3OYGA

Crystal structure of the prototype foamy virus (pfv) intasome in complex with magnesium and the insti compound1 (compoundg)
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
368
structure length
368
Chain Sequence
LDAELDQLLQGHYIKGYPKQYTYFLEDGKVKVSRPEGVKIIPPQSDRQKIVLQAHNLAHTGREATLLKIANLYWWPNMRKDVVKQLGRCQQCLITNASNKASGPILRPDRPQKPFDKFFIDYIGPLPPSQGYLYVLVVVDGMTGFTWLYPTKAPSTSATVKSLNVLTSIAIPKVIHSDQGAAFTSSTFAEWAKERGIHLEFSTPYHPQSSGKVERKNSDIKRLLTKLLVGRPTKWYDLLPVVQLALNNTYSPVLKYTPHQLLFGIDSNTPFANQDTLDLTREEELSLLQEIRTSLYHPSTPPASSRSWSPVVGQLVQERVARPASLRPRWHKPSTVLKVLNPRTVVILDHLGNNRTVSIDNLKPTSHQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PFV integrase
publication title Molecular mechanisms of retroviral integrase inhibition and the evolution of viral resistance.
pubmed doi rcsb
source organism Human spumaretrovirus
molecule tags Recombination,viral protein/dna
total genus 106
structure length 368
sequence length 368
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2010-09-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
A PF17921 Integrase_H2C2 Integrase zinc binding domain
A PF18103 SH3_11 Retroviral integrase C-terminal SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2300 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3oygA04
1.10.340.70 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Endonuclease III; domain 1 3oygA01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3oygA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3oygA03
4DFMA 3QINA 4AHUA 4EDUA 4A4EA 4KHYA 3VQEA 3VQ7A 1U49A 4HCCA 3ZT4A 3LP2A 3VQ5A 4JRPA 2BDPA 3V9WA 4QW2A 4OLAA 4ELTA 4CRIA 4LH5A 4J2BA 4W5OA 3AVHA 1NK7A 1LAVA 3K5NA 3I8DA 3OMGA 4BWMA 3WNHA 2I5JA 1IG9A 2HNDA 4OGEA 3RWUA 2RI5A 3EY1A 1UA1A 3BDLA 4DU4A 4DS5A 2R5AA 1QSSA 4DMNA 2VYTA 4IKFA 1WGSA 2F96A 3WNEA 3KLEA 4DFPA 4HHTA 2EFIA 2G8IA 2BE2A 4DQQA 1NKBA 4I2PA 2D0CA 1O1WA 4KAZA 4N41A 4CEQA 3K5LA 1EP4A 4GVMA 3DRPA 4M42A 3LYIA 5M9OA 3OYNA 2G8KA 1YTAA 1X9MA 3K57A 4E3SA 1RTJA 2YNFA 3C94A 1YVUA 3DI6A 4CJVA 4CEEA 1JL2A 2OPRA 3SV4A 4QQDA 3UIQA 3MEWA 4DTRA 1U04A 3AVMA 4OVLA 1RBSA 1UA0A 1SL1A 4IUQA 4N4GA 1C0MA 4FJNA 2HHTA 1IO2A 3K58A 3ZSVA 2PY5A 1J5OA 3P1GA 3ASKA 3MP8A 1HQEA 4C8KA 3LAKA 5FRNA 2XY5A 2YNGA 1QS4A 3QO9A 3V9ZA 4CEOA 4OVAA 2EQMA 1JLQA 1MHNA 3K2PA 4UQGA 3CFOA 3DM2A 4B9UA 1RT7A 1X9WA 4CJ3A 3U6FA 3NE6A 3LWMA 4M3YA 2G3RA 2X6NA 4DQPA 3V9UA 4DSJA 3NBPA 3PX4A 2P1JA 3V1OA 3S3OA 2XRIA 4W5TA 2X4WA 1KRPA 4OGCA 1RT6A 1LW2A 3RMAA 3LGLA 4CECA 2IOCA 3V9SA 2PYJA 3LX7A 1RI0A 3AVLA 3AV9A 4CF1A 1VRUA 2YRVA 1RDDA 4QVZA 2WOMA 3SJJA 1RBVA 1KCFA 4IUTA 1NOZA 4CJUA 2ZE2A 4N5SA 3LH0A 1RBUA 2GBZA 4FJ8A 3MEUA 3AVBA 3LANA 2PQWA 4M3UA 4QAGA 3L8BA 2IAJA 3TR8A 2DTUA 1HYVA 3FDRA 4DLEA 3PY8A 1C1BA 3B6OA 2IC3A 1S1VA 3SUQA 3DRSA 2EQJA 2E6LA 4IDKA 4OPKA 3VQ4A 3S3NA 3NH1A 4DLGA 3M8SA 2X74A 4CFAA 3BGRA 2O4GA 3HYFA 4FJLA 1T7PA 2RJEA 2D5RA 3AA2A 3QLHA 3TARA 1VSKA 3HVRA 1LV5A 3P5JA 3MEDA 3TAPA 1EKEA 1I39A 5DK5A 3L2VA 3QBYA 3CG7A 4KRFA 4CJWA 3ZT3A 4E7JA 3V4IA 4KHUA 1B9FA 2FBXA 2HHVA 1TVRA 1RILA 1WAFA 1C1AA 1S1XA 1JLGA 2HB5A 4CK1A 3DOKA 4DTPA 1GOCA 4OPJA 3QEIA 4KO0A 2RHYA 2R57A 5E41A 1XHZA 3HPGA 2EHGA 4DWIA 2OYQA 1FK9A 4F2SA 1JXEA 3QEXA 1C0UA 1Z26A 3H8ZA 1OI1A 4RG2A 3OVNA 3DLRA 4AHTA 3OYFA 1T03A 2YKMA 4N56A 3K5MA 2YKNA 4AH9A 2VWKA 3NH0A 4N4HA 2IDOA 1L3VA 3MAQA 1BQMA 4B9SA 3KLHA 4ELUA 3OYDA 4Z4IA 1CXQA 2HW3A 3DLGA 1WJQA 3DLMA 1OZ2A 4E0DA 4O55A 1TV6A 1FXXA 3D0PA 4L59A 4CF8A 4FLWA 3M9QA 2LTOA 2XY6A 4QCLA 4CIGA 3QEVA 3UT1A 4CE9A 1BCMA 4IFVA 5J2NA 1KVBA 1KVCA 3VA0A 4ZTFA 3HM9A 5I3UA 3MP1A 2YV0X 1WSGA 4PA1A 2LVMA 1L3SA 1JLCA 3V81A 1A5VA 1Q9XA 4C5HA 4RW6A 1IKVA 4CJEA 1VSIA 2F5KA 1BISA 1BIUA 1LWCA 1U45A 1KSPA 1BCOA 3OYIA 2VG6A 2FBTA 1TL3A 1IKXA 4DSIA 1NJXA 3QNOA 3OQ5A 5CYMA 5CZ1A 1J54A 2HNYA 1R0AA 3VQQA 1L3UA 3RRGA 4W5RA 2XHBA 3OYBA 2X78A 3CEYA 4PLIA 3QEPA 3QIIA 1TAQA 1BGXT 4ZTJA 3ZT1A 3TWHA 3SYZA 1NK5A 2YHBA 4KHWA 4KHSA 4OKEA 1RT2A 4EZ9A 4KV8A 5SWMA 4BWJA 4JRQA 5D6XA 3MEGA 3AO4A 3IS9A 3VQ9A 2GFAA 4E7LA 1K6YA 2R58A 3SNNA 4C5GA 1NKCA 5D3GA 1S6PA 1RBRA 4CF0A 2G8FA 4CERA 1Z25A 1D8YA 1CZ9A 1FKPA 4CF9A 1REVA 2DIQA 1VSMA 1NJZA 4M3TA 3LDSA 3L3UA 4A4GA 3FC3A 4E89A 2P5GA 4KTQA 4RW7A 4CJSA 1U4BA 2VG7A 1WSIA 3HVTA 2XY8A 1TAUA 3JYTA 3TI0A 3O3GA 3DLEA 2FBVA 3MEVA 2GF7A 3LAMA 4CF2A 3VQ6A 4C8MA 2RJDA 4KHNA 1DTQA 3F73A 4E19A 3RR7A 3OY9A 3P83D 2BKDN 3NF9A 3ZSRA 3HXMA 1KTQA 3HT3A 3ITHA 3HP9A 3AVCA 1X9SA 1WJSA 2KFNA 4DU3A 3K5OA 1ASWA 4NYNA 4IUPA 3HK2A 1UWBA 5SZTA 4CJFA 2A1SA 2Z1IA 1CLQA 4H8KA 3OS2A 5EU7A 2AJQA 4DSLA 1TKZA 4ID1A 3KJVA 1EETA 4NS5A 5HRNA 4F4KA 1NK8A 2IS3A 4FL6A 5IAYA 5C25A 4F3OA 1NJWA 3P8DA 1RTDA 3KLGA 4CHZA 3L2UA 2P0KA 3MXMA 1N27A 1C6VA 2OZSA 3PUFA 4C8OA 2YHAA 3V9XA 3T1AA 5FRMA 3NF8A 3FLGA 2RI2A 3S3MA 4F8RA 2P5OA 2EQKA 4OKJA 4X34A 4ICLA 3HO1A 4FM2A 4CCHA 4LD0A 3TANA 4E7IA 1ZBFA 4BDYA 3LGFA 2E4LA 4TSXA 4JS5A 3LZIA 4Z0UA 4DQSA 5J2QA 4LD6A 1MU2A 2OPSA 4BE0A 3NCIA 4CK2A 4RG8A 5HRPA 2ZQBA 4II1A 4G1QA 4HCZA 2OZMA 4FZYA 1WSEA 1L5UA 1RDAA 3V1RA 4DF4A 4GMJB 1RDCA 5KCOA 3NAEA 2JZ2A 3CFRA 2HVIA 3KD5E 2BIVA 1SUQA 4R5PA 2RHIA 2M16A 1SKSA 2HHSA 1KHCA 4CHYA 4KREA 3FFIA 4FXDA 4CEZA 2K3YA 2O4IA 3OS1A 3KLFA 1LWFA 1NOYA 4HCBA 4DQRA 3ISNC 4Z4EA 4CGJA 3O4NA 2ETJA 3CM6A 4DTXA 1KLMA 2YNHA 2W42A 2B5JA 3LP0A 2OA8A 4LH4A 3K59A 3LP3A 1XNIA 4NYFA 5KI6A 2X4XA 3PO4A 3EYZA 2BGGA 3AO2A 3TAQA 1TKDA 1WNSA 1JL1A 3MECA 2FBYA 1SV5A 4LY7A 3VQBA 4Q5WA 1LWEA 4K8ZA 5KRSA 4PWDA 2HVHA 3NTIA 4FLXA 1BIZA 3OA6A 4E1NA 4KI4A 4OKKA 3LZJA 2BANA 1IKWA 4IURA 4FM0A 1Q8IA 1KVAA 3AVKA 5T7BA 4RW9A 2QXFA 3A2FA 3VA3A 2F8SA 3TAEA 3F70A 2R7YA 3LWLA 3DLHA 4O44A 2KFZA 2JLEA 3KKSA 2RI3A 3M8RA 4KB0A 3OB9A 1NK6A 2A1RA 3QIOA 1OYXA 3KUFA 1HQUA 1ASUA 3ZT0A 5IN1A 3C6TA 4N4IA 4FJKA 1XHXA 3KK1A 4CHPA 2P51A 3SUOA 1A5XA 4H4OA 3ULDA 5KE2A 3VQ8A 3U3GA 1KFSA 2G8HA 2E5QA 2BUDA 3DOLA 1JLAA 4DTOA 1N5YA 2OPQA 4FU6A 2WONA 3KIOA 3QETA 3G0ZA 2RHZA 1YT3A 1QE1A 4MQ3A 4CIEA 3VQPA 2R5MA 3G10A 1D5AA 5HP1A 3WNFA 1SKRA 2PYLA 1CXUA 1WSJA 4PUOA 4CGDA 4M41A 4A4FA 4B9VA 3HSTB 2DFEA 3KKRA 1C0TA 2VWJA 3OMCA 2X6SA 2HHXA 1S1UA 4Z4GA 1S6QA 2HHWA 4FJ9A 3AA3A 4B9NA 1ZBIA 4IBNA 4F2RA 4FZXC 1JLEA 3OS0A 3S9HA 4C5IA 4BE2A 1U48A 3DB4A 1SL0A 1F21A 3AA4A 3V1QA 4Y1CA 4Q5VA 2G8WA 4FLUA 1WSFA 4IUVA 3QIPA 2KZMA 1L3TA 5KGXA 1X1PA 2DFFA 2D0AA 1RNHA 3O4QA 2F8TA 3H08A 3AO1A 4M3ZA 2E6MA 1RBTA 5J1EA 3KLIA 3C6UA 1ZBUA 1D9DA 3HP6A 1LAWA 4BD3A 3SPYA 5CYQA 4KTZA 5DMRA 3ZSQA 3MXJA 1U47A 3LALA 3ZSYA 4CGGA 4CJRA 3RR8A 2ATQA 2FC0A 1NK4A 3O3FA 2JGUA 3L2RA 2LDMA 3P8HA 1S9GA 4Z02A 1S1TA 4FLZA 4FJ7A 4BDPA 1Q9YA 1UOCA 4J2AA 4DG1A 2LSNA 1HRHA 2KW4A 3T3FA 4B9TA 4CHQA 4FK0A 4GW6A 2X35A 2D0BA 2VG5A 3PMTA 4DSFA 3NF6A 1QQCA 3HJFA 4BDZA 4O5BA 4B9MA 2Y1IA 1WN7A 3KK2A 4FLYA 4UC4A 3ALYA 3PV8A 3HPOA 4L8RB 2RJCA 3M8PA 3PX6A 3OYCA 3META 3ASMA 1LW0A 3B6PA 4NCAA 4FLTA 5KE3A 2LCCA 3GOXA 4CEDA 1JLFA 3M8QA 4DTSA 4B9XA 1VSHA 3NH2A 5HLFA 4K8XA 2Z1JA 4RW4A 1KLNA 4EZ6A 5C6SA 5KGWA 4O0JA 3I0SA 1G15A 2IG0A 5CY4A 3OJUA 4CESA 2Q3SA 4CHNA 3KK3A 2B4JA 2Z1HA 2B8AA 2L3RA 1RT5A 3AVIA 3NHGA 1VK0A 2RJFA 4CEFA 3OYGA 4IG3A 4F3TA 3BDPA 4IFYA 1BI4B 1OZ3A 1RDBA 2M0OA 2QKBA 4E7KA 5JS1A 4YNQA 1BQNA 2PZSA 4O0IA 3TAFA 4QOZB 3HPHA 5CZ2A 1WSHA 4Y1DA 4FJ5A 3QESA 3OYLA 1T8EA 4FJJA 4B8CA 4CJ5A 2HHQA 1RT3A 4XIUA 3ZT2A 4ID5A 1QTMA 4FJMA 5C24A 3V6DA 4B3OA 3ME9A 3AO3A 2G8VA 1TK5A 1A5WA 3IRXA 2RPIA 3L2WA 5KH6A 4LSNA 5CIUA 3DYAA 5JS2A 3KTQA 4CJKA 2ITGA 3NTKA 4CFDA 2QK9A 4KI6A 3L2QA 2NUBA 1VRTA 3WNGA 5J2MA 4N47A 3CYMA 2NLUA 1ZBHA 5I42A 5HBMA 3AVNA 2QQRA 4DTNA 4B08A 3ZSZA 4B9LA 4RW8A 3C95A 3NGZA 1EXQA 3NGIA 4J2EA 5FDLA 4O4GA 1HNIA 4HVJA 4FZZA 4CEBA 5J39A 3EZ5A 5KTQA 4AHCA 3DLKA 4CHOA 2QQSA 2HQXA 3O3HA 2EX3A 4HTUA 4FM1A 4FK2A 3H6ZA 1SL2A 4KKOA 2RF2A 4M3WA 3EAEA 1DTTA 4A4HA 2D9TA 3OYHA 3ZSXA 3DMJA 2RHXA 2XO7A 4PY5A 1IH7A 4M3RA 1CZBA 1BL3A 2L8DA 1QSLA 3C4SA 2EQUA 2HHUA 1W0HA 2RHUA 3NTHA 5FROA 3ZCMA 5KRTA 2LRQA 3RMDA 4IUUA 4PQUA 4HUFA 1HYZA 4Z4HA 3PX0A 4OJRA 4CJPA 4AHVA 1I3AA 1DLOA 1J53A 4CFCA 3D45A 4CFBA 1B92A 4QQGA 1NK0A 2KTQA 3LPTA 4DTJA 1HMVA 3QJ6A 1S1WA 3LLRA 4M45A 4C5EA 2M1HA 4NCGA 4BACA 3SQ1A 3CM5A 2ZD1A 3PFSA 3RMBA 1HNVA 1GOAA 4FVMA 1ZYQA 2JTFA 2B6AA 4FYDA 3NGYA 4Z4CA 1TK0A 1VSFA 4C8LA 4KTWA 1XC9A 3O8VA 3OYAA 3OYMA 3TAGA 5D6YA 4NZGA 1RT1A 1VSJA 2QKKA 1WAJA 1RTIA 4E1MA 4DU1A 2O4XA 2DFHA 3IG1A 1XWLA 3SQ0A 3SPZA 4CJTA 4KPYA 5D6WA 4DF8A 4JS4A 4DQIA 3RRHA 4CGFA 1H3ZA 4FK4A 4CJLA 1KFDA 3IAYA 3I0RA 3PMIA 3UWNA 2IGIA 4CGIA 4QQ6A 2O4XB 3RMCA 1N6QA 2GUIA 1GOBA 3ZSOA 1S9EA 4NCBA 1UAXA 2Y1JA 1HJRA 2KQ2A 1QHTA 4J2DA 3FEOA 4FJXA 1VSLA 1T05A 2L89A 4HUGA 3THVA 4MFBA 3MXIA 3E9FA 4E7HA 4H4MA 4C8NA 3MO8A 1VSDA 3Q1JA 3E9GA 4AILC 3JSMA 2E6NA 1SSFA 1NK9A 1W9HA 3NFAA 4FW2A 2RO0A 3ZSWA 4CIFA 4CEAA 3LPUA 5K14A 2HMIA 5J26A 3RTVA 1HYSA 3DLBA 3SI6A 3S6WA 4FJGA 2XK0A 2HNZA 1SKWA 3TABA 4LSLA 4ELVA 3VQAA 1J9AA 3VQDA 4KHQA 1XI1A 3AVGA 2RKIA 1JXBA 3U3YA 1JLBA 3SV3A 4N76A 4W5QA 3VQCA 1G5VA 4CJQA 5C42A 3AO5A 1TKTA 2MWOA 1YTUA 4DSEA 2KZZA 4DFKA 3LP1A 2DIGA 4WE1A 2XDPA 1TGOA 2G8UA 2YNIA 2OPPA 4KB1A 1RT4A 2CKKA 2Z1GA 3ZEHA 3AA5X 4OLBA 3KD1E 3VN5A 5J2PA 3OYEA 4EP4A 3SQ2A 4DTMA 4FCYA 4CJ4A 3OJSA 4JLHA 1ZBLA 3T19A 3NDKA 4DTUA 3SUNA 4PLLA 3CFPA 4FW1A 3OYKA 1RTHA 1D9FA 4B9WA 2DY4A 5HRRA 3MEAA 1ITGA 3QKJA 5KCHA 4AHRA 4ZHRA 4YFUA 1NKEA 4FJIA 4Z4FA 1WLJA 4IG0A 1TKXA 4PL6A 4DFJA 4GY5A 3QERA 1HPZA 4BE1A 2WACA 2K3XA 4EP5A 1WJRA 4HUEA 3AVFA 4W5NA 2MWPA 3PNWC 2DAQA 1TK8A 2XY7A 3OYJA 1FKOA 1Y97A 3NNQA 1BHLA 1C1CA 3E01A 1VSEA 5C0MA 3CQ8A 3SD4A 1EX4A 4FJHA 1IKYA 4KFBA 3SCXA 3L3VA 4I9LA 4M3XA 2EKOA 4I7FA 4AHSA 4I2QA 1JKHA 3QEWA 3SUPA 3NF7A 3L42A 1NJYA 2GFUA 3F9KA 1RCHA 1B9DA 3HL8A 4B8AB 4CK3A 3AVAA 1QSYA 4DS4A 2HQEA 3QNNA 2RN2A 3DRRA 3SZ2A 1ASVA 3MEEA 4Q0BA 2X4YA 3AVJA 1TL1A 3TAMA 5HRSA 3DB3A 3SQ4A 4CGHA 5HROA 3MP6A 1S5JA 4I9QA 2GV9A 4DSKA 2FHDA 4FLVA 3PO5A 1BI4A
chains in the Genus database with same CATH superfamily
5GAGJ 4AHUA 1AWCA 2P4TA 1H3HA 1D8KA 3ZQ7A 4MLOA 5LJ5f 3LP2A 4AFUC 1M90U 2GUPA 1MA9B 4QW2A 1E0EA 4OLAA 1WRJA 1LPQA 4BU2A 3J80K 4W5OA 5GJVB 1NK7A 3K5NA 1N36K 1WLPB 2DLPA 2E1MB 3EY1A 1AOYA 5ADXH 4GLKA 4DU4A 5L3EA 3KP5A 2VYTA 2E1HA 2EIJH 4AFZC 3CC2I 2K02A 3G25A 4J9CA 3NAUA 4DFPA 4IHYA 4DR1K 1PG5B 2K3BA 3LSGA 2L02A 4LD9K 2IGMA 1TNSA 1YI2A 3K9KA 2D0CA 1O1WA 3RSEA 4RGSA 4YOWA 4CEQA 1EP4A 3RZOJ 1VA7A 4NQWA 5AQPA 3DRPA 1YF5L 1UJ0A 5JLXA 2QQ9A 2WADA 1OCTC 2J4RA 2G8KA 1GFDA 3K57A 4E3SA 3LFUA 1PNJA 4FT8A 4RTUA 3MZYA 3O9SA 5IP6A 3DI6A 2OFKA 4XLEA 1VQPI 4CEEA 2HBLA 4BAYA 1BW5A 2ETHA 2ABKA 3NQOA 4U88A 1P7IA 4OIQF 5LJVA 5F64A 1N3CA 4OVLA 3CCUN 2CMPA 1DJ7B 1R0CB 4IUQA 4OMLA 1NGBA 4FJNA 2YHXA 5EEGA 2X6OA 1N25A 3K58A 2JTVA 2PY5A 1WQWA 4RCCA 1FMVA 1UHMA 3K4NA 3Q9SA 4HTLA 2E5LK 2AHQA 3RR6A 2DXBA 2ZO4A 1KSWA 3CC7T 2H94A 3M56A 3L2CA 2XY5A 4DQ8A 4KICA 3V7SA 1QS4A 3EG0A 4OVAA 3CC4N 2JK3A 1JLQA 1MHNA 1YW7A 2A6TA 5HODA 4HF0A 5FLVA 4B9UA 4AVZA 1WI3A 3FHGA 5LJ3g 3U6FA 3JAMO 4NLCA 2L7ZA 2HZYA 3ZCOA 2G7HA 2L2PA 4DQPA 2P4WA 2EWNA 3G71I 2LTPA 4L5IA 1X6GA 2CP2A 1U2VB 3NBPA 3IUCA 3PX4A 2P1JA 2HOAA 3W6VA 3ZOBA 2X4WA 5LGTA 2CS7A 1OR7A 3M1EA 4JJDA 3HDDA 1NG9A 1BWFO 1HK9A 2KDOA 4EJUA 1SD4A 2RQPA 2HYGD 1PD1A 2IOCA 4WXCA 1R9TJ 4F04B 1RI0A 3HIFA 3ZETB 4M75D 4LXCA 1VRUA 9ANTA 1RDDA 2WOMA 1RBVA 2JN6A 1QBJA 2K5LA 1IV6A 1KCFA 1NOZA 3PNVA 1R23A 1M3QA 4AC0A 1F43A 2V8IA 2GBZA 4FJ8A 3FISA 4PJOD 2X1DA 3ABMH 3MEUA 2WV0A 2BW3A 3VPZA 2QEXQ 2OA4A 3KZYA 4UB6C 3KZBA 5EYRA 1HYVA 3CD6T 3ZN0A 3PY8A 4EV0A 6PAXA 4OMQA 2W7NA 3A0HC 2E7XA 3M0PA 1JBMA 1ZHIA 3DRSA 2EQJA 4IDKA 4E6RA 4XONA 3PQJA 3S3NA 4WTOB 1YS6A 2O6GE 1W6XA 2COYA 1TS9A 4F7UB 4CFAA 2OZ6A 3JRFA 1YJ9T 1TQIA 1ZSZA 2O4GA 1NH3A 4BREA 4FJLA 4AVPA 2KT8A 5JHFA 4EMKA 2K9GA 2DETA 3G6EI 2CGKA 1ETKA 3DXJF 3SDGA 3TARA 5GAOq 1VSKA 5JVGL 2XUBA 2FZCB 1Y64A 2XMFA 3GP8A 1I39A 3TAPA 3HOXJ 3L2VA 1R5GA 1D1AA 3CUQB 5I2MA 1V4SA 3JW4A 1IN8A 4G12A 4CC4B 5CVVA 1SG5A 5M1KA 5HDGA 3TU4K 1TVRA 5M1OA 1RILA 1KD1O 2NRHA 1HKGA 4B22A 1JLGA 2MW8A 1VQLA 3HPWA 2VE8A 4JX4A 2R7WA 3HPGA 1M2VB 2EHGA 1OR7C 2LFBA 1I1GA 1RAHB 1X3MA 3LA7A 2KLAA 2OYQA 2DA3A 4C92G 1JXEA 1KAZA 5GIPA 1T8IA 1N39A 4FETA 3H8ZA 1IXCA 1K9MU 3OVNA 4A2AA 2L9RA 2W00A 2M9HA 5DCMA 3LDNA 4IHSA 4JEPA 1BW6A 1X3UA 1U8RA 4XIDA 1QQMA 1XN7A 4N4HA 2BZYA 3EGUA 1JGGA 3BCAA 4QS8A 1BQMA 1VQ5N 3BR3A 3CCQI 2FO0A 4ELUA 1VQOQ 4BEHB 1FJGK 2IP2A 2VPRA 1RI9A 2P0QA 5GTHC 1OZ2A 2PX9A 2DMOA 4BJTA 1ATRA 1KONA 1OCCH 1F36A 2MFZA 1N75A 1FN7A 1VQ6Q 4IFEA 4FLWA 1QCFA 2M7BA 3FK7A 2XY6A 2KRCA 5LY3A 4QCLA 1HNWK 2EYWA 4BR9A 2M87A 3I5UA 2G9WA 2QQ8A 3UT1A 3EUAA 5E1WA 5EJCA 3H3UA 1TUYA 3KP7A 2PLYA 1WJFA 4Z8AA 3VA0A 2XDBA 2QWOA 1J6ZA 4KITB 2YV0X 1ZSZC 2W48A 4PA1A 4JNEA 1ETWA 4EMKC 3VYGA 3VFZA 4DOZA 2QA4I 3HTUA 2MABA 3H35A 4P9FA 4CJEA 1QGPA 4J6WA 2DPNA 3I9V2 1KSPA 2RM4A 1JTYA 3CPFA 2FBTA 3W0LA 2FA5A 3K10A 2VL8A 2P5VA 1KU7A 3QWYA 1TL3A 4J9HA 2LQ8A 4DSIA 2K85A 1BL0A 3QNOA 3EFOA 5CYMA 5GINA 5CZ1A 2CZ1B 2CV1A 1LNXA 1YO5C 2XF5A 2YHWA 1L3UA 1N5ZA 2YU9J 4W5RA 1XQPA 5E79C 2F4MB 3MX2A 2VQHA 2OTJQ 3ELKA 4JUVA 2DA1A 3OGDA 1IG8A 1FWZA 1BGXT 1NK5A 4KHWA 4LC9B 1LDKB 4EZ9A 1Y8QB 3VEXA 4BWJA 1QQOA 1MPGA 3H36A 2GAUA 3KEOA 2M7AA 3FB9A 3UF4A 2RQWA 4EJOA 2R58A 5LEJA 3HSRA 1EA3A 2J05A 4E9HA 4F7UE 2TCTA 2WY8Q 2CO5A 2EV0A 3PNTA 1NYGA 1BI0A 3PLAA 2E3IA 1RBRA 3L00A 3RPUD 1G59A 2QGUA 5BNGA 1PSFA 5J4VA 3A0BC 1CZ9A 4XR6A 1RUWA 2L7FP 4Y0WA 4L9TA 4RTWA 5C12A 5DDGA 3J7ZO 2PMZA 1AA7A 1XSXA 4JKGB 2Q2EA 3CESA 1JUMA 2FEZA 2LT1A 5KN9A 1QCNA 3S41A 3R4KA 5E20A 4RTZA 4A53A 1U5TA 2P5GA 4ESJA 1U4BA 2RQTA 4DK9A 1W97L 2XGDA 3TI0A 1UJYA 1M8MA 3TSQA 1XGOA 1GCPA 4UNFA 4C8MA 3WEEB 4CC2A 4E19A 1MV3A 2F4IA 2L2OA 1NTCA 3PO3J 4C3JJ 4BGDA 3CVTA 1YI2Q 3H6EA 2DKGA 1G8XA 2VC1A 1YHQT 1TYQB 3HC7A 2DXIA 4BI4A 1KTQA 3VYHB 4OAYA 2RQUA 3A8MB 1DKGD 2XF7A 1NBWA 3ULRB 3ITHA 4XLAA 3IV5A 1IRZA 4HQEA 4BR7A 1P4XA 3T1BA 2JWTA 1WXUA 5LJ3f 4IO9F 4AG2C 1IZ6A 2DK3A 4U7DA 2MC4A 1AU7A 1E3HA 4DA4A 2XRLA 1LWWA 4IUPA 3KE2A 4M7DF 1B8IA 3HTVA 4CJFA 3FM3A 2JS0A 3I9QA 4H8KA 1EV7A 3MKYB 3CCUA 5EU7A 3SJMA 1Y56A 2V75A 3E97A 1MUZA 1BJZA 4ID1A 1EETA 4NS5A 4M7DA 3VPRA 2IS3A 2FEIA 5GAMe 4YOTA 2CSIA 4XKBA 1RTDA 1WYXA 4CHZA 1ETQA 1W7PB 2P0KA 3CC4A 2KROA 1ZREA 4RAGA 4FYWB 3MXMA 3CPEA 1GLNA 4HQMA 4LITA 5IYBJ 5TJJA 3MWTA 5IT9K 3PUFA 2KAFA 2E3HA 3JSPA 1ZLJA 1YITI 3VOEA 2HTSA 3V9XA 4B4CA 3S3MA 3MN6A 4F8RA 2P5OA 1U5TC 2K5FA 3CCRT 2HI3A 4ICLA 4JZ3A 4FM2A 4LD0A 3FZMA 3S14J 1DT9A 3HYIA 2KQWA 4K0KK 3LGFA 4AMCA 1O3RA 1IRFA 5IHIA 4ZDLA 3O4WA 4XN0A 2OPSA 4BE0A 2HFHA 2DXUA 4CK2A 2EYYA 5HRPA 2P9UA 2KPMA 4II1A 3OA9A 4FZYA 1WSEA 2DCEA 3V1RA 2YXYA 2D1KA 2O8FA 2DPDA 4ENKA 5BRDA 4I7HA 1XMAA 1RDCA 3RKQA 4QVCA 2JZ2A 2HQAA 3VS1A 2HVIA 1DPUA 5GMKh 1CSKA 4R5PA 5ED4A 3I71A 4FYXB 2Y4YA 4FHTA 2R7XA 1VQ7T 4MTEA 3EFRA 2HHSA 3HSFA 3PM1A 5L3BA 3JSCA 3W6KB 3FFIA 1LB2A 2H1KA 2FOWA 3MKWB 5GANh 2A7YA 4OWRB 2XASA 2K3YA 3OS1A 3M9AA 3KLFA 2FNAA 4WX9A 3PTAA 2CUEA 3QMLA 2WB1N 1QVGM 1T3VA 1ERDA 1QKXA 4KHPK 1ZRFA 1EIFA 1Q86O 1RNLA 2OTLN 4DTXA 4M7DC 4OX9K 3HRTA 5E26A 3R6MA 1H92A 5M1FA 2W42A 4CICA 4C92B 3WTXC 2XF6A 4LG0B 4C2UA 4ORZA 1VQ4N 1G6NA 1WHMA 2X1EA 2DILA 5FLXZ 2BGGA 3AO2A 1TU0B 2CH5A 3ULEA 4ZYHA 3CMAN 1QZYA 4A0XA 3WODF 1VQLQ 3VF2A 3CCSI 1ZQ3P 2CREA 1K76A 3HRGA 1LWEA 4IJAA 4XTUA 5KRSA 5EEHA 3C6HA 4DKWA 1Y57A 1K78A 1WXTA 3WXKA 2HQHA 2CGJA 3F8BA 1TWCJ 2P5LC 4DV5K 4FLXA 1LFPA 5AQNA 3UA7A 1CF7B 3LZJA 1ZBJA 3VEPA 4BQZA 4IURA 4C8QG 1Q8IA 4OPHA 4PKGA 4DV4K 5T7BA 4E70A 2XPWA 4EMSA 2QXFA 3A2FA 3MPUB 2QI2A 1D0YA 1VQ5A 4J01A 3U9GA 3WGHA 1WVRA 1XMXA 2JLEA 3KKSA 3M8JA 3M55A 2RI3A 4HYEA 2R5ZB 2DOFA 2KRNA 3M8RA 3CQZJ 1NK6A 2A1RA 2K4BA 3HB9A 2FX0A 3HRUA 4P96A 3C18A 1Y0MA 2CWEA 1USSA 1O3SA 4UVAA 2I7PA 2WUSA 5C2DA 3ZT0A 5IN1A 2HMPA 1X9JA 3EUHA 3QO3A 3KP2A 2FF6A 4YFKF 3W2VA 2JPSA 4EJTA 2EGEA 5IHNA 3VQ8A 1KFSA 4MHGA 2G8HA 2QWQA 1AWJA 2ZF5O 3J8AA 3EGDB 3HG9A 3DOLA 4A69C 2OPQA 1RIOH 2FSWA 3HI0A 3GWZA 1S72I 2AO9A 4LLLA 3G0ZA 1VUBA 2GEMA 4OIOF 2EYXA 3T5XA 3F8MA 1QE1A 1Y96A 4MQ3A 2ISZA 3C2BA 3G10A 4FPAA 2QWWA 3A4CA 1BB9A 4V2GA 5C4XJ 1KC8R 1UHFA 2EV5A 5HP1A 3U4LA 1OCZH 1SKRA 3W2WA 4BRNA 1LWYA 2C06A 4IPAA 2E1OA 7AT1B 1K0SA 2XHCA 4YG2F 4A4FA 4CBXA 1P7MA 4PJJA 2AS5F 4IVNA 4G6TB 5JICA 3DU6A 3VERA 4P1WA 5K7HA 2VBWA 4I76A 4CZMA 3TEDA 4Z4GA 3IH3A 4GKJK 4C0ZA 3CCMN 1MGQA 4FJ9A 3BZCA 3VYSB 3AA3A 1V3FA 1XNRK 4DQ2A 1ORNA 3EYYA 1X69A 1K4US 4OIPF 3TVTA 4C5IA 1TUGB 1VQMT 4GV3A 3M59A 1SHFA 1M2OA 4M3EA 3Q7CA 4IZ9A 4ILGB 1WSFA 2BH1A 4IUVA 4ENNA 2YJFA 4M78G 4CSWA 1IBMK 2Y90A 2KZMA 4M3DA 1DQUA 4KISA 1STZA 2DFFA 3VWBA 1NWKA 3K4JA 3V8JA 3O4QA 3H08A 2KMTA 5J40A 1WA7A 1WSUA 2YUSA 1R7JA 2XAHA 5KQDA 4M3ZA 2E6MA 2EGCA 4NO7A 4JPBW 5LHHA 5J1EA 2A5XA 3KLIA 2I10A 3MVPA 3C6UA 2R5YB 3T8RA 2R4GA 3EUHC 2XAQA 1ZSGA 2LK2A 4XH1A 4A5MA 3PVQA 1JHFA 4AQYK 3GFLA 4CDGA 4KTZA 3H3VK 5LL6S 5IP7J 1DDNA 2LDMA 4Z02A 1S1TA 1TP4A 2RDPA 5BPNA 1Q9YA 5LMNK 4J2AA 2ID6A 4DG1A 2LSNA 4JZ4A 3BEXA 3GW2A 4BHPA 2KW4A 1XG1A 3T3FA 1FBQA 2K5CA 4J00A 3C2GA 2XGXA 2ZJRF 4XKCA 4YDUA 4JI1K 2VODA 4DHYA 5D8LB 3OHRA 3ZQGA 1QQCA 4C3HJ 2CGPA 3K4KA 4BDZA 3BTLA 2X1CA 4O5BA 3SQNA 4K11A 2MMPA 5K5QA 4IHXA 2Y1IA 3KK2A 3ALYA 3PV8A 1IC8A 2EW3A 1YFNA 4B43A 1QVFS 4L8RB 4HX8A 3M8PA 2NNNA 4ETSA 3OYCA 1R00A 1GV2A 1FOXA 4BY9C 4D0PA 3OSSC 3N4MA 3CCUQ 1FYMA 3CCVI 2CW8A 3CCEN 5FKOA 5GAEP 1VSHA 3BC8A 3A5ZB 2FJ1A 5GAN2 4EZ6A 2Z0WA 3M5AA 1XGNA 2VCPA 2WA0A 2NVXJ 1G15A 4HWIA 4ZDPA 4BG9A 2HXOA 5F27A 2YU3A 2IG0A 3L9FA 5CY4A 4ILJA 4CVNE 1J7KA 1T2KA 1R4NB 4D9JA 5KPTA 1N77A 3CC4Q 4KIGA 4CHNA 2JVHA 2XI9A 1VI0A 5K7FA 4V19S 1T6CA 1MWMA 1U1SA 2ROLA 2A5WA 2E2HJ 3EUKL 4CD1A 4CEFA 2QTVA 2F1LA 1MBGA 1OYWA 5IOYA 1QQNA 3LSPA 1ITYA 1B59A 1T3LA 5GAN5 1MDMA 4NXNK 1ETXA 1RKWA 2NS0A 5F0CA 3WQUA 2QKBA 2VT3A 3F21A 3M57A 1P4WA 5IP9J 5JS1A 3A8GB 3TAFA 3C7NB 1GUUA 3WXIA 4QOZB 3TO7A 1EF4A 3HPHA 5CZ2A 1MNEA 1WSHA 2LR8A 4Q47A 4FJ5A 2OQGA 1YE9A 2GTDA 3OYLA 4RWTA 3G4SN 3TOBA 3BFMA 3CWAA 3S1RJ 3PGGA 2O8CA 1JJ2S 3TBIA 1HUXA 3VDXA 3T0YA 4IQJA 4HPQA 5J8CA 3SZGA 1B4AA 5AYFA 4IOCF 3OWTA 2EFNA 3DEUA 2CSOA 2E5NA 1HKQA 1VQNI 2EZLA 4UUSA 3PT9A 5DD4A 1IO6A 3L2WA 3HFOA 2IRFG 2DYBA 4YDUC 1D09B 5JS2A 2O9SA 4A0ZA 2P7CB 2IIRA 3IH7A 1O13A 3HBTA 2V1DA 2DOAA 2ZJPF 1YJWT 3QP5A 3WNGA 2RNAA 2QG9B 5BR9A 3BG7A 4NB5A 1ZC6A 4I02A 2IJLA 5CVIA 1VNDA 3AVNA 2KYMA 4OB2B 1QVPA 2H8WA 2WB1A 1ZA1B 4A3BJ 4B08A 4ABZA 1Z1DA 2KSSA 2ITMA 1R36A 3C95A 3NGZA 2KFDA 2OTLA 4O4GA 4I98B 1HNIA 2YG9A 4ZZDA 1UDLA 3CCLT 4PZJA 4IXCA 4XTYA 3VRYA 5BPMA 4DV2K 5KYWB 2E70A 4FE7A 5KTQA 3GDQA 4A6EA 1BKBA 3H41A 1X1BA 1VQ4A 2O8DA 3VS3A 2HQXA 2GQQA 4C8QB 1NE8A 3TEEA 5JVHL 4FK2A 5FU6B 2DERA 1YJNI 4AU7A 3RIRA 3I56N 4CCLA 5GANd 3CMAA 4I01A 1YX3A 4JKBA 3ATVA 3OL3A 4AIJA 1PRMC 3IH2A 5C3EJ 3ZSXA 1MZBA 5JI6A 3E6MA 2WSCE 2BE5F 3CMEN 4A3DJ 3DKMA 3ABKH 3JR9A 2NVYJ 1E6HA 4CGZA 4OP0A 3WTVC 1Y71A 1J0RA 2F2EA 2HEQA 2QSGX 2JJ9A 2YR2A 3NTHA 2HKXA 2PTKA 3ZCMA 5KRTA 2XSDC 4K41A 2UXCK 3VB2A 1U3EM 1IXRC 4JK1X 3CQTA 2DEUA 2Z5UA 4DV3K 1OMIA 1NPPA 2BY0A 6AT1B 5A2QE 1VQ5Q 4JYAK 4M77F 4ESBA 3PJRA 2O8BB 2PN6A 5A0DA 2YX6A 2ACJA 3P39A 3VV0A 4QQGA 4JKFA 1NK0A 3LPTA 3CCJT 3RYPA 4QVDA 1HMVA 3HM5A 3REOA 2VC0A 3THKA 2CU7A 2MLKA 5EXWA 3FWEA 5B1BH 3ZPLA 4ZGEB 4L9NA 2Z1DA 3CM5A 3DXKA 4M77A 2ZD1A 3I5SA 2A08A 2YLCA 1YIJN 3PFSA 3CMYA 4H0PA 1JT6A 2FU4A 3JB9F 1UB9A 2JN0A 1KU2A 4OOIA 4Z4CA 2V9KA 2HD0A 5TISC 1JJ2P 5GMKi 3ZMSA 3X26B 4BY7J 2C0IA 1GHCA 1T33A 4KTWA 1ZARA 2QDYB 3WTZA 2PJRB 2LH9A 3O8VA 3OYAA 3J80Z 4M7AF 1RLQC 2X4JA 2KVQG 2P9SB 2P9NA 3M53A 1M1KC 1VSJA 3K1PA 4KMUX 2M0MA 4JAXA 2LRDA 3EPZA 2O4XA 1VIFA 3FXQA 1Z0XA 2DFHA 2PVOB 4B24A 2HOTA 1ORKA 4W97A 4M7AA 4DQIA 3RRHA 3OV8A 1KEAA 4CJLA 3VS2A 1KFDA 2W41A 2JMAA 4F55A 1NK3P 4IHTA 5KAFC 3JV3A 4FQGA 4CGIA 2Y9ZA 2FF3B 4FWOA 4B3RK 1Y07A 2FBIA 3NVKA 2DN0A 5FFXA 5DM6L 1SD7A 2LKPA 1IUYA 2Y1JA 4H03B 2KQ2A 1QHTA 2NUTB 4ELYC 3CC2N 3I55I 1BDGA 3LFKA 3QWXX 1JJ6C 3AHUA 1VIEA 1FNNA 1XQOA 1BR4A 2KP6A 3E9FA 4J9GA 4C8NA 3ZQHA 3CCMA 1Q7YU 3L0QA 3RTRA 4BKXA 3DCFA 4L0ZB 2ZBKA 1QWFA 3CUOA 2E6NA 3GVAA 2F6CA 2FL7A 4IDHA 4DV6K 2CW7A 1I07A 4EFHA 1Z7LA 1JGSA 2KXCA 4U0WA 1WJ5A 1W9HA 3I0WA 4HDUA 2RO0A 1X3WB 1RAGB 2Z2SB 4CEAA 1PJRA 5JVTA 3LDPA 1RACB 2HMIA 2V26A 2D0QB 1VQPN 5CK9A 4FJGA 3MKDA 4LSLA 4ELVA 3VQAA 4M77C 1Q81O 3THXA 2NWMA 1ZHFA 2RKIA 1JXBA 3U3YA 4JI2K 4LB6B 4C8QE 4N4OB 1J5YA 2W0ZA 4N76A 4W5QA 1ZYRF 5FLXO 3ZN1A 4A5BA 3S16J 2VLAA 4A63B 5C42A 2ZNZA 3AO5A 1TKTA 1S6LA 4DSEA 2DFIA 4DFKA 3LP1A 2DIGA 4WE1A 3FHZA 4OFEA 4A59A 4KB1A 2EFQA 3B02A 1H8KA 2KRMA 4BI3A 2P9KA 4O8KA 1TWAJ 2Z1GA 2RD1A 4RS8A 3P7NA 2HF4A 1IW7F 3KD1E 4B44A 3UKRB 3QFUA 5J2PA 4DUZK 1MSFC 1AKHA 4WFNL 4FCYA 5CYVA 5E8IA 2LBFB 4JLHA 2DPPB 1ZBLA 4JHDA 4Q48A 1PWTA 3G71N 4M7AC 4H0OA 3N05A 3GTLJ 3O6WA 1ZRDA 1V5FA 4FW1A 1WOQA 4NHJA 1EFNA 2B0LA 4G6QA 1BUPA 5EG2A 1KQ1A 3H1QA 5D4RA 4Y17A 3D5SC 2ZKZA 4ZHRA 4YFUA 1NKEA 2DX1A 4Z4FA 3ASNH 4PL6A 4DFJA 3C0CA 4XSXF 1HPZA 2HL5C 4PGGA 3ML6A 3UPUA 2K3XA 2JA5J 1BBYA 3QYGB 1RRQA 2IW5A 5BMZA 4GFBA 2CQXA 1WZ2A 4JI5K 1IREB 3A8YA 4FOEA 3FXLA 2D1VA 1IGUA 3D2FA 3CCEA 1T6SA 4YY3K 4ASNA 1BHLA 2EZIA 2BEOA 1M5Q1 3E01A 4K42A 1YJNT 1MJBA 4BRQA 5GPCA 3SD4A 4JP0A 4DZPA 3SFMA 4JK9A 4JLIA 1PM3A 3L3VA 4M3XA 3J7YP 3U1KA 5AIPA 4EJVA 1RRJA 1YS7A 4OIRF 2F9TA 4RM2A 3I59A 3RJPA 3H1VX 3M7GA 3AVAA 3EH2A 2CS3A 2JS2A 3JB9J 1OCOH 1EH6A 1OVYA 2NVTJ 4Q0BA 5DUKA 3G6EN 3AVJA 2YI1A 5FPNA 1WHJA 2GTJA 1OQYA 3EG3A 5HROA 4CBWA 3BF1A 2ECBA 2GV9A 4MTDA 3G4SA 1R6RA 3PO5A 3RVCA 3ZMDA 1WH7A 2HGCA 1TUCA 1X27A 4EHUA 3MEXA 1P9QC 1YOVB 2FB7A 1RZ4A 3HKSA 4A4EA 4KHYA 3VQ7A 2HSEB 3ZT4A 2E12A 5BPDA 1TNTA 1B72B 4JRPA 4ELTA 4HEA2 2JQ7A 4J2BA 4XAXB 3AVHA 4FSVA 1LAVA 1M3CA 3KYLA 2I5JA 3EEQA 2DA9A 2HNDA 1QZ5A 4FIBA 1K8AC 3BDLA 2KRFA 2ZCFB 3DBRB 1IXDA 1GXIE 3FMRA 2R5AA 2QEXI 1KD1R 4DMNA 3HJEA 4LOCA 1OFCX 4LDVA 4ZNXA 5HNHA 3BZKA 4HHTA 3PO2J 4M7YA 3K1MA 1N8RO 2E2NA 4DYCA 2VQLA 1VQ8T 1X58A 4QKUA 1XTDA 4ESFA 5E1ZB 1A31A 2FXAA 5LBQA 3CCQN 3K5LA 4OB0B 4M42A 2X4HA 3LYIA 1BA1A 1RC9A 3DEWA 2OTLQ 1YTAA 1TTHB 5M1PA 1M4ZA 1OKRA 3TPQA 4TV7A 2NRTA 1RTJA 1SAXA 3SK3A 2YNFA 4G6DA 1WQ2A 3MKZA 5GMKl 1YVUA 2VWBA 2R7UA 3CJBA 4QQDA 3BLYA 4NQWB 1VQ4Q 3UIQA 3LQQA 4DTRA 1GV5A 1XQSC 3AVMA 4M75F 1XSDA 4PSXA 4N4GA 1C0MA 2HHTA 4L9VA 3ZSVA 1FYLA 3CMAQ 4IO9L 3I56A 3J81K 3P1GA 3E1SA 2BXZA 3ASKA 2QA4N 4HX7A 3MP8A 4PJOF 1HQEA 4C8KA 4M75A 3CMEA 1WI7A 4KH1B 4M7DD 5FRNA 2EA4A 3V9ZA 1RAAB 1HCRA 2LF8A 3EL2A 2YLBA 4NBQA 3F6VA 4UQGA 4PJOA 2IS1A 2DVJA 1TG0A 4XU2A 1X9WA 2ZPFB 3FXRA 2NRRA 3NE6A 3LWMA 4CW7B 5BS6A 2G3RA 2X6NA 4EIKA 5DEQA 2WAFA 3T7ZA 2VUBA 4W5TA 2LLKA 3IDHA 2F5FA 2H8RA 4IIOA 4UVBA 3TSWA 1PU8A 2F2XA 4BRCA 4WCEL 1RT6A 4RDUA 5JVGF 1VQOI 3D2EA 2ZXWH 1J75A 1KQSP 2PQ8A 3LX7A 5I11A 3LSHA 2WTEA 4AIAA 1X6BA 2PBDA 4BHCA 2W40A 3AVLA 2GIVA 3ULQB 2YRVA 3AG2H 4CZEA 1M1KU 5F2RA 4IUTA 3VEZA 1V5EA 3HSCA 4KUMA 1GCQA 5BR8K 1WI9A 1GLAG 1RBUA 2D1XA 5EZGA 1V55H 4I6ZA 4M3UA 2RVCA 5AQWA 2WC9A 1FZPB 2OCEA 4JD2B 2R7VA 2IAJA 2DTUA 3M07A 3FDRA 3OIQA 2W10A 2VN2A 3JB9H 2LY1A 1R22A 1JQQA 4GVEA 2IC3A 1IV0A 3JRAA 3CJQB 2IT0A 4H5VA 1Z77A 2J5OA 3E19A 3CHWA 4OPKA 2PUKB 1HDPA 2BW3B 5JR3A 4G8XA 3NH1A 4CZCA 3THWB 4EJWA 2NOLA 2X74A 1ZLKA 2E1CA 1LNWA 2DF6A 2UXBK 3EG2A 4DV1K 1D4XA 1WQ7A 1QVFA 2D5RA 1NG2A 1Z6TA 3FZHA 1BI1A 2DODA 1TC3C 3QLHA 5HCKA 3P5JA 2VB6A 1HU0A 4M75C 2K6DA 4NNJA 1GFCA 1EKEA 3CC2A 5DK5A 4KRFA 3LM2A 2JTEA 3JAMK 1ZSZB 4Y92A 1AHJB 3CCMQ 1RRSA 1E3PA 4PJOC 5EEAA 1PSEA 1WAFA 3T1YK 1FSEA 1D1BA 3UATA 3QEIA 2NS8A 2LSOA 2R57A 5LLQA 1I1SA 3K2AA 1WX6A 2OBPA 5HKCA 2EFPA 2CQQA 2MK5A 1FK9A 4F2SA 1NGGA 1VQPA 4N9HA 1U6GA 4OINF 1OI1A 2JSPA 4OMPA 4RG2A 1SEMA 2MD0A 1F1BB 2ATCB 2JM8A 4ZDOA 3OYFA 5ILSA 1T03A 3I64A 3K4LA 4N56A 1I6XA 3K5MA 3LCNA 3LW5E 3REAB 2QM3A 2JTMA 1JJ2A 2DJQA 1ZGJA 3QZ5B 5IT9Z 3P8BB 1GCQC 1FMWA 4GKKK 4Q5SF 4LMYA 3OYDA 2ZPEB 1VQ9I 4Z4IA 1TZLA 5D6EA 3P4IA 5LGNA 4A93J 4EJZA 1NJIO 5DCMB 3DLMA 1TSFA 1ZAOA 3O9TA 4O55A 1EWQA 4C1NK 4PGHA 3BROA 3QBWA 2QGFB 2PVGB 2DMTA 3D0PA 1SFOJ 3GBTA 5IPAA 1BR1A 3EQLF 3M9QA 2LTOA 4RTXA 3CJAA 2TDXA 2NRXA 2LYCA 1YITN 2YUQA 1I94K 2DTIA 5J2NA 2VV5A 4NL2A 3G71A 2VOPA 5HK3A 2RNGA 5FPMA 1WSGA 2X9DA 3V81A 4HV5A 3JCMP 1TWBA 3IUOA 4C5HA 5LEKA 1BK2A 2VKHA 1VSIA 2F5KA 1BISA 1ZXOA 4XRMA 1P7JA 2EJ9A 3OYIA 1AEYA 2VG6A 2ASPA 2DA2A 4A3JJ 1Q82O 4HZFA 5F1JA 2RE2A 2VI6A 3OQ5A 3E66A 3R3LA 5LMUK 2A3SA 3AKZA 3CCEQ 4HNTA 1R0AA 3RPQA 1QPIA 3K1NA 4Y13A 1LJOA 1FOKA 4LDWA 4EMGA 1WFXA 2M8GX 4UV8A 3OYBA 4YHHK 4MDXA 1E6GA 4IEIA 1R0BG 4IJNA 5DUIA 4GBQA 3J80O 2EPFA 1Z6RA 3EFOB 5GAOn 3AAFA 4OFAA 2ZWHA 4L18B 3TWHA 3SYZA 2YHBA 4HF2A 2IGNA 2RA2A 2QDLA 2MIOA 1TT5B 3LWHA 1YHQA 4JRQA 3MEGA 1F9NA 3HOVJ 2DMPA 3IC7A 3AO4A 3VQ9A 1D5VA 1Q82C 2GFAA 3OTOK 4E7LA 1K6YA 1LDDA 2Z33A 3IQLA 4C1NI 3H9QA 4BJ6C 3SNNA 3G6EA 4KULA 3E9OA 4WXDA 3QHSA 2KEAA 5CKHA 8AT1B 1S6PA 2GIZA 1WPKA 4CERA 1Z25A 3VGMA 3CZ6A 4DIQA 2E35A 1IHVA 5DV5A 3G4SQ 4IO8A 3CXCS 1NJZA 1HPMA 4XBFA 4M3TA 2DDBA 3LDSA 3GZ5A 1Q86R 1BO5O 2PMUA 2LP5A 1K8AU 1G3SA 3M5RA 2ISYA 3PIOL 3VENA 1FOWA 3K70C 1VQ6T 1WSIA 3CCSN 2R7RA 1S5LC 1Y1VJ 3FIWA 2O88A 1TAUA 2DTOA 3VW4A 3ABTA 4XKWA 3OW2S 4NC7A 4B09A 2M30A 2EJFA 2JRTA 4CF2A 2AIRB 1MMAA 1U5TB 3SBTA 3LWFA 1F1ZA 5GADP 1DTQA 3RR7A 3QDRB 3OY9A 2BKDN 1IV8A 1DP3A 1AOJA 1NM7A 3NF9A 3F0ZA 2KISA 2MI6A 3HXMA 1IJWC 1ESVA 2IS4A 3IRQA 1G4DA 1MUDA 3AVCA 4UVCA 2CH0A 2K57A 4QWQA 2A07F 5CVRA 3HBLA 1JXSA 1W4MA 1MV0B 2V8KA 3L09A 3VEVA 4DU3A 4MO4A 3AG1H 5FLMJ 1YQRA 2JVGA 5AR0A 2CT3A 1MMSA 3DPUA 2ZPHB 3C65A 2VC8A 3FKJA 5SZTA 2A1SA 4YIRX 2J6KA 2OTJT 3O5BA 2ZJRL 4RAFA 1M90O 4H5WA 4DSLA 4HKEA 1SVOA 1NGIA 1ZGWA 4ON0A 4WFBL 2H1LA 2HQNA 3F3XA 1UFMA 5HRNA 2XICA 2QA4A 2XPVA 1TWGJ 4Q4ZF 3PSIA 1B8IB 3CMEQ 4KUDK 4FL6A 4FTHA 1BYMA 5C25A 2MOXA 1ZR2A 2NOJB 1S72N 2MH9A 4XOTA 1NJWA 2BZTA 1WJAA 4KGZB 2Q36A 2E36A 2O8KA 2LY2A 1U6ZA 2WC2A 1N27A 4M7DB 3CCJQ 2XHIA 2YUOA 2EINH 4C8OA 3VUZA 2YHAA 3FLGA 4EW4A 4IL6C 2L0KA 2EQKA 1ZH5A 4KH5A 4OKJA 5AQJA 2L7KA 1N3AA 2ID3A 4X34A 2KHOA 4E7ZA 4FOIA 4J9BA 4HLXA 4E7IA 2JNGA 1M3HA 1GBQA 1JI8A 3FBNB 1WWXA 4BRPA 2FRHA 1U2VA 2X0LA 1HNZK 3H9JA 2VIXA 4B8XA 2Y0SN 1FT9A 4HCZA 4UNOA 2D4WA 1YIJQ 5AQFA 1MMGA 1GLBG 2BY2A 3CO6C 2E1MC 1G3YA 1GVJA 3FFKB 4DF4A 5CVUA 5GANj 5KCOA 3NAEA 2RGVA 3M58A 3W6JB 2XSJC 5GJWB 1E4GT 2HBPA 4B1XB 4ZYAA 1K7AA 1SAZA 2P9UB 2ZC2A 2RHIA 3ZYYX 1YI2T 3A5MC 3WG9A 3QYHB 2HZDA 3VS7A 4KREA 5FJ8J 3FRNA 3VU3C 4HNUA 1PVSA 1NHAA 5KPZA 3JRIA 1DGKN 2O9VA 2FQ4A 3OS5A 4BQQA 2QYOA 4JI4K 2FNPA 3J7ZI 3ISNC 1U2WA 2DOEA 2R7SA 1AT1B 5D5UB 4XU1A 3G73A 2HKNA 2EV6A 3MFKA 2ETJA 1LCKA 2EB7A 5KYUA 4I99C 1WKMA 1V4RA 3CC2Q 2ZJPL 3LP0A 3M8EA 2OA8A 3DU5A 2JJ7A 1FP1D 2D8HA 1SS6A 4PJNA 3HOTA 5IY5H 3M3ZA 1UG2A 2RNJA 1GT0C 1H88C 4BS9A 3ZQQA 1DPRA 3EYZA 1ON2A 2OAZA 1RDWX 2I7NA 5HDNA 2IGKA 5LJ5j 5CHIA 2JMCA 3VGLA 2VVKA 1B34B 2CH4A 2VJ5A 1L0OC 4J9DA 3VQBA 2HAXA 2EJRA 1VQKQ 4ISFA 4RB3C 4XEIA 4K8ZA 3H0HA 5D5WB 3RMQA 4PWDA 3ULEB 3M0RA 1O7LA 1K8KA 2K9LA 3I4MJ 4BBSJ 3FMQA 2COWA 2A6EF 1YLFA 1NGEA 2GA1A 3CCVN 2ECCA 3OL4A 3BP8A 2L9VA 3WE3A 3J7YJ 1K78B 1KQ9A 2M2EA 1WB9A 3TAEA 3QZ9B 3D5RC 4DOWA 3LWLA 3ABUA 4O44A 2KFZA 1G2HA 4CCOA 5FWCA 3LSKA 5AZJA 4LF4K 1M27C 4OF1A 2P81A 5AQTA 2H3GX 4AUXA 2M02A 3CWSA 3CBPA 1VQMA 2EK5A 3LH5A 3ZX3A 1YITA 4M77D 2R7DA 4M7DE 1J5EK 4M6XA 3KK1A 1QRYA 4BQAA 1W0TA 2M0YA 2P51A 3E7LA 1A5XA 5KE2A 2IA2A 3U3GA 4J9IA 4HA8A 2E5QA 2DO3A 3OSVA 5H20A 2YRDA 4OMMA 4DTOA 3M0UA 4BRMA 1CQTA 2WONA 3K0LA 4HCKA 1U5SA 2RN8A 5D8KB 3VSKA 1K9MO 2OPTA 2Y69H 1YT3A 2GELA 1NYFA 4F7UG 4M6YA 2JA7J 1IDYA 1IBLK 1VQNN 2OX7A 2MD5A 3CC7I 1OPKA 2IVOA 2QM1A 2GGRA 1YX5A 1O57A 1KG1A 1ZG1A 2NOGA 1SC7A 1HA8A 2DNUA 4A3GJ 1VQLT 5B8HA 2VWJA 3QYEA 1NK2P 2W57A 5KNLA 3F10A 4P5NA 4EJYA 4ZGDB 1QHGA 1MBEA 3OYYA 4IBNA 3JS6A 1OJLA 1U8BA 2A61A 3OSGA 3SAHA 3OS0A 2VQGA 1S7EA 1JCEA 4JI6K 1P92A 4LB5A 1WEFA 2Y31A 3QPLA 1SL0A 3K7AJ 4MIMA 4KGXB 3G6EQ 2C0TA 3V1QA 2OZUA 4Q5VA 2QWMA 1LUJB 3E5QA 4J9FA 1UEBA 2P9PA 4BJ5C 2Z99A 2GBYA 4LF9K 2P84A 4M7AG 4WCIA 1X1PA 2D0AA 1RNHA 5BN9A 2F8TA 2A28A 4AFSC 1K73R 2JPBA 4E7SA 3DKYA 4A4KA 1N9RA 3M1FA 5H1SQ 5CQGA 1T0JA 2RK2A 3O8HA 2ED1A 1DEJA 2X3XD 3CD6I 2FSKA 5GMKe 4BD3A 4XLFA 3CCSA 3SPYA 3D5LA 2KMUA 3ZSYA 1HLUA 4R55A 2HVQA 3RR8A 2F2WA 2BE7D 2QLZA 2Y2ZA 3WXMB 2NXNB 1FLIA 2YHYA 1YJ9I 3P8HA 5GANe 1KG2A 4BDPA 4KN7X 5AIQA 1UOCA 3CERA 2KDZA 1GLFO 4P55A 2XAUA 1WHKA 4NOYA 2GM4A 4CZKA 1QVGS 4B9TA 4CHQA 4L3QA 4GW6A 3CCQQ 1XS9A 3KBGA 2M34A 4HBLA 5JFRA 4XU3A 5DM7R 3P9CA 5AQQA 5AQHA 1JCGA 1P4AA 3TDZC 3L1AA 4B9MA 2K7LA 4D5FA 2EFOA 1TYQA 2DMUA 1T08B 2YX7A 2F4VK 3PX6A 4WFAL 3ENOA 1LW0A 5HNFA 1B9MA 4NCAA 4J9EA 4ZYDA 4RM3A 4FLTA 5KE3A 3B6CA 1O3QA 2FYKA 4B9XA 5CQEA 1WBDA 3QRFF 4F17A 1WHGA 3MMYB 4EM0B 5C6SA 5KGWA 4JYKA 3UA6A 2CFXA 2E71A 2QA4Q 3LSMA 2OAUA 1X4PA 2EZHA 4KT6A 3LL3A 1YJWA 4HT9A 2XROA 4FT2A 2C6YA 4FYYB 3ZMVA 1S72A 3H3ZA 2MGQA 5DY9A 5E8GA 3KK3A 2YRCA 2KE9A 2B8AA 3GEZA 2RJFA 1TUDA 1SVLA 2M8EA 1AWXA 2A42A 2NRZA 4IG3A 4F3TA 4IFYA 1BI4B 1RDBA 1ZELA 4RMOA 2M0OA 3HEFA 4B3XA 1N6AA 4YNQA 3JCMh 4O0IA 5AQOA 1EWRA 2QBYB 4XL9A 1LE8A 3I55N 4GO1A 4PUSA 2ZXIA 5AQSA 3ZX0A 3QESA 4BRAA 1MMDA 2MBFA 4XLNF 1VTNC 1BI2A 4KT5C 1MDMB 3GFMA 4CJ5A 1MUNA 1XJWB 4VUBA 2KKOA 2Y0SA 1RT3A 3ZT2A 3JCMb 1A35A 5JLHA 4II3A 3EE8A 2V7YA 2JWLA 1ON1A 4B3OA 5D5VB 4B9QA 3X20B 2O8CB 3K9TA 1K73U 2AP1A 4KGVB 5CIUA 4FSSA 2ITGA 1GRIA 2WBMA 1BR2A 4I2OA 2LNHB 4CFDA 5C4JJ 5HY6A 3HHGA 1J3TA 4UUSB 3BTIA 2NUBA 3L6QA 3F9MA 1S3XA 2K40A 3CYMA 3TP3A 1ZBHA 1JUPA 1WGXA 2V9VA 2QUFA 4DTNA 1PP7U 1TQPA 2K2MA 4BROA 2DXTA 3ZSZA 1UELB 1EXQA 1VFCA 5J1RA 4J2EA 3SBGA 5ICFA 1Q81R 3CCUT 4HVJA 3WVEB 3WVDB 2VJIA 4MMLA 4FZZA 4H0TB 2JVVA 5L23A 4CZJA 1C6VX 3JRHA 4MNUA 4C92F 5FO5A 1MNDA 2X85A 4AHCA 2PFUA 5LHIA 1KG6A 2BTTA 5J3BA 2Y30A 5CQXA 2EX3A 2JM9A 3H6ZA 3JCMJ 3BG6A 4KKOA 3CF2A 4AD9A 4GYGA 4M3WA 4C92A 3GX4X 3CC4T 1ZA2B 4A4HA 4O5VA 2W4SA 1RAEB 2RAEA 2P9IB 3V8KA 1QMCA 2W6KA 2O8DB 3OR2C 1CZBA 2BZ8A 3IH4A 3CPWS 2L8DA 1QSLA 1XGMA 3C4SA 3S93A 2RHUA 2Y0MA 1ETVA 2LRQA 4B3SK 2F5EA 3VEWA 2WY7Q 1ZG3A 4QT7A 1PP8F 1QVFM 3CCVA 3R0JA 1I8FA 3CXCA 2FZKB 1KQ8A 1BC8C 4JRKA 2BVMA 4CFCA 4ZN3A 1SPKA 2P9LA 3L2ZA 2KT0A 1P8ZA 1KFZA 3WGGA 5LJ3j 3H1CA 2KTQA 5DM6F 4UY8O 3GPLA 1B1BA 1V29B 1R1TA 3SZTA 1K4TA 3QJ6A 2DK8A 3IAS2 1WHLA 5IXFA 1FIAA 1DIZA 4M45A 5J1YA 2M1HA 4BACA 3FZVA 1YHQI 4R1HA 4EQQA 1GDTA 3KPHA 3OW2A 3E9PA 3CJ1A 4JN4A 1K6OA 1QHHD 4RKUE 3QG1A 5DLQE 4FVMA 2EYZA 1YITQ 2JTFA 5DLOA 4JKAA 5ELZA 5ICCA 1IJJA 3JCMc 2VXZA 3B73A 2I5WA 4FSXA 1SAUA 1QLYA 1I5ZA 1XC9A 3CJ9A 3DXKB 2IEKA 4JK8A 3BZ6A 3FJ5A 3O9QA 5D6YA 3JTHA 4R8HA 4PJOG 4KMFA 3S2DJ 1D3BA 2QKKA 2Y4XA 4FYVB 3CJRB 4E1MA 4DU1A 3IG1A 4I09A 3SPZA 4FL9A 4CJTA 5D6WA 2BY1A 1YAGA 1U9OA 3HOUJ 4MZTA 1JJ2M 3GIBA 4BXFA 4XRSG 2XAFA 4FK4A 3DEEA 3SHWA 3EGDA 3C1DA 2DL3A 2P9NB 3IAYA 5GAMd 1O7FA 3ENHA 1Z7UA 3I35A 3PMIA 3NWSA 1VQNA 3KFVA 1QHAA 1JJ8C 2NNYA 4C92C 4A3CJ 4CI0C 2X6YA 2GXBA 3F8FA 2O4XB 3RMCA 4H5RA 4UUVA 5GADJ 1V5GA 2QEXN 2CP5A 2HL3A 1UAXA 1HJRA 2GCXA 4M7AB 1PKTA 3FEOA 1VSLA 2KR3A 2MYSA 2F69A 4MFBA 2XPUA 3EG1A 4E7HA 4H4MA 3CCRI 2GA2A 2R7QA 3Q1JA 3R6OA 3E9GA 1H8AC 2NRWA 2PJPA 2BHYA 2JT4A 5EY4A 1PVEA 1RGIA 3PVLA 2ZGZA 3VUBA 4YIIA 4RCBA 1SSFA 2KDSA 2VQFK 2RV8A 1N8RR 4IEJA 4EAHD 3J81Z 2E65A 3UKUB 1FBUA 4EVIA 1E7OA 1MJAA 2CH6A 5J26A 4H0XB 3RTVA 3B6AA 1HYSA 1JTXA 4NB4A 1X19A 1VQ5T 2GOXB 2E2OA 2XK0A 1SKWA 1OU8A 3TABA 3RSNA 4EGZA 4XTXA 4BL0B 1JKPC 3CPWP 4KHQA 1YJNA 1Z3YA 1VQ7I 1YQLA 3AVGA 3SV3A 2EWSA 2ESNA 1OISA 5FPEA 2HEOA 1UG1A 4CJQA 5AONA 1YQAA 5IXBA 3TW6A 5AQKA 3CCSQ 1XMKA 2KZZA 2QQBA 3WTSC 2VXEA 3JCMQ 2IBDA 2YT6A 3MMVA 3RBBB 2KY9A 1NU0A 4H5NA 1RT4A 3THXB 2CKKA 2DMQA 2CYZB 3TO6A 5CKFA 3VN5A 3G1OA 3GLXA 4KYWA 3OYEA 5I2SA 3U1DA 3OJSA 2BYVE 1OH8A 4CD3A 3BW1A 2Q0RA 4WF9L 1XSVA 3I4PA 2P9KB 4JKEA 5BRHA 2QAZA 1RTHA 1K0XA 3H5RA 2HYFA 3QKJA 2ECZA 3KTUA 3K70D 4JI0K 4AHRA 1VQON 2NZTA 3K0SA 1AKHB 2LVSA 1KQJA 4LN2A 4RB2C 3ZQCA 2V6CA 4ZJZA 5C0YA 1TKXA 4JHDB 4LF7K 1R8OB 2FPFA 3QERA 2W25A 4RUGA 4BE1A 2J5PA 1PU6A 1WJRA 2MWPA 2VBYA 3PNWC 3VGKA 3WHCA 2NLXA 3MCAB 3EHRA 1WCMJ 2VBXA 4JX6A 5A0GA 3NNQA 1KA8A 1YBYA 3CETA 2E2IJ 1S7OA 1C1CA 2DPUA 1VSEA 5C0MA 1X3NA 1FC3A 1EX4A 1NGDA 4L5EA 1L3LA 4I9LA 1T95A 3A02A 3F2KA 4HVVA 4AHSA 4I2QA 1S72Q 1U06A 3QEWA 2DJNA 4C0GA 4HT8A 1NJYA 3F9KA 1RCHA 2UXXA 3HL8A 3GZ6A 3JAMZ 3U23A 3OOPA 3TO9A 3M6GA 3TSUA 2AT1B 4CK3A 4DS4A 2HQEA 3O9RA 2RN2A 1ASVA 3MEEA 2FF4A 2E2PA 4XLCA 2HQRA 4PKIA 1U9NA 5HRSA 2M1BA 3TOAA 1A0NB 4JBAA 3DB3A 3MN9A 3S2WA 1NKUA 3I59B 3DQVC 3I55A 4E9FA 3R61A 4BR5A 4OB3B 4G9YA 2Z9OA 4M7AE 4DR7K 4HW0A 3EYIA 3QINA 4FT4A 4DBRA 4XLPF 1SRMA 4X9DA 3DWLA 4GGGA 1PUEE 3D4VA 2VKVA 1U49A 3RYRA 1KK7A 3BY5A 5F1XA 3V9WA 5FLXE 4J5YA 4BQLA 2UUAK 3BQZA 1F4KA 4LH5A 5AQRA 1FY7A 5GAOm 3I8DA 3RKYA 4B23A 1MBKA 1IG9A 4CCMA 3GXOA 5I22A 4OGEA 4NUBA 3RWUA 2RI5A 3KFWX 1UA1A 5L3GA 1ABOA 4DS5A 1JXMA 2D2WA 4IKFA 1XB4A 1WGSA 1ZBSA 3HOWJ 3JCMd 2F96A 3WNEA 1BOBA 2XVCA 3KLEA 2KYBA 3Q7BA 2DAOA 3VTHA 2BE2A 3WTWC 5GANg 1NKBA 2ENMA 4I2PA 1IRXA 1W5SA 2L0AA 3ZBDA 4G9ZA 2K9QA 3Q0UA 3GF5A 3H0IA 1KO9A 1M1EB 1VQ9N 3T1HK 2O8EB 2W85A 5F6FA 1OOTA 2UYTA 4KN4X 2VXFA 2HBWA 4CI6A 2EVRA 2E7WA 2WBNA 1HJDA 3A2KA 1ZX6A 2FPDA 2ZFUA 3M0SA 4BB7A 5KQ8A 3BTJA 3KP4A 2QWPA 1JL2A 2OPRA 3SV4A 1VQMI 4F3QA 3LDLA 4YFNF 1J9IA 3MEWA 5FD6A 1U04A 2RQQA 2Q0UA 1KC8C 1NJIR 1SL1A 2LCLA 4C8QF 2E20A 1UCRA 2J6OA 1HKCA 4N4NB 3HOZJ 1J5OA 4H0YB 2KIFA 5KN8A 3FF5A 3LSJA 2R7TA 1KJWA 1KAXA 3SWNA 1Y0UA 4XRFA 4C8QA 3LAKA 2YNGA 1BC7C 4U87A 4CEOA 1HKTA 4EIAA 4OMNA 3K2PA 1W5TA 3CFOA 3DM2A 1XCBA 4A5NA 3CCVQ 4M75B 2V8JA 4M3YA 3V9UA 4DSJA 2YDLA 3QB0A 2FSJA 4L5JA 3V1OA 3TQ7P 3S3OA 2RREA 2XRIA 3W2AA 4PJLA 3K4CA 1FIPA 1Q82R 1P90A 1GLCG 3A5LC 4QPOA 4OGCA 4PJOB 2NS7A 2M45A 4UV9A 5J1UA 2ASOA 4CBUA 4FVUA 4EM1A 4CCNA 5DM7L 3RMAA 2PYJA 2LJ0A 1RR7A 3TMOA 3X25B 1KIKA 2M51A 2R0QC 3TREA 5AN4A 3TGNA 4MFEA 1BU6O 2PFBA 4QVZA 2O8BA 2FRYA 3SJJA 1TT0A 4YOXA 3ABLH 3SLCA 2DFUA 2J6FA 1NMNA 4YOYA 3RKXA 3FJPA 2XV4S 3AVBA 4AIDA 2PQWA 2E5KA 1KQSM 2L3SA 4KH4A 3KLOA 3L8BA 2Z3YA 3V7CA 1V4TA 1JE8A 1QVGA 4DLEA 1C1BA 1OQKA 2AXTC 3MX5A 3WTTC 4JQFA 4D7NA 2B7EA 2BTFA 1HLVA 1HBXG 1IB8A 2MLGA 1MJ9A 4XM3A 2MF2A 5CE3A 1KZHA 1S1VA 4A57A 1UGQB 2STWA 3OH6A 2MCNA 3VQ4A 3KX2A 2OTLT 4M9SA 1RADB 3M8SA 4R56A 1YYVA 5BREA 2P9SA 1ILYA 3BGRA 2HDAA 1VQNQ 2GWKA 1R71A 4RTYA 1HW5A 1VQ4T 2AA4A 4L5GA 2ZCWA 4J8OA 2OF7A 5LJ5h 2DRMA 2QEXA 2X6WA 4M78F 4QPQA 3SAGA 3BDDA 1NBEB 3SWNC 2L54A 3CMAT 5BPIA 4C8QC 3HTSB 3QBYA 1BA5A 1H1VA 5E3MA 4LG3A 4M71A 4CJWA 1BG3A 4E7JA 3V4IA 4XLHA 1B9FA 1T44A 2K86A 3HZJA 4AM7A 5GAOr 3C6AA 4M78A 5L3DA 1U1TA 2GBQA 2NUTA 3WGIA 2DA5A 3RDVA 2KHMA 2VJ4A 4HDVA 3UB5A 2JA6J 4MZPA 3D7SB 3GF2A 5E41A 4E9EA 2XIGA 4NC8A 2WTUA 1OVQA 3QEXA 1C0UA 1Z26A 1ETYA 2R7OA 3DLRA 2CZ7B 1OYIA 2KI7A 4MDBA 4DBFA 2K27A 3SEQA 3JRDA 3IFRA 4XTWA 5L3CA 3CIPA 4AH9A 2VWKA 1F5TA 3NH0A 2IDOA 2XB0X 3MAQA 1L3VA 4B9SA 1U84A 4FO0A 1Y8RB 3MZHA 3AAPA 1WH5A 2DTZA 4BRKA 4FPBA 1YJWI 4LF8K 2HW3A 3DLGA 1D0ZA 1WJQA 4E0DA 2N8GA 1RKTA 2DBMA 1FXXA 1M90R 3L4IA 3ZEUB 2GQIA 2P7VB 1Z21A 4L59A 3U9DA 4CF8A 1W70A 3QEVA 1Q7YO 3IL2A 1NLVA 2O61A 4CE9A 4E6KG 4DV0K 3CCLI 1KVBA 2K9NA 1KVCA 4N0BA 4Y52J 4CZIA 2ADUA 1WBBA 4ZTFA 4M75E 2VUMJ 4ESRA 2GLOA 4HVUA 2LVMA 1L3SA 3UKRA 1JLCA 1MNMC 4HSTA 2H6BA 3JTGA 5C2FA 4A3MJ 3ATUA 2A40A 3OIPA 2CP3A 1VQOA 2LBFA 4CH7A 4B1ZA 3JREA 4HV6A 4RW6A 4HNVA 4PJOE 1BIUA 1U45A 3VOVA 4KFCA 2F48A 2NAZA 2LJ3A 1EJ9A 3FLCO 1RAFB 1SHGA 3G1LA 1MKMA 2LMJA 1WXBA 4BR4A 1TUUA 4U7BA 1NJXA 3BOQA 1I5LA 2CFOA 2TRTA 3ERED 2DD4A 1YVNA 1W2BS 5D7UA 3PIOF 4M78C 3ECOA 4XU0A 3C2HA 4H5TA 5D6FA 1Q7YC 1UECA 3MDQA 2DBBA 3CCMT 5BN8A 4M9ZA 4X9CA 1X4OA 4LNPA 2XHBA 3LAJA 2FUG2 2LKXA 2X78A 4JJCA 2I8DA 3PIOA 3QEPA 2RQVA 2A6AA 1TAQA 3LA2A 1I3QJ 1R58A 2LKSA 5J4YA 4KHSA 1RETA 1QO0D 4KV8A 3I5RA 5D6XA 4GNIA 4DZJA 1SFKA 3CPWA 2DMNA 3BY7A 2K79A 3OBWA 5M1QA 2L3PA 3P9KA 3CCJI 3RUXA 4BG8A 4DYRA 4XORA 3WTUC 5GANf 1NKCA 5D3GA 2DK5A 1IN6A 3SDZA 2NVUB 4K2EA 1SD5A 5FFZA 3I55Q 2ZMEA 3GBGA 1K9AA 1HJOA 3NRVA 1REVA 2DIQA 2L3QA 4A3KJ 4CXFA 4LFBK 4CA0A 3MWPA 4HOBA 4A4GA 4TVRA 2KIQA 3SEZA 3FC3A 1XNQK 1NEBA 3S32A 3KXTA 4BYYA 5J3LA 4KTQA 1WNLA 2AQFA 3KEYA 2B86A 2PUOB 3HVTA 4AWXB 4BHBA 2XY8A 3JYTA 3JCMX 2HOSA 2BE9B 5AQUA 4MFDA 3H46O 3IHUA 3S2HJ 1LOJA 2G6FX 2JWKA 2Y48A 3J81O 3VQ6A 1QPMA 1BIBA 2RJDA 3CO7C 4KHNA 3F73A 1BA0A 3TKYA 4Y33A 1UAAA 3P83D 2ROTA 1A6IA 1MDUB 3DLAA 3DLLL 5EGOA 2V52B 4PL7A 2ESHA 3WT0A 1VQ9A 3HP9A 4RTFD 3QU6A 1X9SA 2LCSA 2NVQJ 5FB2A 2VYPA 1KC8U 2FOKA 1YCYA 1YWPA 3NVMA 3CCET 3K5OA 3KWGA 1PUFA 4NYNA 2IA0A 3HK2A 1YWOA 3K69A 4IOAL 4BI8B 1UWBA 2V1RA 3SFZA 4JV5K 3IWFA 4D1QA 3UDCA 1DGRM 3CBMA 1ZUUA 2PU9B 1CGPA 5AQYA 3J7AP 3ZX2A 1TKZA 2IS6A 1O75A 1T39A 4D7MA 4A62A 4F4KA 2QTDA 3J80E 1W2BP 5IAYA 2XKOA 1VQKI 1C0WA 4F3OA 2ZMEC 3P8DA 3TU5A 1OX9A 4AT1B 1HC8A 1QQJA 3VYUB 1ONVA 2HPIA 2O3FA 5M3FJ 4P5OA 4C9YA 3E6CC 3CC7N 3G4ST 3T1AA 3O3KA 3VS5A 2RI2A 3DTEA 2QQAA 3U9ZA 4LDUA 3DF8A 1K9MR 1LVKA 3ECHA 1ZBXA 5LL6Z 2DDAA 3TANA 2KIMA 1SQKA 1W7PD 2CQKA 3X2QH 4JS5A 2YCHA 4M3FA 4DQSA 1HSQA 5J2QA 2HTJA 3GLLA 3NCIA 1IBKK 4WCGA 1M8VA 2CP7A 1B9NA 1C0FA 5CR4A 3FBIB 2BXYA 2COMA 2DT7B 3ASOH 1UZCA 4M9XA 2LD5A 1OX8A 3M54A 1SZ2A 4FWMA 2YUNA 4GMJB 1OPLA 1MH4A 2ABLA 3QDFA 5K5RA 1FW6A 2BIVA 2CZ0B 2CQ7A 1ZR4A 3E5XA 2CRGA 1P6RA 5C44J 2EPDA 2M16A 1GLLO 1KHCA 3HSBA 3FX3A 5BOXA 2ZAEA 2A36A 5ECAA 4LFUA 3DXMB 5C10A 2H8HA 2P6SA 4HX4A 2JT1A 3GOIA 5B3SH 2KQRA 3Q3SA 2EAYA 3CXCM 3NPFA 5KYYA 1LWFA 5A2QK 2CW0F 2PG4A 4HCBA 4JD2A 3CD6N 4OMZA 1QVFP 1EH8A 5IT3A 4Z4EA 4BRFA 4XKVA 2CT4A 5K7ZA 3CM6A 4CZZA 3R2XC 3FK6A 4NL3A 4HVWA 3THWA 1YJ9N 3DP7A 3OW2M 2MA3A 2XKOC 2CUZA 3I56T 2R3SA 4LH4A 3FXOA 1N78A 1E17A 1K1ZA 3LP3A 2O8XA 1MBHA 4IQ4A 1SF9A 4ENJA 1LOTB 2E1NA 1XNIA 3GE1A 3SHFA 2X4XA 1HNXK 3PO4A 3CMET 3QBXA 3VODA 2VASA 3DPTA 2F5VA 5ILUA 3S1NJ 1A36A 3DFGA 5KYUB 1TKDA 1M1KO 1JKRC 1JL1A 3NWTA 3MECA 3KWIA 3CF5F 3SMSA 4EGYA 1SV5A 4LY7A 3GTMJ 4LIUA 3ID6A 4C92D 1FMKA 4GDFA 3KVGA 2E2QA 3E1YA 4PCQA 2HVHA 4J19A 1LKXA 4ISEA 4BC4A 1VYTA 3I8BA 4A6DA 5DD8A 3RQIA 3A8OB 2QYZA 5FKNA 2UUCK 3LSTA 2E5ZA 4KI4A 2E6ZA 5LJ3h 5LJ5d 2BANA 2OQRA 1XCVA 4I0AA 4BQOA 1AZGB 2K2VA 4G94A 2XD0A 4BRHA 4XNFA 2A41A 1KVAA 3AVKA 1VHXA 5AZIB 1S29A 5GAMj 3MN5A 3VA3A 1BBZA 3F70A 2R7YA 1YRNB 1K8KB 4F93B 2FXUA 3GG4A 1YIJT 2YSQA 4HXJA 5L3FA 1TTYA 2PZ1A 3SZPA 4KB0A 1VQ8I 3GCMA 3GNFB 3OB9A 4FWKA 3DTKA 1OYXA 2KK4A 4C23A 3DV8A 1QNTA 3CDIA 3KUFA 4J83A 4B1VA 2E10A 5FGMA 1HQUA 1ASUA 1PRLC 1NGAA 4D6WA 4E1JA 2GTOA 1QWEA 4FASD 2HF3A 2W04A 3C6TA 1W5CC 4N4IA 3BUZB 5FU7B 2D8JA 2UUZA 4FJKA 1NM1A 1XC5A 2L7MP 1XHXA 3FZKA 2GWJA 4M74A 3BG3A 1Z3XA 5AZJB 1S9HA 3SUOA 1ZUKA 2RK1A 2I5UA 4H4OA 3ULDA 2PVDB 3QU3A 2B63J 2IXSA 1KD1C 2BUDA 2VONA 1QKWA 3VS0A 3FHNA 1KQ0A 1N5YA 1RL2A 4FU6A 1RUOA 5GIOA 3O6BB 1I81A 3KIOA 3K9JA 3QETA 3WXJA 4YPRA 1KG4A 4CIEA 4XQ3A 4Y7NJ 1SRLA 4BH9A 2NYXA 3CC2T 1SANA 4N9IA 4RAYA 3WNFA 1CXUA 3JRCA 1HR0K 2A5YB 4O6JA 1WSJA 4CGDA 3WTYC 2IA1A 3UNGC 3FE1A 1W36C 4K43A 4KJZA 3HSTB 5E17F 2DFEA 4PHTX 4X64K 1ZGAA 3QP6A 4ZH4F 3KKRA 2BOLA 4CC3A 5DTDA 3OIOA 3DKWA 5KPRA 2CUBA 1ATNA 1NEGA 2CUJA 2ICWG 3BY6A 3OMCA 2VT2A 1LEBA 2HHXA 3WG7H 1Y39A 4BRDA 1VQKT 2FLOA 2HHWA 2NRVA 4V2SA 1M1FA 4B9NA 2BHZA 1JLEA 3MHXA 4CZGA 2BZXA 1JHHA 1VQPT 3MZ8A 3A8HB 4BE2A 2Q0OA 5GPAA 3DB4A 2XU8A 3SMPA 2F5DA 3THYB 3EN9A 1MBFA 3AA4A 2ZXHA 5KVRA 4N0AA 3A98A 1OYYA 3QIPA 5GAN8 2JHNA 1WEIA 4FWQA 1XMQK 5KGXA 5HS8A 3T9NA 4LUDA 5LHGA 2X48A 2L4MA 3AO1A 2HQ5A 2MC3A 1IN4A 3L7WA 3I4NJ 1RBTA 4HSRA 3WU0A 1IUFA 4BUGA 1CKAA 2P9PB 4RMNA 1ZBUA 1D9DA 3HP6A 2QKLB 4A12A 4MLEA 1LAWA 4YRVA 3EKUA 2HDWA 5CYQA 2EYQA 1U47A 4CGGA 2OJ2A 4G7HF 3G71T 1NK4A 3O3FA 4PDKA 1KAYA 4BVOA 3FDYA 1QCOA 3L2RA 2EQRA 2RF0A 4FLZA 4WXHA 3EGXB 4KUIA 3PIPL 1IN5A 2KKZA 1HRHA 4E9GA 1GVDA 2RQRA 1TOVA 3VEYA 2Q2RA 4FK0A 4DJAA 1BOAA 4KDPA 3CDLA 4UOBA 5M5XJ 2X35A 1VQ9Q 5EF6A 4CC7A 1E4FT 2UUBK 5KYXB 4IRHA 3PMTA 4I6MB 4CZLA 1N33K 3HJFA 1POGA 1JXOA 2NUPB 2I0NA 2LF7A 1RR8C 2KNBB 1YHQN 3VF6A 2XDVA 4FM4B 4BC3A 4M6VA 3BJOA 4UC4A 4C2TA 5KAIC 3HPOA 5GAHP 4DB3A 4B1RA 1RI7A 1ZRCA 3BG9A 1WPYA 1K8AO 3B6PA 3GOXA 3MK6A 5FD5A 1JLFA 3M8QA 3NH2A 4K8XA 1LFUP 4RW4A 4BXUA 4O0JA 4N0AC 4NLBA 4BUPA 2K9SA 2XGEA 5JHUA 1ZKGA 1BN5A 3P9IA 1ABQA 5E18F 2Q3SA 3G6ET 2Z1HA 2D45A 4DR2K 1KYZA 4WK8F 3LM9A 3S1QJ 4M7XA 4KH6A 4FWNA 3OYGA 5BRFA 3CC7A 1S1NA 1NLPC 4X1EA 3AY9A 4E7KA 1YP5A 3QICA 3DAWA 1BQNA 2PZSA 1KU3A 2JMWA 3JCMV 3OOUA 2JUGA 4O5FA 4RTTA 2DO7A 3N5NX 2H6CA 1H89C 3AAQA 3PL8A 3CCRN 4B8CA 4DBQA 2W82A 2HKOA 2D0PA 2CG4A 2HHQA 2NUZA 4XIUA 4GYIA 4IX7A 3LDOA 4ID5A 4WQ5A 1WFWA 1QTMA 1LE8B 4LDYA 1KQ2A 4FJMA 3VETA 2MSYA 5C24A 2D0NA 5H6RA 3A03A 1M9SA 3Q5FA 1TK5A 2G8VA 3AT1B 4L9JA 1SFXA 5LJWA 3EDPA 5KH6A 4LSNA 1QZEA 2EKHA 5CR2A 2XKPA 3KP6A 2EJGA 3MN2A 1WIEA 3RSEB 1I0CA 2E1ZA 2JA2A 3J7AF 4A3IJ 3CCQT 2XDDA 3GTJJ 2AQEA 4ME7A 1OKJA 4J8FA 3F22A 3L2QA 4FX4A 1VRTA 5J2MA 4GV6A 1VQ7N 2NLUA 4IRIA 5I42A 2HXIA 3CD6A 5HBMA 2DVEA 2VKDA 3UR3C 4WWCA 4B9LA 4RW8A 5IT9E 1RUNA 1DU6A 4YPHA 2QZ8A 1ZUYA 5FDLA 2QGGA 1W2BA 1N9SA 4LGWA 3EG9A 2KLOA 5J39A 1X2MA 1YJ9A 3V4GA 3O80A 2YPRA 4XH5A 2P5KA 4BC5A 5F0XA 3ZXSA 2QA4T 2PNIA 3IMXA 1I4K1 2QWRA 1A5JA 4HTUA 3COAC 4FM1A 2ZZDA 1SL2A 2RF2A 2BV6A 2GXAA 1JEGA 1S22A 2KZGA 1HKSA 1X1AA 2JXBA 2D9TA 2HVRA 2DJZA 2JUFA 3OYHA 2G0EA 4PNOA 2O03A 5AT1B 3G0QA 3R6SA 4M3RA 4LF5K 2OU2A 1BL3A 3ZR8X 5F0HA 3BPVA 4HF1A 5B5EC 2FE3A 4Y3OA 2KRHA 4C8QD 4M7DG 5FROA 1B34A 1VQ6I 3G1JA 1IHWA 3VESA 3RMDA 2E1YA 4CO8A 2IVMA 3J7AO 4HUFA 3BR6A 1IGQA 2JA8J 1XUPO 3IKTA 4L0YB 2LT4A 5CO7A 4WQ5C 1N32K 2QSFX 2JOYA 2E88A 4A54A 1BM9A 1AHDP 1J53A 3KZZA 5EG0A 3D45A 4CFBA 1XG7A 5FKKA 4FX0A 5IH2A 1QU3A 1HKBA</