3OYHA

Crystal structure of the prototype foamy virus (pfv) intasome in complex with magnesium and the insti mk0536
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
368
structure length
368
Chain Sequence
LDAELDQLLQGHYIKGYPKQYTYFLEDGKVKVSRPEGVKIIPPQSDRQKIVLQAHNLAHTGREATLLKIANLYWWPNMRKDVVKQLGRCQQCLITNASNKASGPILRPDRPQKPFDKFFIDYIGPLPPSQGYLYVLVVVDGMTGFTWLYPTKAPSTSATVKSLNVLTSIAIPKVIHSDQGAAFTSSTFAEWAKERGIHLEFSTPYHPQSSGKVERKNSDIKRLLTKLLVGRPTKWYDLLPVVQLALNNTYSPVLKYTPHQLLFGIDSNTPFANQDTLDLTREEELSLLQEIRTSLYHPSTPPASSRSWSPVVGQLVQERVARPASLRPRWHKPSTVLKVLNPRTVVILDHLGNNRTVSIDNLKPTSHQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PFV integrase
publication title Molecular mechanisms of retroviral integrase inhibition and the evolution of viral resistance.
pubmed doi rcsb
source organism Human spumaretrovirus
molecule tags Recombination,viral protein/dna
total genus 106
structure length 368
sequence length 368
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2010-09-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
A PF17921 Integrase_H2C2 Integrase zinc binding domain
A PF18103 SH3_11 Retroviral integrase C-terminal SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2300 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3oyhA04
1.10.340.70 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Endonuclease III; domain 1 3oyhA01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3oyhA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3oyhA03
4FJHA 4IUTA 4CECA 4UQGA 4KTQA 4O0JA 2KFZA 4M3RA 1S1WA 1BIZA 3AA4A 4ELVA 2KTQA 3ZCMA 1FK9A 5J2QA 4E7KA 4CEZA 2XY7A 3OS0A 4Q5VA 2B4JA 3NH0A 4B9WA 4FM1A 3NH2A 4DFJA 1TAUA 4OKEA 2X78A 1VSDA 3OYDA 3DLBA 4FL6A 1HYSA 2VG7A 1CXQA 2RO0A 4ELTA 5SWMA 4CJTA 4CJ3A 5D6YA 3LANA 3QBYA 4EZ9A 1TK5A 4KKOA 3VQCA 2LCCA 5KRSA 3ZT3A 4RW8A 1D5AA 2F8SA 2ETJA 3KK1A 4DU1A 3KLFA 3ZT4A 5C0MA 5IAYA 2VG5A 3RMDA 4AILC 4PL6A 4J2EA 3QIIA 1TKTA 3LH0A 3F9KA 3AO5A 3QEWA 4FU6A 2P51A 2R58A 3LZIA 3TANA 1NK6A 1ITGA 5E41A 1RT3A 2HHXA 3H08A 4FK2A 2A1SA 5HRRA 2HVHA 2YRVA 3KLIA 4CHZA 2XDPA 4AHRA 5J2PA 4NS5A 1EXQA 3NGYA 5IN1A 2GBZA 4Z4CA 3AA3A 1RTDA 2Y1IA 4HCCA 1KTQA 1I39A 2B8AA 4B9LA 3T1AA 2FBTA 4A4GA 4DFMA 1Q9YA 4F2RA 4M3TA 1ZYQA 2XO7A 2WONA 3QNOA 3AVGA 3LPTA 2YKMA 1JLAA 3L42A 1IG9A 4KHWA 1KSPA 4CGFA 1VSFA 3HVTA 4Z0UA 1BCMA 3SJJA 4CJEA 3TABA 3AVNA 3ZSVA 1YTAA 4HTUA 3RTVA 1RILA 4B9SA 4BE1A 4OKJA 1JXBA 2B5JA 1X9WA 1CLQA 3CFOA 2Z1HA 5C6SA 2EQMA 5D3GA 2HHSA 3LAMA 1S1UA 4IUPA 4DLGA 3DB4A 4B8AB 4N41A 4FLWA 2XRIA 4CRIA 4B8CA 4FJIA 3LYIA 1Z26A 2HNZA 3RMCA 1NKCA 4IG3A 1N6QA 4CFDA 3IAYA 3U3YA 4DQSA 1L3TA 5KCOA 1K6YA 5DK5A 1BQMA 4DQIA 3DLHA 2IG0A 4E7LA 1QSLA 1BISA 3AVCA 1ZBHA 4QCLA 4CHNA 1GOCA 4M45A 2JGUA 2RJCA 2G8IA 1XWLA 4FW2A 4AH9A 1TKZA 2IDOA 2E6NA 1UA0A 3CG7A 4DSEA 1HYVA 1RNHA 2I5JA 3F73A 2RKIA 3NAEA 3P8HA 2EQKA 2JZ2A 3G10A 2HNYA 4H4OA 4AHSA 2QK9A 4BD3A 4AHTA 2LTOA 4CJUA 3F70A 4DSLA 4ID1A 1KVAA 3SYZA 1C0TA 2P5GA 1RBSA 3NNQA 4O0IA 4AHCA 5CY4A 3P1GA 2X6NA 1RI0A 4ZTJA 4X34A 4CF9A 2HVIA 4FYDA 3SQ2A 4I7FA 3V1OA 3M8RA 1SKWA 4E1MA 2IGIA 4KB1A 3WNGA 3QEXA 1HRHA 2ATQA 3HPGA 4R5PA 1OZ2A 3MECA 1U4BA 1S6QA 1H3ZA 1XHXA 3TWHA 4KHSA 5KGXA 1SKRA 4N76A 4Z4HA 4JLHA 3LP1A 2DFFA 3ULDA 4QAGA 3HO1A 3OYNA 2HW3A 2WACA 4CJPA 1U48A 3NGIA 1HQEA 1RDAA 1SL2A 4KHNA 3PUFA 3NHGA 2X4XA 3OVNA 5KRTA 1KRPA 4N4HA 1IKVA 3S6WA 2LVMA 2O4IA 2VWJA 3BDPA 1REVA 4KHQA 3HYFA 1C0UA 3RRGA 3NCIA 1LV5A 2RHUA 3K5NA 1HYZA 1VSIA 2YV0X 3OYJA 3RRHA 4O55A 1ZBFA 2ZQBA 2HHWA 1BI4A 5HBMA 2IAJA 1OYXA 5T7BA 3CEYA 2YNFA 4OJRA 4DTOA 3MEUA 4KO0A 4DTPA 1UA1A 3U6FA 1YT3A 2E6LA 5J39A 1TL3A 1XNIA 3AV9A 3KLGA 2OPQA 2B6AA 1VRTA 4PA1A 4FJKA 1ASUA 1C6VA 4RG8A 4C8MA 2RJEA 1WLJA 3RR7A 3TAPA 1YVUA 5SZTA 4RW6A 1NK5A 2QXFA 4LSNA 3O3FA 3VQ4A 2BGGA 4W5TA 2HHTA 3HP6A 1WSFA 1NOZA 3ASMA 4DS5A 4QW2A 4A4FA 5JS1A 4H4MA 3RWUA 5FDLA 4DMNA 4FW1A 1B92A 3AVJA 3PO4A 4L59A 4QQDA 3P8DA 2P1JA 3OYKA 1RDDA 4CERA 4FVMA 1EETA 3ZSQA 3PY8A 3O8VA 2HB5A 1X9MA 4CF8A 3M8PA 2F5KA 3OYMA 2FBVA 3DLRA 3VQAA 2OYQA 2O4GA 2PZSA 3O4NA 4M41A 3VA3A 1KVBA 4AHVA 2Z1JA 3V9XA 2YHAA 3VQ5A 1RBRA 3SNNA 1GOBA 4E7IA 3KD1E 4II1A 1C1AA 2WOMA 4FLVA 3MXJA 3UIQA 3HL8A 3M9QA 1SV5A 3KTQA 4Y1CA 1WNSA 3DLMA 3AVAA 1RBVA 4J2AA 2R57A 4LD0A 4FJGA 3MXIA 4CGDA 1KVCA 2QKKA 4CK1A 2QKBA 1FXXA 1RBUA 4IDKA 1R0AA 3ASKA 1S1XA 4YNQA 3ZT0A 4I9QA 3CFPA 3K59A 4EP5A 2G3RA 3MP1A 1C1CA 3OMCA 4WE1A 1BIUA 2DIGA 4BACA 3OQ5A 4CHPA 4NZGA 4CJRA 5KTQA 1NK4A 3SPYA 2QQRA 5M9OA 3PX0A 4B9VA 3KJVA 4CHQA 1IH7A 3O3GA 4CCHA 3CYMA 3MXMA 4IFVA 2VWKA 3DOLA 3VN5A 3MEVA 4C8OA 3LALA 1T05A 1J53A 1KFDA 5I3UA 1EKEA 1MU2A 4LD6A 2X74A 3NF6A 2LSNA 1G15A 2XHBA 2NLUA 1LWEA 3PV8A 2VYTA 4O4GA 3OYGA 2XK0A 4K8XA 1RDBA 3DOKA 1MHNA 3QJ6A 5D6WA 4DQPA 5C25A 5CIUA 3OYFA 2OPPA 3O3HA 2RPIA 1LW2A 4FJXA 1N5YA 3OYIA 3S9HA 1G5VA 2BUDA 3EY1A 1FKOA 2G8FA 2IOCA 4NYFA 1TGOA 3AVHA 5DMRA 1RTJA 4OLBA 2XY8A 4CFAA 3SQ4A 1LAVA 3L3UA 3MEWA 4W5NA 1OI1A 3SPZA 4CEQA 4I9LA 2Z1IA 3A2FA 1ZBUA 1A5WA 3SD4A 4FJJA 2E4LA 4F3TA 3OJSA 4MFBA 2D5RA 2DFHA 3LP0A 1LW0A 3TARA 4FM2A 1WGSA 1NK7A 3L2WA 4DTXA 2ZD1A 4OVLA 2HHVA 3DM2A 4C5HA 2X6SA 1OZ3A 1IKYA 3AVIA 1TL1A 2PY5A 2BKDN 3OJUA 3HM9A 4KB0A 1QHTA 2EHGA 2O4XA 2RI5A 4RW4A 3RMAA 3KIOA 1NOYA 3QLHA 2P5OA 4DS4A 3B6OA 4CJLA 4JS4A 1VSLA 3CM5A 3PMIA 5HROA 3V6DA 3FEOA 1U47A 1JLFA 1IKWA 3LZJA 2G8UA 1ASWA 4Q5WA 3L2VA 4G1QA 3ZT1A 3K5MA 3GOXA 2JLEA 1XHZA 4DLEA 1T03A 1I3AA 4B3OA 1WSEA 3QEIA 4PQUA 4DG1A 1SL0A 2FBYA 4CGJA 4B9TA 4CEDA 1TKXA 4HVJA 4CEFA 4FJMA 1Y97A 1O1WA 4O44A 1EP4A 3V1QA 4DWIA 3TAQA 3D45A 2D9TA 4BDZA 4BE0A 3DMJA 2E5QA 2JTFA 1RT6A 4C5GA 2HMIA 2D0BA 2YNIA 3MP6A 2F8TA 3AA2A 5C42A 3H8ZA 1L5UA 2Q3SA 2VG6A 3VQPA 3TR8A 4QQGA 3HSTB 1BL3A 1WAFA 3ZSYA 2YNHA 4N4GA 2DTUA 1KLMA 1VSKA 2RHXA 5J2MA 1KCFA 2HHQA 2G8VA 4OPKA 3U3GA 2RN2A 4B08A 4EP4A 1J54A 4JRQA 5HRNA 4M3XA 1JLBA 2IS3A 4FK0A 3UT1A 1T7PA 1XI1A 1SSFA 4C8KA 4IURA 2X4WA 2GFUA 2GFAA 2FHDA 4ID5A 4DU3A 1L3UA 3JSMA 3RR8A 3QEVA 3NBPA 2OZMA 2OZSA 4F3OA 2PQWA 1CZ9A 3PX6A 3VQDA 3DRPA 1S1TA 4I2PA 4CIFA 1L3SA 4FJ8A 1Q8IA 4CE9A 3OS1A 4BWJA 3LP2A 3QETA 1VRUA 4A4EA 2DFEA 1LWCA 3T3FA 1RTIA 4KPYA 1TK0A 4FXDA 3HT3A 4CK2A 1WSIA 4OKKA 1BGXT 2M1HA 3ZSZA 3AO4A 4KFBA 3TAMA 4IUVA 4UC4A 4E7JA 2BDPA 1WJRA 3E9GA 5HLFA 1RTHA 2DAQA 1HQUA 1TVRA 1NJZA 3PNWC 3SV3A 3FC3A 2YHBA 3AO3A 1QE1A 2RHZA 5HRPA 3D0PA 2PYJA 2K3YA 1T8EA 3HP9A 4IUQA 2X35A 3DLEA 4GMJB 4CJ5A 3NE6A 1IO2A 4HUGA 5CZ2A 2QQSA 4LY7A 1SUQA 3E9FA 4M3ZA 5D6XA 1LWFA 3C4SA 4C8NA 1EX4A 3BGRA 1QTMA 4CHOA 3UWNA 4KRFA 2EX3A 3META 3TI0A 1A5XA 1HNVA 3LLRA 2HHUA 4CF2A 4A4HA 5CYMA 1RCHA 3NDKA 1D9FA 2O4XB 2ITGA 3M8QA 3SQ1A 3PFSA 3SUOA 3OYEA 4Z4EA 4E89A 4CJFA 4KI4A 4Z4GA 3IS9A 4M3UA 4JS5A 3ZT2A 4CHYA 3FFIA 2RHIA 2P0KA 4F8RA 1NJYA 4DU4A 4BDYA 5J2NA 3SI6A 1NK9A 2RI3A 1HPZA 2OPSA 2RJFA 4CJVA 4Q0BA 1L3VA 4HCZA 2LRQA 3MEGA 3KK3A 3TAGA 4DTSA 5J1EA 4J2BA 2GF7A 2GV9A 4DTNA 4DF4A 5KE3A 3T19A 3S3MA 4J2DA 4IBNA 4KAZA 2KW4A 1DTTA 1RT7A 1VSMA 4H8KA 1QQCA 4JRPA 3OYHA 1WSGA 1DLOA 2G8KA 4NCBA 3NFAA 3MEAA 3QKJA 1WAJA 3QIPA 1F21A 3CQ8A 3S3NA 5CZ1A 2R5AA 4TSXA 4FJ9A 3OYCA 3LWMA 4FJ7A 3HK2A 1JKHA 4CFCA 4CJQA 4CF0A 3K2PA 1RT1A 3O4QA 4CESA 4GVMA 2M16A 3AVLA 1S9GA 4E0DA 1ZBIA 3NF9A 3VQ8A 1RT2A 3C95A 4PY5A 4HHTA 3L2UA 3MP8A 5KI6A 5EU7A 4FLZA 3AVMA 3SQ0A 5K14A 4HUFA 4PLLA 1NJWA 1WSHA 2DIQA 4FZXC 3OYBA 4MQ3A 4CJWA 2HQEA 3QINA 5KH6A 3V1RA 4DFPA 3VQ6A 2R7YA 4FLYA 4IG0A 4FCYA 1CXUA 1FKPA 3TAEA 3V9WA 3JYTA 4K8ZA 4LSLA 1N27A 3HVRA 3KLHA 3KKSA 1B9FA 3E01A 3ME9A 1D9DA 3BDLA 1NK8A 1JLEA 3QO9A 2BE2A 3V9ZA 4E1NA 1TAQA 1D8YA 1KFSA 2HNDA 1BI4B 4CJKA 3NGZA 3MAQA 1NKEA 1RT5A 3AVBA 3L2QA 3NF8A 3SUQA 1S6PA 4CK3A 4QQ6A 1UOCA 3PMTA 4CGGA 5CYQA 5KCHA 3KK2A 4Y1DA 1VK0A 3THVA 4DTRA 3L3VA 2EQUA 4BWMA 1JLQA 2X4YA 3QESA 4IFYA 2G8HA 4ZHRA 4O5BA 3HPHA 3H6ZA 2XY6A 3DB3A 3EYZA 4FLXA 2HQXA 3LPUA 4ZTFA 4CIGA 5FROA 1C1BA 4C5EA 4M42A 3DI6A 4AHUA 3PX4A 3OA6A 4E3SA 4NCAA 3ISNC 2MWPA 4CEEA 1SL1A 2CKKA 4GW6A 5HRSA 2KQ2A 2R5MA 1WJSA 4OGCA 1A5VA 3ZSWA 1X9SA 4CEBA 4PLIA 3FLGA 1LAWA 2XY5A 4F4KA 4BDPA 4DSKA 3AVFA 4DFKA 4DTUA 3VQ9A 4XIUA 1TV6A 3AO1A 1BHLA 3LWLA 4W5OA 3AVKA 3VQBA 2NUBA 2EQJA 2BANA 3ZSOA 1Z25A 3MEDA 4DSFA 3SUNA 2PYLA 3OB9A 1UAXA 3LGFA 3OYLA 1JL1A 2MWOA 3DRSA 2EFIA 4KREA 3KKRA 4L8RB 4Z02A 1UWBA 2M0OA 1ZBLA 1C0MA 3C6TA 3V81A 1CZBA 3DYAA 3LGLA 1S1VA 3KLEA 3IRXA 3TAFA 3QIOA 3S3OA 4BE2A 4KV8A 4M3YA 3NH1A 2BIVA 4N4IA 3NF7A 4DSIA 2F96A 3ITHA 2RHYA 2LDMA 2KFNA 3LP3A 3V9SA 4F2SA 4IKFA 3HJFA 4FZYA 1KHCA 1IKXA 1BCOA 2Y1JA 3P83D 1QSSA 1WJQA 4IUUA 3IG1A 3WNFA 4Z4IA 4QOZB 4B9NA 4N5SA 1VSJA 4C5IA 4GY5A 4PWDA 5KGWA 2L89A 2OPRA 1U49A 1X1PA 1NKBA 5FRNA 1VSHA 1J9AA 3SV4A 4Z4FA 3ZSRA 1JXEA 3HPOA 4OGEA 2D0CA 2RI2A 3NTHA 2ZE2A 1DTQA 1U45A 3ALYA 4FJNA 2DY4A 3SUPA 4OPJA 3AO2A 4B9XA 4YFUA 1RDCA 3L2RA 3VQEA 1SKSA 3L8BA 3MEEA 4B9UA 2RF2A 3HXMA 1HNIA 4CJSA 2YKNA 4OLAA 3SCXA 3OS2A 3QNNA 4LH5A 3QERA 1TKDA 1WN7A 2D0AA 1NJXA 4E19A 2RJDA 4FJLA 3VQQA 4N56A 3QEPA 3LX7A 4NYNA 4CEOA 4W5RA 5HP1A 1HMVA 4RW7A 1S5JA 3AA5X 1RBTA 3K5OA 3FDRA 1U04A 4CGHA 2G8WA 3DRRA 3C6UA 4FJ5A 2W42A 2L8DA 1W9HA 1TK8A 4QVZA 3SZ2A 3LAKA 5J26A 4DTJA 1JLGA 4HUEA 4FLUA 4OVAA 2KZZA 1S9EA 3KD5E 2EKOA 4CEAA 3RMBA 1VSEA 3K58A 1NK0A 2AJQA 4CFBA 3CFRA 3NTKA 1W0HA 3I0RA 1WSJA 3I8DA 3DLGA 4W5QA 4KTZA 1XC9A 2IC3A 1Q9XA 5KE2A 4E7HA 3LDSA 3PO5A 2FC0A 3NTIA 3EZ5A 3OYAA 5I42A 4NCGA 4CJ4A 1RT4A 4ICLA 4KHYA 4B9MA 3KUFA 3V9UA 4RG2A 4DTMA 1J5OA 4C8LA 1JL2A 3I0SA 5JS2A 2OA8A 3C94A 4EDUA 1QS4A 2YNGA 1YTUA 1B9DA 1JLCA 4HCBA 2E6MA 3MO8A 4DSJA 1BQNA 4FM0A 2Z1GA 3DLKA 3VQ7A 3OY9A 1ASVA 2GUIA 3Q1JA 3V4IA 1QSYA 4DQQA 4RW9A 3WNEA 5FRMA 4LH4A 4CF1A 4ELUA 3OMGA 3P5JA 1HJRA 3WNHA 3VA0A 4KTWA 4EZ6A 3ZEHA 2K3XA 4N47A 4CIEA 3ZSXA 3CM6A 3M8SA 1KLNA 4FZZA 4CGIA 3B6PA 4KI6A 4KHUA 5C24A 4DQRA 1GOAA 4FK4A 3K57A 4FLTA 4PUOA 2FBXA 3G0ZA 3K5LA 4DF8A 4M3WA 3EAEA 2A1RA 4I2QA 2KZMA 2L3RA
chains in the Genus database with same CATH superfamily
1DGKN 3F21A 4D0PA 3A5OC 4DBRA 3K0SA 3W6JB 4MMLA 1FIPA 4GY2B 1JCGA 4XRMA 2YUNA 4IUTA 4CECA 1VQNA 5M5YJ 4BY6B 1U2WA 1BIZA 4F55A 1N78A 2KTQA 3DEUA 3ZCMA 2A07F 4E6KG 2NVYJ 4G7ZF 2DTZA 3IWFA 2DOEA 3U23A 2B4JA 1VQLI 3PFIA 1VQOQ 1IZ6A 1GLNA 3EGXB 3JB9H 4L5JA 2WA0A 2R7UA 3FIFA 2E2NA 4DFJA 3IKVA 4JEPA 1TWCJ 2EILH 4CZZA 4OKEA 3M8FA 4KT6A 1AZGB 3DLBA 2XSDC 2KEAA 4FL6A 1HYSA 5KPZA 3QYEA 1WYXA 2WBNA 5JVTA 4RGSA 5L3GA 2YHXA 1I4K1 3I56T 1SD4A 2ZJPL 5SWMA 3BTIA 3AL0B 1Q82C 2BY3A 1VQ8I 2D4WA 4CJ3A 5D6YA 3FZMA 4I0BA 1NG6A 4CYDA 1HLVA 2NUTA 1TK5A 2P9LA 2XB5A 3VYGA 2IVMA 3HGGA 3KP2A 2WAQN 4G6TB 3HC7A 1QVTA 3ZMDA 4C92C 4YOQA 2K3PA 4XEIA 3KLFA 5C0MA 2STTA 2HKOA 3VJPA 5CQEA 1ZREA 3AAQA 3CCVT 2V6EA 4BGBA 2NOIA 5FGMA 2A28A 3VUBA 4HV6A 4S05A 1N9SA 2O9VA 4N9HA 2P51A 3DTIA 1TUYA 2R58A 4HT8A 2XU8A 5KN8A 1NK6A 4EVVA 3CJRB 1PDNC 1RT3A 3HTSB 3H08A 1VQPA 3GTLJ 2YRVA 4ESFA 1UHMA 2ED1A 2PUOB 2GBZA 1XMQK 3N4MA 3AA3A 1RAEB 4KH6A 4G7OF 3FE1A 1MBKA 1O3TA 1RTDA 2Y1IA 4Q5SF 2K40A 1N9RA 1PVEA 2GBQA 2JRTA 5AZJB 4J9EA 4B9LA 2E1OA 3KEOA 3EG2A 3HOYJ 4DFMA 4K42A 2VKNA 2DMUA 4M3TA 3VETA 1ULYA 2XO7A 1FYNA 3HSEA 4PHTX 1HKSA 3LPTA 1U0JA 4EW4A 2DEQA 2R93J 1SKUB 4MZTA 1IG9A 4KHWA 2R7TA 4CGFA 1Q18A 3HVTA 1NJIO 2VBZA 2PAVA 4XIDA 3DTKA 4GV3A 1RAHB 4BRAA 5FKLA 4CJEA 3CMAN 3M0QA 3AVNA 1YTAA 1AWWA 5I11A 5FLXZ 2EV5A 4HWIA 2HEQA 5EZHA 3KWGA 2ACJA 1ZSZA 5K7FA 2RPNA 2XPVA 2IBDA 3CFOA 5FU7B 5KYXB 1T39A 4FWOA 5D3GA 3O1BA 4H5RA 2NYXA 4I0AA 1VQOI 3CW7A 1XDSA 2M51A 4M7AD 4DLGA 3MJXA 4N41A 4KULA 3P31A 1YTYA 2ZJQL 1MMGA 1M1KC 4FLWA 4FTHA 3AG1H 4NBQA 4CRIA 4FJIA 5FWCA 2EVRA 1ZGAA 2HNZA 4K25A 1SFEA 3LCNA 2HVSA 3TO9A 2QDYB 3D2EA 3I5SA 3VPRA 1Y71A 5GAHP 1L3TA 1E0EA 4LGWA 5GAN3 4X9CA 2UXDK 3NQOA 1RACB 1WBBA 1K6YA 3A8OB 2M4KA 4G7HF 4DQIA 4XH4A 2D8JA 2ME6A 2ME0A 2A5YB 1QSLA 5LEJA 2QEXT 3ECOA 3AVCA 2JUGA 4A54A 1YLFA 4FW2A 1QU3A 3JCMf 1UA0A 3CCMQ 2IDOA 5F0XA 4YELA 4DSEA 2OQRA 1ZBXA 3M6GA 1R23A 1GBRA 1JBMA 3P8HA 3CDIA 2EQKA 1LWWA 4BJ6C 4OU0A 1H8AC 2LX7A 1Q86C 2FMYA 3C2HA 1WJDA 4YORA 2HZYA 2GBYA 4DBFA 4RDUA 1WGXA 1P59A 5AT1B 2VI6A 1YS7A 4ENMA 2H27A 4B1UB 2PJPA 1MD0A 5GAN8 3K4BA 4BHPA 4GVEA 2EPFA 2KDSA 1SFXA 3ULEA 2P5GA 3UKRB 3ZL7C 2YG9A 3NNQA 4F14A 1ONVA 2IGKA 4C0ZA 1TUCA 3CXCM 4AHCA 4BRMA 2WV0A 2HS5A 4JJDA 2X6NA 1E6HA 3CCUA 2CUJA 1ZSZC 1T56A 2EBPA 2HVIA 4LJZF 4PGGA 4ZGJB 4IO8A 5C2DA 3GUDA 1HX1A 2PI0A 2KISA 3THKA 2O03A 2OTJQ 3F23A 2QWOA 5FWBA 3ZQFA 1OZ2A 3MECA 3GTKJ 1U4BA 3HFOA 2M0MA 2N8GA 4DW6A 2DODA 1SF9A 3TWHA 1LFPA 1SKRA 3R4KA 2KYBA 3LP1A 1EBMA 2DFFA 3FMSA 2KJBA 1W2BA 2HW3A 3EUKL 3LSTA 1ZLMA 3JCMg 1U48A 4JKHA 2MC4A 2X4JA 2X4XA 2Q31A 2K9SA 3WE2A 5KRTA 2ASMA 5B1AH 5LBQA 5CVRA 1J0RA 3HTVA 3S6WA 2V1RA 2LVMA 3TBIA 3H35A 3TSWA 4CC7A 4KHQA 1IV6A 2VE8A 5CPRB 3NCIA 2RHUA 3K5NA 5CLSA 2YV0X 2OUMA 1YQMA 1OU9A 4ORZA 2ZQBA 5HBMA 1IBKK 3CF5F 2E5ZA 1EA3A 3CEYA 1R1UA 1V55H 1JKOC 4X64K 4DTOA 2PFUA 4G9ZA 1PSFA 3VS2A 4KO0A 4E9FA 4M7AB 2JTEA 3U6FA 3AG4H 5JLFA 3F72A 4EA5A 4PKCC 2B6AA 1W36C 3GZ6A 2JN6A 3G4SA 3H45C 3CCSN 4YFNF 1R36A 1VRTA 4PA1A 2XF6A 4RG8A 3TSZA 1Q81C 2QKMB 2RJEA 4OFHA 3LSPA 1XGMA 3JCMV 3RR7A 1ZLKA 3TAPA 1YJNA 3CCMI 4RW6A 1NPRA 3EUHA 2QXFA 3VYUB 3IUCA 1KQ8A 2HHTA 3EL2A 3MMVA 4FSXA 1QPIA 4CC4B 3OL3A 2DYBA 3W2VA 5LJ5e 4LDUA 3CD6T 3O1WA 4QW2A 4A4FA 1USSA 4U87A 5D7UA 1OH7A 3VODA 2V79A 4FW1A 3AVJA 1Y8QB 4L59A 3VERA 1WIEA 3A8GB 2AP1A 2BHYA 4QQDA 2B63J 1RI9A 1BJZA 1MDMA 2P1JA 4CERA 1HSTA 2O6GE 4XTUA 4GYIA 4DQ2A 2HB5A 3J7AP 5IYBJ 2XPWA 4EEFG 2AKKA 2FBVA 3MKZA 4LFUA 3DLRA 4H5WA 5L3CA 1U5TA 4JI5K 5HVQC 2PZSA 3KEYA 1A6QA 3NHNA 3R61A 1AEYA 2P7CB 4DOVA 1SAXA 3VOVA 1IN7A 2AQEA 2Z1JA 2YHAA 2VQGA 1SD6A 3R6SA 1A0NB 4LD9K 1AKHA 1P92A 1BI1A 3SNNA 4KUIA 1GOBA 3H5RA 3DXJF 4L5IA 1C1AA 2O8FB 1FTTA 2BW3A 2NOBA 3OWTA 1ZQ1A 2OTJI 2A69F 3VS4A 3M9QA 1SV5A 1QHHD 3AVAA 3ZETA 2I5UA 3TVTA 4LE9A 4AYBN 4FT2A 2R57A 4RAZA 4GBQA 2HOTA 4CI6A 1C6VX 4CGDA 3L2CA 4JI6K 3UE5A 2A7YA 3PJRA 2K6DA 2MCNA 3VV0A 5LJ3h 2KROA 1VTNC 2AO9A 1NK2P 1RGIA 4XRFA 4WQ4A 3NMZC 1GT0C 4FWLA 1YX3A 3K59A 4II2A 4EP5A 4OMLA 1YVNA 1VQ6A 1C1CA 5A2QZ 1UZCA 3P9KA 4C2MJ 3JB9J 3BG5A 2DA9A 2UUZA 2D2WA 1VQ4I 2DMOA 3EFOA 2DIGA 4BRLA 4CHPA 1VQ9T 1K8AO 4NZGA 1QW1A 3FM5A 2QVOA 1SVLA 3DLLL 2CV2A 3EUHC 3SPYA 3UA7A 4FX4A 2QQRA 1M2OA 3B6AA 1I3QJ 4IJAA 3C12A 1BI0A 5CYVA 1RR8C 4CHQA 1XB4A 1IH7A 2GWJA 3EUAA 3CYMA 2Z0WA 2VWKA 4M63C 1APLC 1MBEA 3CDHA 3FBIB 2PJRB 4F7UG 5GP9A 1TP4A 1KFDA 5I3UA 3GFIA 2X74A 3NF6A 2LSNA 2XHBA 2HOEA 2NLUA 1MSEC 3CMAQ 4B4CA 1W4MA 4AFUC 4JI2K 1U5TC 3GTOJ 3DOKA 2K27A 3M1FA 2C06A 1P2FA 5CIUA 1WEGA 1LW2A 2CP0A 1V3FA 1HC8A 1G8XA 4KUDK 4D7NA 5KYUB 4NYFA 4G9YA 5C4XJ 1ON2A 4J6XA 2QWNA 2HQAA 1LOTB 3EN9A 2XY8A 3LL3A 1VQNN 1ZK8A 2BHZA 3OSFA 1W0UA 1LAVA 3L3UA 2DW4A 4F93B 1BG3A 1DP3A 3IV5A 2R7WA 3RQ4A 1YW8A 2R0QC 2ELKA 2EYQA 4MDBA 3MEWA 1TLHB 2LCLA 1HPMA 4I9LA 3CUQA 4B3AA 3SD4A 4BY9C 4MFBA 2DFHA 4MDAA 1OPKA 1LW0A 4WQ4C 3I59A 2HBMA 3KHYA 1WGSA 1NK7A 3KE2A 5GAOp 1BC7C 1UHCA 1USTA 4NB5A 3SYTA 5GANf 2ECZA 2KKOA 5FLMJ 4OVLA 4Z94A 1YXQA 2HPIA 4N0AA 1N8RO 4O5FA 4C5HA 4BREA 3T69A 3AVIA 3W0LA 2PY5A 2VGNA 1G83A 2BKDN 3QSUA 2LYCA 1BUPA 1J6ZA 1TG0A 5IT9O 4HF2A 3G2BA 3QLHA 2P4RA 4DS4A 3B6OA 5TKYA 4CJLA 5D5XB 1ILYA 2D1VA 2RKHA 1TXQA 4RLFA 1VA7A 3CM5A 2K4YA 3A0IX 3I9V2 2B0LA 4A3DJ 4M78D 2UUBK 4AIHA 3CXCS 4HVVA 2MW8A 5ELZA 5F1JA 1MWMA 2K5LA 5CVJA 2ZMEA 1FBSA 1UG2A 3LZJA 4R1HA 1K9MC 4MEYF 4F91B 1U3EM 3GOXA 4PNOA 3BEXA 2VQHA 2L9VA 4XL9A 1NJIU 2CQNA 2K9LA 3QEIA 1QZZA 1J5YA 2MFZA 1T8IA 2NLXA 1SL0A 2FBYA 2KHOA 3H0IA 3R1XA 5EG0A 1HNZK 3E19A 1VQPN 4HVJA 1FP1D 4L9VA 1QQIA 3A0HC 1QZ5A 2O3FA 4O44A 2X9HA 2WUSA 3OW2M 3H1VX 1MDUB 1TQPA 4C1NK 5K7ZA 4DBQA 2W03A 1PKSA 5GANg 5CAIA 3SMSA 4FYYB 3I55T 4DR1K 1V5FA 2YDLA 2DRKA 2YNIA 3JR9A 3MP6A 1YCSB 3K4MA 4O5VA 4S0HB 3WXJA 3CMAI 3CUQC 1YIJQ 4J9HA 1RLQC 2VPRA 3WT0A 3QYHB 3QDKA 1B1BA 1KYZA 3HSTB 2XGXA 2MI6A 1MZBA 4MZMA 5B66C 3EGXA 3TU4K 3ZSYA 2BZ8A 5AJ3K 1LOJA 2FNAA 1VSKA 3GXOA 4GRIA 5DLOA 1YO5C 1T3SA 3KTUA 4N0AC 3FXMA 2VWBA 2Y9ZA 4M3XA 4FK0A 3KLOA 3UT1A 3JTGA 1QCNA 1HKGA 1X27A 2L3PA 3CC2T 3Q7BA 4E9EA 4B43A 3HOSA 1B72B 3KP5A 2JQ7A 2K4BA 3RR8A 3E1SA 4N4OB 4XQ3A 2Q8KA 4JK1X 4D8KA 4IJNA 3DRPA 2HU9A 3CC4A 2CW0F 2FEZA 3CQTA 2O9SA 4JLGA 4U88A 4J00A 5AQZA 2V8KA 3LDNA 4HRIA 1HNXK 3OS1A 4BWJA 3MN2A 3QETA 1Z3XA 1NTCA 3RYPA 1GCQA 1FT9A 2ZMEC 1TK0A 2PNIA 2XKPA 3DXKB 1EWRA 4PIIA 4H5VA 2P7VB 3AO4A 4LN2A 1OQYA 1ENHA 4E7JA 3VTHA 2BDPA 1LNWA 3ZBDA 1MW7A 4BR0A 2E2PA 1YJ9A 3I0WA 2H3GX 5JHFA 3WQTA 3FC3A 1ZXOA 4QIWN 3AGRA 3MEXA 2LF8A 2CGJA 2D6FA 1EF4A 5HRPA 2JHNA 3CJ1A 3D0PA 3L00A 2PMZN 2HFHA 4HX4A 2ELJA 2DAOA 3VEZA 2JS2A 2X35A 2ZJPF 2A0FB 4IFEA 1QPMA 3DLEA 1WHUA 1WI9A 5D5WB 4Y17A 3ZQLA 4BY6C 5GAOn 2EIJH 2XKOC 2CT3A 2MH2A 4CZCA 2JT4A 4K43A 2Y48A 5AZJA 4ZYGA 2GNCA 2CP3A 4IL6C 2QQ9A 2EYXA 4BUGA 3N5BB 1LCKA 2R7OA 4M78B 3BGRA 2VC0A 4A3KJ 4IZZA 1MPGA 3C18A 1FW6A 4IIOA 2EX3A 3META 5EOYA 3BE3A 1A5XA 3LLRA 4OFAA 2DA3A 2FQ3A 1RL2A 5CYMA 3RCOA 4BHCA 4XLHA 5LHIA 1D9FA 4R8HA 3I0XA 2XGCA 2O4XB 3M8QA 3VGKA 3CCUN 3SQ1A 4GV6A 4RM2A 2L2OA 3DPTA 2XDDA 1UE9A 3AL0C 2NRWA 4B22A 5CVUA 2HMAA 4B6MA 3ZT2A 1YIJI 1GBQA 1Z21A 2QKLB 4FX0A 2P0KA 5AZIB 4F8RA 3V8JA 5KYXA 4X6AJ 4UXNA 3EO3A 4BVPA 1NJYA 2IS6A 3S6IA 1NK9A 1ZKGA 4AD9A 1HSJA 4PJOB 3FHGA 4M77F 3OOPA 3BZCA 3JCMh 3JREA 2QTXA 2JA6J 5J1EA 4M3BA 1DKGD 1GCQC 3J7ZO 2QQAA 2GV9A 4DTNA 5BRFA 1R58A 4DF4A 1JTYA 3GWZA 5GMKe 3T19A 3S3MA 1GLLO 1NJIC 1ATNA 2FA5A 1SPKA 3WGIA 4WTOB 1FOKA 1Q95G 3R9PA 4FASD 2DK3A 1K4SA 3A5ZB 1S5LC 1VSMA 2XF7A 1T0JA 2J06A 1H9GA 1ZHIA 2DTIA 4TVRA 3REOA 1YWPA 1Z1DA 2G8KA 1RUWA 1XMKA 2R7ZJ 2PTKA 4M7DF 3T8RA 3MEAA 4EJZA 3QKJA 2XSJC 5DD4A 1FBQA 3QFUA 4FSVA 3QIPA 1YN8A 5AQWA 1F21A 2BXZA 3IMXA 3S3NA 2R5AA 1W5SA 4FJ9A 1XNQK 5BREA 2IT0A 2LP5A 1T6DA 2HYGD 1JKHA 4CFCA 1UHWA 2KLOA 4CJQA 4W97A 4X1VA 3WTYC 1RT1A 1VQMA 3G4SN 3S1RJ 1UHFA 3MX5A 1E17A 1IJJA 2DA6A 4A5BA 3VSKA 3H0GJ 3E66A 1S9GA 1M1FA 4E0DA 3CCEA 1TSFA 3UKRA 1BJAA 3IWZA 4HHTA 1YJNN 5EEHA 2LREA 5LGUA 3HBTA 1TS9A 5LJ3d 5E79C 2BBYA 1WJAA 2A36A 2AZSA 3AVMA 4YG2F 3SQ0A 1WI3A 4BVOA 4HW0A 4HUFA 3C2BA 4PLLA 3RR6A 5FU7C 2VT2A 3LM2A 3OYBA 3GDQA 4BL0B 4CZKA 4CJWA 3QINA 2Y69H 1ZG3A 3HRMA 3V1RA 3CP8A 1M1GA 1OX9A 5BMZA 2NRVA 2VIXA 1VQ5N 2IVOA 3WTTC 3RKXA 2W10A 2NNWA 5CQYA 2R7YA 2A6TA 4FLYA 4MO5A 4F7ZA 1B6AA 1KU7A 2DK5A 2DVEA 3JYTA 3L1PA 2OI3A 6PAXA 1YJWA 2F9TA 4IWVA 4IOAL 4BAYA 3N4PA 3KLHA 1VQ7N 1TNTA 1UAAA 1IXRC 5DM7F 1R1VA 1KG1A 2BE2A 4V19S 4E1NA 1K8AU 3DEEA 1YHQA 4ELZC 2KKZA 3L2QA 1TWAJ 1YQLA 2HR3A 3M4YA 5JICA 4QQ6A 2XF5A 4CCJA 1BBYA 4OMYA 4NHJA 1FJGK 3THVA 4DTRA 4F17A 3L3VA 3JRFA 1KD1C 3HOXJ 2G8HA 4ZDPA 3IP4B 3HPHA 3H6ZA 4TV7A 2RNGA 1R22A 4CIGA 3OW2S 5E1XA 4AM7A 1VQ6N 1BIBA 4M7AA 1BA0A 3QUIA 3PX4A 3AAPA 1D5YA 1BBZA 1VQPQ 3CCUT 5HCKA 1ZH5A 2MWPA 2BXYA 3UR3C 3CO6C 2NOZA 5CE3A 2HQNA 2R7XA 4M73A 3RIRA 1I5ZA 4BQNA 2QGFB 3SJHA 1A5VA 5C3EJ 1ETOA 2HI3A 3PVLA 5L8RE 2ZXWH 4CEBA 3CESA 2BV6A 4XOPA 3FM3A 1GV2A 4F4KA 4BDPA 5C15A 3AVFA 2IAIA 3KX2A 1KIKA 2DO7A 1NG2A 1ZA2B 4DGWB 3WTUC 3CCLN 2F4VK 2CYZB 1BHLA 2QAZA 3AVKA 4JKDA 2LP0A 1X3WB 1J7KA 5GMKl 2NUBA 2EQJA 4HX7A 2VBXA 3SUNA 3G6EA 1UAXA 4EATA 4OB3B 1Z67A 3MCZA 4A62A 3LNQA 4KFCA 3MVPA 1JL1A 2ZFWA 4A5MA 2QQBA 2EFIA 1D8JA 3CLQA 3MN7A 4L8RB 2KSSA 3CJQB 5D5UB 1X6BA 4Z02A 3O5ZA 4BRDA 1JUPA 2Y2ZA 5F08A 3DYAA 2EFNA 2Y0MA 3W3DA 3TAFA 2DZ9A 1WXUA 3S3OA 4KISA 1N8RU 4QWQA 1GLEG 4CBWA 1BC8C 1QWEA 2BIVA 3PNYA 4DIQA 4N4IA 3GO5A 2RK1A 3NF7A 1V4SA 3ITHA 4F7UE 2RD1A 2RHYA 2V8IA 4KIGA 3ENBA 4JD2B 2VJ5A 4A2UA 3H9NA 2ZPBB 3A03A 2O8FA 4XTXA 3HJFA 2W6LA 3R3LA 1BCOA 2XAQA 2R7QA 3IAS2 2RQRA 2XI9A 3P83D 3QDFA 2W48A 5ICFA 1A5JA 4IUUA 3IG1A 4Z4IA 4XH1A 3G1JA 4QOZB 2AK5A 4PWDA 1ZBSA 5KGWA 2HMPA 2E36A 1SQKA 1J9AA 4RGXA 4A93J 1QNTA 2YXYA 4Z4FA 1PKTA 1KA8A 4M7AC 1IRFA 1YJNT 1GRIA 2KXDA 2DKGA 1LCUA 1KQSP 1X1CA 4E7ZA 1TW2A 5K1YA 1VQLA 2YSQA 1SKSA 5ECAA 2ZFUA 2RF2A 3HXMA 1HNIA 4XTZA 2ECBA 2YKNA 5GTIC 2A68F 2CP5A 1R4NB 2KT8A 2WTUA 4LH5A 4RA2A 1NG7A 2G9WA 2RJDA 1M90C 4FJLA 4BGAA 1OQKA 2Q0OA 3LX7A 4J8FA 4CBXA 4NXNK 2BH1A 1VQ8A 5IPAA 4JZ3A 1HMVA 2PJRA 4HV5A 2Z1DA 4H0PA 1KG3A 1RBTA 2DXIA 3FDRA 4FE7A 2W82A 2QWQA 2W42A 2FPEA 2M4GA 2X1DA 4XKWA 4QSHA 2DL5A 1T6CA 1TK8A 3NRVA 4J7IA 2K5CA 1GFCA 5J26A 5E1ZB 3GP8A 3M53A 3JAMK 4V19K 1S9EA 1S72T 4B24A 1PCXA 4CEAA 4Y3OA 5E1WA 5IYCJ 1SG5A 2M45A 3Q0UA 4LF8K 2YWWA 5GANh 4AIDA 1QA6A 5KYUA 3A8MB 4C9YA 3S1NJ 3O6BB 2DL7A 1JKRC 2WFBA 3WUHA 3RJPA 4W5QA 3DLLF 1FSHA 4KYWA 3R8EA 1MIJA 2OA4A 4OINF 4B48A 3VS1A 1XSXA 1BOAA 4RGRA 3LSMA 1W2BP 5E3OA 1JUMA 1XSDA 2A37A 5F2RA 4C2UA 3EZ5A 2VGMA 2UUCK 5D4RA 1RT4A 4ICLA 4B9MA 3WODF 1Y0NA 3KUFA 5LHGA 5GIOA 2QYOA 2YUQA 3FK6A 4JX5A 3V9UA 1DPUA 1MMNA 2P4WA 2X9DA 4C8LA 2JG6A 1RKTA 2FG0A 3JRAA 4BI3A 2E2JJ 1IREB 4WX9A 4EDUA 2KRCA 1FYLA 1UGRB 1A31A 5BPDA 3L6QA 4LIUA 2ADUA 4NUBA 4NNJA 4UVAA 1BQNA 2AS5F 5KK1A 2HXIA 3DLKA 3I5RA 4A5AA 1TWFJ 3SWNB 3Q1JA 4MZPA 4RGUA 3TPQA 4DQQA 2IVWA 2YHWA 1V1CA 4RW9A 1OCZH 4NC7A 4L9TA 4CF1A 3CC4N 3OMGA 1PYVA 1V4TA 3G4SQ 5D6FA 3WNHA 4KTWA 2A6HF 4BQQA 4EZ6A 3IC7A 2K3XA 4CIEA 3QWXX 1MBGA 4RM3A 3JB9F 2P9SB 3CM6A 3M8SA 4FZZA 3X26B 2WB1A 1XG1A 2XAFA 2DT5A 1GOAA 2E70A 2DXUA 5DM6L 4PUOA 3TKYA 1KQ2A 1VQOA 1H92A 4HSTA 3K5LA 3G1LA 1QP2A 2DD5A 4LF9K 2MLKA 2JA5J 2E12A 4DV3K 1H89C 2E10A 2UZKA 4QVDA 3OH6A 1OISA 4FJHA 3HOTA 4KICA 1G59A 2HQ5A 5BRDA 3LDQA 2HTJA 1BKBA 4G94A 4O0JA 2KFZA 2VOOA 4XK4A 1S1WA 2L7MP 1STZA 3JCMd 5GAGJ 4DR3K 2RDPA 1VQ5Q 2LDUA 5J8CA 2HAXA 2XY7A 3OS0A 2EH3A 1TT5B 2DJZA 3U8XA 4Q5VA 3PL8A 4HSRA 2XC7A 1NPPA 5BS6A 2QA4N 5E84A 4B9WA 4B3SK 5CVIA 4RMNA 5IHIA 4FM1A 4PFOA 4LF7K 3Q9SA 5H2FC 1X2QA 1VQ7Q 4O8KA 2BVLA 3KXTA 2O8CB 2W41A 3IH3A 1TAUA 3K4CA 1NK3P 4J7FA 4CCNA 5LGNA 2VG7A 1WI7A 2RO0A 3WTXC 4XLAA 1WHJA 4OO1J 1OYIA 1QVGM 2DPPB 3M56A 1M5Q1 1HW1A 2OV7A 3Q0VA 3BP8A 1LJOA 4EZ9A 1F43A 1O7FA 5KYNA 4PKIA 3VQCA 2DF6A 2OAUA 1D5AA 2F8SA 2EZIA 1G3TA 5KPRA 3KK1A 3ASOH 4CI0C 5AQPA 4L18B 4H0EA 4XH5A 1B72A 2QWPA 2NRHA 4JLIA 2V4JC 1Y96B 1VQ6Q 1HYOA 1W1FA 3C6AA 2IRFG 1WKMA 5LJ3e 1TKTA 4A57A 1WSUA 5FPDA 4JQFA 1QVFM 5JI6A 2QTVA 4HXJA 3IKMA 5ICEA 2VJ4A 2QEXI 1Y0UA 5AN4A 2MC3A 2PU9B 1F9NA 1RI7A 3VEYA 2F9WA 3W3CA 2PLYA 1ITGA 1A04A 2L3QA 2M9UA 3DXKA 2EJ9A 3FKIJ 4EJWA 2RK2A 2A1SA 3CD6Q 3CCLQ 2XDPA 3BR2A 1W6XA 2EFOA 5J2PA 4CYCB 5IN1A 4Z4CA 5J40A 4RLQA 1WQ2A 2GEMA 3WU1B 3RI4A 3E6DA 4XORA 1IGNA 1I39A 1ZN2A 2B8AA 1LWVA 2EW3A 2DCEA 2FBTA 3EDPA 4A4GA 1Q9YA 4F2RA 2LQWA 5EXWA 5LJVA 4PSWA 3QNOA 3AVGA 4ZN3A 1Q7YC 1P9QC 3H92A 2YKMA 3W6VA 3PSFA 1JLAA 1NGBA 4NC6A 4MFDA 2YJFA 1VUBA 3EGDB 2YUPA 3L42A 3SFMA 4J01A 3EG0A 1VQMN 2R7RA 1RAAB 1VSFA 1XGOA 4Z0UA 1BCMA 2JPSA 4M78A 2EGAA 3F8FA 4M75E 2CV1A 3EE8A 2NXNB 3CCEN 3WHCA 3GPLA 1BW5A 4EVIA 2K79A 4BE1A 2M5WA 4I76A 3JCMX 2DT7B 1ZC6A 2B5JA 3OMYA 5EEGA 5E20A 3DKYA 1VQ5I 2Z1HA 2EQMA 1I0CA 3ZN0A 3CVSA 2ESNA 3F0CA 2QG9B 2MF2A 4A4KA 1E3HA 1XMAA 1C0GA 1PWTA 2E4HA 4IHYA 1X3NA 2Q0UA 2MLGA 3DB4A 4B8AB 4KT5C 5CR2A 2M1BA 1VQ7I 3ZCOA 1MNMC 4CJ7A 4B8CA 2E8AA 5AZIA 3F8NA 1GXQA 3LYIA 3DPUA 4A3JJ 5M3FJ 3RMCA 1NKCA 1WPYA 2E6ZA 1ZARA 1PP7U 2VXFA 1G2HA 5FLXK 4PJOA 3WQUA 3A01B 1YJ9T 1I07A 4ILGB 3U3YA 1YJWN 4ZGEB 1ORPA 1ETXA 3CJNA 3VF4A 2DA2A 5J4YA 1T2KA 4P9UA 1BQMA 4IZ9A 2X1EA 2EJFA 3PT9A 3F8BA 3O9SA 3LDOA 1W2BM 3GFLA 3RDIA 4ZGDB 1ZBHA 4CHNA 1GOCA 3OSGA 1TKZA 1VQ6I 4HBLA 2E7WA 2R4GA 1NGJA 3JRDA 3EEQA 2HNYA 4H4OA 1IO6A 4BD3A 3JCMb 2VN2A 3VEXA 2BTTA 4H0YB 3ZMVA 2EINH 4CJUA 3F70A 3MMYB 4DSLA 1JJ6C 4QS9A 4ID1A 2ZC2A 2OTJA 2ROLA 5DUIA 1WUAA 2AXLA 1EH7A 5EJCA 1NHAA 1PVSA 1C0TA 3PNVA 4OF1A 3CD6I 3CCLI 4M78C 1UB4A 4XU3A 4CCOA 2MSYA 3CPWP 4DB3A 3P1GA 1WLPB 4FWMA 5GAN6 1J75A 1RI0A 4ZTJA 4X34A 4CF9A 1P7JA 3IHOA 4CCLA 1ZBJA 1X6OA 3ZPLA 2IPOB 1AOJA 4B8XA 2W04A 3MFKA 2NUPB 4I7FA 1YFHA 5GAEJ 2HKXA 2DA7A 3LSGA 2J6OA 1HRHA 1YX5A 3M58A 1LUJB 1LVKA 3HPGA 2AKLA 4R5PA 1VQ4A 4A2AA 3PSIA 3ZFJA 4J5YA 5GPAA 1S6QA 3G6EN 2ZXJA 4KHSA 5BPLA 4AI5A 1V29B 3S32A 3D0SA 4JLHA 2JM9A 2ZZDA 3G25A 2JWLA 4U0VA 2E1MB 1YNZA 1YITN 2CJJA 3OYNA 1N77A 2WACA 1BO5O 4PJOC 1ZELA 1RDAA 1K73R 1G3WA 2ZWHA 4XBFA 3AG3H 1UG0A 3H9QA 1KRPA 4N4HA 1Q82R 1DPRA 1YI2T 4D9JA 2KHMA 2JW4A 1NLPC 2BYVE 3I64A 1X1DA 5BNGA 1WB9A 2ZO4A 3BDPA 4WF9L 3RRGA 2HBPA 1K61A 3RRHA 3GTJJ 3VYTB 2OPTA 4LLGF 4PJOF 2P5LC 1JXOA 5T7BA 5D4SA 4WXDA 4BNCA 3LW5E 3W2WA 3H5AA 4E4HA 4UVCA 4JI4K 3I33A 3A8LB 1VQMT 2ZPHB 1QLYA 3H0HA 3BDDA 3IFRA 2DA5A 3ZX3A 2E6LA 4XLEA 4FOIA 4LITA 1HK9A 2P0WA 3KVGA 3REBB 3WTZA 3RESA 4OB2B 2ED0A 5CKTA 1DJ7B 1VOMA 5L3DA 1C6VA 4C8MA 3KP3A 4F52A 2CGHA 5AQLA 5GANd 5CKDA 4ZN1A 5M1PA 2ZGZA 3KLNA 1U8BA 3DKXA 4PKGA 1VQLN 4LB5A 3BC8A 2BGGA 4EQQA 5EDNA 2OQGA 4C8QB 3CCRT 5KPTA 4DS5A 4C0GA 5IWAK 1FBUA 5A0GA 1B9MA 1XQSC 2EB7A 5AQUA 2WAQA 2VLAA 1B92A 2QA4Q 3S16J 2M34A 4CZMA 1U84A 9ANTA 3OYKA 4UHTA 1XGSA 4FVMA 5TJJA 3ZSQA 2A40A 3O8VA 1YJWT 1ETVA 2F5VA 2NOJB 3FHNA 2L0AA 3OYMA 3HYIA 2O2OA 5AQRA 3VQAA 2F1LA 2OYQA 4Y0WA 4HVUA 5LJ5j 1ETKA 3O4NA 2V1XA 3S14J 3JSCA 3PIOF 1HKTA 1YHQT 2FOKA 4IXAA 1E4FT 1RBRA 4E7IA 2JOYA 5AQIA 3KD1E 5FPNA 4FLVA 4AI4A 3MXJA 3UIQA 1G3YA 3BLYA 4OMQA 1X1AA 3FXUA 3KTQA 2VUBA 5IP9J 1RBVA 1EH8A 1O13A 2NNNA 4LD0A 2NOGA 3MXIA 2YI1A 3VS3A 3L7WA 2TCTA 4JD2A 2XDBA 4CK1A 4EHUA 1M1KR 2EGCA 1FXXA 2JJ7A 3RERA 1EWQA 2V9PA 4CVNE 4IRIA 3CJTB 4YNQA 3AT1B 2YLBA 2I0NA 2F6CA 1BIAA 2RVCA 2NYSA 3UPUA 2ROTA 3ZMZA 1IBMK 3MP1A 4XM3A 5GAMj 3WHBA 3JCMe 5LLQA 4CZHA 4Q48A 4HNVA 1JJ2A 4E7SA 1ZG1A 3W2AA 5GAOl 2DZCA 1BIUA 1RESA 4CZIA 2ASOA 1XC5A 2MD5A 3GTPJ 3OQ5A 1S7OA 4CJRA 3DJCA 5KTQA 2FUG2 2ZGWA 3IH4A 3CF5L 1NK4A 2OFKA 3A4CA 4A69C 2LT4A 1U8RA 3PX0A 4B9VA 3THWB 4NLBA 1WDXA 1TUGB 3O3GA 1YOVB 4CCHA 3X28B 2ETHA 2K3BA 3JRZA 3U4LA 5FLXE 4YFXF 3MEVA 3ZQ7A 3LFUA 2NOLA 3JRCA 2HQHA 1Q86R 1T05A 4UVBA 1V5EA 1C0FA 2Y4XA 2ID6A 3GCMA 4LD6A 2HZDA 3CQXA 3N97A 1MNEA 3DBRB 4CW7B 2WAEA 4O4GA 2RF0A 2UWMA 3BPXA 3OYGA 2WB1N 3TDZC 4K8XA 1RNLA 2WY8Q 1RDBA 2DX1A 2WBMA 4KJZA 1VQON 4LF5K 2G0EA 3OYFA 1OCRH 4KGZB 3JAMO 1B07A 3ID8A 3OR1C 2CH0A 3I55I 3S9HA 4J6YA 1AWJA 2G8FA 5HL7L 2QA4I 1KO9A 4OLBA 1TQMA 4AC0A 4HDUA 2XHKA 3SQ4A 4NXMK 3JSPA 3HFNA 5M1QA 1QZEA 2D0OA 1RIOH 4CEQA 3OIPA 2Z1IA 2MH9A 1RABB 1VF9A 1TZLA 4FJJA 1FY7A 3OJSA 2E65A 1W2BS 1IW7F 4MFEA 4YIIA 3P9CA 4LB6B 1KONA 3H36A 1RETA 4AM6A 2O8XA 3TMOA 1M30A 4AF1A 4FM2A 1P4XA 3BG3A 1ORNA 2JNGA 1KHIA 3EFSA 3FZLA 3D7SB 5GJVB 3QRFF 3L2WA 4IVNA 4CDGA 1VAZA 3OGDA 4H0TB 1OVQA 1U6GA 2X6SA 4OIQF 3D7EO 4ME7A 3T1BA 3Q9VA 1FMVA 2P9IB 3I5UA 3SZTA 2VC8A 2G7UA 4BQOA 4Z89A 2XICA 4D7MA 4OOIA 2KL4A 3OJUA 1IV8A 4OP0A 2IA1A 4AG1C 1JEGA 1VI0A 1DP7P 2Y90A 2HNHA 4A5NA 2E35A 1VQ8T 2P5OA 5F0FA 2O61A 4IEIA 3HGYA 2K9GA 3F8CA 2M30A 1T44A 5IOZA 1BOTO 2DBBA 3SWNA 3S17J 2LOOA 1JHHA 2CMPA 1YP5A 4F92B 4C2TA 1Y57A 4C3HJ 3FEOA 1U47A 1JLFA 4Q5WA 4PJNA 3L0QA 4M72A 4DLEA 2B7EA 1Q81R 2P9SA 1WHGA 1YIJA 4XU0A 2V1NA 4M6YA 4PQUA 2OCCH 1HKBA 2ZF5O 4DG1A 2MABA 2KQWA 4WXHA 2KR3A 4F9OA 2QM1A 1SD5A 4Z88A 5GAN7 4CEDA 3DEWA 1TKXA 2HL5C 3VU3C 1MJBA 4FJMA 4HX8A 5DUKA 2R7FA 3D45A 4QLCU 4I01A 3TP3A 2D9TA 4BRKA 4BDZA 1MMSA 1UUEA 3DMJA 1RZ4A 2X48A 2JTFA 4P9FA 3I9QA 4HKEA 2V1DA 1NNEA 1OCCH 2E7XA 2HCKA 4C5GA 1BI2A 3F3XA 1YITQ 1MMAA 2F8TA 4BQAA 5C42A 2Q3SA 2VCPA 1SAUA 3AY9A 3TR8A 4C3IJ 5HNHA 1BL3A 3G73A 4MEXF 4BUPA 1ZRDA 4N4GA 1OX8A 1FMWA 3MD2A 2QSGX 4J6WA 3SK3A 2DTUA 3WTSC 1KLMA 5E18F 5JMVA 1NM7A 2RHXA 2LJ0A 4JYAK 2O8CA 4OPKA 4S04A 2NUZA 3U3GA 1SANA 1RDWX 3ZMSA 3TL4X 1UJ0A 4JRQA 5GAMg 5HRNA 2FJ1A 1JLBA 3TU5A 4DYRA 3ISPA 1XI1A 1HJOA 2IPQX 1PRLC 3BCAA 1B59A 4RB3C 4XLNF 3EHQA 2O9LA 3S2HJ 1KAXA 4IHWA 2YR2A 2FHDA 2ZPIB 4ID5A 1L3UA 3JSMA 3QEVA 3JCMJ 3NBPA 3FR0A 2EBIA 2L5QA 1X01A 2OZSA 4F3OA 1T6SA 5E8GA 3VQDA 1KGSA 2A6AA 3SWNC 1WOQA 1S1TA 4I98B 4CIFA 2J6FA 1Q8IA 1VQOT 1KG4A 1Y96A 1NGCA 5KYYA 3FXLA 1HXDA 4A4EA 3CQZJ 1KK7A 2HGCA 4IQ4A 1RTIA 4FXDA 4M77D 3FLCO 4CK2A 2JPBA 5KCMA 2D0QB 5DD8A 3WVDB 1BGXT 4OKKA 3ZSZA 3M9AA 4ZYEA 2HNIA 2YRCA 1VQLQ 1YQRA 3O08A 3VGMA 3WU2C 5BR8K 4IUVA 2Q1NA 4UC4A 1GLAG 3CBPA 1KG7A 1RTHA 2BZXA 2DAQA 4J83A 1TVRA 1M3CA 2DERA 3PNWC 2E19A 3HEFA 2MA3A 4HLYA 1AU7A 2YHBA 2FO0A 2Z16A 3TW7A 3FRNA 1M1EB 2RHZA 3RPUD 5DCFA 2PYJA 4LDWA 4FSSA 1R0CB 3LQRA 4UUSB 2K85A 3ONQA 2VASA 1CKAA 4CYCA 1SRLA 4LDXA 2DMNA 4M7DD 4AYBA 2FVUA 4A3EJ 4CJ5A 4ENNA 5CZ2A 3PQKA 2MOXA 1OVYA 4M3ZA 3HKSA 3CIPA 1LWFA 2KLAA 1XX5A 3C4SA 2CW7A 1KEAA 2VKHA 2ZGYA 3BG7A 1EX4A 2OTJN 1QVPA 5E17F 4A0ZA 4MLEA 3UA6A 4XU2A 2RB6A 3EGDA 2AT1B 4EPCA 2FXUA 1HNVA 1KU3A 1KZHA 3CC7Q 1RDUA 2HHUA 1ETWA 4CF2A 1RCHA 3IHUA 2XAUA 2F2WA 5A2QE 2EZLA 3D6RA 5J3LA 3PFSA 5GADJ 5HDNA 4Z4EA 4YOWA 2KI7A 4X66K 2IW5A 3BR6A 4Z4GA 3SHWA 4HLXA 3IS9A 2J7IA 5DPKA 3VYHB 1YITI 1D3YA 1QGPA 5BOXA 2QWRA 2IS4A 2WSEE 1GLFO 5GANe 3LA3A 1VQ4N 1ETQA 3CMEQ 3M8EA 4BDYA 2DMQA 5J2NA 2FF6A 2OF7A 4CJVA 1L3VA 1I8FA 5EYRA 3IRRA 1FOWA 2GTDA 3TAGA 3KK3A 4QTRA 5FLXO 5I2SA 3FHZA 2XGEA 2P9NB 2DPUA 4NOYA 5CVVA 2VC1A 1NGEA 3QWYA 3FMRA 3U1KA 4II3A 4KN4X 4J2DA 3OL4A 4KAZA 3A01A 1ZQ3P 1S1NA 4DR7K 5EG0B 4H8KA 4B44A 1F1ZA 4F7UF 2X51A 2YCHA 2F4IA 1RRJA 4LLLA 1J9IA 2ZCWA 3KZIC 4LG3A 4V2FA 3GFJA 2NRXA 4NCBA 1QVUA 3NFAA 2VKEA 1WAJA 2F2EA 4ZZDA 1ZRFA 2CQQA 3HXLA 5GMKj 3KYLA 1Z77A 2VJIA 5CZ1A 4CCMA 3OYCA 1VYVA 3HSFA 1IGUA 4DUYK 3QPHA 3LAJA 4LG0B 3OSVA 2LMJA 5F1XA 1TBXA 4A3IJ 1FYKA 2MD0A 3JB9I 2V8JA 2E20A 1TWHJ 1T0FA 3O4QA 4MNUA 4CESA 4BRGA 5FKKA 3QZ5B 1S72Q 4M77G 3MAJA 2GQVA 3SDZA 2NVQJ 3TOBA 2OU2A 2DI3A 4M77B 3VQ8A 2ENMA 1T38A 1RT2A 1B8IB 2XROA 2Y31A 4C0FA 2LCSA 1FX7A 2EYYA 3MP8A 3FJPA 3JRIA 3ULQB 1Y0MA 1K78B 2DK8A 4X9DA 2RHKA 1EIFA 2LY9A 3BDUA 3CCMT 3D5RC 4OB1B 2DYRH 2NUPA 4DV0K 1U1TA 1J09A 4K11A 4EMSA 2CYYA 2DIQA 1OPLA 4M7DG 1MH3A 2BY1A 4M7DB 1PSEA 1JO8A 4A2BA 4IG0A 3FXJA 2NS7A 2ISYA 2JSPA 2M8EA 3CC7I 3V9WA 3CCQQ 3FIWA 3V4GA 4K8ZA 2F4OB 2OTLA 2EGEA 2QWMA 2A6EF 3E9LA 2CZ6B 2K5FA 1WZ2A 5IT3A 3JW4A 4ZYHA 1I1SA 1D9DA 1NK8A 2GXBA 2K7LA 3QO9A 1TAQA 1D8YA 2Z33A 4YPHA 4JAXA 3PTAA 3G71T 3MAQA 3CMEI 3NF8A 1S6PA 3S2DJ 2A3ZA 3NGPA 4CK3A 3M54A 3GLLA 3ZOBA 4CGGA 3RKQA 4M7YA 5CYQA 4BR5A 2OTJT 3EE9A 2O01E 1JU5C 3X25B 3K4LA 1FSEA 3LSIA 1JLQA 2LF7A 1DQUA 2CZ0B 4IFYA 1Z9ZA 2OX7A 3DQVC 4D1QA 1IXCA 2E2OA 2B86A 1W4SA 2VBYA 4OB0B 1EV7A 1E2XA 4XNFA 3RKYA 4FM4B 2V9KA 4FLXA 2HQXA 3LPUA 2X4HA 3E0JB 1T0FC 4IHSA 3M3YJ 4E3SA 1NEBA 3ISNC 1P4AA 4CEEA 1SL1A 4P5OA 4DQ8A 1NGNA 5ICCA 4H5TA 1WJSA 3ENHA 5L3BA 3VSLA 5E3LA 5H6QA 3QPSA 1B4AA 4YFKF 4PLIA 3S93A 2VL8A 2CRGA 3BTJA 2RV8A 4DSKA 3K1NA 3COAC 1F36A 4I7HA 4XIUA 1TV6A 3LWLA 4J8OA 1JQQA 2PVGB 4C8QA 2FQ4A 1HOMA 3HI0A 1IRGA 3ZSOA 4G6QA 4YRVA 3MEDA 1Y1VJ 2VQLA 4CZGA 3LGFA 1IRXA 4GKKK 3TDUC 2AHQA 2J4RA 4XLFA 1PD0A 1O9SA 3V42A 1S72I 3TGNA 1AZEA 1K73O 1P6RA 4KREA 2ECCA 5C2FA 3BJOA 2FLOA 2CZ1B 1Q82O 1C0MA 2E1MC 2H8HA 1AD5A 3H3OB 4WWCA 3LGLA 2DMTA 3KLEA 2V7YA 4V2GA 4ZDLA 1HJDA 2D1HA 2P6SA 2KP6A 2PMUA 5M1OA 4KV8A 1W7AA 4DYQA 1OFCX 4DSIA 2O88A 2F96A 1KQSA 1VHXA 1NLVA 3RVCA 4K2EA 1H641 3BT9A 3V9SA 1FMKA 4LFCK 3PQJA 2LJ3A 2RQVA 1D1CA 2PMZA 2HL3A 3DU6A 1Y07A 4QPOA 1IN8A 2LKPA 3T9NA 5J8FA 1WJQA 2OBPA 3NFCA 5M5XJ 3WNFA 2A42A 1L3LA 2DN0A 1J59A 1YUWA 2RQPA 4B9NA 3CCQI 1IG7A 1ZUUA 1VSJA 1B9NA 3T1YK 4GY5A 2L89A 3QYGB 1U49A 4XRSA 4M71A 3QYFA 1X1PA 1VSHA 2K9QA 2XIGA 3H0DA 2OANA 5DM7L 3SV4A 3ZSRA 4EJOA 4C3JJ 1YG2A 2RI2A 3KK7A 2COYA 4RMOA 2KZVA 1U45A 3ALYA 5BN9A 1DU6A 3QPLA 4LMYA 3J81Z 2P9PB 4B9XA 4YFUA 4PL8A 1RDCA 3L2RA 2EK5A 1DDNA 3R2XC 3A98A 3L8BA 3VUZA 3MEEA 4B9UA 3KP7A 4CJSA 2ICWG 4QT7A 3O2PE 4BC5A 3SCXA 1UFMA 4FOEA 1TKDA 1WN7A 1K0XA 1NJXA 3THWA 1P8ZA 4E19A 1E6GA 4UOBA 4JBAA 4HNTA 1Z91A 2B9SA 4KGVB 5HP1A 1FWZA 2X1CA 1X9JA 5FPEA 2CSOA 4RW7A 1QQNA 3RMSA 1GVDA 2JTVA 4CGHA 4IQJA 2HEOA 1WEFA 4RTFD 2G8WA 1GHCA 4A61A 2ZJRF 2L8DA 4B23A 1NYFA 3JB9D 1JXMA 1YIJN 1WH5A 4AIKA 1JT0A 2ZAEA 5LFAA 2AQFA 3ASNH 5D6EA 4C8QF 2P9UB 2GELA 2KQRA 4HUEA 4ITVA 4BG9A 4FLUA 3BR3A 3WE3A 2KZZA 1QQJA 3KD5E 1B34B 1OU8A 1VSEA 5FD5A 3K58A 4UB8C 1TW3A 1VQ4Q 3CWTA 3R0JA 5GAOm 2CUDA 2QEXA 1M1KO 2Q2EB 2OJED 4MHGA 4PDKA 3J7ZI 2FSJA 1WSJA 4AWXB 3HOWJ 3EZWA 2KMUA 2IC3A 5KE2A 4E7HA 2RH2A 2O8EB 3PO5A 4FL9A 5GAN2 3JCMW 2KRMA 3FDYA 4DOZA 4M7AG 1HSQA 2K9NA 2VBWA 3G0QA 5I42A 2UU9K 2DBKA 4BXUA 4EJVA 2KVQG 5AQQA 3BTLA 3CMAT 1XGNA 4M75F 1J5OA 1W70A 2AHJB 4LFBK 3I0SA 2OA8A 5GAMh 3MZ8A 1JI8A 3C94A 3DWLE 3SHFA 2VOPA 2YNGA 4DHYA 3H6EA 2L3SA 1PUFB 1H1VA 2P9IA 3E6BA 1CGPA 1XUPO 1PNJA 4BXFA 5JVGL 2CW8A 3VQ7A 2YX6A 4HZFA 1Q86O 2GUIA 3E2UA 4CHUA 4NLCA 2VV5A 1ZGJA 2NRZA 3G1MA 1O57A 1QCFA 2K2MA 3LWFA 5FJ8J 1X3MA 1QP3A 1KD1R 3FB9A 4ELUA 4JJNK 3QBXA 1YBYA 3I8BA 1HJRA 1WHLA 4NB4A 3BF3A 4N47A 4X65K 2CFXA 1BB9A 3ZSXA 3HM8A 2DM1A 4CGIA 1VQ5A 1K9AA 4DQRA 1U6ZA 1GLDG 2GQIA 2EQIA 3E5UA 2IXSA 5LD2C 1F1BB 3ATVA 4OMPA 3EAEA 2H09A 3J8AA 4PUSA 2MIOA 1J5EK 1VQ7A 4P55A 4WK8F 2L3RA 1PG5B 1YF5L 4JN4A 1POGA 2L7KA 3HPWA 4NL3A 4BEHB 1XJWB 3P9IA 3LL7A 3VS0A 5JLXA 4BY7J 4JKAA 2Q36A 2E1ZA 5DCMB 5ADXH 4ELVA 1YWOA 1JE8A 1XCBA 5J2QA 4B1VA 4E7KA 3HRSA 1GLBG 3DWLA 2DJNA 2MPXC 1SMYF 2PN6A 5GINA 2CU7A 3C0BA 3A02A 2E64A 4B9QA 3NH2A 2IJLA 3BY6A 2E3IA 1HCRA 1VSDA 3OYDA 1NLOC 2X78A 2Y9YA 5AONA 4FYWB 3K9JA 4ELTA 2NRRA 2COWA 3HSCA 2HBLA 2OAZA 1R5GA 2PEXA 2XHIA 4O3MA 1FJLA 2HKQB 1UECA 4KKOA 2ZXHA 2EFQA 1MGQA 3QU6A 4KMUX 3MN6A 4RW8A 3SB2A 1J2XA 5CKEA 3KYDB 2KIQA 4A6DA 4DU1A 3ZT4A 3CD6A 3CCLA 1MH4A 2YJEA 2V1QA 5IAYA 5F0HA 2OCEA 5FKNA 2XB0X 1FYMA 3JSOA 2VG5A 1R71A 5EY4A 4K41A 4PL6A 3LOCA 1YIJT 2BZYA 1IXDA 1BYMA 3AO5A 1Q81O 1JJ2P 2HF3A 2UV1A 2L2PA 3PIPL 4Y13A 1OH6A 3J7YJ 1HDPA 3JCUC 3KZBA 4PJMA 3NWSA 3TANA 1QWFA 2V9VA 1BL0A 3HSRA 5A0DA 3J80Z 2HHXA 2V26A 1RR7A 2HVHA 3CCRQ 1TOVA 4MDWA 4CHZA 4BJ5C 3HIFA 4NS5A 2JMWA 5HS8A 3O8MA 1GVJA 3TO6A 4CZJA 1M90R 4HCCA 1KTQA 4ATOA 1ZUKA 1SVMA 4DYCA 5IP6A 1W0TA 3ATUA 3T1AA 4UUSA 1I50J 2OZUA 1TQIA 2FMLA 3DF8A 3ZYYX 5LMUK 3B8AX 2RE2A 1A6IA 2CWEA 3ZGKA 2WONA 4CA0A 4XU1A 3CCST 4BC4A 2LJ1A 1Z7LA 1ACMB 3ZRGA 4BB7A 1KSPA 1EZZB 1ZHFA 3GVAA 2FU4A 3K4JA 2LT1A 4YHHK 1YQKA 2FF3B 2IP2A 3SJJA 4A0YA 2JUFA 1WH7A 2ZBKA 3TABA 3ZSVA 5CQGA 3BR0A 5I21A 5LY3A 1WZOA 4E70A 3GLXA 2IVPA 2YG8A 4Y33A 3A2KA 3P7NA 2IS2A 4CC2A 1XG7A 2EZKA 4FWQA 4CO8A 4OKJA 2D8HA 2EJGA 2LG4A 2Y75A 5C6SA 2LX9A 3N4QA 2HHSA 5FPMA 3LAMA 1Z3YA 2ID3A 3EYYA 5CKHA 2E2HJ 5TRDA 3FZVA 1S1UA 2RNAA 5AIPA 2HYFA 1W7PD 3O6WA 2E3HA 1WHHA 3REAB 3HTRA 5J47A 3WEEB 2X85A 4M77E 1YI2I 2EIKH 1R7JA 4QS8A 1OYYA 2XAHA 3K70D 3TEDA 4CFDA 3IAYA 4DBHA 1KXPA 4FISA 2OTLN 2WTEA 4DQSA 5K7HA 1X3ZB 5KCOA 2GTJA 2P9NA 1WHKA 3EQLF 2FPFA 5D5VB 2FX0A 1NG9A 4ESJA 4MLHA 3DLHA 1D0XA 2W7NA 1KQ1A 2F2VA 4AFQC 1BISA 5LGTA 2DQLA 4QCLA 3CPWA 3FX3A 2JGUA 2RJCA 2G8IA 2DEUA 1XWLA 2MAMA 3GBQA 3U2RA 1GCPA 2NAZA 3C7JA 2E6NA 2L7ZA 3CG7A 2WC2A 5LHHA 5J1UA 1HYVA 1XTAA 2I5JA 1WEIA 4A3MJ 3JXUA 2YRDA 2JZ2A 3G10A 1R59O 4PJOD 2QK9A 2H8RA 2QGGA 5LL6S 5ICGA 2DXCA 1LFUP 2GOXB 1X2KA 3DCFA 4M3DA 5CHZA 3ZQCA 3H3NO 1KVAA 4HOBA 5CQXA 3BPVA 2DFUA 1IAWA 2KAFA 4XN3A 1K73U 5J4VA 3MN9A 2EV6A 4LG0A 5BQTA 1AHJB 1UB9A 3CCRI 4ENJA 1SEMA 1Q82U 3BG9A 4O0IA 3NVMA 2E2QA 5DTDA 3RUXA 3VYRB 2I5WA 5ADXA 4FYVB 5IY5H 4ESRA 3VENA 4M77A 2PBIA 3PE0A 1RRSA 3J7AY 4FYDA 1B8IA 3WGGA 2KT1A 3V1OA 4RAYA 1OCPA 3F9MA 4E1MA 2IGIA 3WNGA 4OIRF 1SHFA 5KYWB 5EF6A 4CZLA 2ZJ2A 1K78A 2O8BB 5DEQA 2HOAA 1H3ZA 4DZPA 3PLAA 1XHXA 5GAGP 2VWFA 4UV8A 5KGXA 4N76A 3RPUA 2ZPEB 1UCRA 1K4US 1KQ9A 3HO1A 2RN8A 4OAZA 2LY1A 4JK8A 2YX4A 4M7DA 4YEJA 2YU9J 4OX9K 5FFZA 3PUFA 3NHGA 2F5FA 3OVNA 1KAYA 1HW5A 4YTLA 4FVUA 3V8LA 1DGRM 3S1MJ 2CFOA 2VWJA 1CSKA 2ATCB 2LBFB 3JCMc 1VQNT 4XOTA 3BJAA 4BH9A 1XCVA 1LV5A 3HHHA 3KZYA 1HYZA 4MTDA 4O55A 1I5LA 1ZBFA 3WG7H 2HHWA 3QU3A 2DBMA 2IAJA 3V8KA 1OYXA 2GUPA 1UG1A 3LM9A 1I81A 2JVVA 5FW9A 4H0OA 1G4DA 1VQKQ 3N0UA 5AQGA 2XG8D 1QQOA 2YNFA 4OJRA 3QAHA 2DOAA 3SEQA 3MQ0A 3MEUA 2J5OA 2LMDA 1UA1A 2Y30A 1K9MO 4HA8A 2KJCA 3I55A 3EHRA 4X62K 5KAFC 3AGKA 5AIQA 1TL3A 2OC6A 1W7PB 3M4GA 1G6NA 2QA4A 3KLGA 4M78G 2OPQA 3M4OJ 4B1RA 2KPMA 1BM9A 3GYHX 2V52B 4BR9A 1ASUA 2NRAC 4C1NI 4U67L 5DS9A 5AQNA 2DL3A 3WXLA 1D0ZA 1WLJA 1I27A 3GMEA 2FF4A 1JGGA 1YVUA 1NK5A 1I94K 2LLKA 4GDFA 1HA8A 4LSNA 4C92A 2PX9A 3O3FA 3OH9A 1WQ7A 3VQ4A 5IHNA 4M77C 2K2VA 4J9CA 2RQTA 1NOZA 5JS1A 3KFWX 2CZ7B 2JPCA 5K5RA 3CXCP 2DTOA 3RWUA 2VXZA 1M1KU 3PO4A 4BJTA 2BE7D 4JI8K 3RZOJ 2JRMA 1E3MA 4GKJK 3P8DA 1VIFA 1RDDA 5HODA 1Q7YR 4PJOG 3PY8A 2HDAA 1PU6A 1X9MA 4CF8A 4PL7A 2VQFK 4E47A 3SAGA 3M8PA 2IVNA 2LQNA 1NM1A 4DR5K 1GL5A 4M7DC 2DLLA 1FC3A 1Z6TA 1FOXA 5AFUA 4AHVA 4HPQA 1WNLA 1VQPT 4C30A 3C3WA 3VQ5A 4JRKA 2L9RA 3FXOA 4FT8A 4DV5K 4DK9A 2CGKA 3UNGC 1JHFA 4HQEA 2FSWA 2WOMA 1IXSB 4A3GJ 1X75C 2V75A 4K0KK 1RAGB 4JHDB 1WNSA 2MG4A 2QEXN 4J2AA 1I6HJ 5IH2A 1TU0B 1E3OC 1KVCA 1N3CA 1KG6A 3OS5A 1Q86U 1N75A 2D1KA 3OV8A 1OR7A 4UB6C 3FBNB 3H3UA 3BR5A 4M7XA 1ATRA 4IDKA 1R0AA 1S1XA 3ZT0A 2G7HA 2OJ2A 3KETA 4IEEA 5HLHA 4BYYA 1VZ0A 1TUUA 5M1NA 5I2MA 3ABUA 2G3RA 2ZCFB 4CGZA 1K73C 3CCJQ 3OMCA 4I09A 2XVCA 3VS7A 4H4KC 1BR2A 3IQLA 3H9JA 4ZJZA 4YOUA 2GLOA 2P0QA 4WYBA 2L02A 3JRBA 2P9PA 5GIPA 3UDCA 4H03B 2EIMH 1VQKI 5HKCA 3KEQA 3IKTA 4WCIA 5FKMA 5C4JJ 1SFOJ 3VPZA 4M7AE 1N33K 3DOLA 1QO0D 3CVTA 1O3QA 4C8OA 1XDUA 3LALA 1J53A 1SC7A 1EKEA 2CUBA 4AVZA 1R5ID 5BPNA 4CCKA 3DV8A 1G15A 4GFBA 4JI3K 2ASPA 4C92F 1OLTA 2XK0A 1D8KA 1TWBA 2HBKA 2K9MA 2FPDA 2E1YA 1MHNA 3QJ6A 5D6WA 4DQPA 1MSFC 2GIVA 4BU2A 3VF6A 3QG1A 2OPPA 3O3HA 1IJWC 3VTIA 4GLMA 2FBHA 1BA5A 2P84A 3GFMA 2Q1ZB 1FKOA 1IV0A 4O8UA 2P9UA 5ILSA 1RTJA 2CP6A 1SFUA 4CFAA 1M8VA 2ZSIB 1B34A 3O8HA 1KU2A 2LTPA 2FSNA 2L4AA 1QHGA 3SPZA 5GAN4 1G2BA 5GAEP 1K0SA 1OR7C 4EGYA 1QVGA 2Q2EA 4B3TK 2ZKZA 4IDHA 1ZBUA 1A5WA 3DFGA 4YIFA 2E4LA 4F3TA 5HOOA 3P8BB 4IF4A 2OTLQ 3PIOL 3IL2A 2STWA 1PU8A 4RTYA 1XC3A 2D5RA 3LP0A 1RC9A 2O8EA 5E8IA 1WA7A 5EVZA 3TARA 1Q81U 4DJAA 3LWHA 4DTXA 2W4SA 3N05A 4P1WA 4U0WA 2HHVA 2E41A 4RCHA 2HSEB 3EKSA 5EGOB 4IOXA 2I7NA 1OZ3A 1TL1A 2FOWA 3CJAA 1GLJO 1QHTA 2M7BA 1QVFA 3E6CC 1NH3A 3A8YA 3I35A 4G12A 3MKDA 4RW4A 3RMAA 4NO7A 3FXQA 1PUFA 1JJ8C 2H1LA 4B1WB 3CD6N 4FE4A 1NBWA 3JS6A 3PO2J 3V7SA 3HUGB 3ZX0A 3U9GA 1NYGA 4L6V5 3PMIA 4HAMA 3I54A 3CP2A 3CCJI 2C0OA 4OPAA 3I0TA 4IRGA 2JMAA 2W25A 1IKWA 1ASWA 4QPQA 2UXXA 1DT9A 3AARA 3L2VA 2XIDA 1OKRA 4G1QA 1YITA 1LFBA 3ZT1A 2CV0A 3K5MA 1XHZA 4JPBW 4BROA 1T03A 3I56Q 1I3AA 3GBGA 4B3OA 1WSEA 3OBYA 3PNTA 3G7ZA 5HK3A 4B3RK 2H3EB 3DLLA 1BU1A 4JKCA 1F4KA 1MJ9A 4CEFA 1Y97A 1O1WA 5C44J 4KH5A 3V1QA 3WTVC 1ZX6A 3TAQA 3VDXA 2WWYA 4C23A 4IO9F 2W24A 2NS0A 5CKBA 2COBA 4BBRJ 3O3KA 2KY9A 4BEHA 1RT6A 1TTHB 1MA9B 2HMIA 2QZ8A 2D0BA 2NRTA 2IIMA 1QQMA 5AQFA 3CCVQ 1GUUA 1X1BA 3EPZA 5DCMA 3ROUA 5C0YA 3AA2A 3PIPA 1L5UA 1KJWA 4XKCA 5JVGF 3G4ST 1PM3A 4QQGA 2P9KB 4A63B 4ZDOA 1WQWA 4PJLA 1Z6RA 3DBHB 5IXFA 1U3OA 5IT9E 2HBWA 2NOEA 2KNBB 2YNHA 5CKFA 5AQYA 4LIVA 3R60A 1BU6O 1XPXA 1W5CC 1SVOA 4IHVA 3QQAA 1Z0XA 2HHQA 1WWXA 1E3PA 4C0DB 3G71Q 4B08A 5GAOr 4EP4A 4WCEL 1J54A 4LC9B 2JMCA 1K76A 3K0LA 5JR3A 1T7PA 1HKCA 2O8DB 1RPWA 1VQ9N 1Z05A 3MZYA 5GAOq 1LDDA 2LKSA 3EFRA 2DTHA 5CK9A 2NVUB 1KD1O 1XTDA 4PCQA 2XRLA 4JZ4A 1CZ9A 2OTLI 2BY2A 3PX6A 2WSCE 1N5ZA 3LFKA 1VQ5T 2VYPA 4VUBA 4DNCA 3CETA 3MKWB 4M3GA 1M27C 4FJ8A 3LP2A 2V7FA 1RKWA 1S6LA 1HF0A 1LWCA 2M0CA 3CZ6A 3IRQA 1VQ7T 4KPYA 3HT3A 1JJ2S 1JUSA 2M1HA 1IHWA 3DXMB 3ZLJA 4KFBA 3TAMA 1WJRA 3SZGA 3E9GA 1GLCG 1HQUA 5E3MA 1OV3A 4CC3A 4RAFA 3SXYA 3SV3A 3FISA 2ZNYA 1S3JA 1K8AC 2I8DA 5F6FA 1PD1A 5AQMA 1R00A 2K3YA 4UNOA 1M3HA 1N39A 1Y56A 4IUQA 3CC7A 4LOCA 4O6JA 2UUAK 3HHTB 1LDJA 1NMNA 3LSJA 4BI4A 3OW2P 1SUQA 2DT6A 3DU5A 1YW9A 1VQ6T 3HHGA 1QBJA 5K5OA 1PUEE 4C8NA 3I56I 2JVGA 3BY7A 4FWNA 3MK6A 4Y52J 3CMEA 1KAZA 4CHOA 3UWNA 3THXB 4KRFA 2FD5A 2VKDA 5FB2A 5GJWB 4GO1A 4M9SA 2QEXQ 2P81A 1NGAA 4BHBA 2ITGA 3PIPF 4N0BA 3SUOA 3CCLT 4CJFA 2FBKA 4BRQA 1DGWY 2HDDA 4M3UA 3CCVI 3CUOA 4CHYA 5IP7J 3OA9A 4KDPA 2FNPA 3M5AA 4H0XB 3VEWA 2E34A 2ITMA 3HOVJ 1HPZA 2OPSA 2RJFA 5C12A 4Q0BA 4OFEA 4Q47A 4YDUA 4BRPA 1K9MU 3MEGA 4DTSA 3FMQA 1JRIA 2GF7A 1QZYA 3G71I 3WEEA 2JA8J 4KBMB 3K1MA 3BTCA 4XLPF 3M7GA 4BRIA 4IBNA 3E9OA 1REPC 3X24B 1DTTA 5GANj 1RT7A 5KQ8A 5GAMe 4N4NB 1QQCA 3OYHA 1N8RC 1DLOA 2O8KA 2RC4A 3C7NB 4UY8O 1S72A 4LK0F 1M90O 1GXIE 3LSKA 4Y15A 4EIAA 2DL4A 2CQKA 2J05A 1SS6A 3CQ8A 3DPLC 4D5FA 3H0FA 3A0BC 3ZQHA 4TSXA 1HR0K 2XDVA 1AHDP 1Z7UA 3LWMA 3OIOA 2L4MA 3L2ZA 3I55N 3HK2A 3IH2A 2LZ6B 4RTVA 3FZKA 4QVCA 5AQJA 2E1HA 4CF0A 4AIJA 4LNPA 5HNFA 3RTRA 2M02A 4H0VB 3E6MA 3BQYA 2M16A 1Z9QA 1X6GA 2QXLA 2DQRA 4FWRA 2X6XA 4KUMA 3NF9A 4ILHA 3C95A 4PY5A 5FFXA 3CCQA 3L2UA 2EKHA 2OAWA 2DL8A 5C10A 1RADB 3EH2A 5KI6A 1OJLA 5LRSA 5EU7A 4DV1K 4KIBA 3CC2N 1O3RA 4IHXA 5K14A 2KK4A 4F7UB 4M78E 3K4KA 1N6AA 1IB8A 3HRUA 1WSHA 4U7DA 3A5LC 2DFIA 2OD5A 3NARA 5KYWA 1NWKA 2O8BA 5KYYB 4WCGA 4DFPA 2J6KA 2VXDA 4YDUC 4XR6A 3NVKA 3SZPA 4FCYA 4BR2A 4UUVA 9ATCB 1R9TJ 1CZAN 3TAEA 2QI2A 4MGRA 2FBIA 4A0XA 3F0ZA 4LSLA 1N27A 3A5MC 2V7ZA 3BJ6A 1GFDA 1HBXG 4JJCA 1BR1A 3KKSA 3CBMA 3QB0A 4CSWA 1B9FA 2DYSH 3E01A 1JLEA 2HSTA 3V9ZA 2PVDB 3QHSA 2WAFA 4JP0A 4XKVA 1BI4B 4CJKA 3CI5A 5DYMA 4LLNA 1NKEA 3TREA 1RT5A 2ZXIA 1K1ZA 2LBFA 4PJOE 4ISEA 1WJBA 2HXOA 3B73A 1UOCA 3PMTA 5HLGA 3JCMQ 3KK2A 4Y1DA 4JK9A 1BWFO 1D0YA 2X0LA 1KG2A 3JCMP 3VKIA 2UXBK 3OSSC 4BY1J 1LNXA 3VB2A 1KQSM 1U9NA 1R49A 4KT0E 4B1ZA 1K4TA 1X3UA 3UKUB 3EYZA 1K8KB 2GOMA 5FROA 3O5BA 1KC8R 4U0YA 1SEUA 4C5EA 1D09B 4XSXF 3QXEB 2QSHX 4AHUA 2FZCB 1M8MA 1W7PA 4NCAA 4XN0A 3H3VK 3V7CA 5JLHA 5HRSA 3E5QA 3R6MA 5ED4A 2JT1A 4OIPF 3D5SC 5AQTA 2TRTA 2KIFA 1BA1A 2HTSA 2XY5A 4BRHA 3X20B 2BE9B 2HDWA 4DFKA 1LDKB 4DTUA 3VQ9A 3M5RA 3I4NJ 3CC4T 2HWVA 3HBLA 4PFZA 4RB1A 4AFSC 3PVQA 4ENKA 3VQBA 1R5HA 2CGLA 1Z25A 3BUZB 2DE0X 2PYLA 2BEOA 4XTVA 3OYLA 4FWKA 1WFXA 4BRCA 3S1QJ 3DRSA 2DXBA 3SBGA 4RTXA 3M0PA 1BK2A 3KKRA 2C0IA 4ZNXA 1UWBA 2M0OA 3FZFA 2R7SA