OP0A 1HOMA 1WHJA 4RCCA 2D1HA 3SEMA 4XLAA 4CESA 3URGA 3OYCA 2R7VA 1YWOA 2G8UA 3H3OB 4EW0A 2MOXA 1QHTA 4XKCA 1UZCA 2HL3A 4P1WA 3THWB 2WAFA 1PWTA 5ELZA 3SBTA 2LRQA 4L5EA 3FISA 1ILYA 2L7MP 1VQPN 3GFLA 3ZQGA 3K1MA 3FBNB 4IFYA 1R5HA 2OI3A 1OR7C 4DF4A 2J5PA 4RWTA 1XC9A 3PO3J 1ZBHA 3JSCA 3SHWA 1PCXA 4FWSA 2KE9A 5AQWA 1TUGB 1TGOA 1XD7A 3TABA 2RQVA 4M7DF 1ZHFA 3QWLA 2E6NA 3G25A 2NVQJ 4RAGA 4CJKA 1VZ0A 1FTTA 2XIGA 2FSKA 1UJ8A 3FMSA 4JHDB 4AVZA 2HWVA 3KTUA 1TTYA 4L9TA 3M0RA 1JXSA 4OB1B 2G8HA 2HHVA 3HUGA 3IS9A 1Y0MA 5IHNA 1ZREA 3G71N 3CUQA 4YDUC 2G7HA 3E9GA 3G7ZA 1OH6A 3G1MA 1JJ8C 5L3GA 3KHYA 3TSUA 5AQQA 1ATSA 3MMVA 3X26B 3BDDA 1R71A 3O3GA 3TOAA 2EA2A 5DLQE 3M4GA 4MLHA 4ILGB 4GKKK 2IW5A 1P7JA 4CJSA 1B72A 2K9LA 4YRVA 3KCCA 2HDCA 3QZ5B 3IDHA 3S3NA 2HB5A 4BRGA 4IJAA 1ZYRF 1HF0A 4BE2A 3CWTA 2L7ZA 2IIMA 3H9NA 2D1XA 4IOCL 2X6NA 3QPTA 2WY8Q 4PUOA 2OTJQ 4XLCA 2HQ5A 4G9YA 3HT3A 1RGIA 3G2BA 4KBMB 4E7IA 3IHOA 2R5YA 4FASD 5GANh 4VUBA 1X58A 3T1HK 3EGUA 4QVDA 3PSIA 1SFEA 4EHUA 1RETA 4PJMA 2PMUA 2JTFA 1VQ7T 4M3YA 1Z21A 3SZPA 1W1FA 5CK9A 3TU4K 3FHFA 4FYDA 5LJ5j 4EMKA 1B9FA 3OH6A 3WVEB 1M1EB 5BPDA 5A2QO 1S1UA 1W97L 2GLOA 3PT9A 4PKCC 2GWKA 2LMDA 5KPRA 3M7GA 4FX4A 1OR7A 3WT0A 4MO7A 3SJJA 2W25A 1HJRA 3OBYA 1VQ9Q 1R1UA 4FOIA 1TQIA 3GF5A 4JOMA 2QVOA 1WEIA 1NYGA 3S2HJ 2BYVE 3HZ6A 4MMLA 4JJDA 5IAYA 4XTWA 4H0VB 3PO5A 5DM6F 4MFDA 3V6DA 2F7TA 3DEWA 2GTJA 3CPWS 2K4JA 5EXWA 3GBTA 2MABA 3PJRA 2L3QA 4NCAA 3SK3A 1OU8A 4MO5A 2DBKA 3VMFB 1WUAA 2Z1DA 2QQ8A 3LSPA 1SSHA 2P9UB 3CCSI 1VQNA 1M3CA 1QPMA 1XTAA 1ZQ1A 3DXMB 4Y1CA 4PQUA 1NG7A 1UMQA 2L3PA 4E70A 5EGOB 3WTXC 3N4PA 2XPUA 4M7DD 4QSHA 5FD6A 3FEOA 5C2FA 3SV4A 1Q82U 4CGDA 1VQ9I 2XKOA 4IBNA 5GMKe 3TSQA 4HUGA 1T8EA 1KO9A 2CZ0B 4FIBA 5D6EA 3DU5A 5LJ3d 5EEHA 4OFAA 4RTVA 1AD5A 1MZBA 5C12A 4FSVA 1AZGB 5ICEA 3JCMe 4MTDA 5E3OA 3JRDA 1QCOA 2BXYA 1CZAN 3PX0A 5KCHA 1U49A 2RREA 4NLCA 1SVMA 3P8HA 4ID1A 4KTZA 1AEYA 2AZSA 1WWXA 3NF6A 2XGEA 3FR0A 2A3LA 1WH5A 1WFWA 3VF4A 1VUBA 4Z4CA 3LANA 5TKWA 3VEOA 3M8RA 4EAHD 3VQCA 1Y96A 4UUSA 4Y0WA 4HQMA 1D9FA 3VS7A 4RMOA 5L3CA 1ZBSA 4DS5A 3VTHA 4B44A 1Y97A 3I33A 3LH5A 4IFVA 3PX4A 4N41A 4M74A 4LLLA 2EFPA 2HDDA 3AO4A 1T05A 4IPAA 2HZTA 4M7AE 1WZ2A 3RR7A 4O55A 3ME9A 2Q31A 3NNQA 3F3XA 2CV1A 4DTSA 1WH7A 2X6SA 5CZ2A 1QTMA 2E4HA 4RGSA 3CP8A 2XIDA 3VEYA 1OMIA 5HODA 2H27A 2ITGA 2EYQA 4MGRA 1RRJA 3HPHA 3JB9H 4BRDA 2HW3A 5HOOA 3E19A 1N9RA 4IVNA 4BGBA 1EIFA 4C0DC 4NUBA 5AIPA 5J4YA 4DR5K 2FF6A 3Q9VA 4D8KA 1YITI 3F5TA 2BE9B 4M3EA 2W41A 3FRNA 2P9IA 3L3VA 1JHFA 3LWIA 2YNGA 4LIUA 2O8CB 4JYKA 1BI0A 2RN8A 5HL7L 3Q5FA 4G6QA 1DIZA 1W6XA 2VJ5A 5FO5A 1LW0A 3BP8A 4F4KA 3CCMA 3FZKA 3IC7A 3WTTC 2WACA 2XDPA 1M3QA 2B0LA 1RT5A 2DI3A 1BIZA 1VRTA 4C3HJ 3AL0C 3O8VA 3M0PA 5AQMA 3QP5A 3CG7A 5CHIA 3C2HA 3NWSA 2QEXI 2DMQA 4AM6A 3HTSB 3E9FA 1J9AA 4O0IA 1RESA 3T1AA 2EH3A 3HFOA 3THYA 4U0YA 3E0JB 5GAOm 2VIXA 3QJ6A 4OAYA 3CCST 2ELJA 4EJTA 1TSFA 1OCPA 4IHSA 4QS7A 1H3ZA 3BY5A 1UECA 1K73U 1GLEG 2J5OA 1LFUP 1D5AA 4QOZB 4A5AA 2MAMA 3HM8A 4FT4A 2CKKA 4UV9A 2CV2A 3JSOA 1JBMA 1ASWA 1VQ5Q 6AT1B 2HMPA 4FJIA 1VFCA 3M59A 4FWOA 4E7ZA 1QWEA 3EKSA 2IS1A 3OA9A 2R5YB 2STWA 2H94A 5EC7A 2FBTA 3RMDA 2G6FX 2LVSA 4OKKA 2DXUA 2QQSA 4KH0B 1HLVA 2XHCA 4CSWA 2KTQA 4XSZF 2FQ3A 3JCMV 3PIPA 5KYYA 2P51A 2Y9YA 4DR4K 4CD3A 1Y1VJ 2NRVA 1MGQA 4B47A 3GE1A 1SUQA 1WYXA 2LNHB 3HPGA 4W5QA 3SWNA 3SXYA 2DFHA 1XGNA 3PSFA 4D5CA 4DV6K 4J8FA 1A31A 5HCKA 3IH3A 1N6AA 1JI8A 3QP6A 5CVIA 4CGGA 4Q5WA 2KFNA 3VYRB 5TJJA 1LWYA 5H1SQ 2QA4N 5C10A 3FZLA 3FHGA 1VQ4I 2PMZA 5J2QA 1J3TA 1M8MA 2X9DA 2FPEA 3OYHA 2ROLA 3UE5A 3K5NA 2CQXA 2M0YA 4M75F 3I55A 2P81A 1YHQT 2ME0A 5CLSA 3HYFA 1AWOA 1N5YA 3HP9A 2DNUA 2PX9A 4OGCA 3IP4B 5DCMA 3ZN1A 4B1RA 2TRTA 1JJ2A 1WXBA 4ZDOA 2CH4A 5AQOA 1TT5B 1M90U 4DV0K 1IG8A 1JLQA 1V4RA 2NXNB 2E88A 1IXSB 4M77F 2HHHK 2HI3A 5LHIA 4CEFA 4S0HB 3MWPA 4ZC3A 4TVRA 2YHBA 1VNDA 1MSEC 2ZPHB 2W04A 3ZQIA 1JLAA 4WQ4A 3CHWA 2MH9A 3MEAA 4GNIA 3J7ZO 3ZMSA 2D0AA 3HB9A 2P84A 4ZN3A 2ID6A 3ZMZA 1REVA 4MLEA 2AP1A 4A0ZA 2GWJA 3PIPF 4CEBA 3TAMA 4Y52J 5M5XJ 4F7UF 4EIKA 2YHAA 3CCVA 2RE2A 5B1AH 1MV3A 4YOUA 5LJ5g 3T5XA 2V8IA 3CPEA 4YFNF 3RR6A 4LF6K 5M3MJ 2KBTA 1GFCA 1AOJA 4CHOA 4XTYA 2G7UA 3JCUC 1AU7A 3HHTB 1TL1A 2OUMA 4AM7A 4B9TA 5A2QK 2Q36A 3EPZA 2XD0A 2WV1A 3MP1A 5EG2A 3EH1A 1QWFA 1U84A 2YHTA 2GNCA 3S3OA 1Y8QB 4N4GA 3CQYA 1X1PA 4M7XA 2DEUA 1RR7A 4XLHA 2O9LA 5KYWA 1ZBLA 1R23A 2H6CA 2HS5A 5LGNA 2UUZA 3JRZA 4HV5A 2BHZA 3KLGA 2DQLA 4LSLA 3H41A 4B23A 4TV7A 4OKJA 5E8GA 3GUDA 3I4MJ 4A4GA 5CVRA 3LSKA 4JD2B 3OSGA 3FFKB 1NBWA 2LBFA 2JHNA 3G71A 2P9PB 3I55T 1CF7B 4GVEA 3PFSA 1KU3A 3QG1A 4IHYA 3CCEA 2LF7A 3V7RA 1QQNA 4XH1A 2MC4A 4V2GA 3VRZA 3JB9G 1N8RU 3PY8A 1QZ5A 1WLJA 3KPHA 3KTQA 1VQ7I 4BQQA 4II3A 2XC7A 4NQWA 2ZGYA 4CEAA 1E3PA 4UVCA 5EZGA 4CZZA 3HOSA 5KYNA 3H1CA 3MEUA 3PV8A 1UA1A 3HJEA 2VE9A 3U1KA 1VQ5N 1NKUA 3KX2A 3HGYA 2VBXA 2B7EA 4BY6B 4HCKA 2ECZA 1PSFA 2X1CA 1S9HA 2R57A 3A1PA 2ITMA 4B3AA 2CWEA 2WB1N 2K9GA 1D09B 4ABZA 4DZPA 4H4MA 2BZTA 1RTDA 1LVKA 3HXMA 2WAEA 4EGYA 3PGGA 1FP1D 4GY5A 1TV6A 3CCMQ 2JT1A 1SMYF 5JS2A 3HKSA 3QINA 1KVCA 1TZLA 2KLOA 4GLKA 4Y91A 4FWNA 4DYCA 3L3UA 2JA6J 3TU5A 3SAHA 3THYB 4JZ4A 2DPPB 3LQRA 1EXQA 4E9EA 1XHZA 3K57A 1NGNA 1XMOK 4PLLA 1HJDA 2QDLA 2YNIA 1D0ZA 3OW2M 5GAGJ 2Z0WA 2ACJA 1LB2A 2D0QB 1HNWK 1HYVA 3WGGA 4CJRA 3CCEN 2LCLA 4BY6C 3JXUA 3C1DA 2VBYA 1Y39A 3VODA 5DK5A 3HBTA 1ETWA 1QHGA 1X1BA 4RW9A 3DV8A 1FTZA 2E19A 1UGRB 4X66K 2V1QA 4N4HA 2FUG2 5D7UA 2XU8A 2FPFA 2JHJA 1VSJA 1TOVA 1MMAA 2RDPA 4ZGDB 1T44A 2VQCA 2ASMA 2QAZA 2JRTA 2JGUA 3JB9D 2JS0A 2KW4A 4JKEA 4BBRJ 2QKLB 4XMYA 5CVJA 4BAYA 1FBQA 2WB1A 1TXQA 3OW2S 1IJWC 2NRAC 5E3MA 1GXQA 4KREA 4PDKA 2W6KA 3A0HC 2WOMA 4WFBL 4A3GJ 2L9VA 1TL3A 2M3AA 1RACB 2HL5C 3CMAQ 1T7PA 3KK2A 1YI2T 1ITGA 2DA7A 4F7UG 1WGSA 2ZNZA 4N4NB 5D6WA 3FSPA 2NLXA 3FIWA 1Y8RB 1J5OA 3ELKA 1EJ9A 2BTFA 3LSMA 2OZSA 1IN5A 2D1KA 3MN9A 3DMJA 3QEXA 5LJ3g 3V42A 4NYNA 2N8GA 3MX5A 4GYGA 3VEPA 1Q81O 1DU0A 4XR6A 2M16A 1EBMA 1BM9A 4OMYA 4LUEA 5M5WJ 1RT4A 4BXXJ 4RGUA 1KG4A 3SZTA 3CVTA 2GAUA 4ZJZA 3OW2A 3I59B 3MO8A 1YNZA 3TSWA 1YUWA 4P96A 2O5RA 3HRGA 4A3EJ 3CXCM 3KD5E 2IS6A 4CEQA 3FDYA 4IF4A 1WJFA 4HT8A 1TWGJ 2ZZDA 1I39A 1RAFB 2NNYA 3KEOA 2PQ8A 2YUSA 4KA4A 2XDBA 4FU6A 3JAMK 5SWMA 4PFPA 4XK4A 2NRHA 4UB8C 3JB9I 3GG4A 4OMZA 2KFDA 2V9PA 2EKHA 1HBXG 3CCLT 1N6QA 3UKGA 4FM1A 4BL0B 1VQNQ 4DV1K 5ADXH 1B4AA 2JM8A 1QS4A 1WFXA 4KMFA 3LOCA 1M4ZA 4PUSA 1BOBA 5FKKA 1Y1WJ 2DA6A 4XTUA 3CCRI 3TANA 2YWWA 3K5LA 2BXZA 2XY7A 1MSFC 2XSDC 2PU9B 4JJNK 1NGJA 4FJNA 2L4MA 2Q1ZB 4A6DA 4CCHA 4JJCA 2O61A 3QIIA 4UY8O 3CCQN 4EP4A 2D0NA 4X1EA 1X75C 3PO2J 3FXMA 3OYDA 1KG6A 1YJNI 4C8QE 2FC0A 3AY9A 1MHNA 3QIPA 3OB9A 2BW3A 2R7SA 2KGTA 3PIOA 4HXJA 3QO3A 4IIMA 1X3UA 3W3DA 2FHDA 4DQRA 3SHFA 2O01E 2E6MA 4IRGA 4Z88A 5KPTA 4A5MA 3MN2A 2OA4A 2HKNA 3S14J 5EG0B 4KT0E 3J7AF 7AT1B 1Q9XA 4HW0A 5C42A 2FX0A 2XROA 4KGZB 1S9EA 4B3OA 3DI6A 3SJHA 4A6EA 3KEQA 3A4CA 2YT6A 2UYTA 4M9SA 4B24A 3U21A 1GLNA 2KR3A 2QM3A 2F8TA 4YIFA 1W2BS 2HHQA 2KDZA 4B9SA 4PKHA 1L3VA 2F2EA 1LWWA 2GWRA 2LY1A 3SAFA 4Z94A 2QDYB 2W84A 2P9SA 2KKOA 5KI6A 4XKBA 3ZFJA 3SDGA 3QPSA 4OO1J 3PVQA 4CZMA 4YY3K 5HS9A 5EYRA 2CT4A 1QMCA 1S1WA 1BOTO 1NGAA 4M7AF 3CJ1A 1P4AA 1Y96B 3HC7A 4QPOA 5GIPA 1ZBFA 3BE3A 3I35A 3JRIA 3CP2A 3HKZN 1X19A 2NOIA 2BANA 3QBXA 4LF4K 2RQPA 2HF4A 1W7AA 1XQSC 3NRVA 1NK7A 1ZG3A 4EMKC 2CT3A 2DF6A 3LZIA 4Z8AA 2X51A 3J81E 3THXB 4B09A 2VWBA 5J47A 1J75A 2KAFA 2P7CB 3RMBA 3IV5A 4H0YB 2PTKA 3CJRB 1N27A 4M77G 3EFSA 1WSHA 4AIDA 1R59O 4RW7A 5FDLA 1W2BA 1S5JA 1WHUA 2KQ2A 1D3BA 1YXQA 4Z4EA 3GYHX 1GLLO 2DK3A 4C5EA 3TP3A 4DK9A 4K41A 4DTOA 3P1GA 1QQMA 1XC3A 1WI9A 2M02A 1I50J 2QWLA 3KLEA 1WXUA 3JYTA 3ZSQA 2NYXA 2PFBA 2CRGA 3HK2A 3DKYA 1S9GA 3J7AP 2AK5A 9ANTA 4J9CA 4XIDA 3IG1A 3V7SA 2DMNA 1CKBA 3ABTA 4P9UA 3QNNA 3VEZA 2F5CA 4BBSJ 5GAHJ 4CCMA 4JKCA 5FLVA 4M77B 4M3TA 4LSNA 1QZZA 3C95A 1BA0A 1HKGA 2P6SA 1YQRA 2O6GE 2HQEA 3HG9A 4AHSA 1I8FA 2NUPA 3F8BA 2PAVA 5FPNA 2QEXQ 3NAUA 1W0TA 3LL7A 3HI0A 1JXMA 3M1FA 2RHYA 4C5HA 4M7AC 3RTRA 2DA9A 3AV9A 2KRFA 2C0OA 1BL0A 4DF8A 2OPTA 2GQIA 4HX4A 3KZYA 1JJ2P 2LQNA 2LREA 2FBVA 1L3TA 4FCYA 3EL2A 4WYBA 2DTHA 5D8LB 3QWYA 2BH1A 1UHSA 3D45A 2MLGA 5ED4A 4U7DA 2KSSA 3GVAA 3N05A 3NPFA 2BTTA 9ATCB 3F23A 1FXXA 5KAIC 4WTOB 1BI4B 3NVMA 5JICA 3TAEA 2E5LK 1L3SA 1K8AR 2K9NA 3GPLA 3RR8A 2HU9A 2KIUA 4CUGA 2C0IA 3EFRA 2VYPA 4F7UA 1NLPC 3CBMA 4ZTJA 4ISGA 2EA4A 1ZRDA 5JHUA 3VQDA 1ITYA 4B9NA 4R8HA 2NOLA 3GTGJ 3GBQA 4G12A 2DEQA 4C92A 4XU2A 2OAUA 1Z6TA 2CP0A 3TEDA 1Z25A 4JRIA 3I54A 4NXNK 2OQGA 5HRRA 4PJLA 2K2VA 4DCHA 3LSHA 2COZA 3C6HA 2BY2A 5C0MA 1YW8A 4GDFA 3BUZB 2PFUA 2ZPIB 2NUZA 4A3CJ 2RQWA 4DFKA 3FKIJ 3F10A 1HU0A 4DKWA 2YU3A 5JLFA 1BK2A 2M4KA 1EF4A 4O8UA 1WZOA 3QIOA 2M5WA 2IS4A 4C8QG 2OCCH 3CO7C 4OAZA 3ER0A 1Q81R 4QS9A 4C0FA 3BLYA 4UHTA 4E4HA 1I5ZA 2XAUA 1TQMA 1YJWT 3PIOF 2PJRB 2WONA 2XRLA 5B66C 1U1SA 3ID8A 4N5SA 1JQQA 1LJOA 3B73A 4BR7A 3KBGA 2NVUB 1RLPC 2LSOA 2DILA 2R7QA 4PJNA 4X6AJ 4F16A 2F5FA 2M4GA 1RL2A 2P9NB 1I27A 2CH0A 1FMWA 2WC9A 2ZXIA 5K5RA 1WDXA 2DJQA 3COAC 1UG1A 2DD5A 1WHHA 3MZYA 1SKUB 5FJ8J 5M1PA 2VWJA 5BPMA 2NLUA 2JN6A 1MNDA 2F5VA 4FETA 2L2OA 4WXHA 4U67L 4M75D 1NK6A 2JRMA 2RI5A 3CIPA 4DW6A 5FLXE 2XHBA 3K4MA 2Y90A 3SDZA 3GL1A 2IVMA 1BIAA 3O4NA 4B8XA 4ISFA 4AFQC 3HYIA 1TKZA 5H2FC 1GVJA 5IP6A 1HQUA 1GHCA 2J7IA 4YPRA 1XWLA 3O6BB 1XDUA 3ZPLA 5F0FA 3RKWA 1M1FA 3U3YA 1MMNA 3M1CA 3WUHA 4A93J 3FJ5A 2Y69H 5HNFA 5FU7B 5CPRB 2YXYA 2QQRA 5LL6S 1M90O 1WAFA 1QVPA 2G3RA 2R0QC 1PKTA 2KHOA 1H8KA 2DVJA 4ZNXA 2YX4A 2IS2A 2CZ6B 3QFUA 1Y6IA 1ATRA 3A8LB 3EKUA 4CIEA 1WHMA 3H5RA 2G8FA 2KL4A 1Q7YU 3O1BA 3QJYA 1E2XA 1R9TJ 1K73R 4CBWA 3U3GA 2LH9A 1YQKA 2FVUA 4B4CA 3H6EA 3EQLF 2BKDN 4M7YA 2DYRH 2KI7A 1BL3A 3ECOA 5CJ9A 1YHQA 2ZJPL 1SS6A 4D8DA 2HHTA 2HOTA 1KSWA 2EZKA 1F1BB 4KN7X 2YRCA 4F7ZA 1B9DA 3T8RA 4FWKA 2A07F 2DPNA 4FZXC 2V51B 4K8ZA 3CCET 1MMDA 3GO5A 4A4EA 4XAXB 4PKIA 4ELZC 2CP7A 4HKEA 4GV6A 1ZHIA 2D9TA 2JW4A 1ZXOA 1NK8A 4BRFA 1LNXA 2PZ1A 4M75B 1KAZA 1X2KA 4II1A 1UJ0A 1X27A 3CCEI 4H8KA 1BR1A 2IC3A 2OX7A 1FY7A 4L9NA 4LDUA 3LFUA 2HMIA 1ZARA 4ON0A 3O1WA 3VQ6A 2KFZA 3OL3A 1NOZA 2JUFA 3PQKA 5IN1A 4FYVB 1T6SA 5CQEA 5IT9Z 1KVAA 1RT1A 1GLAG 3E6MA 4MIMA 4WQ5C 4U7BA 2DIQA 3U9DA 1K0SA 4JX6A 3QXEB 4B21A 4CI0C 3RPUD 5GAEJ 4JRQA 4M45A 5E1WA 3GZNB 1U6GA 2NYSA 5CAIA 4J9HA 3HTUA 4CJWA 2NS0A 1USTA 2KDSA 3PX6A 2JPBA 4M75G 5HROA 4XQFA 1U78A 2XY8A 5L3FA 4LLNA 1I4K1 1SRLA 2V6EA 2XGCA 4Y4RA 2OTLT 1IV0A 1VI0A 1UOCA 2G9WA 5CIUA 3A8OB 1ZYQA 4AT1B 3CXCS 5FPDA 3REBB 4BC3A 1O3QA 4I2PA 3IAM2 1N3CA 2YR2A 3BDUA 4W5NA 1LPQA 4XBFA 2FZGB 4Y3OA 3BR1A 5K1YA 2DMOA 1T2KA 5D4SA 4F9OA 3FHZA 4LE9A 3J7AY 3WVDB 3K9JA 1X6OA 5AYFA 4CHYA 3CD6T 1U5TB 5F6FA 4HF0A 4EJUA 1S8NA 3ASMA 2KIMA 3RI4A 1EETA 3KVGA 3TWHA 3FXUA 4BC5A 3QDRB 3L42A 1NH3A 4M3RA 4QW2A 1W4MA 1C0UA 2P9UA 3FZVA 5AQSA 3DLEA 2F2XA 2WFBA 4KGVB 4G94A 4IQ4A 3U6FA 3A2FA 3ASKA 1TUDA 1DEJA 3NWTA 3H3ZA 1NZ9A 2E5QA 4XIUA 3H0FA 2X9HA 3VFZA 5LEKA 1VQLT 2O8CA 4N4OB 2B63J 4OWRB 3ZX2A 1S6PA 2CH5A 2QZ8A 2LLKA 4F52A 3SNNA 2MPXC 2TCTA 4ICLA 1J53A 2QWMA 3K9TA 4J7FA 1JO8A 3UF4A 1XHXA 1EX4A 2EYYA 3H5AA 4DQSA 1BO5O 1IKYA 5LY3A 3DPTA 5AQYA 3SBGA 1U2WA 3CCJI 4M7DB 5CKDA 4HNVA 2JXBA 2V6CA 1N8RC 2DFIA 2XUBA 3C7NA 4JI8K 3AA5X 2RD1A 2HCKA 1KTQA 2PBDA 2RHZA 1RKTA 2KROA 5K7FA 2OTLI 2JA5J 3MXJA 3RSEA 2FXAA 3SDBA 2V1XA 4NL3A 2VJIA 3OYAA 4MZTA 1ZR2A 2M2EA 5IT3A 2WTEA 1RCHA 4EHTA 4Y92A 2EPFA 1T03A 2BZ8A 4YHHK 4EM1A 2M1BA 3RERA 5J3LA 3VKIA 1W2BM 2FMLA 2LT1A 4B08A 3ZQCA 1FZPB 4IOAL 2FBKA 1HX1A 3DCFA 2WAQA 4EV0A 1KD1U 1W5CC 3GTJJ 4F3TA 2L7KA 1AWWA 4ASNA 2NUTA 2DX1A 4GFBA 3VERA 4FE7A 4LD5A 4CE9A 4A4HA 2E65A 2YLCA 4L5GA 4ENJA 1LNWA 2HEQA 4FLVA 1YFHA 1I1GA 1Z77A 3P4IA 4Z6YA 4DTJA 4MEYF 2M7BA 2RNAA 4JKGA 1VQ8Q 3CDHA 5BNGA 3CETA 1YHQQ 3I58A 4ENKA 2IRFG 2HBWA 2R7DA 2FMYA 2D8JA 2QK0A 2BDPA 3ZQFA 1S5LC 2P0WA 2RK2A 2CH4W 1XGMA 4ZDPA 4YFKF 1XC5A 1SQKA 2P5LC 2QYOA 3U4LA 3CJ7A 1X4PA 2IOCA 3NGIA 5IOYA 4IEEA 3VEVA 4A2UA 3QB0A 3LWHA 3AAQA 1A5WA 1QSLA 2CW8A 1Q95G 1GDTA 5KRTA 4E19A 4FJ5A 4JYAK 3VTIA 5IHKA 3F8CA 3CCVT 1RC9A 2DOAA 2V1RA 4WE1A 2JA8J 1BA1A 4C8OA 3X28B 2ZPFB 3CWAA 1D1BA 5CR2A 1S7AA 1W4SA 3NMUA 3K2PA 1HUXA 2HAXA 2FRWA 4QQDA 2UXDK 3NH2A 1WJRA 3WXKA 5BR8K 1XJWB 4HT9A 4C2MJ 3WXIA 1WSUA 3FDRA 3VS2A 3DRSA 4PFZA 4LGWA 2H8HA 2ATCB 2EQMA 1KONA 1ERDA 3CMEN 1VHXA 4B6MA 1VQ9A 3UNGC 1R0AA 3P9IA 3WHCA 1JTYA 2GXGA 8AT1B 3K2ZA 1GFDA 1QSYA 4S04A 5J8FA 4H0PA 4QVCA 1KQ9A 4IEJA 1N5ZA 4BB7A 1YTYA 2R92J 2E1NA 3SD4A 3G1JA 5BRDA 2MH2A 1RBVA 1YW9A 3KYLA 1SPKA 1WGXA 4DSFA 3THXA 1STZA 1I6XA 1T0FC 4UXNA 3KNTA 4KFBA 2CW7A 1R00A 1FMVA 2DD4A 1ZTRA 4IHXA 2COMA 1WNSA 3TVTA 3WE3A 3C94A 2YUOA 5TGTA 3H8ZA 2GCXA 1UHFA 3GIBA 3HOUJ 1PUFB 4IG0A 5HK0A 4RDUA 1IKWA 4C8QA 3ZSOA 3TW7A 3A0BC 2CP6A 2QM1A 2HXIA 3MN6A 4R0KA 1Z3YA 1WHKA 1BKBA 1K9MU 1ZSZA 3FZMA 2E2OA 2BOLA 2ZAEA 3RNJA 3CCUN 4YEJA 3JCMf 2O8EA 3TMOA 3CWSA 1MJAA 3KP6A 2VI6A 2E60A 1QP3A 2EV0A 4H5VA 5IXFA 1W7PD 3WHBA 1NBEB 3CD6Q 2NOFA 2FU4A 5FROA 5F0XA 1BC7C 1ACMB 3WG7H 4LFBK 4A59A 1B8IA 1PD1A 3FXLA 4H4OA 3RMCA 5DM7L 1Y07A 3NCIA 1VQPI 1C6VA 4FYYB 3VWBA 4I7HA 1ULYA 1QLYA 2EKOA 4XU1A 3HTVA 1VQ7A 5AQVA 4BJTA 3GTKJ 2LQ8A 2E5NA 2LR8A 1H92A 2OA8A 2DLLA 4DWIA 4RW8A 3GTOJ 1PP8F 1KFDA 4LFAK 3D1NI 3S6IA 2OBPA 1LDDA 1WHGA 1LOTB 3H1QA 2VXDA 3HHHA 2L2PA 4GCVA 1E3OC 3AG2H 4JK1X 3PIPL 4D5FA 3DLGA 4XRMA 4FSXA 2K9SA 2H8WA 2VXZA 2QXLA 2A7YA 1EH7A 3BDPA 3VJPA 1RDBA 1FWZA 5KRSA 3KK7A 4RB2C 2ELKA 1WJEA 2F5KA 4BRQA 1WI7A 4FJKA 1RKWA 1YIJQ 2BE5F 1ON2A 3DTIA 2VLAA 3LGFA 2F2WA 2K7AA 2IXSA 3H46O 3NTIA 4NNJA 3KUFA 5M1OA 3KXTA 1LCUA 4GO1A 1YQLA 3EG9A 1BU6O 2VE8A 5AQTA 1H1VA 1APLC 1M1KR 1WNLA 3CF5F 1MU2A 2I5JA 5GPCA 4HCBA 4HDVA 2YDLA 3D5LA 1T08B 2JTEA 3M4YA 5GMKl 4ELYC 4CJFA 1VQ7N 4P5NA 2W24A 2ECCA 3OBWA 1A5XA 2CUBA 4O44A 4BQLA 3W2VA 4QT7A 4G1QA 1VQ6Q 5LJWA 3OTOK 2EQRA 1SD4A 4IRIA 4F2SA 3V8JA 3CW7A 1AVZC 4E3SA 1QBJA 1RRSA 1XSVA 3VESA 2OPPA 4QTRA 4B8CA 3THWA 2Y30A 4LLGF 4AVPA 5A2QE 3F0CA 3J81O 4C8QF 1ZC6A 5GMKh 3L2RA 1LEBA 3CCUQ 1LW2A 5CCAA 1D8KA 2KMUA 1LJ9A 3MKWB 4RTTA 4IO8A 1V54H 3CCQT 3HL2A 5J6XA 3OS5A 2YUNA 2CSOA 2QA4T 3CCQA 2QYZA 1BC8C 3I56Q 1NG6A 3LAPA 3BTLA 4BROA 3CPWA 2LD5A 1SVLA 1K61A 2FA5A 4NB4A 4JS4A 2GIZA 4JI6K 1ZG1A 1DU6A 1ETKA 1NJWA 4EMGA 4OMQA 1UB9A 4CJ5A 1OCRH 3ZQHA 4JI4K 2RC4A 2RHUA 5KPZA 1VQ6I 2YHXA 2EGCA 2VG5A 3H92A 3JCMW 3WXJA 3S15J 3CEYA 1RDWX 4A4KA 2UZKA 2OAZA 1NGFA 4FJJA 3KK1A 3H0DA 3L2ZA 4LDYA 1KC8R 2DFEA 2HHUA 1LEAA 2DW4A 2O8BA 4XOPA 4ESJA 5CO7A 4UUSB 1M9SA 2QTXA 2AIRB 4J8OA 2HQNA 2VG6A 5GAN8 3LA3A 2FG0A 1T6DA 3SFMA 3JW4A 2RGVA 3W2WA 3GOXA 5F27A 1IV8A 2WA0A 4QCLA 3CMEQ 4AIKA 3GTPJ 2DERA 5HDKA 2EQIA 4ITVA 5IHIA 2MYSA 2AXLA 5ILUA 2A5WA 1OKRA 1JLGA 3V9WA 4DSEA 4XLEA 2CH6A 1SKRA 1BU1A 1K9MC 2JWKA 2RNJA 1KQSS 2RVCA 3ZEUB 3JCMd 2R3SA 1G83A 4H0XB 2Y9ZA 3K58A 2VVKA 1X9SA 3CD6N 5CE3A 4BY1J 3DBLB 1TC3C 1BBYA 4KI4A 5AQNA 1U45A 2ZJPF 1HYZA 3TSZA 3QHSA 5SZTA 5AZIA 1B7TA 4ESFA 3HBLA 4XU3A 4DBQA 1ZLKA 2BEOA 1RAHB 5KQ8A 2P5GA 4BH9A 5M5YJ 2LX7A 5AQHA 3J7YJ 2R7XA 2IVWA 2G8KA 5LJ3f 3AGRA 5CKBA 1YJWQ 2FOKA 2LKSA 1RUOA 3R4KA 3EG2A 4CGIA 1A6IA 2DT5A 2Y31A 2GBQA 2XAFA 3I53A 3O9RA 3TAGA 1P9QC 3L1AA 3IQLA 1B34B 3TPQA 2CUFA 5CQXA 1I6HJ 1XMAA 4PY5A 1S1NA 1YG2A 5TISC 2O8FB 2F8SA 5GAHP 3CMAN 3HSTB 3K9KA 1I81A 5EX5A 4PWDA 4QIWN 2O3FA 2DIGA 2Q2RA 4L6V5 1VSMA 1JLCA 4C92B 1TG0A 5LMUK 2ZQBA 2CP3A 1HW1A 4KGXB 5IWAK 1JKOC 1BCOA 1U5TC 4E0DA 1ASUA 4QQ6A 3O08A 1WB9A 3ZQ7A 3I3LA 3AA4A 3D5SC 2Y0SN 4M7AD 5GPAA 2D4WA 2I7PA 4DG1A 3K10A 1YFNA 2LQWA 4FM2A 1YJWI 4FJMA 1ZRFA 2LDUA 3AVIA 2IAJA 3CC7A 1UDLA 1NGEA 2NRXA 4EA5A 1MKMA 1QZYA 2OPSA 3C6UA 2RO0A 4XKWA 3JCMJ 3F6VA 5LJ5d 1HSJA 1JKHA 2OPRA 1SHGA 4KTQA 4M77D 3OMGA 3V81A 1M8VA 1TYQB 1BI3A 3LWFA 1C1BA 4H0EA 5ICFA 3Q1JA 3ALYA 1OYIA 1SANA 1NHAA 2PQWA 4RCHA 2DMPA 2B86A 2W6LA 3P9KA 3HOZJ 5GMKj 2E2JJ 1DTQA 1G2HA 1X43A 3CC2I 4HSRA 4UOBA 3U9GA 1OPCA 4RM2A 1TNTA 3QEPA 2RQRA 5CKFA 3BJAA 1BIUA 1K8KB 3MAJA 2F5DA 5H6QA 3DBHB 3N0UA 1NMDA 2OF7A 2BV6A 1KQSM 4PZJA 2V79A 3CXCP 1Y57A 2DJIA 2HKQB 4LD6A 3NGPA 1C0TA 3RRHA 2DFFA 2STTA 2F5TX 1JUSA 1Q82R 3TO7A 1EWQA 3GLXA 5DCMB 3O9UA 4ANJA 5IPAA 3OW2P 1GRIA 3MX2A 2DCEA 3RSEB 4E89A 2ZJRF 2V7ZA 3CC7N 5GAOq 3AKZA 3JCMg 4W5TA 4CECA 2R7TA 1Q7YC 1VQLI 4M7AG 2XPVA 4BI3A 2DYSH 1TW2A 2ZJQL 2DK8A 3AG3H 5BRFA 2B4JA 2DMUA 1BR2A 4UY8I 5EG0A 1ZR4A 3EHQA 2MWOA 4B3RK 4C1NK 2WWYA 1GCPA 3A8YA 4J6XA 4PA1A 1KQ0A 4PIIA 3T19A 1WQ7A 1IF1A 4CGZA 3EEQA 5LHHA 4L9JA 1VQ4T 2HTJA 1SAUA 3RKYA 4M41A 3BFMA 3FWEA 5I3UA 3CQXA 3U9ZA 2HD0A 2F5EA 2DTIA 2HF3A 3SPZA 1K73O 2HDAA 1QVTA 4RB1A 2EBIA 1G59A 2Y1IA 4OIRF 4BRCA 4C1NI 4DV7K 1VOMA 5DLOA 3IAYA 2ZPEB 1GCQC 5AZJA 2HGCA 2XY6A 2EQJA 4JI7K 4JP0A 2J05A 1U9OA 4HV6A 3F72A 3KFVA 3C0BA 2ABLA 2VUBA 2LNVA 1RRQA 1HKCA 3CO6C 4X1VA 4M77C 2PMZN 5EZHA 1M3BA 3JRGA 2MMPA 2PY5A 2K9QA 4BXUA 2BUPA 3MMYB 2EWNA 2EINH 1ETOA 2OTLA 5JVGF 4F8RA 1OV3A 1XQPA 4DU3A 2R58A 4JJBA 4PK4A 1VQ9T 2YS9A 1SD5A 1HDDC 3JRHA 4X65K 5F2RA 4IL6C 2E5ZA 2XVCA 5M1FA 2RQTA 2P5KA 1E6GA 4MHGA 3CC4A 1XDSA 3U23A 1GLDG 3VYUB 3EZ5A 2KZVA 4CI6A 4XRSG 1T3SA 4O3MA 4BG9A 1V5EA 3ZRGA 1C1CA 3PMIA 3CC4I 4PGGA 3B8AX 2A5XA 3OJUA 5GMKi 4MQ3A 4KIGA 5C24A 1SV5A 4BY9C 1E4GT 1BW6A 1XSDA 1M2VB 2EK5A 4L3QA 4CC4B 2VKEA 3ID6A 2LT4A 2OV7A 3CC4T 4A2BA 3OH9A 2CZ7B 2NOHA 2YJEA 1YJNA 3OYJA 5AFUH 4RLQA 2KRSA 4AQYK 2WTUA 1LWCA 3JB9J 3DPUA 4BHBA 4BD3A 1PP7U 1B3QA 2LG4A 4FTHA 2DN0A 3SUQA 4CJ3A 3OIPA 4ELTA 3JRCA 4CJLA 4PGHA 4C92E 3J80K 3KLOA 1I1JA 4OB2B 4CJVA 1VQ4Q 5KCMA 1KG7A 3ONQA 1MWMA 1N3AA 3EYIA 4WXCA 3CFPA 3LQQA 4F7UE 3QEVA 3SZ2A 3LALA 2W4SA 2DL5A 4RTYA 1FSEA 2M1HA 3P8BB 2B6AA 2CFOA 1KFZA 4YORA 4KH1B 5JHFA 3G73A 5GANj 2P9LB 2QCOA 2AO9A 1JCEA 4C8MA 4FWLA 4I0AA 4HCZA 1Q86C 4A53A 5D3GA 3TO9A 1H8AC 1FYMA 5LJ3j 3WTYC 3R0JA 5KYWB 1IREB 2D5RA 3RMSA 4LFCK 2GFAA 2RKIA 3O3HA 3OYGA 1KQ1A 2QASA 3KLIA 4E7HA 1S3JA 5J2NA 4LMYA 3ECHA 3IH2A 3GMEA 3QDFA 2E34A 4KB1A 4C0GA 5GANg 3QWXX 2LC4A 4NC7A 1AA7A 1TWBA 2VKVA 1S72N 1TYQA 4OMLA 2XKPA 2EGEA 1K0XA 2L9NA 2ZFWA 2XRIA 3KK3A 1HYSA 2RHIA 1WJBA 4DV5K 1BW5A 4CEDA 2V26A 5GAN2 1Z26A 5T7BA 1YI2Q 4PFOA 4DZJA 1XQHA 2CYZB 2DT6A 1BQMA 1SD6A 3W3CA 3VRYA 2K6DA 4KMUX 1KVBA 1JT0A 1B9NA 1RLQC 5JLWA 3K0SA 3K4LA 3RQ4A 4WF9L 3KZZA 3D5RC 1JKPC 6PAXA 3UIQA 3SJMA 5IOZA 1MDMA 1MBHA 3BTJA 2RJDA 4BREA 5IT9O 4C9YA 3EG0A 4ZGEB 4OF1A 2HSPA 3U1DA 1D8YA 3ZEUA 3C3WA 3W0LA 3SMPA 5EGOA 3ENOA 3F73A 4IXAA 2CP5A 3A8GB 2X4JA 1EV7A 1OPLA 1VQ5T 1VQPT 3L7WA 2KHMA 3BF1A 3VYSB 2CQKA 1GLCG 4A3FJ 2DTZA 4S05A 1MDUB 2VXEA 2QW9A 3BJ6A 4HVWA 5ILVA 4BACA 2PUKB 3G4SI 1H9GA 5J8CA 1JKQC 3KLNA 2ZGZA 4C2UA 2TDXA 2RJCA 1JGGA 1IZ1A 3VQ8A 2VOOA 4BQOA 5GADJ 2YHYA 1YJ9Q 2LTOA 3CPWP 1K6YA 3CMET 4BRKA 3LSTA 1VQNT 2L0AA 1DGWY 2DOFA 4J9EA 4FLUA 3NVKA 2I0NA 3QPLA 5BQTA 2IGIA 3A5NC 4EZ6A 3QFPA 1QO0D 3E5XA 1GT0C 2XAGA 3BZ6A 4GBQA 4FT8A 3CMEI 3QICA 1KYZA 2XPWA 5ILSA 3ESWB 2E8AA 5KE2A 1KLMA 3EG9B 3G1LA 1MBFA 4PL8A 1E3HA 2DPUA 3NF8A 1U6ZA 1TQPA 2CSQA 4BC2A 2V8KA 2IVPA 4FE4A 5EEGA 1TUCA 3CF5L 1BBZA 3F2KA 1K73C 3QEIA 2QEXT 3LCNA 4X9DA 3SUPA 2DL8A 2LOOA 5HBMA 2A6HF 2BW3B 4AFUC 4OPJA 3NHGA 4F91B 4BY7J 2C06A 4XH4A 4NXMK 1OCCH 3FBIB 3TDUC 3CCUT 2E2IJ 4HYEA 2EJRA 1CXQA 1LE8A 4X64K 1QNTA 4IKFA 3F8FA 3VEXA 4AFZC 2QLZA 4JX5A 2FB7A 4IEIA 2P9SB 5JMVA 2A3ZA 1BI2A 3CCJN 3WEEB 4C8QD 5C44J 1H9TA 3DOLA 3CCUI 1KFSA 1IXDA 4Y1DA 5E20A 5J1YA 1MMSA 2CS3A 1LFBA 1HKQA 3SYZA 4BG8A 3CMAT 2L5QA 2DXBA 4K25A 4RG8A 4HVJA 3NF9A 2HHWA 1ACIA 4ENNA 1VSEA 3K4JA 2VG7A 4V2SA 1P7MA 4FLWA 5LBQA 1CF7A 4BE0A 1Q7YO 2CUJA 1K9MO 4JPBW 5EJCA 3HSBA 3PE0A 3MEGA 2PUOB 2HTSA 1YQAA 2M9UA 1U9NA 4FJ7A 1TS9A 1VQKQ 2NRWA 2QGFB 3T0YA 1QHHD 3D0PA 4CGJA 5KYXA 1W70A 4BI8B 2G8VA 3UA7A 4IFEA 4DQIA 1QVFA 1ESVA 3UB5A 2O0YA 5DUKA 3AA2A 1QVGS 1SSFA 3Q0UA 1RUWA 4OIOF 4JAXA 2ZPBB 1TK5A 3G0ZA 5GAEP 2GM4A 2RV8A 1NG2A 3VDXA 1DTTA 3I0RA 4KBOA 5HNHA 3R2XC 4NC8A 1BJZA 1UWBA 2X48A 3I0SA 1KC8U 3EGDB 2SRCA 2O8BB 3BG7A 1OLTA 2JA7J 3OYKA 2QUFA 4LF9K 1SHFA 2GV9A 4XOTA 2HEOA 1YT3A 1UGVA 3T69A 3H0GJ 1FK9A 1C0GA 4M72A 1NEGA 4BU2A 1ZSGA 3S1QJ 4AH9A 2DBMA 4C23A 4CJ7A 2ESWA 1VSIA 2HPIA 5AQUA 3DEEA 5BS6A 4PJ0C 4FVMA 2LC2A 2ZB9A 2XV4S 4L5JA 2R7UA 1CZ9A 2KY9A 5GADP 5AT1B 4A3IJ 2XDDA 2V52B 4DA4A 1KG3A 2VT2A 5M3FJ 3BZCA 2DLPA 5BPLA 1Q81C 2E70A 4AHCA 2VC0A 2KVQG 1LMZA 1RDUA 1MV0B 1WQWA 4JK7A 2A1SA 3OJSA 3JAMO 1VQMT 3KWIA 3CD6I 4CF2A 1BOAA 2UWMA 3PMTA 1MBJA 5I2SA 2VKHA 3RZOJ 2EQUA 3FB9A 4DQPA 3BR0A 4M7AA 2VQLA 1D8JA 1KLNA 1BN5A 1VQKI 3SWNB 3SYTA 3U2RA 3KP4A 3OIOA 1K78B 4QVZA 1S29A 2DU9A 2CDTA 1ZX6A 1YJNT 2GIVA 2DKGA 3I56N 1IO2A 2FNPA 4HA8A 2HBLA 1MBKA 2CZ1B 4CZCA 3MK6A 3NMZC 5E3NA 3LAJA 3QO9A 2XG8D 1L0OC 2P5VA 4FX0A 5M1QA 4E1JA 1QVGM 4RKUE 4CRIA 4M3XA 2VB6A 2KRCA 1HW2A 3RMAA 4HLYA 2O8EB 3W2AA 1KQ2A 4EJZA 4KITB 1E0EA 4AI4A 2LFBA 2IVNA 2ZSIB 2AT1B 4CO8A 3V8LA 5C6SA 3EDPA 4HEA2 2E3IA 4RW6A 4HCCA 1P4XA 3MZ8A 3VS3A 2OTJA 4IOAF 2HHXA 3TGNA 4HSTA 3QSUA 3L8BA 4J6YA 1IDYA 2DBBA 3WNFA 3HVTA 4A3KJ 1MBEA 2XSJC 2HBMA 1V4TA 2KK4A 3FXJA 2D5VA 4EVVA 4FK4A 3IMXA 1HXDA 3IKVA 1PRLC 2W42A 1PYVA 3AVBA 3QNOA 2IGOA 1FIPA 1SKSA 4IOXA 3CBPA 3K5MA 1RT7A 2NWMA 4CJUA 1JJ2M 1FMKA 3O80A 4FPAA 4FQGA 3ABMH 1UUEA 1K9AA 2FZCB 4DUZK 3DTEA 2PYJA 3J81K 3PIOL 3DLRA 1CGPA 1T56A 4RB3C 4FK0A 5LJ3h 1AWJA 4Y17A 3BZKA 2OZ6A 2BGCA 2UUBK 2XY5A 3HPWA 2GA1A 1YWPA 5J39A 3ASOH 1OFCX 1QSSA 1AWCA 3LYIA 4PL7A 1T39A 5HLFA 4RLFA 3V4GA 4J6WA 4RA2A 3GOIA 4DR3K 3QOPA 1YP5A 1DT9A 3LFKA 2H8RA 2PJRA 5K5OA 2MSYA 4I98B 3T1YK 1WEGA 1YBYA 3P8DA 3LDNA 2PYLA 2QA4I 1Z3XA 3REOA 3N4QA 1XI1A 5JLHA 3DJCA 1KSPA 2JUCA 2XAHA 4Q0BA 1I07A 1ZUUA 1YJ9A 2D45A 3LA7A 2ZC2A 1DJ7B 2QWPA 2L4AA 4C92F 4O5BA 1REPC 1T38A 1WSIA 2M45A 3CLOA 1IGNA 1Y64A 1H0MA 3I59A 4R5PA 3WTZA 3J80E 4C3IJ 4CDGA 1B92A 3BG6A 4M78A 2FD5A 3EE9A 2A6EF 3K1NA 4NQWB 1FPQA 5I2MA 2Y0SA 1PU7A 3QETA 3ZMDA 2UUAK 1X69A 3JAME 2KT8A 4A5BA 5KGWA 3N4MA 3G6EA 3CC7I 1Q1HA 2W48A 1N75A 3CWUA 4CFDA 4OFEA 4AM3A 5IP9J 2Y0MA 3BG5A 1OH5A 2V75A 1ZQ3P 3P39A 2KLAA 2ETJA 3NF7A 3K7AJ 3CC2Q 4BR9A 1D1CA 3SB2A 4I6ZA 2XF7A 4GRIA 1JLEA 3WNHA 3CFOA 4KN4X 5AZIB 3ZT4A 3KP7A 4QQGA 4BKXA 3LL3A 2QTVA 4MDBA 3A03A 1QQCA 4KIBA 2VQFK 2VPLA 2YV0X 2WAQN 2IS3A 1IBLK 5J1RA 2F4VK 2V1DA 4IURA 4KIFA 3JTGA 2EFOA 2CQQA 4BQNA 4PSWA 3DYAA 3AVKA 2HVRA 4FL6A 3QLHA 3ZMUA 3ZSYA 1IXRC 3G71Q 3P5JA 1LQ1A 1N8RO 4G8XA 3M5RA 3CBOA 4XLPF 5CKTA 3I0XA 1PNJA 3OS0A 4C0ZA 2VQHA 2QSHX 1I1SA 1NLVA 3HIFA 4XSXF 1KQSP 1HQCA 2QWQA 1DPUA 2QK9A 2E12A 3I8BA 3HHGA 5FWBA 2Z5UA 3G6EI 2CO5A 1AT1B 1MUDA 4PJOC 1NK5A 5BRHA 1OYYA 4BUGA 4JI2K 1KQSA 5GMKm 3CCLQ 5EEAA 1R6RA 1LE8B 1JLFA 2V7FA 1TH7A 4G9ZA 2EILH 2GZWA 2YSRA 2DETA 1RBUA 2EYZA 3BT9A 3H9GA 2RPIA 2YKNA 1TWHJ 1GVDA 3GTMJ 1VQLA 3V1RA 2IA1A 4J2AA 2NOEA 1T0JA 1LOJA 4ZYDA 2CGKA 5GTHC 1Z7UA 4Z89A 4LN2A 3O5ZA 2K85A 3P31A 3JCMQ 1DGRM 1JE8A 3QYHB 2DA2A 1NK0A 2LKXA 2DPDA 3ZMTA 2Y4XA 1NK9A 2AQEA 1UFFA 3JV3A 4XTXA 3WQTA 2H1KA 5KCOA 3DKXA 1P59A 4QKUA 1HC8A 2X4HA 1NPPA 1FBSA 1R7JA 5FKOA 4ZHRA 5DTDA 4DOWA 5GAMg 2J6FA 4HNUA 4B3TK 1UHMA 3FM5A 4IUQA 1VYUA 2OTLQ 5EY4A 5HS7A 5CYQA 1ZGAA 4BRMA 3S1NJ 3CF2A 5GAN3 1NKEA 4M42A 4AFSC 4KH4A 1VSDA