3OYGA

Crystal structure of the prototype foamy virus (pfv) intasome in complex with magnesium and the insti compound1 (compoundg)
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
368
structure length
368
Chain Sequence
LDAELDQLLQGHYIKGYPKQYTYFLEDGKVKVSRPEGVKIIPPQSDRQKIVLQAHNLAHTGREATLLKIANLYWWPNMRKDVVKQLGRCQQCLITNASNKASGPILRPDRPQKPFDKFFIDYIGPLPPSQGYLYVLVVVDGMTGFTWLYPTKAPSTSATVKSLNVLTSIAIPKVIHSDQGAAFTSSTFAEWAKERGIHLEFSTPYHPQSSGKVERKNSDIKRLLTKLLVGRPTKWYDLLPVVQLALNNTYSPVLKYTPHQLLFGIDSNTPFANQDTLDLTREEELSLLQEIRTSLYHPSTPPASSRSWSPVVGQLVQERVARPASLRPRWHKPSTVLKVLNPRTVVILDHLGNNRTVSIDNLKPTSHQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular mechanisms of retroviral integrase inhibition and the evolution of viral resistance.
pubmed doi rcsb
molecule keywords PFV integrase
source organism Human spumaretrovirus
molecule tags Recombination,viral protein/dna
total genus 106
structure length 368
sequence length 368
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2010-09-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
A PF17921 Integrase_H2C2 Integrase zinc binding domain
A PF18103 SH3_11 Retroviral integrase C-terminal SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2300 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3oygA04
1.10.340.70 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Endonuclease III; domain 1 3oygA01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3oygA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3oygA03
3OQ5A 3L2WA 3KIOA 3ZT2A 3DLEA 2WACA 3TAQA 4RW8A 2GBZA 2DFEA 2E5QA 4C5GA 2DAQA 4HCCA 3E9GA 3VN5A 4J2AA 4KTQA 3OYFA 4DTXA 4DTRA 1NK4A 2HHQA 3V6DA 4ICLA 1S9EA 4Q5VA 2HHTA 3OY9A 2XO7A 4LH4A 2R5MA 3QEWA 1XC9A 3LYIA 4H4OA 4FJ7A 2F8SA 3CYMA 4I2QA 3I8DA 2RJFA 1WJRA 3IG1A 2EQMA 4CIFA 2GFUA 2G3RA 3GOXA 1BHLA 3MEWA 1B92A 2K3XA 3NE6A 1VRTA 2YNHA 3AVHA 1YVUA 2YNIA 3AA5X 3M8RA 3VQAA 1ASWA 4CIGA 4IKFA 1NJYA 5FROA 3KKRA 4FM1A 3TAGA 2AJQA 3LP0A 2B8AA 2R57A 4ELTA 3MP1A 2RF2A 3ZEHA 4CE9A 4CJLA 4KB1A 1BQMA 2HNYA 2B4JA 3ASMA 3SNNA 4GW6A 1BL3A 4LY7A 2ZE2A 3C4SA 3E01A 4M3UA 3E9FA 1TL1A 1JXEA 1ZBUA 4R5PA 2W42A 5KCOA 4FJ8A 3FDRA 4TSXA 4I7FA 3V81A 1Q9YA 4LD6A 4FZXC 5T7BA 3NF6A 3FLGA 1VSIA 2E6NA 1TKDA 4H4MA 1LW0A 2MWPA 3QJ6A 4CJWA 3S9HA 4ZHRA 4B3OA 3SQ2A 4FW1A 2HQXA 3PO5A 3OB9A 4CJFA 5E41A 2DFFA 1LAWA 3Q1JA 3MAQA 4JRPA 4B9UA 1X9SA 4FLVA 2XK0A 2PY5A 1U45A 3KK3A 4PWDA 4CJEA 3OYJA 4PA1A 2YV0X 4BD3A 1X9WA 3K57A 3ZSRA 4BDYA 1L3UA 2BGGA 3P1GA 4OKJA 2BKDN 4CK1A 4A4FA 3P83D 1KCFA 3G10A 3HJFA 3SUNA 5KE2A 4CJ4A 3CFRA 3ZT3A 4L59A 1NJZA 3F9KA 4DQQA 2XY8A 2EKOA 1C0TA 2OA8A 3RR7A 4I9QA 4MQ3A 1WJSA 4I9LA 4CEEA 3OMGA 1QE1A 4ID5A 3RWUA 4KRFA 2X6NA 4F2RA 2JTFA 4FJXA 4FJKA 5HBMA 4DLGA 3KJVA 2HMIA 4UQGA 2EQJA 4DQPA 3P5JA 3LX7A 1WSHA 2HHVA 3DRRA 4CIEA 2YNGA 5IN1A 3TAPA 2OPQA 1ZBFA 2RN2A 1TK0A 4IUQA 3NTIA 3OS0A 4KTZA 4FJ5A 3VQDA 1UA1A 2IAJA 4B9LA 4DTNA 4CHPA 4C8MA 4B9VA 3K5NA 2VG6A 3DB3A 3DLGA 3NDKA 4IURA 3OA6A 3NGIA 4N56A 4O0JA 1UWBA 3BDLA 2Z1GA 3K5LA 3ZT1A 3MEAA 3CFOA 3O4QA 2G8IA 5CIUA 2X4WA 4EP4A 2QKKA 4IFVA 5HRPA 4IFYA 1QSSA 2KFNA 1VSJA 2IGIA 3HL8A 4W5TA 3S3MA 5C25A 3V9SA 1XWLA 3S3NA 4DTJA 3KKSA 1QTMA 3NAEA 1F21A 1JLBA 3T3FA 4CFDA 4PL6A 2X6SA 5DK5A 2LSNA 3SUQA 3LALA 3SPYA 4RW9A 3QESA 3M8SA 4N76A 1BGXT 3SQ4A 4Z4HA 3OVNA 1HYZA 5SZTA 4NCBA 5JS2A 1WN7A 2Z1HA 3KLIA 3A2FA 4BWMA 3HO1A 3LAMA 4JS4A 3SUOA 3LPTA 1RT4A 4O55A 4EZ9A 4Z4CA 4HHTA 1RT1A 2IOCA 3HK2A 2OZMA 4PLIA 1KTQA 3VA3A 1RTHA 1C0UA 4DWIA 2O4XB 2KFZA 4DTPA 3SQ0A 3NTKA 3KLEA 4X34A 3NGZA 3UIQA 4DLEA 1J53A 3NH2A 1RDAA 1KVCA 4C5HA 2X78A 2QQSA 1NK6A 1LWCA 5HRSA 3CG7A 4FLUA 3O3GA 4AHCA 2XY5A 3DLRA 1SSFA 1D8YA 1EP4A 3AO2A 1RBVA 3LANA 3RMAA 3NF9A 1DLOA 3TAFA 4DSJA 5CYMA 1G5VA 1VSHA 4LSLA 4CK3A 4EP5A 2IS3A 4DSLA 3SD4A 1A5WA 3PX4A 2A1RA 1RT7A 3LGLA 1BCOA 4QVZA 2BIVA 1NKBA 4DQSA 5C24A 3B6PA 1A5XA 1HRHA 2NLUA 3HM9A 4DU1A 3MO8A 2KQ2A 4AH9A 1G15A 1S9GA 3QERA 1X1PA 4MFBA 2G8HA 4AILC 3MXJA 4FM0A 1B9DA 3QIOA 2K3YA 2BE2A 3MEGA 1TVRA 2XY6A 4NYFA 5JS1A 2IG0A 4W5RA 2M16A 1UOCA 3HPOA 3BGRA 2P5GA 3RTVA 4O0IA 1ZBLA 1VSMA 3QBYA 3NH1A 2RI3A 4M42A 3C6UA 4NS5A 4DTUA 3V1QA 4CHYA 1KHCA 1TV6A 2D0CA 3IAYA 3SYZA 5CYQA 1U48A 1HNIA 2ZQBA 4DFJA 4IUUA 2JLEA 3SQ1A 4DU3A 2VG5A 3V9ZA 2LVMA 1C0MA 3H8ZA 3NH0A 4ELVA 5FDLA 4CHQA 3LPUA 5KRTA 4C5IA 3TAEA 3META 1MU2A 1RDBA 1TGOA 3V4IA 5J2MA 2RO0A 1KLNA 3C94A 1Z26A 3KTQA 4FLZA 2BUDA 2DIQA 1WSGA 3AA2A 1WAFA 3D0PA 2FHDA 4E7JA 2HHWA 3VQ8A 3MEVA 2E6LA 4LSNA 2B6AA 4C8LA 4G1QA 1RT3A 1A5VA 4O5BA 1OZ2A 2LRQA 4BE2A 1U4BA 3TARA 1YTAA 2BANA 4C8NA 4N5SA 3O3FA 1YTUA 1LV5A 4O4GA 4EDUA 5FRNA 2VG7A 4FLXA 1NK7A 4K8XA 2HVHA 4M3RA 1XHXA 2P5OA 2G8FA 3ZSOA 1T7PA 4M3TA 3KLHA 1S1XA 5K14A 4Q0BA 3VQCA 1TKTA 1SKRA 3TAMA 4A4HA 3TR8A 1L3TA 2DIGA 3FEOA 2EQKA 5C42A 4CFCA 5IAYA 1XNIA 5HROA 4QQGA 3VQQA 1SL2A 3LZJA 3QIPA 1FKOA 4N4IA 2HHXA 1VSLA 4IG3A 2L89A 5KE3A 4CEBA 1C1CA 3AVNA 3ZSWA 3UT1A 4IUTA 1R0AA 1CLQA 3AVLA 2ETJA 1RBSA 4NCAA 3LDSA 1QSLA 4OGCA 1ASUA 3M8QA 3EAEA 4EZ6A 4ID1A 1BQNA 2RI5A 4A4EA 3RRGA 4CHNA 3KLFA 3PNWC 3LP1A 3VA0A 3LH0A 1KVBA 3F73A 1NOYA 3TANA 4CRIA 4FXDA 3K2PA 5J1EA 2G8UA 4HUFA 1J5OA 1U04A 4FJ9A 4DFKA 5CZ1A 1C6VA 1D5AA 3AVAA 3L2UA 3QEPA 4B9SA 3V9WA 3C95A 3L2VA 4PQUA 3OYBA 3LLRA 3OYHA 3VQEA 2F5KA 1RBTA 1KSPA 2L8DA 3O3HA 3DB4A 5CZ2A 4UC4A 3AVGA 1IKYA 4F3OA 4CGHA 4DTSA 4W5NA 3KK1A 3OYLA 3DRSA 1S1UA 2GFAA 3AO3A 1WGSA 2E4LA 4IUPA 4QW2A 4CEAA 2D5RA 4QCLA 4B9TA 2G8VA 3ULDA 5C6SA 3CQ8A 4F2SA 4LD0A 3AO4A 2YRVA 3ZT0A 3U6FA 2DY4A 4FLYA 3LAKA 3HT3A 4M3XA 4B9NA 4NCGA 2LCCA 3SV3A 3VQPA 4CF1A 4FK0A 4CEQA 4W5OA 3LP2A 5J26A 3H08A 2Q3SA 2JGUA 1HJRA 1RILA 5I3UA 2OZSA 1EX4A 3IRXA 4FM2A 2QQRA 4E1NA 5HP1A 1WSIA 2X4XA 4DFPA 1LWEA 4OGEA 4HUGA 3QEIA 2X4YA 2Y1JA 3OMCA 1RDDA 1CXUA 3SZ2A 3HP9A 3PX0A 3PUFA 2LTOA 2NUBA 3CM6A 3DLBA 1OYXA 2P1JA 4Z4IA 1XHZA 1SL0A 5D6YA 1JLFA 1Y97A 1L5UA 4RW7A 2PZSA 4CEDA 4FJLA 4FJMA 2O4XA 5J39A 1IH7A 1JLAA 1HNVA 2Y1IA 3ITHA 4KAZA 2EFIA 4E7LA 4J2EA 1SV5A 3PMTA 2DTUA 4C5EA 4OKEA 1OI1A 1U47A 3MEUA 5D6WA 4B08A 3AO5A 2QXFA 2PYJA 1VK0A 4Z02A 1CZ9A 4DFMA 3MXIA 1W9HA 1FK9A 3OYEA 3OJSA 1T8EA 1C1AA 4E0DA 4GVMA 4OJRA 4Z4GA 1Z25A 4J2BA 1GOAA 3QO9A 1JLQA 3EYZA 1LAVA 2VWKA 1XI1A 3HVRA 3RRHA 4DS4A 4N4HA 4KO0A 1FKPA 3VQ9A 3WNFA 4M41A 3V9XA 3ZSZA 1TAUA 4CJVA 4DS5A 1QS4A 5D6XA 3T19A 4DF8A 1U49A 4OPJA 4Y1CA 3IS9A 1EXQA 3V1OA 3L8BA 4DSIA 1QSYA 2RKIA 1CZBA 1LWFA 1VSFA 4W5QA 1Q9XA 2VWJA 2ATQA 1S5JA 1DTTA 3ZSYA 4O44A 2A1SA 1NKEA 4FVMA 4PY5A 2RHUA 3SUPA 2RJCA 4KHUA 3DYAA 1IKWA 3VQ7A 1JXBA 5KGWA 4OPKA 4DQIA 4KPYA 4RW4A 4FZYA 3AVFA 4E19A 3HP6A 4H8KA 2B5JA 3TI0A 3OYDA 4F3TA 1IKVA 2HNDA 4E3SA 1RI0A 2FBXA 4M45A 1TK5A 3TABA 3DOKA 4B9XA 5KCHA 1RCHA 3OYAA 1NK5A 4CJPA 3OYNA 3ZCMA 1OZ3A 3SJJA 4KHYA 4FL6A 4OVLA 4B9MA 3MEEA 1I39A 1D9FA 4B8AB 4FYDA 3LP3A 1UAXA 5EU7A 2O4GA 4AHUA 3K59A 1SKSA 4CJ3A 2XY7A 4GY5A 4DG1A 2YNFA 4QAGA 2IDOA 3UWNA 1NKCA 3MECA 3H6ZA 3AO1A 1NK9A 3B6OA 4FLWA 1BI4B 3U3GA 1VRUA 1TAQA 3QINA 2JZ2A 3I0SA 4CJRA 4KHWA 4HTUA 3G0ZA 1NOZA 2F96A 3RR8A 5HRRA 4AHSA 1O1WA 4KI4A 2P51A 3DLMA 1FXXA 4DSEA 2OPSA 3OS2A 1HQUA 1IO2A 3KK2A 3P8DA 3THVA 4C8OA 1HYVA 1CXQA 1RTJA 4KB0A 3FC3A 4DSFA 4BWJA 3RMCA 2X74A 3ZT4A 4KHQA 1BIZA 3K5MA 3DLKA 2D0BA 3ZSXA 4CK2A 4NYNA 3PV8A 1GOCA 4BE0A 4ZTFA 4YFUA 3VQ5A 3WNGA 1TK8A 2HHUA 1C1BA 4CJUA 4J2DA 1EETA 1S1TA 2FBTA 1ASVA 2RHZA 4IUVA 3ZSVA 1WSJA 3HPGA 3L3UA 2EHGA 4BACA 2DFHA 3LGFA 4KREA 3DMJA 2QK9A 2ZD1A 1BISA 4FJJA 3P8HA 1HYSA 2E6MA 4M3YA 4WE1A 4CJKA 1Q8IA 3HPHA 5J2QA 4QQDA 2PQWA 3PFSA 4DQRA 3MEDA 2QKBA 3ZSQA 2RJEA 4DF4A 3U3YA 2L3RA 3K58A 3QETA 3PMIA 4B9WA 1H3ZA 1S6PA 3QKJA 3RMDA 1NJWA 3SV4A 3EZ5A 4FJHA 3NNQA 3KLGA 4ZTJA 2D9TA 2BDPA 4QOZB 3V9UA 3AVKA 4BDPA 3QLHA 3S3OA 3HVTA 3EY1A 2EQUA 1J54A 1KLMA 3PO4A 1TKXA 3S6WA 1WNSA 3LWMA 2YKNA 4C8KA 4E7KA 4AHRA 1RDCA 4XIUA 3OJUA 1S1WA 5HRNA 2D0AA 3LWLA 3MP8A 2RJDA 2EX3A 2HB5A 3OS1A 1QQCA 4KHNA 4DMNA 4CJ5A 5KI6A 5KRSA 3MXMA 1K6YA 1WAJA 4RG8A 4DTOA 1L3SA 4KTWA 2M1HA 4I2PA 2Z1IA 4CF9A 4JS5A 4HCZA 4CECA 4FK4A 1HQEA 4E7IA 3NF7A 2XRIA 5HLFA 4CF2A 4FW2A 2FBVA 1JL1A 2F8TA 1IKXA 1JLCA 5J2PA 4A4GA 1B9FA 3NTHA 2WOMA 4Z0UA 4II1A 4CF0A 4HCBA 1KVAA 3ISNC 4CGJA 2HW3A 1JKHA 3NCIA 3K5OA 3SPZA 2RHIA 2YHAA 3WNEA 4CGGA 1ZBIA 4QQ6A 1RTIA 2HVIA 3AVMA 3OYIA 2R58A 4CESA 4JLHA 2RHXA 1NK8A 2I5JA 2Z1JA 3V1RA 5M9OA 1MHNA 4E89A 4FLTA 5KH6A 4FK2A 4CJTA 4CEFA 3I0RA 3TWHA 1WLJA 1QHTA 3F70A 3PY8A 3L2QA 4CEOA 4CGDA 3OYCA 3CM5A 3OYGA 1KFSA 2O4IA 3DOLA 3CFPA 3KD5E 1RNHA 4LH5A 2XHBA 3AA4A 3ALYA 4L8RB 3QIIA 3SI6A 1J9AA 1UA0A 1DTQA 5J2NA 1N5YA 3QEXA 5KGXA 1WSFA 1RT6A 4CHZA 1N27A 3D45A 2OPPA 2KW4A 5SWMA 4E1MA 4KI6A 2G8WA 1ZYQA 5D3GA 3AVCA 4IDKA 4N4GA 4E7HA 2RHYA 1YT3A 3HXMA 4DU4A 4Z4FA 1N6QA 1LW2A 1WJQA 4AHTA 3NBPA 4FJNA 4B8CA 1SKWA 4N47A 3DLHA 4CEZA 4CFBA 3OYMA 3FFIA 4RG2A 3M8PA 5C0MA 1HPZA 3CEYA 4KHSA 4M3WA 2ITGA 1I3AA 2VYTA 3AVBA 5KTQA 2KZMA 3O8VA 4AHVA 4CFAA 1ZBHA 1X9MA 1GOBA 3HSTB 4Q5WA 4M3ZA 2PYLA 1WSEA 4OKKA 1IG9A 2OPRA 2IC3A 2MWOA 4CERA 1NK0A 3AVIA 1BCMA 4IG0A 1T03A 4KV8A 4OVAA 1EKEA 3HYFA 3NGYA 2CKKA 1S6QA 2GUIA 3L3VA 4PUOA 3QNNA 3WNHA 1JL2A 4YNQA 3NF8A 1JLGA 4HVJA 3AA3A 3JSMA 4F8RA 3MP6A 1RT2A 1KFDA 1RT5A 5I42A 3KUFA 3L42A 2YKMA 4CHOA 4FJIA 3M9QA 4JRQA 5CY4A 3OYKA 4K8ZA 1S1VA 4CGFA 4HUEA 2KTQA 2R5AA 4PLLA 1SUQA 4FU6A 1VSDA 4RW6A 4BE1A 3T1AA 4BDZA 1HMVA 3VQ6A 2GV9A 4Y1DA 2LDMA 1W0HA 4FCYA 3BDPA 2YHBA 3ME9A 3DRPA 3L2RA 3LZIA 2HQEA 1RTDA 4DSKA 4KKOA 2OYQA 1RBRA 3DI6A 4CF8A 3O4NA 1KRPA 5DMRA 4CJQA 1VSKA 2P0KA 1TL3A 4IBNA 2KZZA 1T05A 5FRMA 4Z4EA 1ITGA 2WONA 3VQBA 1SL1A 4FJGA 3QEVA 2RPIA 4CJSA 1BI4A 3JYTA 2GF7A 1NJXA 2XDPA 1RBUA 2R7YA 3QNOA 3SCXA 4DTMA 4N41A 2X35A 3NHGA 3PX6A 3AV9A 1L3VA 1JLEA 2FBYA 2M0OA 4OLAA 3RMBA 4NZGA 2FC0A 4KFBA 4GMJB 3AVJA 4F4KA 3ASKA 2HNZA 3VQ4A 1D9DA 3KD1E 2HHSA 2RI2A 1VSEA 1BIUA 3C6TA 4OLBA 3DM2A 2G8KA 1REVA 4ELUA 3NFAA 4FZZA 1TKZA 4CCHA 4CGIA
chains in the Genus database with same CATH superfamily
2P9UA 4IWVA 3U1DA 2KIUA 4BY1J 2DAQA 2M3AA 4HCCA 4J2AA 4KRTA 2GUPA 2CP7A 1K7AA 4DTRA 3TCJA 2F5VA 2HHQA 2P9SA 4PJOB 4ICLA 2LY9A 4G9ZA 1IW7F 2XHKA 4BQLA 4Q5VA 3WGIA 3KNTA 2HHTA 2LNHB 3OY9A 3G6EA 1W2BA 3O9RA 5J40A 4DYCA 1SG5A 4FJ7A 2F8SA 3SWNC 4BRFA 4I2QA 2GTDA 1J5YA 4ZYDA 1AWOA 1K8AO 2RJFA 4O6JA 1WEFA 2G6FX 2G3RA 3GOXA 1BHLA 2XPWA 2YU3A 1Y57A 1GLDG 3HTUA 3VESA 1FX7A 4G7OF 2CS7A 4GYIA 1LWYA 1S1NA 2YX6A 2I10A 5CE3A 3CW7A 2ESWA 1BYMA 3I5UA 1ASWA 3U1KA 1H641 4PSXA 4BRCA 2M30A 5FROA 3LDNA 2QXLA 3FDYA 4CZKA 5M1OA 2XHCA 1N34K 2A28A 2QDYB 3LP0A 3O8HA 2R57A 4KJZA 3M58A 4ELTA 2IBDA 4KUMA 2FOKA 3D5RC 2VI6A 4CJLA 1BQMA 3CQYA 5FD6A 4LDUA 1GLBG 1L3LA 1BL3A 1R36A 5IP7J 1KAXA 2JRTA 2E7WA 1MD0A 4X66K 3OR1C 3MWTA 1JXEA 1W36D 4MHGA 2DFUA 4R0KA 3A02A 2W42A 3TSZA 1MMNA 3CCMI 4XRMA 2DMUA 1W6XA 4FJ8A 2PU9B 3R2XC 3FDRA 2CFOA 5LHHA 5L3EA 4LD6A 4FZXC 5T7BA 3VS2A 1TWFJ 4IZZA 3WEEB 1DU0A 3NF6A 5ECAA 3FLGA 1M1GA 2JA6J 3RIRA 2E6NA 3C7JA 3G6EN 4MMLA 2UUAK 1ZREA 2M0YA 1RPWA 1LW0A 4C9YA 3AKZA 1RAHB 5FU7C 4GKKK 4ZHRA 1MJBA 3HFOA 3IAM2 3DWLE 5BQTA 1EFNA 4RWTA 2JK3A 1IRGA 4FW1A 1OV3A 4C92A 5B3SH 3PO5A 3SQNA 1NGEA 2LY2A 4M6YA 3L09A 5ICCA 3I5RA 1KG7A 3GTKJ 4CVNE 3MAQA 5HS7A 4H0PA 1VQNA 2DYIA 4JRPA 4OPAA 1X9SA 3WVDB 4DV0K 2BY1A 4VUBA 4PWDA 1JHFA 3HOSA 1FYNA 3IAS2 1Z67A 2R5ZA 2LP5A 1IXCA 3HG9A 5KYUA 3SZGA 4BDYA 4E9HA 3P1GA 3QO3A 2F2VA 2CQQA 2KAFA 1B9NA 1W7PA 3H0DA 1SKUB 3BY7A 3P83D 4DR5K 3T7ZA 1M2VB 4CJ4A 5CVVA 2FE3A 3R6NA 2X6WA 4L59A 3F9KA 1M1KU 2X51A 3GZ6A 5AT1B 3DEWA 3J7YJ 2KP6A 1GLEG 1PUFB 3A98A 4CEEA 1WFWA 5I22A 2YSQA 2X6NA 5AN4A 2NUTB 2L54A 3K70D 1XPXA 2A0FB 4ZJZA 2JUCA 3B8AX 2G7UA 2HXIA 4UQGA 4M78G 1NU0A 3P5JA 2DF6A 1A0NB 4CD1A 1IJWC 3BZKA 5D5XB 4HT8A 3CC4Q 1R5ID 1RRQA 1VQ4I 1WH5A 1WRJA 4HX7A 3NTIA 4LF8K 1RABB 4C3HJ 4HYEA 2K9LA 4B9QA 1UA1A 3N0UA 4CHPA 1IUFA 2EFWA 2Q31A 1FBUA 2OTLQ 2KRMA 4MDXA 4RM2A 2ZMEC 3OA6A 4O0JA 2RREA 3RKXA 4M7DD 1UWBA 3CC2I 5AQVA 2E5KA 1VQNN 3E0JB 1TWBA 2Z0WA 5CLSA 1MBEA 1V5FA 4B1WB 1CF7A 5IHNA 1J7KA 2HHHK 2HWVA 4G6DA 4IXCA 1GT0C 3RUXA 2HNHA 2IGIA 1NGJA 4W5TA 2KNBB 2J6FA 3V9SA 3S3NA 4UV8A 4C2TA 4DTJA 2QEXA 2P0PA 3T3FA 4F7UF 4PL6A 1QCFA 3EGUA 2LSNA 1YO5C 3LALA 4PFZA 1D5YA 4RW9A 4JQFA 4YFXF 3QESA 4N76A 1YHQT 3SQ4A 3OVNA 1HYZA 4OO1J 4MLOA 1K8KA 3HO1A 5LEJA 4JS4A 4B48A 1APLC 4O55A 1DT9A 1ZSZB 2P7VB 3H3ZA 3CP2A 3U23A 3G71I 1XNRK 1UFMA 4BRDA 4IZ9A 4PLIA 1KTQA 4BR2A 3WQTA 1RTHA 2QVOA 2LVSA 2EIFA 3K0SA 3NVKA 1VQMI 3GG4A 3K9KA 1BA0A 9ATCB 3SQ0A 3NTKA 2MMPA 1DGWY 2P5KA 3JSCA 2CQNA 3IUOA 4X34A 3H3VK 3UIQA 3DCFA 2EA4A 2EZLA 2FEIA 4DLEA 4AIAA 4JI1K 3CIPA 1KVCA 1NK6A 1LWCA 2Q8KA 5BR9A 3DLRA 3TQ7P 1KGSA 3BY5A 3AO2A 1SD4A 1RBVA 3NF9A 2HS5A 3E6MA 2LQNA 4B1RA 1G5VA 4LSLA 1WJBA 1GBQA 4JX5A 3SZTA 1IXRC 1RLPC 5D6EA 2A1RA 2R0QC 1RT7A 1T2KA 5GANg 2IAIA 4BQOA 3I56I 2ENMA 5AQLA 5GANd 1NKBA 4EW0A 4HPQA 4DW6A 3A8OB 2QEXN 2WWYA 2CV1A 2C6YA 2BXZA 2NLUA 1KQJA 3I55T 1T6CA 4M9XA 1S9GA 3BUZB 1JCFA 2NOEA 1X1PA 4G6QA 3GTOJ 3CJ1A 1N9SA 4AILC 4ORZA 4ELYC 1YITA 3BF3A 2HBPA 2BE2A 3IKMA 1NBWA 3TVTA 3CMAT 3CXCS 3HB9A 1UOCA 1YW7A 1HBXG 2Y90A 3EG9B 4FQGA 4DR2K 2ZXWH 2LK2A 4IEJA 1MBHA 3KPHA 2NVXJ 4D5FA 4NS5A 4DTUA 3V1QA 1TV6A 1U2VA 2D0CA 3A4CA 2ITMA 3IAYA 5LHIA 2WV0A 1EH6A 4XLPF 5HNFA 2IVNA 1U48A 1YFNA 1LKXA 3UF4A 4IPAA 3PIPF 2ZQBA 2JWTA 2NOLA 2O61A 5D5VB 2RB6A 4RMOA 1KYZA 4XK8E 2EWSA 1W5TA 1DPUA 3V9ZA 5E3LA 2FQ3A 1YJNI 3C12A 5DYMA 1UJYA 3MKYB 2J05A 3MZ8A 2VKDA 3OS5A 3CCEI 4MDBA 3LCNA 1T38A 2E1MB 3W6JB 4UUTA 3IH7A 3HSBA 4EHUA 3W3DA 2DA4A 4ZN3A 2J6OA 3SHFA 4NL3A 4U7DA 5KRTA 3V4IA 2TCTA 4RDUA 1SAUA 4PJOA 2JTVA 2PMHA 1B6AA 2GA1A 2AXTC 2VCPA 3KTQA 2DL7A 3L0QA 4P9UA 4FLZA 1S9HA 1WLPB 5C2DA 1K9MO 1WSGA 3REAB 1XQOA 3D0PA 2P81A 2P8TA 5E1XA 2E6LA 1YITN 3MEXA 1HKCA 4C8LA 1IN8A 2ATCB 2GWJA 3ZMVA 2MH2A 2MA3A 2EK5A 2VXEA 1ABOA 4OB2B 1NK3P 1U4BA 2J06A 3D7EO 3HRSA 1B3QA 2LY1A 4AUXA 1ZLMA 4C8NA 3O3FA 2NOBA 4BR9A 1U6ZA 1GV5A 4A3EJ 3QZ9B 2AO9A 2NS8A 4WQ5C 4OAZA 4FLXA 2NXNB 1M2OA 2PAVA 3CWUA 1A35A 4BRIA 1T7PA 3KLHA 4WCIA 2XASA 2HDAA 5K14A 4Q0BA 1UFFA 2LKSA 3RTRA 3CCQT 5DCMA 5DM7R 1L3TA 2DIGA 3FEOA 1ZLJA 2O3FA 3DV8A 2EQKA 3CC7I 1KQSA 2FMLA 4M7AA 3U2RA 4BREA 1VQ5I 1FJGK 5EYRA 4A0XA 5JHUA 1FKOA 1MBKA 3K70C 2XSDC 2B86A 1GFDA 3S1MJ 4N4IA 1Y71A 1BWFO 4L5JA 5FPEA 5HL7L 4Y4RA 3LA2A 3VKIA 3LSIA 5M1PA 3CD6I 4CEBA 2JRMA 4X9CA 2RQUA 3AVNA 3ZSWA 1N8RC 3WEEA 1RR7A 1KD1O 2L4MA 2WUSA 1FP1D 1N3CA 3G1MA 3FZVA 4KHPK 3HFNA 2QTXA 4C3JJ 3PNWC 3LP1A 1Q86R 1YHQQ 2PMUA 2RC4A 2KJCA 4M7DC 2P9PA 3VEVA 3T8TA 3IWFA 5KQDA 3KZZA 2LC2A 2CGLA 3VA0A 2D45A 1KVBA 3SDBA 1SFKA 4YELA 2QQAA 2RNGA 1QWFA 4BU2A 5LJVA 1VAZA 2K5FA 4ANJA 3ULEA 1D4XA 2P0WA 4MEXF 4RB2C 3CUOA 3G4SA 1J5OA 4WCEL 4AD9A 4FJ9A 1YI2T 1C6VA 4CSWA 1D5AA 3L2UA 5M1FA 3QEPA 4FPBA 2ESNA 2NRHA 1ZX6A 4BGAA 2DQRA 4X65K 4JHDB 4XOPA 5D7UA 2A41A 2NOGA 3THYB 3PE0A 4A3BJ 1QBJA 2FZCB 1RBTA 3MX2A 3CZ6A 4KT5C 3QDKA 1P7JA 1HSJA 2DA2A 4X1VA 1CQTA 2Y69H 1E0EA 3MN7A 4JK9A 4CGHA 4FYVB 4W5NA 3QUIA 2ZAEA 4AM3A 5JLWA 4NOYA 1YJWT 3CCLI 1G2BA 1SZ2A 1A5JA 3FZFA 2V9KA 3TPQA 2V1RA 1YIJT 3JCMb 3DXMB 2L3QA 3AO3A 2XAUA 2DO3A 1E3OC 3H1CA 4I76A 1E6GA 4IUPA 3I55Q 2V7FA 4DR3K 2OV7A 2AQEA 4XN3A 2IA1A 1UG2A 4AIJA 1RAGB 4B9TA 2XGXA 2AXLA 4A3MJ 3CMAQ 1KXPA 4XTUA 2VE8A 5JVHL 4LD0A 3AO4A 2YRVA 3ZT0A 1R71A 4FLYA 3LAKA 5LMNK 4M3XA 1IN5A 1IG8A 2V6CA 4KBOA 1Q1VA 2JN0A 1BA1A 2LCCA 2RQVA 1PP7U 4BRPA 3SV3A 4FHTA 3K4KA 1N32K 3A5OC 1RFQA 3G4SN 4EEFG 2NRZA 4CCOA 5K7FA 5DLQE 4DBFA 3O6WA 4I0BA 3K4BA 3SMPA 4PKCC 2Y9ZA 3QYHB 1WBBA 4IOXA 2XVCA 5A0LA 1X69A 2EJRA 1NBEB 1K8AR 3H9JA 3JB9F 2X4XA 3FF5A 2JM9A 4MGRA 1Z1DA 3OH6A 5F0FA 1J6ZA 3BJ6A 1S5LC 5J3BA 3VGLA 3X20B 4EMKB 1BI2A 1X4OA 1HNXK 2LTOA 3HYIA 4HZFA 3ZRGA 5GAHJ 4F16A 1ZSZA 2DTIA 4Z4IA 1JLFA 2F4OB 4PFOA 4K42A 2YUPA 3G7ZA 1OH6A 2XG8D 4LMYA 5FPDA 4XTYA 4FJLA 3GFIA 1T0FA 3UNGC 4BHCA 1HNVA 1FZPB 5BPMA 2K9MA 1YQMA 2IS2A 3ITHA 4HF0A 4NLBA 1Y96B 1D0XA 1XC3A 2CV0A 2EFOA 1V5EA 1I50J 4XKCA 3BG6A 2NVUB 1OR7C 4DBHA 4B08A 1PC0A 4P55A 2BOLA 2GGRA 3DXKA 2QXFA 1JQQA 2O8XA 4F14A 4YEJA 3RMSA 3OW2S 3I0WA 4H5TA 1VQLI 1CZ9A 4DFMA 2BVLA 2DJIA 3CCUI 5HLGA 3MXIA 3OJSA 3LAJA 3WTSC 2JWLA 4E0DA 2WB1A 2DAOA 3CCQQ 2ZGZA 4OJRA 2X9DA 4X9DA 2JNGA 1FSHA 1VHXA 3EYZA 4MDWA 1RESA 3G2BA 1DGRM 1JJ6C 2EGCA 1DEJA 2K6DA 1XI1A 1P7IA 1USTA 1NLVA 4P9FA 3QP5A 4JRKA 3RRHA 5BPIA 1OYWA 2WV1A 3VUBA 1YJNA 5F2RA 4H0YB 3Q0VA 3VQ9A 3HTRA 2DDAA 2F2XA 3CCEA 3TREA 3PIOA 3GFMA 1HKQA 4M75B 4CJVA 2GCXA 1UECA 1QS4A 5D6XA 2FF3B 3QSUA 1R6RA 1TYQA 4OPHA 2W10A 3Q7BA 1K9AA 4DEYA 3MQ0A 3V1OA 3L8BA 4EJOA 1TLHB 4F93B 2YI1A 1Q9XA 3UKRA 1FTZA 2L7ZA 1OH8A 1VQ6I 3WHCA 2ATQA 4BQNA 1YUWA 1D8KA 2VPRA 1J3TA 2K4BA 2RJCA 3BG5A 4KHUA 3CMYA 3DYAA 3NPFA 1MBFA 3VQ7A 1JXBA 4GV9A 5F04A 4OPKA 4KPYA 1WJ5A 1USSA 4FZYA 2KISA 3VF4A 4H8KA 2XRLA 3TI0A 3OYDA 2L0KA 2V75A 1IKVA 2Q2EB 2FBXA 3KE2A 2YJEA 3DOKA 5EZGA 2VJJA 3OYNA 2D6FA 1ZELA 3ZCMA 1JE8A 1VQ9I 4FL6A 3A8HB 1YI2Q 3W2VA 2Y0SA 2OTJA 1D9FA 2KLOA 3TU4K 2SEMA 2WB1N 1P7MA 2KR3A 3I71A 1G3YA 5EU7A 4CJ3A 2XY7A 3KLOA 5CKEA 2M51A 2KVQG 2RHKA 4YPRA 4C2MJ 4DG1A 2DXTA 5CO7A 1ILYA 5BNGA 2VKNA 4OFHA 3MECA 2OQRA 3H36A 2GEMA 4LDYA 1O7LA 3AO1A 4W1UA 2YPRA 1NK9A 1BR4A 2EVRA 5AQNA 5DM7L 3AGKA 4FLWA 1HXDA 3FK7A 3KFVA 1YJWQ 2X85A 5LHGA 2BE5F 3JCMW 2DPUA 3D0SA 4H5RA 1YIJQ 4UUVA 2YS9A 4DUYK 4GXOA 3I0SA 4IF4A 3L1PA 3O9QA 3H9GA 2F96A 5EC7A 4AHSA 1MA9B 1O1WA 2AKLA 3VEZA 3DLMA 3KCCA 3ENBA 3N97A 3JB9J 1KQ8A 2R7SA 2DILA 4HCKA 3D2FB 3QHSA 1Q81C 4DSFA 5LJ3e 4BWJA 3U9DA 1Q82C 1OMIA 3EEQA 1OPCA 2FLOA 4J5YA 3ZT4A 1BIZA 5H6RA 3DLKA 1KJWA 4J01A 2XUBA 5KYNA 1DP3A 1BN5A 5LEKA 3OYYA 5L3GA 2ICWG 5AONA 4DCHA 2COMA 3S32A 2V9PA 5GAN3 2VC1A 1YFHA 2HHUA 2Y0SN 2OTJN 4EMSA 1EETA 5AFUA 3GLXA 1ZHIA 2FBTA 3HPGA 3EQLF 3CJ7A 1KG5A 1VIFA 5IH2A 1XCBA 3LGFA 2FPFA 4F7UE 5LL6S 1AZEA 2K9SA 2BUPA 4PJJA 3D1NI 1EZZB 3TKYA 4M75D 5CKDA 5FPMA 1M1FA 4CJKA 4CZMA 2O8BB 3HPHA 4JI2K 3IP4B 4FVUA 1VYTA 4DQRA 1OH5A 3K6GA 3ZSQA 2AT1B 4C0DB 3VV0A 3JAMZ 3K58A 3M0QA 4Y13A 5L3FA 3ULQB 3PMIA 5HK0A 3MVPA 4XKBA 3CCVA 4JNEA 1ZRDA 2GZWA 1R58A 3DP7A 1PUEE 1OQKA 3I8BA 5GPCA 1XQHA 2YCHA 4A62A 2D9TA 4CZIA 3FKJA 5HS8A 2VXFA 2FVUA 3V9UA 2P9NA 2OU2A 2M1BA 3HVTA 4PZJA 4D5CA 3VOEA 1J54A 1KLMA 2CH4W 2Z99A 2DBBA 1TKXA 3S6WA 2WC2A 1WI7A 1WNSA 3R60A 2FXAA 3E1SA 3TTCA 2XAGA 1NK2P 3VGMA 4WXDA 2EYXA 2HDCA 3MP8A 2RJDA 3DQVC 3MHXA 2DA5A 4JX4A 4IRGA 2CGHA 4CJ5A 5KRSA 1W2BS 2HR3A 5CKTA 5AQZA 2DXUA 4G8XA 5CYVA 4JS5A 3JCMX 5L3DA 3M56A 1QVUA 2ECBA 3FXRA 2CUDA 1RI7A 5ILSA 2QA4I 1OCCH 4CF2A 4YY3K 4BH9A 3WXMB 1JL1A 2OAZA 2F8TA 3O2PE 1IKXA 4JK8A 2L9RA 3NTHA 4Z0UA 5BS6A 5ADXA 1PKSA 4JDSA 4BB7A 3CERA 1IBMK 4LDWA 3CVTA 3AL0B 1D0ZA 2NUPB 1LOTB 2F2WA 2JTEA 2HW3A 3K5OA 3LH5A 4CGGA 2HEQA 1ZBIA 3EG1A 4BVOA 3N4PA 1K9MR 2LQKA 3CCVN 3AVMA 3OYIA 2J6KA 3H1VX 3O8GA 2DL3A 1O75A 3JW4A 4JLHA 2DYRH 4CHUA 2RHXA 3MWMA 5EG2A 1NK8A 1BW5A 2I5JA 5CHIA 2W82A 2VWBA 1OU8A 5EX5A 1WXTA 5M9OA 1MHNA 2QWLA 4XU1A 3JB9H 3K69A 4FLTA 4L0ZB 5LGNA 2WBNA 3GTMJ 3L2QA 4CEOA 3OYCA 3WTTC 3CM5A 1M27C 1GV2A 4NHJA 5A2QZ 1KFSA 2DEUA 4V19K 3CFPA 4EHTA 4S05A 1VTNC 4D1QA 3MKDA 3RERA 2YHWA 2VE9A 5LJ5g 5KPTA 3S17J 3G1OA 4L8RB 1Y0NA 3O9UA 3QIIA 1MKMA 3SI6A 3OMYA 1WWXA 2IP2A 5BN8A 1DTQA 5L3CA 3H5RA 2R7ZJ 2GQQA 2B7EA 2KKZA 2LQ8A 4XL9A 2OPPA 1Y96A 3ZQ7A 4XLAA 3C0CA 4NXNK 1AKHB 4KIGA 3AVCA 4UVBA 4Y52J 2M5WA 1N75A 3HXMA 2O8FB 4A0ZA 3DF8A 2JA7J 2W03A 4H0TB 1N6QA 1ORKA 4WYBA 5DD8A 5M5YJ 4WQ4A 4FJNA 3Q0WA 3CQXA 2P7CB 3VS6A 4LG3A 1I81A 2XDBA 1KD1R 3LM2A 3C65A 4EA5A 1BB9A 1UEBA 5F64A 3OYMA 2KPMA 3ZGKA 5IXBA 1UELB 2KY9A 2VIXA 1ARKA 3ASNH 5C0MA 4AMCA 3OL4A 3QPLA 1R77A 2CP6A 2OC6A 4M3WA 2JPCA 2E2OA 3LFKA 4M7DG 2L3DA 4FETA 5KTQA 3FK6A 2RNJA 4BHPA 4AHVA 5BR8K 1YWPA 2E2IJ 1JBMA 4QKUA 3FM5A 1MW7A 2EV0A 3SHWA 1ON2A 5TISC 4Q5WA 4M3ZA 3CC4A 2BBYA 2OPRA 1WBDA 1XSXA 3F21A 4HDUA 3MJXA 3AVIA 2M87A 4YIFA 5AQFA 3SYTA 4I98B 1KG6A 4KV8A 4GFBA 2DBKA 3WTYC 2K5IA 2ZPGB 3A01B 2XF5A 2DOEA 4ZH4F 5GMKh 5FKNA 1F1BB 1JL2A 4DR7K 4YNQA 3DXJF 4M77F 1I5ZA 1JLGA 2E2PA 1K73R 3GFJA 3TEDA 3MP6A 3DWLA 3KUFA 5M1QA 3Q0UA 4G9YA 1SD7A 2GELA 1FT9A 3S2HJ 3LDOA 2A6HF 4C8QD 4YDUA 2W0ZA 3ZQIA 1KZHA 1SHGA 3M9QA 1E6HA 2QAZA 3QMLA 5KPZA 3X25B 1U2WA 3RZDJ 3FXKA 2ZCWA 2PVDB 4KIFA 1WHMA 2XGEA 1YQAA 5LFAA 3QP6A 2GV9A 3EGDB 3S8PA 2KT1A 4DV3K 3ME9A 2Z33A 1X6GA 2P5VA 3MMVA 3UB5A 4DSKA 4KKOA 2ZJQF 1RBRA 1XMQK 1YJ9I 2HEOA 4WQ5A 1VQKI 3O4NA 3EUKL 1JKQC 2FJ1A 5FWBA 2DXIA 3UATA 1O3RA 2KYBA 1VSKA 3J80O 1U9NA 1ZLKA 4PJLA 2KZZA 4J9HA 3I59A 4M75C 5JLFA 1RUNA 2BXYA 2W4SA 5AQSA 5EEGA 3OIPA 8ATCB 2WONA 1SL1A 3CC4N 2GF7A 1XDSA 3FXOA 2EGEA 1WPYA 2A42A 3RMQA 3QNOA 2ABLA 3ZL7C 2HI3A 4PSWA 4N41A 2X35A 1X2KA 3C7NB 3RESA 1VF9A 2OTLN 1Q86U 4M9ZA 2JA8J 2WAFA 2FC0A 1LDJA 1XOVA 1O4XA 4Y7NJ 2F4MB 5FLXE 2HHSA 2RI2A 1VSEA 1BIUA 3DM2A 1X2NA 2ASPA 4UUSA 3D2FA 3FZKA 2YXYA 1REVA 1HU0A 1TKZA 4CCHA 4FSXA 2LCSA 1YITT 4CGIA 1L0OC 4GY2B 1F1ZA 3DBRB 3R3LA 1BJAA 2V1DA 1NGGA 3KIOA 5GAMg 3PLAA 5F6FA 2CQKA 3DLLA 1H8KA 2DFEA 5GAMd 1QQIA 4WF2A 1Y7XA 5ERIA 3E9GA 4XAXB 1X1BA 2GNCA 4PHTX 1W1WE 5J1UA 1V55H 4DTXA 5I21A 1NK4A 5C4XJ 3MFKA 2WSEE 2KIFA 2ZJRL 4UXNA 4FPAA 2KRCA 1IN7A 2OJED 1MNMC 4M7XA 1WEIA 2HQAA 1FSEA 2XO7A 1ACMB 4B3XA 1ZARA 2QTVA 3PIPL 4EVVA 3AAPA 3KP3A 3QEWA 4JX6A 2QTDA 2E1NA 3SB2A 3CJ9A 2EB7A 1M3BA 3IDHA 4YOUA 2X9HA 2EPDA 3EH1A 1YAGA 4ESBA 3HDDA 3NEUA 3MWPA 1TW3A 2EQMA 3MEWA 2D1VA 1AOYA 4U0YA 1FOWA 4N0AC 1S8NA 1VQOA 3P9CA 1G4DA 2YNHA 4XBFA 1YVUA 2FPDA 5GAOl 4HQEA 2HZDA 1YQLA 5CKHA 3CLOA 3PFYA 3QPHA 2EW3A 3K4NA 2HKOA 3T9NA 3SFMA 8AT1B 1LUJB 4JKCA 4K41A 2AJQA 2PLYA 1I3QJ 2O7OA 3WU0A 2A05A 4CE9A 2WY7Q 1ZH5A 4RTZA 2RE2A 2B4JA 4YIRX 3ASMA 3B6AA 2GOXB 2XF7A 1TBXA 4WXCA 4XRSA 2QGUA 1BUPA 5CKFA 1M4ZA 3PJRA 3E9FA 4M3UA 1TL1A 1AD5A 2Y2ZA 4A5AA 2RKHA 1ZBUA 3RKWA 4R5PA 1QHHD 4DV6K 1TC3C 4IO9F 5GADP 1K8AU 1XTDA 5K5QA 1Q9YA 2G7HA 3J80K 3KFWX 2ID6A 4EV0A 4B1VA 2CH6A 3RDVA 4EW4A 3VEYA 3GEZA 1V54H 3H41A 1WHHA 3ABLH 2VGNA 3PUBA 2BZ8A 3SQ2A 2H09A 5GAN6 5AIQA 1GLNA 3J80Z 2QKMB 1H8AC 4RM3A 3HOTA 2QASA 4LF5K 2HQXA 5CR2A 3WGGA 1TXQA 4KULA 4M73A 1M3HA 4C23A 4HA8A 4FWKA 4B9UA 2Z5UA 3IH3A 2F7TA 7AT1B 2DPNA 1VQON 1YIOA 3KK3A 4M78E 5AZJA 4PA1A 1AOJA 3PGGA 1X9WA 2HVQA 3EUHC 2BZTA 2W7NA 1FIAA 2NUPA 2BGGA 4OKJA 1PYVA 4OMQA 4AI5A 5C3EJ 1KCFA 2ZO4A 4OIRF 3SUNA 3CFRA 4P96A 1ZHFA 4FWRA 4DQQA 3M53A 5TRDA 1Z7LA 4GNIA 4HSBA 2R7QA 5IHKA 2OA8A 4F7ZA 3RR7A 1HDPA 1KQSS 3PM1A 5FU6B 5FKMA 2OCEA 3OMGA 4A0YA 4LB5A 3KLNA 4ID5A 4J19A 3GVAA 3SFZA 1K6OA 5HBMA 3F0ZA 3V8LA 4LUEA 1XN7A 2PUOB 1BKBA 3G4ST 3SJHA 2QENA 5E1ZB 5IT9Z 2CS3A 2UXXA 2KJBA 3SBTA 3M0UA 5IN1A 3TO9A 3TAPA 2FU4A 2OPQA 2M34A 3WTVC 1ZBFA 2RN2A 2D1KA 3WG7H 4KTZA 4EJTA 4FJ5A 2BY3A 3BCBA 4B9LA 1SAXA 2K7AA 4C8QC 1FMWA 5M1NA 3K5NA 1MV3A 2IVWA 3DB3A 3CWAA 3E19A 3NDKA 4IURA 1X1CA 4MLEA 5EXWA 3EE8A 1OJLA 3CPFA 4LN2A 5M3MJ 3CJAA 1FMVA 2XHIA 2X4WA 1Z9CA 3BLYA 2GOMA 2QKKA 3MCPA 3WUHA 1UHCA 5HRPA 1JTYA 2VBZA 5FLMJ 2JWKA 1T3LA 4U88A 1QSSA 1HJOA 2KFNA 1JXMA 4LGWA 1N78A 5LJ5f 5C25A 3EG3A 2ZFWA 4ENKA 4V19S 1HQCA 2V6EA 2P5LC 3K4JA 4YFKF 5ICFA 4E9EA 2I5WA 3NAEA 4CFDA 1VA7A 3KX2A 1YITQ 1XDUA 3SUQA 3BR1A 1JCGA 1BGXT 2QWMA 3BCAA 4Z4HA 2PFUA 3JSPA 2Z1HA 4DR1K 4DZJA 3A2FA 1JJ8C 2F5EA 2QBYA 1TW2A 2E41A 3LAMA 4DA4A 3UR3C 1RT4A 2RDPA 5FO5A 4RAFA 1AHJB 1KU3A 4Q48A 2YJFA 5LJ5h 4CZFA 5GAOp 3JS6A 1MGTA 2UXCK 3DPUA 4YPHA 2X3WD 3AG4H 1I1JA 3J7YP 2I0NA 1D09B 2CW8A 3V4GA 5ED4A 2XV4S 1I5LA 3AARA 1LWVA 3KLEA 2Q1ZB 2ZM6K 4F7UB 2E34A 2IW5A 3GCMA 2NVQJ 2SRCA 4C5HA 2ZPBB 4BROA 2CUEA 5HRSA 3I4NJ 2AK5A 3O3GA 4AHCA 1FIPA 1GL5A 1S72A 2KRSA 3A03A 1VYVA 4ZDPA 3RMAA 3LWIA 1AWCA 1DLOA 2M7BA 2D8HA 3CXCM 5HLIA 1KEAA 4CK3A 2P9KB 2PNIA 4AQYK 2F6CA 3EGDA 3C3WA 2HBMA 2COBA 3PX4A 1LFUP 3A5ZB 3I56T 1BDGA 1W97L 4QT7A 2BIVA 4ZZLA 3VDXA 3W2WA 3QDRB 4L9NA 5C24A 3INZA 3B6PA 4DU1A 3MO8A 2KQ2A 1V1CA 2VASA 1P90A 4O8UA 3QERA 3I54A 2AZVA 2LZ6B 4EJYA 4MFBA 3J7AP 4JD2B 4FM0A 1B9DA 1GVJA 2M4GA 3QIOA 3F8FA 1W4SA 3MEGA 5EF6A 4O5FA 2FSWA 1EO1A 4HWIA 2IG0A 3VEPA 4IIOA 3HPOA 1QGPA 3OOUA 3RCOA 3BGRA 1ZQ3P 5BOXA 2I2LA 1XMKA 1TT0A 2P5GA 3MK6A 4O0IA 3HIFA 2BYVE 1ZBLA 3I0XA 3NH1A 3CJNA 4XU0A 3C7NA 4MMKA 4LIUA 5CVJA 5AQQA 4CHYA 1U5TC 1KHCA 4PJNA 1HOMA 3BTIA 2CT4A 5C2FA 3SYZA 3M07A 3HRTA 3PNYA 3E66A 3BROA 1HNIA 1JXSA 3VUZA 5IT3A 4DNCA 1JJ2P 3ZQFA 2JLEA 4TVRA 4ZYGA 3PSFA 1OKRA 1D5VA 3DU6A 2VG5A 2QWQA 1YJNT 2LVMA 3GTLJ 3PNVA 1N25A 3H8ZA 3CCET 3NH0A 1SVLA 1SFEA 4B21A 2E60A 1UMQA 2EQRA 4A54A 3DKYA 3WU2C 5ICGA 3LPUA 4Q5SF 2FRHA 1ETOA 3QQAA 2CZ0B 1J2XA 4C0ZA 5J4YA 4C5IA 4DV4K 1TGOA 1ZSGA 5J2MA 2KRHA 2RO0A 1X1AA 2DT5A 1GDTA 1Q7YR 1QO0D 4M3EA 3TW6A 3C94A 4BXUA 4CYCA 4M7DF 4IVNA 3FWEA 5GPAA 1WPKA 2DIQA 3JRZA 5AYFA 3AA2A 1Y6IA 1IHVA 1WAFA 3FZLA 3J7ZO 2OZUA 3BEXA 1KG4A 4LSNA 1VQPA 4G1QA 3V42A 4BYYA 2PJPA 4JJCA 3UKUA 1B8IB 1OZ2A 1DKGD 3HHGA 2LRQA 5AFUH 4Z8AA 4EJUA 4BE2A 2KDZA 1YTAA 1UB4A 3AG1H 4OMPA 1I5OB 3G4SQ 4N5SA 1OISA 1YX5A 3S41A 2DTZA 2ECCA 1NGNA 1WNLA 1NK7A 2P9UB 1BI0A 4HOBA 2MCNA 1KU7A 1SKRA 3KZIC 3F9MA 3R8EA 4YOVA 3MKLA 5ELZA 1ZR4A 1UUEA 2DJZA 3A1PA 3M0RA 4A4HA 2HBJA 2LDUA 3TAMA 3TR8A 1XS9A 2X1EA 1G99A 3P7NA 2E1CA 2IGNA 4CFCA 4YRVA 2P9SB 1XNIA 5HROA 5GAMh 4QQGA 3O6BB 3VQQA 4MQ9F 2JVGA 1QVFP 1Q86C 3QIPA 1ETVA 2LNVA 3UA6A 2E8AA 5DV5A 3EHRA 2COYA 2PTKA 4DBQA 2HHXA 1S3JA 4PJMA 3VTIA 2KHMA 2LBFA 4GGGA 1JJ2A 3CD6T 1Y1VJ 4KH6A 5LJ3f 1SMTA 2ELKA 3IHOA 1C1CA 2A5XA 1R0AA 4IUTA 3VB2A 2E1YA 1CLQA 1ZBJA 4NCAA 4NL2A 1QSLA 4OGCA 1AWXA 3M8QA 4C1NK 4BRKA 4EZ6A 4ID1A 3KLFA 1JO8A 5EGOA 1RZ4A 1XUPO 1YIJA 2X3XD 1VQPN 1JEGA 2YX4A 3VEXA 2V7ZA 5KAIC 2JTMA 2DMQA 2CJJA 1NGFA 2LJ0A 2QF7A 2A37A 4BRAA 3EKSA 4UB6C 5AQYA 1MPGA 3F73A 2TRTA 5HODA 1LFPA 2DTHA 2M4KA 4OIQF 4FXDA 1UJ8A 3K2PA 1YCSB 5J1EA 3GTJJ 2G8UA 1TTYA 4HUFA 3M55A 3SMSA 1JRIA 4C3IJ 1X43A 5MLCQ 2N8GA 3DTIA 1K78B 4DFKA 2FD5A 5CZ1A 1TWGJ 4LDVA 5IYDJ 4M77E 3V9WA 3C95A 4O5VA 4PQUA 5CKBA 2VQEK 2E10A 1N77A 3OYBA 3LLRA 4ESRA 5M5XJ 4M75G 5ADXH 1XGOA 3TO7A 3HKZA 4DIQA 2HL5C 1QPIA 3O3HA 2MGQA 1ESVA 2E6ZA 3DB4A 5CZ2A 1KD1U 2R93J 4ETSA 4PL8A 3AVGA 1R0CB 2HKQB 1J75A 5GAN2 3KK1A 2D0OA 1WUAA 4I7HA 4B44A 3AHUA 2YHXA 1POGA 1S1UA 3T1YK 4RUGA 2KIMA 4I6MB 1HNWK 3I56Q 5HY6A 1JKRC 3H0IA 5JVGL 3X28B 2OFIA 1MIJA 1GLCG 1SD6A 2HBKA 2LT1A 2WBMA 2E4LA 4LF7K 1YN8A 3OW2A 3CCRI 4QW2A 4XOTA 1YJWN 4Z2YA 3DPLC 2D5RA 2R5ZB 4JYAK 2V8JA 5KYUB 1YIJN 2DBMA 3ZX3A 1LFBA 5LMUK 4JK1X 2H1KA 3HT3A 2VT2A 4A3GJ 3L4QA 4HSRA 2CT3A 3QPTA 4F9OA 1SHFA 3H92A 4NCGA 1QZEA 1K73U 4BGDA 3J81E 2VVKA 3VQPA 3ML6A 4FK0A 4CYDA 2Q3SA 2JGUA 1NM7A 1RILA 4XLEA 3A8YA 1EX4A 3A5LC 4IOAF 3IRXA 3C6HA 4RBOA 3CCYA 3GMEA 2R7VA 2DK3A 4E1NA 4RMNA 5FU6C 2LKXA 2Z9OA 1YJNQ 3QICA 4DOZA 2CSOA 2K40A 3CCEQ 5F1JA 4DR4K 2Y1JA 2ASMA 3GL1A 1H0MA 1RDDA 1OX9A 3GX4X 1Y56A 1N6AA 1GCQC 3H3UA 4AU7A 4I99C 2LMJA 3PX0A 1TWHJ 2QQBA 1GRIA 3OOPA 5TGTA 3CM6A 1DIZA 4AG2C 3ABUA 3DLBA 2P1JA 2DTOA 4XQFA 5D6YA 1KHIA 3CMEI 3CF5F 1L5UA 3IWZA 2P4RA 4CJ7A 2YT6A 3T0YA 1U0JA 2ZJPF 4FJMA 5J39A 3ZX0A 1YHQI 3OW2M 2VXDA 3M4YA 1KONA 2Y1IA 4KAZA 2DYSH 4AWXB 2Y9YA 4F7UA 1BO5O 4KDPA 4BC4A 2EFIA 4E7LA 2GBQA 3CJQB 1SV5A 2DTUA 5CK9A 3W6VA 4XTZA 4OKEA 1GLLO 3M3YJ 2W84A 2L7KA 3CO6C 2L3SA 3FJ5A 1WJCA 1LNXA 1WHUA 4K0KK 3ZX2A 2BE9B 4K11A 1PD1A 1H89C 1Q95G 2P9KA 5E8IA 5AQOA 2MC4A 1F9NA 3KBGA 2GWRA 1Q82O 4BQZA 5K7ZA 4CC7A 3OYEA 3BR5A 1T8EA 3U9GA 4FT2A 4A53A 3BR0A 2OZ6A 1K8KB 5I2MA 2FBHA 3E9OA 1O3TA 5AIPA 3QO9A 1SSHA 2C0TA 4BRNA 3HVRA 4RTXA 4DS4A 4KISA 5DUKA 3JRIA 4JD2A 1FKPA 2X4HA 3LWFA 5HK3A 3K4CA 3KP7A 3WNFA 3V9XA 2UXDK 1G59A 3ZSZA 2LF8A 1TAUA 2E88A 4C92D 3HOUJ 1U49A 4NNJA 1VIEA 2CGKA 4F3QA 3I55I 1QSYA 4ZGJB 2RKIA 1CZAN 1VSFA 1VQ6T 3CMAI 4O44A 1ZG3A 2NOHA 2HQNA 2CGPA 4PY5A 3SUPA 1IKWA 4OU0A 1RC9A 1W7PD 5KGWA 5GAHP 3ZMTA 3HUGA 2P9LB 2BTTA 4RW4A 4N9IA 4AVPA 3AVFA 2L02A 3HP6A 2L0AA 4BRQA 2A6TA 1NZ9A 3QWXX 4KH1B 1TTHB 2KMUA 4M6VA 1TQIA 1TK5A 2QM1A 3TABA 2OANA 1ZGWA 4EJWA 4FWLA 4CJPA 5I9EB 2IVPA 3RVCA 1EWRA 1HKBA 3O08A 1ZUYA 2DOAA 4KITB 1ZN2A 4OIOF 4N0AA 1QNTA 3QZ5B 1IUYA 3UA7A 2H6BA 3PIOL 4A3LJ 3HSEA 1S29A 3KP5A 4FYDA 4EMGA 1UAXA 2K9GA 2B9SA 3K59A 1SKSA 1YCYA 3LDPA 2PBIA 1V4SA 5F0HA 4RGSA 3ENHA 4QAGA 3JV3A 1NKCA 1U2VB 4BY6C 3H6ZA 4CW7B 3CPWM 1Y8RB 4QVDA 4E47A 1BI4B 5GADJ 4HVVA 1R23A 3NQOA 2EJFA 4QPOA 1FBSA 3FIWA 5D8LB 1DP7P 3W6KB 2HBLA 2XSJC 4CJRA 2H56A 4BNCA 4MTDA 3OBWA 1EF4A 4Z6YA 1LJ9A 3CCVQ 1X3WB 1Z3XA 4DSEA 4RB1A 2OPSA 3OS2A 1HQUA 1IO2A 3THVA 2QWNA 1V5GA 3G73A 1HYVA 2DA9A 1CXQA 4HTLA 4KB0A 3HZ6A 3EGXB 4OINF 4RGRA 5BPDA 3R0JA 5GMKl 2LKPA 2UUZA 2H3EB 4KHQA 1WSUA 2IIMA 3H0HA 4RTUA 3VYTB 1YTYA 4HNVA 2NNNA 1XG1A 3ZSXA 4KYWA 4J9CA 3ERMA 1NGCA 1HC8A 2KL4A 4B8XA 3CCQI 3TTDA 1LJOA 4X1EA 4LXCA 4JV5K 1HUXA 3T1HK 5BMZA 2IS4A 1C1BA 2QUFA 2JMCA 1ASVA 3JCMf 3HTVA 4IUVA 2FBKA 4CDGA 5C0YA 3ERED 2L7MP 2NWMA 4II2A 3ASOH 3OSSC 4LF9K 4BACA 3E7LA 3A1YA 3DMJA 5KHDA 1QA6A 4RKUE 3M57A 1ULYA 1UHFA 4FJJA 1NKUA 2G0EA 2MLGA 2E6MA 4M3YA 4WE1A 3F5TA 2XIGA 1SVMA 4QS9A 1D0YA 3FMSA 1Q8IA 5J2QA 2CZ6B 1BJZA 2PQ8A 5DCMB 2MIOA 1P2FA 2HSEB 2DA7A 3PFSA 4B3RK 2QKBA 3ELKA 4M7AB 3JCMh 4DF4A 1P4WA 1I94K 3IC7A 3E3VA 2Y4XA 4B9WA 1K78A 2HL3A 3BFMA 5GMKi 1OCPA 1S6PA 2PUKB 4FSSA 1E3MA 1VQ7A 1NJWA 3SV4A 3EZ5A 4EA4A 2XAQA 3ID8A 2FA5A 3KYLA 3M3ZA 4XEIA 2JW4A 3NNQA 3KLGA 3CXCP 3HGYA 2ASOA 1W2BM 2BDPA 4PKGA 1A36A 4FYXB 3M1EA 1AA7A 5KN8A 3VF6A 2QWWA 1RUWA 4J6WA 3WGHA 3ZMZA 1VQOT 1YI2I 1M8VA 2DK5A 3VGKA 3A2KA 1T6DA 4I6MA 1ZXOA 1X3UA 5JVTA 1RDCA 3NMZC 4F17A 3GFLA 1M3QA 2P9PB 3GZNB 2NUZA 2OJ2A 2Q0RA 3GXOA 1S1WA 4D8KA 4I09A 1QLYA 1IV0A 2V7YA 4XTXA 1G3TA 2L2PA 2CW0F 2EX3A 2J5OA 2XPVA 4XN0A 1QVGP 2HB5A 3OS1A 1TSFA 3KP4A 3TMOA 2LG4A 1GXIE 3ULEB 3OSFA 1K9MC 1L3SA 4KTWA 2BTFA 1YJWI 4CF9A 1KAYA 1RAFB 1Z91A 4E7IA 3NF7A 4DR6K 1WX6A 3VMFB 3HOYJ 4FW2A 2A68F 5FKKA 2JOYA 2ZXJA 3E9PA 1TS9A 1IN6A 2GIZA 2WOMA 3S15J 4KMUX 3PQKA 4II1A 5B1BH 1CGPA 2EIMH 2MSYA 2XKOA 1VQ6Q 5FD5A 1T8IA 3N5NX 3NCIA 3SPZA 4LLLA 2YHAA 3WNEA 5HDNA 4EM1A 1FWZA 2WAQA 3QAHA 4QQ6A 1TQPA 2HXOA 1LE8A 4J9BA 2LMDA 1RAAB 1OEBA 2DE0X 2NYSA 1VQ7N 1MUDA 1Z7UA 5FWCA 1H3HA 1ATRA 4PJOD 3GOIA 3VS7A 3K10A 3JAME 5M1KA 3V1RA 1XTAA 3GPLA 3D5LA 4M3GA 2KBTA 2J7IA 4OP0A 4CJTA 4GO1A 4CEFA 3I0RA 1YG2A 4PGGA 2KXDA 4C92C 3PY8A 5ICEA 2DMOA 5IY5H 5D5WB 2K5CA 1VFCA 3M1CA 2P6TA 2A5WA 2WFBA 3VYRB 3DOLA 4LF6K 2O4IA 1RNHA 1PU6A 5LD2C 4MZMA 3BG3A 2MPXC 2NAZA 4N4NB 4D0PA 4UY8O 3QFPA 3VYGA 5GMKe 4KA4A 3IL2A 1PM3A 4CHZA 1N27A 2H1LA 2VUBA 3PL8A 4M7DE 3MD2A 2DYBA 2KW4A 1QCNA 3K4LA 5BPLA 2G8WA 4YORA 3WG9A 5D3GA 2GXGA 1EH8A 2K9QA 3IRQA 5FFZA 2DT6A 4N4GA 1X2MA 4E7HA 1SFXA 4H5VA 4DU4A 1ZRFA 4L5IA 5GIPA 3DBHB 4BRGA 3S93A 4RCCA 4QLCU 4M7AD 2ZJ2A 1BG3A 3NBPA 2VUMJ 3GE1A 5CQXA 4B8CA 4II3A 1SKWA 4PKIA 2COWA 3LSMA 4GYGA 3OTOK 3IHUA 1XGSA 4KMFA 4BR5A 3DAWA 3FFIA 2WAQN 3FHNA 3FISA 2RQPA 1OOTA 4BRMA 2KE9A 4RG2A 1U5TA 4M75F 4DEXA 3K2AA 4H03B 5B66C 3CEYA 1CKAA 2ITGA 4IRHA 4CCNA 1VQ8A 3AVBA 1JKPC 1XG7A 4PIIA 3OWTA 4CFAA 3F23A 1ZBHA 1OPLA 3R4KA 1GOBA 1U84A 3HSTB 2H6CA 1Q7YU 1RKWA 1X01A 4J8FA 3D4VA 2JMAA 2IC3A 1XMAA 4ON0A 3CCJI 3M4GA 3WTWC 4FISA 2ISYA 1MH4A 1F5TA 4IG0A 1KC8C 5EY4A 4E4HA 4OVAA 3WU1B 1ETXA 4CI6A 1IBKK 3WTXC 3NGYA 1ORNA 3JRGA 2J5PA 3S6IA 4J7IA 3QNNA 1W70A 3WNHA 2E1HA 1K0SA 1IGQA 4HVJA 3H1QA 3DXKB 3JSMA 1QZ5A 1T56A 5A2QE 2K3PA 3DTEA 1KFDA 3L42A 4LLGF 3CCSA 3CUQB 4R56A 1NMNA 2P9LA 5CY4A 4BY9C 1IB8A 2V1UA 1S7OA 4GVEA 4CGFA 2KTQA 4M78A 4HBLA 2R5AA 3RR6A 1S7AA 5KPRA 3ZMDA 3I4MJ 4RW6A 4GLMA 1TZLA 3T1AA 3AG3H 2QLZA 4V2FA 1W0HA 5GAOn 3HRGA 1TL8A 2KFDA 5F27A 4RTWA 1IGUA 3LZIA 2HQEA 1R1TA 2E4HA 3CQTA 1SMYF 2ME6A 2OYQA 1VQKT 3FE1A 4M77B 3WXKA 1CKBA 5DMRA 1IREB 1TYQB 1VOMA 2HPMA 2YG8A 4GBQA 4CJQA 1VQ8N 2P0KA 1TL3A 2NRTA 4IBNA 1ZG1A 4NC8A 3JTGA 3ABMH 3FB9A 3UKRB 2Q97A 1T05A 2AHJB 4Z4EA 4I02A 3QYFA 3F6VA 2E7XA 4A3DJ 2O03A 1VQOQ 1ITGA 1S72T 2NOZA 4FJGA 1BI4A 2HTSA 3BJOA 5B1AH 1NJXA 2XDPA 1BOBA 2DODA 5HLTA 3SCXA 4PGHA 4DTMA 4ISEA 1RETA 5CQGA 2GX9A 2VC8A 4NO7A 1W36C 3PX6A 4LD5A 5GTIC 2AA4A 1JTXA 3SWNB 2QCOA 3ZP5A 4KFBA 2AS5F 1WVRA 3AVJA 3HHHA 2O01E 4F4KA 2DFIA 4LJZF 1P8ZA 1D9DA 3KD1E 3C6TA 4OLBA 5BRHA 2O8EA 3E6DA 5IOYA 1BI3A 4JI5K 2JA5J 2O0YA 1AT1B 4FX4A 3EGXA 5AZIB 2RM4A 1NM1A 3F8BA 4ZC3A 4DGWB 3J7AY 4JJNK 2KLAA 3GTGJ 3SJMA 1ZG5A 5LRRA 2WACA 2HQHA 2GBZA 2P4TA 3R1XA 3VN5A 2DA6A 4KTQA 1UJ0A 4XQ3A 1QWEA 3L00A 3RQIA 2P6SA 1OCOH 3OYFA 3KETA 2JT4A 1KQ1A 1T44A 3V6DA 3H5AA 3GYHX 3MPUB 1S9EA 2STTA 5KCMA 2HGCA 4CCJA 3CCMA 4LH4A 2R5MA 1XC9A 4A5BA 4H4OA 1NJIC 1AU7A 4FWMA 3VOVA 3MN9A 1QVTA 3CYMA 4KT6A 3DLAA 2WTUA 4RTYA 2MYSA 3GBGA 2HMAA 3K9TA 1M5Q1 4F91B 3IG1A 1YW9A 4JLGA 2GFUA 3SEZA 3P39A 3ZEUB 3CBOA 1B92A 3CMMA 1OCTC 2RGVA 2BV6A 4D7NA 2O8CB 4XORA 1Q81R 1JHHA 3SAGA 1X3ZB 3AVHA 2K3BA 2XI9A 4RB0A 4JKFA 2HQRA 3OH9A 1LPQA 5FJ8J 2IPOB 1Q82R 3M8RA 3I64A 2EAYA 4HEA2 5LL6Z 4O3MA 1MUNA 3K7AJ 5FU7B 3KKRA 4FM1A 2EGAA 2MC3A 2EWNA 5D4SA 2EZIA 3TAGA 3DLLL 1YWOA 2P9IA 1GUUA 2B8AA 2LLKA 2DDBA 5AQKA 4PJOC 2FZGB 2GIVA 2HNYA 3LA3A 3SNNA 4GW6A 2HU9A 1RRSA 1HKSA 4LY7A 4CZCA 2E20A 1VQPT 4HRIA 4IIMA 2NOIA 5GMKm 1NEBA 4JI8K 2XAFA 2W1OA 3G6EI 5KCOA 3CETA 2EZHA 3R0AA 1PDNC 4KGXB 2O88A 3FXJA 4TSXA 1LVAA 3CTAA 4I7FA 2CH5A 3VFZA 1EIFA 4ZNXA 4F7UG 2K5LA 1MDMA 4M77D 2CUFA 4C8QF 4LD9K 1VSIA 5DS9A 3VSKA 4Q4ZF 5K5RA 5JLXA 4ME7A 3CCMN 1TKDA 4UNFA 4H4MA 2PN6A 2MWPA 3QJ6A 3S9HA 2VL8A 1NH3A 4B3OA 4HX8A 4HVWA 2STWA 5FLXO 3LL7A 4CD3A 5C10A 3JR9A 3OB9A 5HDKA 4CJFA 5E41A 1RADB 2O8DB 1VQ4A 3Q1JA 1WDXA 1K4US 4M7AC 3FHFA 4FLVA 2XK0A 3S2WA 2LR8A 1KQSM 1K73O 6PAXA 4CJEA 3OYJA 2JXBA 2YV0X 2YHTA 3K57A 3FR0A 3REBB 1XQSC 2M7AA 1L3UA 4AIDA 3I9QA 2F1LA 2P9NB 3CC2A 4CK1A 1XD7A 4MQVA 2EYQA 2QGFB 1R00A 3B6CA 2K3FA 2ZC2A 2CZ1B 1R0BG 2ELHA 3G3ZA 4J9FA 5AQRA 3ZT3A 1NJZA 2BZXA 1RR8C 4BG9A 2ZMEB 3HGGA 2E5NA 5D6FA 1FLIA 2EKOA 4OMMA 5K7HA 4WWCA 3M5AA 4RAZA 2DA3A 4MQ3A 1ERDA 4A69C 4I9LA 2LFBA 5E18F 1GLAG 2EZKA 5AQUA 3RWUA 3VS5A 4KN4X 4F2RA 4FJXA 4L0YB 4FJKA 4DLGA 3CDLA 2HMIA 1UGSB 2DRMA 1MMGA 1OX8A 1FW6A 1SAZA 1JJ2S 1IRXA 4FX0A 4KN7X 2OPTA 2MW8A 4CIEA 4LF4K 4J00A 2DI3A 3CDIA 1NG7A 5LJ5e 1VQKQ 5J4VA 4ASNA 3CPWP 1TK0A 1VQNI 1T0HA 3CO7C 4N4OB 1D3BA 4WTOB 3G71A 3ZLJA 2VXZA 4RGXA 1NLOC 3PNTA 1VQMA 5GP9A 2VG6A 1N3AA 1S72Q 1R9TJ 3VS1A 1C0GA 3DLGA 4E7ZA 1VQ4N 3NGIA 4N56A 3W2AA 3ABKH 2Z1GA 4ATOA 1ORPA 3PVQA 2OCCH 3MEAA 3CWTA 1SFUA 3CFOA 3O4QA 2DMPA 5AQPA 4XH1A 1MSFC 2PG4A 4EP4A 2VKHA 2FB7A 3U8XA 1NG9A 4IFVA 1ON1A 2WSFE 4IFYA 4P5OA 2DXBA 4OAYA 3CC2N 2CUJA 2JT1A 4B47A 3HL8A 1VSJA 4B22A 2K2MA 2Z2SB 4IFEA 4UVCA 4DHYA 2W00A 1Z77A 4L9TA 1QTMA 1F21A 1JLBA 1M1KC 2HF4A 5DK5A 2Q36A 4JI0K 3R6SA 3V8KA 4JKGA 3CLQA 2UWMA 2R7OA 1K76A 3I56A 3M8SA 4CZJA 3NMUA 5JS2A 1VYUA 4WF9L 1ONVA 3BG9A 5D5UB 2CO5A 1U8RA 3SUOA 1TUGB 3LPTA 1TUDA 4EZ9A 1VNDA 1QHAA 4HHTA 3KK7A 1OPKA 1XCVA 3TSQA 1RT1A 2IOCA 2OZMA 1WH7A 5FLXK 5B8HA 3WXJA 1C0UA 2MAMA 3K0LA 2KFZA 5DTDA 5GAEJ 2Y30A 4IOAL 4DTPA 1QVFS 5IHIA 1BI1A 2IXSA 1Y1WJ 2EILH 3TL4X 3AT1B 1HNZK 3E5XA 1Y0MA 3G71N 4CCKA 2A3SA 1J53A 1XB4A 1RDAA 1SPKA 3C6AA 5IT9E 2QQSA 5E26A 1VQMN 3CUQA 1U1SA 3NFCA 2CP2A 1XMXA 2O5RA 2XY5A 4XR6A 4DV2K 3MCAB 2KYMA 1SSFA 1UHWA 5LJ3j 1NNEA 3LANA 4R1HA 3SK3A 3TAFA 1QU3A 2AZSA 4DSJA 4AF1A 2QEXI 1VSHA 3IKTA 2HSTA 3KYDB 4EP5A 2IS3A 2W25A 4DSLA 1W5SA 3SD4A 3E1YA 2DM1A 1E3PA 2VJ5A 2WY8Q 1ZSZC 2ZJPL 1HF0A 4QVZA 1WHLA 1BW6A 4M78F 4DQSA 5FGMA 3THXA 4M77A 1JXOA 4BJ6C 3V7SA 3K9JA 1HRHA 4CC2A 3HM9A 4AH9A 4U0WA 2PJRB 4OMOA 1G15A 1VQPQ 1T0FC 2VQFK 3HXLA 3QPSA 1H9GA 1X4PA 5BREA 5BPNA 2EFNA 3I56N 3BPVA 3FKIJ 2F9WA 2XROA 2XY6A 1DPRA 5GANf 5JS1A 4XSXF 1BL0A 4W5RA 1PSFA 4G12A 1WHKA 3RTVA 3DTKA 3H0GJ 2W57A 4BUPA 1VSMA 3QBYA 2BHZA 4AFSC 1G8XA 4M74A 2H27A 2RI3A 4NB5A 2HDDA 2DOFA 4B6MA 3C6UA 2DT7B 2UV1A 5KYYB 3H5NA 4XKVA 3SWNA 5F0CA 2QYOA 2L9SA 2JSCA 1ZYRF 4IHWA 3JCMP 2NOJB 1K61A 3VODA 3F3XA 4DFJA 4IUUA 2E1OA 1W4MA 5FPNA 3SQ1A 2MF2A 5JMVA 5GANh 3FHGA 1R4NB 5AZIA 1Q18A 3LA7A 3T8RA 5HDGA 1X58A 1C0MA 4PKHA 4C92G 1YNZA 4FWOA 5FDLA 3EKUA 5GAMe 3ZMSA 4JAXA 5HOOA 4GV3A 3TDUC 3CC7A 4F04B 2M8EA 1VQ5A 2DXCA 3TAEA 1YJNN 3META 1MU2A 3I59B 3RJPA 3Q3SA 3GF5A 4BBRJ 3CCEN 1YITI 2XGCA 4BGBA 1ITYA 5HVQC 1Z26A 2KI7A 2M02A 3JRBA 1JUMA 5KYWB 3M0TA 4B4CA 4LFCK 4IO8A 4XM3A 2V8IA 3CD6A 4MLHA 4I2OA 3TTFA 4E7JA 2HHWA 3VSLA 1MJ9A 3MEVA 1KFZA 4G7HF 3O9TA 2B6AA 3RDIA 3JCUC 2RA2A 1RT3A 3ZEUA 2L5QA 5B5EC 1IHWA 2I8DA 1ETWA 5GJVB 4FWNA 2O8CA 4I01A 2OAWA 4UUSB 5IYCJ 2BANA 1YTUA 1A31A 4CZZA 3OSVA 4EDUA 1IBLK 4OOIA 2E1MC 2VG7A 4DK9A 2DKGA 4M3RA 2EIJH 1HW5A 2G8FA 3ZSOA 3PFIA 3MN6A 3M59A 2R7FA 1S1XA 3RPQA 4LFAK 5ILUA 3TO6A 4M7DB 1YW8A 1E4FT 3H6EA 3SEMA 1LB2A 2NNWA 2EPFA 3VEOA 4ZYHA 2HYGD 2ZBKA 3FZHA 4GCVA 2UUCK 5IAYA 3VWBA 4X0GA 4JJBA 1SL2A 3LZJA 3D6RA 3F8MA 3MDQA 5J3LA 4L5GA 1BR2A 2OA4A 2KEAA 3BQZA 1TT5B 1VSLA 4IG3A 3ABTA 3F22A 3COAC 3EHQA 3CC7N 4RAGA 3M6GA 3TSUA 1VQ5N 5K1YA 2L89A 3A5NC 5KE3A 3KEOA 2ELJA 3UT1A 1N9RA 3JB9G 4DKWA 3KWIA 2GQIA 3MCZA 3ZCOA 1ASUA 1UZCA 5L3BA 1U5SA 1UCRA 3CCLA 3BWGA 1QP3A 1IF1A 3CD6N 4A4EA 4M75E 2NVYJ 5IP9J 3RRGA 1WI9A 2MK5A 4UB8C 4MDAA 1V4RA 2K86A 4Y17A 3EUAA 3NGPA 1QMCA 2O8DA 3LH0A 3HOXJ 2CREA 3OBYA 1YRNB 1B72A 1AWWA 3HL2A 3TANA 5EG0B 2L7FP 1UAAA 1FYLA 2OQGA 4BJ5C 4A63B 1MNDA 1TUUA 4EJZA 4RTVA 2Q2RA 4EIKA 2DCEA 1JUPA 3AVAA 1XSDA 4B9SA 2F4IA 2ZNZA 2R3SA 2E65A 4NC6A 3L2VA 3ZMUA 2ZMEA 2KXCA 3HI0A 3VQEA 2F5KA 3ISPA 2L8DA 4MO4A 3GUDA 2CP0A 3G0QA 3HEFA 4ZYAA 3HRUA 4V2GA 2X6OA 5LY3A 1ENHA 1IKYA 4F3OA 4IQ4A 2R5YB 1M90O 3OYLA 3AGRA 3DRSA 1HLVA 2Q0OA 1KIKA 2LT4A 4H5WA 2JSPA 2R7XA 4P1WA 3ZETB 2Z16A 1VRLA 4CICA 3VERA 1LMZA 4CZEA 3X24B 1MMDA 2FOWA 3I35A 1WGSA 3DEUA 2NLXA 2VONA 2LREA 3CCRT 1VQ7T 2VOOA 3CCLN 1M1EB 3WODF 5AZJB 4LIVA 4XSZF 4JI3K 2X1CA 3A0IX 2G8VA 3ULDA 5C6SA 5I11A 3QWYA 4BI8B 2QSGX 3SZPA 1TNSA 3G4SI 2FZKB 3HM5A 2CH4A 2QGGA 1UTIA 3F6OA 2DRKA 4B9NA 4OB3B 1HYOA 1R8OB 4B3MK 1RI9A 5KVRA 6AT1B 2QK0A 2VN2A 1TUCA 2M9HA 3I4PA 4W5OA 2HYFA 5J26A 3H08A 2EIKH 4OIPF 2VQLA 5F1XA 2OF7A 4JOMA 3M4OJ 5I3UA 3BDUA 4FM2A 4BI3A 1P92A 4YOTA 1S3XA 4XLNF 1XC5A 4ZYEA 5HP1A 3JRHA 2DVEA 4G94A 1LWEA 1VQLA 4OGEA 3CCUA 4HUGA 1JT6A 3L2CA 2A61A 3QRFF 3QEIA 1YQKA 2X4YA 3OMCA 3GBQA 3QYGB 1WYXA 1CXUA 1HSQA 2H3GX 1KAZA 1Q7YO 3M0PA 2K4YA 3PUFA 3V7RA 3RBBB 2V1XA 2CMPA 3CMET 1XHZA 1SL0A 2IGKA 4KGVB 1Y97A 2HSPA 3K1PA 1BIBA 5LJWA 2NYXA 4MO7A 2A3ZA 3R6OA 1HA8A 3BZ6A 2PZSA 4CEDA 2Y31A 4J9EA 4PJOG 4D7MA 5AQJA 2E5ZA 1NGDA 1JLAA 2RMOA 4X64K 2AHQA 1FJLA 4NQWB 2KT0A 2IGOA 4J2EA 2MD0A 2LOOA 2A5YB 1VQ6A 1PSEA 4C5EA 2A69F 4DV7K 4ISGA 3A0HC 4A6EA 5D6WA 2DTRA 1RAEB 2BW3A 3AO5A 2IVMA 1K1ZA 1F4KA 2COZA 1VK0A 2XPUA 3ZYYX 4DQ2A 4EMKC 1AEYA 1I4K1 1HD3A 2EA2A 5M3FJ 4XRFA 4FYWB 3FXQA 1C1AA 1M3CA 2QBYB 1ZRCA 1Z25A 4J2BA 4AT1B 3TGNA 1GOAA 1FMKA 1JLQA 1LAVA 2HOSA 3RPUD 2PJRA 1T3VA 1VQ9A 1VQLN 1BU1A 3CCUN 3LMMA 5CQEA 4KO0A 4ZGDB 4CZGA 4A3JJ 1C0FA 1M8MA 4M7AG 2FL7A 3NARA 3M5RA 2RNAA 3LFUA 4G6TB 2IS1A 1GXPA 3FFKB 2DPDA 1OKJA 4DS5A 2CQ7A 4RTFD 3IS9A 4D9JA 3GNFB 1TG0A 3J81O 5KYYA 1LWFA 5DUIA 5FFXA 2V1QA 4WQ4C 5L23A 2FPEA 5H1SQ 4AIKA 4C8QE 2NOFA 2ROTA 2A1SA 2VGMA 5L8RE 4GRIA 3P38A 1MNEA 3HSCA 5C15A 2RHUA 1Q81U 3FXLA 4ILGB 1VQ8T 2W48A 1Q82U 1KQSP 3ATUA 2CDTA 3QXEB 4FTHA 1WKMA 1VQ6N 4E19A 1ABQA 2ZJRF 3TBIA 3WE3A 3W3CA 4E3SA 4AIHA 1RI0A 1U3OA 4QVCA 4PFPA 4M45A 3IV5A 4KH5A 4B9XA 5KCHA 1RCHA 4M63C 1QVGS 3RI4A 4ELZC 4B3AA 3NWSA 4KHYA 4UNOA 4OVLA 1OYYA 4B9MA 1XGMA 1RKTA 1I39A 1SEMA 4B8AB 2J4RA 1BOTO 3LP3A 1NPRA 2O4GA 5KYWA 2DD4A 2HOEA 1WI3A 5JHFA 3E5QA 1NGIA 4GY5A 3X2QH 1VQ9N 3CCST 2IDOA 4OB0B 3UWNA 4BC2A 2KSSA 4A57A 2RK2A 2H94A 1KQ9A 1MJAA 3HTSB 2W04A 2BHYA 3S2DJ 4GDFA 3B6OA 1FOKA 3U3GA 3L6QA 1FYKA 4CO8A 1HLUA 1VRUA 4YDUC 2OUMA 2R7RA 3QINA 3HZJA 2D0PA 3F72A 1Y39A 3BTLA 4FOIA 2H8HA 4BG8A 2GTOA 4QWQA 3S1RJ 5GAOq 1W0TA 4KHWA 3G0ZA 3R9PA 1NOZA 4U67L 4E7SA 4A3CJ 3DFGA 3C2HA 5E1WA 1QVPA 5EVZA 1O7FA 4IOCF 2CFXA 2LJ3A 2P51A 2DVJA 3CCRQ 1FXXA 1VQ7Q 3JCMe 2ZF5O 1IO6A 1X3MA 3CP8A 1KG1A 4M7DA 5DLOA 2QWOA 1ZKGA 2FXUA 1RTJA 2NRRA 2O9LA 3FC3A 2ZZDA 2Y48A 4A12A 3EPZA 1IXSB 2NZTA 1T98A 4IXAA 2Z3YA 2X74A 2KROA 3IH2A 3M54A 1J0RA 2OTJI 2KHOA 4CYCB 2IIRA 1F36A 4CK2A 1GOCA 1BIAA 1PU8A 1WZ2A 4IX7A 4YFUA 3VQ5A 4NB4A 3FLCO 1TK8A 3KZYA 4EVIA 3EZWA 3UKUB 2DZCA 5KNLA 4IDHA 1YS6A 1GLJO 1WSJA 3L3UA 2FQ4A 1IRZA 2DFHA 4BL0B 4UVAA 1MZBA 4ESFA 4CGZA 1P59A 5CPRB 1S6LA 3Q7CA 1WZOA 4M71A 2YUOA 1I27A 2KDOA 2DNUA 3J81K 2PX9A 3HSFA 2HAXA 2P84A 4J9IA 3CHWA 3DJCA 3U21A 3CMEQ 2FO0A 1YRNA 3VYUB 4NC7A 4LFUA 5EG0A 3FMRA 2ZB9A 3MEDA 3J81Z 5E17F 1MH3A 2QA4A 4NBQA 3QETA 3P31A 4YOWA 4WK8F 5E20A 4QS7A 3CCMT 4DBRA 2X4JA 4CZLA 1U6GA 4BJTA 2VB6A 5M5WJ 2LBFB 2DPPB 3RMDA 4B09A 3N4QA 1A04A 4FJHA 4M3DA 3OL3A 3G1JA 5E3MA 4C92F 4RLFA 3C18A 2B0LA 3T5XA 3RPUA 1NLPC 5EDNA 4M3BA 2XKPA 4BDPA 1REPC 4KUDK 2LH9A 2R5YA 1WHGA 3GBTA 5FB2A 2I7NA 1M2VA 2JMWA 2V26A 5KYXB 3LSKA 4JLIA 3ULRB 1EJ9A 3ZETA 3LWMA 4GLKA 5EGOB 4H4KC 4E7KA 1YYVA 3H9NA 2W41A 3OJUA 2YDLA 1IJJA 5HRNA 3PO2J 2D0AA 4XU2A 1PUFA 4HNTA 1RNLA 2FG0A 1F43A 4C0DC 1FOYA 1I6XA 5E79C 2WTEA 5KI6A 3MXMA 4KBMB 1K6YA 1OCZH 3D5SC 2NUTA 4RG8A 3SLCA 4V2SA 3PVLA 4DTOA 4Y15A 3KVGA 2M1HA 1KC8O 4I2PA 3CPEA 3RKYA 4CECA 4FK4A 2IGMA 3RYRA 1TH7A 5DDGA 5HLFA 1QZ6A 2A07F 2FBVA 3BR3A 3I3LA 4BRLA 1DQUA 1IGNA 1D8JA 2YHYA 4DV5K 1JLCA 4H0XB 1HX1A 5J2PA 4A4GA 1B9FA 2R4GA 2VQHA 3CCVI 1ZAOA 3LM9A 2FUG2 5LGTA 4CF0A 4M77G 3VENA 3KWGA 5JICA 1PRLC 1B34B 1KVAA 2QA4N 1X9JA 2DA1A 2JS2A 2TDXA 2CYZB 1Y0UA 2PMZA 3DKXA 1N39A 3THWB 2R7WA 2GXBA 1RTIA 3GF2A 2E3HA 2A6EF 1SRLA 4FT8A 1TU0B 2M2EA 2QQ8A 3JREA 2R58A 3VS0A 1VQ8Q 3O1WA 4EMHA 4CESA 1K0XA 2GXAA 1OR7A 2MLKA 4EIAA 3VRYA 2DMNA 1BBYA 4WFNL 4U7BA 2JJ9A 2CUZA 4B3TK 1X27A 3ID6A 1HJDA 1VQ4T 1UDLA 5GAN4 4FK2A 2HYJA 3TWHA 1QHTA 3F70A 2HD0A 4CGDA </