3OYGA

Crystal structure of the prototype foamy virus (pfv) intasome in complex with magnesium and the insti compound1 (compoundg)
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
368
structure length
368
Chain Sequence
LDAELDQLLQGHYIKGYPKQYTYFLEDGKVKVSRPEGVKIIPPQSDRQKIVLQAHNLAHTGREATLLKIANLYWWPNMRKDVVKQLGRCQQCLITNASNKASGPILRPDRPQKPFDKFFIDYIGPLPPSQGYLYVLVVVDGMTGFTWLYPTKAPSTSATVKSLNVLTSIAIPKVIHSDQGAAFTSSTFAEWAKERGIHLEFSTPYHPQSSGKVERKNSDIKRLLTKLLVGRPTKWYDLLPVVQLALNNTYSPVLKYTPHQLLFGIDSNTPFANQDTLDLTREEELSLLQEIRTSLYHPSTPPASSRSWSPVVGQLVQERVARPASLRPRWHKPSTVLKVLNPRTVVILDHLGNNRTVSIDNLKPTSHQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PFV integrase
publication title Molecular mechanisms of retroviral integrase inhibition and the evolution of viral resistance.
pubmed doi rcsb
source organism Human spumaretrovirus
molecule tags Recombination,viral protein/dna
total genus 106
structure length 368
sequence length 368
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2010-09-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
A PF17921 Integrase_H2C2 Integrase zinc binding domain
A PF18103 SH3_11 Retroviral integrase C-terminal SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2300 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3oygA04
1.10.340.70 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Endonuclease III; domain 1 3oygA01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3oygA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3oygA03
1S6PA 1UA0A 1HNIA 2HMIA 4ELUA 1T05A 4HUFA 4ZTFA 4LD0A 4M3RA 4CJVA 4DQPA 3DB3A 3PNWC 1I3AA 3MECA 4KTZA 3D45A 3V1RA 1RDDA 4NS5A 1NOYA 3GOXA 1WN7A 4IUQA 3LANA 4CFDA 2A1SA 3OY9A 3PY8A 3LDSA 3P1GA 3T19A 1EETA 3AA5X 4AHUA 3OS1A 3PX4A 5T7BA 1D9DA 3SUPA 4AHSA 3OYIA 3AVLA 2IOCA 4NYNA 3RTVA 3ZT3A 3NFAA 3MP6A 4KB1A 3VA3A 3CM5A 4O55A 4W5RA 3TAGA 4B9VA 5CYQA 4CK1A 4LD6A 2RN2A 4FW2A 1J54A 1F21A 2ATQA 4DFKA 4CEDA 5CYMA 3FC3A 1XHXA 3KLHA 3HVRA 3LP2A 4Q0BA 1A5VA 2LSNA 4CF0A 1EP4A 3AVHA 3LAMA 4B8CA 4BACA 2DIGA 2RF2A 4LSNA 4Q5VA 3F70A 3SJJA 1D8YA 1RNHA 2M0OA 3U6FA 5C0MA 3I0RA 2KZZA 1RTHA 5D6YA 4FJMA 4NCBA 2HNZA 4FLZA 3DRRA 1NJXA 3KD1E 2FBYA 2F5KA 3HO1A 4CJSA 2EHGA 4N76A 4FJGA 4ID1A 2VWKA 2O4XB 1S1TA 2E6MA 4CE9A 4A4FA 2BIVA 3DLGA 1ZBIA 3AVJA 2W42A 4CECA 4N41A 4EP5A 4F4KA 2XO7A 3HM9A 3SUOA 1FXXA 4HTUA 2G8KA 3OMCA 4CJUA 1RDBA 2NUBA 4B9XA 2F8TA 1HYSA 1W9HA 4CJ4A 2E5QA 5HRSA 4JS4A 2HHXA 1X9WA 1WJSA 4F3TA 1CXQA 1BCOA 1WJQA 1BQMA 1RBUA 3M8SA 3QESA 1X9MA 4FZXC 3ALYA 2XHBA 1NK6A 1SL0A 1NOZA 2GFAA 5HRPA 4QOZB 3K5OA 3NH1A 4OLBA 4A4GA 4OGCA 3KKSA 1WNSA 1A5XA 4KHUA 4DQIA 1KFDA 2YKMA 4J2EA 3HXMA 5JS2A 1Z26A 1O1WA 4GVMA 3KLGA 3DLHA 4DU4A 4J2AA 2HQXA 1RBRA 1LW0A 3MEGA 4CF8A 1UA1A 3OYCA 2R7YA 3L3VA 3KD5E 4LY7A 4B9UA 3O4NA 4ICLA 4QW2A 3S3MA 2B4JA 5KGXA 3ISNC 4OKEA 4DWIA 4L8RB 1U47A 2G8FA 3V9ZA 2I5JA 5C6SA 3VQ6A 3ME9A 1Q8IA 2YKNA 2VG6A 3EZ5A 3C94A 4PLLA 3WNHA 4DSLA 2YHBA 1X1PA 1EKEA 2ZQBA 2KTQA 3C95A 2XDPA 1OZ3A 3LX7A 2DFFA 4DS5A 3OYNA 5D3GA 4DTRA 4NCGA 2D0AA 4E1NA 4FZZA 4I2QA 4C5EA 5D6WA 2IGIA 3NE6A 4Z4GA 2P51A 2PZSA 3VQAA 2IS3A 4CJWA 2Y1JA 3CM6A 3PO4A 2YNFA 3O4QA 4OJRA 1FKOA 4Y1DA 1NJYA 4E7LA 2QQSA 3AVCA 3H6ZA 3AO5A 1JL2A 1MU2A 4G1QA 2ITGA 2RI5A 3HVTA 4AILC 2RJCA 3OB9A 1WAFA 2RJFA 1KVCA 2FBVA 1SKSA 1NK0A 2RHZA 4C8OA 4KB0A 2JZ2A 2EQKA 1ZBUA 4FCYA 4FK2A 4IFYA 1KCFA 4CCHA 4IG0A 2FBTA 3LPTA 3V1QA 2X4XA 4DTOA 4KKOA 4FJ9A 4Z4FA 2EX3A 3JSMA 2RI2A 4H4MA 4FM1A 1TK8A 2EQUA 3EY1A 1VRUA 3S6WA 4KHSA 1EX4A 3RMAA 3OYJA 5CZ2A 4H4OA 1T7PA 4M41A 5KCHA 5IN1A 3AVAA 3S3OA 2CKKA 4B3OA 1U49A 4BWMA 3RMCA 4HCZA 4PA1A 3TANA 3OJUA 1BL3A 3JYTA 4UQGA 1ZBFA 4FXDA 4CGJA 2YNHA 3CFRA 4OLAA 2VG7A 2G8VA 4CGDA 4CK3A 3KKRA 3KTQA 3AVNA 1RT6A 2OYQA 4X34A 3NTHA 3TABA 4CEZA 1HMVA 1G15A 2PY5A 3MEDA 3VQEA 1HPZA 4F8RA 3VQ9A 1DTQA 4DTMA 4AHVA 3PO5A 4FLXA 2G3RA 2EQMA 1SKRA 5J1EA 5HP1A 4RG8A 1QTMA 2JGUA 4FJIA 1J9AA 4DMNA 5FRNA 4KTQA 1LWEA 4MFBA 3L8BA 4YFUA 2HQEA 2G8UA 2P5OA 2QQRA 1RILA 5CY4A 1ZBHA 2HHTA 4LSLA 4CF1A 3RRHA 1DLOA 4DTPA 3ZT1A 4KHYA 4CIFA 3ZSRA 3THVA 4N4GA 2M16A 2IG0A 3G0ZA 4CIGA 4AHRA 5J2PA 4FJLA 4CJKA 1TV6A 1NJZA 3VA0A 4B9SA 4N4HA 3CG7A 3MEEA 3AVFA 4CGFA 3UT1A 2PYLA 2B8AA 3FLGA 4CEFA 5KE2A 4M42A 4DTNA 4HCCA 5DK5A 3LAKA 3AA3A 1U45A 2X78A 4H8KA 3K5LA 1L3VA 4BD3A 4CJTA 4BE2A 2OPQA 1RDCA 3P83D 5J26A 2MWPA 3HSTB 5C42A 4CF2A 1IKYA 3MO8A 4DU3A 2P5GA 1XWLA 2D0CA 1TKZA 5IAYA 4B9MA 2EKOA 4N56A 2HHWA 1VSIA 1SKWA 4KFBA 1LWCA 3KK2A 4BDYA 1TVRA 3NF7A 5HLFA 3AV9A 3TAEA 4CEQA 4DF4A 3OYHA 3OA6A 3DOKA 3NHGA 4LH4A 2R5AA 1RT7A 3SCXA 1BHLA 1WSHA 3LP3A 3SQ4A 4CGGA 4BE0A 2R57A 4FM2A 4JLHA 1KVAA 1QS4A 1NKBA 4FLUA 3OYKA 3VQDA 1OZ2A 4DTUA 3QINA 4CRIA 5J2NA 4O44A 4E7HA 4W5NA 3MP1A 3ASKA 5K14A 5M9OA 2WOMA 4CHYA 1RT4A 5J2MA 3G10A 5DMRA 3S3NA 2BDPA 4FJKA 1SSFA 3LLRA 1VK0A 4IUTA 4W5OA 4FJNA 3AVMA 1JXEA 2PYJA 1BCMA 3NNQA 2M1HA 5J2QA 3QEPA 1JLBA 1R0AA 4FLYA 5I3UA 4FJ8A 4C8NA 3HPOA 4CJEA 2BGGA 2RI3A 1GOBA 1VRTA 3LP0A 1W0HA 3QLHA 4E89A 3P8HA 2YNIA 4UC4A 2FHDA 3V9XA 3O3HA 3KIOA 4NYFA 3V4IA 4CJLA 1HYVA 4GY5A 4CHZA 4Z4HA 3LALA 4O0IA 3BDLA 4IFVA 1IO2A 4DSEA 2FBXA 4N47A 3LH0A 4ELVA 1HYZA 1VSFA 1WLJA 4PWDA 1HQUA 3C6TA 1QSSA 3SNNA 3HJFA 4HHTA 3I8DA 4M3ZA 3VQCA 3DMJA 1S1WA 4K8ZA 3IAYA 4HVJA 2A1RA 4FJ5A 4KI4A 3UWNA 4HCBA 3DLMA 4IDKA 4C8MA 4CJFA 3F9KA 3MEVA 1JLEA 4RG2A 3LPUA 3VQ8A 4M3TA 1YTUA 1U48A 2X35A 1I39A 4OPKA 2OA8A 4B9NA 2LRQA 5C24A 3ASMA 4JS5A 1K6YA 4KPYA 4DSJA 2IDOA 3DLBA 2X6SA 3NCIA 4NZGA 3V1OA 4CEAA 3UIQA 3QBYA 4DSKA 3PFSA 2K3YA 3NBPA 4OVAA 3OYGA 1J5OA 4DS4A 5KCOA 4GW6A 4HUGA 3QO9A 3CFOA 3VN5A 1XC9A 2RHXA 1L3TA 3ZT0A 3META 1XI1A 1S1XA 3NGZA 1TK5A 5FROA 3TAQA 2OPSA 4DSIA 2OPPA 1LAVA 3NAEA 4FJHA 2B6AA 2E6LA 2LVMA 3SQ2A 2HHUA 3AVIA 2GFUA 2MWOA 1GOAA 3WNEA 3U3GA 3B6PA 4DQRA 3TAPA 1VSLA 3O3FA 3M8PA 4I2PA 4E7KA 2E4LA 3QKJA 4FU6A 4KHNA 2L8DA 3M9QA 3HL8A 2DIQA 4EZ9A 4I9QA 1SV5A 2Q3SA 3NF9A 3T1AA 3OYAA 2RJEA 3KK3A 3MXIA 2O4XA 1NK4A 4CHPA 4IURA 2G8IA 1IKXA 3DYAA 1XHZA 3TARA 2GV9A 4E3SA 4F3OA 3L2WA 4BDPA 1BISA 5HBMA 2D5RA 3K57A 3CEYA 4C5GA 1JLCA 1VSDA 4RW8A 4PQUA 1KTQA 3ZSVA 2JTFA 4FLWA 1JL1A 5KRTA 1KLNA 1TGOA 3V6DA 3HPHA 3MEWA 3WNGA 1RT1A 5KGWA 2DY4A 1BI4B 1TKDA 2HNYA 2Z1GA 3QNNA 4C8LA 1ZBLA 1J53A 3L2UA 3I0SA 3OYMA 4PL6A 1RBSA 1NK9A 4CESA 5KH6A 1B9DA 2D0BA 2B5JA 3LGFA 4M3WA 4N4IA 1ASVA 3ZSYA 1ZYQA 1RT3A 4M3XA 1TK0A 3KLIA 2BKDN 3DRSA 1FKPA 1UOCA 1RCHA 4F2RA 2F8SA 4DF8A 1JKHA 4CGHA 4DSFA 4OVLA 3V9UA 1HJRA 4QQ6A 3ZSWA 1U4BA 4CFCA 3FFIA 3NDKA 4B9LA 2PQWA 4IUUA 3AO3A 4II1A 1C0MA 3M8QA 4E0DA 4N5SA 4FK4A 3PMTA 1WSIA 4PLIA 2YHAA 3SPZA 4BDZA 2HB5A 2OZMA 4CEOA 1RT2A 3TI0A 1NKEA 5JS1A 1MHNA 3ZEHA 3MP8A 2HNDA 3M8RA 3DB4A 1HQEA 3AVBA 3Q1JA 1TL1A 1KLMA 3HP9A 3FDRA 2DTUA 1CXUA 3SI6A 1RTJA 1GOCA 2VG5A 2RKIA 4CJPA 3T3FA 1KFSA 1BQNA 3AO2A 1NJWA 2XY5A 3SUQA 3MXMA 4PY5A 4KI6A 3ZCMA 4EZ6A 2R5MA 1EXQA 1XNIA 2EQJA 4IKFA 4ELTA 3PX6A 4CIEA 4M45A 3VQ5A 3PUFA 4I9LA 1VSMA 4FLTA 1IKWA 3IG1A 3EAEA 1B92A 1C0TA 3E9FA 3U3YA 4FJXA 2KW4A 1QE1A 2Z1JA 4RW7A 1HNVA 2QKBA 2GF7A 4Z4CA 3LWMA 1T03A 1RBTA 3LZJA 3SYZA 3DLRA 2RJDA 3SV4A 1BGXT 1HRHA 3BDPA 1JLFA 2HHVA 3L2RA 4B9WA 1Q9XA 2IC3A 1RI0A 3PV8A 2BUDA 4DTXA 2LCCA 3PMIA 3D0PA 1SUQA 4EP4A 4QAGA 4CERA 4WE1A 4EDUA 3MEAA 1OI1A 2ZE2A 4CF9A 3QEIA 2QK9A 3K59A 4HUEA 5FDLA 2X6NA 1S1UA 2EFIA 1DTTA 3TAMA 3P5JA 1RT5A 1LV5A 4O0JA 1KVBA 2BANA 4LH5A 3ZSQA 2YRVA 1ASUA 4DQQA 4A4HA 2Z1HA 3K5NA 1WGSA 2D9TA 3RWUA 5CZ1A 4CK2A 3ZSXA 3V9SA 4F2SA 2WACA 2RPIA 3ZT4A 3PX0A 2KZMA 3VQ4A 3KUFA 1C6VA 1D5AA 3F73A 1N27A 1X9SA 3VQBA 4KAZA 5EU7A 2WONA 3OYLA 3B6OA 3C6UA 3HYFA 3DOLA 3V81A 2JLEA 4R5PA 4FL6A 5SZTA 3VQQA 1VSJA 5C25A 2DFHA 3L2VA 3QIPA 3P8DA 2IAJA 4Z0UA 1Q9YA 3O8VA 4CJQA 4AH9A 4FYDA 1C0UA 2NLUA 3SV3A 1TKTA 4CJ5A 1ASWA 2G8WA 1CZ9A 4CEBA 5I42A 1KHCA 2RO0A 4IBNA 5SWMA 4E19A 3NTIA 1CZBA 4QVZA 4FZYA 1TAQA 3KJVA 1TKXA 1YT3A 4DTSA 4CHQA 2XY8A 2BE2A 3HP6A 2F96A 4CGIA 3LGLA 3SPYA 4CFBA 3H08A 4CJRA 4L59A 4OPJA 3L2QA 1IH7A 4CFAA 4Z4EA 4DLGA 4M3UA 2Y1IA 3ITHA 3VQPA 4E7IA 4CHOA 4Y1CA 4DFPA 4FLVA 1RTDA 3NH2A 3OYDA 1Y97A 1YTAA 3TR8A 3OQ5A 3NF6A 4FVMA 2X4WA 3ZSZA 3ZT2A 4GMJB 2ETJA 3QEVA 1OYXA 1CLQA 1QSYA 4E7JA 2X4YA 3RMDA 2KFZA 2R58A 3VQ7A 2P1JA 3TAFA 5CIUA 4IG3A 3CFPA 2VWJA 3OS0A 3V9WA 2QKKA 4W5TA 4W5QA 5E41A 3QJ6A 3K58A 1S6QA 1QSLA 4BWJA 4KO0A 2ZD1A 3KK1A 3DM2A 1IG9A 4ID5A 3HK2A 3AVGA 3RMBA 1ITGA 4JRPA 3LZIA 1IKVA 5HROA 1VSKA 1JLGA 3BGRA 3RR7A 4C5IA 2GUIA 4FJ7A 3DLEA 3OYBA 3LP1A 3HT3A 4OKKA 4DQSA 1WAJA 1L5UA 1S5JA 2XY6A 4QQDA 3SQ0A 3DI6A 3A2FA 4IUPA 1LAWA 2VYTA 4NCAA 2HHSA 4KRFA 1WSEA 3AO4A 4QQGA 3ZSOA 2RHIA 3SQ1A 2QXFA 3KLEA 4DTJA 1L3SA 1BIUA 3CYMA 5KE3A 3DLKA 4O5BA 3IS9A 3OMGA 2O4GA 2YNGA 4RW4A 4KTWA 1REVA 2RHYA 4DFJA 2XK0A 2X74A 1A5WA 4CJ3A 1T8EA 3CQ8A 4E1MA 4RW9A 4Z4IA 2FC0A 4I7FA 2HHQA 3K5MA 1LWFA 1SL1A 2LDMA 5D6XA 3QNOA 2K3XA 4FW1A 3QETA 3KLFA 3QIIA 3AO1A 3OJSA 4FM0A 1JXBA 1C1CA 3E9GA 4DLEA 1U04A 5HRNA 3SZ2A 4KV8A 3SUNA 4B9TA 5FRMA 3AVKA 1S1VA 3OS2A 1SL2A 3QIOA 1NK5A 4AHCA 3MEUA 4FJJA 1KSPA 2KQ2A 4M3YA 1WJRA 3ULDA 2OZSA 3NTKA 1VSEA 3AA2A 4AHTA 4OGEA 1JLAA 4CEEA 1C1AA 4K8XA 2OPRA 3AA4A 1QHTA 3O3GA 3OVNA 2HVHA 3NGIA 2P0KA 3NGYA 2HW3A 1N6QA 1NKCA 2L89A 4ZHRA 3HPGA 5HRRA 1D9FA 1WSGA 4PUOA 1QQCA 4QCLA 2L3RA 3QEWA 2KFNA 4J2DA 3K2PA 3C4SA 2HVIA 3LYIA 4FK0A 1FK9A 2G8HA 4J2BA 4CHNA 2Z1IA 4KHWA 1WSJA 4B8AB 1LW2A 1WSFA 1JLQA 3QERA 1H3ZA 4O4GA 1VSHA 1C1BA 2E6NA 3RR8A 1TL3A 1NK7A 3EYZA 4KREA 1N5YA 2DFEA 4OKJA 4Q5WA 3L3UA 1UAXA 2YV0X 4XIUA 1S9EA 4DFMA 1UWBA 1S9GA 3WNFA 1BI4A 1YVUA 3TWHA 4YNQA 2AJQA 3RRGA 1RBVA 2XRIA 1L3UA 4RW6A 3MXJA 3NF8A 4A4EA 5J39A 4C5HA 2O4IA 3FEOA 3MAQA 4IUVA 2DAQA 4DG1A 1Z25A 1RTIA 2RHUA 2XY7A 4MQ3A 3SD4A 5KTQA 4DU1A 2LTOA 4Z02A 4JRQA 3S9HA 3OYEA 3L42A 1B9FA 1RDAA 3QEXA 1G5VA 5KI6A 4KHQA 3OYFA 4B08A 3H8ZA 3DRPA 3LWLA 1KRPA 1TAUA 4C8KA 3NH0A 1BIZA 4ZTJA 4BE1A 2GBZA 3E01A 1NK8A 4TSXA 3IRXA 5KRSA
chains in the Genus database with same CATH superfamily
2DLLA 2OPTA 1NK2P 1HNIA 1ATNA 2ZJPF 1YWOA 1T05A 2M9HA 4ZTFA 4M78A 4CJVA 2FNPA 3EKUA 1I3AA 1KO9A 4M75A 3HGGA 4Z88A 3S93A 1WSUA 3V8LA 3ABKH 3D45A 3V1RA 4EM2A 1VQ4Q 2QWWA 2M1BA 3BTJA 4ZYDA 2ELJA 3FHZA 3EUAA 4NS5A 1VQ5A 3BR5A 1V4SA 2XF5A 4HV6A 4IUQA 2A6EF 3TCJA 1W1FA 4D6WA 2B9SA 1N3CA 3IAS2 2Y48A 3LDSA 2HQ5A 3MZHA 5AQOA 4JI7K 3AA5X 2XKOC 2QBYA 3KFVA 3OS1A 1NK3P 2YJEA 5ECAA 1KEAA 3SUPA 4E7ZA 3K9JA 1O3RA 4ZDOA 3ISPA 3AVLA 1PJRA 1LOTB 3DTIA 5HVQC 4BR5A 2EYWA 5F2RA 5CKFA 3J7AF 2QSGX 1DPRA 1G59A 1TQIA 3NFAA 3MP6A 4KB1A 2ZO4A 4A3KJ 3CM5A 1FOXA 3TAGA 2EWSA 3C2GA 2KDZA 1YJNI 1J54A 1F21A 4GCVA 1L0OC 3BPXA 2EBIA 3HC7A 5CYMA 1ABQA 2I5WA 1DGKN 1QZ6A 5KQ8A 1XHXA 2XB0X 1UG1A 4U0YA 1R4NB 2R7FA 1VQ4I 5M1NA 1PU7A 2WSCE 4QS7A 1CKAA 4OMFB 1F43A 3VOEA 1BO5O 1EP4A 4CZEA 3BROA 3AVHA 4M7AG 2KT0A 2X48A 4JX5A 5F1JA 3BR6A 3LAMA 4FE4A 3I4NJ 4KMUX 4B8CA 4DK9A 4J19A 3CETA 2RF2A 4JBAA 4Y15A 1D8YA 2CP5A 1OH8A 3X20B 2M0OA 2ZGYA 1BBYA 1MJBA 4F3QA 5D6YA 3CC4Q 4FJMA 2HNZA 3DF8A 1OU9A 4C92B 2VWKA 4B1YB 2K85A 1S1TA 2XAHA 4BC4A 1KU3A 4F17A 5EEHA 3SDZA 1CKBA 1KC8O 4LFBK 3MCAB 4N41A 4F4KA 1OPLA 1SFXA 3I4PA 3CMAN 3ZETB 5CVVA 3FHFA 4L0YB 2XU8A 3F22A 1U2VA 3OMCA 4DHYA 3S2HJ 1RDBA 2GTJA 2F8TA 1W9HA 1AWWA 4B1RA 2K3BA 1RKWA 2OQGA 2PNIA 2HHXA 3HTVA 1X9WA 4S05A 4QTRA 1CXQA 1BQMA 1RBUA 4IIMA 2M45A 1SD4A 1BUPA 3QESA 1X9MA 3CCLA 2RQPA 1DQUA 2CS7A 1SL0A 1NYFA 4NQWB 1X6GA 1K8AC 4OLBA 2Y9ZA 1GV5A 4EA4A 2EKHA 2IIRA 3C0CA 2IGKA 3WGIA 4EQQA 2W85A 3CC4I 2DEQA 2YKMA 2MW8A 4J2EA 4EMKC 2ZSIB 2CFXA 3HXMA 1Z26A 4PJLA 3WQTA 1W2BM 4GVMA 3KLGA 2CP7A 3H1QA 5EC7A 4DU4A 1YIOA 4R1HA 4LB6B 2ZMEC 2RDPA 1LW0A 4CF8A 4OMMA 4UUVA 3J81O 1K73C 4YIFA 4ZH4F 3OYCA 3N97A 2W1OA 1H641 1NGHA 4AYBA 1EH7A 1YITN 4B9UA 1FSEA 4WXDA 2H56A 1TQPA 5E18F 4L8RB 3CDLA 4ENMA 3K7AJ 4E6KG 2K5FA 1POGA 3TDZC 5C6SA 4A2AA 3SEQA 4B1ZA 4J83A 5KVRA 3CC2Q 2VJ5A 2K7LA 4W1UA 2JVVA 1Q8IA 4NLCA 3E0JB 5LHHA 1N3AA 2YKNA 3F8MA 4XSZF 5TJJA 2PUKB 3G4ST 2O8KA 2P9UB 2D1XA 2P9NB 3C94A 3MMYB 1HA8A 4BI4A 1P4WA 4RLQA 2DO3A 4XH5A 2KTQA 2Z33A 1Z91A 4OMZA 5J3LA 3R6MA 3LX7A 3MKZA 5LJ5f 1ZRFA 1JT0A 4I6MB 3LNQA 4DTRA 4RAFA 4F7UA 4NCGA 4E1NA 4I2QA 4C5EA 3A1YA 5D6WA 2D8JA 2P51A 3BF3A 5AQTA 2MAMA 2F4OB 3VQAA 1N25A 3S1QJ 3CXCP 4S04A 2EIKH 3CM6A 5CQXA 1MGQA 3PO4A 2HQNA 5AQJA 2YNFA 2V1DA 3O4QA 1YW8A 5FLXO 3J7AO 4E7LA 3HOTA 3P8BB 1SKUB 4M7AF 4KRTA 1MJ9A 2EJ9A 1JL2A 2MSYA 1MU2A 1MZBA 2OTLT 4J9CA 5B1AH 1TYQB 1VAZA 3RQIA 2ITGA 1KQ9A 4LMYA 4RTVA 1NG7A 1HCRA 2W82A 9ANTA 3CC2I 3DXMA 1WHHA 4XM3A 3T1YK 1WHJA 2Q0UA 5H1SQ 2KKZA 3HKZA 2HYFA 2DA2A 3PIPA 3Q0VA 4KB0A 1VQNA 1ZBUA 4BS9A 2ED1A 5LEJA 5L23A 2FBTA 3ZQ7A 5HNFA 4BRFA 1IXDA 1HDPA 2CRGA 1WQ7A 2IA0A 2EFQA 2FPFA 2QA4N 3GTPJ 3JSMA 4FM1A 4YORA 1EV7A 1VRUA 3S6WA 1VQOQ 1KQJA 4H4OA 5AQSA 4FWLA 3JCMV 4HCZA 3TANA 3OJUA 3GOIA 4Z2YA 3CCJT 4YOYA 3PT9A 3GLLA 3CFRA 4OLAA 2YG8A 2VG7A 1I94K 4CGDA 4G7OF 1M2OA 4CK3A 3D2EB 3TQNA 2CV1A 3ZQFA 3KTQA 2RB6A 3AVNA 5DCMB 4PJOA 4BKXA 3INZA 4EMKA 2W03A 1RAAB 3NTHA 4II3A 1V3FA 1WEIA 1VQLI 2PY5A 4NC7A 2LJ0A 4ZYGA 1O9SA 1R0BG 1YRNA 4AHVA 3EEQA 3PO5A 2EZIA 4JV5K 2ZMEA 3KZBA 2P84A 4X65K 4RAGA 5M5YJ 4A6DA 5M1QA 4X6AJ 1AWXA 1WPKA 1FBSA 2CQXA 2FRHA 1XD7A 2V52B 4JUVA 3LA7A 1LE8B 2LY1A 4MGRA 3VF6A 2J4RA 2HQEA 2QQRA 2RQVA 3JCMW 4CF1A 4J7IA 2EINH 5AQQA 2DOAA 5ICGA 3ZT1A 3QPHA 2KZVA 2ESHA 2N8GA 1QZ5A 2LP5A 3VRZA 4QS9A 4H5WA 3TDUC 4KHYA 1IXCA 3VSLA 3THVA 1JT6A 2Y9YA 2UYTA 1MUNA 4C9YA 4F93B 2CW0F 3CXCA 5KYXA 3A8GB 3FLCO 1ZR4A 1NJZA 2VXDA 4N4HA 3CG7A 1B8IB 2AHJB 3EGDA 1PWTA 4CGFA 4ESRA 3CC7I 2XG8D 4M42A 2MGQA 5DK5A 3N4QA 1U45A 4UB6C 2M8GX 3OIPA 2X78A 4HLXA 3V8JA 5FU7C 2D0QB 2X51A 1RDCA 3P83D 5JVHL 1JJ2S 1OCPA 1W5TA 2V1QA 3L1PA 1ZX6A 2V79A 2H94A 4CF2A 5F0CA 3D7SB 4DU3A 2HGCA 2D0CA 3LSGA 4DIQA 1T39A 1ZQ3P 2K7AA 3E9OA 4HZFA 3CHWA 3VEVA 2KT1A 2EKOA 3ZOBA 3CP2A 5DPKA 2PTKA 2IT0A 1VSIA 3RDIA 4CCLA 3GX4X 1S7AA 3H9GA 4BDYA 3EH2A 2NUTA 1TVRA 3I59B 1EZZB 3AV9A 3TAEA 3GUDA 3WEEB 3HOXJ 2CWEA 4DF4A 4B22A 3OYHA 2DVEA 3NAUA 4I2OA 1KAYA 2ZCFB 3SCXA 1EWQA 1UHWA 5J47A 1BHLA 5A2QO 2R57A 1SFEA 2DLPA 1R00A 2O88A 1KVAA 1QS4A 1XCVA 4LF4K 4LLGF 1EJ9A 1OJLA 4HT8A 1IBLK 3KP6A 1KZHA 4HQEA 4E7HA 4IJNA 2DXIA 3A8MB 5M9OA 2WOMA 5LMUK 2XRLA 2LY2A 3KYLA 4I02A 4RS8A 3G10A 3HRUA 3S3NA 4F9OA 4AWXB 2FBHA 1SSFA 4C0FA 1VK0A 4IUTA 2QVOA 3WU0A 1JXEA 3IKVA 1EFNA 1YI2N 1BCMA 2LKSA 3NNQA 2OFIA 4XLFA 2NRXA 1VQPQ 3PIOA 3TEDA 2QLZA 3F8CA 4C92C 3EFOA 3JB9D 2L9SA 1GOBA 1VRTA 1VQ9A 1W0HA 1NGIA 3KX2A 5AQMA 2DF6A 2LDUA 3QMLA 2OANA 3D2FB 2H3GX 4LFCK 5GMKh 3THWA 1K83J 4CHZA 2GWKA 4UUSA 3LALA 4M3EA 4IFVA 3M4GA 1VQ7I 1SC7A 1IO2A 4ASNA 3QQAA 5EVZA 2K9SA 4ON0A 1H9GA 3HSEA 1JKPC 5BN8A 4PWDA 4OPHA 3CCQN 3ECHA 4BI3A 3H0DA 3SBTA 2AS5F 2MC4A 4BHBA 3HHHA 2E6ZA 1UE9A 3T0YA 3NMZC 3LWHA 4KI4A 3D0SA 3U9GA 3DLMA 1JJ8C 4IDKA 2X3WD 1BA5A 1NEBA 4OB2B 3VF4A 3PLAA 5EY4A 1VQPI 1HX1A 3CUQB 1FIPA 3F9KA 2EQIA 4RG2A 4G7ZF 1JHFA 4M3TA 2QEXQ 1Y8QB 4P1WA 1Z6TA 2FQ3A 2DA6A 2FQ4A 2ZXIA 2CZ1B 4KITB 1V4TA 1TT5B 2EVRA 4JS5A 2PFBA 1K6YA 2W48A 4O8KA 4CCKA 1WXBA 3DLBA 2NZTA 2X6SA 1W7PD 1YHQQ 2E19A 3E6MA 4CEAA 4DSKA 1YJNA 1TBXA 2V6CA 3PFSA 1T0FC 2GGRA 4JX4A 1UJYA 3OYGA 3CW7A 2ED0A 5KCOA 3HM5A 1U78A 3VTIA 1VQ4A 3CFOA 2ICWG 2GQQA 1L3TA 4QWQA 1YNZA 3TEEA 3GWZA 1ETQA 3N5BB 1R4MB 2ASMA 2V7FA 3TO6A 5AQRA 1UJ0A 4CZHA 2XPUA 1MMNA 2QA4T 1TK5A 3TAQA 3M9AA 2OPSA 1A35A 4DSIA 1Q82R 2R3SA 5IY5H 2ECZA 2NYXA 1JEGA 1KK7A 2B6AA 2LVMA 2W84A 3AVIA 1X4PA 5KN9A 1KG3A 2DNUA 5A0LA 1ZSZC 4KN7X 4DQRA 4O5VA 2RN7A 3M8PA 2VXEA 4MFDA 4I2PA 3HFOA 3CCMI 4JKGB 4DBQA 4G12A 2QTDA 3GTJJ 2M30A 3V7CA 3I56T 3VS1A 4C92A 3KETA 3NF9A 4CUGA 3IFRA 2F5EA 3E6BA 4CHPA 1QNTA 4M7DG 3WE2A 1IKXA 1D8KA 4H5RA 1C0GA 4DR3K 4F3OA 3JAMO 4JKDA 3P39A 1ZA2B 2CREA 2QTXA 3CCEN 3K57A 3NGPA 1KG2A 1GLFO 5EJCA 3PM1A 3GF5A 3ZLJA 2FBKA 1BIAA 3CC4A 5KRTA 2KXCA 3VYHB 3V6DA 1Z77A 3WNGA 5KGWA 2MMPA 5DUIA 4NC8A 3QNNA 4C8LA 2ISYA 3H46O 1ZBLA 4YOXA 1VYVA 1LFBA 4NQWA 2QK0A 3COAC 1BR1A 2JUFA 4CESA 4AFQC 5KH6A 2DA7A 2DDAA 3CF5L 2E2JJ 2B5JA 2JK3A 4M77D 1X2KA 2FMYA 4ESBA 1TK0A 2R7VA 3VEYA 4BG9A 2BKDN 1YJWT 1RCHA 2Y4XA 4IO9L 1QPMA 1QVUA 1R5GA 3G6EN 4DF8A 3K4MA 5LEKA 2ITMA 5GAOp 2MA3A 4JLGA 4PJ0C 5CKHA 5JHUA 2VCPA 5HS7A 5F64A 1F36A 1C0MA 1QLYA 3CCSN 4E0DA 5AQZA 4IQ4A 2D5VA 4OFHA 2F9WA 1T0FA 1R5ID 2YHAA 2BVLA 4JI5K 1WHUA 1WNLA 4YOTA 2XV4S 2JPCA 3QRFF 3SPZA 4BDZA 2HZYA 1JKOC 4CEOA 4BR7A 4KGZB 3ER0A 3NPFA 5BNGA 1I50J 3TI0A 3SWNC 3WXIA 3LDLA 1T95A 5LHIA 1Z9CA 2LX7A 2P9NA 3EYYA 2K6DA 3DB4A 5H6QA 4FIBA 4H5TA 4Y4RA 1NGAA 3HP9A 3FDRA 4Z89A 1RTJA 4CJPA 1VQ5N 3AO2A 1NJWA 1WJ5A 4XR6A 3MKWB 5GAGJ 4I6MA 3KZIC 4ZZDA 1EXQA 5AFUA 2VIXA 2HBLA 3CC2A 4F14A 1Y96B 2F4IA 2X3XD 1YI2T 4IKFA 2E60A 1W70A 1M1KO 3KEOA 4IHVA 4M45A 3PUFA 1ORKA 1VSMA 3WU2C 3EETA 4FLTA 3KVGA 3M0RA 3SJMA 1LOJA 5IOZA 1WHMA 3IG1A 1C0TA 4OOIA 1DJ7B 3FIFA 3BTCA 2KW4A 3ENBA 2XB5A 2XC7A 2GF7A 3EPZA 4J9FA 1MJAA 3GBQA 2PZ1A 3C3WA 1RIOH 3DLRA 2YI1A 1XQPA 2LQ8A 3R61A 4QVCA 3O1BA 4UNFA 3SZTA 1BGXT 1HRHA 2L0AA 3PGGA 3VF2A 2XAJA 3OV8A 3LCNA 2W40A 4B9WA 3HB9A 1Q9XA 3VYRB 5LJ3h 5GAN3 1NMDA 2ZPEB 4LF6K 1XB4A 3CCQT 3GNGA 4M7DF 4FWMA 3CCRN 4DTXA 3PMIA 5HK0A 3PFIA 4C1NI 4BY9C 4II2A 2QGUA 1ON2A 4QAGA 1HKTA 1VQLA 3C18A 1ZUYA 1APLC 3KP2A 1OI1A 2ZE2A 4BY1J 3ECOA 1M3QA 1KAXA 4BVOA 2OI3A 1VQ6Q 2FD5A 3BR3A 2QK9A 4C8QG 2NRHA 4HX8A 1ODDA 4JEPA 2Y0SN 4BQAA 4CW7B 2OAWA 3A1PA 5A0GA 2NOHA 4ZYEA 4RB1A 4E7SA 3D2EA 1RT5A 2DJNA 5DCMA 4XRSA 4WCIA 1WI7A 4V2FA 3RZDJ 4LH5A 4KH0B 4C0ZA 3K9KA 2V7ZA 2YRVA 2WFBA 2I2LA 2BY2A 1ASUA 2G7UA 4DQQA 1NG2A 3K70D 4FWQA 2HTJA 1TWAJ 2IW5A 2KMTA 5CZ1A 5AFUH 4CK2A 3TSQA 5IOYA 1AA7A 2K4JA 4EV0A 3CJRB 2WACA 3OMYA 3ZT4A 3PX0A 2ROTA 4LG0B 1D5AA 4C2MJ 1LE8A 3DWLA 5IPAA 1HKSA 5I22A 2ZZDA 2WONA 1YS6A 3HYFA 3DOLA 3C12A 2R0QC 3CC7A 2BY1A 2YXYA 3G1JA 4R5PA 5JMVA 4FL6A 2L02A 3G0QA 3FZFA 5SZTA 2RQTA 1IBKK 4A3BJ 1E3MA 1VSJA 2F4MB 5AQVA 2UWMA 5C12A 3QYFA 2VE9A 3UKUA 3QIPA 4K41A 1K78A 2JQ7A 4A5BA 1ETWA 1LQ1A 2ZKZA 1Q9YA 1BJAA 2ZXHA 5FFZA 2CH5A 3CUQC 1T38A 1N78A 2P7VB 1C0UA 2BZYA 1VA7A 4Z8AA 1B8IA 4A3IJ 1TKTA 3J7ZO 2XI9A 3KP5A 5K7FA 2DM1A 3F8BA 2G8WA 5M3MJ 4RB3C 1KU7A 4RTZA 4AYBN 1B34B 4IBNA 4G6TB 3O9SA 5SWMA 3FF5A 4KH4A 3JCUC 3GL1A 3ELKA 3M55A 4A2UA 4E19A 1JUPA 1XGSA 3KBGA 1CZBA 1VOMA 4AUXA 4EW0A 3E5XA 2JA8J 2YCHA 1XTAA 3T69A 4AIKA 4DTSA 4WF2A 3AY9A 1J5YA 4KYWA 1V76A 3S41A 2XY8A 3KP7A 3FXQA 1V5GA 4CGIA 5HCKA 3L7WA 5L3FA 4CFBA 5D5UB 3Q0UA 1IH7A 4M7AB 3CD6N 3M53A 1W2BS 1U3OA 2KSSA 4WCEL 5AR0A 2DI3A 4DLGA 3I59A 4K43A 1D0ZA 2XGEA 3WEEA 4M3UA 2Y1IA 4E2FB 2E34A 1K8AR 3D6RA 4AFUC 1RTDA 3OYDA 4PFOA 4FOIA 3M5RA 2DAOA 2HF3A 2JNGA 3ZFJA 3KZZA 1YTAA 1N9RA 4Y33A 4C2TA 4FVMA 3ZT2A 4R79A 2O7OA 4GNIA 1M27C 2M8EA 1BI0A 4X0GA 3E6DA 1R9TJ 5GTIC 2AQFA 1K73R 4A3DJ 3M5AA 1IHWA 3CCUN 2UV1A 3RMDA 3ZMTA 1DT9A 2V9KA 1TNTA 1GFDA 3TAFA 1Y0NA 2VWJA 4K25A 3G6ET 1VQ7A 3V9WA 3G3ZA 3QOEA 5GMKe 4W5TA 4W5QA 2MC3A 5KAIC 2VQHA 1WHLA 5E41A 2AHQA 3QJ6A 3K58A 1X2MA 3HKZN 2QUFA 1AEYA 2VQEK 1QSLA 2ZFWA 4KO0A 2ZD1A 5GAOl 5CQEA 2LX9A 5CAIA 4PKGA 1BC8C 1CF7B 4HX7A 3AVGA 1LJOA 5FWBA 3RMBA 3S16J 1ITGA 1IREB 4JRPA 1IKVA 3D2FA 1OMIA 2J06A 1VSKA 2QYOA 1E4GT 5ERIA 2XAQA 4BRLA 3QFPA 3HT3A 1DEJA 1Q82U 4DOZA 4CC4B 4QQDA 1VQPA 3VU3C 1BL0A 4HAMA 1X4OA 1OEBA 4M6XA 1GLBG 3WXJA 2UXCK 3DI6A 1Z21A 4JI8K 4BQOA 3A2FA 1WH7A 2JZYA 3EG1A 1OYWA 1T33A 1XMKA 1H9TA 3M0UA 4NCAA 4BC2A 3ZX2A 5J8CA 1QGPA 2HHSA 2P9LA 2W4SA 1VQ5T 4DYCA 3EKSA 4WF9L 5FD5A 3AO4A 2NS8A 1UG0A 3ZSOA 3ROUA 1EF4A 1N5ZA 2RHIA 3ZEUB 3VW4A 3HBLA 1ZHIA 3HJEA 3CUQA 1IV6A 1BIUA 3CYMA 4YOUA 2RE2A 3IS9A 4A0XA 2YNGA 4RW4A 2OUMA 2RHYA 5ICEA 3ASNH 2BTFA 2K4BA 5BRFA 1HSQA 1A5WA 2P9IA 1KXPA 2DL5A 3THYA 1YOVB 3O4WA 4E1MA 3CPFA 4Z4IA 4PGHA 2FC0A 3FZHA 1B72B 3EGUA 1S72T 1F5TA 5IYDJ 4L9VA 2Q31A 1FIAA 2PU9B 2LDMA 1TQMA 3G1MA 5D6XA 3QNOA 5FKNA 4FW1A 5FKLA 2AQEA 3QWYA 3OJSA 2KLAA 1S22A 3KLNA 2RQQA 1BI1A 3E9GA 5KAFC 5IT9Z 2LR8A 2VC1A 1ZAOA 2HWVA 3SYTA 1N8RO 1HSTA 1I6XA 2M7BA 1PUEE 1KD1O 5F0HA 3KXTA 3OS2A 3W0LA 5ADXA 4CXFA 5IXBA 3O5ZA 2H27A 3H92A 1KSPA 2KQ2A 2YUPA 4CZJA 4M3YA 1ZG5A 2DYBA 2XROA 1VSEA 3T8RA 3CCMA 4AHTA 1HR0K 4GKJK 4FE7A 3VDXA 4HDUA 1C1AA 4J01A 3A0IX 2ENMA 3WE3A 1S3XA 1OPKA 4N4NB 2I10A 3BZKA 2P0KA 3THXB 3VEPA 1A6QA 3NGYA 2LZ6B 1XQHA 4WFNL 1N6QA 2VI6A 5EYRA 4OAZA 1NKCA 5GAOr 2L89A 3HPGA 3LM9A 5HRRA 1QQIA 3J7AP 2L0KA 3O8HA 2L3RA 3QEWA 3H35A 2IS1A 1QCFA 4JKGA 4J2DA 1X1BA 3K2PA 3C4SA 3LYIA 1FK9A 1UHCA 2WY8Q 1Y0MA 1VNDA 1WCMJ 3GZ5A 5EX5A 2A3ZA 4EJOA 3TU5A 4BHCA 1XG7A 4CHNA 2VOPA 5F08A 4DKWA 2A5YB 2DD4A 2XSJC 1YP5A 3PVQA 4IHTA 4B8AB 3QJYA 3J81Z 1VFCA 2LC2A 1JLQA 2XIGA 1SZ2A 3CCLT 3RR8A 5IP9J 4UNOA 1G99A 3EYZA 3HXLA 4YEJA 5E8GA 2DFEA 4YHHK 1GXPA 4JK1X 4FX0A 5GAN6 2JWLA 2VB6A 1NHAA 3L3UA 1HC8A 2X1DA 4JK9A 2VQGA 1TWFJ 2HQRA 1LUJB 1K9MC 1UFFA 4F55A 3A0BC 3Q9SA 1J9IA 1SG5A 3JB9G 1RBVA 2UUZA 2XRIA 1L3UA 1X2NA 5B5EC 2VWBA 1OYYA 2DAQA 5ADXH 1Z25A 5LFAA 1WBBA 2PMZA 2QKLB 1XX5A 3VV0A 1VQ9N 2CUZA 3ESWB 2ID6A 4DU1A 1U1TA 4Z02A 4B1VA 3OYEA 1KU2A 2DRKA 4CC3A 3O9QA 2EZHA 3S1RJ 3OYFA 3DRPA 2IPOB 1TAUA 4CI6A 3HHGA 1BIZA 4ZTJA 2GBZA 3CJQB 3E01A 2AXTC 1U9NA 2Q0RA 2VKVA 4BB7A 4TSXA 3I33A 4RGUA 1S6PA 2EFWA 3FKJA 3C2HA 4JI0K 2V1UA 4HUFA 1ACMB 3U9ZA 3PUBA 4FT8A 4LD0A 4M3RA 3HSFA 2DYSH 4MNUA 5L8RE 2QI2A 4L9TA 1UECA 4IWVA 1UGPB 2AXLA 3EE9A 1WJAA 3B6AA 1RR8C 4RTWA 1WN7A 1PP7U 2ECCA 2NVUB 3ZQGA 2K3FA 3CMYA 5KHDA 5JFRA 4LB5A 2RKHA 2TRTA 1S1NA 1RLPC 1NG6A 3P1GA 1OR7C 3T19A 3JCMd 3ERED 2CP6A 2ZGZA 3TVTA 2NOLA 4FQGA 4W97A 2PVDB 4AHUA 3PX4A 1QA6A 1GLCG 3IH4A 2JRMA 5DCFA 2M4KA 3B73A 2JVGA 2D1VA 1EQYA 3OYIA 3BY6A 2IOCA 2X9DA 1GLDG 4JJCA 4A3CJ 4AVZA 2VXZA 2OCCH 1WDXA 2E70A 3BQYA 4BQNA 1Y96A 4H0XB 2JJ7A 4BGDA 2EGAA 3A4CA 4U87A 1YJNN 3GFLA 3HRSA 1Q1HA 3TTFA 5CYQA 4FW2A 2RN2A 3IWZA 1GLNA 1A31A 1M5Q1 3WTUC 1Y1VJ 4DFKA 3OA9A 4CZCA 3FC3A 1PSFA 3A01B 5GAN2 2O03A 4IL6C 1VQNT 1VQ4N 3HVRA 4DR1K 3LP2A 4Q0BA 1A5VA 1JGGA 1YX5A 2LSNA 2P0PA 1OOTA 4L9JA 1QWFA 1BI3A 4N9HA 1ZRCA 4XKWA 3JSCA 3VS0A 2DZCA 3U6FA 4K2EA 4YPHA 4HVWA 4JZ3A 2NRVA 4FLZA 3PQJA 2KISA 4MO5A 1SEMA 1HK9A 3U4LA 4M7YA 3HO1A 4CJSA 2EHGA 1YIJI 4FJGA 1P6RA 4MTDA 4EJYA 4JYKA 4H0EA 1P59A 5HDNA 2LQWA 4A4FA 2ABLA 4LGWA 2XO7A 3R0JA 4A3FJ 1FXXA 4BBRJ 2FL7A 1XGNA 1RI9A 4NL2A 2OTJI 4EGZA 4Y0WA 4EJVA 4RCHA 2G8KA 4LDUA 3DLLA 3J7YJ 2HKNA 2E5QA 3ZBDA 4B1UB 3C0BA 4XH1A 1R1TA 3X26B 1U0JA 1SMYF 3JB9F 1WJSA 4AG2C 4WFBL 2Z1DA 1U84A 3M8SA 2AT1B 2CQQA 5KYUB 4FZXC 2DMPA 2QXLA 3CQXA 1NK6A 5KNLA 1MMAA 1NOZA 2K5IA 5HRPA 4QOZB 4EW4A 1RUOA 1K8AU 4B9QA 1J09A 1K76A 4A4GA 3G2BA 1WJCA 2RGVA 2E10A 1RUWA 1YTYA 1UG2A 1P7IA 2R7TA 4DQIA 4FSXA 3LFKA 2BUPA 2L3DA 1QHHD 1SFKA 4DR5K 1X1AA 5JS2A 2GWJA 1K61A 2ZPGB 1VQ8Q 5AYFA 1PNJA 1KHIA 3JCMJ 3SBGA 2XVCA 4M77G 3O9TA 1Y1WJ 4FL9A 2O2OA 3M54A 3QFUA 3P7NA 3MEGA 5C10A 5LD2C 2ZJRF 1U2WA 1OPCA 2PN6A 2Y75A 1FYMA 3MN7A 2RNAA 1K73U 4Q4ZF 2CW7A 2R7YA 4PFPA 2E5LK 1U5TC 3O4NA 4ICLA 1UTIA 5IT9K 2EV6A 2B4JA 5KGXA 1OR7A 1YJ9I 2KFDA 2JA7J 5A2QZ 3GLXA 4OKEA 4LK1F 2EGEA 3J7ZI 2W0ZA 2QENA 5GAHJ 2G8FA 3E66A 2K9GA 2OCEA 2QDYB 1QP3A 2WA0A 3ME9A 2O9SA 4RBOA 4HKEA 4RA2A 2OA4A 2VG6A 4A0YA 3AHUA 3BT9A 3CESA 5DD4A 3S2WA 1B34A 4N0AC 2L9RA 5D5WB 4KMFA 2XD0A 2YHBA 1X1PA 4LUEA 1T56A 4FTHA 2ZQBA 5IP7J 4J7FA 1Q81C 1UB9A 4XLAA 2DFFA 2NOGA 4DS5A 2BZTA 4NLBA 2FOKA 3QU6A 1B4AA 3CJCA 3OYNA 3BTIA 1VQ8I 3L1AA 1NNEA 2HXOA 1G83A 1RR7A 3AKZA 1W36D 2D0AA 4FZZA 1BJZA 5C0YA 2LT1A 3VFZA 5IT3A 4L18B 2EA4A 5HS9A 1KFZA 3NVKA 2R5YB 2IS3A 4YPRA 1Q7YO 1KA8A 1B3QA 3U1DA 4L5IA 3KWGA 3D4VA 4Y92A 2FXUA 2F48A 2Q0OA 3PL8A 1BW5A 1GVDA 5BPMA 3J81K 5M1PA 2EAYA 2CW8A 1FY7A 3K0LA 1G4DA 4M7DB 1MPGA 1QVPA 2HEQA 2RI5A 4CZZA 4AILC 3T8TA 1X3NA 2ZM6K 4CC2A 3OB9A 1OH7A 2RJFA 2FBVA 1SKSA 2B86A 1VQ9T 1IGUA 3CJBA 3MN6A 4XLNF 2DXCA 2P4TA 4FK2A 4IFYA 4IPAA 2QQBA 2A42A 5DD8A 2L7FP 2X4XA 4D0PA 3G71Q 2GOXB 3IUCA 3BC8A 1PP8F 2RI2A 4H4MA 2STWA 2YRCA 3CF5F 1Z6RA 1EX4A 3RMAA 2DMQA 1T7PA 4M41A 5KCHA 4NUBA 2JHJA 3AVAA 3IP4B 4MQ9F 4B3OA 4BWMA 5E79C 1D3BB 3FM5A 1K6OA 2A69F 1BL3A 1CF7A 2OTLQ 3QDRB 3EQLF 1VQMQ 1XMOK 2O8EB 4IO9F 4J6XA 1AKHB 4LIUA 2NRZA 2A40A 2KPMA 1RT6A 3CCVN 2OYQA 1RAGB 4LNPA 1VQLN 4M7AE 3ZXSA 3TABA 2VC0A 2OZ6A 4B09A 2QTVA 4UVCA 1DTQA 1MMDA 4DTMA 1MD0A 2E1CA 3OIQA 2H6CA 1MMGA 1RAIB 2F2EA 2EQMA 3L09A 2XF6A 4CD1A 1CQTA 5HP1A 4RG8A 2C06A 5DTDA 3EYIA 4FJIA 4M77F 4CYDA 1QVTA 2M02A 4A5NA 3RPUD 4XU2A 2KI7A 4DMNA 3HHTB 3ZEUA 1Q86C 3G71I 1NZ9A 2G8UA 2P5OA 2ECBA 4LSLA 5GTHC 4LDXA 4XOPA 4DV4K 3RRHA 5AIQA 2K40A 4ZNXA 1UUEA 3VWBA 1YJNT 2HSTA 2PVGB 5CVJA 1DU6A 1QQMA 2LC4A 4J9BA 1JE8A 1VQMI 1BKBA 4MMKA 2M16A 4CA0A 1B72A 1VQ4T 4JKFA 4CIGA 4UY8O 2V8IA 4AHRA 1AWOA 1IG8A 1TV6A 3VA0A 5AQPA 3CXCM 1S72I 3CC7N 3CI5A 3H45C 4JJNK 3Q0WA 3ZCOA 3UT1A 3RKWA 2PYLA 3CMMA 2B8AA 1MV0B 2CU7A 5HLIA 3FLGA 1RADB 3AL0B 1X3WB 2R7RA 1LEBA 4HCCA 3RYPA 1HLVA 3CPEA 1UCRA 3K5LA 1L3VA 3L4QA 4BD3A 4CJTA 4HNTA 4BE2A 3A02A 2VQFK 1JKRC 2HSPA 5C42A 5CKBA 3TKYA 1I81A 1BW6A 1K8KB 3MAJA 5BRDA 1GVJA 3A5OC 2LBFB 1PUFB 2WSFE 1IHVA 3L0QA 5E26A 3LOCA 4B9MA 3QAHA 2DJQA 2NUPA 3GVAA 4EAHD 3OW2P 4N56A 2HHWA 1D8JA 2OBPA 3KK2A 2J6OA 2X1CA 4CEQA 4LD5A 3GP8A 1OFCX 3BW1A 1Y0UA 5FU6B 2RQRA 3DOKA 2JA5J 3EL2A 3NHGA 2CYYA 1XDSA 4LH4A 2EFPA 2R5AA 1RT7A 1A36A 2BZXA 1G3WA 5B1BH 1B9NA 1WSHA 5KCMA 4HV5A 3SQ4A 1MH4A 4MDXA 4ISEA 4B1XB 4IXAA 1GDTA 1NKBA 4FLUA 5LJ3f 1NLVA 1NH3A 4DTUA 4HA8A 4JKBA 3QINA 5J2NA 5GANd 1YQAA 3ASKA 3LWFA 2FRYA 1RT4A 2V1NA 4XU1A 3GTMJ 1S8NA 3FHGA 4MZTA 5AONA 3CC4T 2KIFA 2L4MA 2NOFA 3CMEN 3AVMA 4HWIA 4EVVA 4I01A 3A8YA 1WJDA 2P6TA 3CMAQ 4BRAA 1GCQC 2DRMA 2DTRA 4YIRX 3QEPA 2FSWA 1R0AA 2VT3A 3R4KA 4J9HA 1WBDA 5DM6L 4FJ8A 3HPOA 4MMLA 1FSHA 4CJEA 2TDXA 4R0KA 5CVRA 2BGGA 3S2DJ 4DR2K 3DKXA 1AVZC 1E4FT 4E89A 3P8HA 2FYKA 3IRQA 3H3ZA 2FHDA 3JCMh 4Y7NJ 4UOBA 1LEAA 2DJIA 4LFAK 3KIOA 3V4IA 2CUBA 2O8BB 2JSPA 4BUGA 4CJLA 5HK3A 2BE7D 1R71A 1Y7XA 2IVPA 3O1WA 1XJWB 1HYVA 4Z4HA 2R92J 1VQ7N 1QPIA 3BDLA 5KPTA 4MQVA 2J7IA 2OAUA 2KJBA 4GY2B 4DSEA 5C15A 3T1BA 1X3MA 5JI6A 4H0YB 3D5RC 4F52A 2K5CA 3R1XA 1ESVA 2IGNA 3HRGA 4BHPA 2O61A 3JAME 1U6ZA 4IF4A 4M3ZA 3H9QA 4XLEA 2LJ3A 3VQCA 3DMJA 5A2QK 5FO5A 3SFMA 2VGNA 3TW7A 3JTGA 3M4YA 1ORNA 5GANj 1NJIO 5D6EA 4OFEA 1PG5B 3JCMX 3O08A 1IDYA 3DJCA 4DV7K 3CMAI 2A3LA 2CUFA 3QWXX 2DPUA 1YITQ 1S5LC 4C8MA 4CJFA 2NOIA 3WQUA 3JW4A 3MEVA 1PU8A 3QG1A 4E1JA 1OH5A 4NXMK 4DV2K 3K2AA 2Z99A 2X35A 5FB2A 3HOVJ 5LJ5d 2GNCA 3G1OA 3KCCA 4A63B 2W6KA 3OW2A 4WWCA 3RBBB 1YX3A 2CQ7A 4JRIA 3ASMA 1DP7P 4KPYA 3QDKA 4DSJA 4C3JJ 2CSOA 3NCIA 3GXOA 2RF0A 3CC2T 3UIQA 3QBYA 1QZEA 2E1MC 3JSOA 3NBPA 2Q2RA 5AZIB 4OVAA 3DAWA 5M5WJ 4IOAL 2K27A 2VT2A 1S29A 3MZYA 4GW6A 4BY6C 2PBIA 3H0GJ 2L4AA 1UMQA 4AIAA 1PC0A 4KT6A 2P9KB 3VS7A 2HBMA 4OU0A 3META 5CQYA 2HSEB 3W3CA 1SQKA 3K69A 5CKTA 3JCMg 3CIPA 1SVMA 1J75A 5M1FA 3QPSA 5FROA 1IRGA 1YITI 1QQOA 4LK0F 1H8AC 1RC9A 1WXUA 3ENHA 5GAMd 3L4IA 1BOAA 3A01A 3QXEB 1YIJA 3K4LA 4J6WA 1QVFP 3KK7A 1C6VX 1YXQA 5FPEA 1WZ2A 1KG4A 3I0XA 1GOAA 2F5FA 4J00A 2X9HA 2G9WA 3B6PA 4WQ5A 3TAPA 1PHTA 3O3FA 3CCMN 1Z9ZA 4E7KA 2LMDA 5H2FC 2E4LA 2OTJA 5LJ5j 1M3BA 3W6VA 3H0FA 4KHNA 1IF1A 2K9LA 3MFKA 4JJDA 5CR4A 1TUUA 1RI7A 3HTSB 3T1AA 3MXIA 4O5FA 2Z2SB 4OIPF 1SANA 1V1CA 3I0TA 2QA4Q 3UATA 1K79A 1BN5A 2CGKA 2LVSA 2D45A 2GV9A 3J80Z 2GA1A 4HXJA 4BDPA 1BISA 4YDUA 2D5RA 3HOZJ 4FVUA 5CLSA 3CEYA 3M0SA 4XQ3A 1FYNA 1VSDA 4PQUA 2OFKA 3W2VA 1VYUA 4FLWA 1JL1A 3NRVA 3A8HB 1D5YA 1LVKA 2AO9A 2JT1A 3HPHA 3MEWA 2NRAC 5HNHA 3I53A 5F1RA 1ZSGA 2DTHA 1QQJA 1GRIA 5AN4A 5KYUA 2RQUA 3GF2A 2E5KA 2A28A 2E3IA 2UUBK 4B3XA 1V5EA 3I0SA 1T6DA 1LDKB 4ILGB 5GAMj 1M3HA 1RBSA 1NK9A 3VS3A 2SRCA 4HF1A 4M78C 2LYCA 4LF5K 1N6AA 4OFAA 3CC7T 2D0BA 4M3WA 4B3MK 3FZLA 5KYYB 4RKUE 1XMAA 2NAZA 3AG2H 2CT4A 4M3XA 2LY9A 2ZBKA 2WAEA 1YJ9A 4YOWA 1FKPA 1UOCA 5IXFA 3WTTC 1YQRA 2XAGA 3SZPA 2QG9B 4QS8A 1N32K 5EG2A 1TLHB 4CGHA 3V9UA 3WTSC 2L7MP 2PUOB 5E1XA 3JRBA 3EDPA 4GV6A 2LTPA 2PMZN 3QP6A 3NDKA 2MABA 3DPUA 5CJ9A 3BDUA 1OCZH 4Y52J 4FK4A 1OLTA 4PCQA 1M90O 3FX3A 3SAHA 1WIEA 1WSIA 4KIGA 4M3GA 2LRDA 2NVYJ 3SHWA 1MDUB 1KD1C 4CSWA 2WWYA 1VQ8A 3QPLA 4J8FA 2OZMA 1W5CC 4YTLA 4C0DC 4PSXA 3JR9A 3NWSA 1QVFA 2HBJA 4I0BA 5JS1A 3NWTA 3G4SN 1T6CA 1VQKI 1MHNA 2E2IJ 3MP8A 3AGRA 7AT1B 1T3SA 5LGNA 4FO0A 2KIMA 4XOTA 3C6HA 1KLMA 1LFUP 4LF9K 1WHKA 2RKIA 2KRNA 3T3FA 2XY5A 3SUQA 1WH5A 3K1MA 1E6HA 5EDNA 1Y39A 3ZCMA 4EZ6A 4ORZA 3FJPA 2E5ZA 4L5EA 2HKXA 3DU5A 3REBB 1RACB 5AQHA 1LKXA 3M0PA 1K9MR 3O6WA 1FBUA 1E3OC 4ELTA 1RKTA 4JKHA 3RSEB 2O8DB 2R5YA 3VQ5A 3G25A 4I9LA 2KIUA 1IKWA 3E1SA 1B92A 3E9FA 2KEAA 9ATCB 4A2BA 5IT9E 4C3IJ 2Z1JA 4RW7A 4ISGA 3HBTA 3FBNB 3BCBA 2DODA 2EYZA 2DPNA 3QICA 4M7DA 1O3QA 4Z4CA 3W3DA 2CUDA 1IJJA 1VQ7T 1OU8A 1O3SA 1RESA 2RJDA 5FU6C 3SV4A 1QVGP 2HVRA 4PKCC 1QW1A 1TS9A 3E97A 1JLFA 2HHVA 2BXYA 3QO3A 2IC3A 3PV8A 3IUOA 2PJPA 3MWTA 2BUDA 1I3QJ 1R23A 2LCCA 1S7EA 4M6VA 1YI2Q 3D0PA 1TT0A 2YHWA 4BC5A 1QO0D 4EP4A 2H8RA 2GBYA 3RKXA 1JHHA 2ZAEA 5H6RA 3CDIA 3CUOA 4CERA 1REPC 1K7AA 1ETXA 2EV5A 1JUMA 1VQPT 4J9IA 1D3BA 4C30A 1GBRA 3LAJA 1TNSA 4HUEA 4EJZA 1S1UA 3CCJN 3HOYJ 3I55I 3LSRA 2VUMJ 2EFIA 2Y31A 2K5LA 2QQ8A 1W0TA 1LV5A 2LH9A 1KVBA 3ABTA 4GV3A 4KH1B 3EH1A 3G71A 4MHGA 3VSKA 3ZSQA 3JB9I 2G0EA 4DUZK 3CCQQ 4WQ4C 1FPQA 3K5NA 4BQQA 2YUOA 2DW4A 4XQFA 2CH0A 5K1YA 3HRTA 3IH7A 2KKOA 1Y07A 4BC3A 4UVBA 2LCSA 2O3FA 3C7NB 1V55H 2RPIA 4CYCB 1VQMA 2KZMA 1SHFA 2E36A 3WXKA 1X75C 3MK6A 2OV7A 3UKGA 4M7DE 3HUGB 1ZARA 3EE8A 3RVCA 3HG9A 3SAGA 5EU7A 1S72A 3B6OA 3C6UA 2FZCB 3V81A 3DXKB 2CGJA 1P9QC 4JN4A 1QVGS 4IHYA 3BCAA 3L9FA 5K5QA 2HMAA 5EEGA 4XLPF 5C25A 3MKDA 4RGXA 3LDPA 3L2VA 1N77A 4D1QA 5GANh 2XRNA 1Q1VA 2O8XA 3B8AX 1WI9A 3A03A 2QM1A 3BP8A 1W7PB 4AM3A 5IHKA 4FYDA 3SV3A 1KG1A 4CJ5A 1AZGB 3CCMT 2H3JA 3CP8A 4CEBA 2HU9A 2DL3A 4MEXF 2JN0A 1CZAN 4CBXA 2OC6A 4PUSA 3VYGA 2GTOA 4ZGEB 4A62A 3NTIA 1EH6A 2DYIA 2KXDA 1Q18A 2J5OA 2CO5A 1IXSB 5KN8A 1HLUA 4AQYK 1RAEB 1QVGA 1P4XA 3DLLL 2M0CA 2LBFA 4BGAA 2BE2A 4JKEA 1PUFA 1Y71A 3HP6A 2BXZA 2F96A 3LGLA 1XOVA 4C8QD 1R0CB 4CJRA 3L2QA 1M3CA 3R9PA 2O0YA 2IVOA 1FJLA 2P7CB 4Z4EA 3ITHA 1RLQC 1KG6A 3BDDA 5E3NA 4FX4A 4O8UA 3UE5A 4HG2A 3P9CA 1IAWA 4Y1CA 4JI2K 1STZA 2CJJA 4DEYA 2L2PA 2YUNA 2E65A 3K0SA 1AOYA 1EIFA 2P5LC 3PJRA 3J80K 2JWTA 2K02A 2M51A 3HOWJ 4A59A 3F8NA 2X4WA 1KC8U 2IVNA 1H3HA 2UXXA 5E3MA 1GLJO 5HKCA 2KJCA 3HTUA 4D7MA 1Z0XA 3QEVA 1QKWA 5JVTA 1CLQA 4ETSA 2V8JA 4IHWA 1T0HA 1XC5A 3ZQCA 3MN5A 2KFZA 3T5XA 4PJOC 3GDQA 4BUPA 2R58A 3VS4A 5CIUA 3JCMe 5AJ3K 1J6ZA 2MPXC 3CCEQ 4Q48A 4IX7A 2QKKA 5TKYA 3F23A 1XQOA 3W2AA 1YCSB 1A04A 5GANg 2DQLA 2IPQX 3VS6A 1UHFA 4BWJA 2VGMA 3A5LC 2EFNA 2DBKA 1FLIA 3MD2A 1LCKA 1NGFA 4WQ4A 4JHDB 3LZIA 1DPUA 1TW3A 3RR7A 4BU2A 4IOCL 2O8BA 3PQKA 4A3EJ 1D0XA 1IG7A 3T7ZA 2HZDA 1Q81R 4OKKA 4DQSA 4PJJA 4JZ4A 1ZLMA 4ZGJB 1S5JA 3CMAA 4M77B 2QWPA 1HW1A 3DBLB 3DU6A 2AIRB 4HF0A 3BY5A 3O6BB 3LAPA 2NS7A 3SQ0A 1S9HA 3FXOA 2HZTA 2LG4A 4DV1K 1UGQB 1HPMA 3G6EQ 2HQAA 2VYTA 2LCLA 4EIAA 3CQYA 4WK8F 2K57A 2D0PA 5GAMh 3DTEA 1U5SA 2JRTA 2VLAA 2NNWA 5AQUA 3CCEI 3CCSQ 1T3LA 1L3SA 1XSVA 2FZGB 3DLKA 4D5FA 4MDWA 1M2VB 3FR0A 4L9NA 3HEFA 3AGKA 1YQMA 4ILJA 4X1EA 3I9V2 4DFJA 4KH6A 4C8QE 2VJIA 2GOMA 2MLGA 4CJ3A 1ARKA 3SHFA 4B3TK 3BY7A 5EG0B 3NARA 1WFWA 4HW0A 1T8EA 3BR1A 2HPIA 2WC9A 3B02A 3UB5A 3F72A 2UXBK 2CS3A 4N4OB 2FO0A 1UDLA 3DEWA 3K5MA 1Z3XA 4KJZA 1ZUUA 3IL2A 1P7MA 1UFMA 1C0WA 2IEKA 1YITA 1C1CA 2Z16A 5AZIA 4UHTA 2NLXA 1U04A 5HRNA 4Y17A 2KL4A 3GIBA 3TU4K 1K4US 3SUNA 4B9TA 3WGGA 2O8FB 1XMXA 4OWRB 1HUXA 5AQGA 1IB8A 3UR3C 1Q7YC 3QIOA 3SJHA 4AHCA 4F16A 2P9KA 4FJJA 3WTZA 4HDVA 3QB0A 2OZSA 3R0AA 4OGEA 1R1UA 1JLAA 2RK2A 1QHGA 3CCSI 2OPRA 1NWKA 3OVNA 4KUMA 4Q5SF 5AQXA 1HU0A 1SAUA 2CG4A 4B1WB 2HW3A 2VBWA 1IC8A 2KRMA 3FE1A 3H3NO 2CZ6B 4ZN1A 4OMLA 1IRFA 3VGLA 5M1OA 1QQCA 2R4GA 2FPEA 4HCKA 3FXRA 4CVNE 2QWQA 1PD1A 4F92B 2HVIA 3VTHA 4I76A 5GAMg 2ZGWA 2F6CA 1CSKA 2AZVA 1Q86R 3I56N 3CCRQ 1LJ9A 3CXCS 4A61A 2L9NA 1X2QA 4RTUA 4HTLA 2Z1IA 4KHWA 3CZ6A 1NPRA 1IW7F 3G73A 2IIMA 2QCOA 4IZZA 3AG1H 5CR2A 1XN7A 5CKDA 4O4GA 1I5OB 3GTQJ 1SVOA 2COZA 2MBFA 3NQOA 2E6NA 2OX7A 2V6EA 3VS5A 1M3AA 3EFRA 4NBQA 2QQAA 4Q5WA 2M3AA 4DFMA 4RGSA 2BHZA 1VQOI 2WTUA 2HL3A 4CZGA 1JCEA 2XGDA 1QWEA 3EG9B 4QKUA 4BRDA 1K9MU 1QBJA 3J7AY 5AQNA 3RKQA 1WX6A 2D1KA 2HR3A 3THKA 3IC7A 4RW6A 3NF8A 5J39A 4M9XA 4C5HA 2O4IA 3FEOA 5AQWA 3ZX0A 2M34A 4D8KA 1JCGA 2K9NA 5LJWA 2KRFA 1QU3A 1XPXA 3IQLA 1RTIA 4MQ3A 5KYYA 2E7WA 3SD4A 2GUPA 3M56A 5FLMJ 1TW2A 3CPWP 1TC3C 3RMSA 4JRQA 3GYHX 1E17A 4IVNA 3L42A 1B9FA 2GIZA 3OL4A 1YJWN 3CCRI 2XHIA 2EA2A 3UPUA 3BLYA 1SD7A 4DV5K 3S32A 4H5VA 1MBKA 1PSEA 2CGPA 2V1RA 2DMOA 1NK8A 1QHAA 2JUGA 1TUYA 5KRSA 3H9JA 1JGSA 1UA0A 1U2VB 2HMIA 1GT0C 4ELUA 2FXAA 1I5LA 2HOAA 2ELKA 2HOSA 1VQKA 4HLYA 3BG3A 4DQPA 3DB3A 3PNWC 4DR6K 1YW9A 4KTZA 1I27A 3E6CC 1SRLA 1HSJA 2CSQA 1X9JA 1RDDA 3V7RA 4I6ZA 4XTUA 1ZUKA 3JRAA 3GFJA 1PVEA 2EIJH 2Y4YA 2K3PA 2YHYA 3WXMB 3P38A 3KYDB 3I35A 3K9TA 1Y8RB 1T0JA 1D5VA 3TOAA 1EETA 3UA7A 1R58A 3VJPA 2DERA 2KMUA 4ZYHA 5T7BA 2X85A 1RDUA 2GCXA 4MEYF 1X27A 1YFHA 3JCMb 1KQ2A 1WI3A 4AHSA 2UZKA 1ZELA 2BGCA 5DS9A 3RTVA 4BR4A 3J8AA 4B3AA 3OH9A 2WADA 4ZDPA 4VUBA 3ZT3A 4B44A 4XU0A 4MZPA 3CD6Q 2FSJA 5HDKA 3AAQA 3VA3A 1J7KA 1ZQ1A 3RMQA 4B9VA 4OX9K 4XNFA 3MEXA 3RSEA 2O8DA 2ME6A 4CK1A 4LD6A 3WHCA 2BV6A 1ZBXA 3CPWS 1VI0A 1YG2A 5ILSA 2ZCWA 5BPNA 1SSHA 2YG9A 1JXMA 4WYBA 3FK6A 3MN2A 4UXNA 3ABLH 3KLHA 2BW3B 5KYWB 3ZQQA 4RM3A 2DTIA 3RPQA 3U9DA 2E2PA 4JI4K 2K9MA 3HRMA 4JI6K 1I0CA 1TXQA 4BACA 2Y90A 1R77A 1WZOA 4LSNA 5DM6F 3F70A 4EFHA 1H89C 5C0MA 3OSSC 3I0RA 4BRHA 5HOOA 2X6YA 3CCUQ 5ICFA 3GTOJ 1YIJN 4G8XA 3DRRA 1NJXA 3KD1E 1OKRA 3GBGA 2F5KA 2NVTJ 2W24A 4BJ5C 3VUZA 1WQWA 2O4XB 1VF9A 2A05A 5AIPA 3I55A 2E6MA 3CERA 3VEXA 5I21A 1SFOJ 1O57A 2P5VA 2FNAA 1UHSA 2BIVA 3DLGA 3DKYA 3AVJA 4ENKA 3CPWA 1ZBIA 2W42A 3GEZA 4EP5A 2OTJN 4BL0B 3SUOA 2YX7A 3R2XC 4GKKK 3JCMf 3CD6I 2HL5C 4HTUA 4CJUA 3B6CA 3AT1B 3TTCA 4GFBA 2NUBA 4P96A 4UB8C 2Z9OA 4LDYA 3RTRA 3E9LA 4CJ4A 5HRSA 2IXSA 2OD5A 3H3VK 1XQSC 4DUYK 2DYRH 1HXDA 1BCOA 3ZRGA 1ZG1A 2E2NA 2LSOA 1MSFC 3F0CA 3LSPA 3ALYA 4E47A 2EK5A 1WEFA 3AG4H 2E5NA 1IDZA 3RIRA 1LWVA 2JT4A 1NJIC 3K5OA 3NH1A 3PNYA 3QSUA 2KDSA 1N75A 4PGGA 5FJ8J 4ELYC 2EZKA 1WNSA 3KKSA 4U67L 1A5XA 3FXMA 1QZYA 3CCUI 4KHUA 1KFDA 3K4KA 3C7NA 2JS2A 4UVAA 4CYCA 2MD0A 3T9NA 1IO6A 4AIDA 3Q7CA 3DLHA 3HUGA 1IJWC 2IS4A 5GANe 1EA3A 2XASA 2W04A 2EGCA 1RBRA 4XTVA 2YUQA 1WXTA 1BIBA 4JI1K 2EJRA 1UA1A 3DXKA 2IS6A 2CQKA 1N39A 3FXLA 3L3VA 4LY7A 3KD5E 4IOAF 4E9EA 1YJ9N 3S3MA 1IXRC 4XN3A 4ANJA 4KUIA 1U47A 4BRQA 3F6VA 4P5OA 3V9ZA 5DUKA 4NC6A 2QEXI 3VQ6A 1W7PA 1RUNA 3DPLC 2HAXA 2K86A 2M5WA 4M3FA 2KYMA 2PFUA 1YRNB 2A5XA 4KA4A 3WG7H 3OIOA 3VYUB 1IGNA 2HDDA 2RREA 4PLLA 4DSLA 5E20A 1YHQI 4JDSA 3FHNA 1EKEA 4G7HF 1QZZA 3HL2A 4FT2A 3JB9H 3MJXA 3WHBA 3QODA 1IZ1A 2UUCK 2CP3A 2A6HF 3F6OA 1OZ3A 1Q81U 1XGOA 2FLOA 3I5RA 1FTTA 5D3GA 1SHGA 4E4HA 3OYYA 2X4HA 3PTAA 1I8FA 2I7PA 3D7EO 4Z4GA 2PZSA 2MFZA 1TG0A 3ZETA 1ZG3A 3GFIA 5DV5A 4CJWA 2Y1JA 4BXUA 1V54H 5K7ZA 3JRHA 2ZPIB 1JXOA 1H1VA 3LSKA 4KGVB 1TWGJ 2DT6A 4Y1DA 1NJYA 4P9FA 2JS0A 2XPVA 2QQSA 3QYEA 3AVCA 2DO7A 2X1EA 3H6ZA 2HBWA 3AO5A 2XGCA 2IRFG 3VGMA 5BRHA 2VKNA 4BBSJ 3HVTA 1LPLA 2LFBA 3QYBA 3F2KA 2W41A 4WX9A 1WAFA 5EEAA 2LNVA 4JRKA 1KVCA 1K4SA 1NK0A 4C8OA 5F0FA 1GXIE 4FCYA 1X58A 3L6QA 5GAEJ 5M1KA 2GA2A 1KCFA 4CCHA 2WUSA 3UA6A 1LNXA 4KKOA 3EGXB 4FJ9A 2BY3A 4Z4FA 4MLHA 2CZ0B 3GTLJ 4CZFA 2E4HA 3H3UA 2YHXA 1Y6IA 1ATRA 5D4RA 1KD1R 5CZ2A 2NNYA 3S3OA 2CKKA 3E2UA 1ZGAA 1U49A 4N0BA 4BXFA 4PA1A 4B6MA 4UQGA 2WB1A 5J1UA 1ZBFA 4CGJA 4JHDA 1F9NA 1MBGA 2KP6A 1ZLKA 3M1CA 2G8VA 1CGPA 1HOMA 4FWOA 3AG3H 5LRSA 1NBWA 3KKRA 4V19S 1Z9QA 4IRHA 1MMSA 2M0YA 1G3SA 3LA2A 1OX8A 4FPAA 4X34A 1OH6A 2VONA 1VQ9Q 5GAMe 3ENOA 4CEZA 2PEXA 3CCEA 1HMVA 2L7ZA 3MEDA 4AM6A 3A5NC 1HPZA 3VQEA 3VQ9A 4A3GJ 3J80E 4XK4A 3KNTA 4FLXA 1PD0A 2P9UA 2ZXJA 4BVPA 4XTXA 5J1EA 2LF7A 4X9CA 3FM3A 2JGUA 3K70C 3F8FA 1M90C 4KBMB 4U7BA 3M7GA 2LQKA 1J9AA 4JNEA 1SD6A 4XICA 3VPZA 5LHGA 3G1LA 5AT1B 5BPDA 4MFBA 3N05A 2NVXJ 1C0FA 1Q86U 4IEIA 1EO1A 1M30A 3EFOB 5GMKi 5CY4A 1ZBHA 2HHTA 2QSHX 1LDDA 4F7ZA 3UF4A 1DLOA 1M2VA 3TTDA 3VGKA 3EHQA 2EJGA 2BE5F 2ELHA 2E2OA 2WBNA 4DBRA 4M78D 5GAEP 2L01A 4CIFA 4CCOA 5EG0A 1MW7A 4M75D 3KTUA 2IP2A 3FIWA 4N4GA 3QOPA 3VEZA 2CH4W 3G0ZA 4B8XA 5TKWA 4Y91A 5J2PA 3PVLA 1S72N 4CJKA 4JI3K 2W25A 4B9SA 5ILVA 4PJMA 3MEEA 4WXCA 1YQKA 1TYQA 3R8EA 4BREA 2DL7A 1BBZA 1SS6A 3VETA 3WG9A 4CEFA 5KE2A 3CCSA 4YFXF 2A08A 5FKOA 4LN2A 3AA3A 5GAOq 1YUWA 3H6EA 2YWWA 1GL5A 3WTWC 2IVWA 2NRWA 2O8FA 2VXFA 3KZYA 1WRJA 1M1KU 1YIJT 5MLCQ 4ZZLA 3HSTB 3GTKJ 4LC9B 1ONVA 4X62K 1E3PA 3HFNA 1K0XA 1IBMK 1T44A 1XWLA 1TKZA 3JRIA 1WUAA 4M77E 4GXOA 1YJNQ 1RAHB 3Q7BA 1ACIA 2KIQA 2E1YA 3C6AA 2K79A 2KDOA 1UEBA 2OTJT 2MH2A 2NOBA 2H1LA 4Z94A 4KFBA 1LWCA 4LF8K 3R6NA 5HLFA 5A0DA 5TRDA 3DBRB 3LMMA 4H0OA 2F2VA 4J6YA 2RAEA 4CI0C 2LOOA 1LPQA 5FU7B 1N33K 4B4CA 3LP3A 3MMVA 3DPTA 4B43A 2FSKA 2WC2A 4CH7A 1M8MA 1P8ZA 4AC0A 3GPLA 3M1FA 4JLHA 4Y28E 1OZ2A 2EIFA 4QVDA 1U9OA 4CRIA 4NO7A 4QLCU 4W5NA 3MP1A 2HMPA 2F5VA 5K14A 3M8EA 1VQOA 5HLTA 5J2MA 1OV3A 5DMRA 4XH4A 2BZ8A 4EJUA 4LDWA 4FJKA 2VC8A 1MBEA 3LLRA 3PNVA 2NOZA 4W5OA 4FJNA 3AAFA 4JQFA 2M1HA 3CCLN 2IAIA 2QW9A 3EG2A 4X64K 2VN2A 4FLYA 4HVVA 4C8NA 5EF6A 3LP0A 5GAN8 5GINA 2KGTA 3QLHA 4KICA 4ESFA 1WKMA 4BYYA 4XKBA 3K4NA 3CCRA 1BA0A 3EG9A 1YJ9T 1YAGA 3O3HA 1BR2A 4DNCA 1VQ6I 3TP0A 1MH3A 4IEJA 4NYFA 1ETYA 4DBFA 4CO8A 2M9UA 4M3BA 4FHTA 4PK4A 4GY5A 2EPFA 3ASOH 4M78E 1JJ6C 2DXTA 2P4WA 1FOKA 3VUBA 4M75E 5K5RA 3OHRA 3LH0A 4ELVA 1HYZA 1ZLJA 2HKOA 2W00A 4B23A 4OMOA 2HNHA 2IS2A 5IT9O 1QSSA 3OR1C 2Y0SA 3I8DA 5CVUA 4Y13A 2PG4A 2BHYA 1S1WA 4K8ZA 4C23A 4MDAA 1IZ6A 5GMKj 1JRIA 3N0UA 2L3QA 1VQ8T 4FJ5A 2CGLA 2QQ9A 2ZJ2A 4PL8A 3PFYA 3SDBA 4JPBW 5GANf 2XHCA 4R56A 2HS5A 1JLEA 5GMKm 3VQ8A 5ICCA 1PRMC 1YTUA 1U48A 1RRJA 2Z5UA 3S1MJ 4NDLA 1I39A 2R7OA 2OA8A 3L2ZA 4B9NA 3SLCA 2JSCA 3OW2M 5C24A 3DLLF 4OIRF 1ZGWA 2IA2A 3DKMA 4H03B 2IDOA 4MLOA 1UGSB 1MBJA 2DA1A 2ZB9A 4J5YA 3K1PA 4EPCA 2LKPA 3I64A 1GV2A 4XRMA 1YQLA 1KC8C 5E17F 2C0IA 4IRGA 1HD3A 3UKRB 4UV9A 3OBYA 4DS4A 3M57A 4A6EA 4HUGA 2IA1A 3QO9A 1KQ0A 3LH5A 4FWNA 1F1BB 2X0LA 1N9SA 5HS8A 5L3GA 3ZPLA 2PVOB 1XC9A 2RHXA 4RMNA 3N5NX 1HKGA 3ZT0A 1LWWA 1Y57A 2NRTA 1M1FA 3WTYC 3GZNB 1HNZK 1FJGK 3PNTA 3ZMSA 1W1WE 2HDWA 2E64A 1LAVA 2XKOA 3TP3A 4C8QF 2YPRA 4FJHA 2BW3A 5KYWA 2E6LA 2RK1A 1VQNN 1D1CA 3SQ2A 3E5QA 2A41A 1NGBA 4RCBA 2GFUA 5F1XA 4OAYA 3U3GA 3JTHA 1VSLA 4MO4A 2EPDA 4DOWA 3LW5E 2O8CB 3DFGA 3FZVA 3CD6A 3OSGA 2ADUA 3OH6A 2L8DA 4U7DA 4C0GA 2DIQA 4TVRA 4EZ9A 4I9QA 1NKUA 3OOPA 4AU7A 1RFQA 2Q3SA 2RJEA 3KK3A 2O4XA 4A93J 1NK4A 2ABKA 1SD5A 2FF3B 4IOCF 3MX5A 2G8IA 5HDGA 3VS2A 4E9HA 2DK3A 3DYAA 4M71A 2WBMA 5C2FA 3TARA 2GBQA 5BREA 4RUGA 5I2SA 1D3YA 3L2WA 1ZSZB 3G71T 3LSHA 2KVQG 4FYXB 1Z7LA 3HI0A 4WXHA 1JLCA 4RW8A 3O8MA 2M2EA 1KTQA 4BXXJ 2H6BA 5HY6A 3KHYA 1D1BA 3CCUA 5JLXA 5F04A 2PJRB 4EA5A 2QAZA 1TGOA 2E12A 4EIKA 2F5CA 4V19K 2A0FB 4V2GA 2I8DA 5C44J 3CCVQ 4K0KK 1VQMT 3P31A 2DY4A 1BI4B 1VQLQ 1TKDA 3HPWA 2HNYA 2V7YA 2VVKA 4XORA 3F3XA 3PO2J 2COYA 2FSNA 1XTDA 3FZMA 3OYMA 1PYVA 1AWCA 1VTNC 2VBYA 1AOJA 3VRYA 3PIPL 4PJOD 1B9DA 1Q7YR 3M0TA 4BR9A 3LGFA 1ASVA 1BI2A 1R7JA 4LG3A 2Q8KA 5GAMf 2F2WA 4OB3B 1KYZA 3E7LA 2F8SA 3HSCA 3ABUA 5KPZA 4OIQF 2FOWA 4LIVA 2QEXA 2GAUA 3WGHA 4HNUA 4DSFA 1B6AA 4XTYA 4OVLA 2P6SA 4QQ6A 3ZSWA 3F0ZA 3Q9VA 3BR0A 2STTA 1U4BA 3UDCA 3FXKA 1KSWA 3OSVA 3LA3A 4CFCA 1SMTA 3FFIA 1SEUA 2RN8A 3AARA 2PQWA 3AO3A 3SDGA 4II1A 4N5SA 1T2KA 2BH1A 1YHQA 3JS6A 4KN4X 1JJ2P 2B7EA 2ZPHB 5C4JJ 5DY9A 4F7UE 3IWFA 1OCCH 1GLEG 1N8RU 3CC7Q 2WAFA 4PSWA 3CCVI 1KD1U 2HB5A 5LRRA 3P4IA 3O9RA 1M4ZA 3A2KA 1I1SA 4B3RK 3KP4A 2GXBA 3CTAA 4MO7A 1VQKN 4HRIA 4A3LJ 1QVFM 1K9MO 3CWAA 4CZIA 3CJTB 4RTTA 2HPMA 2HNDA 1HQEA 2D8HA 3M8JA 1Z1DA 3Q1JA 3AVBA 3EUHC 1TL1A 3M8FA 3EG3A 3O9UA 3M59A 2E20A 4FWSA 3SI6A 4G94A 2EB7A 3SZGA 5JICA 1GOCA 3I3LA 3OL3A 4A69C 1KFSA 1BQNA 1NGDA 4EMHA 2FPDA 2GQIA 2HQHA 1NU0A 3SFIA 3R3LA 1M1GA 2R5MA 1NGNA 1W0UA 2R7XA 1XNIA 5LJ3d 3SMSA 2DN0A 2R93J 5C4XJ 1KQSP 2KAFA 2DILA 1U6GA 5CE3A 2EQJA 4NB5A 1R8OB 3U8XA 3HZJA 5E1ZB 4Z6YA 4CIEA 4RB0A 1JKQC 4IRIA 2NRRA 3SWNB 3UKUB 1K78B 3ZQLA 2IGMA 4XL9A 1WQ2A 3U3YA 3LQQA 2HD0A 1BC7C 4E9GA 2FMLA 3REOA 3QZ5B 2HKQB 1HNVA 2RQWA 3D5SC 1V4RA 4X66K 2QKBA 2Q2EB 2NS0A 4KNYA 4CD3A 4JK8A 4PZJA 3DTKA 2KY9A 3ZMVA 3LWMA 1T03A 2Q97A 1DUXC 2FEIA 3QDFA 3SYZA 3FSPA 3FRNA 3PSFA 2RD1A 3BG5A 3RR6A 3QU3A 2JUCA 1SF9A 1YO5C 3L2RA 1RI0A 5LLQA 3CMEQ 1HDDC 5H20A 4PJOE 2FZKB 2DFIA 4I0AA 3E1YA 3VOVA 1SUQA 3GE1A 3EGXA 3H5RA 4HYEA 3I8BA 2YUSA 2PBDA 1KAZA 3CVSA 4IIOA 4CHUA 3RESA 4EDUA 3M3ZA 2JTMA 3CMAT 3CJ1A 3FWEA 4M9ZA 3BJAA 2OF7A 1OQKA 3QEIA 1P2FA 1FP1D 2MG4A 2E3HA 3K59A 3A8LB 5FDLA 5FLXZ 2JMAA 2DCEA 5LJ3j 2P0QA 4QPQA 3I55N 1TWCJ 5LMNK 1VQ7Q 1G2HA 3P5JA 3JSPA 4H0TB 1HNXK 1OULA 5K7HA 2G6FX 2DFUA 1AU7A 1KQSS 2D4WA 2M7AA 1JJ2A 4MDBA 2DXBA 3TBIA 4A4HA 1WGSA 4XBFA 1PRLC 1P4AA 2RMOA 3O8GA 3ZSXA 3EHRA 3V9SA 2NUZA 1NG9A 3WU1B 3QP5A 3CMEI 3VQ4A 3KUFA 3PIOL 4CC7A 1X9SA 4DGWB 1NGGA 4U88A 1E2XA 3QYGB 1HF0A 2E2QA 2Y69H 3R6SA 3IHUA 2JMCA 3VQQA 3PSIA 1YITT 4HOBA 2P9SB 3AFHA 2DA3A 2QWMA 4J9GA 3S17J 2VPLA 4UV8A 2YDLA 1K9AA 2HEOA 3P8DA 3QWLA 4AFSC 3X2QH 1KQSA 2IAJA 4KT0E 3ZN1A 3C2BA 4XRFA 3BJ6A 5EGOB 1DKGD 4DW6A 3EUHA 4AH9A 1L3LA 4B48A 2ACJA 5D8LB 4M7AC 5K5OA 3ERMA 1ASWA 8ATCB 1MDMB 4HSBA 2LJ1A 2A37A 1O7FA 2HBPA 1KG5A 4EJWA 1DDNA 3GO5A 3CLOA 2ASOA 4GGGA 1NTCA 3FKIJ 2YSRA 3K4JA 4QVZA 2P9LB 4PKIA 1TAQA 3KJVA 1TKXA 3C7JA 5GMKl 3BFMA 1QVGM 1OCOH 3PO3J 4DA4A 2VV5A 3QHSA 4A12A 4KIFA 4L59A 3JRZA 2IBDA 4OPJA 1RRQA 4AF1A 2MH9A 3Q5FA 1MA9B 2EFOA 4CFAA 4IDHA 5GAOn 3UNGC 3KEQA 2VBZA 2R7DA 3OGDA</