3OYGA

Crystal structure of the prototype foamy virus (pfv) intasome in complex with magnesium and the insti compound1 (compoundg)
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
368
structure length
368
Chain Sequence
LDAELDQLLQGHYIKGYPKQYTYFLEDGKVKVSRPEGVKIIPPQSDRQKIVLQAHNLAHTGREATLLKIANLYWWPNMRKDVVKQLGRCQQCLITNASNKASGPILRPDRPQKPFDKFFIDYIGPLPPSQGYLYVLVVVDGMTGFTWLYPTKAPSTSATVKSLNVLTSIAIPKVIHSDQGAAFTSSTFAEWAKERGIHLEFSTPYHPQSSGKVERKNSDIKRLLTKLLVGRPTKWYDLLPVVQLALNNTYSPVLKYTPHQLLFGIDSNTPFANQDTLDLTREEELSLLQEIRTSLYHPSTPPASSRSWSPVVGQLVQERVARPASLRPRWHKPSTVLKVLNPRTVVILDHLGNNRTVSIDNLKPTSHQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular mechanisms of retroviral integrase inhibition and the evolution of viral resistance.
pubmed doi rcsb
source organism Human spumaretrovirus
molecule tags Recombination,viral protein/dna
molecule keywords PFV integrase
total genus 106
structure length 368
sequence length 368
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2010-09-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
A PF17921 Integrase_H2C2 Integrase zinc binding domain
A PF18103 SH3_11 Retroviral integrase C-terminal SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2300 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3oygA04
1.10.340.70 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Endonuclease III; domain 1 3oygA01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3oygA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3oygA03
3JYTA 4IUUA 1DLOA 2P5OA 2HVIA 2KFNA 2RJCA 3HL8A 1UOCA 3Q1JA 3WNHA 4CJKA 3ZCMA 1RT5A 3OJSA 4DTOA 4KHUA 2YHBA 3HPHA 4KB1A 2Z1JA 1LAVA 3L3VA 2D0CA 2EQKA 4AHRA 4C8MA 3V9WA 4DU4A 2EQJA 2OPSA 3SD4A 4AH9A 1X1PA 4DTMA 1LW2A 1SSFA 4FM1A 4O4GA 3AO1A 4AILC 2PYJA 2HVHA 3WNGA 4CJQA 3HO1A 4OVLA 4FJHA 3V6DA 1ZBIA 3KTQA 4NZGA 1ZBFA 3V1RA 3HM9A 5J2QA 2QK9A 1TVRA 1SKWA 1QSSA 4E0DA 2G8WA 1WSFA 4NYNA 3LDSA 4AHCA 5SWMA 4FLTA 1XC9A 1TAUA 1SKSA 4E3SA 4OVAA 1ZBUA 4IUQA 2X4XA 2VG7A 3ALYA 4IDKA 4OKEA 4Q5VA 3VQEA 4PUOA 3E9FA 1WJSA 4FLZA 2FBYA 1J5OA 2G8FA 3DOKA 4W5NA 1KCFA 3ZSOA 4CJLA 4IBNA 4RG8A 3KJVA 4B8AB 1RBRA 4DSFA 4BACA 4DFPA 3SQ2A 3I0SA 4Z4FA 2XK0A 1DTTA 1RDDA 2Z1HA 4M45A 4CEZA 4A4FA 5FRMA 5KH6A 3BGRA 5KTQA 2IOCA 4CIFA 2XO7A 4DS4A 5KRSA 3CFRA 3QESA 2LSNA 2XRIA 4BDPA 1S6QA 4NS5A 3QNOA 3ZT3A 2M1HA 1TKTA 3PV8A 4C5HA 3BDLA 4X34A 3P83D 5E41A 4FLUA 3SQ0A 4K8XA 4FJ7A 3ULDA 1HNVA 3ZT4A 2YV0X 3P1GA 3VQ8A 3PX6A 1W9HA 5I42A 5FDLA 4AHSA 1S1XA 4CJ5A 3AVMA 4CEBA 4CJVA 3C6TA 3LYIA 1RDCA 3AVCA 1BGXT 1NKCA 2QQRA 3FFIA 4IUPA 1VSHA 1S1UA 4E7HA 1X9SA 1KLNA 3QEPA 1BI4A 5HRPA 1I3AA 5JS1A 3DRSA 3HPGA 2HQEA 2A1SA 2XY8A 2LVMA 3WNFA 4CHPA 4DU3A 3KLFA 2F8SA 1HJRA 3G0ZA 1Q8IA 3SQ1A 3ME9A 1WSGA 2E4LA 4F3TA 3HVTA 2ATQA 3AO2A 3RRGA 4EDUA 4Z4HA 3H08A 4J2AA 1D9FA 2QKBA 4IFYA 3OYIA 3MO8A 3TAPA 2HHTA 1ITGA 2W42A 4CHQA 3EY1A 3L2UA 4CRIA 2OPQA 2L8DA 2RJDA 1BIUA 1CZBA 3AVJA 5IAYA 4EP4A 1KRPA 4EZ6A 4KHNA 4QOZB 1NK7A 4LD6A 1EXQA 1T8EA 1RBTA 1L3SA 3AA4A 1ASUA 3SJJA 3S3MA 3C4SA 1S9EA 1UA0A 5IN1A 4QW2A 2GFUA 2YKMA 3HP6A 1W0HA 1U4BA 1QS4A 4CF0A 1UA1A 3VQBA 4CEOA 4DFJA 2XHBA 2D5RA 3L2WA 2JTFA 3F70A 3L2VA 3T3FA 3H6ZA 3E9GA 4CFBA 4CF1A 3NGYA 3HVRA 4CGGA 3CQ8A 2RJEA 4BE0A 3OYFA 3QEWA 4CJWA 4IUTA 4CF9A 3SUQA 3MXIA 1S9GA 2GF7A 3A2FA 1YTAA 3LPUA 1D5AA 2G8VA 2XY5A 3CYMA 4CIEA 3TANA 2R58A 4M3ZA 2BGGA 1CXQA 4FYDA 3DMJA 2IS3A 2ITGA 3VQ7A 3DLGA 3AVFA 5C0MA 3PX0A 3DLRA 3M8SA 2Y1JA 3AA2A 3PO5A 4RG2A 3ASKA 3NNQA 3KD1E 1QHTA 4FK4A 3OYAA 2ZD1A 3SUPA 3FDRA 3V1OA 3OJUA 5I3UA 3AVGA 3LP1A 1N27A 3MEEA 4DQRA 2HB5A 3OYBA 2L3RA 4OKJA 1XHZA 3H8ZA 4HVJA 4II1A 5DMRA 5J2PA 3DLHA 4DFMA 1RBUA 4F8RA 3FLGA 3THVA 4PLLA 4H4MA 1X9MA 1D8YA 1NKBA 3MP8A 3AO5A 4FJ9A 4KPYA 1WLJA 3VQ5A 4GW6A 4FJIA 4HTUA 3F9KA 2RI2A 2VG6A 5C6SA 4H8KA 2EFIA 3ZSYA 4KI4A 1HYSA 1J54A 1A5VA 2EHGA 4OKKA 4BWJA 4AHUA 1JLEA 3OY9A 2IG0A 1SKRA 3NF8A 4N76A 2DFHA 3M8QA 3M8PA 3LZIA 4DU1A 3EYZA 1G15A 1BQMA 3IG1A 4B9VA 3RR7A 5K14A 2R57A 4LY7A 3ITHA 3FC3A 5KRTA 4Q5WA 1BISA 3NDKA 4B9TA 3MP6A 2MWOA 2DFFA 4DLEA 1OI1A 3MAQA 1QQCA 4PLIA 3LX7A 2P0KA 4KHWA 1HPZA 3NHGA 3HYFA 1HRHA 4DSKA 4FLWA 1RT3A 5EU7A 1C1AA 1RT1A 1CZ9A 4NCBA 3AVHA 3AVAA 2KFZA 1JLAA 5KE3A 3K58A 2OPRA 2RHIA 5J1EA 3L3UA 2BIVA 4DQPA 2HNYA 2WACA 4C5EA 4I2PA 1NJYA 3MECA 1S1TA 4K8ZA 1GOBA 1Y97A 1KVAA 3L42A 4CHOA 2OZSA 4Y1CA 4QQ6A 4M3UA 1VRTA 4CJ3A 3PFSA 1N6QA 1S6PA 4Z4EA 1WNSA 3O4NA 2P5GA 4BE1A 3RMCA 3LPTA 1C1CA 1SL1A 4GMJB 1KFSA 1FKPA 4A4HA 4UQGA 4LH5A 2HNZA 4DSLA 4B9UA 4B9MA 4N41A 4DLGA 4JS4A 3AVBA 2M16A 2RI5A 3OMGA 3VQAA 3V4IA 3KLEA 2O4GA 4FJGA 4E1MA 2HHUA 2HQXA 1B9FA 5J39A 4IURA 4OJRA 5CYMA 1NK6A 2K3XA 2O4XB 4KREA 1TV6A 1K6YA 3OS0A 3OYJA 1HYVA 2GFAA 5D6XA 1YVUA 4CECA 3E01A 4CGFA 3L8BA 2A1RA 4N47A 1LV5A 2G8HA 3TWHA 5C42A 2G8KA 2YRVA 4I7FA 2Z1IA 4Z02A 2GUIA 4I9LA 2ZQBA 4Z0UA 4KKOA 4B08A 3ZT1A 4PA1A 1EP4A 2PQWA 4M3RA 4CHYA 5C24A 3OYDA 3SYZA 4L59A 4G1QA 4MQ3A 5HRRA 5KI6A 3TAGA 4FK2A 1RCHA 5CZ2A 4DSJA 4CJSA 3MEWA 3QJ6A 4RW7A 2HHQA 1DTQA 2BUDA 5HP1A 3AVIA 4Z4CA 2ETJA 3KKRA 3LAKA 3OA6A 3MEUA 3O3GA 5M9OA 3HJFA 1NJZA 3TAMA 1EETA 3MXJA 1KTQA 1D9DA 2R5AA 1TGOA 4J2EA 1VSMA 3ZSRA 3MEDA 4OLAA 1WJQA 3LP2A 2NLUA 3OYGA 2B4JA 3LALA 2RHUA 4CGDA 4A4EA 4FJJA 3ZSQA 1NK4A 1VSLA 1UAXA 4B3OA 4GVMA 1KLMA 4DG1A 1Q9YA 3ZSZA 4HCBA 4L8RB 1HQUA 4AHTA 4CK3A 4E1NA 1OZ2A 2JGUA 4CESA 3O8VA 3ZSWA 4DSIA 4QVZA 4E7JA 4M42A 3DM2A 1BCMA 3B6OA 3KK1A 3EAEA 3NTHA 4M3XA 4FJNA 3VQ4A 4KB0A 4CJPA 4B8CA 1MHNA 3LGLA 1NK0A 1TKZA 4DWIA 4HCZA 2F96A 1JKHA 2P51A 4E7LA 3AA5X 1IG9A 2YNHA 3NFAA 3LWLA 2BDPA 4CIGA 3VA0A 1NOYA 2VWKA 1WSJA 3P8HA 1EKEA 4JLHA 3KLGA 4OLBA 1YT3A 4I2QA 2LRQA 3DLKA 4FU6A 1WSIA 3SV4A 3I8DA 1TAQA 1SV5A 3IRXA 3ZSVA 2RO0A 3D0PA 4FJKA 4OPKA 4DTNA 3OMCA 5CIUA 1T03A 3LZJA 1RTDA 1XWLA 4B9WA 4DF4A 3RR8A 4ELTA 3MXMA 2RJFA 2WONA 3QO9A 3OYMA 1RTIA 3L2QA 4FW2A 3L2RA 4BDZA 1EX4A 2I5JA 3ZT0A 4FLVA 1U47A 2DTUA 2R5MA 4CJFA 2JLEA 2E6LA 4DTSA 3I0RA 3LP0A 1WJRA 2E6NA 4WE1A 4EP5A 2RPIA 5J2NA 3SCXA 4C8OA 1RI0A 4CEEA 1LWEA 1UWBA 4ZTFA 3DB3A 3DYAA 4KV8A 2O4IA 3OB9A 2EQMA 4W5QA 3CFPA 1O1WA 1KVBA 3KK2A 1NJXA 2YNIA 4FZZA 5D3GA 1XI1A 1FKOA 3TAQA 4LSLA 1LWCA 2RF2A 3AO4A 3NF7A 3ZT2A 1JLGA 3ISNC 3G10A 3RMAA 3P5JA 5KGXA 4DQIA 3PUFA 4Y1DA 2FC0A 4DFKA 3M9QA 2OZMA 5J2MA 3OS2A 5HBMA 3WNEA 3NTKA 1JXEA 1C6VA 4O0IA 3LWMA 2QXFA 1QSYA 3DRPA 4N56A 2YNFA 4JS5A 4RW8A 1IKWA 3NF9A 1ASWA 4TSXA 2G8UA 2BANA 3NH0A 2AJQA 2X6SA 3META 1WSHA 2OA8A 2X74A 2DAQA 3MEVA 3AA3A 1RNHA 4BE2A 4QQGA 4DS5A 3FEOA 1BQNA 1RBVA 3K59A 3UIQA 1B92A 3TAEA 3U3GA 4ID5A 1JLBA 1KHCA 1RT7A 2HMIA 3KUFA 4OGCA 4CJEA 4J2DA 3K2PA 1U04A 1H3ZA 3P8DA 2DFEA 4CK1A 1KSPA 2RHYA 2QKKA 1B9DA 2R7YA 4B9NA 3V1QA 2RI3A 3UWNA 2FBVA 3QEIA 3K5NA 4B9LA 2VG5A 1GOAA 3OVNA 4DTXA 2RKIA 3OYLA 3SZ2A 2FHDA 1VK0A 2F5KA 4QAGA 2PYLA 3QINA 2IC3A 3LANA 4N4IA 4HUGA 2F8TA 3LAMA 4ELUA 2RN2A 4O5BA 5D6YA 4XIUA 4HHTA 3QIIA 3K5LA 2IDOA 2E5QA 3HPOA 1Q9XA 1ZYQA 3EZ5A 4CFAA 1BHLA 3RRHA 3IAYA 4M3TA 1S1WA 2XY7A 1TL1A 4DTJA 3RMBA 1ZBLA 3PO4A 3CM6A 3DLEA 4FCYA 3AO3A 1JL1A 4Q0BA 3K57A 3NCIA 2ZE2A 2X6NA 2B5JA 2M0OA 4CHZA 1BI4B 2OYQA 5D6WA 4B9SA 1JLCA 4PQUA 1C0MA 4FJXA 3PX4A 3ZSXA 4CFDA 4PWDA 4CJTA 4KTQA 1NKEA 1U45A 2X4YA 3V9SA 4DMNA 4CGJA 3K5MA 4CE9A 1S5JA 3TR8A 1C0TA 2GBZA 2CKKA 4DQQA 3TAFA 3NH2A 1T05A 1SL2A 1HMVA 5CY4A 2RHXA 4HCCA 4KI6A 2HHVA 4CJRA 4CJUA 2YNGA 4RW4A 2P1JA 1Z25A 3UT1A 1U48A 1A5XA 1HQEA 2B6AA 2XY6A 1A5WA 4N4GA 2NUBA 1BIZA 4KAZA 4C8KA 3KKSA 3PNWC 3KLHA 4CCHA 2D0AA 3NF6A 4IG3A 4O44A 4YFUA 1VSDA 4W5RA 4OPJA 3QERA 1TK0A 1QSLA 4OGEA 4C8LA 4J2BA 1MU2A 1JXBA 3NE6A 1TK5A 5HRNA 1ZBHA 3JSMA 2QQSA 4NCGA 2HHWA 4KTWA 4CHNA 4BDYA 4JRPA 1HYZA 4F3OA 4BWMA 3MEGA 4B9XA 4ICLA 4C5GA 4DTPA 2HHSA 2Y1IA 4NYFA 4CERA 3SNNA 1NK5A 3SPZA 2KZMA 4EZ9A 4HUEA 3VQQA 4FZYA 2LTOA 1L5UA 1L3UA 4LSNA 1TL3A 4F2SA 1WAFA 2VWJA 4M3YA 5KE2A 1XHXA 4DF8A 3VN5A 3NH1A 4LD0A 1G5VA 1X9WA 4FW1A 4KO0A 4QQDA 3OQ5A 1JL2A 2Q3SA 3S6WA 4RW9A 1RILA 1KFDA 2LDMA 1HNIA 3DLBA 3KD5E 3RMDA 3OYNA 3RTVA 1Z26A 3T19A 2KZZA 3SQ4A 3TI0A 1GOCA 4FJLA 2LCCA 2DIGA 4CF2A 1U49A 1YTUA 4FZXC 1RT4A 3C6UA 3QNNA 3SUNA 2PY5A 4Z4GA 3OYEA 1CLQA 4C5IA 4CGIA 3QEXA 2E6MA 4CEFA 4FM2A 3S3OA 2B8AA 3LLRA 3CFOA 3QEVA 3M8RA 3HK2A 3OYCA 2X4WA 1WN7A 2IGIA 3O3FA 4DTRA 3TARA 4FXDA 1VRUA 3VQDA 1VSFA 3VQPA 4C8NA 2BKDN 3NAEA 4FLXA 2DY4A 4IUVA 2FBTA 2HNDA 4F4KA 2KTQA 3QBYA 1LAWA 1RTHA 3DI6A 3F73A 3SUOA 2BE2A 2WOMA 4CEQA 3U6FA 4A4GA 4CFCA 4FK0A 2GV9A 1IO2A 1RDAA 1RTJA 2OPPA 5KCHA 3HT3A 3OS1A 3QETA 3KIOA 5JS2A 1IKXA 3LP3A 1RT2A 3D45A 4ZHRA 4LH4A 3NGIA 4JRQA 1BL3A 2IAJA 4PY5A 2HW3A 2KQ2A 1NJWA 3CEYA 3DOLA 3CM5A 3QKJA 4ELVA 3V9XA 1IKYA 1WSEA 4IFVA 3GOXA 4R5PA 1KVCA 4RW6A 4CGHA 1NK9A 2K3YA 1VSKA 1NK8A 4FJ5A 2MWPA 2XDPA 2D0BA 4KRFA 4GY5A 1JLFA 2L89A 4BD3A 1JLQA 2DIQA 3DB4A 2D9TA 4N4HA 5T7BA 3RWUA 1WAJA 4H4OA 4O0JA 1TKXA 4M41A 1J53A 1R0AA 1T7PA 4M3WA 1C0UA 3S9HA 1F21A 3HXMA 3NTIA 1ASVA 1IH7A 2FBXA 2KW4A 2YHAA 1RT6A 4MFBA 1SL0A 4I9QA 1VSJA 1WGSA 4DTUA 3V9UA 5FRNA 2X35A 1QE1A 3V81A 1BCOA 5HROA 1N5YA 2HHXA 1XNIA 3O3HA 1FK9A 4DSEA 3ASMA 1FXXA 4W5TA 2G8IA 4FL6A 2YKNA 4NCAA 3DRRA 2RHZA 3PY8A 3BDPA 1TK8A 3LH0A 4N5SA 3AV9A 5DK5A 3B6PA 3T1AA 4QCLA 4W5OA 3HSTB 3IS9A 3VA3A 2Z1GA 1SUQA 1NOZA 4AHVA 3PMIA 4FJ8A 3K5OA 5CYQA 1OZ3A 3NGZA 4CEAA 3TABA 1REVA 3DLMA 4E89A 4FM0A 3V9ZA 5HRSA 3VQ6A 4FJMA 4DQSA 2O4XA 4KHQA 3MEAA 1RBSA 3U3YA 2X78A 3C95A 2VYTA 2JZ2A 1RDBA 4CF8A 1IKVA 1I39A 4FVMA 4CEDA 5FROA 1C1BA 5CZ1A 4HUFA 1VSEA 4CJ4A 2PZSA 4CK2A 1TKDA 2EKOA 3PMTA 2G3RA 3OYKA 4IKFA 3SPYA 4KHYA 3OYHA 5KGWA 5HLFA 3S3NA 3ZEHA 4E7IA 4UC4A 5J26A 5C25A 3QIOA 1L3TA 1OYXA 1LW0A 3QLHA 2EQUA 4F2RA 1LWFA 3NBPA 5KCOA 3O4QA 3KK3A 1S1VA 3MP1A 4PL6A 3QIPA 4KTZA 3SV3A 3VQ9A 1CXUA 4E7KA 3AVLA 3LGFA 1VSIA 3SI6A 1J9AA 3AVNA 3C94A 1L3VA 3VQCA 4Z4IA 2EX3A 4E19A 5SZTA 4KHSA 4YNQA 4ID1A 4IG0A 4KFBA 4FLYA 3AVKA 3CG7A 3HP9A 1QTMA 4O55A 4ZTJA 3KLIA
chains in the Genus database with same CATH superfamily
2VLAA 5J8CA 4R8HA 1WNLA 2PJRB 1KC8O 2KPMA 1T08B 3KEQA 3S6IA 3SD4A 1MJBA 1M4ZA 4CJQA 3CLQA 2IJLA 1O3QA 2CH5A 3KTQA 2JPCA 5AQZA 2FRWA 2QWQA 4FT2A 5KPRA 2KL4A 1GLAG 1WSFA 4IX7A 3LSKA 1CSKA 1YQKA 2J6KA 1I6XA 2CQXA 2MAMA 2G8FA 2AHQA 4M7AB 3VS6A 1RBRA 3M53A 4CBUA 5AZJB 3AG1H 5AQTA 3L7WA 4EJUA 2X6XA 3PV8A 3M0SA 3HOWJ 3AGRA 2C0IA 3VWBA 1CGPA 3VF6A 4CJ5A 4CEBA 1HJDA 4LB6B 1VQMQ 2EFQA 2ZPHB 2LKSA 2HYGD 4EJWA 5A2QK 2HQEA 3VS4A 3CC4T 4JK8A 4CHPA 2LY9A 2F8SA 1PKTA 3G0ZA 1EWQA 4BI8B 1O4XA 2V4JC 1HR0K 2ATQA 2BE7D 1UFMA 2W84A 1Z7UA 4IFYA 4FIBA 3TAPA 4A3FJ 4KUIA 2Y0MA 3VYSB 1ZLJA 4JKFA 4J9GA 4MFEA 1OU8A 3SJJA 1D3BB 1YHQT 4DJAA 1RDWX 2HI3A 3AL0C 1U6GA 3RDIA 3PIPA 2MH9A 1R77A 3QP5A 4BY1J 3CCRA 3J7YP 1HJOA 4AG1C 1IBMK 5I21A 4XMYA 2L02A 4IRGA 4H5RA 4UOBA 4OF1A 3MEEA 5DM7R 4LITA 4AU7A 4PLLA 1X4OA 2IBDA 1V54H 4ZDLA 2CP5A 4IL6C 3TSUA 1HKGA 4KGVB 4GYGA 3IG1A 3RR7A 4DR6K 1HK9A 3CCLQ 4KITB 2ED0A 3K6GA 1MNEA 1C1AA 5J1YA 2PI0A 2CYZB 3EG9B 4FPAA 3EFSA 5FU6C 4A53A 2MLKA 4F7UE 3C12A 4F7UF 5EZGA 4CJ3A 1Q82O 3JXUA 1G4DA 3RMCA 3DP7A 3JREA 4PSWA 3FM3A 3ZETB 2HHUA 3E6BA 1XB4A 4PKHA 4BRCA 1E2XA 4M75F 2ZNZA 1U2WA 2VGMA 4I7FA 3OW2S 4JRIA 2DXUA 5J1UA 2ECCA 4C92B 3ZYYX 4K42A 3IH2A 3CD6I 1G59A 1NGHA 2CU7A 3CBMA 5IOZA 4M7DD 4IZZA 1YWPA 2K9SA 3VS1A 1AKHA 4B1YB 3VS7A 2OTLI 2O8BB 4Z94A 1YQLA 2EGAA 3ZRGA 2OU2A 4XRFA 3TCJA 1YJNQ 1J6ZA 3CC4I 4M77E 4JDSA 4J5YA 2EZLA 4JJDA 4M78F 5JVGL 1YT3A 3DLKA 2O5RA 4IQJA 5KYUB 3M58A 3OYMA 1S3XA 5TGTA 3WHBA 1VQLA 3MN7A 1POGA 2L01A 1WJRA 1X6BA 1VIFA 2JRMA 3MX5A 3M59A 2YLCA 1FJGK 1LWEA 2VIXA 2NOZA 2O4IA 2EQMA 2YNIA 1XI1A 2RC4A 1BDGA 4M7XA 3OS2A 3WNEA 1B72A 4MDAA 2KZVA 2NAZA 2DDAA 3DBHB 4B8XA 2G8UA 3OV8A 1PVEA 3CBOA 4HWIA 2DAQA 2E2PA 1XG7A 2KIFA 4MMLA 3RKYA 4YHHK 2IW5A 3L1AA 2CDTA 4RTVA 1NG9A 3CJAA 1KSPA 1B9DA 4M7YA 4O5VA 2QI2A 5C12A 2LH9A 4G7HF 1ZSGA 4BU2A 2AT1B 2JQ7A 1WI7A 1OYIA 4RTWA 2E2OA 2BVLA 3REBB 5D6YA 3QIIA 2LY1A 3CQTA 4CC7A 1BHLA 1WRJA 3HB9A 1M1KU 5FWCA 2M0OA 1PU7A 5KQ8A 3I59A 3CMAT 4AM7A 3DLLL 3E97A 4A61A 1KAZA 1N36K 5E18F 3UKRA 3FBIB 3NVKA 3MN9A 1TW2A 3CCST 1CQTA 1DPRA 3OSFA 5HOOA 5GAHJ 4U7DA 3JRAA 1LOJA 1DU0A 4EA5A 4BI3A 1YCSB 3CD6T 1TUYA 4LSNA 5AFUA 2LNBA 4BQAA 2DPPB 2LDMA 1HNIA 1JJ8C 5AQPA 4FJLA 4BYYA 1WSUA 1KG5A 1GVDA 4M75B 5GANj 3GIBA 3ZEUA 1DP3A 2Y69H 2KTQA 2NRAC 5GAMd 1LAWA 3CZ6A 5KCHA 5KNLA 2NRWA 3WXMB 4XOTA 3ERED 1KHIA 2BGCA 4RW6A 4LD9K 4GDFA 2DPDA 2IPOB 1YG2A 3CCUN 3CCEA 2C06A 1W6XA 2ENMA 1PCXA 4M77A 1T7PA 3GEZA 3A0IX 2DCEA 1LNWA 1WGSA 4DV4K 1LWWA 3T5XA 3F3XA 5FKMA 2YX7A 3HOVJ 3LWFA 2XAJA 1HNWK 3G1LA 3BY7A 4BXXJ 2DD5A 5GAOq 1A0NB 1RBSA 3KFVA 4XR6A 1LEBA 3FWEA 1S3JA 4R1HA 2Y9YA 3S3NA 2NRZA 2ATCB 3OL4A 3V7SA 4Q4ZF 3SDBA 2BV6A 2G7UA 1K9MO 1CXUA 1EA3A 3VQCA 1X9JA 1N3AA 4FASD 4ID1A 3PVLA 5GTHC 2GIVA 5JVHL 1ZSZC 4ORZA 3HL8A 4U87A 1AHDP 3HRGA 1QU3A 4NHJA 3P9KA 1WLPB 1R8OB 1MW7A 5IT9K 1WHGA 4AILC 4BRGA 3TP3A 4MZPA 3HBTA 2L5QA 2E1HA 5AZIA 1FMVA 2RV8A 3TKYA 2P6SA 2ZFUA 2ME6A 4ETSA 2O01E 4XLAA 1HW5A 5F1RA 3NRVA 5DM7F 4FX0A 5C2DA 5DD8A 3DXKB 3HSBA 2EZHA 4CEZA 1P4AA 2QWPA 1VQ5A 1K9MR 3F8NA 5GAMf 2WB1A 2KFDA 4H5TA 5ICEA 2JWTA 4BQLA 3GNGA 3PX6A 2K4JA 3JCMc 3I59B 4I98B 5FKLA 5EXWA 3VTHA 3IQLA 1ZHIA 4JI0K 1BI4A 1Y1VJ 1I3AA 3G71T 1TP4A 1Z67A 1WA7A 3AG2H 3ZQCA 5F1XA 2BE5F 1TL8A 4IRIA 4E47A 4AYBA 3TVTA 3M57A 2H56A 4CRIA 2RJDA 1WH5A 3EFRA 2W00A 2GCXA 1RBTA 2ZBKA 2EWSA 1ZLMA 2K7AA 3S1QJ 2Q0OA 2GTOA 1W0HA 2DO3A 3ZQFA 1W36C 3O08A 5GJVB 1GLFO 3WU0A 1D5AA 4JKGB 1J0RA 2OCEA 4HF2A 1WUAA 3EETA 3PIPF 3M8SA 2V8JA 3PO5A 3CC7N 2RN8A 3OJUA 3FLGA 5E1WA 4HLYA 3ZSYA 5IT9O 2DERA 2P5LC 4N76A 1FC3A 5TJJA 4LY7A 1XQOA 4KUDK 4KHWA 1NPRA 1HPZA 4MO4A 1RT3A 2Y90A 4DHYA 1S7EA 4NCBA 2Y2ZA 4I99C 2V9KA 4RGRA 1WHUA 2RHIA 1KG2A 4CHOA 4OB3B 1DPUA 4Y1CA 5KPZA 3UKUA 1SL1A 1GLEG 3PIOL 4JI7K 3PJRA 5J39A 5BPMA 1IBKK 4PZJA 5IP7J 3OYJA 4UNOA 5GIPA 1JUMA 3TWHA 2YRVA 1T2KA 3PL8A 5C24A 1ON2A 3LA2A 2EINH 5CZ2A 5GJWB 2F6CA 3KZZA 3N5NX 3MEUA 2CW0F 1KTQA 2LX9A 4HX8A 1H8KA 2TDXA 1OQYA 2WAFA 4FJJA 3VGMA 3HI0A 3IDHA 4A3GJ 3A8YA 1X43A 3DM2A 4GYIA 2GX9A 3E6MA 2DVEA 2Q8KA 4OB1B 5E1XA 3H0FA 4MTEA 3CCVQ 1HKTA 3RTRA 4ISGA 3JCMP 4XLFA 2QM3A 2JA6J 4M78G 5LJ3e 1Q7YU 1HYOA 1RI0A 4CEEA 1T3VA 3R1XA 1UWBA 3SHFA 1MGTA 2L2OA 1Y8QB 2LBFB 1UDLA 1LWCA 3ZT2A 5KGXA 4RGXA 2I5UA 5GAN7 2JRTA 5DTDA 4B09A 1JCFA 4E7SA 3CP8A 1WSHA 2OA8A 5JLWA 5ICCA 2B86A 2GELA 2OZUA 5CJ9A 2HMIA 3SWNC 2O0YA 2OTJT 1V4TA 4CK1A 3RBBB 3ZX2A 3CCJT 3UB5A 3V1QA 1VQLN 1GOAA 3OVNA 2RKIA 2F5KA 2K85A 1H88C 5LL6S 1HD3A 4B43A 1FZPB 4ELUA 3ZMTA 4DZJA 4XIUA 5F1JA 4M3TA 3IAYA 3RMBA 1VQKN 4Q0BA 4B9SA 2DPNA 1C0GA 1NKEA 4XU0A 2LNVA 1JTXA 1SL2A 5D8LB 2DFUA 4KI6A 4M3DA 3I56T 1KXPA 4CCHA 3U2RA 1JU5C 3KLHA 4A62A 5A2QO 4IG3A 5M1QA 1QSLA 2DLPA 2NVUB 2QBYB 1TSFA 2NUZA 2FU4A 4BDYA 3SZPA 3JCMW 4HNUA 1Z3XA 3ZOBA 2K40A 2KDZA 4HRIA 2HSPA 2W24A 5FO5A 2P9SB 1ON1A 2HR3A 5FKKA 3MD2A 1NYGA 4DF8A 1J9IA 1HNZK 3OQ5A 5KK1A 1RILA 4Y7NJ 2GXGA 4M6XA 2KXCA 3CXCP 4H0OA 1RT4A 1S72Q 3K0LA 3QDKA 3QHSA 3DCFA 2KDOA 4G9YA 5IXFA 3M8RA 3CESA 2X4WA 4DTRA 2E20A 4DUYK 3TO6A 4LLLA 3BF1A 2V1DA 1VA7A 4LB5A 1W4MA 1RTJA 5FPNA 4LF4K 3W6JB 1AWOA 4LIUA 1XSXA 1R0CB 4IFVA 1TU0B 2DT5A 2XRLA 1YE9A 4XTYA 2HBWA 3HDDA 1ZGWA 1Q86R 1K0XA 5FRNA 2X35A 4XN0A 4BXUA 2YKNA 5D5UB 3BZKA 5DK5A 4A6EA 1C0FA 4L18B 2JS0A 2FX0A 3S16J 1ZN2A 4JUVA 2WY7Q 1T56A 5FROA 1YQMA 4XTXA 1VSEA 2BOLA 1T0FC 2G3RA 2BH1A 1GLBG 1ZREA 3LDNA 4DW6A 4ZYDA 1VQOA 3SI6A 2ZM6K 3GCMA 4IO8A 4KFBA 1XC3A 3CMEA 3JYTA 1DLOA 1C6VX 2RJCA 3DWLE 1YLFA 3JSOA 4MMKA 2KXDA 2GEMA 1LAVA 2D0CA 2JPBA 5IT9Z 5IOYA 1FJLA 2VBWA 4OAYA 2NRXA 2SEMA 3AO1A 5D7UA 9ANTA 2GNCA 4M4ZA 1BIBA 1QSSA 4NYNA 4X66K 3I4MJ 4FLTA 3I53A 1Y96B 3CCMQ 3D2FA 2WC2A 2X4XA 2LVSA 1LJ9A 1YIOA 1WJSA 2FBYA 3ZSOA 1KFZA 4IBNA 3SDGA 2WSFE 2VPLA 2Z2SB 1VF9A 3SQ2A 1FOYA 1I94K 3LM9A 5FRMA 1FMWA 4AF1A 1B59A 1K83J 2LSNA 4JJCA 2M1HA 1LPQA 2W41A 2MYSA 4F16A 3ULDA 3LFUA 1S1XA 3OBWA 1OH7A 4DNCA 5K7ZA 3I3LA 3GBQA 5DS9A 4B3XA 1X1BA 1HC8A 4JX6A 4E4HA 2DTOA 3H08A 3H9JA 4YDUA 3RJPA 2EVRA 4YFXF 1U4BA 1WI3A 5F08A 1QHGA 5E84A 2QYZA 2BXZA 4CJWA 1SD5A 3VDXA 3NQOA 1IREB 4NDLA 5GAMg 3M4GA 3U9GA 4B24A 4M3ZA 3DJCA 3R6OA 3HXLA 3VEWA 1QKXA 4A3LJ 4AIHA 2P9IB 2OBPA 3H3OB 3KYDB 3GTGJ 2BBYA 3JV3A 2HTJA 4FE7A 1UB4A 3QWXX 1KAYA 4S04A 3UKGA 1B4AA 2EFIA 4RKUE 2EHGA 4BRAA 3QDFA 3M8QA 3LZIA 2YRDA 2DA4A 3FC3A 2FQ3A 1BISA 2FOKA 1VQ8N 1ITYA 2A7YA 3RVCA 4GGGA 3PT9A 2KFZA 1TWGJ 1NGNA 4BQZA 4RAFA 4B3SK 3MKWB 1KD1C 1KVAA 1T0HA 2JTEA 2YDLA 4H03B 4A2BA 1N6QA 4Z4EA 3I0XA 2XPVA 4C1NI 1WBDA 4LH5A 4B9MA 2GUPA 3VYRB 1T44A 2YS9A 1QRYA 2M45A 4KREA 5I2MA 4XLHA 3BQZA 2G8HA 4FYVB 4ENKA 5ILVA 3TOBA 1LE8A 2BTTA 3HKSA 5DV5A 2WBMA 2K6DA 3AVIA 4XTZA 1YJWQ 2VCPA 3BQYA 4J2EA 2LQKA 2H8WA 4M7DF 3JAME 2K7LA 4F7ZA 2F9WA 5GAOl 5LJ3d 2JXBA 1FTTA 1PU6A 1R59O 2OTLA 1BCMA 5LMNK 1WEFA 3NTHA 2KVQG 4B8CA 2PMHA 3LGLA 1IRFA 2F96A 1XMKA 1AWCA 1VQ7Q 4XRSA 4OU0A 1HLUA 3P8HA 1EKEA 1XTAA 1TAQA 4WXHA 2RO0A 3ABLH 1T03A 3SZGA 1YJNT 4NLCA 2XVCA 1FYNA 4X64K 3ABKH 4FW2A 2JVVA 1KYZA 2VV5A 2IVPA 5J2NA 4C8OA 5EEGA 2M3AA 2E41A 4OPHA 5GMKl 1NJXA 1K7AA 4WK8F 1BC7C 3AO4A 3WE2A 3BR5A 4Y1DA 2YHYA 5FKOA 3D7EO 4JI4K 3LWMA 4RTFD 2YNFA 1WB9A 4CO8A 3ZMUA 3FMSA 4EAHD 3M3ZA 4QQGA 3UIQA 3R3LA 1OVQA 3U3GA 2XDVA 2E36A 4OGCA 2ZO4A 5E1ZB 2P9KA 4DA4A 5D5VB 2GXBA 4V2GA 1MZBA 1HKQA 2JNGA 2KRNA 1MDUB 3FDYA 1FP1D 1EH6A 4JP0A 1S1WA 5GAOp 3WVEB 3DLEA 3K57A 3QAHA 2OYQA 1Y7XA 1XC5A 3A8OB 1QBJA 3KWIA 4ENJA 2XKOC 4XONA 2RNAA 3JB9G 3J8AA 4JX5A 5CY4A 2XKPA 2YNGA 1U48A 3PGGA 3M3YJ 1A5XA 1VQMI 1YW7A 3EGDA 4M78B 2IS6A 3KFWX 4J2BA 1E7OA 1R36A 3ZMDA 1MU2A 2FBKA 3SYTA 3NE6A 4CCKA 4ITVA 1YHQN 3D2EB 4F3OA 3FF5A 3S1RJ 2BW3A 2HHSA 1NK5A 3H92A 2CQ7A 1T6CA 1WAFA 4KN4X 1P92A 3C2BA 3CBPA 2A6HF 1BO5O 3RTVA 3SQ4A 4CZKA 1VQLT 1BU6O 1I1SA 1U6ZA 4LGWA 4E9HA 3LCNA 1KQSM 2LJ3A 4EPCA 3A5NC 5MLCQ 3PFYA 1RR8C 4A4GA 2NUTB 3E1YA 1O3TA 2VL8A 2IVOA 4MHGA 1WJBA 2EBIA 1O9SA 5CVVA 2RH2A 3M54A 1NJWA 3CCQT 4MDXA 1ULYA 3CERA 4FJ5A 3I55A 2JG6A 4HAMA 2D9TA 5AQFA 1HQCA 2QGUA 4M3WA 3S9HA 3CCEI 1IH7A 1YJ9T 1VSJA 2ASPA 3ZQHA 2KE9A 2O8EA 1YI2T 4FL6A 4NCAA 4LLGF 3J81Z 5CO7A 1VQ7T 4R56A 1MBFA 1REVA 2I0NA 2DA1A 2H3EB 2K2MA 4NXNK 2EFWA 3EYYA 4BJ6C 4J9IA 1JGSA 1YO5C 4C92F 2HBPA 2W4SA 1IF1A 1KU9A 1Q81U 1A6QA 2DMTA 1G83A 2XPWA 4PL6A 4HV6A 1FOWA 4HBLA 1ZH5A 4E19A 1BOTO 4IG0A 3DPTA 4FLYA 3M0UA 2HKOA 3ULQB 3KJVA 4RGUA 4FM4B 1FBSA 3DU6A 1V5GA 3RPUA 3L0QA 2EQKA 2AKKA 2OPSA 5AQQA 4DTMA 2QGGA 4FM1A 1MUNA 5LJ5e 2CUZA 1K76A 4WYBA 2VQFK 1SKWA 4LG3A 4ZZLA 3L1PA 1XNQK 5GP9A 1TQIA 3LL7A 4IDKA 2ZSIB 3E9FA 4QS8A 1K8AU 3A0HC 1KCFA 2VKHA 1BB9A 4BACA 3CCJI 2P9PB 3ZQ7A 1RDDA 2E12A 2WSEE 4O5FA 3K0SA 4I09A 3N05A 4HVVA 1RRQA 3Q0WA 1NGIA 2YV0X 3QBWA 3VGKA 5I42A 3I54A 3CF5L 1NKCA 3GFJA 3GF2A 4C23A 3KYLA 4FSXA 3WEEB 2LVMA 1IGQA 3H1VX 2CFOA 2XAHA 4XAXB 1YJWT 1K4SA 3U8XA 2Q1NA 1FWZA 4E2FB 1ZELA 1EXQA 1GT0C 1S9HA 2LC2A 3PQJA 2JA8J 1YITT 4MZMA 1S5LC 1B6AA 4LLNA 2JTFA 4CFBA 3QEWA 4FL9A 1S7AA 3U1KA 4BR5A 3FXQA 5C4XJ 3A2KA 4WCEL 3CO7C 4BH9A 4RMNA 4JJBA 2W7NA 4RG2A 2HZYA 4EVVA 3T8TA 3VEYA 3FDRA 2HBJA 2PQ8A 2HFHA 3MZ8A 3UF4A 5AJ3K 3L2ZA 3OYBA 1XHZA 1G3WA 5EGOB 4DFMA 4HTLA 4FJIA 4D0PA 5JVTA 1I5OB 1QGPA 1NTCA 3ZQLA 2NOGA 1QQCA 3VJPA 3NHGA 1TBXA 2L9VA 3M56A 2ISYA 1LDDA 2AQEA 1W7PA 2ZPFB 3Q0VA 2WWYA 5LRSA 1S6PA 3A98A 5KCMA 4ILGB 1FKPA 3MKZA 4DLGA 4EMKA 4A5AA 3P9IA 3REAB 3KLEA 2JWKA 3X2QH 1YXQA 1BG3A 2OI3A 1LV5A 2NOFA 3GWZA 4PA1A 1T6DA 4GCVA 3CQYA 3CJBA 5HRRA 1N8RU 4KH4A 2A40A 4Y4RA 5FW9A 1MH4A 3MXJA 3TBIA 2OJ2A 4RBOA 1YX3A 4IHSA 3RSEB 4CDGA 2HOEA 5H2FC 3F22A 5TISC 3A01A 1HQUA 4CK3A 3F72A 4E1NA 3O8VA 1IZ1A 2DTZA 4IIMA 1MMGA 3WTWC 1JKHA 4KB1A 4GLKA 3LWLA 3CPEA 2VWKA 2CUJA 4IQ4A 2LRQA 1KQ1A 4PJMA 1SV5A 4WFAL 4FJKA 4CGZA 3LSGA 3J80O 3O9TA 3IP4B 1IUFA 5F0HA 1RTIA 2Y4XA 2Z9OA 4CJFA 4A12A 2KY9A 2E6NA 3VW4A 2FB7A 4NB4A 3W3DA 5DM7L 3KLNA 1M8MA 3CFPA 1F1ZA 4JK1X 3NF7A 3F5TA 2UXDK 1QZYA 2CT4A 3R60A 1HOMA 2QAZA 3V42A 2PFBA 2IIMA 2MMPA 2DBBA 5AQXA 4FWOA 5K1YA 4KH5A 3SQNA 1W7AA 1ZA2B 2HKNA 5H6QA 3A8GB 4M78D 1JLBA 5KYUA 1HKBA 2KP6A 4RTZA 1H3ZA 5LJ3j 1TC3C 1NWKA 4RCBA 2M8EA 3MWMA 2VQHA 1JXMA 2NOIA 5DDGA 2J7IA 3CWUA 3TO7A 1Q9XA 5K5OA 1MA9B 5CQEA 1Y8RB 1Y57A 4KNYA 4PJOE 1QQIA 3H41A 3A4CA 1APLC 4U0YA 2AK5A 4C0ZA 3PO4A 4LJZF 4RTYA 2JZYA 1ZBHA 1JXBA 1WCMJ 2R3SA 1T98A 1KG1A 3I55I 3EGUA 1JGGA 1IXRC 4ESBA 2MH2A 5E17F 4CZMA 2QKLB 3GMEA 5KHDA 5D5XB 4JQFA 5HNFA 1O13A 3A02A 2K9MA 1G3YA 1KFDA 2E6ZA 5CKBA 4OIQF 1RRSA 2JA5J 3HGYA 1VQ6Q 2PY5A 4CEFA 1E6HA 3QEVA 2YCHA 3LSRA 3R6MA 4FXDA 3FXJA 2CGJA 2VQEK 2DY4A 4DCHA 2P9NA 2XRNA 1YFNA 3X25B 4R79A 5JS2A 1W7PD 4DKWA 2HW3A 1V3FA 1BW5A 4F92B 3H45C 3CC7A 1LB2A 1KVCA 3CF5F 1HSQA 1NK8A 2XDPA 4BRDA 4KYWA 3C6HA 1R0AA 5GMKm 2DXCA 3NTIA 4P5NA 2KW4A 1WKMA 3BROA 2HHXA 3BE3A 4BRLA 1FK9A 1WJ5A 3CQXA 5AQGA 2Q31A 1KQSP 3HSTB 4NC6A 2Z1GA 3CCUI 4YOUA 4FJ8A 1FIPA 1S1NA 3NGZA 1LFUP 3P38A 3C95A 3BTCA 2E8AA 1J75A 3ZMVA 4CK2A 1VQPQ 2P9IA 1OYXA 5HNHA 1RI7A 2QVOA 3MCAB 4P55A 3AVLA 1HLVA 3LGFA 1L3VA 1IN5A 4LNPA 1K73U 3MQ0A 3CMEN 1MNDA 3O8HA 3Q1JA 3CMEI 3VS5A 3HPHA 1QNTA 2P9PA 4LE9A 4BROA 2DT7B 1PC0A 1P4WA 3M0RA 2CG4A 2ZPGB 1K73R 2I7PA 2QCOA 3AG3H 4JKHA 2D1XA 1ZBUA 1RAHB 4PUOA 4M74A 2CZ6B 2KMUA 2M51A 1JJ6C 4RG8A 2K5IA 1LNXA 3HYIA 1TTHB 5JLXA 2FVUA 4DFPA 2XK0A 2Z1HA 4A4FA 3REOA 4CIFA 4FE4A 3P31A 3CTAA 1SRMA 4Q48A 4DV5K 4RB3C 1XUPO 4EJYA 1N8RC 2ZXHA 1TNSA 2KK4A 1N77A 4CJVA 4WF2A 4U88A 5HLHA 2QQRA 1BBZA 2VYPA 5HRPA 1Q86C 1GFCA 3WNFA 5HK0A 4EW4A 3CCVA 5GADJ 3OBYA 2XAFA 2X85A 1T3SA 3DEEA 1P7JA 3CMAA 1ITGA 4CW7B 2HF4A 3J81O 4QOZB 5J4YA 1RDUA 1E17A 2RK2A 3M4OJ 1DEJA 3CC2T 1UA0A 5KAFC 4QW2A 4FT4A 3VQBA 4DFJA 2P9UA 4BHPA 1XQHA 3HTUA 3O9QA 3H6ZA 4JKEA 4XK4A 3NGYA 5ED4A 4JZ4A 2ZWHA 1I0CA 2W85A 2X9HA 2GF7A 2YU9J 1IDYA 1M3BA 3SMSA 1MSEC 1BKBA 3DMJA 3SEMA 2LP0A 3MWPA 2Y1JA 2DXBA 3BWGA 4IJAA 4FWMA 3IC7A 1ENHA 4RAZA 1NM7A 2LR8A 3ER0A 2E5LK 3H8ZA 5J2PA 3CO6C 4F8RA 4EVIA 7AT1B 3KP6A 5GMKe 4YPRA 3VQ5A 2BY3A 4HTUA 4AHUA 1JLEA 2IG0A 5IWAK 3VF4A 5K14A 4XKVA 2R57A 3CC7I 1LMZA 2DFFA 2LQ8A 2V7ZA 1HRHA 2F5FA 2QWOA 4FLWA 3CPWA 2VXDA 1TUUA 2V7FA 2CREA 4IFEA 2ZJRF 1VRTA 4EA4A 4GMJB 1H89C 2QASA 4C8QA 3OMGA 3KVGA 2UU9K 3CCUA 3ZLJA 3E3VA 4IURA 2O4XB 2ZPBB 3CC4A 3MWTA 5C42A 3KK7A 1V5EA 1EP4A 2Z5UA 3GFIA 2E34A 5KI6A 1BR2A 3EGDB 3UKRB 3H0DA 1MBGA 3CMYA 1LDKB 2HHQA 3E5XA 3HRMA 1OKRA 3MEDA 1WJQA 2CP3A 3LALA 1QWEA 2K3PA 1VSLA 3MPUB 4GVMA 3MZHA 4L8RB 4EMGA 3HSCA 2LF8A 1ZQ1A 2DQLA 3EL2A 2KAFA 1WXUA 4CJPA 1MHNA 1RLPC 1ZG1A 3VA0A 3ZPLA 1SS6A 3RYRA 1SHGA 4YORA 1B3QA 2ELHA 2CGKA 3RPUD 2ICWG 1PG5B 4CF1A 4ZGJB 4LG0B 2LK2A 4DTSA 4PNOA 5AQMA 1IC8A 2RA2A 3W3CA 5GAN3 3QRFF 3BEXA 1YP5A 2UYTA 1KQSA 3FKJA 1K8KA 3CWSA 2VODA 1V4RA 2DETA 1DP7P 3QP6A 2W04A 4HG2A 3LMMA 5HBMA 4RS8A 2WUSA 1R5GA 3META 4BRPA 2YJFA 1N75A 3H0HA 1E6GA 1MJ9A 1NM1A 2M34A 1GLDG 1BQNA 3URGA 1Q1HA 5GAOr 4RAGA 4ID5A 1RT7A 1VQ5N 2VT2A 3LDLA 5HLTA 2RI3A 4B9LA 3K5NA 2VG5A 2HZTA 3WXJA 1SD4A 2D5VA 1VQPN 1QMCA 4M77C 2F8TA 3LAMA 3I58A 4QLCU 4KT6A 1YNZA 3RRHA 1ZYQA 1M3CA 2AZSA 1JL1A 3OS5A 3F23A 4FJXA 3BUZB 4AYBN 4DMNA 2DMOA 5TKWA 2EB7A 2FBHA 3HHHA 2MW8A 4L9VA 2YG9A 3K4MA 1IXSB 2M0YA 2A05A 1JT0A 2PN6A 4YFUA 3TO9A 4C8LA 2KJCA 3SFIA 1AWXA 3OIPA 2Y75A 5HRNA 4JHDA 5M1KA 1IGNA 3GG4A 4NCGA 4A4KA 1OCZH 1JKOC 5B1BH 4EZ9A 4DEXA 1XDUA 3VU3C 1U3OA 4QQDA 3JAMZ 2F5EA 2KDSA 2CUEA 3TW7A 4A93J 1N5ZA 3BW1A 2F7TA 3HSFA 3KD5E 2OTLQ 1SFEA 2HQNA 3DTIA 4M7DA 1N25A 1YHQQ 3VRYA 2LCCA 2HQAA 1QPMA 3OH6A 3JCMQ 3TSPA 4BC3A 3EFOA 1UCRA 1UHCA 2IGIA 1ESVA 1AD5A 2QEXT 4FTHA 2EYXA 4UXNA 4CZJA 1XS9A 3VSKA 4XTUA 5GAN2 1I6HJ 4PY5A 3C0BA 2FMYA 3IHUA 1P9QC 2A5WA 1R4NB 1ZR4A 1O57A 1JRIA 1ETYA 2P6TA 4M41A 1C0UA 1W7PB 1AOYA 3EG9A 2JW4A 3FKIJ 2K27A 1ASVA 2FBXA 2FSWA 3D7SB 2F5CA 1Z0XA 1N5YA 1Q82C 4DYQA 2HKXA 5LJ5h 1VQ4Q 2UXCK 2NVXJ 1NGCA 3T1AA 3IS9A 5EDNA 2QQBA 3K4LA 4DQSA 4LDWA 1BR1A 3OSVA 3QO3A 5I11A 5B8HA 1W1WE 1RDBA 1XJWB 1XSVA 1GXPA 5CZ1A 4CYCA 2FXUA 4FWKA 4HUFA 3LA3A 4DEYA 5HLFA 5J26A 4IOAL 1PRLC 4QIWN 2EQUA 1XQSC 3KK3A 1HW2A 1W2BP 2L4AA 3JRFA 2C0TA 4CC3A 3CCYA 4DV6K 1QTMA 5AONA 2GQVA 5LJ5f 3OIOA 2YLBA 3OJSA 5AQHA 3BJ6A 3V9WA 2NUPA 4G7OF 2Z16A 3TU5A 4FJHA 1Z91A 1QCOA 1QVFS 4X0GA 2DXTA 2DL3A 2HOAA 3WEEA 2VG7A 2YHXA 5ILSA 2EA2A 4FLZA 2KHOA 2OC6A 1ZARA 2PTKA 1GUUA 3FK6A 1DTTA 2E70A 2KJBA 2E5KA 2PMUA 2XO7A 3M0PA 1I50J 3G4SQ 3ZT3A 2CH4W 4X34A 2R7RA 2VXFA 3JS6A 2A3ZA 1W9HA 3VUZA 4JPBW 2AZVA 5GANg 3FM5A 4IUPA 1P8ZA 1HJRA 3ME9A 1QHAA 4JI6K 2E4LA 4F3TA 5KYXB 1D3YA 2M30A 5E3MA 1K78A 1VUBA 3C65A 4CHQA 2X9DA 3O1WA 4X62K 1XOVA 1KRPA 4QSHA 4LD6A 3QFUA 1EV7A 3BZCA 1QS4A 1ONVA 1YCYA 2V52B 2KSSA 1QVFP 1NNEA 5KYWB 5GANe 4CH7A 4RUGA 2ZGYA 1UEBA 2BZYA 3OSSC 2XY5A 5CQGA 4RB0A 3QUIA 2YU3A 4DV0K 2KT1A 1IN7A 4LK1F 2QEXQ 3S32A 3GFMA 5HODA 4XLNF 2V26A 2L7KA 4XORA 3EKSA 5EOYA 4QVCA 4C3JJ 4A3IJ 1ILYA 2X3WD 3ABTA 2LNHB 2VONA 1WHMA 4UVCA 4HVJA 1TLHB 2OA4A 5HLIA 1D8YA 4XKCA 2VG6A 3CUQC 1SKRA 4B9VA 2A0FB 1LQ1A 2PAVA 4DLEA 2CQKA 3BR0A 2JSCA 4ABZA 5EU7A 1UELB 2E7XA 3L3UA 2BIVA 4C5EA 5FU6B 4IRHA 4JI3K 5GAMj 1KFSA 4A4HA 1KC8U 3G0QA 2XD0A 1RAAB 3ZL7C 1F4KA 2W82A 2MPXC 1K6YA 3O1BA 2WC9A 4EEFG 1ZG5A 1LEAA 4Z02A 3OA9A 1JT6A 5JVGF 4FK2A 4DSJA 4XKBA 4O3MA 4M78A 2X6YA 4OMFB 3LAKA 1K8AO 1D3BA 4C9YA 4OIPF 2NLXA 2FSKA 1FYKA 4DG1A 3FGUA 2M4KA 5FFXA 5AFUH 3B6OA 4M3XA 5LEJA 3I56I 4M78E 2P0PA 4YOWA 2YNHA 2IGOA 3S17J 1W5CC 3KLGA 4JLHA 3X28B 3CCMT 3T1YK 3I8DA 1Z6TA 1XWLA 3TSWA 4ELTA 1SANA 3RR8A 3MXMA 3EGXA 3L2RA 3J80Z 1YJNA 5IHNA 2IA2A 2IXSA 5FLXK 4EP5A 2RPIA 3DLLF 4LD5A 2XSDC 1BN5A 2M7AA 2WAQN 1M27C 2K86A 3M5RA 3M0QA 2OTJI 3J7YJ 4BJTA 3M9QA 2OZMA 3NTKA 1QSYA 1IKWA 5FLVA 3K59A 4BC2A 4EMKC 1EIFA 2E19A 2DFEA 2LJ1A 2YUQA 4B9NA 2FQ4A 3RI4A 5FJ8J 3LOCA 1KD1U 1ZUKA 1VK0A 5GAGP 1EH7A 2FSJA 4M72A 4KUMA 1GV5A 4GV9A 3OWTA 2JPSA 3NAUA 3BR1A 1RKWA 3V9SA 4CGJA 2UUZA 1S5JA 4DQQA 3FSPA 2RHXA 2HHVA 4MTDA 2L54A 1A6IA 1MMNA 3UT1A 5DYMA 5IPAA 4LFCK 1AZEA 1QWFA 3A0BC 1S72A 4QTRA 2A28A 5FPMA 4CI6A 4V2FA 1SAUA 3ZP5A 3OIQA 3E9LA 2HS5A 4XU2A 4LUDA 3LSIA 4NYFA 4BG8A 2E64A 2R7FA 2V1RA 1L5UA 1QVFA 3D2FB 2Q0UA 1U5TA 4LD0A 1VQKT 3DPUA 2CQQA 4J7FA 2HBMA 2OCCH 1YI2Q 2W6KA 5ILUA 3CJ7A 3T19A 2EFPA 1GCPA 4OMQA 1ZX6A 1W70A 3C6AA 1YIJQ 3G4SN 1G8XA 3KP2A 1OLTA 1S29A 1SAXA 1Y0MA 5EEHA 4IUVA 5EYRA 1MBKA 5FKNA 1NG6A 1VQ8A 1KU2A 4LH4A 2FYKA 1HX1A 1UHMA 2XHKA 3CEYA 2OTJA 4C92G 4BG9A 3CCJA 2D0BA 4H0EA 1OCTC 1TT5B 2Y4YA 1WAJA 1D8KA 4XN3A 1ZG3A 4CZHA 4Y52J 1SL0A 3EHQA 2XASA 4RTTA 2AO9A 3BR2A 1QVGA 3ASMA 3ABMH 3PY8A 2YJEA 4A3JJ 4HZFA 2HQHA 4W5OA 3QU3A 2EZIA 3JR9A 4AHVA 2KBTA 4OAZA 2W10A 5KPTA 4FM0A 3TP0A 2HVSA 3SJHA 2ELKA 3I56A 2JZ2A 1U8RA 3EG1A 1C1BA 2EKOA 3OYKA 4ESJA 2K3BA 4W1UA 4FHTA 4RDUA 4UC4A 1OCOH 1STZA 5GAEJ 3H3ZA 4F2RA 4LOCA 4HVUA 3SV3A 3CCLA 5SZTA 3DEWA 2AKLA 3KEYA 4EHUA 4XM3A 3I5UA 4HSTA 3WNHA 5AQLA 2ZJPF 4BEHA 2JS2A 1H3HA 3QOPA 1X4PA 3A1PA 4FYYB 3BJOA 4AH9A 3THWA 2QK0A 1SFXA 1P7MA 3RERA 3HRUA 4ILJA 3JB9D 4FT8A 4E6RA 5CHZA 3DOKA 3DBRB 4DR7K 1QP2A 3Q3SA 3HM8A 1CF7A 5CCAA 1RI9A 4EV0A 4PL8A 2CH0A 4C30A 3S2WA 2HDCA 3CFRA 1WXTA 4CZZA 1VOMA 1KQ2A 4LN2A 3A5MC 5CKEA 1AA7A 1ORKA 2CH4A 3P1GA 3W0LA 5FB2A 4H0XB 3WTXC 4AHSA 2CGHA 3VODA 2NNNA 4CSWA 2XSJC 4BY7J 3HKZN 4L5JA 4HNVA 4CHUA 1VYTA 1GLJO 4I2OA 2DEUA 2VUBA 4PKGA 2E5ZA 4KHNA 3P9CA 4X1EA 5IT9E 1TG0A 1YS7A 3IWZA 1RL2A 5IN1A 1PD0A 2G6FX 5LMUK 3J80K 4K41A 2ZNYA 2X0LA 2X1DA 3QPLA 1E3MA 5GAEP 1RESA 1CXQA 4DGWB 2QA4I 3DLGA 3RCOA 2KQWA 4BS9A 3M0TA 4KICA 3NNQA 2R7UA 5D4SA 3SUPA 3M8EA 4EIKA 3AVGA 2ABKA 2OF7A 4OPAA 2M8GX 3MP8A 1J5YA 4Z89A 5IYCJ 4CD1A 4OKKA 2R7ZJ 3ITHA 5EEAA 1EFNA 3LX7A 4B9QA 2P9LA 3UATA 5J1EA 3MECA 4AVZA 1WHHA 3I55T 1AT1B 2P5GA 2GGRA 2GWKA 4E9FA 1I1JA 2CZ1B 2HNZA 1QW1A 2HF3A 3VQAA 1HDDC 4F52A 1OCPA 5CVIA 4CECA 2GWRA 5D6XA 5AQNA 4N47A 3UDCA 2J5PA 2CT3A 1JKPC 3HRTA 2DK8A 4CZFA 2QBYA 1H1VA 5J3LA 2DLLA 3ZX3A 3TAGA 3O6WA 4JRKA 2H8RA 1LCKA 4UUTA 2LT4A 1NJZA 3ZFJA 3DWLA 3I64A 1ACIA 2DVJA 3OYGA 2B4JA 3HBLA 3BT9A 2HQRA 4ZGEB 2CSQA 2JGUA 5AQSA 3LQRA 3HOSA 1VZ0A 5GAHP 4YIRX 1QZ6A 5HY6A 4L0ZB 4WF9L 1TKZA 4K8XA 3AA5X 1NOYA 1ETXA 1VQKQ 1OEBA 5AYFA 2FSNA 2DOAA 3LZJA 1Z7LA 3VS3A 1B34B 2UXBK 3PE0A 2EBPA 1LFBA 2Z33A 3SCXA 3K1NA 1IN6A 1I4K1 4EGYA 4C0GA 3G4SI 1YITN 1KG7A 4CVNE 4HLXA 4U67L 5IHKA 1XGNA 2GXAA 2K2VA 4M77B 2YUNA 3SFMA 2KLAA 4GXOA 2NOJB 2QXFA 3LSHA 5M1OA 4TSXA 1JXOA 2X6SA 1A04A 3D2EA 2V6EA 2X4HA 5AQWA 1ZUYA 3CCQN 1MBHA 2XF5A 4LF5K 3G6ET 5HS9A 2R7TA 3ZMZA 1KQ0A 3V8LA 1YTYA 3BDUA 3OYLA 2FHDA 4LF7K 1UJ0A 2P84A 1RAEB 2RN2A 3K5LA 2L3DA 3TMOA 3RESA 4HW0A 1Q1VA 1WFXA 3CLOA 2O88A 4ZDPA 2HQ5A 2LX7A 3HOUJ 2O8BA 4ZN1A 4PJ0C 2D0OA 4PWDA 3TAFA 1HMVA 3TW6A 2EKHA 2HKQB 2P9KB 1Z25A 3CJNA 5JLHA 1N33K 2HL5C 2DDBA 3F2KA 5E8IA 1JKQC 5CVJA 1VSDA 2FRYA 1XNRK 1HKSA 3MEGA 1B9MA 4C5GA 4OMMA 2E3HA 4CERA 2XAUA 2LTOA 2ESWA 3NHNA 2F2EA 1K4US 1XHXA 2QEXN 4G12A 3GTLJ 3VERA 3DLBA 3QG1A 1VQ9N 4YRVA 1TWBA 4XIDA 4GKJK 3TI0A 4J8FA 4CGIA 3S3OA 1SF9A 3QZ5B 2V8KA 1YFHA 1XG1A 1IJJA 2F2XA 2I5WA 3VQPA 3NAEA 4MLOA 1Q18A 3LNQA 3V8KA 1X3ZB 3QETA 3K9TA 5FGMA 1NKUA 1HCRA 1YJ9N 2ZJQL 5CVRA 1OPCA 1SD6A 3V9XA 3ABUA 2XGEA 1VHXA 5JFRA 4ZGDB 1QVFM 2KQRA 1OULA 2L89A 1Q81R 1JJ2M 1K4TA 1KONA 1N3CA 2EFNA 3VENA 3KP3A 3CCQQ 1CKBA 3CXCS 3ULRB 1B8IB 3E66A 2RHZA 1ZC6A 4DB3A 3EZWA 3B6PA 4QCLA 5B3SH 4NO7A 5BN8A 3IUCA 1KC8R 2LQNA 3DLMA 3JRZA 4AIDA 3JB9J 3ENOA 3CMAI 4L5EA 4QKUA 2RDPA 2JM8A 4FVMA 4CEDA 2BZXA 1BI0A 1N9SA 2MGQA 1QPIA 2BUPA 4BR4A 2ABLA 4U0WA 3CCMI 1JCEA 4H0VB 1S1VA 4KTZA 3O8MA 3BTLA 4E70A 3WVDB 3AARA 2A5XA 5KYYB 2KRFA 3K1PA 1M90C 1Z3YA 2EH3A 2RQTA 4DTOA 3V7RA 3F8CA 5EG2A 2ZZDA 2QF7A 4I76A 2RQWA 4E0DA 4C1NK 4EJZA 4Q5VA 3CMAN 4S05A 3FBNB 3VYUB 1QZZA 3IHOA 1J5OA 2CV1A 1OYYA 1UGSB 4DR4K 1NPPA 3ULEB 4DSFA 3RKQA 5LL6Z 1G6NA 5KH6A 3KLOA 2DA5A 2PVDB 4XU1A 1S6QA 4NS5A 4M7AC 4BEHB 1SVLA 1AWJA 1FEXA 1K9MC 2A37A 3C1DA 2EGEA 1HNVA 2A5YB 2JUGA 4B6MA 2R92J 1VSHA 4E7HA 1KLNA 3QEPA 4KULA 1SKUB 2XY8A 4DU3A 2DTIA 3KLFA 2CZ7B 4C3IJ 3AO2A 4AQYK 4GLMA 2L2PA 1VQ7N 4Z4HA 1D9FA 4AFUC 2MD5A 5D5WB 1BIUA 4BB7A 5GIOA 2VJIA 4B1WB 1Y0NA 1ZK8A 1ASUA 3FMRA 1RUNA 3RYPA 3WXIA 2DL5A 1F1BB 4B3TK 3S15J 1U06A 4M7DE 2DA3A 4CGGA 2RJEA 3HJEA 3A2FA 1WX6A 3KZIC 2DILA 2YUSA 4YG2F 3N0UA 3OYAA 3CWTA 5I3UA 1YJWN 1E4FT 1VQ6A 4C8QG 3A8MB 2NRVA 1NJIO 1AVZC 3VUBA 2ED1A 2P9SA 2KRMA 4M7AF 1IHVA 4BRFA 2DN0A 2F1LA 2XU8A 4C2UA 2M4GA 4YPHA 5IYBJ 4B9TA 5E3LA 3MP6A 4BHBA 1OI1A 3MAQA 2E1OA 3HYFA 4DSKA 1R22A 2FF6A 4AIAA 4ANJA 1GOBA 4J8OA 3QYEA 5C10A 4BE1A 1J2XA 2COMA 3NGPA 2FEZA 4DSLA 5LFAA 3ASNH 1X1CA 3G2BA 4F7UG 1BI2A 1VQOQ 5CYMA 5D4RA 1PM3A 3F9MA 1TV6A 2NUTA 3PUBA 4CGFA 2LREA 2G8KA 1TUGB 3MDQA 5IXBA 3TEDA 2OJED 5DUKA 3WXKA 4JAXA 1Q95G 1YX5A 4HPQA 2BTFA 4XNFA 2CUDA 3CCEQ 2JJ9A 5M9OA 2BY1A 4N4NB 5D6EA 1U1TA 4A4EA 1NK4A 5ADXA 4JD2A 3M7GA 3ZSZA 1RRJA 4N0AC 1OZ2A 1T95A 2LKPA 2ROLA 3JSPA 3BZ6A 1SZ2A 2M7BA 3I9QA 4LFUA 2PEXA 1BR4A 4FWNA 1W2BA 1SPKA 3GFLA 2TRTA 5GAN4 1UJYA 3NARA 1ORPA 3MAJA 4B9WA 3PIOA 3ISPA 2DTUA 4MQVA 1XGSA 1I5LA 1NGFA 2AXLA 4AD9A 1KQSS 5EJCA 4DQ2A 2MI6A 2JTVA 1FN7A 4K43A 1MUDA 3I56Q 3P5JA 5GPAA 5J2MA 1JXEA 3NMZC 2PU9B 2L3SA 3OGDA 3CUOA 3CCMN 2MC3A 1WIEA 2O7OA 4NC8A 3LL3A 1Q82U 2K02A 3IH7A 2KT8A 3BFMA 4IPAA 1K73C 3IH3A 4AMCA 1RFQA 3DXKA 3THXB 1HUXA 1IRGA 2FPEA 4X9DA 4N4IA 3G71Q 2VJ4A 3GTOJ 1R1VA 3RSNA 5GMKh 2E2QA 4HHTA 4CFAA 4C2TA 3GTKJ 3AO3A 4IDHA 5IY5H 1M1GA 2B5JA 3ZCOA 1G99A 2IS4A 4MO7A 5CVUA 3HSEA 3DKWA 2E4HA 1VQPI 5CKDA 3P4IA 2XY6A 4C8QF 1RUOA 4OPJA 1LVKA 3J7ZO 1U2VA 2FNPA 2EYQA 2MBFA 4ICLA 3BY6A 1Y64A 3SNNA 4HUEA 1H92A 1V1CA 4M6YA 3VN5A 4UB6C 4DYRA 3EE9A 3R61A 3FHNA 3TEEA 3ATUA 1GOCA 1UECA 4L5GA 2V1UA 4BKXA 3QNNA 4A3BJ 4ZYHA 1K61A 2WA0A 2O03A 2CH6A 4EMHA 4M7AE 4QWQA 2FMLA 1RTHA 2CV0A 4CZIA 1QVPA 1EZZB 1RR7A 1ETOA 4M9XA 3LP3A 1RT2A 2QG9B 4R55A 1LOTB 3GNFB 4Q5SF 3IH4A 3GOXA 4VUBA 3K70C 3CCUT 2KNBB 5T7BA 1OJLA 3I35A 1USTA 5H6RA 5LJ5g 2R0QC 1F21A 5AZIB 3HXMA 4LF6K 4I9QA 4ATOA 2YSRA 2YG8A 2EAYA 3P8BB 1FXXA 2FA5A 3DRRA 4XSZF 3EH2A 1R5HA 1AZGB 2BXYA 2L9NA 5KYWA 2UUCK 3ESWB 3PM1A 3K5OA 4FWQA 4FJMA 1XPXA 4ZZDA 1OMIA 2O4XA 1IZ6A 5KAIC 5K5RA 3NPFA 4CJ4A 4A69C 3H9NA 5BN9A 3CCQI 1AEYA 5C2FA 4KHYA 3HOXJ 4L6V5 3CC2A 4AFSC 2FG0A 3QIOA 2V79A 2AHJB 5KCOA 3O4QA 2YX6A 3AKZA 3OR2C 3E7LA 1ETWA 4G9ZA 3OW2P 2FZGB 3CCLI 3SMPA 1LDJA 4IUUA 1K0SA 1RT5A 1O3RA 3A03A 2YHBA 2COWA 2Z1JA 2O8DA 1GCQA 4U7BA 2O9LA 3VPZA 1D0YA 2DYRH 3GBGA 1YF5L 1MUZA 1WJAA 4NZGA 3UKUB 3PTAA 3QYGB 3J7ZI 1VI0A 1WJFA 2EK5A 3ZETA 4OKEA 3ALYA 4WXDA 4YTLA 2LCSA 1G3SA 3MK6A 1O7LA 1MMDA 1VQ8T 2JMCA 2VOOA 2FF4A 4F7UA 1T0FA 2O9SA 2XRIA 2LD5A 5DD4A 1VRLA 4YIFA 4FJ7A 2ZJQF 3G73A 3ZT4A 3VQ8A 1Q81C 4P1WA 4FOEA 4M73A 4H5WA 2MF2A 3AVMA 3GTMJ 4Y28E 3JCMf 1X9SA 3CDHA 4FSSA 1VQPA 1T0JA 3IKMA 2A1SA 5K7FA 4KH6A 3BP8A 2DXIA 2P7CB 2K9LA 2HL3A 4PL7A 1E4GT 5FU7C 2W42A 3BOQA 2OPQA 1XMQK 2DAOA 3L00A 3HP6A 2GFUA 4I6MB 4CF0A 2OTLT 1PNJA 4CEOA 3AHUA 1PUFB 4NUBA 2QW9A 4PJOC 4JOMA 4M6VA 3HVRA 4IUTA 1MJAA 2V1NA 3CYMA 1ZRDA 1RUWA 2ITGA 2XB5A 1FSHA 3DLRA 1UTIA 4D1QA 3SXYA 3KD1E 3IRQA 3O5ZA 1BWFO 1PVSA 4LF9K 3LP1A 2RREA 2EIFA 1NE8A 3COAC 3JAMO 3H3NO 2O8FB 4PFPA 5GAOn 3J7AF 1RBUA 5J8FA 1WJCA 1Z9CA 4HEA2 3GZ6A 1Y1WJ 1JO8A 1J54A 1WWXA 1X3MA 1G15A 3MVPA 3WQTA 3IWFA 1S72N 4KMUX 2MWOA 3QICA 4XICA 2D2WA 3H0IA 3HZJA 1JLAA 1GV2A 1Y97A 4X1VA 1GBQA 2IVMA 4WCGA 4M3UA 1IV6A 2L7FP 2DA9A 1C1CA 4JK7A 4UQGA 3T8RA 4CI0C 3EYIA 2PVGB 4CC2A 3V4IA 4M77G 2H09A 2RK1A 4HSRA 1KGSA 1M1FA 1A35A 1ZLKA 1YVUA 3L8BA 3UA7A 3WTYC 2ZQBA 3LSMA 3ZT1A 3KBGA 1KZHA 1JJ2S 3QJ6A 2BHYA 3O3GA 1TGOA 1NBWA 4CGDA 4C8QB 2OTJN 1TT0A 1VQ4A 2VBYA 2P4WA 3FISA 2E1NA 3CCJN 2DK5A 2F48A 3BG9A 3QPSA 3VQ4A 4XTWA 3QZ9B 2LYCA 2PFUA 4K0KK 2CP6A 3GO5A 4BRIA 4G94A 3ZN1A 3ENHA 3Q5FA 3H35A 2CWEA 1MUYA 1V55H 1ERDA 3LP0A 2J6OA 3I56N 1WZOA 5HS8A 5J1RA 1ABQA 3DB3A 2EV0A 2HZDA 3R6SA 4CXFA 4F14A 2Q97A 3K7AJ 3H1QA 4CA0A 2CUBA 3OYYA 1Z21A 1M8VA 5LJWA 5A2QE 2XF7A 3FXRA 3I33A 3G3ZA 2O3FA 4E9EA 3KYCB 4AT1B 1KHCA 2QTXA 1Q86O 1YS6A 2QKKA 3PFIA 4BGBA 3K69A 1JB0E 1Y6IA 1N8RR 3R9PA 4M77F 2PYLA 4J01A 3WGGA 3CCRN 1M9SA 3G6EQ 1U5TB 4XL9A 4CZLA 1BI4B 2JJ7A 1GXQA 3CCVT 4CFDA 3CCEN 3RSEA 2HU9A 3K5MA 5EC7A 1GHCA 1AOJA 4NXMK 4HCCA 1ZGJA 5AQUA 5EX5A 3TSQA 2P1JA 3G6EN 1WHJA 3CCRQ 2BHZA 1Z9QA 2CRGA 2KHMA 3JCMg 1TK0A 1V5FA 2QM1A 4KTWA 1YWOA 2RF0A 4BWMA 1FLIA 3QDRB 4Y13A 1RIOH 2ASOA 2Y1IA 2XAGA 3RZDJ 2NVYJ 1TW3A 1VQ4I 1SC7A 5LJ5j 2W57A 1G5VA 4M77D 3TTDA 4FW1A 5KVRA 2ZGZA 3HKZA 3AGKA 3U4LA 1Z26A 4AUXA 3KEOA 2DIGA 3WODF 1X2MA 3HL2A 1SD7A 4C5IA 2VJJA 2HDDA 3QEXA 3B6AA 4WFBL 2WFBA 2BEOA 1DKGD 3UR3C 3TARA 4J9EA 4O6JA 4DZPA 2BKDN 1OISA 3I0TA 3OSGA 2HNDA 4RM2A 2A07F 3M8FA 4P9UA 2PG4A 3U21A 3KIOA 3E2UA 4J9BA 2A3SA 4JRQA 1BW6A 1PDNC 1S22A 3FLCO 2KQ2A 1SFUA 4YFNF 3DOLA 1WSEA 4KDPA 2DA2A 4UUSA 3DB4A 3CJTB 3RWUA 4KRTA 1ETKA 3WG7H 1XQPA 2BW3B 2XV4S 5E3OA 4DTUA 2JMAA 1QVGS 1W1FA 1R00A 3HFNA 3ZN0A 5GMKi 1GL5A 3PNVA 2N8GA 3PO3J 5L3GA 2WB1N 4QVDA 1WGXA 1B34A 1BU1A 1OR7C 1HW1A 3BTIA 2HMAA 1OZ3A 1BA5A 1WXBA 1KG4A 2VYTA 1I39A 1OPKA 4BQNA 5A0LA 1GXIE 3ZEHA 2HNHA 2VUMJ 3QLHA 4KBOA 3K9KA 3VQ9A 4C8QE 3CCMA 3BCAA 2O8CA 5F0FA 1RC9A 1IHWA 1GLNA 1V4SA 3HTRA 2O2OA 4ON0A 2R7QA 2OQRA 4DUZK 1QQNA 4CUGA 4YDUC 1SSFA 4O4GA 3TPQA 2HVHA 4GVEA 5GMKj 3FXMA 1AHJB 5LBQA 1UHSA 2JM9A 3HM9A 1TVRA 3SEZA 2D1KA 3CCSQ 1XC9A 4KMFA 2A6AA 3SWNA 1CKAA 4BUPA 2EGCA 4MLHA 3VEVA 3T1HK 2C0OA 5K5QA 1VQNN 3OW2A 3N4MA 2JHJA 4YOXA 4B8AB 4NQWA 3I0SA 4BXFA 2NOBA 3BGRA 2IOCA 1JJ2A 5KRSA 3QNOA 1FNNA 1I81A 4FYWB 3SQ0A 1LE8B 2YHWA 1KEAA 4OIRF 4FWRA 2Y0SN 2QDLA 1KD1O 1ZQ3P 2K9QA 2HHHK 2XB0X 4JI2K 1RDCA 3CUQA 3FFIA 4RLQA 4C0FA 4BRQA 4C92E 3HPGA 4ZYGA 3DTEA 1SMYF 2V9VA 3O8GA 4JBAA 3SQ1A 2IGKA 3VEXA 2ISZA 1KG6A 2IAIA 1P90A 2HHTA 3EG0A 4B1ZA 1CZBA 2JT4A 1L3SA 4WCIA 4YIIA 4B3AA 2NNYA 3R0JA 1NLVA 1KU7A 3OR1C 1Y56A 3F70A 2DOFA 3CQ8A 4PFOA 1VTNC 2OFKA 2KRHA 5M1PA 3I0WA 6AT1B 4FYDA 1YQRA 3CWAA 1TWFJ 1JI8A 3PX0A 2EQRA 3O9UA 3ECHA 3ASKA 4J6WA 3CW7A 5LEKA 1QHTA 2ZD1A 2VBZA 4YOTA 1NK3P 1BBYA 4RCCA 4OKJA 1DGWY 1VQLQ 1TYQA 2QWMA 4EHTA 5LJ5d 3F9KA 5F64A 3VGLA 1HYSA 5HDNA 4DU1A 3I5RA 3G4SA 5CAIA 1YYVA 2OD5A 4H5VA 4BY6C 4AI4A 1RT1A 1FBUA 3EFOB 3GZ5A 2P0QA 2WACA 1RAGB 1S1TA 2Z1DA 5F6FA 4MFDA 3T9NA 2XC7A 2K79A 4JKDA 4BRHA 2Y9ZA 1PSEA 2DL7A 2HPMA 4BR2A 1MSFC 1MDMA 2L9RA 1VQLI 1M3QA 1HYVA 3K4CA 5AQIA 5JICA 2QGFB 4FJ9A 2PMZA 3QPTA 2LZ6B 1SVOA 2IGMA 3OYDA 2O8KA 4BJ5C 1RCHA 2BVMA 1ARKA 1ATSA 3C2HA 3NVMA 3LP2A 3O3KA 2RHUA 2K5LA 3S41A 3H0GJ 3U1DA 1Q82R 1XCBA 5F0XA 3ATVA 4DSIA 2R7DA 4C92D 1S72T 1P2FA 4AG2C 3J7AY 2L7ZA 5AT1B 3FJ5A 3K4NA 2D0NA 1XMOK 3K2AA 2OAUA 1JKRC 5FPDA 4HSBA 4KA4A 2E6LA 3I8BA 1O3SA 1UGRB 4UV9A 4D8KA 5BREA 3GVAA 5C44J 2DW4A 3R2XC 4DQIA 3G10A 4DYCA 4DBHA 1U5SA 2XMFA 3MN6A 4O0IA 1R49A 5E8GA 1EO1A 5GAMh 3AAFA 1QZ5A 3AA3A 1U0JA 1RNHA 4BGAA 4PHTX 1T33A 4MLEA 4M9SA 2GQQA 2RHYA 3I71A 3A8HB 3UWNA 1GFDA 2H6BA 3SZ2A 3J7AP 3H5AA 5H1SQ 1ODDA 3MFKA 5HKCA 2ZE2A 2RB6A 1F5TA 1C0MA 3A01B 4IOCF 2SRCA 3M1FA 1SMTA 4ENMA 4PJOA 4L9JA 4FWPA 3A5OC 1WQWA 4CE9A 3TR8A 3F0ZA 4N0BA 2CO5A 4CJRA 3WTZA 2PJRA 8ATCB 2NUBA 3KKSA 1JE8A 2HMPA 1DGRM 1WZ2A 4I0AA 1N34K 3DXJF 1M1KR 1TK5A 2PNIA 2KLOA 3JRBA 4IO9F 4BY6B 4CHNA 4PUSA 1OCRH 3ML6A 3VSLA 2KZMA 4E1JA 2WAEA 5F04A 3TGNA 5KE2A 1NG7A 2E3IA 1JL2A 4RW9A 3VRZA 2FJ1A 3RMDA 3MEXA 3CCLN 4MO5A 2G7HA 2CP0A 3CFOA 3HK2A 2DKGA 3SHWA 2LQWA 4J83A 2NXNB 3JCMe 3BF3A 3ECOA 3CDLA 2PJPA 3DKMA 1WYXA 1PP7U 4JX4A 4OIOF 2XGDA 3QBYA 3DI6A 2ZSHB 3SUOA 5AQRA 2NRHA 3SLCA 1NZ9A 1R1UA 4RAYA 3KP5A 1VQMA 4NC7A 2VI6A 1RABB 4CGHA 2VQLA 1VSKA 1Y0UA 1JLFA 4BD3A 3DTKA 1YIJA 3WGIA 4LDYA 1TKXA 4CCJA 2R93J 2PBDA 4F91B 2UV1A 3KPHA 1UG1A 4DSEA 5HCKA 3KZBA 3DKXA 5GAGJ 2QQAA 2E7WA 2GZWA 1N8RO 3BG6A 1D09B 3SAFA 2M87A 2DYIA 1IRXA 4KIBA 3TU4K 3V9ZA 2KI7A 3U3YA 3CHWA 2VC1A 3CCJQ 3SAGA 4KFCA 5ELZA 2PZSA 2OTJQ 1TKDA 2P8TA 1K9AA 4XOPA 4IKFA 3E1SA 2VKNA 1YVNA 2E1MC 5L3DA 4PFZA 4UUVA 2HEQA 2ESHA 1J9AA 4Z4IA 3MHXA 1Y39A 3DPLC 4II3A 2GTJA 3AVKA 2EZKA 5EG0B 5GAN6 2HVIA 3T0YA 4ASNA 2BE9B 3QBXA 5LGNA 4A59A 1X1DA 5IYDJ 4BQQA 2DMUA 4FOIA 2PYJA 2A69F 4HQEA 3V6DA 2OZ6A 2FF3B 4A3KJ 3KXTA 4HT9A 3AFHA 4PCQA 4PKCC 1W5TA 1UFFA 4F93B 3PLAA 2R5ZA 3B73A 3VEZA 3G6EA 3ZEUB 4CZGA 1U78A 2WBNA 4JYAK 2D45A 1QO0D 4C2MJ 3GTQJ 1W0TA 2QQ8A 1R71A 1GLLO 1IJWC 4OWRB 2VKEA 3JCMd 3C2GA 1KSWA 1NGDA 5LRRA 1A5JA 1VQ5Q 5FDLA 2LKXA 2DYBA 1VQ9Q 2A61A 5GTIC 1IN4A 2DL4A 3D0SA 1W97L 4E6KG 3LSTA 4J2AA 4J7IA 2DJIA 4OMOA 2QKBA 4AIJA 5DEQA 4LXCA 4RMOA 2YR2A 3AVJA 4M78C 2QA4T 2H1KA 1JCGA 1T8EA 5CKHA 3BPXA 1M3AA 2FPFA 3S3MA 4L5IA 2UXXA 1UA1A 3PSFA 2NYXA 1ZBXA 1XSDA 4XH1A 1IN8A 3CD6Q 3IMXA 3MZYA 4XQFA 4HQMA 3MCPA 1BOAA 3R6NA 1GCQC 1YW8A 2QEXI 3B8AX 2HB5A 2XICA 2L3RA 5CYVA 1VQOI 1NJIU 3W2VA 1VQ6T 1UJ8A 1Y07A 4M7AD 4KPYA 1GLCG 2QSFX 3U23A 4H0TB 3OY9A 3IKTA 1IAWA 1OCCH 1TWHJ 2DFHA 2D0QB 1H8AC 3M8PA 4CD3A 2R7VA 1XMXA 4XSXF 5KRTA 4Q5WA 1B07A 3LDOA 1R9TJ 2KIUA 4D5FA 3FJPA 1YIJI 1YI2N 5C0YA 4FWSA 9ATCB 2HXIA 3GUDA 5M5WJ 2JHNA 1MNMC 4IJNA 1FYLA 1F36A 3LPTA 1HXDA 2YUPA 2WSCE 2RI5A 4A63B 5ICFA 1TWAJ 4GY2B 4WQ5C 3TTCA 3OS0A 1ZTRA 3FE1A 2K4YA 1WI9A 3HTSB 5A0DA 2M9UA 2IA0A 2GUIA 2DPUA 2JN0A 1JXSA 2GAUA 2EILH 4ZNXA 4MQ3A 1EF4A 3F8BA 1W5SA 2PUOB 2UZKA 1X75C 1D9DA 4UY8O 3QYFA 4OLAA 3CPWP 2NLUA 3GLXA 1AU7A 1XDSA 2H3GX 3KX2A 1SEMA 4A3CJ 2NOLA 2RNGA 1LWVA 2COYA 5EVZA 4DR1K 2DMQA 4KB0A 3P7NA 5LJ3f 2RM4A 4Q47A 4HCZA 4HF1A 4CBXA 2P51A 2BDPA 5L8RE 4ZJZA 3QYHB 4DV1K 4OX9K 1WSIA 2DM1A 1P7IA 2DL8A 4IOXA 3D0PA 4OPKA 4DTNA 3OMCA 5CIUA 1DIZA 3ASOH 1EX4A 4LDVA 1BUPA 4FLVA 1T3LA 2R5MA 4X9CA 3BG7A 1NMDA 3EPZA 3RKXA 5L3CA 2O8CB 1JEGA 1RNLA 4U0VA 4NLBA 4FZZA 2Q0RA 2QEXA 3TAQA 5FPEA 2RF2A 1UE9A 3ISNC 3RUXA 4IHVA 3O2PE 1HBXG 1KQ8A 2QXLA 3UNGC 3E5QA 2X4JA 3DRPA 3CPWM 2JK3A 1YAGA 4YEJA 3KE2A 3FEOA 1RBVA 1OU9A 2PX9A 3Q7BA 2VBXA 2UWMA 3N97A 1EQYA 1SQKA 4FVUA 2FBVA 4JI5K 1NK2P 1BM9A 3HIFA 2ECBA 3LANA 4CCNA 1KYWA 4IO9L 2IDOA 2NS8A 2H1LA 3ZQIA 3NCIA 5D6WA 1ATRA 4XEIA 1WDXA 3CJCA 3GW2A 3DQVC 2NVQJ 4KAZA 4D6WA 4ELYC 4W5RA 1VQ5I 1SRLA 1UAAA 2W25A 4B47A 1M1EB 3E0JB 2BZTA 2GA1A 4JYKA 1VQKA 1R7JA 1YJNI 3S6WA 3G71N 1ATNA 1QA6A 2DYSH 4NL3A 2HD0A 5AQOA 1BA0A 1YTUA 4Z4GA 3FHFA 4FYXB 5M1FA 2E6MA 2Y30A 2X3XD 2JUFA 3LLRA 3R0AA 3OYCA 5F27A 4DBRA 1WN7A 3QOEA 3O3FA 3VQDA 5BR9A 4C8NA 4FLXA 3MKYB 3W6VA 3V8JA 5FLXO 3OTOK 5DCMB 3F73A 2BE2A 4A5MA 2RAEA 3PQKA 3U6FA 4CFCA 5C4JJ 1N9RA 2ZCFB 3LFKA 2HNIA 1K79A 1FOXA 4ZHRA 4XH5A 2CSIA 4DV3K 4FISA 3DV8A 5BNGA 5DLQE 4DV2K 4EM2A 3K4JA 2F2WA 2ID3A 4B1UB 2F2VA 2VPRA 1OH6A 4C0DB 4H0YB 4MFBA 4ZN3A 5HROA 1I1GA 1XGOA 2DJQA 2BYVE 1XCVA 5CPRB 2K57A 1X2QA 1SUQA 3CIPA 3PMIA 4B48A 4WTOB 3I55Q 4CC4B 2KT0A 2W40A 3VYGA 2B7EA 3SPYA 2DMNA 1IV0A 1T8IA 2LTPA 4WX9A 1Z77A 2DA7A 2RVCA 3CCLT 1JJ2P 3PIPL 4A5NA 1D0XA 2O31A 3ENBA 3F8FA 2IPQX 1PU8A 4O55A 2P4RA 1X1AA 4KH1B 4S0HB 4Z6YA 4CJKA 1UOCA 2ZXWH 4LF8K 3S93A 2LFBA 4RB1A 3LWHA 4KHUA 2FXAA 4DU4A 1OOTA 4IVNA 4UY8I 2R5YA 3HO1A 4J9FA 4Y92A 1S6LA 3I55N 1VQON 3GF5A 3EHRA 2VXEA 2COBA 4JKGA 2DRMA 4K25A 2FBIA 4IXAA 2HXOA 4M45A 3CQZJ 2UUAK 3QESA 2O8DB 1TKTA 4D8DA 2QQ9A 3EG3A 2K5CA 1UMQA 3TOAA 3IUOA 4IHWA 2DK3A 2RHKA 4CZCA 3DBLB 3ZXSA 5ECAA 1F9NA 3AAPA 3HFOA 4XQ3A 1IW7F 1VQNT 5JS1A 4B1VA 4B3MK 4TVRA 2LF7A 1VQ7I 3RRGA 2M5WA 3MO8A 2L0KA 1BI1A 2HYFA 1RACB 4Y0WA 3MMYB 2ECZA 3FZMA 2YKMA 3WGHA 1IO6A 2IS1A 1YHQA 5FLXZ 2HPIA 3K10A 3GX4X 4G7ZF 3L2VA 3H3VK 3KCCA 3W2AA 4C8QC 4N0AA 2CP7A 4CF9A 3PVQA 4EQQA 2QWLA 4M9ZA 5HDKA 5KYYA 2EA4A 3TANA 5LLQA 2IS3A 2QDYB 1NH3A 1NLPC 1IUYA 4ZYAA 4AI5A 4JV5K 3E19A 3FFKB 3VOVA 4YOVA 2VQGA 2R5YB 3THVA 2QLZA 2J05A 4OINF 4GW6A 1LCUA 1A5VA 4BBRJ 2ZCWA 1KQ9A 4KT5C 1OVYA 1MV0B 1WVRA 3L6QA 3NDKA 1IRZA 3VPRA 4PLIA 4IZ9A 1QVGM