3OYHA

Crystal structure of the prototype foamy virus (pfv) intasome in complex with magnesium and the insti mk0536
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
368
structure length
368
Chain Sequence
LDAELDQLLQGHYIKGYPKQYTYFLEDGKVKVSRPEGVKIIPPQSDRQKIVLQAHNLAHTGREATLLKIANLYWWPNMRKDVVKQLGRCQQCLITNASNKASGPILRPDRPQKPFDKFFIDYIGPLPPSQGYLYVLVVVDGMTGFTWLYPTKAPSTSATVKSLNVLTSIAIPKVIHSDQGAAFTSSTFAEWAKERGIHLEFSTPYHPQSSGKVERKNSDIKRLLTKLLVGRPTKWYDLLPVVQLALNNTYSPVLKYTPHQLLFGIDSNTPFANQDTLDLTREEELSLLQEIRTSLYHPSTPPASSRSWSPVVGQLVQERVARPASLRPRWHKPSTVLKVLNPRTVVILDHLGNNRTVSIDNLKPTSHQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular mechanisms of retroviral integrase inhibition and the evolution of viral resistance.
pubmed doi rcsb
source organism Human spumaretrovirus
molecule tags Recombination,viral protein/dna
molecule keywords PFV integrase
total genus 106
structure length 368
sequence length 368
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2010-09-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
A PF17921 Integrase_H2C2 Integrase zinc binding domain
A PF18103 SH3_11 Retroviral integrase C-terminal SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2300 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3oyhA04
1.10.340.70 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Endonuclease III; domain 1 3oyhA01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3oyhA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3oyhA03
1D9FA 2IC3A 1RT3A 2D0BA 1WNSA 4GY5A 1HNVA 1I3AA 3P83D 3AO4A 4CGGA 1T8EA 1TKDA 3SCXA 1QSLA 2M1HA 3OS1A 4C8NA 3L2WA 1FKOA 4AHTA 3V1QA 2A1RA 1WAFA 4N47A 4DSLA 3V6DA 4RW6A 4IUTA 3ALYA 4RG8A 1BQMA 1HJRA 3MEUA 3VQ4A 4DTJA 2RJFA 1R0AA 1BIZA 5J2MA 4C8KA 4FJGA 1Z25A 3OYIA 2X4YA 3ME9A 1VRTA 3WNHA 1NK6A 2JTFA 4FJ7A 4PUOA 3M8RA 4B9XA 2L89A 3AA3A 4FXDA 4IUVA 3SI6A 2X4WA 1EX4A 3OA6A 3NHGA 1ZYQA 3RR7A 4RW8A 4C5GA 4Q0BA 2G8IA 2QK9A 1W9HA 5FROA 3V1RA 4CFAA 2HHSA 4A4GA 3JYTA 4K8XA 4DTPA 3AVLA 2K3YA 4GW6A 2R5MA 3H8ZA 1S6QA 3VQAA 2RN2A 4DFJA 3DLGA 1X9MA 4DSJA 4FJIA 4N41A 4II1A 4E7IA 4KKOA 1FKPA 4BWJA 3DI6A 4DLGA 3OYFA 2DFFA 4O4GA 1XHZA 3ZSQA 4OVAA 4DFMA 4CRIA 3MEAA 2Z1HA 3PMTA 4OLBA 1FK9A 3CYMA 4BDZA 3OMGA 5HRSA 2XY6A 4W5NA 1HYZA 3EY1A 3K5NA 1B9DA 4FU6A 4DFPA 2RHYA 1RT5A 5KRSA 3OYAA 4LD6A 2DAQA 1RBRA 5D6WA 2GUIA 3I0RA 4LY7A 4CIEA 5J2NA 4B9NA 2DTUA 5J2QA 3FEOA 2EFIA 3VN5A 2KQ2A 3ZT2A 5SWMA 3SYZA 4CEZA 5K14A 3KLFA 2P5GA 4KPYA 1OZ2A 4EZ9A 4MFBA 4L8RB 4FJXA 3C4SA 4DS5A 2VG5A 1WSJA 3FC3A 1JXEA 1I39A 4I2PA 3RMDA 4N56A 4EZ6A 3TR8A 4F2SA 3PX0A 4FL6A 4CK1A 2Z1GA 4DG1A 1RDAA 3JSMA 4C5EA 3HK2A 4FJ9A 1OI1A 1WJRA 1CXQA 1WN7A 4KREA 3UT1A 5HP1A 3KUFA 4B9TA 4CF1A 4DSEA 3S3NA 3EAEA 3C6UA 2D0CA 4CIGA 3TAPA 1ZBIA 2KTQA 2OPQA 3VA3A 4CHZA 4CF2A 1S5JA 4KI6A 1RDDA 2YHBA 4NS5A 2D0AA 3LP0A 1JLFA 1U4BA 4KB1A 1Q9XA 2K3XA 1C0UA 4FK4A 2RJCA 2HNZA 3AVHA 1ITGA 3HO1A 4QCLA 3HL8A 3MEVA 3M8QA 4LD0A 4CJSA 2JGUA 4H4OA 5FRNA 4W5RA 5J1EA 5C24A 3M8PA 1TK8A 4KTQA 4FZZA 3TAFA 3ZT4A 4CE9A 1WJQA 1KVCA 4IDKA 2G8VA 4DTXA 4Z4GA 3TAQA 1HNIA 2BIVA 3V4IA 2PZSA 2Z1JA 1GOAA 3NGYA 1LV5A 3LAKA 3HP9A 4CJKA 3AVMA 3OB9A 2BE2A 3S3MA 4FVMA 3OYEA 1UA0A 4M3TA 1JXBA 5J26A 1BIUA 3T1AA 3ZSVA 1Y97A 3LH0A 1XNIA 3L3VA 5HRNA 4CEEA 3HSTB 3V1OA 3DOKA 1MHNA 1QQCA 1VSKA 3KKSA 4CIFA 4FM2A 4CEAA 4L59A 2YHAA 1IKVA 1TV6A 3NF7A 4RW9A 3P8HA 3O3FA 4DTRA 3MXMA 4KAZA 4RG2A 4EP5A 4DS4A 3L8BA 3QEWA 3G0ZA 1WGSA 3DM2A 1RT6A 4NCGA 5KRTA 2LVMA 4W5QA 4IKFA 2HHQA 2DFEA 4CGHA 3OYLA 1YTAA 3V9ZA 4DSFA 1C1BA 1X9SA 4W5OA 3KD5E 1KVAA 3ISNC 2IOCA 1C0TA 4J2BA 2IAJA 4CJQA 3AO2A 1U47A 2R57A 1CXUA 2RI3A 3PV8A 4IUPA 3SQ1A 2Q3SA 4M3WA 4M42A 2KZMA 1S9GA 1XHXA 4HHTA 2BGGA 4F4KA 3ZSWA 4TSXA 3FLGA 4M3RA 4E89A 4E3SA 5HLFA 4IBNA 2XO7A 1FXXA 2Y1IA 3WNGA 3QNOA 3S9HA 1NK8A 3HJFA 4JRQA 1S1UA 2O4IA 3OYMA 4MQ3A 3Q1JA 3NH2A 4DWIA 2E6LA 3OYBA 3L42A 4RW4A 4OKKA 3QINA 5KE3A 5CYMA 3RMBA 3A2FA 3VA0A 4PWDA 4KHNA 1ASWA 3DLHA 3CEYA 1YT3A 2YNGA 5CZ2A 3VQBA 4CESA 3DLMA 1JKHA 4CK3A 3MEDA 5C0MA 2VG7A 3TAEA 1VSIA 3DLEA 4N4GA 1DLOA 4NYFA 2BUDA 3P8DA 3VQCA 4YNQA 2M16A 3NTHA 3QLHA 1VSDA 4CHPA 1Z26A 3G10A 4FW1A 2E5QA 4Q5VA 2RPIA 3OYGA 2DIQA 4Z02A 4QQGA 1IH7A 1REVA 4OKEA 4FLVA 1QE1A 4CJPA 3L2VA 4IG0A 1MU2A 1RNHA 3SQ2A 1TVRA 3QIIA 4CJUA 4J2AA 3VQDA 1D5AA 2DIGA 4HUEA 4FLZA 4AHSA 3SUOA 1NK7A 2HB5A 5HRRA 4C8LA 3L2RA 3F70A 1TL3A 4NCAA 3F9KA 1XI1A 2R58A 2E6NA 3T19A 3OVNA 4FM0A 2XRIA 2HW3A 1VSHA 3D45A 1WJSA 3EYZA 2QKKA 4F3TA 1VSFA 4M3XA 1TKXA 3HVTA 2HVIA 3RR8A 3QERA 1D8YA 1NKBA 4J2EA 1JLGA 1HYVA 1K6YA 2ETJA 3L2QA 1BHLA 1QSYA 3SQ0A 5IAYA 1IO2A 2D5RA 4Y1CA 3VQ5A 1KFDA 2XHBA 2ITGA 4FCYA 4M3ZA 3O4NA 2IG0A 1G15A 2QXFA 4KO0A 2CKKA 3K58A 3SZ2A 5HRPA 4FLYA 3SQ4A 4KHYA 3HXMA 2M0OA 1JL1A 3WNEA 3K5MA 2X6NA 3DLRA 3MP6A 5CYQA 3HPOA 5FRMA 4CJ4A 4JRPA 4HUGA 4DLEA 2LTOA 1SL1A 4C8OA 1NKCA 3PX4A 4KHQA 3OS2A 3K57A 3PUFA 3AVKA 4O5BA 1C6VA 3KTQA 4DU3A 2IDOA 1SSFA 3NBPA 1BGXT 2EKOA 3MP8A 3QESA 2HNDA 2VWKA 2XY5A 2X78A 4OJRA 3O3GA 3TABA 1T03A 5KGXA 3AVFA 1JLAA 3QIOA 5C6SA 1RBTA 3BDLA 2WACA 3ZSYA 4DU4A 4KI4A 2VWJA 2KFNA 1GOBA 4M3YA 3DB4A 3SD4A 3META 4NZGA 1NK0A 1KLMA 4IUQA 4PLIA 2X4XA 2ATQA 3AO1A 1BI4B 3HP6A 5I3UA 3LGLA 4E7HA 2LCCA 3TAMA 1C1CA 3FFIA 4CEOA 2VYTA 3SUPA 4CJVA 3LAMA 1DTTA 1LAWA 3LP2A 1LW2A 3MEGA 1U48A 5SZTA 2JLEA 3QIPA 1BI4A 2G8HA 1JLQA 1NK5A 3U6FA 3ASMA 3IRXA 5EU7A 1L5UA 3CM5A 3C6TA 1YVUA 4ID5A 2HHVA 1LWEA 2L8DA 3I0SA 3LZJA 4QAGA 2GBZA 3VQ7A 4B3OA 2AJQA 3E01A 2XY8A 5CZ1A 3RTVA 1NKEA 4CJTA 1L3TA 4LH5A 5JS1A 4CJEA 3PFSA 2NLUA 1DTQA 3LPUA 4DQSA 5KGWA 3NGZA 3PO4A 2R5AA 2EX3A 3OYJA 4Z0UA 4W5TA 3V9SA 2PYJA 4E19A 2KW4A 3AVGA 3MP1A 3KK1A 4CFDA 1NOZA 3CFOA 1EP4A 4Z4IA 3ZT0A 3L3UA 4AH9A 1LWCA 1KHCA 1BISA 2OPSA 3V9XA 3QNNA 3DLBA 4CHNA 2EQKA 1RBUA 2FBYA 3E9GA 3LP3A 4OKJA 1RBVA 1O1WA 3MEEA 1A5WA 1C1AA 4PA1A 3OQ5A 3AO3A 2BANA 4N5SA 3BDPA 2OYQA 4QQDA 3LALA 2OZSA 4Z4FA 3CM6A 4OLAA 4FLWA 3ZSRA 4B9LA 2HMIA 4ZTFA 5E41A 4DTUA 3AVAA 2D9TA 4BE0A 1HQEA 4HUFA 1SL0A 1KLNA 3DRSA 3P5JA 3LZIA 4A4HA 5HBMA 2GFAA 1NJWA 3THVA 2RI2A 3KD1E 1QTMA 4CERA 3SUQA 2G8KA 3DB3A 2FC0A 4AILC 1HYSA 2DFHA 1CZ9A 4CJFA 4CHYA 1UAXA 4E1MA 1EKEA 4KV8A 3B6PA 1U49A 4C5IA 4B9WA 1IKYA 1RTHA 2A1SA 1HPZA 2IGIA 3LANA 4Y1DA 3PNWC 2YRVA 2LDMA 4OGCA 3U3GA 3RRHA 2WONA 2EQJA 1H3ZA 1WSHA 3RMAA 2RHUA 2RJDA 3QJ6A 4B8AB 1VSLA 4BE2A 4H8KA 4FJKA 1UOCA 3VQPA 4CECA 1QHTA 1RTIA 4KTZA 3MAQA 4ELTA 3F73A 2MWPA 2QKBA 3TAGA 4BDYA 1BL3A 4PL6A 3O4QA 3O3HA 3K5LA 1RT2A 3SNNA 3AVBA 1XC9A 3AVNA 4ZTJA 1OZ3A 4Z4HA 4FZXC 5KE2A 1IKWA 3D0PA 5I42A 3OYCA 4CHOA 4C8MA 4FJMA 3IS9A 4R5PA 3LPTA 2X35A 1N6QA 2RHZA 3V81A 3OJUA 3QEPA 3NTKA 3OMCA 1QSSA 4ICLA 3LYIA 1NJYA 1TK0A 4UC4A 3VQ9A 1C0MA 2YNIA 3RWUA 3L2UA 3C94A 3K2PA 4NYNA 3KLIA 3T3FA 4FLXA 1KCFA 1ZBLA 3CFRA 4WE1A 4B9MA 4CGIA 4X34A 4Z4EA 4H4MA 3ZSZA 3KK2A 3AO5A 3HT3A 2Y1JA 3HPHA 3KK3A 3OY9A 4FJ8A 1RCHA 1ASVA 4BD3A 3QEXA 5J2PA 4DTOA 2BDPA 2ZQBA 4AHUA 3AV9A 4DU1A 2RO0A 2XDPA 4IURA 1VK0A 5D6XA 4DF8A 3QO9A 1LW0A 4JS4A 3BGRA 5C25A 4Q5WA 4FM1A 3LDSA 4AHRA 3ZT1A 3NCIA 5FDLA 1T05A 2BKDN 1D9DA 3LGFA 2QQRA 3HM9A 1NJXA 3SPZA 1RDCA 3NTIA 1N5YA 3VQ6A 3LWLA 2HVHA 1JL2A 3V9WA 4UQGA 1RT7A 4C5HA 4N4IA 4IFVA 1UA1A 2G8WA 1IG9A 2EQMA 4M45A 4DSIA 1S1VA 2GF7A 4CEQA 4HCCA 2FBTA 4I2QA 1U04A 2B5JA 3ITHA 4CJLA 4F8RA 3AVJA 2F8TA 1WSFA 4FJHA 2YNHA 4A4FA 4BE1A 5J39A 1WSEA 1BQNA 2B4JA 2F5KA 3QBYA 3OJSA 1ZBUA 3NDKA 4KHWA 2E4LA 3P1GA 1RILA 4CJWA 3EZ5A 1RT4A 1RI0A 4LSLA 3ASKA 1B9FA 5KH6A 3SUNA 4I9QA 4KHUA 4AHVA 4FJLA 2XK0A 1EXQA 1OYXA 1WAJA 4KFBA 4B08A 1VSEA 4CFBA 1J9AA 5T7BA 3U3YA 3QKJA 3MXJA 3NE6A 2LRQA 1NK4A 2B8AA 4ELUA 3TARA 4KB0A 2R7YA 2E6MA 3AA4A 1SKRA 4BWMA 5D3GA 2OPPA 5D6YA 2FHDA 2JZ2A 3AA2A 2PQWA 4DQQA 4FJNA 3C95A 4CF8A 4KRFA 1J53A 3DYAA 2O4XB 4ID1A 5C42A 1NK9A 3AVIA 4HVJA 4QOZB 4JLHA 2EQUA 4KTWA 1GOCA 4N4HA 4CF9A 4DMNA 2YNFA 3NH0A 1W0HA 4N76A 2O4XA 1XWLA 4CJ5A 3NH1A 3PX6A 4FZYA 1HQUA 1KTQA 4I9LA 1S6PA 2F96A 4FK2A 4QQ6A 3LP1A 1VSMA 3ZT3A 4B9SA 1SUQA 3ZSOA 2YKNA 1VRUA 3WNFA 3GOXA 4O44A 4OPJA 3SV3A 4CGFA 4AHCA 1YTUA 2I5JA 1J54A 1ZBFA 2VG6A 4CEBA 4PQUA 1JLEA 4FLTA 4HCBA 4E7KA 3H6ZA 4O0JA 3VQ8A 4B8CA 4CK2A 3K5OA 4CFCA 1TAUA 4B9VA 1B92A 2P0KA 4CJRA 4KHSA 4CGJA 3NF8A 1S1WA 2RF2A 3TWHA 3NAEA 1ZBHA 4E7LA 1LAVA 4CEFA 4DSKA 1CZBA 4DQIA 2HHXA 1RTJA 1JLBA 4OGEA 1ASUA 2YV0X 4XIUA 2O4GA 2X6SA 3UIQA 2GV9A 4FJJA 2RHXA 1RT1A 2RKIA 3DMJA 3CFPA 4DQPA 5M9OA 4CF0A 2FBXA 3HVRA 1T7PA 3KIOA 1TGOA 3FDRA 3DRPA 4QW2A 2XY7A 4QVZA 1IKXA 3AVCA 3MXIA 3VQEA 5KI6A 1X9WA 4G1QA 4J2DA 1VSJA 4NCBA 1SV5A 1KSPA 4JS5A 2GFUA 5IN1A 3E9FA 3OYHA 2MWOA 1TKZA 2NUBA 3HPGA 3TANA 4O55A 5JS2A 4B9UA 2Z1IA 2KFZA 3VQQA 5KCHA 1S9EA 1WLJA 3CG7A 2X74A 4ELVA 3O8VA 3DRRA 3ZCMA 2ZD1A 4DFKA 4IFYA 2PYLA 3HYFA 4RW7A 3SPYA 3SJJA 1HRHA 4EP4A 3NNQA 4ZHRA 5DMRA 1KRPA 4F3OA 2PY5A 2EHGA 4YFUA 3QEVA 1EETA 2ZE2A 3NF6A 4HTUA 1NJZA 1TAQA 2W42A 1L3UA 3B6OA 3NFAA 3KJVA 4GVMA 1S1TA 2OPRA 3DLKA 3RMCA 4FYDA 1KFSA 4E7JA 3NF9A 2G8UA 4DTMA 3LX7A 3OS0A 1UWBA 1SL2A 2FBVA 2IS3A 2RJEA 3SV4A 1TK5A 2RI5A 3S6WA 1QS4A 4IG3A 4LH4A 1KVBA 5KTQA 2P1JA 3I8DA 2HHTA 2HHWA 4BDPA 2G3RA 3M9QA 3PMIA 4DTNA 3QETA 4FJ5A 2LSNA 1WSIA 4DTSA 2F8SA 4CGDA 3NGIA 3DOLA 3M8SA 3OYDA 1G5VA 3KKRA 3PY8A 1JLCA 1A5XA 4CEDA 3KLEA 3MO8A 3IG1A 1A5VA 2P51A 3CQ8A 1TL1A 4FLUA 3IAYA 3AA5X 1U45A 4PLLA 3TI0A 1RTDA 3PO5A 4K8ZA 4M3UA 1CLQA 4FK0A 4EDUA 1N27A 3MEWA 3MECA 4PY5A 5DK5A 1TKTA 1L3VA 2KZZA 1WSGA 4F2RA 4LSNA 4E1NA 4OVLA 4A4EA 4OPKA 5HROA 2QQSA 3QEIA 2HHUA 3V9UA 1SKSA 3LLRA 3UWNA 1X1PA 4HCZA 4BACA 4O0IA 3RRGA 2HQXA 3ULDA 2YKMA 5KCOA 1J5OA 1BCOA 3ZSXA 3OYNA 2RHIA 1RDBA 4DF4A 4Z4CA 2OA8A 1SKWA 4IUUA 5CIUA 3K59A 4M41A 4CJ3A 4CCHA 4GMJB 3LWMA 2B6AA 2OZMA 3ZEHA 4E0DA 3OYKA 2L3RA 1Q8IA 4I7FA 1HMVA 1Q9YA 2HQEA 4DQRA 2DY4A 2WOMA 3KLGA 1RBSA 1L3SA 1LWFA 1S1XA 3H08A 5CY4A 1F21A 1BCMA 4FW2A 3KLHA 1NOYA 3S3OA 2G8FA 2P5OA 2HNYA 4CHQA
chains in the Genus database with same CATH superfamily
3CO6C 4BRKA 4HRIA 1I1SA 1GL5A 1VQLT 4RW6A 2AK5A 2ADUA 5LJ5g 4RMOA 1BIZA 3H0GJ 4ETSA 4A3FJ 2G8IA 4JHDA 5EZHA 2R7SA 1ZQ1A 2NYXA 4GW6A 3BF1A 4BRIA 2YG8A 3BC8A 1B9DA 4KH6A 4PJOE 3H3UA 3K7AJ 3FM5A 2K6DA 4OMMA 2XPVA 1G3TA 4L8RB 3KWGA 1Y1VJ 1ZBSA 4NL2A 4AF1A 1NGFA 3MMYB 4EZ6A 2MGQA 3LSJA 2JQ7A 5JVGF 1F1BB 2IA0A 3LSKA 1JKOC 5HP1A 2CFXA 5GAHJ 4IRIA 3M3ZA 5IYBJ 2OPQA 2E1YA 1ZH5A 3CBMA 4M77C 2O01E 4MQVA 1G59A 1XG1A 3CD6N 5J1EA 2OTJN 2MD0A 1YI2T 3I4MJ 4KTQA 4P9UA 1IRGA 2VXFA 1NYFA 1GOAA 2DA4A 2ZSHB 3RQIA 2KFDA 1R49A 1IGQA 1K73C 4RGXA 2LBFA 1O13A 2EPDA 3I54A 5M1QA 4BNCA 3DM2A 3V9ZA 4DSFA 2ZJPF 5MLCQ 2DJZA 4W5OA 1H88C 4JOMA 2I0NA 4KH4A 4BI8B 5BNGA 4M3WA 1WA7A 4RCCA 1FXXA 1NK8A 2O4IA 2LC4A 1IF1A 3G4SA 3QFPA 3E9PA 1NGJA 5AQUA 4OB1B 2CSQA 3ENOA 4JHDB 1G3SA 2VG7A 1VQMA 3KP4A 2MG4A 1FYLA 3HM5A 2DIQA 2UYTA 4OKEA 1YI2Q 1RNHA 4DK9A 1GVJA 4CZEA 5LHGA 3PVLA 2HB5A 2HMPA 3L2RA 3CMAQ 1XGOA 3H1VX 1K73R 2D4WA 4LLGF 4ISFA 1WJSA 1RZ4A 1HYVA 2D5RA 1GLCG 4OB0B 3BG9A 3BW1A 5LJ5f 3HXMA 1MBGA 1ATSA 4PFZA 1GLLO 2X6NA 4HUGA 4AFSC 4XOTA 2K3FA 2HWVA 2AKKA 3I56Q 4GV3A 5J3BA 2NOHA 3CCLA 2X78A 3A5NC 2IW5A 3OL4A 1AU7A 3FXJA 3EUAA 4DU4A 4PKGA 1JHHA 2XF5A 5FKNA 3K2ZA 1XNRK 1BI4B 4E7HA 1LAWA 5SZTA 1R0CB 2JLEA 3QIPA 1T3LA 3U1DA 5HLGA 1NG6A 1WZOA 3LZJA 3M59A 3J7ZO 1HDDC 3L0QA 3VWBA 2F9WA 2D8HA 3LPUA 4DQSA 2QGUA 3CWSA 2P9SB 2OCEA 4DR5K 5EGOB 1WH5A 3C65A 2HQ5A 2LKXA 2K57A 2CV0A 3BY7A 3D6RA 2LY1A 1VUBA 1Q81U 4OLAA 5CHZA 4F91B 1NJWA 3THVA 5C2FA 3SUQA 2G8KA 2BZTA 5GMKh 3CC4I 4V2GA 3JRCA 3S17J 2AXTC 4KDPA 3O80A 4U87A 4OGCA 2KNBB 2EVRA 2DO7A 4Y33A 3VQPA 4HEA2 2AZVA 1R8OB 1OZ3A 1NGEA 3VGKA 2E1OA 3D5RC 1N33K 1WKMA 1JEGA 3HHTB 2QENA 3V81A 1MMAA 4LXCA 4KH5A 2ZXIA 3A8LB 1K6OA 4BRLA 2XAGA 3ZSZA 4C0DB 1BO5O 4C23A 4F7UA 4LGWA 2RB6A 2IS4A 4J9CA 5CVUA 2KXDA 4AHUA 2HOSA 2RO0A 4HLYA 4JS4A 3ZT1A 3QRFF 3WXJA 2HOAA 3CCVQ 2IGNA 2J6OA 2DYRH 5A0LA 4X1VA 3K10A 4M7AC 1TXQA 2DVJA 3CXCP 2GF7A 4CEQA 2FBTA 2P81A 3LA7A 1W2BA 3PTAA 3T69A 2OBPA 2F5KA 1WFWA 3OJSA 3F6OA 2NXNB 1WHLA 4A4KA 1Q7YO 3CDLA 3FXMA 2JPSA 3U3YA 1VSEA 4X0GA 2P9LA 3SDZA 1LDKB 3OSSC 1EA3A 2FEIA 3M1EA 2JT4A 3I9QA 2OPPA 2PQWA 1MWMA 4FJNA 5A2QE 3E6DA 4N76A 3PX6A 4I9LA 4A2BA 3ZT3A 4HNUA 3WNFA 1YTUA 1UDLA 4PQUA 2DNUA 4KHSA 4DCHA 3NAEA 3WE3A 4KGXB 1J59A 4DQIA 3JAME 4KMFA 3H1CA 4YIIA 5GANg 3DRPA 1TLHB 4A5AA 3W2VA 1W0TA 1BOAA 2HL5C 3HPGA 2D8JA 1BB9A 1WLJA 1UELB 1G3YA 3G7ZA 3CC2I 1PHTA 3K4KA 5C2DA 2ISZA 3DKWA 4HSBA 5I9EB 1VQOT 2V9PA 4J19A 3KX2A 3K1PA 3UATA 2SEMA 4MDAA 1H89C 3M8SA 2YUSA 4B3RK 3IH2A 2GAUA 2KT1A 4M3UA 3J7ZI 2QEXI 3H1QA 4PJOG 2P9LB 2K4BA 3FHZA 1QCFA 1YNZA 3OSGA 1STZA 3SAHA 2NVXJ 1RDBA 4ENJA 5FLMJ 1KAYA 5FD5A 1YW7A 2K27A 4CJ3A 3H41A 1VQ9I 3LSGA 1KA8A 1BOBA 1QW1A 3LW5E 3A0HC 3QMLA 4FLWA 3QYFA 3CD6Q 1W7PD 3LA3A 4DSLA 1WDXA 4J6YA 1GV2A 2FXAA 1XSXA 2P9KB 3M0QA 1M3HA 4XLAA 1NJIO 1Z7UA 2ZJ2A 1R7JA 1GLBG 4KKOA 1XHZA 5FD6A 4XQFA 3DLLF 3S1MJ 4D8DA 3R0JA 1YHQN 4MEXF 3O3KA 2E6ZA 4EA5A 4IRGA 1W2BP 1RBRA 1LUJB 4GLMA 2DA3A 5K14A 4KPYA 4EZ9A 2VG5A 3HPWA 2IS6A 2PMHA 2KHOA 3G1MA 4CK1A 1WJRA 1PKTA 3UT1A 2EV0A 1FOWA 3CF5L 1DIZA 5KAFC 1U3OA 2HU9A 3S32A 3J80O 2P9IA 4KB1A 1XQSC 4FK4A 3AVHA 2EYZA 2E88A 3TU4K 4GO1A 2Q97A 1N75A 3VRYA 4BY6C 3CMAN 3Q9SA 3BWGA 3FMQA 3CJNA 4M77B 5E3LA 5GMKi 1PSEA 3E19A 2DTOA 3LH0A 5F27A 5HK3A 1FJLA 2DD5A 2O7OA 4XRSA 2FO0A 4KIGA 2ESHA 3LA2A 2HD0A 2HHQA 1IBKK 3SFIA 1FP2A 3KD5E 1BOTO 3J81Z 3L1PA 1HC8A 2V6EA 4EMHA 2E2JJ 4FWLA 3PV8A 5CLSA 4M42A 2Q3SA 2R7VA 1YJ9T 4ON0A 1ZA2B 4E89A 5HLFA 1OQYA 3JAMZ 3OYMA 1IDZA 1QCNA 1YQKA 1MWKA 5CYMA 5LRSA 1GLEG 4VUBA 1D0XA 4CK3A 3DLMA 3NTHA 5HKCA 3M8EA 2E5QA 2WY8Q 2KEAA 4CJPA 3ENHA 1MV3A 1Q7YC 1Z05A 1FY7A 1SAXA 3HTUA 4RAFA 2HBWA 4C8LA 4DUYK 2V1NA 1TL3A 3N05A 2LD5A 1SG5A 3TREA 4A3KJ 1VSFA 4IL6C 3VQ5A 2ZXJA 3K58A 1JL1A 4FOIA 1X9JA 3DPTA 2KVQG 3BDDA 2E12A 2K79A 1JUSA 2VBYA 5KYYB 1BGXT 1EH8A 2XC7A 4BQZA 2EYXA 1YITA 3ZMUA 4AI5A 4M77A 1NK0A 4UUVA 2LCCA 4ZZLA 5LGUA 4NLCA 2PMZA 3S1QJ 2YI1A 1IGUA 1H641 1OKJA 3VQ7A 3T1BA 4R8HA 2G7HA 1F36A 1TQPA 2KW4A 3CFOA 4NC8A 2OPSA 1FT9A 3CBOA 3QPTA 2RNAA 4CCKA 2OZSA 3N0UA 3M0SA 5FKLA 2EZHA 1DU0A 1J75A 4BR5A 2IA1A 2VXZA 2GLOA 3ZQQA 1WWXA 5F64A 1TUDA 5C12A 1MKMA 3F9MA 2RJDA 2L9SA 3LDLA 1H9TA 3I56T 3A98A 1KJWA 2JTVA 1LDJA 4Z6YA 4XTZA 3LYIA 3VS3A 3TSWA 1KGSA 3NMZC 1YIJA 3PFYA 3VSLA 1HD3A 1P92A 5TRDA 2CP0A 3CCLQ 3SLCA 2CH4W 1LOTB 3MN6A 1RCHA 3EFRA 4DU1A 3CXCM 2XDPA 2K86A 4JZ4A 2ABKA 4B6MA 4Q5WA 3F0CA 5KYYA 4DEYA 4M78G 1QZ6A 1NJXA 1RDCA 3BPXA 1IAWA 1RT7A 1LNWA 5IT9Z 2DYBA 3NWSA 3CC7I 4DQ2A 4LD9K 4PL8A 2DJIA 5CQXA 4EJVA 4OMFB 3ZMZA 1RT4A 1W36D 3SUNA 4I9QA 2F2EA 2EWNA 4B08A 4KFBA 2OD5A 1X2KA 3MXJA 1SFEA 1T0FA 4LNPA 1N3AA 4MZPA 2HVRA 1KC8U 2H09A 2XUBA 3VPRA 1YS7A 4PJ0C 2FL7A 4LUEA 4X9CA 1FBUA 4BRNA 5AQQA 2DFIA 1AEYA 4PKHA 5DM7L 4JLHA 3U8XA 1SMTA 3WQUA 1JBMA 2R4GA 2DPUA 4KYWA 2FD5A 3OR2C 5GAHP 2F96A 3OW2S 1XB4A 1C0GA 3RYPA 3CXCA 1VSMA 1NWKA 4O44A 3MZ8A 2OTJQ 5F0XA 3QDFA 4B8XA 4JKEA 3VQ8A 1B92A 4JKCA 1HSTA 1S1WA 4OB3B 4IZZA 3DF8A 4UHTA 3WG7H 2FBXA 4DR7K 4NUBA 1VSJA 4BHPA 1RNLA 1WI9A 2JT1A 3HYFA 3HRUA 3SPYA 3NNQA 3JSOA 5DMRA 3JB9H 2RGVA 2BW3B 1RADB 4O5FA 2W42A 1NH3A 4M78A 2EKHA 1OMIA 3OS0A 1GCQA 2YHXA 3CJRB 5L3CA 3CHWA 2O0YA 4CEDA 3VSKA 3OW2M 1I5LA 5GAN2 4OIRF 3PO3J 5HROA 2VJ4A 4D5FA 3QEIA 3V9UA 2KP6A 1S29A 5KCMA 2X1EA 1WJEA 2B6AA 1JKRC 3OYKA 2HQEA 4CC3A 3CCSA 3HTSB 1MJ9A 3ZX0A 2DPPB 4DBQA 4JI0K 5EZGA 1WI7A 3O08A 4JYKA 4BRPA 3RCOA 2GA1A 4EVVA 4FJ7A 3F22A 2JTFA 4LIVA 2L89A 2CQKA 2JWLA 1APLC 2WA0A 1KG7A 1FSEA 3FHNA 3GE1A 2V1DA 1KQSP 2KBTA 4DTMA 4BWJA 4CVNE 3SWNA 4BDPA 5HLHA 1YQRA 5CYVA 4OVAA 1M3QA 3OMGA 2YJFA 1X6GA 1HYZA 2HGCA 3CCEN 3NRVA 3EZWA 1AA7A 1BC8C 4M77G 1A6QA 2IGOA 2VC1A 2O8FA 4FJXA 2CZ7B 3C4SA 2BW3A 3VYSB 4M78B 1IUYA 3OMYA 1Y8QB 4MMKA 2W4SA 3HYIA 3S3NA 4L9JA 3G3ZA 3QUIA 2EK5A 2HI3A 3FMSA 4XLEA 6AT1B 1VQKA 1ITGA 4D7NA 2ASMA 4CDGA 4RB2C 5C24A 2FRYA 3HKZA 1Y0MA 1J7KA 1KU3A 2W57A 4PIIA 3HP9A 3OB9A 4BRCA 1FLIA 4XTWA 4EHUA 1EJ9A 4CEAA 3CPWS 5AZJB 3MK6A 2V9VA 5KRTA 2LCLA 4P9FA 2RQRA 3M4GA 4H5TA 5LRRA 5K7HA 3PIOF 5TKWA 2R57A 2NNYA 1VIEA 5L3FA 2GZWA 4GKKK 4GLKA 1XMQK 2FU4A 4XSXF 2VPLA 3Q1JA 4K0KK 3QINA 3BTLA 2LJ3A 3TOBA 3VQBA 4XRMA 5C0MA 1VQ9A 2EAYA 4N4GA 4FW1A 4QTRA 4JKGA 2XGCA 2GWRA 1HNWK 3SQ2A 5ICCA 1QGPA 4HSTA 2KGTA 1O7LA 5AQVA 3JCMe 4F3TA 3HRMA 1VFCA 2JUCA 1MNDA 2F4MB 2YWWA 3LDNA 1ARKA 1MMNA 1TT0A 1U3EM 2KRNA 2Q2EB 3FF5A 2PMUA 1BI0A 1L3LA 2L4MA 2FZKB 3VV0A 3NBPA 1T33A 3CC2A 4M7AD 5EEAA 3JB9F 4NZGA 3UNGC 3MN7A 3VESA 3C3WA 3FX3A 4CBXA 2VGNA 1S7EA 2NOBA 3HUGB 1KG4A 3JRAA 5GINA 3U6FA 1GCQC 2Y75A 3I0SA 2GA2A 4IO9L 1NKEA 4BBSJ 2QA4N 5AQSA 2CUZA 3A03A 3ML6A 2X1DA 3V9SA 3BG7A 1FBQA 2NRWA 2IT0A 3E9LA 1H3HA 4RTVA 1PRLC 4XBFA 4ABZA 3I64A 3KYCB 1R9TJ 3F5TA 1FP1D 2NRAC 1PC0A 1U5TC 3VF6A 4KA4A 2E5NA 2IGIA 3ZL7C 3CCSQ 4CECA 4CJ7A 3H0HA 3F73A 2O8EA 3TAGA 4MTDA 1F43A 1NG2A 4I98B 1WQWA 2VUBA 2CSIA 2CUBA 4D8KA 4KNYA 2LYCA 1QA6A 2A6TA 2P6TA 4B9MA 1PD1A 3HT3A 4E9FA 1F1ZA 1TWAJ 1UGVA 1Y57A 3FZHA 4BD3A 1XDSA 3CXCS 4IURA 1QKXA 4AMCA 5GAOm 4CZIA 3CC7T 2X6XA 1W70A 3CMMA 4EJUA 1NLVA 4C8QD 3J80E 2GXBA 1WJ5A 5GAMh 4JKHA 2NS0A 3AVJA 4FJHA 4M7AB 5GIPA 2XICA 2QG9B 4AD9A 3M9AA 1MJAA 4LFUA 2E6MA 1IV8A 1BR1A 2E5KA 2FHDA 3RKWA 2JZ2A 2VONA 1D09B 1TS9A 1JJ2A 3DYAA 2O4XB 1GBQA 2L0KA 3CC4N 2EQUA 5IP7J 1GOCA 2M02A 1HLVA 4JRIA 4WK8F 3NH1A 2F5FA 1JO8A 1S7OA 3PNVA 4M75F 2LFBA 2QQAA 4YRVA 5AQZA 1J54A 2QDLA 1N32K 4OWRB 4QS9A 1NLPC 4B9VA 1TAUA 1VQPQ 2P0KA 5AQFA 3EDPA 3EE8A 2FBKA 1RACB 2TDXA 2LNHB 1TC3C 1QVGS 5FO5A 1RT1A 4IOXA 1QPIA 2RNJA 1A5JA 1TGOA 3BJOA 4QW2A 4NCBA 1YITT 4UVCA 3CJ7A 5D7UA 4Y92A 2M0CA 1NGCA 2PYLA 3DXJF 2UZKA 4IHTA 4DOWA 1WBBA 1VQMN 1EETA 3NFAA 2QCOA 2F6CA 1DU6A 2DOFA 2CT4A 3LAJA 1X1BA 3WU1B 1QWFA 3VYUB 4G6DA 3CF5F 4K11A 3T9NA 2XF6A 1NLOC 3PMIA 1WSIA 3N5BB 1I1JA 4BHBA 5E1XA 3OYDA 1YWPA 3MO8A 3CO7C 4M7DG 2Q36A 2EYQA 2OF7A 3I0WA 2VCPA 3J81K 1DP3A 1TKTA 2RA2A 1J6ZA 4OVLA 1VQ6T 3LLRA 5IP9J 1NGIA 3O4WA 2XAFA 1FZPB 4X6AJ 1OH7A 2NRVA 1LE8A 4CCHA 3K70C 1VQMI 2HOTA 3SEQA 1I94K 5GAMf 3MWTA 3X28B 1L3SA 2O8DB 1PP7U 4IOCF 1ZARA 1U2WA 4FYXB 2XIGA 1HNVA 4A62A 1REPC 4XLHA 1JJ8C 8AT1B 1KD1U 1TWFJ 3AT1B 1KO9A 3ALYA 3VQ4A 4C8KA 1PU7A 4DTJA 4OU0A 2X4YA 4NXNK 3M8RA 3NHGA 3X25B 3LFKA 3LAPA 2XHIA 2DF6A 2Y2ZA 3EPZA 3Q9VA 1HPMA 2CO5A 2DD4A 3CMYA 4UUSB 3PE0A 1T6DA 3FEOA 4DBRA 4B1XB 4MFBA 3IQLA 5FPEA 1JT0A 4ORZA 3F3XA 4XU0A 1K9MC 3I56A 4JI6K 5I22A 5GJVB 2L9RA 2HSTA 2DDAA 3HG9A 2O8XA 3HOTA 9ANTA 3THWA 1D1CA 4A3BJ 1T6CA 2KZVA 2YHBA 4NS5A 2PJRA 4XM3A 2OFKA 4EJWA 4MLHA 2HNZA 1OKRA 4EIKA 1IJWC 4W5RA 3SDGA 3M8PA 1WJQA 4IDKA 2BIVA 3LAKA 1VQ8A 1YJWN 1D5YA 2NUPB 4MTEA 1K8AO 2XDBA 3CD6A 4KMUX 2HHHK 4ZDLA 1U06A 4M74A 3NF7A 2VQFK 2CDTA 4IFEA 2PFBA 3F8MA 2DFEA 2O8DA 3GO5A 1TZLA 4A2UA 2YU9J 2RI3A 4OMQA 3Q5FA 4F4KA 4TSXA 5LJ3d 1TWCJ 2BY3A 3KFVA 2ZSIB 2WAQN 3OH6A 5GTIC 1VYUA 2BY0A 2FLOA 2VVKA 2EINH 3THKA 1JJ2M 2M16A 2FOWA 2XU8A 2NRXA 2W25A 1D3YA 2RPIA 4AI4A 5F08A 1IHWA 2OUMA 4UUSA 4NC6A 1L0OC 4Y28E 3SUOA 3A01A 3JCMP 3H9NA 2HKXA 3F9KA 2W0ZA 2VGMA 2G9WA 2IVPA 2P9NB 2OAZA 3L2QA 3K4MA 2BTTA 3K1MA 2J6FA 5E1ZB 3JTGA 3THWB 2VT2A 2HF4A 2V7YA 4M6YA 5I2SA 4NQWA 4AT1B 1RFQA 4DU3A 1D1BA 2XY5A 2VWKA 1Z21A 2EBIA 3FRNA 1U1TA 2VQGA 1KQ8A 2VWJA 4AM3A 1RGIA 2LKSA 4RTUA 2ATQA 3LGLA 2VYTA 1NMDA 2MMPA 5AQTA 3BZKA 4RGUA 1YXQA 2QTDA 3GIBA 1BN5A 1YVUA 1TNSA 5ADXA 1I5ZA 3I58A 4WXHA 2VBZA 3PO2J 3BT9A 2Y4YA 2QWOA 4LK0F 1DTQA 2PVDB 2A40A 5C4XJ 2R5AA 1KU7A 3CDHA 3DV8A 2TCTA 4Z0UA 1S3XA 3GDQA 1FYNA 1Q81R 2ME6A 5E3OA 1DPRA 4FZYA 2Y90A 5DS9A 2WAFA 1QRYA 1QVPA 3ZCOA 2FZCB 4WFNL 2MLGA 3KFWX 2ZMEA 3WU2C 1KFZA 3B6PA 1RTHA 5CHIA 1PVEA 1UOCA 2XPWA 1KQ9A 2YU3A 1DDNA 4KTZA 2QKBA 2LCSA 2QEXA 5IT9E 1ITYA 1XC9A 4PL6A 4PDKA 5H6QA 2BYVE 4DYCA 1E4FT 2RHZA 3DXKA 1TWBA 3JB9I 2EZLA 2LQKA 5FWBA 2EJFA 2ELHA 1G2HA 4FOEA 1UG2A 4DV0K 2NVQJ 1T2KA 2WV0A 3FXRA 4U7BA 3K9KA 3G1OA 4NQWB 2ZFUA 3NCIA 4I7HA 4HV5A 3S2DJ 4OB2B 1N5YA 3EG9B 2K02A 1VA7A 2YG9A 3MCPA 4CH7A 4ZZDA 5IPAA 4A4FA 2B4JA 1EQYA 2KT0A 1X3NA 1B9FA 1AHJB 3WU0A 4FJLA 3EG0A 2XK0A 4DSEA 1S72A 2OPTA 3FJ5A 5A0GA 4M7AG 1PKSA 4EHTA 4KB0A 4U88A 3RKQA 4ZC3A 4BWMA 1Q82R 5H6RA 1UHFA 3JW4A 2JUGA 1VIFA 3V7SA 4LDXA 5E8GA 3NH0A 1HBXG 4EJYA 1LEBA 3JSCA 4CJ5A 4CCJA 1YFNA 1HQUA 2LZ6B 1HXDA 2ZMEB 1VQ7Q 4KITB 1BU1A 2A41A 4B9SA 1XTDA 4A3GJ 1ZLJA 1TWGJ 3X20B 1MJBA 3DWLA 3TTDA 4CEBA 1HKBA 3U9ZA 2EW3A 1MBKA 3HSRA 4IHWA 4B3TK 1BYMA 3NF8A 4EATA 3CCQT 1ZG1A 2FF4A 4XTUA 1V3FA 2ELKA 1YAGA 2NRTA 2GV9A 4DQPA 1NG7A 3JTHA 3VQEA 3J80K 1SV5A 2E7XA 1HNXK 4JS5A 1RETA 1TUCA 4J00A 4FSXA 3WG9A 4PJJA 3NEUA 5E1WA 3O8VA 1YFHA 1RLPC 4KGZB 2P4TA 4ZHRA 1WRJA 1YIJT 2ELJA 1M8VA 3DLKA 1ZHFA 1JB0E 1SL2A 3PIPL 3QETA 2F5TX 3PY8A 1JLCA 4BQAA 1TL1A 1CLQA 1SVMA 4KUDK 2KZZA 4BR7A 4G6QA 1P9QC 2HHUA 1SKSA 1RKTA 1K61A 2J06A 4Z4CA 3VERA 4I76A 4JI5K 5HDNA 1RI9A 3SDBA 3ZEHA 1HMVA 2W40A 1S1XA 5EG0B 1YJWT 4N56A 3PIOA 2HSPA 3P83D 2BHZA 4B44A 2P0PA 3JCMQ 2EWSA 2PZ1A 3OYIA 3GF5A 3E6BA 2G7UA 1CKAA 3RR7A 1WXBA 1PUEE 4LF4K 3ABKH 3M3YJ 2L3QA 5GAMj 1JI8A 5C44J 4I2OA 1FKPA 3DI6A 4DLGA 4O4GA 1KQ2A 4M75G 3PNYA 1Z9ZA 2QA4Q 4E4HA 1O3QA 1NMNA 3EO3A 2HS5A 2M9HA 2KQ2A 1W5TA 2KT8A 3FHGA 4OMZA 6PAXA 1W7AA 2Q0RA 4CZLA 2VWFA 2RM4A 1QP2A 3ID8A 3IP4B 4KREA 5KPTA 1CXQA 2H27A 1RAGB 2F1LA 5GMKe 2JA6J 3EAEA 1MGQA 2D0CA 1X1AA 4CHZA 1S5JA 4C8QA 3Q7BA 3TP0A 2BZXA 1XQOA 1KXPA 3EGXA 3SMPA 3O1WA 4DZPA 2KRCA 5FU7C 3TAFA 4Z4GA 4AQYK 3V4IA 2PZSA 2MC4A 2DZ9A 4HA8A 4V2FA 3S3MA 4BQLA 2WTEA 3ZSVA 2KYMA 4A3MJ 4NDLA 2L7KA 4HQMA 1J5YA 2BH1A 1OH6A 3FR0A 3QYBA 1YJNN 1RT6A 2QA4T 4CGHA 3OYLA 3CCJA 5EG0A 2F5DA 5FFZA 4DBFA 4B48A 4FWSA 4C92A 1KQ0A 3VUZA 2NVTJ 1VQ5Q 3S9HA 1DUXC 1A31A 4S0HB 4JI4K 4XTVA 3KETA 4CESA 4GDFA 2EIFA 1USTA 3C6AA 1IRZA 2ZPEB 1VSDA 4CHPA 2FRWA 2RV8A 3HRTA 3DBHB 1UGPB 4XTXA 3GWZA 3AG3H 3DEEA 2DIGA 4C30A 5B5EC 3JCMW 1UG1A 3J80Z 3GX4X 4FSVA 4A3CJ 4FM0A 3OVNA 1T6SA 1UG0A 3QERA 1RAAB 2DE0X 4P5NA 2I10A 1QSYA 2XHBA 3CPWM 2ITGA 4HOBA 3RESA 2KKZA 4KO0A 4NO7A 2K5CA 2RDPA 1OCPA 1N39A 4C8QB 5LFAA 5D5XB 2LF7A 3PX4A 1ZYRF 2L7ZA 3IUOA 4E6KG 5KGXA 1JLAA 1VQPN 3PSIA 4LLLA 2XB5A 3VKIA 1C1CA 3LAMA 1MPGA 1V76A 1D0ZA 3EKUA 4HW0A 1NK5A 2E1MB 2L5QA 1DP7P 4P55A 3O8GA 3KLOA 1UE9A 1J5EK 3JRBA 3EGUA 3RTVA 1TSFA 2DA9A 4CJTA 5KGWA 1PRMC 1YITQ 3M4YA 3BTJA 3GL1A 1OPCA 4C92B 3MP1A 4ME7A 4XU2A 1Z0XA 1FYMA 2K5IA 4QLCU 2RH2A 2MD5A 2PQ8A 2DBKA 2M4GA 1IZ6A 5LJ3f 2OZUA 3H3ZA 2RREA 3OGDA 3D2EA 2X3XD 1NEBA 1TWHJ 1XQHA 2Y30A 1S9HA 4BHCA 1M8MA 1IKYA 1H92A 1HPZA 1WZ2A 4EQQA 2YRVA 2WONA 2EQJA 1WJCA 5LD2C 3DBLB 3HSEA 2Y0SN 3S8PA 2H8RA 1LJOA 5KE2A 4YOQA 1UHWA 3OJUA 1YITI 2ZJQF 4ELZC 2QQ9A 4BJ6C 1I8FA 1E2XA 2H3EB 2YNIA 2DJNA 4PHTX 3AAFA 3F21A 4M78D 4XRSG 4NC7A 1ABQA 3KP5A 4Y4RA 2XASA 2FX0A 2OTLQ 3EGDA 4F93B 4UQGA 3UKRB 3VGMA 4F8RA 3WUHA 5DTDA 2HAXA 3VYRB 3NDKA 3F8FA 2F4IA 3LSIA 5ERIA 4CFBA 1KZHA 3QHSA 2LRQA 2W84A 1NK4A 1KU2A 5HNHA 2L7MP 3LL7A 2RKHA 1VQMT 1J09A 4DQQA 4BR4A 5C42A 2YUPA 4KTWA 4O5VA 1ZKGA 3OOUA 4EV0A 4BXXJ 1OLTA 3CCSI 3D2EB 1BJZA 3OWTA 4IWVA 3FXLA 4CZMA 2GIVA 2YXYA 4DA4A 1U6GA 1OCRH 1MDUB 2JW4A 2CYYA 4YORA 1TBXA 2HEOA 4CBWA 2V51B 3P38A 4FE4A 3J7AY 4XIUA 2GTOA 3H45C 3VS2A 2PU9B 3CFPA 4A12A 3FDRA 2L9VA 2FNAA 3A8YA 1YVNA 3KHYA 3JRIA 1PM3A 1RR7A 2F4VK 4GFBA 4C3HJ 3RKYA 2FSNA 1K9AA 3GNGA 2L4AA 5IP6A 4M78E 2Z1IA 3DRRA 1J0RA 2E64A 1IHVA 1T44A 4LE9A 4QVCA 1VQ9N 2LOOA 2HTJA 2ZE2A 3SJHA 1HK9A 1KFSA 1VF9A 2G8UA 2QTVA 2ZXHA 1UWBA 2CGJA 2FBVA 3UKRA 4XTYA 4LH4A 1SFKA 4G7OF 4AVPA 1UHCA 3CCLT 1WBDA 4CGDA 3NGIA 1W4SA 2H8HA 3RSEB 2BGCA 2JSPA 3IG1A 4DNCA 4JYAK 3TI0A 4JNEA 4K8ZA 4M9XA 1VQ7T 5DK5A 1MW7A 3O2PE 1RESA 2ZGWA 2MIOA 2BBYA 3CCRA 1YJNI 4PGGA 2YKMA 5A0DA 3UA6A 4RTTA 4BXUA 2YX7A 5GADP 3EYIA 3LWMA 4JKDA 2XGXA 3HOSA 4FM4B 1IG7A 2A69F 4N0BA 1D9FA 2E7WA 4AWXB 4A5BA 4B1ZA 2LMDA 3V1QA 1W1WE 2JPCA 2M2EA 3M0RA 4IUTA 3WTVC 2NVYJ 3O5ZA 3C2BA 2ZZDA 3M0UA 1Z25A 3ME9A 4IUVA 3SI6A 3PIPF 1SVLA 1EX4A 4M63C 2LTPA 1TT5B 2VKNA 2YRCA 2KY9A 4L5IA 1GXPA 2WAEA 1YJNQ 1Q9YA 1NGDA 1ZSZA 2XY6A 1IBMK 1X19A 5AQRA 1PUFB 1XX5A 1XGMA 3L00A 3JCMg 2DAQA 1VQKT 3I0RA 4DR4K 2JVGA 3SYZA 4CEZA 4CICA 2XGEA 1OX9A 1D4XA 1X58A 1WJDA 3A0BC 3F8BA 2Z1GA 2FRHA 1WN7A 4B9TA 5L8RE 1T95A 4QVDA 3OHRA 2OQRA 4BJTA 2F5VA 3BY6A 2CQQA 1KVCA 1O57A 2NOIA 3QBXA 2BE2A 2BY1A 5LJ5d 2KPMA 3KKSA 1IKVA 5E3NA 4DTRA 4A69C 4PSWA 2IAIA 4EP5A 2WWYA 3QEWA 4M78C 3GMEA 1K8KB 1AWXA 3KEQA 1M2OA 3OOPA 2X85A 2X1CA 4HVVA 4HHTA 2BGGA 4FWKA 4E3SA 3IRQA 2E65A 2DKGA 1VYTA 4A61A 4KFCA 1D5VA 3B73A 2E6LA 2DLPA 3T1YK 4OKKA 4LF9K 3W6KB 2M51A 4ZNXA 2HBKA 3LMMA 3DAWA 4YNQA 2QWLA 1ZRCA 4HNTA 4PJOC 3KBGA 1MSEC 1B3QA 2O8CB 1PUFA 1YQMA 4LF6K 4J2AA 3A02A 4J9FA 4Y91A 2PEXA 5HRRA 1X4OA 2E6NA 2L54A 2I2LA 2A5XA 3SXYA 5GAOp 2GWJA 3HVTA 2CV2A 3TTFA 4B1UB 2IG0A 2MAMA 1UFMA 1ZHIA 1OYYA 5BPMA 1AVZC 1QZEA 4G8XA 4M75B 2FQ4A 1U9NA 4IHSA 4D5CA 2EKOA 5DM6L 5DPKA 3EH2A 2CJJA 3X26B 1NEGA 8ATCB 3E2UA 3AL0C 3BQYA 4NBQA 2LQWA 4FT4A 2HBLA 5GMKl 1L5UA 1D0YA 4U0YA 1AKHA 5BPLA 3CC2T 1L3TA 3QFUA 1IBLK 2OTLN 4DR2K 3OYJA 1XPXA 1EWQA 5K5QA 1TYQB 3DEWA 4XIDA 1Z9QA 4IJNA 5ILUA 2E41A 2JTEA 3H9QA 5F0CA 4M71A 2HMIA 4H5RA 4C92C 3INZA 5LY3A 2LH9A 2L0AA 3KD1E 3VGLA 2FC0A 1SF9A 2OTLA 2MBFA 1EKEA 1NGGA 3BPVA 2QWMA 4Z88A 4B43A 2Y69H 4B9WA 1VQ4A 4RLFA 4GKJK 3RMAA 3FGUA 3GEZA 2O8CA 4ELTA 3IAM2 5JI6A 1KD1C 1VQ7I 1RT2A 3AVNA 3HZ6A 5I42A 4B24A 4ILGB 4JKAA 2AHJB 2LQ8A 3HDDA 3OMCA 2VKDA 5KYWB 3K2PA 3LM9A 1SS6A 4WE1A 4H4MA 2E35A 4YDUC 4BC4A 2R5ZB 2MH2A 2EZIA 1VQKI 3CJ1A 4FHTA 3BDUA 3A5ZB 1K1ZA 1B4AA 4DF8A 1KG5A 5EOYA 1JE8A 3GBGA 2O03A 5CO7A 1Y0UA 5CKHA 2NZTA 2M8GX 2DCEA 3KEOA 2HBPA 2K85A 2HPMA 3FWEA 1YP5A 2TRTA 1CSKA 2YX4A 2E2QA 2ABLA 1JCFA 3MZYA 2R7XA 3G71N 1DQUA 1O75A 4RWTA 5GAN3 1OYWA 3HKSA 2M4KA 4OFEA 3OBYA 5D3GA 1ZC6A 3C95A 2XD0A 3VEWA 3AVIA 3G6EI 2O2OA 2Y0MA 4JI7K 1JTXA 1KTQA 3MN5A 3EUKL 3ZQHA 4QQ6A 3I4PA 3PLAA 5AQYA 3ZYYX 4OPJA 2A6EF 1S6LA 4AHCA 4FLTA 3PIOL 2OU2A 3CWAA 1WXTA 4EW4A 3RNJA 3TWHA 3LDOA 4RMNA 1O3RA 3UIQA 4CGZA 4FJJA 2KKOA 2O4GA 2RKIA 2QWWA 5M9OA 2EGAA 2H8WA 4A59A 5FU7B 4V19K 3I55N 5KYWA 2L3SA 1AWCA 3EKSA 2UUZA 1RRQA 2IBDA 2RAEA 2NUBA 2UXDK 2IPQX 3D2FA 2HBMA 2DYSH 4EP4A 3LDPA 3TTCA 1TAQA 3B6OA 4YELA 2OPRA 1SQKA 2PMZN 5BRDA 3LX7A 1W7PB 4R79A 5HK0A 5KYXB 4WTOB 3TVTA 3LM2A 2G3RA 4DTNA 4DTSA 3WE2A 2FUG2 2R7UA 1AWWA 1V54H 1QMCA 2KROA 3BG6A 3E6MA 4PLLA 4C2UA 5JLFA 4YY3K 2A68F 4XICA 3OIPA 2JM8A 4I0AA 3UWNA 4IOAL 3R6MA 2N8GA 1M3AA 2DN0A 1E3MA 3DLLA 3RJPA 2W41A 5K1YA 3G0QA 4HX4A 4PJLA 2UXXA 3TMOA 1ONVA 4PGHA 3KLHA 1BCMA 2IP2A 5ADXH 3QDKA 2MH9A 4LOCA 2ZNZA 4ZN1A 2BZ8A 3LH5A 3ASNH 4LFCK 3W6JB 1Z3YA 2X48A 4FYVB 4OIPF 4EIAA 5J2MA 3CCUI 1I1GA 4FXDA 2RVCA 4II2A 2PUKB 1IXCA 2FOKA 4FJIA 4ISEA 1ACIA 4PK4A 2DFFA 1JGSA 4DFMA 3CPWA 3CYMA 1MMGA 4EGZA 3PVQA 1VRLA 1YITN 1DT9A 2Z2SB 3RDIA 1O4XA 2FPFA 4D9JA 1X2MA 3T0YA 3S2WA 1GBRA 4DG1A 3JSMA 4CF1A 2LP0A 3SAGA 1NGBA 4KI6A 2IRFG 2ENMA 3AARA 1W5CC 2RQTA 3AG2H 2JHNA 5FRNA 3WXIA 4NNJA 4MZTA 2IPOB 2JA5J 4LITA 2Q1NA 2FPDA 1PJRA 1QVUA 2Z1JA 4MLEA 4ZGDB 3PL8A 1M1KO 5JLWA 3MFKA 2CZ1B 3X24B 1Y0NA 1SANA 2P4WA 1E17A 4DS4A 1WGSA 2COMA 1OOTA 3SQ1A 4CZJA 2ED0A 4O8UA 1S9GA 1WFXA 1D1AA 2MW8A 1FW6A 4M3RA 1RDWX 2L2OA 1S8NA 3KLNA 3VEVA 4IX7A 3SWNC 3CCQA 1JKHA 4E9EA 4RCBA 2BUDA 5AQHA 3M54A 5AQXA 2OAWA 3OYGA 3QJYA 1AZGB 1VZ0A 2P7CB 2DPNA 2F69A 4RKUE 4NCAA 2HW3A 3RYRA 1K7AA 4ZDPA 1JLGA 4WQ4C 3EE9A 4FCYA 1G15A 1QVFA 5DYMA 2L3DA 4AIAA 2CKKA 1OV3A 3VRZA 3MWMA 2M0OA 3HC7A 3ZQIA 3V4GA 3HPOA 2DA7A 1RAIB 2M0YA 3PUFA 3IWFA 3I59B 2HXIA 1SSFA 1B72B 4CA0A 2RQUA 5E18F 4E47A 3SD4A 2W00A 3M8FA 3LP2A 3Q3SA 4G7HF 1UHSA 3REAB 3CP8A 3GP8A 3IRXA 5DCMB 3SHFA 3C6TA 1LWEA 1ZELA 2L8DA 4JD2B 4LH5A 1QZZA 2VUMJ 3VOVA 3RQ4A 2FYKA 2GUPA 2JUFA 1RUNA 2W10A 4MZMA 1EP4A 3UPUA 2CUJA 3V9XA 1B07A 3DLBA 1RBUA 1NG9A 2QF7A 3W2AA 1C1AA 3OQ5A 4XH1A 2OYQA 3O9TA 4HUFA 4M3FA 2WUSA 3VJPA 5HBMA 3ABUA 1YYVA 4AILC 1OEBA 3G71Q 1I6HJ 3GFIA 1CZ9A 1GT0C 1R1VA 1RTDA 1VQNQ 3RI4A 1M1GA 2RHUA 1KG6A 1VSLA 4BE2A 2EV5A 2MWPA 1BL3A 2CRGA 1YHQT 3AVBA 1WEFA 4AFQC 4RCHA 1ZR2A 2CYZB 3BCAA 3G6EA 1Q86C 4M7DD 3NAUA 1JJ2S 4RTFD 3FXQA 4JX5A 4DR3K 2A6HF 1H0MA 4JRKA 1PNJA 1YJ9A 4OMOA 3VEOA 1IN8A 3QYHB 5D6FA 3TW7A 3ZP5A 1HOMA 4HKEA 1VK0A 4A0YA 3LDSA 4KHPK 1LFUP 1K8AR 1SD5A 1B72A 3VS1A 2DK3A 3CCLI 1VHXA 1UA1A 4N9IA 1IGNA 3I55Q 1FJGK 4FWPA 4J9EA 1NGAA 5HLIA 1ZBUA 4KHWA 2DODA 4M7YA 2VQHA 1LPLA 4RGRA 1TU0B 2ZPHB 1CF7A 4OMPA 1EXQA 5AQMA 4YPHA 1P4WA 2BUPA 5IH2A 2K7AA 2D2WA 3GTGJ 1O3SA 2JN0A 3BY5A 1Y39A 2QDYB 2VWBA 2R7YA 1EBMA 5D6YA 2A07F 4F52A 3AA2A 1VQ9T 5BN8A 1XQPA 4ESBA 1M1KR 4LG0B 3LNQA 5C4JJ 4DMNA 2IS2A 2QASA 2R0QC 3SZTA 1YIOA 2YT6A 2VKVA 3VU3C 3LP1A 1X2QA 5BMZA 2FMYA 2LKPA 5GANh 2D45A 3KZBA 4L3QA 2QK0A 3GW2A 2GTJA 3H0DA 4M75C 5HL7L 2H1KA 2JS2A 4BQNA 1OVQA 1ESVA 4E7LA 2CQNA 4JLIA 1LAVA 2QQ8A 3JCUC 1K4TA 1ASUA 1YTYA 3WXKA 1YHQI 5ECAA 5KHDA 5J1RA 2XHKA 2EYYA 3AG4H 3D7EO 4JI1K 4X62K 2ROTA 3E9FA 4KULA 3WEEB 1OPKA 2K40A 4ELVA 1R36A 4DFKA 4I01A 2J6KA 4I6MA 4OMLA 3CPEA 3QBWA 4PJOB 3ECOA 1FMVA 4I02A 1LVAA 2VKHA 3QU3A 2HHTA 4M72A 5KVRA 3KTUA 1WCMJ 1USSA 3CCMA 4JK7A 1SHFA 3KLEA 3HSFA 3H3OB 4FLUA 1QVFM 4AG1C 4FK0A 4EDUA 1CF7B 2PJPA 5EY4A 1GLFO 1XCBA 4UY8O 1VQLQ 2HVQA 2QQSA 4XMYA 2AP1A 4HCZA 3I35A 1ULYA 2EZKA 3ID6A 2L02A 4WXDA 1Q81O 2VB6A 4DOZA 2EQIA 4BVOA 4GXOA 1EWRA 1OCOH 1Q8IA 3BJAA 5CY4A 1F21A 3S3OA 2EFQA 2QBYA 2OQGA 1I3AA 2PX9A 1M90U 1T8EA 3N4QA 2M1HA 3OS1A 3FMRA 1LNXA 2NOEA 5GPAA 1WAFA 1W97L 1ZA1B 4JI8K 1IC8A 5LMNK 5JVHL 4PUOA 5ICGA 2DT7B 3AA3A 3TU5A 1ZYQA 4C5GA 4YOXA 1VQOA 1WLPB 1Y7XA 2K3YA 3GPLA 4DSJA 3DLLL 3P9IA 4E7IA 2IEKA 1R5GA 1J2XA 2VC0A 5IOZA 4CRIA 1HW2A 3E6CC 1TQIA 1QVFS 2ZGYA 5EX5A 4L5GA 4F55A 2KLAA 2DXUA 4LD6A 4LY7A 1ORPA 4BC3A 3EL2A 3HOWJ 4JJDA 3H35A 3L2ZA 1XSDA 3CCMQ 2HQRA 1N8RR 3WTTC 1I39A 1NZ9A 4C0FA 4RB0A 3OA9A 3BFMA 1WHJA 5IT9K 1SRLA 3HK2A 4BYYA 4FJ9A 2IXSA 4NHJA 1E0EA 1PWTA 4MDWA 2DMUA 4BL0B 5FWCA 2RN8A 1JLFA 1Q9XA 5GANd 2I5UA 2P5LC 4QCLA 1JXSA 3I53A 5GANj 4BJ5C 3GBQA 1HNIA 5FW9A 3SBTA 2ZGZA 2K4YA 2NUZA 2EJGA 1Y07A 4F3QA 2VN2A 1QQCA 1A35A 3J7AP 2M87A 2VBWA 4CIFA 2PNIA 2J4RA 4RG2A 2VODA 1GV5A 3JXUA 1ZGAA 1JKPC 1JJ2P 1PG5B 1KVAA 2QUFA 2QBYB 3QYEA 5E8IA 1CXUA 3LSTA 3OBWA 3QB0A 2BV6A 1XHXA 5BR8K 4L0YB 3JRFA 3ZSWA 5ICFA 4H0EA 5FPDA 3IAS2 3B02A 2DFUA 3CJAA 5KE3A 4PZJA 3CCQI 2XVCA 2DRKA 2HXOA 2XAQA 2YNGA 1OULA 3TAEA 2HBJA 4A93J 1M90O 1IZ1A 1DGWY 3HHHA 1EF4A 3MX5A 4EMSA 1FNNA 5D4SA 3F23A 2V1XA 3CW7A 4AHSA 2H94A 1TTHB 1NPPA 2R3SA 4XKBA 3R6OA 3T7ZA 1QHAA 3RR8A 2CH0A 5IT9O 1H1VA 3BTIA 5JR3A 3VMFB 3ZRGA 2HZTA 4JRPA 3BG5A 2HQNA 4B1RA 2GGRA 3A0IX 3W3CA 1WIEA 2ZF5O 3GTPJ 2M0MA 3MP8A 3TABA 1JT6A 2KRSA 4I09A 1ETVA 3HXLA 1HJDA 4ZYDA 3DB4A 4B22A 5I3UA 2X4XA 3HFOA 5LJ3j 5HDKA 2E1ZA 1BI4A 2OX7A 1KEAA 2LC2A 5E84A 1ORKA 4B1WB 2FE3A 4XLPF 3C0CA 1U8RA 3GTLJ 3HB9A 4W5TA 2PYJA 2WTUA 4AUXA 4F04B 2VLAA 2P9SA 1CZAN 3QOEA 4PKCC 4M75D 3MEEA 1ETOA 4B09A 2BANA 4FO0A 1JGGA 3ZSRA 4EAHD 4ZTFA 1KU9A 5E17F 3AVAA 4DB3A 2J5OA 3A8OB 1TQMA 3RR6A 5HS8A 1XCVA 2DVEA 1VQ4I 3FIFA 4A6EA 5A2QZ 2QWRA 4ZYGA 1TUGB 4A5NA 1MBHA 2FBHA 5LJ5h 3IS9A 2K3BA 1VQ6I 2WADA 4CYDA 5JLHA 3JCMf 3VQ9A 1QZYA 3L2UA 2Y0SA 1ZBLA 3CFRA 1WI3A 2HSEB 3A1YA 4OAYA 1PU8A 2LF8A 2RD1A 3M58A 2X9DA 3QEXA 4LF8K 2OC6A 3CMEI 3WT0A 1RKWA 4JK8A 1Q1HA 3LCNA 2EIJH 3VF2A 3V9WA 3ZPLA 4F7ZA 4ZYHA 1VAZA 4Q48A 3CQXA 1JUPA 3MN2A 4U7DA 3WTZA 1WSEA 4M4ZA 3QSUA 3EZ5A 2FG0A 1RILA 3P1GA 1QBJA 2LY9A 2D0NA 2B9SA 3CCSN 3GFLA 1JU5C 4Z8AA 5F0HA 4WCEL 4LLNA 2HKQB 1YO5C 2H6CA 1JRIA 5HS9A 2AZSA 4CF8A 1PCXA 3DU5A 1B7TA 4E9HA 2W03A 4KT0E 4JN4A 2R7TA 3KPHA 2BEOA 5L3DA 1I50J 1I0CA 4MNUA 3QODA 4AIKA 4CGFA 5CVRA 1JHFA 2J5PA 2Y9ZA 1KD1R 2PFUA 3SAFA 5D8LB 3M4OJ 5GAN4 4HCKA 5GAN5 2X6SA 1QVGP 1OX8A 1VQ4N 5LJ3h 1E3PA 3R9PA 3MXIA 1X9WA 2HOEA 3RPUD 1KSPA 4FIBA 1VQPI 3JR9A 3ATUA 4CCMA 1ACMB 3CUOA 3LSHA 1LQ1A 1MV0B 2NOJB 1KRPA 2X51A 1V4TA 1W0UA 4YFUA 3THYB 3SBGA 2QKMB 5KK1A 3IKMA 2VXEA 5KTQA 1O9SA 5AJ3K 2V7FA 1RIOH 2HMAA 4ZGJB 4RTXA 3SZGA 1QHGA 4BEHB 5F1RA 1ODDA 1U45A 1OH8A 1ZSZC 2I7NA 3K0SA 4E1NA 4ESFA 4CC7A 3FZFA 3VYHB 2HYJA 1ILYA 1X1PA 4HV6A 3OSFA 1YRNA 4PL7A 1FX7A 2LT4A 3FSPA 2O3FA 4UXNA 4CYCB 3DEUA 2OTLI 2L3PA 4KAZA 2KZMA 2IC3A 4ISGA 1WNSA 3ULEB 3EFOA 3H3NO 1SFXA 3TSQA 1LDDA 1VQMQ 1BQMA 4IEIA 1V55H 1ZLKA 4JI2K 3E5XA 4CW7B 1K9MR 3AVLA 3A5LC 1BBZA 2LY2A 1BA0A 2VE8A 4BDZA 5M3FJ 2QQBA 3WTYC 3WGHA 4FU6A 2RHYA 1RT5A 2XIDA 4CIEA 2DTUA 4B9NA 5LHHA 1BWFO 2DL8A 4OOIA 3ZT2A 4B1YB 2GM4A 4Y15A 3JCMJ 3ZBDA 4Z2YA 2A61A 1WJFA 5CKFA 1OI1A 5LL6Z 3JRZA 2O9LA 1ZRDA 1ZBIA 2UU9K 4U0WA 5FGMA 2ZJRF 2QM3A 3CCMI 3WTUC 3HO1A 2XRNA 2ACJA 3HL8A 3M8QA 1XMOK 1Y64A 2COWA 2ME0A 2NNWA 2V1UA 5ILSA 3NGYA 1U84A 4EGYA 1R0BG 4U0VA 3LOCA 2KDSA 4EJTA 1YRNB 3IHOA 1FYKA 2QW9A 4L59A 2OANA 3P8HA 4CYCA 2DILA 4W5QA 5FLXK 3CCVT 1K83J 2CP6A 2HKNA 1T0HA 2HCKA 1IO6A 1C0TA 4J2BA 2IAJA 2WAQA 3ULEA 3EFOB 4ESJA 3VPZA 1VQ8Q 4IOAF 2I5WA 3CJTB 2HQAA 4BU2A 1UGSB 2XO7A 4BGAA 3HJFA 5DD8A 2PG4A 3U9GA 5GTHC 4B3MK 1H8AC 1E6HA 1KHIA 1Q86O 1MH4A 2WSEE 3A2FA 3BCBA 1D8JA 5BPNA 3CEYA 1ENHA 1VQOI 1QU3A 2EYWA 1YT3A 3KWIA 1ETKA 3BP8A 1S7AA 3VQCA 1HDPA 3GXOA 1YOVB 2X4JA 4QIWN 4YFKF 3IRRA 3FZVA 1HA8A 5FLXZ 1YCYA 3SFZA 5KPZA 4HUEA 2UV1A 2QSGX 4C3JJ 4M75E 1WHHA 1GLDG 2ZJQL 2NOLA 3D45A 1NE8A 1E6GA 1VQKN 1YJ9Q 4OFHA 1XC5A 5CPRB 3I4NJ 2X3WD 4FZXC 2FF3B 3O4NA 3HSCA 4KHYA 2OZ6A 3WNEA 1G3WA 1SL1A 2R7DA 5GAGJ 1DPUA 4XKCA 4YPRA 2IDOA 3REBB 1ON1A 1T03A 5J8FA 5M3MJ 1QQIA 1N6AA 3AVFA 2WY7Q 3QIOA 5J4VA 3GLXA 5GANf 1XUPO 1YI2I 2ZMEC 4RS8A 3WGGA 5LLQA 3FKIJ 1DTTA 2M8EA 4Q47A 4TVRA 3RERA 3ASMA 2EV6A 3RUXA 2A05A 4I99C 2DBBA 4F7UE 2HHVA 3SJMA 3LQQA 2GBZA 4DV6K 2AJQA 3E01A 4CCNA 3GYHX 1YW9A 3REOA 3PFSA 2E8AA 1BUPA 4PKIA 2WV1A 2KL4A 4G9ZA 3KK1A 4HSRA 1HX1A 3BEXA 1XGSA 4LJZF 3PGGA 3CBPA 1HQCA 3NH2A 3F6VA 1RBVA 1A5WA 4QQDA 2CV1A 2KHMA 1ZRFA 2KRMA 1SL0A 5AR0A 3LZIA 1IDYA 3U4LA 3R4KA 1WOQA 2PAVA 1HLUA 4HDUA 4KV8A 4FL9A 1MBJA 2NRZA 4FASD 3PNWC 5HLTA 1SEUA 4B8AB 4LDYA 3FK7A 4XH5A 3TSUA 3HSBA 2H3GX 2Y4XA 1YX3A 5IY5H 2V9KA 2OTLT 2ZBKA 3KLIA 4M7AE 4QT7A 1KCFA 3AAQA 3CQTA 2O88A 5FU6B 1HKQA 2C0TA 5BPDA 3I71A 1T8IA 3HPHA 1XTAA 1ASVA 4X64K 5J2PA 2BDPA 2CQXA 2BVMA 2V75A 4NLBA 5IHNA 2HVSA 5FDLA 1R59O 1Y8RB 3BTCA 3SEZA 3VENA 1JL2A 3EG3A 2COZA 2KXCA 5M1NA 4Y0WA 3JCMV 1BQNA 2ZPGB 2VJIA 4Y17A 4WFAL 3FK6A 3SFMA 2IIRA 4K41A 3JV3A 5L23A 5LEKA 4FISA 4AHVA 4HQEA 3QKJA 2HQHA 1Q95G 3CCMN 2D1XA 4D0PA 4LB6B 1GFCA 3E5UA 3ENBA 4KRFA 4IEJA 5K5OA 2R7OA 1HU0A 4RA2A 1K73U 1W0HA 5E79C 3CCVI 2MI6A 3GNFB 3CC2Q 3WXMB 3HJEA 4W1UA 3LDQA 3O1BA 3CQZJ 3VEYA 5AIQA 2I5JA 2B63J 3KZIC 2DERA 3J7YJ 5B8HA 4EW0A 1NJIC 1IUFA 2K9LA 2MSYA 2F5CA 4DV4K 1Y1WJ 1DKGD 3DKYA 4HAMA 1C0WA 4CF0A 2XY7A 3N4MA 3VUBA 3AVCA 3CCVA 2O8BB 5GAOr 3FKJA 4BY7J 2F4OB 2PN6A 3OYHA 1NK3P 4BVPA 2W85A 3VQQA 3P7NA 4J83A 1BI3A 3MKLA 1QQOA 3SJJA 2EHGA 3VTIA 4HTUA 1K8AC 4FSSA 2GBYA 2DL5A 4FYDA 1M1KU 4EJZA 1EO1A 3NF9A 3C12A 2DMTA 3SV4A 1TK5A 1V5EA 2K5LA 4B1VA 4B23A 5CKEA 3TQ7P 2QYOA 5IT3A 2W48A 1N27A 4CUGA 4X66K 2HR3A 3R2XC 1JCEA 5IXBA 1ON2A 1MGTA 2RHIA 1VQNA 3UDCA 4M41A 1ATNA 3AHUA 2OZMA 3MN9A 1MNEA 4CZCA 1Z6RA 1VQ6A 2DL7A 2DY4A 4WCIA 1FOYA 4MFDA 2Q8KA 5BOXA 1FIAA 2HNYA 2RPNA 1K4US 1RT3A 3ULQB 5B3SH 2LQNA 4ZH4F 5EEHA 3G1JA 3V6DA 1HJRA 2AS5F 1M27C 1VRTA 2GEMA 3BF3A 2QK9A 5FROA 4XKWA 2X6WA 5JHUA 1Q81C 4B3AA 4YTLA 1I07A 3OYFA 4J01A 2XMFA 5I2MA 2GBQA 1X27A 2O8BA 1X3ZB 9ATCB 1WPYA 3EY1A 5KRSA 5FFXA 1YJWA 1VQ8N 5LEJA 5E26A 2EFIA 5KN9A 2CUDA 1OZ2A 2CU7A 5KN8A 4AM6A 2O8FB 1IW7F 1E4GT 3R1XA 4IIOA 1RDAA 4B21A 1LFPA 5LGNA 5F04A 3M56A 4IQ4A 2R7RA 2Q1ZB 1YCSB 2RJCA 3FHFA 1RI7A 2A3ZA 3W3DA 1TK8A 2AQFA 1KC8C 2HZYA 3CWUA 1OQKA 1M4ZA 3AVMA 4FVMA 5J47A 2ZCWA 1JXBA 4E1JA 1YJ9N 2LBFB 4FPAA 1XNIA 2MFZA 4G7ZF 3V1OA 1MHNA 2E1CA 3I33A 4XK4A 2PBIA 5C3EJ 2GQQA 2VIXA 3CCLN 2KZGA 5CKTA 2HEQA 5CKBA 1X9SA 3KP2A 2P7VB 1HKSA 3F72A 2MPXC 5K7ZA 3J81E 2NVUB 5DDGA 4HYEA 2MABA 5DV5A 3OYBA 4RW4A 1MUYA 2O31A 1RR8C 2XF7A 2KMTA 3VS5A 5AZIA 3AY9A 3S1RJ 1OYIA 2QI2A 2ATCB 4IO9F 4FWMA 1N3CA 1QKWA 3W6VA 4Z02A 2DTZA 1G99A 2NRRA 1MH3A 1WEGA 2PBDA 2LVSA 2ZFWA 2F2WA 4BBRJ 3A2KA 3R6NA 4CZHA 1TNTA 3EYZA 1NTCA 4A63B 3BR5A 4FWQA 2ETJA 1BHLA 4C92D 2DOEA 3JCMd 3FZKA 2HZDA 2E10A 3K5MA 2KIMA 5FRMA 2LTOA 1NKCA 1EZZB 2ZJPL 4K25A 4ANJA 2F5EA 4FTHA 4P5OA 3P4IA 1W5SA 1GOBA 3CMAT 2EILH 2C0OA 3HP6A 4CEOA 1J5OA 5E20A 3CCUT 3D4VA 3JCMc 3O8MA 5ILVA 3RZDJ 2NNNA 4P96A 3HUGA 2ED1A 4JBAA 1OPLA 2ECBA 3GVAA 2K9MA 3OS5A 5EGOA 3PO4A 2K5FA 1R58A 3AVGA 3NHNA 4YOYA 2QAZA 2CW7A 2YJEA 4A3DJ 4QWQA 1CQTA 3AO3A 4Z4FA 5AZIB 4J9BA 1KG3A 1KLNA 4IZ9A 5I21A 2V79A 2RI2A 4NL3A 1NBWA 1SFOJ 1QTMA 2JMCA 4EM2A 1G6NA 3M1CA 2DTIA 4L9VA 1HJOA 1HYSA 4E1MA 4C92F 2NS7A 2LDMA 3AG1H 4HVUA 2YHWA 3L9FA 4C92G 3D0PA 2O8EB 5F1JA 2MC3A 1IV6A 3NTKA 1QSSA 1DGRM 1JTYA 2K2MA 2X9HA 2RMOA 3VFZA 2UWMA 3NVMA 3CC2N 4F7UB 4X34A 2DBMA 1GXQA 1AWJA 4FETA 1Y71A 3KK3A 3OY9A 4FX4A 2H3JA 1X3UA 4QPOA 4H0OA 3MKWB 1TW3A 4ITVA 3ROUA 1N8RO 5D5VB 2XSDC 1R77A 3SPZA 4HX7A 1SAZA 1SZ2A 2PI0A 4N4IA 3CCST 2EQMA 4M45A 4RUGA 1S72N 2YHTA 4UVBA 5AQOA 4AFUC 5J39A 3ECHA 1BK2A 4JK9A 5GMKj 4A2AA 3EHQA 4J9HA 1XD7A 4UB6C 2VASA 4DW6A 1OYXA 3L4QA 1RRJA 5FLXE 4BH9A 2LR8A 4Q5SF 1VQPT 2PVOB 1YWOA 5KPRA 4YOTA 4HPQA 4KBMB 4J6XA 3BLYA 4DV3K 5FB2A 1SPKA 4QSHA 3M55A 1BG3A 4N4HA 2O4XA 1XWLA 1MUDA 1S6PA 2E2IJ 3RTRA 1ZX6A 3E5QA 4XORA 1QLYA 1Y6IA 4E7KA 1KYZA 4OAZA 1GRIA 3CCRI 1R5HA 2JPBA 4CEFA 3C7JA 3KCCA 1OFCX 5TKYA 1ATRA 4XAXB 4RB1A 3UB5A 3V7RA 4N4OB 3I8BA 2GFUA 1LOJA 3GTQJ 2MWOA 3F2KA 5JS2A 4WWCA 2KDZA 1BDGA 3BJ6A 1P4AA 1YJNT 3CI5A 5DLOA 1VQ5T 1GDTA 3NF6A 3TOAA 2OTJI 4C1NK 2VKEA 3G71I 3CCJT 2RJEA 3DTIA 2HHWA 2QZ8A 1PSFA 2V8KA 4RM2A 2LRDA 3JB9G 2JK3A 3U21A 2P51A 3I9V2 4V2SA 3JCMb 3O5BA 2E71A 1HCRA 1SD7A 3MEWA 1L3VA 4XLFA 2HTSA 4K42A 1XSVA 4DEXA 4BACA 3ULDA 2RN7A 1BCOA 2E5ZA 3SQNA 3ZQLA 4HWIA 3IMXA 4BY6B 1V4SA 3H9JA 1V5GA 2FJ1A 1UCRA 2ID3A 5JLXA 4GMJB 4YHHK 4JQFA 4I7FA 4JI3K 2H56A 4DQRA 2WOMA 1NOYA 2G8FA 2E3HA 4XLNF 2VQCA 3E1YA 5KQDA 3GLLA 3MQ0A 3U1KA 2NOGA 3C18A 2P9KA 2YCHA 4CD3A 3QOPA 1VQ9Q 4F7UF 2STWA 3WNHA 4F92B 4Q0BA 2XKOA 2GX9A 4C9YA 2EJ9A 2KRFA 3WODF 3BOQA 2R5MA 4DFJA 1QPMA 4UV9A 5IYCJ 4OLBA 1V4RA 5AQNA 3GBTA 1VQON 2F7TA 1MA9B 4DFPA 5J2NA 1MD0A 5J2QA 2FSWA 1JXEA 4I2PA 2YLCA 4HF1A 4C5EA 3FLCO 1SSHA 2XDDA 3HRSA 2P9IB 3TAPA 3VA3A 3FXOA 5LJVA 4FYWB 4XN0A 3LP0A 3H5RA 2K3XA 1BR2A 1C0UA 3N97A 3ERED 2PJRB 3MEVA 4LD0A 3BZ6A 1U0JA 4JJBA 4M7AF 1A36A 2BHYA 3FIWA 4PJMA 1ZBXA 5J26A 3RBBB 1BIUA 5HRNA 2NUTB 3L3VA 4IXCA 2VE9A 2NUPA 4BR2A 3O3FA 1T3VA 1RUOA 2ZWHA 3B8AX 2O6GE 4HG2A 2A5YB 3S93A 2BE5F 5TGTA 3J81O 1BIAA 1JCGA 3ISNC 3AO2A 3S6IA 2BVLA 2M3AA 2KISA 5AQIA 1TW2A 3FLGA 2FEZA 2JZYA 3WNGA 3NWTA 1WJAA 3MDQA 4B47A 1WB9A 4H5VA 5AYFA 4BKXA 3JRHA 4PWDA 2E70A 1FOKA 2BE7D 3MKZA 4MLOA 4YIRX 3VODA 3G10A 4QQGA 3L2CA 3HOUJ 5EG2A 4IG0A 3CCRT 2FVUA 3QIIA 2R5YB 3FDYA 1WQ7A 3MWPA 1OCZH 2D1KA 1XI1A 3T19A 3A01B 2CUFA 2HVIA 4HT9A 4Z94A 1IO2A 3QP5A 4F14A 2E3IA 3H9GA 3SQ4A 2P9NA 1KONA 2R7QA 4FLYA 4CZKA 4PUSA 2ETHA 3EG1A 3OS2A 1C0FA 1K78B 3BR6A 3QESA 1Y56A 1HUXA 5DLQE 3CF2A 1RBTA 2CWEA 2D5VA 1M3CA 4DIQA 4M78F 1XMXA 3JRDA 5FKOA 3I0TA 2ESWA 2KRHA 2KQWA 1LW2A 2NUTA 5J40A 4MGRA 2Q0OA 2CZ6B 2O9VA 3CM5A 3DTEA 5AQPA 5M1OA 4B3OA 4N4NB 2XY8A 3NPFA 3ZQGA 4JUVA 4DV7K 3JREA 2Y9YA 4E19A 5F2RA 4Z4IA 4BAYA 3CZ6A 3V8JA 4D6WA 1S72Q 3H6EA 1GCPA 4GNIA 2OJED 1ZR4A 4PJOF 3R6SA 5LL6S 3GUDA 5TISC 5J1YA 3CCJI 3DRSA 1HKGA 1NGHA 1PYVA 1P2FA 3DB3A 1VQ6Q 2CG4A 4CHYA 4RDUA 4K8XA 1YQAA 5GAOq 4H8KA 4CCOA 1QHTA 4KN7X 3RIRA 1QWEA 2DDBA 2R5YA 3J7YP 4DQ8A 4Z4HA 1SMYF 3OYCA 3LPTA 3V8LA 2GTDA 3NMUA 2IJLA 4MO7A 1ZG5A 3DXKB 3C94A 2ZJRL 3DTKA 4KJZA 4IPAA 3KK2A 1S72I 1YUWA 3MVPA 4RBOA 1M90R 4BUPA 3MX2A 1M1FA 2VOPA 3AV9A 1GUUA 4G12A 2W6KA 3RMQA 3QO9A 1E7OA 2JN6A 4S04A 1K78A 1ZREA 3HBTA 5JHFA 1RRSA 3RSNA 3CLQA 3LWLA 4C5HA 2ASOA 2DA6A 4HTLA 3ITHA 2I7PA 3K4BA 4IQJA 1X2NA 5DUIA 2KR3A 1RI0A 2E36A 1LWVA 3PJRA 2KIUA 1DEJA 2E19A 4LDWA 1WAJA 5IWAK 1MMSA 1BR4A 1WXUA 1TP4A 3G6ET 3M0PA 3VS0A 1T0JA 3MMVA 5BREA 3W2WA 4J6WA 3O9UA 5BPIA 1J53A 4QOZB 1JUMA 3O9QA 2O9SA 4KIFA 1B8IB 1A6IA 4FK2A 3TO9A 4P1WA 1IXDA 1SUQA 2YKNA 1VRUA 2P6SA 3GOXA 3HOYJ 2EQRA 2H6BA 4LFAK 1PU6A 3M1FA 2VG6A 3MZHA 4HCBA 3H6ZA 3NGPA 4CJRA 5EF6A 1ZBHA 3CD6I 3AGRA 2HHXA 1CZBA 3KYDB 2YV0X 1D3BA 4OFAA 1T7PA 2OFIA 3KIOA 4J2DA 2WB1A 2DT5A 3AAPA 4CZGA 4FT2A 1OVYA 1S9EA 3R8EA 2Q2RA 4RW7A 2HF3A 1HRHA 3ASOH 4PCQA 1Q82O 3VS7A 3QXEB 1XGNA 1L3UA 3K9JA 4FWNA 2MOXA 1VOMA 3ZMTA 2E20A 2D0OA 5EC7A 2R92J 2RI5A 4II3A 3I8DA 4IHYA 2QXLA 3MKYB 5BS6A 3H5NA 4F2RA 4LSNA 4A4EA 2BXYA 1PP8F 3HFNA 3IV5A 2P9PA 2HYGD 4O0IA 5DUKA 5KCOA 3M5AA 3CCUA 5GAGP 1YG2A 4MDXA 3CMAA 2VT3A 3L1AA 4LF5K 4BXFA 1FSHA 3KLGA 1B8IA 2DMQA 4UOBA 3HKZN 4E7SA 4BGBA 4CGGA 3AO4A 3BE3A 3SCXA 1KIKA 3L2WA 1AZEA 5CVJA 1WHUA 1KQSM 3KP6A 3H92A 2RK2A 3BUZB 4RW8A 3V1RA 4CFAA 4A4GA 3SWNB 1D3BB 4L9NA 4BS9A 1S6QA 3VQAA 3I3LA 2E2OA 3L4IA 4WXCA 3MEAA 4W5NA 4XK8E 1AHDP 4GGGA 2JJ9A 2GUIA 3EEQA 2XDVA 3VN5A 1XMAA 2QTXA 2VJ5A 4XQ3A 2V7ZA 4LG3A 1WSJA 1LWWA 4C92E 3TR8A 4J9GA 4FL6A 1RLQC 3K2AA 4J7IA 1N78A 3K9TA 1Z77A 2VOOA 3I5RA 2QGFB 4F16A 3IKVA 3VF4A 2RQWA 1BL0A 1N25A 1P90A 3FE1A 2A37A 1UTIA 2JGUA 3CWTA 2Z9OA 1KQSA 1T08B 1N9RA 3WXLA 3ZT4A 1BM9A 1N8RC 2P9PB 4AVZA 1UA0A 4M3TA 5GJWB 3T1AA 2A6AA 2CUEA 3DP7A 4CEEA 2YLBA 3HSTB 5AZJA 3DOKA 2H1LA 5D6EA 2YHAA 2X6YA 3R3LA 3TPQA 4BUGA 4C8QE 3NFCA 1W1FA 2LVMA 4BRGA 4TV7A 5CKDA 3ATVA 1ETWA 4CC4B 4A0ZA 2IS1A 3TSZA 4IUPA 3SMSA 4EM1A 4M7XA 5DM6F 2Y1IA 5HS7A 5LJ3e 3VA0A 4KHNA 1ASWA 3CCET 1YF5L 2YPRA 1NBEB 3ZX3A 1OU8A 3CMAI 3GG4A 5DM7F 4NYFA 4JKGB 2EFPA 4M7DF 2M1BA 1Z26A 1GFDA 3D5SC 5M1PA <