3OYGA

Crystal structure of the prototype foamy virus (pfv) intasome in complex with magnesium and the insti compound1 (compoundg)
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
368
structure length
368
Chain Sequence
b'LDAELDQLLQGHYIKGYPKQYTYFLEDGKVKVSRPEGVKIIPPQSDRQKIVLQAHNLAHTGREATLLKIANLYWWPNMRKDVVKQLGRCQQCLITNASNKASGPILRPDRPQKPFDKFFIDYIGPLPPSQGYLYVLVVVDGMTGFTWLYPTKAPSTSATVKSLNVLTSIAIPKVIHSDQGAAFTSSTFAEWAKERGIHLEFSTPYHPQSSGKVERKNSDIKRLLTKLLVGRPTKWYDLLPVVQLALNNTYSPVLKYTPHQLLFGIDSNTPFANQDTLDLTREEELSLLQEIRTSLYHPSTPPASSRSWSPVVGQLVQERVARPASLRPRWHKPSTVLKVLNPRTVVILDHLGNNRTVSIDNLKPTSHQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PFV integrase
publication title Molecular mechanisms of retroviral integrase inhibition and the evolution of viral resistance.
pubmed doi rcsb
source organism Human spumaretrovirus
molecule tags Recombination,viral protein/dna
total genus 106
structure length 368
sequence length 368
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2010-09-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
A PF17921 Integrase_H2C2 Integrase zinc binding domain
A PF18103 SH3_11 Retroviral integrase C-terminal SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2300 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3oygA04
1.10.340.70 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Endonuclease III; domain 1 3oygA01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3oygA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3oygA03
2IC3A 1BIUA 1XHXA 3NF9A 4J2DA 1U04A 2BIVA 3MXJA 5SWMA 3NGZA 4DS5A 4CJ4A 2XDPA 1SSFA 1KSPA 3QKJA 2KQ2A 3NGIA 5J1EA 5HRRA 3LP3A 1XC9A 2E5QA 4FLUA 3QBYA 1KVCA 3TABA 3B6OA 2RHUA 1VRUA 1Z25A 2IS3A 1R0AA 3C4SA 3Q1JA 3EY1A 4C8LA 1KHCA 3IAYA 3AO5A 2R7YA 2LVMA 3HK2A 1X9MA 4E89A 2OPRA 2F8SA 1IG9A 4OPJA 2IG0A 3L3VA 3QETA 3D45A 5KRSA 1QSLA 4CJSA 3SZ2A 3THVA 3PO5A 1JXEA 4IUVA 5J2MA 1RT6A 2LTOA 4FLXA 1SKSA 3DLKA 1LV5A 3QEXA 4AHVA 1LWEA 1XI1A 4DSFA 4CFBA 5T7BA 5C0MA 1TL1A 1S1XA 3AVIA 3TAQA 2OZMA 1XNIA 4DFMA 4J2AA 1U45A 5KCOA 1W9HA 3TI0A 4OLAA 3PMTA 3CFRA 2EQMA 4EP5A 3KKRA 4Z4CA 3P5JA 5KTQA 3F73A 1ASWA 1WJSA 4B9XA 5HBMA 4QQ6A 2EFIA 3SCXA 2LSNA 4FJJA 1JL1A 2Z1IA 2PYJA 3A2FA 4DTJA 4KB0A 5D6WA 1BISA 1S1WA 4F3OA 1TAQA 1Y97A 1L3TA 3SPZA 3QJ6A 4OJRA 3OJUA 3KIOA 2FHDA 2Y1JA 4DTOA 2X6SA 2A1RA 1CZ9A 1SKWA 3ZT1A 3V1OA 1WSJA 4YNQA 2A1SA 4CFDA 1G5VA 1SL2A 2BE2A 3ZSYA 2F5KA 2FBVA 4B9SA 1CXUA 4FU6A 4Z4GA 4KV8A 4DSEA 1RT4A 3MEUA 4FJMA 3META 1NKCA 4I9QA 3LGFA 3VQEA 1OI1A 2YNHA 2K3YA 3O3FA 2G8KA 4RG8A 1EP4A 4DS4A 2R58A 2OPQA 4PQUA 1L3SA 3K5NA 1NJYA 1X9SA 5KGXA 3VQDA 4TSXA 2KZMA 3KK2A 4FL6A 1NK9A 3LP0A 5J39A 3KLHA 3DRPA 1KVBA 2KFZA 4FZZA 3FEOA 4R5PA 4CESA 4C8OA 1TKDA 3DRSA 2HNYA 4DQIA 3I0SA 4O55A 4CIFA 4KB1A 2DFFA 4C5GA 4DTUA 4W5NA 1KLMA 5KH6A 4OPKA 2LDMA 1TGOA 3H8ZA 2G8HA 5HRNA 2K3XA 3V9SA 3ZEHA 2GFUA 4DWIA 3LGLA 3AO3A 1A5VA 1D9DA 2RJEA 1KFDA 2Z1GA 1RNHA 4HVJA 1BI4B 2OPPA 4BDZA 3DLEA 1KTQA 1MHNA 3SQ4A 2P5OA 4W5RA 3LP1A 4HHTA 4ID5A 1ZBLA 5CYMA 1Q8IA 1RDCA 2QQSA 2PYLA 5D3GA 2ETJA 3HP6A 4DTNA 2GBZA 4DSIA 3L2UA 1SKRA 4FK2A 2RPIA 3DRRA 2YKNA 3OS0A 4DQPA 1S1UA 1WSEA 4M3UA 5KI6A 1L3UA 3TWHA 4E7LA 1BCMA 2BGGA 3LWLA 1RTIA 1S9EA 4JRPA 3RRGA 2MWPA 2BUDA 1RTHA 1ZBIA 1LWFA 3VQCA 4CE9A 4CEAA 3KK3A 2DIQA 2XY6A 4DSKA 5JS1A 2VYTA 1IKYA 1JXBA 3AA3A 1JLGA 4H4MA 2YHBA 4KTWA 2Z1JA 1VSJA 1TK5A 3VQBA 2XY5A 2X4YA 1OYXA 4M3RA 4CF1A 4BE2A 1JLAA 3M8SA 2RO0A 4KHSA 4DG1A 1EXQA 1B9DA 2Z1HA 4CEFA 5KE2A 1JLQA 4CERA 1L5UA 2VWJA 4FM1A 4B08A 3MEAA 3HPOA 4B9NA 2G3RA 4E3SA 1HYSA 4E0DA 1QS4A 1W0HA 1C1BA 4M3TA 1HJRA 1N5YA 4Q0BA 2YHAA 4E7HA 1RBSA 3OY9A 3G10A 2X4WA 4II1A 2G8FA 4AHTA 4E7IA 2HMIA 2D0AA 4A4GA 4E1MA 3KLEA 3ZT4A 1U49A 2RKIA 3ZSRA 4HCZA 3T3FA 3LAMA 4O44A 3M8PA 1IKVA 4DSJA 1IKWA 3OQ5A 4CIEA 3OS1A 3S3OA 2GF7A 4M3ZA 2E6NA 2EQKA 3PO4A 3OYDA 1RI0A 3ZT0A 1C0MA 1TKTA 1VK0A 4CEOA 4IKFA 2B8AA 4CEBA 1S1VA 4CIGA 1BI4A 1TKZA 3NDKA 4DLEA 3M9QA 4BWMA 2RJCA 4A4EA 1SV5A 3TAFA 3MO8A 3TANA 4KO0A 4IUPA 3AA5X 3MP1A 3AVBA 4PUOA 3S6WA 3L2QA 4IUTA 2OYQA 4FVMA 3HM9A 4FK4A 3O4QA 4PLLA 1DTQA 1I3AA 3E9GA 3LP2A 4ELUA 4KTQA 3WNHA 3RMBA 1RCHA 2GFAA 3RR8A 4FCYA 4LD0A 4HUGA 2QXFA 3TAGA 4C8NA 2R5AA 2RHZA 3NE6A 4BE1A 1BQNA 1RDAA 2RHXA 4W5QA 3IG1A 1DLOA 2KTQA 1UA0A 1YVUA 3I8DA 2ZD1A 3VQ6A 4I9LA 1IO2A 4FJ9A 4CEDA 3RR7A 3L2VA 2JZ2A 3SUNA 4I2QA 3U3GA 3VQ7A 3ZSWA 2XY8A 4CCHA 3HPGA 3K5LA 3K5OA 4DMNA 1WSIA 2EX3A 4OKEA 2LCCA 1WSGA 2EQJA 4B9MA 5CYQA 4QQGA 4N4IA 2HQXA 4BD3A 2BDPA 4NZGA 4UC4A 5E41A 2HQEA 4N56A 2L8DA 1J5OA 4OGEA 5C42A 3JSMA 3AVKA 4B9WA 5SZTA 3S3NA 2HVHA 4AHRA 1OZ3A 3DLGA 4Z4IA 1IH7A 5J2NA 3OYLA 3BDPA 1RDBA 4FW2A 2RN2A 1FKPA 3C6UA 4O4GA 2ATQA 3OMGA 3AO4A 4W5OA 4C5IA 3VQ9A 4WE1A 3HVRA 4FJ8A 4BACA 4NS5A 1NOZA 4C8MA 1D5AA 1LW0A 4FLYA 4BDPA 1RT3A 1ASUA 2F8TA 1VSMA 3K59A 2R57A 4BE0A 1ZYQA 2O4XB 1RT7A 3LPUA 3V81A 1HQEA 2HHWA 1HQUA 3V9UA 3SQ2A 4E7KA 3V4IA 2DY4A 1CXQA 2G8IA 3QLHA 5FROA 5HLFA 1GOAA 1T05A 4Q5VA 3NNQA 1RTDA 3UT1A 4RW6A 3ZSVA 3OYIA 3OYJA 4LSNA 3M8RA 1NOYA 2P1JA 3PNWC 3OYFA 2M1HA 1BCOA 2G8UA 3DB3A 3HL8A 4NYNA 3DM2A 3V1QA 4GVMA 4J2BA 1J54A 3E01A 2W42A 5I42A 1IKXA 4IFYA 3AVNA 2OA8A 3VQPA 1NK7A 5DMRA 3P8HA 4C8KA 1UWBA 4B9LA 1WAJA 3AVHA 1HPZA 3AVMA 3AVJA 4IG3A 3QEVA 2ZQBA 1Z26A 4QOZB 3GOXA 4N76A 3PX6A 4FW1A 3ULDA 4CHPA 3OYEA 1CZBA 4DFPA 1VSKA 3LYIA 1REVA 4I2PA 4OVLA 1JKHA 2JGUA 2EQUA 1I39A 1QQCA 1C0UA 4AH9A 2RI3A 4GW6A 2P5GA 4CF0A 1RT5A 3ALYA 1ASVA 2PZSA 4OGCA 4F2RA 1A5WA 4KHQA 4MQ3A 3HXMA 5J2QA 4NYFA 4DF4A 4QVZA 1YTAA 1NJXA 1LAWA 1C0TA 5FRMA 4RW7A 3RMCA 4FJHA 2E4LA 3LX7A 1WGSA 3ME9A 3OJSA 4AILC 1L3VA 3P83D 5FDLA 3HVTA 3ASKA 1JLEA 4OKJA 4LD6A 3TAEA 1A5XA 5IN1A 2YV0X 5D6XA 1O1WA 4H8KA 2DTUA 4FJGA 4KRFA 4CJLA 3LZJA 1N6QA 2PY5A 3SQ0A 3HYFA 2JLEA 1B9FA 1BIZA 3QNNA 2O4XA 4CGGA 1GOCA 2Q3SA 3KD1E 4IDKA 4L8RB 1S1TA 4CJUA 1N27A 2GV9A 5FRNA 4E19A 1HNVA 1TAUA 2X6NA 4DQSA 3HP9A 5KRTA 2RHYA 3VQAA 4PY5A 4K8XA 1DTTA 3MEVA 3AVCA 2G8WA 4FJ5A 1TKXA 1CLQA 5CIUA 3LLRA 2IOCA 4CEZA 3PUFA 2XRIA 1C6VA 2ITGA 2XHBA 3UIQA 1WLJA 2NUBA 3NCIA 2FC0A 2DFHA 4F8RA 4DTXA 1NK8A 3QERA 3K2PA 2QKBA 4PLIA 4CGJA 3CQ8A 1EETA 2HHQA 4CJ5A 4QW2A 4C5EA 1NKBA 4DF8A 4FLVA 1QSSA 1TK8A 2YRVA 1OZ2A 2DAQA 3QIPA 1HYZA 4CJFA 2BANA 3NBPA 1D8YA 2AJQA 3OYBA 4CJKA 1NKEA 3OVNA 1VSDA 3SV3A 3T19A 3ZSZA 4FLZA 4E1NA 3QIIA 3PMIA 2R5MA 4NCGA 5J26A 1C1AA 1EX4A 4EDUA 3L2WA 2XK0A 3VA3A 4XIUA 1RBUA 4FLWA 1YTUA 3H6ZA 4UQGA 5DK5A 4EZ9A 5JS2A 4DU4A 3V6DA 1UOCA 2EHGA 3P8DA 1J53A 3QEWA 2KFNA 4LH5A 4BDYA 4KHWA 3LALA 3OS2A 3WNFA 4E7JA 3ZSXA 1VSIA 3VN5A 1S9GA 1LW2A 1ZBUA 4W5TA 1HRHA 4KHYA 1SUQA 1U47A 3D0PA 2JTFA 3S3MA 1NJWA 3E9FA 3MEDA 3L3UA 4CK1A 4CJ3A 5KGWA 3PX4A 2Y1IA 3HSTB 4CJWA 1UA1A 4Z4EA 4IBNA 2I5JA 4IURA 4Y1DA 4FK0A 1ZBHA 3DLHA 1WSFA 4EZ6A 2E6LA 2KZZA 4EP4A 4DSLA 1QTMA 3F70A 2IAJA 4M45A 2WONA 1K6YA 2LRQA 3IS9A 3B6PA 3L42A 3CFOA 3ZSQA 1KLNA 1C1CA 4DFKA 3KD5E 3QNOA 2YKMA 4CK3A 3MP8A 3DYAA 4LY7A 1U4BA 2X78A 3OMCA 2HHSA 4B8AB 1JLCA 3QIOA 3SUOA 4PA1A 1NK0A 3PV8A 3AV9A 3OYCA 3EYZA 1TK0A 4AHUA 4O0IA 3TR8A 4CFAA 3MEWA 3NHGA 4F4KA 4DTSA 2HNDA 1Q9XA 3WNEA 4FXDA 3DLBA 1SL0A 3V1RA 3MEEA 1QHTA 3P1GA 2OZSA 4IG0A 3DOKA 3CEYA 5D6YA 3VQ4A 4IFVA 4F3TA 2RI5A 3MEGA 4LH4A 4DTRA 5EU7A 2VG6A 2P51A 3LWMA 2RI2A 4B9UA 3SI6A 3VQ8A 1FKOA 4FJLA 3QEIA 2WACA 3QINA 5J2PA 3OA6A 4CGIA 2QQRA 3DLMA 2YNIA 3OYGA 5I3UA 3RRHA 4CHOA 4FJIA 4DTMA 1RBVA 3RMDA 3MXMA 1X1PA 2HB5A 1WAFA 3EZ5A 2L89A 3C94A 4Z4FA 2HVIA 4QAGA 1RT1A 4DLGA 3HPHA 4CEEA 3DI6A 1QSYA 4FLTA 3FLGA 4FM2A 4FJKA 3AVFA 1XHZA 4I7FA 2YNGA 3SNNA 3NTIA 4GMJB 2G8VA 4KKOA 4HCBA 4ZTFA 1JLFA 1LWCA 3L8BA 4CJPA 4M3YA 1S6PA 1VSFA 4Y1CA 4FJNA 3K5MA 1BGXT 2QK9A 2RF2A 3OYAA 4NCBA 3OB9A 3SJJA 3O4NA 3BGRA 3NH0A 4OLBA 3AVGA 3QEPA 2XY7A 3I0RA 4KAZA 3QESA 3SUQA 2MWOA 4N5SA 3S9HA 2DFEA 2L3RA 4ZTJA 4MFBA 3NH1A 3VQ5A 3O3GA 4KHNA 3SYZA 1GOBA 4Z0UA 4B9TA 4HUEA 1VSHA 1KVAA 4CJTA 1ITGA 3ZT2A 2OPSA 3TAPA 3V9XA 1KRPA 4RG2A 1WNSA 4RW8A 3LPTA 3CM5A 4KHUA 3O8VA 3F9KA 1WJQA 1VRTA 3JYTA 1TL3A 3AA4A 4B9VA 2O4IA 3NF6A 4M3WA 3QO9A 1JL2A 4KREA 2HHVA 4FYDA 3DMJA 2RJDA 3LAKA 4ICLA 2M0OA 4QQDA 5HROA 1NJZA 4KPYA 3SV4A 5IAYA 1T03A 4CGHA 2P0KA 2RHIA 4C5HA 4ELVA 2D0BA 1HYVA 4CJVA 3FC3A 3RMAA 1U48A 2FBTA 4DFJA 3CFPA 3EAEA 1VSLA 3U6FA 3PFSA 4DQRA 1FXXA 4L59A 4IUUA 1RTJA 1T8EA 4FZYA 2QKKA 2PQWA 3BDLA 3OYHA 3DB4A 4CRIA 1UAXA 2B4JA 1SL1A 3OYMA 1HNIA 4FM0A 5HRSA 4PWDA 1KFSA 3SD4A 1F21A 4M42A 3C95A 4KFBA 2KW4A 4HCCA 3ZSOA 3DOLA 1MU2A 2EKOA 2VWKA 1RDDA 5C24A 4K8ZA 2D5RA 1T7PA 3HJFA 2F96A 1RBTA 1Q9YA 4CJRA 2M16A 4CHQA 2X35A 5CZ1A 5C6SA 4YFUA 4CEQA 4CHZA 3NGYA 4OVAA 1WSHA 3AO1A 3WNGA 1LAVA 2WOMA 4N4HA 4KI6A 1XWLA 3LANA 3T1AA 3SQ1A 5C25A 1RILA 1KCFA 1RT2A 2HNZA 1X9WA 4JRQA 4N47A 3KLGA 4X34A 2E6MA 3AVAA 3MP6A 3M8QA 4Z02A 2YNFA 2X74A 3CG7A 4H4OA 3PX0A 4J2EA 1NK6A 3U3YA 3CYMA 4M41A 1TV6A 1S5JA 5KCHA 3AA2A 4HTUA 4CGDA 2FBYA 1TVRA 4Z4HA 3NTHA 4JS5A 1ZBFA 1YT3A 1B92A 1FK9A 2O4GA 2D9TA 4F2SA 1JLBA 2RJFA 2VG5A 3PY8A 3NF7A 5M9OA 3MECA 3SUPA 1RBRA 1WJRA 1QE1A 4CJEA 1S6QA 3NAEA 1BL3A 3NFAA 4CGFA 4AHCA 2HW3A 3ASMA 3NTKA 4CF8A 3O3HA 4CF9A 4IUQA 4Q5WA 1BHLA 3HT3A 3K57A 4A4HA 3CM6A 4B8CA 3C6TA 3KLFA 4KI4A 4CECA 4FZXC 4PL6A 4N4GA 1WN7A 3AO2A 4DTPA 5CY4A 4CFCA 5CZ2A 3FDRA 4JS4A 3LH0A 4HUFA 4RW4A 3OYKA 4A4FA 3MXIA 1NK5A 4ELTA 2B6AA 1NK4A 4CK2A 4M3XA 4KTZA 4DU3A 3NH2A 3ZCMA 1BQMA 4CHYA 3DLRA 3TAMA 5K14A 5HP1A 3LDSA 4BWJA 3VQQA 3RTVA 3IRXA 1VSEA 3AVLA 4CHNA 4DQQA 3L2RA 2CKKA 5HRPA 3TARA 1J9AA 2HHTA 3LZIA 3FFIA 2NLUA 3H08A 4CF2A 2HHUA 2XO7A 3V9ZA 4FJXA 4B3OA 2HHXA 2B5JA 3V9WA 2DIGA 4O5BA 3KKSA 3K58A 2BKDN 4CJQA 2X4XA 3SPYA 3NF8A 4ZHRA 4LSLA 1HMVA 1D9FA 4JLHA 1EKEA 2VG7A 4OKKA 4G1QA 3MAQA 4FJ7A 3RWUA 4RW9A 5KE3A 3UWNA 4O0JA 3VA0A 2FBXA 3ISNC 4NCAA 3OYNA 4DU1A 2IDOA 3KTQA 2IGIA 4QCLA 2ZE2A 3ITHA 4N41A 2D0CA 4AHSA 3G0ZA 4GY5A 4ID1A 3KJVA 3KK1A 1G15A 3KUFA 3HO1A 3KLIA 1H3ZA 3ZT3A 2GUIA
chains in the Genus database with same CATH superfamily
4R55A 1XHXA 3SEMA 1QRYA 4J2DA 4BB7A 2NRAC 4RCHA 4A3GJ 1VQMQ 2AA4A 2B0LA 3CJ7A 4CJ4A 4NBQA 3L4QA 1BC8C 3U4LA 2XG8D 4F7UG 2FX0A 3DXMA 1UG1A 2VBXA 5KYNA 1W4SA 3NGIA 2OTLI 1HCRA 3HDDA 2GBYA 3FB9A 1TXQA 5AQXA 3K70C 3PIOF 1WKMA 4L0ZB 4NXMK 1P2FA 4FLUA 1R1TA 3J80O 5CVVA 1FT9A 5F0CA 1PSFA 5H1SQ 1WUAA 3TABA 4B3MK 3CUOA 3R0AA 4IRGA 1Z25A 2A5XA 3RERA 3O2PE 3DKMA 4MDWA 1X2MA 2QWQA 2FQ4A 3IAYA 1EH6A 3M0SA 3HK2A 3WTYC 1GLAG 3HHTB 4CUGA 2F9WA 4X0GA 4C2MJ 2F8SA 3HRGA 2M0MA 3CCVN 3L3VA 2RN7A 3MN2A 1ATRA 1RPWA 5KRSA 4H0TB 1QSLA 4K0KK 3SZ2A 5CKHA 3PO5A 2BTTA 4IUVA 3O8HA 4RTZA 5F64A 3HC7A 1FNNA 3EG3A 1NYFA 4I6MB 5H20A 1SKSA 3H5AA 4JKGA 3DLKA 1YITI 1N33K 1LV5A 5LEJA 4LG0B 1LWEA 4UB6C 1SFOJ 3RPQA 3ZMTA 1JKRC 4DSFA 1BBYA 5TISC 4D7MA 2KAFA 1YQKA 4KHPK 5C0MA 1TL1A 1EWQA 2JMAA 2OZMA 1HYOA 1JEGA 1U45A 1YJNA 3QUIA 1Q81C 5AQUA 1K1ZA 2VWBA 1S72A 2IVWA 3MKZA 3CW7A 4Z4CA 3ZETA 2E7XA 3P5JA 1FOKA 4IRIA 1JCGA 4E4HA 1I3QJ 1K79A 3TGNA 2M9UA 2YT6A 3BG7A 4EATA 5HBMA 5IH2A 2WSFE 2LSNA 2BUPA 4KRTA 2E71A 2ACJA 3OSVA 3ZR8X 5KCMA 2Z1IA 4JI1K 2CFOA 3L1AA 3HGGA 3A2FA 3DBLB 4DTJA 1OH5A 4EQQA 3M6GA 2DMOA 4IEEA 3H0GJ 3GTOJ 1Q7YO 1WA7A 3CCMT 1CQTA 1Y97A 2V8JA 2DPDA 1XMQK 2NYSA 3A5ZB 2A07F 3E66A 4NOYA 5EY4A 1BA5A 1Z6TA 2K9MA 1YVNA 3NGPA 5CKDA 1N8RU 4XU0A 2Y1JA 3F8NA 2ME6A 1S8NA 2X6SA 2A1RA 2V7FA 3SWNB 2EK5A 4YNQA 2H3JA 3JSCA 5IT9O 4FWKA 1YWPA 1Q86O 1SMTA 3T1BA 4H0XB 1DP3A 4AFZC 4PKCC 1G5VA 4J83A 4MFEA 4K43A 2Z0WA 1VQ5Q 4PJOC 2NRRA 1SL2A 2Y75A 2CGJA 4WCEL 4RMOA 3ZSYA 2A36A 1K7AA 3DU5A 2F5KA 2FBVA 3D2EA 1MMDA 1MBKA 2W7NA 3META 1NKCA 2P5KA 5KYYB 3FE1A 2JHJA 3WG9A 5ELZA 2K3YA 5BRDA 4OMLA 3O3FA 4XU1A 2MOXA 3HOVJ 1GXPA 4RG8A 2L0KA 1VQ8Q 3GG4A 4DS4A 3V7CA 4L6V5 2ZCFB 3LH5A 1D3BB 3VFZA 4JK8A 5KGXA 1W2BA 3A8GB 4DV4K 2IA0A 3CCLI 2W85A 4WCGA 1YIJT 2KZMA 5CVIA 2WY7Q 1NBEB 3ULQB 3LP0A 3FHNA 3JRAA 4Y91A 3EGDA 1O9SA 1T38A 3SMSA 1VQ7A 1WFWA 1N25A 4KIGA 2HNYA 2YX6A 2L3QA 1OU8A 4Y33A 1RLPC 2A3LA 1Y39A 2DFFA 4I6MA 5E18F 4C5GA 3C1DA 3E9PA 4DTUA 4W5NA 2HKNA 1KLMA 4N0AC 4CI0C 4NNJA 4M78E 1OR7C 1BJZA 3SEQA 3VF6A 4PSWA 1W7PA 5D5WB 4FWQA 3THXB 4MGRA 1XMAA 1MMGA 2BEOA 1EZZB 1YX3A 4LUEA 3TO6A 4MO4A 3KYLA 2VKVA 2J6KA 4X1VA 1RRSA 2DF6A 1SRLA 1D9DA 5IYCJ 4WF2A 3F2KA 5AQJA 3DLEA 1KTQA 1MHNA 2P5OA 4JZ4A 2PUOB 4W5RA 4PNOA 3RESA 4C8QC 4HHTA 4MDAA 1M9SA 1WHGA 1YFHA 1VZ0A 2EFQA 1MNEA 3GW2A 3CCVI 1ZAOA 2NS0A 4BY7J 2PYLA 3RYPA 5D3GA 2ETJA 2D0QB 1T6SA 1Z6RA 4OFHA 4FK2A 3LQQA 2V79A 5LJ5g 2HQRA 1HOMA 3SEZA 2FZKB 1L3UA 1BCMA 2DOEA 2F1LA 3LWLA 3CWTA 1S9EA 1QNTA 3RRGA 4ILGB 2FQ3A 1RKTA 2CJJA 4A3DJ 4QPOA 1Y6IA 4CEAA 3ZN0A 2DIQA 2QWRA 2XY6A 1IV8A 4UVAA 5JS1A 1WIEA 1FYKA 3CC4I 1M90O 2MH9A 1JLGA 4XQ3A 4LFBK 5AZJA 2YHBA 5IP7J 1TYQA 1VQOI 3KP7A 4M78G 2YJFA 1KQ8A 1UJ0A 3CCRQ 3I56I 5M5XJ 1OKJA 2E2QA 2X4YA 1OYXA 4CF1A 5GMKe 2L3DA 5HS7A 3DQVC 3P9KA 2KRMA 3M0TA 1D0ZA 1X19A 1TNSA 4DG1A 2VL8A 1B9DA 2J5OA 3GF2A 5F0HA 2Z1HA 4KICA 3W2AA 1U1TA 1D3BA 2COMA 3MZYA 2HYFA 2VWJA 3I59B 3CUQB 1S6LA 3S93A 2CT4A 3MEAA 4PGHA 1HYSA 3O3KA 2XPVA 2AIRB 1VQNT 1C1BA 1YX5A 1T8IA 1RAHB 5I22A 1B9MA 4IJAA 4Q0BA 3GNGA 3LW5E 5CCAA 5KNLA 3FK7A 2QWNA 4V2SA 4XLNF 1F36A 4EM1A 2JN6A 3CBPA 2G8FA 1P4AA 2DNUA 3JRZA 2JSCA 3R4KA 1M2VB 4O8KA 4E1MA 3A8YA 3ZT4A 2RKIA 3U21A 2QYZA 3T3FA 5GAOp 3IKTA 2DL4A 4A3CJ 4U88A 3OS1A 4MTDA 2ZJQF 4ZDLA 1T0FC 3THXA 3HOWJ 2JWLA 4Y13A 1K73U 3TP3A 1G2BA 4CC7A 3PO4A 3OYDA 4V19S 1P9QC 1DGKN 1DPRA 4CEOA 1EBMA 1WEFA 1WQWA 1JGSA 1S1VA 4CIGA 3GZ5A 3FM3A 4G9YA 4DLEA 1STZA 4F3QA 2QKLB 2D2WA 5JI6A 1YN8A 4M7DF 1SV5A 2E1YA 1I0CA 3ESWB 3TAFA 3FKIJ 3MO8A 3D6RA 2DFUA 2VGMA 2V9KA 3AVBA 4RM3A 3S6WA 2LP5A 2OYQA 4FVMA 4Y0WA 2ABLA 1I3AA 2LC4A 3E9GA 4ELUA 4ILHA 1J59A 3EUKL 2DU9A 5JVGL 2EAYA 1VQPT 1RCHA 3K1MA 3LA7A 1Q86C 3TAGA 1ITYA 2R5AA 2RHZA 1H9GA 3NE6A 3R6OA 3G6EN 4C0FA 3CCEN 2RHXA 4LF5K 3IG1A 2ZXWH 1DLOA 2WAFA 2W1OA 5A2QO 1MD0A 5EX5A 3M56A 2HZTA 3OIPA 2EA4A 3VQ6A 4DV5K 2HKXA 3RR7A 3HUGB 3L2VA 2GXAA 3NFCA 2A69F 2H1LA 4B3RK 2JZ2A 1K4TA 3RZOJ 4B1UB 2KE9A 3KHYA 2P9KB 3VGKA 3DLLL 3U3GA 2YLBA 5BR8K 1OV3A 5EEGA 4CBWA 3E6BA 2M2EA 4FL9A 4CCHA 3HPGA 3K5LA 3O08A 2BHYA 4I02A 2EX3A 4OKEA 3CC7A 1XTDA 1I94K 1EWRA 1WSGA 2EQJA 4RA2A 1HUXA 1HW2A 2OTJN 2HQXA 4CBXA 1AEYA 1W5TA 3IFRA 3THKA 4AFUC 1RETA 1VQ5A 3QQAA 1MV3A 1J5OA 5C42A 2QWWA 2DYRH 3JSMA 4RB1A 4B9WA 2M02A 2E2HJ 2V9VA 1GVJA 3SFZA 5GAEP 1KZHA 1OZ3A 4Z4IA 2FSJA 2CUBA 3OYLA 3GP8A 2KLOA 1RDBA 2IS6A 1W36C 2ENMA 1VQ8A 2ITMA 2DMQA 1E3MA 2VOOA 1FKPA 3X25B 4BEHB 5TRDA 1XB4A 4HNTA 4W5OA 3JCMQ 1ZGAA 1G59A 2HDDA 1JJ2S 4LIVA 1NOZA 4C8MA 1IBKK 1LW0A 2XMFA 2LREA 2E5LK 2NRXA 2DJIA 3QWXX 1E17A 1VQOA 5ILSA 3MKDA 3I56A 2OJ2A 4BE0A 4FX0A 4WFNL 3WT0A 2DOAA 1Q82U 2H94A 4YOQA 1G83A 1KD1O 2J6OA 2KRNA 3GZNB 3MCAB 1TQIA 2KRFA 4C1NK 4E7KA 3CCSQ 3GE1A 3QMLA 4PFZA 2O8CA 3H6EA 4HF1A 4B43A 1REPC 2XF5A 4H0EA 1GOAA 2HYJA 2FMYA 1RTDA 2X6YA 1Z67A 3ZSVA 4E1JA 2P1JA 3GTGJ 3BW1A 5J1RA 1TSFA 4B47A 2DBBA 1MDMA 1U8BA 3WGHA 1R0CB 1NLVA 3V1QA 4GVMA 4J2BA 5CVJA 2HFHA 3E01A 2W42A 2LJ1A 1IKXA 3IKMA 1IRZA 1FW6A 2Q1ZB 3GDQA 3M4YA 3BF3A 4ZZDA 1YI2N 4A57A 3TSQA 2IAIA 2ID3A 3JCMf 1HNXK 3TW7A 3TSUA 5BPLA 4XKVA 4BRLA 2ZQBA 1Z26A 3PX6A 4IXAA 2F5FA 5F1XA 2K27A 3OYEA 2RN8A 2DRMA 2R0QC 1FMVA 3H3VK 3HUGA 2DL3A 1FTZA 1QA6A 3CC2N 1REVA 3CCQA 2ECBA 1P4XA 1I4K1 1DU6A 4PJOB 5AQZA 2YX4A 2AZVA 2GNCA 2YUQA 1E7OA 1UGVA 1NG7A 3RDVA 4YOYA 3NARA 4ABZA 1C0UA 4AH9A 1J0RA 4MDXA 1VQ6T 1NMDA 1I5OB 3WQTA 5LRRA 1UZCA 4CHUA 2O61A 4CF0A 1NJIO 2PZSA 3F8MA 2A61A 1A5WA 4ZDOA 2JA2A 2DJZA 1WBBA 5J2QA 1OPLA 4JI7K 1S3XA 2V9PA 4DF4A 2KSSA 3CCRA 4QVZA 1S29A 4FYWB 3SBGA 4BR9A 3M0QA 3DV8A 3G6EI 1FTTA 3AFHA 3CCEI 1LAWA 5FRMA 3ZGKA 4GV6A 3TOAA 4MEXF 2KQWA 2YSRA 2FL7A 4BEHA 1HBXG 4IHTA 4AILC 1L3VA 5FDLA 4RGSA 4ORZA 3ASKA 3DP7A 4H5WA 4A62A 4OKJA 3CBOA 1K8AO 3G4ST 5IN1A 3HHHA 5D6XA 3OW2M 2FBIA 2QWLA 3CJ1A 5J8FA 1CKBA 4LF9K 5DTDA 1FPQA 2PMZA 2XU8A 4JKCA 4CJLA 3FXUA 4BVPA 2JUFA 4AU7A 1M8VA 2LCSA 4M7DD 2D1XA 3H41A 1UECA 2OTJI 3KD1E 4JHDA 3RBBB 4BGBA 4HX4A 2QWPA 4FE7A 4FYXB 3O9SA 2YR2A 5FRNA 1IN5A 3BDDA 3E97A 1KC8R 4XLCA 3HP9A 5KRTA 3QJYA 3IUOA 5C12A 3HSBA 4K8XA 3AVCA 1L3LA 3CLQA 2RQVA 4C8QB 1TKXA 5LJ3j 3NAUA 5KAIC 5GAEJ 3OBWA 4M7AE 1XQSC 4PCQA 2FLOA 2XHBA 3I9V2 2FC0A 5B5EC 4DTXA 1KU9A 1YHQI 4PL7A 1LNXA 2EJ9A 1YYVA 1QHAA 5EDNA 2RC4A 4CGJA 4WFBL 3CQ8A 1EETA 4DF8A 2MBFA 5GAMg 2HVRA 2D8JA 1VQ4N 1WCMJ 2W25A 2PU9B 3ASOH 4RTYA 4FWMA 4N4OB 2KHMA 3CMEN 3Q0WA 1FY7A 3NBPA 2HOSA 2AJQA 3ABLH 4PKGA 2LSOA 4OPHA 5AN4A 1VSDA 2EFNA 2OTLQ 3SV3A 2VGNA 2K9SA 3KETA 5I11A 4FLZA 4E1NA 2WB1N 5CPRB 1MBEA 4E7SA 3PMIA 2YPRA 4IOCL 1XX5A 1EX4A 3L2WA 3LM9A 5GAN8 4LD9K 4FLWA 1W4MA 4JKDA 4UQGA 5JS2A 2KHOA 5C4JJ 2E12A 1XG1A 4PJOA 2G0EA 1NE8A 4JRIA 3I55Q 2LLKA 2FSNA 4J19A 3M4OJ 3QEWA 4BDYA 3LALA 5FLXE 1RC9A 2CSQA 2HD0A 4E7JA 5LJ3d 1LOTB 1E0EA 2V6EA 3VN5A 5HCKA 3BTCA 2K9NA 1AOJA 1QO0D 3VGLA 2LYCA 1IW7F 5IP9J 5EGOB 3VS0A 1HRHA 4EJVA 2DL5A 1QU3A 4KHYA 3D0PA 3JREA 2JTFA 4PFOA 1FSHA 1NJWA 4KITB 4PKHA 2PFUA 3SJHA 5DEQA 1X9JA 5KGWA 2Y1IA 4DOZA 1KQ0A 2BOLA 4M7AG 2ZF5O 5D8LB 1WZOA 4M9ZA 1MBFA 2KRSA 5L3FA 3KNTA 5LJ5e 2IXSA 4CD3A 1XGNA 1V5FA 3VTIA 1R4MB 3CC2I 3MN9A 3THWB 2PFBA 3DLHA 5E8GA 4BUGA 3RPUA 1DU0A 3HL2A 2GA1A 5ADXA 1OR7A 3IP4B 1JB0E 2JXBA 1SS6A 2MPXC 1AD5A 3L0QA 4YOXA 4WFAL 1RRQA 3SDZA 3GVAA 3ULEB 3QNOA 1X58A 3MP8A 3DYAA 3DJCA 3G2BA 1U4BA 2DCEA 4B8AB 3QIOA 4GV9A 4DR7K 5HDKA 3FRNA 2EZLA 3AV9A 1Y1WJ 2O8EB 2AS5F 2BBYA 4C8QA 3EYZA 4JBAA 1TK0A 2JVHA 3INZA 2G7UA 2UWMA 2ISZA 2XGEA 3DLBA 3M8EA 1SL0A 2CREA 4FISA 1WHUA 4GVEA 3ECOA 3T1HK 1G6NA 1WH7A 4UV8A 1Y1VJ 1H88C 2KFDA 4BGAA 3ZL7C 3AG4H 4A6EA 4IG0A 3SZPA 2DRKA 5KYXB 4RMNA 3J81O 3CQTA 3VQ4A 3CEYA 5D6YA 1XCBA 2RREA 5GTHC 1VQ9I 2L9RA 4A3MJ 4JLGA 2Z9OA 3NVKA 4F3TA 2RI5A 3MEGA 2CZ1B 3KBGA 1KYZA 2X6XA 1GUUA 3CD6T 3CF5L 3LWMA 2P0WA 2FMLA 4I76A 4M77G 4YPHA 3VQ8A 1JT6A 1T6DA 1QCNA 3JCUC 2P9LA 5HVQC 1AOYA 3QSUA 4YFKF 3QEIA 2NXNB 4M71A 3D2FA 2JJ9A 2FPDA 5J2PA 2MLGA 2LJ3A 1U6ZA 1SSHA 2CDTA 4H0YB 2BE5F 4G6QA 4JI0K 1LKXA 3H3UA 4AIDA 2V8IA 4BRDA 3CCLQ 4CGIA 3CP2A 1QVFP 4LDYA 1TC3C 4M7YA 2O8FB 2RQWA 1E6HA 1RBVA 3RMDA 2RM4A 5BRFA 3MXMA 1X1PA 1WI3A 2CW7A 4DZJA 2HB5A 2L89A 3C94A 1YHQA 5FPNA 2HVIA 2HBPA 5E3LA 2KP6A 4J01A 2K5CA 5EGOA 3A0HC 1PU7A 2LKXA 4DLGA 2L02A 1VQ4I 1HC8A 2RD1A 1NGAA 1ZBXA 1YQLA 5LMNK 4IOAL 3CMEI 3LSHA 5F0FA 2RQPA 3AVFA 2VC1A 1XHZA 1T08B 5FU6C 3MHXA 3S1RJ 1FX7A 3SNNA 4GMJB 2VXZA 2R7XA 4JJNK 2O88A 4RGRA 2CRGA 1JLFA 1LWCA 3E1SA 3L8BA 4CJPA 4M3YA 3I0XA 1G8XA 2W84A 3N4PA 2QSHX 4IHWA 1BGXT 4JPBW 3OYAA 1LFUP 1U8RA 1LPQA 2GQVA 2KIFA 2XRNA 3EZWA 3SJJA 2A28A 2K4JA 3VPZA 4Z8AA 4DV0K 3BTJA 4BG8A 1CGPA 3CQXA 3NH0A 1M4ZA 4FPBA 5KPZA 1R5HA 2ESHA 4A93J 1VNDA 1YJNT 3I0RA 1SAUA 4M7XA 1EJ9A 1T0FA 2OAUA 4CC4B 1MZBA 4B1VA 1S72T 4CDGA 3D5RC 2L3RA 4IO9L 4B3TK 3ULEA 5LGTA 5J4YA 2A41A 2FE3A 5J6XA 4XU3A 4KHNA 3MZ8A 1PUFA 3FSPA 1EV7A 2HDCA 4BI4A 4B9TA 4CJTA 2E36A 2OPSA 4CBUA 3TAPA 2EIFA 3V9XA 1H9TA 3Q7BA 1E3HA 3GTMJ 3J7AY 2F2VA 1KRPA 3W0LA 1CF7A 1U5SA 2JW4A 2O8EA 2UUCK 4CZGA 2FXAA 1TZLA 3QG1A 1WJQA 5FPDA 4LFAK 3CPWA 2E70A 2BE9B 1GVDA 5GAN7 1TL3A 2FPFA 2NOZA 2NUTB 4HKEA 2O4IA 3R60A 4FT2A 1UG0A 4KREA 2HHVA 3A1PA 4GLMA 3G1MA 3R9PA 4AC0A 3I53A 4AIKA 4QQDA 5HROA 3SV4A 2P0KA 1W70A 2VBYA 4H5VA 2KGTA 1V55H 4XNFA 1KIKA 1UG2A 1S9HA 3CFPA 1VSLA 1WJEA 1FXXA 1J75A 1QCOA 1DPUA 2D5VA 1USTA 2P4TA 3SDBA 2KDOA 3ENHA 4FWOA 4CRIA 1I5LA 3OHRA 5ILUA 2ETHA 1M1GA 1KQSM 2NWMA 2H8HA 1HNIA 3HOZJ 2QA4T 5HRSA 1SEMA 2COZA 3PE0A 5B3SH 2I10A 3K4JA 1RAGB 5IPAA 4HRIA 1HU0A 1LFPA 2WV1A 2O8FA 3DOLA 2R7TA 2H6CA 2QKMB 2F48A 2ZSHB 4K8ZA 3AG1H 3O1BA 2BXZA 4JLIA 2EH3A 3HJFA 5HLTA 1X6OA 2L4MA 4R8HA 2YHWA 2P9NB 5KQDA 3WGIA 4CEQA 4OVAA 4DOWA 3UA6A 1VQ9A 3IRRA 1VQ7T 2HSEB 4HVWA 5HY6A 1LAVA 4KUMA 4JV5K 3QZ5B 1OLTA 1XN7A 1YW9A 4RAGA 1SQKA 3RJPA 4KI6A 1TTYA 1XWLA 3LANA 1RILA 1IRGA 2LX9A 3KLGA 2K5IA 4XK8E 3M8QA 3U9ZA 2YNFA 4HV6A 2X74A 4M78C 3PX0A 2Y30A 4XRSA 4MZPA 4UUTA 1NK6A 3GBGA 1S1NA 2DERA 4H4KC 4BR7A 1UFFA 3HOXJ 1S5JA 4P5NA 3MEXA 3UDCA 2R5YA 4JKHA 1W0TA 2FBYA 4ITVA 2XROA 1SMYF 3MKWB 5DLQE 5ECAA 1FK9A 3DTEA 3E1YA 4XL9A 4WWCA 2RJFA 2Q0RA 2TRTA 5M9OA 3M5AA 2E5NA 3MECA 2COWA 1JTYA 4FWPA 4CJEA 1S6QA 3VENA 1BL3A 3ASMA 1K4SA 3O3HA 2E2PA 4BROA 3G71N 4Q5WA 5K7HA 5CKEA 4XQFA 1DDNA 3HT3A 1IAWA 4A4HA 4B8CA 3QYBA 1X1DA 1X3ZB 4GDFA 2IW5A 4PL6A 2NUTA 5FPEA 2R5ZB 2ZSIB 2PAVA 1IJWC 5CZ2A 3EL2A 4I7HA 3OYKA 2HZYA 4ELTA 3ROUA 2LOOA 1NK4A 4A0ZA 4KTZA 4H5TA 4EGYA 1N5ZA 4K25A 1O7LA 1YQRA 1XS9A 4DV3K 2QWMA 2DLPA 1X27A 5IP6A 3G1LA 4KGZB 3LDSA 4HX8A 1U78A 4V19K 3VQQA 3ECHA 1UB4A 3K4BA 3QRFF 1NH3A 4CZLA 3T9NA 3RTVA 1T0HA 4H0VB 5JLFA 2JS0A 4AI4A 1IG7A 4GGGA 3E7LA 5EZGA 1AKHB 1PVSA 1TTHB 3M1CA 3K9KA 1YIJI 3H08A 4CF2A 3TOBA 3VF4A 4M75E 4LB6B 3BG5A 2GBQA 1VQMT 5MLCQ 2QEXN 3S2WA 1QLYA 2EWSA 3PO3J 4CJQA 1X3WB 4ZHRA 1M30A 3MMVA 2VG7A 2P9NA 2PQ8A 1Y96B 2H3GX 3WXMB 3M58A 2HWVA 4FJ7A 4F04B 4RW9A 5KE3A 3UWNA 1T39A 3S1MJ 2HXIA 2I2LA 4HAMA 5EG2A 2L9VA 4II3A 3OYNA 3CDLA 4FWRA 4UNFA 2DA6A 4JJCA 2HI3A 1M8MA 2IGIA 1RUOA 1SF9A 2VPLA 2W6LA 1Z9QA 5TKYA 2O31A 5GAMe 3UF4A 1LE8A 4ID1A 2EFWA 1EIFA 1B3QA 4DJAA 3FXOA 2ZFWA 3BR1A 4IVNA 5I21A 1UGQB 2MF2A 3K1NA 2CUJA 1H3ZA 2A42A 4D0PA 2DTRA 1HR0K 1I27A 1M3QA 2W82A 3IH2A 1BIUA 4HQEA 5LRSA 2BIVA 1U04A 3MXJA 3BR3A 2EGEA 2LQKA 3NGZA 1JQQA 3M59A 2XDPA 1BI2A 1KSPA 3S1NJ 1ZLMA 3ABMH 2F2XA 3O9UA 4IPAA 4AYBA 2IA1A 2FJ1A 2LKSA 3OOPA 2A37A 3ENBA 5LL6S 1H0MA 5GAN3 2RA2A 3CCUN 2RQQA 1HLVA 5HKCA 1KVCA 2F2WA 3JCMV 4F17A 1R0BG 3K7AJ 3JCMh 2RV8A 3E6CC 1R0AA 1JKOC 2DETA 4M75G 3V42A 2DTOA 1KJWA 3EY1A 2JM9A 3TP0A 2XV4S 3R1XA 2R7YA 2LVMA 2BH1A 4LMYA 2NYXA 4RM2A 3IDHA 1IG9A 4OPJA 3EG0A 2KNBB 4CJSA 3THVA 2LR8A 3ABUA 4BNCA 4CGZA 3SMPA 2JJ7A 1JXEA 2P9PB 1KG2A 5J2MA 1RT6A 5CVUA 1B34B 3QYGB 4AMCA 2VE8A 4AHVA 2LD5A 5AQGA 1KO9A 1HDDC 2L7MP 1M1FA 3TKYA 3V7SA 1RFQA 4DUYK 2KT1A 2J05A 4M3DA 4IHVA 4CZZA 2ZXHA 5T7BA 2NUPB 1S1XA 3TAQA 4A59A 1ACIA 2WA0A 3IL2A 3HPWA 3JRDA 3CC7T 2W10A 3CCMA 1QPIA 2JM8A 3TI0A 3JAMO 4ATOA 4OLAA 1VQNI 2K3BA 4LDVA 3CFRA 2EQMA 4EP5A 1VQ5T 2I7PA 4BHCA 2V1UA 3AT1B 3CXCM 2VC8A 5C3EJ 5KTQA 3AG3H 3F73A 5GPCA 3GFJA 5KK1A 2O5RA 2WAQN 1HNWK 3SCXA 1Z77A 4JI3K 2XSDC 1Y96A 3EH2A 3JCMd 1NNEA 5F6FA 3AL0C 4EA5A 1VQ8T 4JK9A 4RAFA 4PJOE 1TWHJ 2LTPA 5D6WA 2HCKA 5HLIA 5FU6B 2K2MA 2RK1A 3TDUC 3WTWC 2KJBA 4G94A 2DJNA 2IP2A 2OTJQ 3QJ6A 1WHHA 1QBJA 2JWKA 3OJUA 3PO2J 1OH6A 4RWTA 1X3UA 4AFSC 1CZ9A 2BXYA 2ZFUA 2UU9K 4F7UA 2GWJA 1E4FT 1WSJA 1MNMC 1ZSGA 2COYA 3BG6A 3N5NX 2C0IA 1AZGB 2O0YA 3ZCOA 2CSOA 1YCYA 1MUNA 3LWHA 1B4AA 2UZKA 5E20A 3I9QA 4PFPA 4O3MA 2Y0SN 4YIIA 1CXUA 5E26A 4GYGA 4Z4GA 3BPVA 4CYCA 4DSEA 4EVVA 4GKJK 4I9QA 3LAJA 2L7ZA 2MLKA 1OI1A 3T7ZA 4CZEA 2E1MC 3KZIC 1U06A 1B9NA 1G3YA 1ZK8A 2A6AA 5L23A 2CS7A 4PQUA 1VQPI 2HKQB 1ETWA 1U6GA 2I7NA 3CIPA 3K5NA 5GAN4 1R6RA 1NJYA 3JTHA 2UV1A 2PG4A 2Z33A 2HF4A 1J5EK 2KKZA 2P5VA 1IHWA 2VT3A 1NLOC 2YLCA 5GMKm 4TSXA 3KK2A 3CO6C 4FL6A 2IS4A 5M1OA 2IGMA 5J39A 1K9MO 2K02A 1NEBA 1WFXA 1IZ6A 3AG2H 3DRPA 1WQ2A 4J00A 1UHWA 4FZZA 4R5PA 4C8OA 5FLXZ 2P9PA 2RQTA 2IPOB 2JMWA 2JRTA 3I0SA 3ISPA 4A0YA 4UVCA 4KB1A 4C8QE 1BW6A 2K5FA 2GWKA 5KH6A 1TOVA 4LXCA 4BRCA 1XD7A 2D1KA 3FXJA 5HRNA 3Q9VA 4QS7A 2K3XA 5E17F 1QVGA 5FGMA 3V9SA 3OL4A 1M1KO 1IGUA 4DWIA 2NUPA 2CQQA 2M7AA 3LGLA 1FLIA 1NGFA 3QFPA 3RI4A 3AO3A 3CCUI 1ONVA 5LJ3g 2VQLA 1KFDA 4E9GA 3HSFA 3UKGA 1BI4B 1E4GT 3F9MA 2VKHA 1PYVA 3HYIA 4YIFA 1YI2Q 4I09A 3SQ4A 3O4WA 2VUMJ 3LP1A 1HF0A 1ZBLA 3BE3A 2M8GX 5CKTA 4AD9A 3CCRT 5KQ8A 3SFMA 1Q8IA 3E6MA 3D4VA 2YI1A 1WGXA 1HSQA 1RDCA 4WX9A 3PSIA 3WE2A 1MW7A 2K7LA 5H6QA 1TUDA 2PBDA 3L2UA 1SKRA 4UHTA 3WG7H 3FXQA 3J80E 2YKNA 2FXUA 3OS0A 2L01A 4DQPA 4PUSA 2BW3A 4DUZK 3HKZA 2P6SA 4NDLA 5FJ8J 2M4GA 4B1RA 2BGGA 2RH2A 2BUDA 5KYUB 2K3FA 4EVIA 2DXBA 1W5SA 2KISA 2DT6A 5CKFA 2JOYA 5IYDJ 1AA7A 1QVTA 1LWFA 5LMUK 4BRNA 3VQCA 4M78B 1IN4A 2FRHA 2IJLA 1XNRK 4CCOA 2E19A 2PN6A 1JJ2A 2VYTA 1IKYA 2FUG2 1JXBA 3AA3A 3CETA 4PJ0C 2VWFA 1W2BP 1TP4A 3VEPA 1VQNA 1YJ9N 3HXLA 2P5LC 1X2QA 2A05A 2JA8J 4E47A 2WC2A 4LF4K 1VSJA 2EBPA 5LY3A 5FO5A 2XY5A 1R58A 4BE2A 4B3AA 2RO0A 4KHSA 4RCCA 4YOVA 1OX8A 4M7AC 1PKTA 1R1VA 2YUNA 4ZZLA 4OWRB 4HV5A 3LSJA 2Z99A 1WPYA 4B08A 1NZ9A 3J7YP 3RSNA 3KE2A 3GOIA 5IYBJ 1Y57A 3UKRB 5AQWA 1X4PA 1YE9A 5BS6A 1HJRA 1W97L 1N5YA 2YHAA 1SRMA 2YJEA 4E7HA 1B8IA 4C92G 3EG9A 1RBSA 3G10A 2AP1A 2YU3A 1UTIA 2Z1DA 1ETYA 1EFNA 2AK5A 4CA0A 1ABQA 3O5BA 4BI8B 3MX5A 4XKWA 3KLEA 3L9FA 2C0OA 2XHKA 1Z9ZA 4HCZA 1M3BA 5GJWB 3M0RA 1IKVA 3DXKB 2BY3A 3J7AF 4DSJA 1XCVA 1LQ1A 2O9VA 3LFKA 1VQ6I 3S3OA 2VE9A 3A5MC 2NS7A 2YRCA 4WQ5C 1RI0A 3DBRB 2MMPA 3ZT0A 4V2GA 1YQAA 1VK0A 1BR2A 1ZH5A 1VQ4Q 2O6GE 2CG4A 3Q3SA 1GCQC 2E20A 5FKLA 2KROA 1BI4A 2JT1A 4EGZA 5IT9E 2VQCA 3CMEQ 4KH4A 3M9QA 5HS8A 4BXXJ 1YNZA 1J5YA 5D8KB 1OH8A 4DR6K 1QCFA 5GAOl 1HQCA 4B9QA 1UMQA 1YWOA 3EETA 4GKKK 2CYYA 4KO0A 2M0CA 3MP1A 2ISYA 1QHGA 1K78B 3E9LA 3G4SI 2HL5C 1WB9A 2V6CA 1VUBA 4PLLA 4LC9B 3VYHB 1DTQA 4OU0A 2IGOA 2M8EA 1BG3A 4M77C 1KQ1A 2EIKH 3PNYA 3S14J 5GAHP 3RIRA 4FCYA 4HUGA 2LP0A 3PNTA 3JRBA 1MWMA 4RCBA 2CP0A 2YG9A 5KYUA 3CD6N 4GY2B 3FZHA 4W5QA 5FKOA 2NVUB 3GTLJ 4XICA 5HDNA 4M78A 3CJRB 2LVSA 1GBQA 3GTPJ 3HOUJ 3C0CA 4J9DA 1Y8QB 1W7PD 2YU9J 3OR1C 5C44J 2HVSA 1QQMA 1IO2A 4CEDA 1ZELA 2ZGWA 2WY8Q 2NUZA 2JRMA 3VQ7A 1VHXA 4AUXA 5AQYA 4G12A 4LLNA 3ZSWA 2PMHA 1OQYA 4JI5K 4C3HJ 2ELKA 4P5OA 2LCCA 4L5IA 1YBYA 4Z2YA 2QSGX 2HBJA 4QQGA 4N4IA 2DE0X 2K5LA 1RAFB 1D5YA 3COAC 3C7NA 4E6KG 3O8GA 2L8DA 1Y71A 4OGEA 3CCST 4HPQA 3REAB 1KC8U 1R9TJ 1RKWA 1IO6A 3VB2A 5SZTA 3S3NA 2JZYA 2HVHA 3O1WA 3AHUA 3DLGA 4EIAA 4BY1J 1HKCA 3ZPLA 1MGQA 3LDNA 1JXSA 2HHHK 2RN2A 2VJJA 5F2RA 5AJ3K 1M1KC 3HM8A 1AT1B 4NS5A 3L4IA 4ESJA 5BN8A 3QDFA 3JR9A 4FLYA 4IF4A 5IHIA 4BDPA 2C06A 3E5XA 1XMXA 3TSWA 4Q48A 4KH0B 4LITA 3OW2S 4PKIA 3K59A 3CCYA 2X4JA 5AR0A 2NVTJ 5D4RA 2ZPGB 1RT7A 1S72N 1VIFA 3LPUA 2HHWA 2M30A 3VEYA 1FOWA 3D1NI 5M1NA 3HB9A 4IJNA 2VVKA 5BOXA 5FU7C 1VQKQ 1Z7UA 3SWNC 2DY4A 1FC3A 3QLHA 3O9QA 1T3SA 1LDDA 1RZ4A 2HNIA 3H0HA 5HLFA 3FFKB 3OWTA 3J7YJ 3GWZA 2VPRA 3NNQA 2STWA 4RW6A 2EGCA 3OYIA 2Q0OA 4LSNA 3PVQA 3UATA 2VT2A 4O6JA 1SEUA 3GTKJ 1K78A 4I2OA 5L3DA 4XSXF 1BCOA 2LNVA 3IMXA 5LJVA 4RLQA 2G8UA 3DB3A 3TBIA 4CJ7A 4OAYA 1WOQA 4I0BA 1YI2A 3HOSA 3AL0B 2WTUA 3LA3A 3ZQ7A 3RYRA 2Y2ZA 4B21A 1J54A 5I42A 1SFXA 3X24B 2ZJQL 4B9LA 4ZNXA 1HPZA 5EOYA 1TLHB 1M1EB 4IG3A 1WEGA 4KT0E 3QEVA 2GAUA 3KP3A 4XOTA 3GL1A 4FYYB 3BPXA 3DPLC 2M1BA 3ULDA 1MGTA 4CHPA 3TTCA 2K4BA 3J7ZI 3BDUA 2ZM6K 3K4NA 4KMFA 1QHHD 3OIQA 3IHOA 3LYIA 1BBZA 1XMOK 2OU2A 5KVRA 2JGUA 1D1CA 3LWIA 3K0SA 1NG6A 5M1QA 3ZLJA 3GF5A 1R77A 1ZGJA 2F4OB 2CH4W 4C30A 3I35A 2E34A 2P5GA 1TNTA 3L2ZA 3G4SA 1HW5A 2E1MB 3G25A 4E2FB 2DZ9A 1YRNB 4RTUA 1N9RA 3VS6A 4U0WA 4NLCA 3CJAA 1QQNA 4MQ3A 3X20B 4DV7K 1WHJA 5GMKi 4L5EA 1YTAA 1VQ7N 2XGCA 3CD6I 3I33A 1RIOH 3M7GA 4H0PA 3IH3A 2Q0UA 3BP8A 1Y0UA 3U23A 4BJ5C 2VIXA 4RW7A 4F93B 4E9FA 3RMCA 4FJHA 4X9DA 3QB0A 4X6AJ 3M1EA 4NB5A 3ME9A 2LF8A 1ETXA 3BZ6A 1JLEA 4IZZA 4XH4A 1Q81R 1O1WA 4H8KA 1ORKA 4OFAA 2DTUA 1XGSA 1WRJA 3KFWX 4XLHA 4DCHA 2R7UA 3VESA 3LZJA 4BRHA 3ATUA 2HBLA 1MUZA 5TJJA 3HYFA 2XC7A 4OOIA 1LVAA 2LNBA 4IHSA 2H3EB 1D5VA 2Q3SA 2QGGA 2M87A 2CW0F 2OTLT 5GADP 5A2QE 1EH7A 2GV9A 1VQLQ 4E19A 1HNVA 1TAUA 4BRAA 3BJAA 2G8WA 4FJ5A 3JCMc 4FYVB 1G4DA 3TPQA 1ORNA 3I55T 4PJOF 5CIUA 2IOCA 2R7VA 3PUFA 3I4MJ 1C6VA 4BRQA 2ITGA 3VW4A 1YITN 1WLJA 2P7VB 2V8KA 2DFHA 1LWWA 1NK8A 3QERA 3K2PA 1A35A 4MZTA 2X6OA 2DXTA 1I07A 3VU3C 4BQNA 4C5EA 1NKBA 2XDVA 2H8RA 2RHKA 1QSSA 1YJNI 2OI3A 3BY5A 2YRVA 1POGA 3E5UA 3QIPA 4ME7A 3CUQC 3L6QA 2VQGA 2DYSH 4A3LJ 1S72I 1AWOA 5IOYA 5GANf 2LX7A 3VUBA 4CZCA 3M4GA 3IKVA 4CJKA 1ILYA 3IRQA 1LJ9A 3OVNA 5GAN5 3T19A 2KVQG 3ZSZA 3QIIA 5C2DA 3MKYB 4YG2F 2R93J 5F1JA 1C1AA 2E60A 2AKKA 3HI0A 3GLLA 2XK0A 2QI2A 4J6WA 2AXTC 5IHNA 3T69A 4XH5A 2XGXA 4XIUA 1GXIE 2IA2A 5HLGA 1YTUA 1N8RO 5J1YA 3KK7A 4EFHA 2EYXA 4DU4A 3VJPA 3V6DA 4R56A 3CMYA 2EHGA 4RB3C 2KRHA 3J7ZO 4LH5A 5LJ3e 1S22A 2OAZA 1VSIA 1T95A 2ABKA 3F10A 3OOUA 2HDAA 1ZBUA 5JLHA 1YRNA 2M7BA 2WSCE 4G7ZF 4M7AB 2FOKA 4W5TA 1ZG3A 1SUQA 1U47A 2P6TA 1RI7A 3FXLA 2Q8KA 3MZHA 1Y0NA 4KA4A 2E1OA 3E9FA 3H0DA 2R7OA 4PJJA 4C3JJ 2W48A 4C8QF 4A3BJ 3TDZC 3L7WA 2OCEA 1DKGD 2TCTA 2LFBA 5FKNA 4CJWA 1UA1A 4AIHA 4IBNA 2I5JA 4IURA 4LJZF 1D8KA 5GPAA 4YDUC 2EZHA 4X66K 3G71Q 2QA4I 1RDUA 1IF1A 2NNNA 4F55A 3AAFA 2W0ZA 2KZZA 3ZQHA 4EP4A 2ED0A 1BYMA 1N77A 4AF1A 4IQJA 1ORPA 2X9DA 2WONA 3B6PA 2Y4YA 3LSIA 1KLNA 1OH7A 1V4TA 2JN0A 4C2UA 3GFIA 2LF7A 4M75C 1WJAA 3F6VA 1V1CA 2X78A 2HHSA 2KR3A 1VQ7I 3SUOA 1OCPA 5AQMA 2FA5A 1O57A 1WBDA 4BYYA 1YP5A 3EGXB 3PV8A 2MD5A 4ZJZA 3CCJQ 3K70D 3OW2P 1NMNA 5CLSA 3CCLT 3JCMg 4GV3A 4DGWB 3TR8A 2V1QA 5EZHA 3RKQA 2A40A 3UR3C 5CHZA 4JNEA 1Q9XA 1NU0A 1FIPA 1KQJA 4XTUA 1VQKA 4QTRA 1QHTA 4MIMA 3H3ZA 2QQAA 4LOCA 4ISGA 2Q2EB 2L2PA 1BOBA 1GXQA 4M77B 1GBRA 2MIOA 1G3TA 4IFVA 1Z3XA 2O03A 2QEXQ 4LD5A 3DAWA 4H5NA 1TUGB 5ICGA 1ETKA 2NLXA 1IC8A 2M34A 2RI2A 3JRGA 4TVRA 3K69A 3V7RA 1T33A 3EUHC 1OULA 1T3LA 3C3WA 2WACA 3X26B 1MUYA 5E3OA 3CC7N 5DY9A 3OA6A 4M4ZA 2L3PA 2JQ7A 5CQGA 1WWXA 1N75A 2WBNA 4HSTA 2CV0A 1VQ5N 1KQSS 4EW4A 1XNQK 2YNIA 9ANTA 2F7TA 2DN0A 2EBIA 5I3UA 1BR1A 2A6HF 4DTMA 2BY0A 4LF8K 2X1CA 2FO0A 1A6QA 3OH6A 2LY2A 3EN9A 5AQTA 3DKXA 1LEBA 4Z4FA 1SVOA 3LSMA 4M7AA 1KONA 2DYBA 3LSPA 3IHUA 3HPHA 1K8KA 1VQ8N 3QXEB 4FLTA 4CSWA 1O13A 2W41A 3THYA 2GIZA 1FJGK 3CC4N 1BIBA 5AQOA 4B1ZA 4HCBA 3A02A 2AXLA 2CQ7A 1TW2A 5JHUA 4BBSJ 4BRMA 4RAYA 2KKOA 1VSFA 1VQON 4Y1CA 1GLEG 2Q97A 2KT0A 4FJNA 1MKMA 3V8KA 3CCUQ 3I56N 4NCBA 3OB9A 5L3EA 3O4NA 4KBOA 4BQLA 4NQWB 4I01A 4LIUA 4Q47A 8ATCB 3ID6A 4J9EA 4UUVA 5J8CA 2JT4A 2PI0A 1RAIB 2D8HA 1VQMI 4JAXA 2XY7A 2HNHA 3EO3A 4AT1B 1U84A 2QG9B 3GPLA 1Q7YR 3J80Z 2MWOA 4PJOD 3IQLA 3D5LA 2LQNA 2DFEA 1YF5L 5D6FA 3PFYA 1T44A 3NH1A 3VQ5A 3GNFB 3REBB 2JUGA 3LNQA 1GOBA 1V4SA 4Z0UA 2Z16A 1SAXA 1K6OA 3ZT2A 3MMYB 1OCTC 1K0SA 3HSRA 5FU7B 5CK9A 1K73O 2QGUA 3QOEA 1BK2A 3CQYA 3WXIA 2J7IA 3LPTA 3MDQA 3O8VA 3BLYA 1Q86R 4MEYF 4Y7NJ 2VI6A 1HJOA 1EF4A 4JI4K 3PJRA 4B9VA 4ZH4F 2LMJA 4HEA2 3U1KA 1VQLA 2CUFA 3QPHA 3F8CA 3QO9A 4XTVA 2AQEA 3ZFJA 2ASOA 2D0NA 1GV2A 3DMJA 3LAKA 3KCCA 2A5YB 1V76A 2IRFG 3N0UA 2QA4A 4M77A 1DJ7B 2RHIA 1DT9A 4C23A 3TMOA 4FASD 2DTZA 5JFRA 2D45A 4IDHA 2RQRA 1QZ6A 4ELVA 1UHFA 2CH0A 2D0BA 1HYVA 2ZPEB 3A1YA 3M0PA 4CCNA 5I9EB 1H1VA 1NKUA 3RPUD 4B44A 2NVXJ 4X64K 3EAEA 3AAPA 3PFSA 3M3YJ 1YW7A 3CCQN 3TQNA 1ERDA 2M0YA 4L59A 1Q1VA 3KXTA 3G73A 2EJGA 1GLDG 4FZYA 4DYRA 3DB4A 2VKDA 4A69C 4P96A 5F08A 3BOQA 3QDKA 4LF6K 3OYMA 1S7AA 4FM0A 2AO9A 3JB9F 4DNCA 4IXCA 3F21A 4M42A 4KFBA 4HCCA 1ZHIA 3ZOBA 1M27C 5DCMB 2P9UB 4D9JA 3UPUA 4LG0A 2O9LA 3CCRN 1IXRC 1ZGWA 4C8QD 5C24A 4EW0A 4FT8A 2D5RA 4U0YA 2O9SA 1PNJA 1NK3P 4D1QA 3QBXA 1VF9A 4KN4X 5CQEA 4CHQA 1PG5B 3C18A 4A3IJ 2W04A 2X35A 1JE8A 2AT1B 2DTIA 4B48A 1WSUA 4CHZA 2HR3A 1XQHA 1JTXA 4M6XA 1XC3A 2WOMA 1RR7A 4AM6A 3BG3A 1ATSA 3CJ9A 3HRSA 1WHLA 2J5PA 5IT9Z 4N47A 1TWFJ 3BR2A 3MP6A 5CO7A 3O9TA 5BPMA 3WU0A 3H9QA 3CC7I 3U3YA 1ZQ1A 3PNVA 1TV6A 4HA8A 3MWMA 4NQWA 4PDKA 4EJYA 1Z05A 1VQ5I 3AA2A 4HTUA 5EEAA 3PT9A 1YJWQ 4E9EA 1TVRA 4Z4HA 2E3IA 1YT3A 3ZX3A 3VS2A 3CPWP 3CO7C 4E9HA 4QS9A 4QS8A 7AT1B 5K1YA 1USSA 2I5UA 3KVGA 2VG5A 3G71A 5AQKA 1VQ8I 5EG0B 2LQWA 4AM7A 3SUPA 1RBRA 1W1WE 3QICA 2L7FP 3SWNA 3ZMVA 2O01E 4C92C 2EYWA 1QVFM 2KMTA 4CGFA 1Q82O 2KXCA 1WDXA 2NOGA 4Y3OA 4CF9A 1U9NA 2DILA 1RUWA 4JZ3A 3ZQGA 2R7ZJ 1M90R 2NNWA 3HBLA 2MFZA 2C0TA 3C2HA 1N34K 3L2CA 2MI6A 3C6TA 4U87A 1QWEA 3L00A 3WU1B 1UAAA 4N4GA 4IHYA 5CY4A 4CFCA 3FBNB 5KN8A 4QVCA 2V51B 2H1KA 2EFOA 3QFUA 2L4AA 5KYYA 1UE9A 2ROLA 3E2UA 3CCJA 5BRHA 3MD2A 2JMCA 1RAEB 2JTVA 1XQPA 3ZCMA 1YQMA 3CWSA 2DAOA 1KG6A 2E7WA 2FVUA 1VQMA 3DPUA 1LB2A 2KXDA 3TAMA 2CWEA 2E6ZA 4ELYC 1BA0A 3HGYA 1WH5A 1DUXC 3IRXA 4FVUA 3UE5A 3N4QA 5CAIA 2I0NA 3MKLA 4J8FA 5HRPA 2RMOA 2TDXA 5ICCA 2A68F 3UKUB 3HEFA 2QEXA 1J9AA 3LZIA 4G7HF 1JRIA 2NOLA 2PVGB 2HHUA 1LUJB 2EW3A 2L0AA 3V9ZA 3VODA 2PUKB 1NBWA 5FKMA 1AWXA 1TQPA 3EE9A 4O5BA 3KKSA 2I8DA 1IHVA 1WI7A 1MA9B 3C6HA 5AQQA 3JRIA 4ZGJB 3J7AO 2KJCA 3CXCS 5JVTA 5GIOA 2KMUA 1EA3A 2QENA 4JX5A 4G1QA 3JRCA 1YJ9Q 2HTSA 1P6RA 2OCCH 1BB9A 1KQSP 3VOVA 1Q95G 3VA0A 2FBXA 4NL3A 3ISNC 3EUAA 3CCQI 4LDUA 2IDOA 2E41A 5C2FA 1D0XA 1ZR2A 2DL8A 1QMCA 4QCLA 4L9JA 1TBXA 1T56A 3ASNH 1Q7YC 1NGHA 2R7WA 1R5ID 1IB8A 1QP3A 2E2NA 1G15A 4RTXA 5EYRA 3A98A 3I5RA 4YFXF 3JSOA 4B09A 4DIQA 3DF8A 4G7OF 5K5OA 4F52A 2DVJA 2XF6A 3S16J 1OVQA 2BYVE 4HWIA 3DKWA 3OTOK 3CCRI 3SDGA 4CZFA 3SAHA 4MLHA 4EMHA 1PP8F 3FZMA 5FWCA 1JXOA 4DW6A 3H45C 1SSFA 3C12A 1QVPA 4A2BA 2ZJRF 4M75B 1VAZA 5EG0A 1JHFA 2HU9A 4YPRA 3EG1A 1QVGS 5J1EA 2O8XA 2E5QA 4BJ6C 1AHJB 4S0HB 2HGCA 3QPLA 1CKAA 1QQJA 3MJXA 4CH7A 3B6OA 3W2VA 5GMKl 2RHUA 2DPUA 1Z0XA 3C4SA 3Q1JA 3I5SA 4R1HA 4C8LA 5LFAA 5CQXA 3ZX2A 5L3BA 4RDUA 4XKBA 2OPRA 1E6GA 1R5GA 4E6RA 1W36D 2E5ZA 2LTOA 4FLXA 4OIQF 2BGCA 2WADA 1DGWY 2LH9A 3JB9D 3I59A 3CUQA 1GLNA 5AZIB 2QBYB 1XI1A 2PNIA 1KU2A 1G99A 3PQJA 4WK8F 4CFBA 4JKEA 1V5GA 4O8UA 2Y9YA 3EFOB 3CDIA 1XNIA 2MG4A 4NC8A 4DFMA 3Q9SA 3ZMUA 1X43A 5KCOA 2DBMA 1R59O 2O7OA 1M2VA 1YHQN 4F7UF 4XH1A 2QGFB 4WTOB 2QZ8A 1GRIA 2A3SA 2FZGB 1TS9A 4A3JJ 1WJSA 1IN7A 3CZ6A 1XGMA 4LK1F 2HQ5A 2EFIA 3JCMe 1IXSB 5J47A 4FJJA 1WJCA 2EGAA 4A5NA 2PYJA 3WXJA 3WTSC 2DD5A 4BAYA 5FLMJ 1KD1R 4CVNE 1DEJA 4IHXA 4KB0A 4C0ZA 2E64A 5AQVA 2P7CB 1PP7U 5A2QZ 3FMSA 1BISA 1S1WA 4F3OA 4MZMA 1TAQA 5E3MA 2BZXA 5JR3A 1L3TA 3C6AA 5KYWB 1U5TC 3VEZA 1BIAA 1OMIA 4BR4A 1I1GA 1ZN2A 3BZKA 2E8AA 4DTOA 1GV5A 4EMKB 1WQ7A 4LF7K 4IWVA 1JXMA 4YDUA 2M51A 3V1OA 2UXCK 2EVRA 2RK2A 5AFUA 2A1SA 3R61A 4CFDA 2VJIA 2DOFA 4BHPA 4M63C 2LK2A 2FU4A 2RDPA 3H1QA 4HLYA 4HDUA 2BE2A 1M90C 4BG9A 1ZTRA 4CCLA 4B9SA 4FU6A 4KV8A 3JXUA 1YOVB 4EA4A 3SLCA 3MEUA 2D4WA 2LT4A 4M75A 3LGFA 2YNHA 5EJCA 1JT0A 2A0FB 3CTAA 1KAZA 2VOPA 3BY7A 3OV8A 1YJWA 2R58A 4J7IA 2ID6A 2OPQA 1O75A 3JB9J 1R1UA 1X9SA 3NQOA 1X2KA 5D4SA 3WTZA 1RUNA 2PEXA 3VQDA 4ZGDB 1YI2T 3DFGA 1NK9A 2P9KA 3KLHA 3M55A 4DR3K 1R23A 1H641 3HSCA 2DMUA 1K76A 3O8MA 4HSBA 5GANj 1KVBA 3WVDB 2KFZA 3PVLA 2R7RA 3FEOA 2H56A 2ZPBB 1W5CC 3JRHA 4O55A 4CIFA 1A31A 1NJIR 4J8OA 3WVEB 3TTFA 1MNDA 5K5QA 3I71A 4OPKA 4DEXA 2F4MB 1GT0C 1B72B 2LDMA 3G1JA 2QBYA 1TGOA 3S8PA 1NGNA 1U2VB 4ESRA 2G8HA 2CT3A 2FPEA 2VN2A 4NC6A 3ZEHA 2GFUA 3A8MB 3EFOA 2MYSA 1YTYA 3EUHA 5AQPA 2HZDA 5H2FC 4LDXA 2RJEA 2Z1GA 1RNHA 4HVJA 3W6VA 2MC3A 1BU1A 1S5LC 1UFMA 5ICFA 2KQRA 4KYWA 4L9TA 5AIQA 3I0WA 1K8AR 2LQ8A 3TSPA 3J80K 2FBHA 2NOEA 1X3MA 1GL5A 2EFPA 1VQ9N 3H3OB 2XAUA 1NPRA 4ENNA 4CD1A 2XAFA 2Y48A 4U0VA 3CMAQ 2HOAA 3CWUA 2QQSA 3A4CA 5FD5A 2EQIA 2YUSA 1PVEA 1TWCJ 3KYDB 3A8HB 2QVOA 5GANd 4OP0A 4DTNA 1BJAA 4BKXA 2GBZA 5CYVA 1WHMA 2KBTA 1BDGA 5LJ3h 2K9GA 2RPIA 3UA7A 3DRRA 1R49A 1NEGA 4M3UA 2DTHA 3U8XA 2LDUA 3CP8A 4A2UA 4GLKA 4E7LA 3WHBA 4JRPA 2QWOA 2MWPA 3DXMB 3CJQB 3GBQA 3EPZA 1O3RA 1J7KA 4CICA 4CCKA 3QZ9B 3S15J 1H8KA 2ZC2A 2DA2A 3B02A 1SKUB 4YOWA 2MH2A 3OH9A 4ETSA 1SHFA 3S6IA 2ECCA 4OAZA 3DLLA 2O3FA 4J9IA 3VPRA 1KEAA 3OW2A 2K9QA 3OL3A 1B1BA 1TK5A 3VQBA 3KWGA 4O5VA 1HXDA 1FYMA 3FMQA 2E65A 3Q5FA 4IIMA 1GHCA 3SFIA 1EXQA 4M7DG 2DODA 2XAQA 1JLQA 1PKSA 4C92B 2OANA 1L5UA 1RESA 1RL2A 5HODA 3TREA 1LWYA 4FM1A 3DKYA 3LSRA 3S1QJ 3CMET 1NGDA 3HPOA 4MLEA 4B9NA 3MN7A 4E3SA 1QS4A 3LWFA 1Q1HA 3O5ZA 1KK7A 2K57A 1W0HA 4M3TA 3QHSA 2IT0A 1QVGP 3ZP5A 5DCFA 1HKQA 3VEXA 3TVTA 3WGGA 1T2KA 4II1A 3VGMA 4FX4A 3MQ0A 1J09A 4KUIA 4AHTA 2HMIA 3R8EA 1GLBG 3BJ6A 1BW5A 2AHJB 2H09A 1U49A 3FXKA 3H0FA 5FPMA 3ZSRA 2QQBA 4LN2A 3CWAA 4JOMA 4O44A 1FP2A 3M8PA 2W4SA 5AYFA 5IT9K 3CESA 1OPCA 4IEJA 3DTKA 3OQ5A 1YITQ 1D4XA 4F16A 2JS2A 3PL8A 2XD0A 3TW6A 1PWTA 2ZWHA 4M3ZA 4FSXA 3Q0UA 2EQKA 1V4RA 1N39A 3NWSA 1VYTA 4U7BA 1TKTA 4IKFA 4M77E 2JTEA 4M78F 2ZPFB 1VOMA 3CPFA 2WV0A 4CEBA 2CP3A 3VYRB 1OOTA 3NDKA 1P4WA 1KD1C 2X4HA 4JKFA 3HOYJ 4JRKA 4BWMA 4KT5C 2IS2A 3P9CA 4N0AA 1M5Q1 4M3EA 4A4EA 4BVOA 5A0GA 4ELZC 1TQMA 4KT6A 2E3HA 3TANA 4ON0A 2LY9A 4IUPA 3AA5X 1NHAA 3GIBA 2P84A 4JX4A 3H92A 3OIOA 4UVBA 3L2QA 4IUTA 2EV0A 3O4QA 4FK4A 3FMRA 4XORA 1JJ2P 2RPNA 4M74A 4OMMA 4KTQA 2QDLA 3SQNA 3WNHA 2QLZA 2VODA 2GFAA 3RR8A 2BZ8A 2XRLA 4LD0A 1IGQA 1R22A 2QXFA 2DM1A 3D2EB 4C8NA 4B24A 2OUMA 1RABB 4IRHA 2KTQA 1YVUA 1GFDA 3VYGA 2ZD1A 3TTDA 3WTUC 4ENJA 1HPMA 4JEPA 2UXXA 3TL4X 4HNUA 4LGWA 3CCSA 4LFUA 3EFSA 3GMEA 4AYBN 1SG5A 3I55I 2I5WA 1Q81U 1MH4A 1U3EM 1JKQC 4A54A 4BC5A 4KGVB 2M5WA 4B23A 3CHWA 1OYWA 3EGDB 1WSIA 1W1FA 3IV5A 4CC2A 5B8HA 2FG0A 4X62K 5CKBA 2VASA 4MMKA 5E41A 1LDKB 1WX6A 2HQEA 4C92A 2ZKZA 5E8IA 1QKWA 3JB9I 3ENOA 5HL7L 4OMOA 1VQKT 2K79A 3ML6A 2V7YA 4L9NA 3AGRA 2O2OA 2CZ7B 1NJIC 3LCNA 5TGTA 1YO5C 1K83J 1W7PB 2EZIA 3DWLE 3AKZA 3BDPA 2UXBK 4FW2A 3LSGA 1R4NB 2DPNA 1WZ2A 3MWTA 2XPWA 2ATQA 3OMGA 3AO4A 2XAJA 4C5IA 4PJNA 3VQ9A 4EEFG 3MCPA 4C0DC 4FJ8A 2OD5A 4BACA 2CV1A 4EV0A 4LNPA 4ZN1A 1D09B 1YLFA 3QWYA 3NEUA 1D5AA 1GLJO 1C6VX 4JI6K 4HX7A 1RT3A 3K2AA 1UB9A 1G3WA 3A03A 4RAZA 1GLCG 1ASUA 2F8TA 2STTA 1K8AC 1XPXA 3CCMN 5BPDA 2D0OA 2R57A 4AM3A 5ICEA 5DD4A 4D8DA 1ZYQA 2O4XB 4HG2A 3V81A 1IN8A 1HQEA 3HTVA 3V9UA 2ED1A 5LHIA 3VERA 1W2BM 4RTFD 4MMLA 2DLLA 3B73A 3K10A 4B6MA 2B63J 2CSIA 1ABOA 1CXQA 2G8IA 3THWA 1X01A 1NGEA 3VYTB 1T05A 2IPQX 2R92J 4OFEA 4Q5VA 2OZ6A 3J81Z 4A63B 3R6SA 3OYJA 3M8RA 4ASNA 1DP7P 2EYQA 3PNWC 2LJ0A 3CCVQ 2M1HA 4JX6A 5KPRA 3CC7Q 2BY2A 2EILH 3HZJA 3GCMA 4BR2A 5H6RA 1X1CA 3HL8A 2XF7A 1RNLA 2ECZA 5AQHA 5AZJB 1ZSZC 3P4IA 1NWKA 4NYNA 3GXOA 3ZEUB 1IUFA 4LLGF 1TYQB 3WTTC 1Z3YA 3AVNA 3HFOA 1ZLJA 3VQPA 1JGGA 3CMAA 2QXLA 4QLCU 4H03B 1U5TB 1AHDP 1YIJN 3T8TA 4C3IJ 2CUZA 1KG5A 4EJZA 1RADB 5AQFA 3AVHA 1K61A 3AVMA 2NRTA 2YS9A 2XGDA 5TKWA 2DYIA 2VXEA 1FSEA 1V3FA 2F2EA 1E3PA 1M3AA 5BQTA 3GOXA 2ZB9A 4FW1A 2XAHA 3SAFA 1CZBA 4DFPA 2QM3A 1VSKA 3CC4Q 4HXJA 3RR6A 2DEUA 5KYXA 3LL3A 5EXWA 1YCSB 1I1SA 3M5RA 3VEWA 1VQOQ 1I39A 4A3FJ 2LKPA 4XLPF 1QQCA 3I56Q 1RRJA 2RB6A 3R6NA 4GW6A 1X6BA 3P7NA 4KUDK 4A61A 2CH6A 1RT5A 2KYBA 3ALYA 1ASVA 4FETA 4OGCA 4KHQA 1VQLT 3HRUA 2WFBA 4OINF 1QWFA 5HK0A 1PUEE 1ON1A 4NYFA 3PIPL 4YELA 4HOBA 3W2WA 1UUEA 4ESFA 4B1XB 3C65A 2EZKA 1NJXA 2EYZA 2Z5UA 3QOPA 5ED4A 1C0TA 2DMTA 1WXUA 4MDBA 2ICWG 2OTLA 4ENKA 2BV6A 2OJED 2DPPB 2E4LA 3LX7A 4CZHA 4Q5SF 3OJSA 3P8BB 2KZVA 3HVTA 2UXNA 4FSVA 2QQ8A 4M3BA 4EM2A 4LD6A 4XN0A 3TAEA 4M78D 2JHNA 4K41A 5F0XA 1QPMA 4CW7B 5A2QK 2YV0X 2LG4A 4RBOA 1NGIA 4UY8I 5ADXH 2EA2A 4BY6C 4FJGA 1K4US 4KH1B 2MK5A 3I55A 4KRFA 2PY5A 4PL8A 2JLEA 1RGIA 2KT8A 3EDPA 1XOVA 2DBKA 3EHRA 3QNNA 2O4XA 4CGGA 1GOCA 2QTXA 2L9NA 4IDKA 1S1TA 1N27A 1R8OB 3VEVA 4XKCA 3C2BA 4J5YA 1HSJA 3BG9A 2X6NA 4DQSA 1XDSA 2E88A 1D1BA 4EAHD 1MJ9A 2DVEA 2XUBA 1QZ5A 4DA4A 1YITA 3VQAA 3IAM2 4PY5A 2ELJA 1TUCA 3MEVA 3CCQQ 3KTUA 1KQSA 2EPDA 1CLQA 5LEKA 1Y0MA 4BY9C 2XKOC 5BMZA 3LLRA 4CEZA 3HKZN 4RUGA 2EIJH 2XDDA 1A36A 3O80A 2JUCA 3NMZC 3NCIA 1LCKA 4GO1A 4F8RA 2QKBA 5B1BH 3LSKA 1F1ZA 2PZ1A 2HHQA 3ZEUA 1NGGA 4PK4A 5DYMA 2QF7A 1X6GA 2QUFA 4JYAK 1S7EA 4ANJA 1TK8A 3E0JB 3E5QA 1ZARA 3CCMI 3LMMA 2O8KA 1OZ2A 5J40A 3LM2A 1BO5O 2BVLA 1U5TA 4GCVA 2BANA 3A5LC 3Q7CA 3I3LA 4AWXB 2NVYJ 2V1NA 4XBFA 1VQNN 4EIKA 1S3JA 5DM6L 2XHIA 4NCGA 5J26A 2K6DA 3K4LA 4EDUA 3CJCA 2X0LA 3G71T 1TWGJ 3H6ZA 2F69A 5DK5A 4EZ9A 2VCPA 3VKIA 1IBLK 3M57A 3A0IX 1KFZA 1ZA1B 2FD5A 1N32K 2QDYB 1J53A 1E3OC 3CVTA 4KIFA 3DU6A 3HZ6A 3WNFA 3X2QH 1Q7YU 4I99C 1S9GA 4RS8A 2YRDA 1ZRDA 4RGUA 1IUYA 3WXKA 2XKPA 2IVMA 2HYGD 1BUPA 1JUPA 3CPEA 1V54H 2FRWA 3RUXA 4FWNA 4XEIA 1HDPA 4FM4B 5BN9A 1IRFA 2PTKA 2ESWA 1MIJA 4DEYA 3CCJT 3L3UA 1AWJA 2NOHA 4XM3A 1A04A 4AG1C 2VYPA 3PX4A 3KLNA 2Q1NA 2ZCWA 4EHUA 1JHHA 3M1FA 1Q86U 2QM1A 3H46O 2NVQJ 1ETQA 2CP2A 4XTXA 4J9CA 4Y1DA 1B07A 1N3CA 2FF3B 3SXYA 2Q2RA 2O8CB 2FEZA 2E6LA 3CCLA 1VFCA 4DSLA 2GGRA 2ASMA 1UDLA 2R7DA 1K9AA 2QEXT 4M45A 1VQPN 1K6YA 2LRQA 3IS9A 4YIRX 1PHTA 3DLAA 4UY8O 4JI2K 1TT0A 1BWFO 1NLPC 1PD1A 3FLCO 4HZFA 3RCOA 1C1CA 4MLOA 5GTIC 4DFKA 3KD5E 1MDMB 3K4MA 3RZDJ 2YKMA 4CK3A 4M9SA 2DA9A 3RQIA 4LY7A 1WNLA 1JLCA 2NRZA 3F72A 4DR5K 1BI1A 2BVMA 5GAOn 3BCAA 3EKSA 1ZG1A 1KAYA 3OYCA 1ATNA 5CE3A 1SC7A 4AHUA 4O0IA 4QSHA 4CFAA 1OQKA 1KU3A 3NHGA 4F4KA 3EKUA 2K9LA 1A5JA 4B3XA 1TUUA 3CBMA 3KP5A 4LUDA 5FW9A 4TV7A 2EYYA 1H3HA 3V1RA 1BOAA 2DXUA 2FRYA 2OZSA 2NOJB 4LK0F 3WTXC 1WXBA 2M4KA 5E1ZB 3SBTA 4M7AF 4Z89A 3IUCA 3C7JA 3TCJA 3MCZA 3CCVA 3VRZA 2P51A 3FZFA 4HF0A 3SI6A 1MV0B 3QU6A 2R5ZA 1XG7A 2P0PA 3PIPA 3HBTA 1FKOA 4N9IA 1ETOA 3CCUT 1FZPB 4FJLA 3X28B 3VUZA 3QINA 5GIPA 2ZJPF 1NG2A 1WYXA 4DBRA 4M6VA 1ZHFA 1I50J 5LBQA 3FXMA 2NRVA 3E9OA 3DLMA 4BQOA 2GA2A 2GX9A 2EINH 3SYTA 3RRHA 4CHOA 4A0XA 4FJIA 3WEEB 2XPUA 1BL0A 3RKWA 2HQAA 2GLOA 4YOUA 5FD6A 2EV6A 3EZ5A 4FPAA 2RF0A 3CC4A 2DK8A 2K7AA 1RT1A 2FEIA 1OISA 2VUBA 4HW0A 2PVOB 4CZIA 3H5RA 3CMMA 4KH6A 3FLGA 3PSFA 1AKHA 4FJKA 3SB2A 2DMNA 1BN5A 4I7FA 4KBMB 2YNGA 3NTIA 3BR6A 4KKOA 2W00A 3G6EQ 3CCEQ 1ODDA 1M90U 4JHDB 4MHGA 1S6PA 4XLEA 1SVMA 4LG3A 1IXDA 3JB9H 3K5MA 1UJ8A 1JUSA 2RF2A 3U9GA 1F1BB 4C0DB 1IJJA 1PCXA 2KK4A 2WC9A 3BGRA 3VEOA 3BT9A 2CH4A 1X3NA 3U9DA 1LOJA 1YS6A 2ZBKA 1ZBSA 4P55A 4M77F 2O8DB 3LAPA 2YHTA 5GAOm 2KLAA 3JRFA 3QESA 1MH3A 9ATCB 1ULYA 3S9HA 8AT1B 1JJ6C 4MFBA 2CP5A 1MJAA 1LMZA 2NZTA 3O3GA 2YUPA 4HUEA 2GOXB 1NTCA 1KVAA 1ITGA 4XR6A 3EQLF 2HSPA 2CP6A 4YOTA 3GFMA 3RTRA 4DBFA 4RW8A 2FF4A 1W6XA 5BPIA 5GANg 4OO1J 4K42A 4KHUA 1QVFS 2YSQA 3BQZA 3F9KA 3K4CA 1VRTA 4JK1X 4PIIA 2HKOA 3JYTA 1OVYA 5AQNA 4M3WA 3CXCA 2DDAA 1JL2A 3QYFA 1ZREA 4FYDA 2BZYA 2G6FX 4KDPA 1VQ6N 1YHQQ 2Z3YA 5A0LA 2L9SA 2WSEE 4ICLA 2M0OA 1NJZA 1ZSZB 5EC7A 2FNPA 1U1SA 1HJDA 2VQFK 1AVZC 4C5HA 3RMAA 3BY6A 5HLHA 4JKAA 3U6FA 3M8JA 3T8RA 4DQRA 4JKBA 4X65K 3S17J 3JAMZ 4IUUA 1IXCA 2E1NA 3KYCB 2A7YA 5DM7F 1T8