3OYHA

Crystal structure of the prototype foamy virus (pfv) intasome in complex with magnesium and the insti mk0536
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
368
structure length
368
Chain Sequence
LDAELDQLLQGHYIKGYPKQYTYFLEDGKVKVSRPEGVKIIPPQSDRQKIVLQAHNLAHTGREATLLKIANLYWWPNMRKDVVKQLGRCQQCLITNASNKASGPILRPDRPQKPFDKFFIDYIGPLPPSQGYLYVLVVVDGMTGFTWLYPTKAPSTSATVKSLNVLTSIAIPKVIHSDQGAAFTSSTFAEWAKERGIHLEFSTPYHPQSSGKVERKNSDIKRLLTKLLVGRPTKWYDLLPVVQLALNNTYSPVLKYTPHQLLFGIDSNTPFANQDTLDLTREEELSLLQEIRTSLYHPSTPPASSRSWSPVVGQLVQERVARPASLRPRWHKPSTVLKVLNPRTVVILDHLGNNRTVSIDNLKPTSHQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular mechanisms of retroviral integrase inhibition and the evolution of viral resistance.
pubmed doi rcsb
source organism Human spumaretrovirus
molecule tags Recombination,viral protein/dna
molecule keywords PFV integrase
total genus 106
structure length 368
sequence length 368
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2010-09-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
A PF17921 Integrase_H2C2 Integrase zinc binding domain
A PF18103 SH3_11 Retroviral integrase C-terminal SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2300 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3oyhA04
1.10.340.70 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Endonuclease III; domain 1 3oyhA01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3oyhA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3oyhA03
3K57A 3RRGA 1N6QA 2HHVA 3NH0A 3K5LA 4B9WA 3EYZA 4LSNA 4CJVA 3AA3A 4PA1A 1I3AA 3AVFA 4IG3A 3IAYA 4HUGA 2G8IA 3RMAA 3AVJA 4CF9A 1OZ3A 3C6UA 4NCGA 1DTQA 3TAPA 4FVMA 3WNHA 3SUOA 1TKDA 3E01A 5FRMA 4DTXA 1NK4A 4FJ5A 2ZD1A 1BI4A 3JSMA 3OYNA 2XO7A 4I9QA 4M3YA 3OYLA 2P0KA 3OYAA 5KCOA 1VRUA 4CIGA 4FJXA 3NGIA 1QQCA 1QE1A 5KI6A 1ITGA 2HMIA 2K3XA 4CHYA 3KLEA 1TK5A 1RT3A 3BDLA 4L59A 1TK0A 3V1OA 4E7HA 1JLEA 2EFIA 2MWPA 2XY8A 4M3RA 4FLXA 4FJKA 1RT4A 3AO3A 3VN5A 3QBYA 3D0PA 4Q0BA 3LP3A 4F4KA 3META 2BIVA 4GMJB 3PMTA 2P51A 3DLEA 4KB0A 3HVTA 3LANA 1U47A 2Z1GA 2BANA 3OA6A 3DLGA 5D6WA 4M42A 1HQUA 1TL3A 3CFOA 1U45A 5HP1A 3DMJA 1VSLA 3FEOA 3AO4A 1VSFA 2HHSA 1G15A 3MECA 3MP1A 1IKVA 1ASWA 1XHXA 1Y97A 4NYNA 3E9FA 1RT6A 4OPJA 3NE6A 3CG7A 2O4XB 4HCZA 4FZZA 5JS1A 1RTJA 4AHSA 1N27A 5K14A 1KTQA 4AHTA 4DU3A 3M8SA 3MXIA 2FC0A 2X74A 2Z1JA 4CGFA 4AHUA 1RBTA 1KVCA 3VQAA 4DTMA 2RJDA 4KHNA 3S3NA 1VSEA 4B3OA 3VQ5A 1RBUA 3AVLA 1JKHA 4EP5A 4DSIA 1WGSA 2AJQA 3LAKA 5D6XA 2JGUA 3AVGA 3QJ6A 1IKXA 1QSLA 2HHQA 5KE3A 4DU1A 5C42A 3LGFA 3AO1A 4PLIA 5J26A 3AV9A 3L42A 1UA1A 2QK9A 1KVAA 2X4YA 4UQGA 2YHAA 3ALYA 4IUUA 3U3GA 4Z0UA 1JLGA 3OS2A 2RI3A 2IG0A 1SL1A 1Z26A 1BI4B 3SQ2A 4DSLA 4F3TA 4CF8A 2QQSA 1FKOA 4CGGA 4CIFA 4E7JA 3OYMA 1TK8A 1WAFA 2RPIA 1VSIA 3K58A 3PO4A 1RNHA 1BHLA 2G8WA 2P5OA 1NJZA 5IN1A 4E7KA 1RT1A 5KGWA 4FK4A 3LWMA 1DTTA 4OGCA 3WNEA 3LLRA 4HUEA 1KRPA 4EDUA 2PY5A 3V81A 3O3GA 3NAEA 3AVKA 2OPSA 4Y1DA 4IFVA 2E6NA 5FROA 5T7BA 3L3VA 3KLGA 1WJRA 4KHQA 4CFDA 4O44A 1VSHA 3V4IA 4FK2A 2HHUA 1SKRA 3DOKA 2PYLA 4O5BA 3V1RA 4DTNA 1Z25A 4RW7A 4FLTA 3KK3A 3K5MA 5DK5A 3KKSA 3ITHA 3LALA 3KLIA 4TSXA 3QERA 1D8YA 3VQ4A 2BGGA 1JLCA 1NK8A 4BDPA 3AO5A 4C8MA 4JS5A 3S3MA 1LWCA 3RR8A 4KI6A 2VWJA 4B9XA 2DTUA 3ASKA 3MEUA 3OQ5A 1NK9A 3DLBA 2HW3A 3KKRA 2LVMA 1HQEA 3V1QA 3MP8A 1WSJA 3A2FA 3IRXA 4M45A 1T03A 1TAUA 1J53A 2DY4A 1CXQA 4CF1A 2XHBA 1B9DA 4KTZA 4CERA 4BDYA 4KFBA 4DLEA 4M3XA 3AVNA 5J39A 1C0MA 3LYIA 4E19A 4N56A 2IOCA 3P8HA 1VSMA 3QETA 2G8UA 2OZMA 5IAYA 1BCOA 5FRNA 4B08A 4IDKA 3SUNA 5CYMA 1H3ZA 4CK2A 1NJYA 1D5AA 1JLQA 1UA0A 1RDAA 3QEPA 1T8EA 2YKMA 2B4JA 3HSTB 4GY5A 4CEEA 3O3HA 1EKEA 4I2QA 4LH5A 3RMCA 4CGDA 3OS0A 3MEEA 3CM5A 4CJKA 1HPZA 2F96A 5E41A 2XY7A 3IS9A 1KVBA 4NCBA 1TVRA 3AO2A 4DQIA 2YNHA 4F2SA 3WNFA 1BL3A 3QEWA 4C5IA 3RMDA 2F8TA 3S6WA 1NJWA 1L3SA 4M3WA 4PY5A 2XDPA 3KJVA 1I39A 5I3UA 1RT2A 4CHPA 2FBTA 4Z4CA 3HJFA 2A1SA 4ELVA 1HYSA 4O0JA 5DMRA 4ZHRA 4DFKA 3F70A 2PYJA 4FK0A 4NYFA 2EQUA 3ISNC 4DLGA 2KQ2A 3NBPA 4FCYA 2I5JA 3D45A 3VQPA 1A5WA 1B92A 4CEZA 2DFHA 3CFRA 4KRFA 4LSLA 2IS3A 4ICLA 2D0CA 2HQXA 4ID5A 4RW4A 2FBYA 4AH9A 3SCXA 2XRIA 1LAVA 3L2WA 1VSDA 4B9UA 1C6VA 5JS2A 4IG0A 3S3OA 3SUQA 2OYQA 2G8KA 4Z4EA 4N4IA 2BDPA 4ELTA 3NH2A 3MEWA 1YT3A 1EXQA 1TKZA 2R57A 4DTUA 1C1BA 3ZSOA 4CIEA 3SQ0A 2D5RA 4DFPA 3OYBA 3T19A 1SL0A 3VQBA 2E4LA 1NOYA 3RTVA 4EZ9A 3K5NA 4M41A 3C95A 2KTQA 1S6QA 3O8VA 1LW2A 2G8FA 1JLFA 1XHZA 3LP2A 3VQCA 4OKKA 4B8CA 3U3YA 3QNOA 3ZT1A 3KLHA 4KV8A 4J2AA 3AA4A 2HHTA 4C8LA 3AVBA 4CJ4A 1FXXA 2F5KA 2RI2A 3MXJA 4OKJA 3M8QA 1S6PA 1HMVA 3TARA 2NLUA 1NK6A 1SL2A 1RDBA 3NNQA 3QKJA 1BCMA 5HRSA 4RW9A 3LX7A 2EQKA 1Q8IA 2RO0A 2VYTA 1LWEA 1OI1A 3DB4A 2O4GA 4B9VA 1U4BA 3RMBA 1D9DA 2D0AA 4FLYA 4BWJA 2JTFA 5CZ1A 3C4SA 3MEGA 3QLHA 4CHNA 4YNQA 4OPKA 3MXMA 2E6LA 2X4XA 4E3SA 3THVA 4N76A 2EHGA 4IBNA 4QQ6A 5C24A 4CK1A 1F21A 3OYIA 4CJ3A 2YNGA 2R58A 1L5UA 3OY9A 3VQ7A 1X1PA 5KCHA 4I7FA 4IUQA 3HP6A 3KIOA 2PZSA 4FLWA 1ZBFA 2HHXA 2OPPA 2YKNA 2B8AA 1TL1A 4DMNA 4N5SA 3OJSA 3G0ZA 2GV9A 3F9KA 5HLFA 2D0BA 2IGIA 2IC3A 2NUBA 3LP1A 4FW2A 1Q9XA 2P1JA 3FDRA 3P1GA 4GW6A 3ZSZA 1RT7A 1YVUA 5HBMA 3HPGA 4DU4A 1KFDA 1BGXT 3DRRA 3F73A 4QOZB 4FZXC 4HHTA 4Z02A 3VQ6A 1RDDA 3M8RA 3LWLA 3CM6A 3OYGA 1OYXA 3TR8A 4CK3A 1VK0A 4Q5WA 3V6DA 4M3ZA 3P83D 3SZ2A 1SKSA 1A5VA 5EU7A 1XC9A 3LH0A 3ZEHA 3NDKA 4E1MA 2DAQA 3I8DA 1L3TA 4J2DA 3B6OA 4FJ9A 1IH7A 2JLEA 4F8RA 3DYAA 4KHWA 4BE1A 1DLOA 3HT3A 3KD5E 4MFBA 3HPHA 1KCFA 4B9NA 4BE0A 1IO2A 4JRQA 3OVNA 3L2QA 4FLUA 4DSKA 4FJJA 4KI4A 3V9ZA 4CGHA 1QHTA 1SSFA 2D9TA 4H8KA 4CJRA 1C1AA 3V9UA 1YTAA 2ITGA 2VG7A 3ZCMA 1HRHA 3NFAA 4FJMA 1ASUA 1A5XA 2M1HA 1S9GA 3S9HA 3VQEA 3IG1A 2KFNA 3NTIA 3V9WA 4G1QA 4L8RB 3DRSA 2X4WA 2B5JA 3V9SA 4DFJA 4BE2A 5KTQA 4C5EA 2OA8A 4ELUA 3NF6A 5C6SA 5HRNA 1LWFA 4N47A 3ZSXA 5HRRA 4Z4IA 4GVMA 1BIZA 4DF8A 2VG5A 1C0UA 4JRPA 4M3UA 3MAQA 3B6PA 3OYDA 2IAJA 4CEAA 2ZQBA 4AILC 2M16A 3GOXA 3SNNA 3HPOA 3NF9A 5J2QA 1SKWA 1U04A 3ZT3A 3C6TA 3RRHA 3TABA 1NKCA 1S1TA 3DLRA 1HNVA 2FBXA 4FL6A 3O3FA 4DS4A 4CEQA 2ATQA 4O55A 3FLGA 1W9HA 2PQWA 3QINA 3NF8A 4OVLA 4CECA 1IG9A 4FLZA 1QSSA 1LV5A 4CJQA 1JLBA 1XNIA 2O4IA 3BDPA 3M8PA 5CY4A 3NH1A 4K8XA 1LW0A 1RTIA 4HVJA 2LDMA 1R0AA 4ZTFA 1JL1A 2EX3A 4HUFA 4CHQA 4KKOA 1RCHA 2MWOA 3LGLA 3VA0A 3TI0A 2F8SA 5C0MA 3NGZA 4FJIA 4DQSA 2ZE2A 4DQRA 4X34A 4EP4A 3AVIA 3VQ8A 3JYTA 3SYZA 2XY6A 3HM9A 2BKDN 4PL6A 2ETJA 5C25A 3SQ4A 1D9FA 1BIUA 2QKBA 2YHBA 1EP4A 1KLMA 2DIQA 2G3RA 3H8ZA 2GUIA 4AHCA 3KK2A 3OMGA 4Q5VA 4C5GA 4CEDA 4DF4A 4BD3A 3VQQA 2HB5A 3O4NA 4AHVA 4CJLA 4NS5A 5KRSA 4W5TA 4N41A 2Z1HA 4CJFA 4FJLA 2WACA 4H4OA 3L2UA 3DLKA 3T1AA 2RN2A 1WAJA 3NGYA 4E1NA 3NF7A 4I9LA 3LDSA 4MQ3A 3AA5X 1X9MA 4M3TA 3HK2A 2LRQA 3SI6A 3HO1A 4BDZA 1S1UA 4CFAA 2QKKA 1QSYA 1S9EA 3CEYA 1WSHA 3OYFA 3NTHA 5CIUA 4CEBA 4IFYA 1TKXA 4FW1A 2G8VA 1ZBIA 1L3UA 1FK9A 3VA3A 2L89A 4LD0A 3QIOA 3SPYA 3MEVA 5D6YA 3WNGA 3KLFA 4RG2A 1BQMA 1LAWA 4ID1A 2XK0A 1TAQA 4W5QA 3LP0A 4CEOA 4DS5A 4C8KA 4CHZA 3ZSRA 3PX0A 3SD4A 3DB3A 3MO8A 3DLHA 1QS4A 3PV8A 3K2PA 4QVZA 3CQ8A 3TAGA 1Q9YA 2P5GA 1MHNA 5SWMA 4E0DA 4FJ8A 4ZTJA 4CFBA 1J54A 4FM0A 4DSEA 4KREA 3QIPA 1RBVA 2Q3SA 3H08A 3ZT0A 1SV5A 3FC3A 2L3RA 3EY1A 3KTQA 5FDLA 2YNFA 4DWIA 2RJEA 4DG1A 2W42A 3AVAA 2RHZA 1WNSA 1FKPA 4E7IA 3MEAA 2RKIA 3HVRA 4HTUA 2HNYA 3OYJA 4FXDA 3UWNA 1WJSA 4WE1A 4F2RA 4KTQA 2X78A 3SQ1A 4CGJA 4DSFA 2DIGA 1B9FA 4B8AB 2YNIA 1K6YA 2FHDA 2RHUA 3Q1JA 3P8DA 1GOBA 2E6MA 3VQ9A 2EQJA 5J2MA 1NKEA 1VSKA 2X6SA 1HJRA 4B9TA 3P5JA 4CJUA 2RJCA 4DFMA 4OVAA 3OMCA 1CZ9A 3SJJA 1XI1A 3KD1E 1SUQA 1TGOA 4RW6A 4A4EA 4AHRA 3OJUA 4OLAA 4QQGA 1HNIA 3CFPA 4DTRA 2X6NA 2VG6A 1X9WA 3HP9A 3QEIA 1JL2A 3SUPA 3TAQA 3C94A 5CYQA 3LPTA 5KGXA 3RWUA 3ZSQA 3L3UA 1X9SA 3DLMA 3PX6A 4N4GA 1L3VA 4B9MA 3SV4A 1WSIA 2HQEA 1RILA 1UWBA 3EZ5A 1NK7A 3PUFA 2HNZA 5CZ2A 1TV6A 3PMIA 1IKYA 4O4GA 3KUFA 3V9XA 1UOCA 2KFZA 1ZBLA 4HCBA 1ASVA 4YFUA 1NJXA 4F3OA 1IKWA 2IDOA 1W0HA 4DTSA 4Z4FA 3TANA 2EQMA 1G5VA 1O1WA 3QEVA 4H4MA 4IUPA 2RI5A 3FFIA 3L8BA 2K3YA 4II1A 1CZBA 1RBSA 3ZT2A 3LZJA 3DM2A 3SV3A 1HYZA 1S1VA 1ZBHA 3BGRA 4QCLA 2GFUA 3HXMA 3TAEA 2X35A 4QAGA 2Y1JA 4PUOA 3OB9A 4KHUA 3K5OA 4LH4A 2HVIA 4CHOA 3PFSA 2HHWA 4CJ5A 4OJRA 2RJFA 3OYEA 3AVMA 4KTWA 4IKFA 5KRTA 1ZYQA 4J2BA 2KZMA 1RT5A 4CJTA 1C0TA 3U6FA 3QESA 3QEXA 3QNNA 3OYKA 4FM1A 3OYHA 3PO5A 3G10A 4BWMA 2E5QA 3I0SA 2G8HA 4I2PA 4KPYA 3K59A 4E89A 4PLLA 1HYVA 2RF2A 4A4HA 3TAMA 4XIUA 5J2NA 4KAZA 3MP6A 2GF7A 4IUVA 1S1WA 4CESA 2R7YA 4RW8A 1NK5A 1N5YA 4N4HA 1JXEA 3LPUA 1NK0A 4B9LA 4OGEA 4OKEA 1WSEA 1WJQA 1KFSA 1KLNA 1C1CA 4KO0A 2XY5A 2M0OA 4HCCA 4A4FA 3M9QA 3CYMA 1T7PA 4B9SA 1S5JA 4R5PA 4IUTA 4QW2A 3L2RA 2RHIA 3E9GA 4FLVA 4CCHA 1JLAA 4JLHA 3ASMA 3QO9A 3SPZA 4Z4GA 1RBRA 2OPRA 3DOLA 4LY7A 2A1RA 3OYCA 1OZ2A 4KHSA 3L2VA 4C8NA 1ZBUA 1U48A 3AA2A 2Z1IA 1KHCA 4W5NA 2YV0X 3H6ZA 4LD6A 1NOZA 4KB1A 1NKBA 3NTKA 2LCCA 4DTPA 2KW4A 3MEDA 4DQQA 3ZT4A 4CFCA 2RHXA 3UT1A 1RDCA 2OPQA 2FBVA 3PY8A 2HVHA 4EZ6A 3TWHA 1U49A 4CJPA 4CJSA 5HRPA 4DTOA 4NCAA 1XWLA 1MU2A 3LZIA 3LAMA 4DQPA 4O0IA 3T3FA 4FJGA 4FZYA 4J2EA 1RTDA 1YTUA 1EETA 2VWKA 3QIIA 5KE2A 4CJEA 3O4QA 4FYDA 3I0RA 4K8ZA 2QQRA 2CKKA 2GBZA 4JS4A 4E7LA 5I42A 3AVCA 2DFFA 4W5RA 3VQDA 3HL8A 4DTJA 4C5HA 2EKOA 2RHYA 4DSJA 2R5AA 2O4XA 3OS1A 1UAXA 4Y1CA 4W5OA 3EAEA 1WN7A 2QXFA 4CEFA 4FJ7A 1J5OA 5D3GA 4Z4HA 1RTHA 3ULDA 3PNWC 5HROA 3PX4A 3UIQA 3ME9A 2JZ2A 1WLJA 4KHYA 2Y1IA 2KZZA 4BACA 1EX4A 3ZSYA 1J9AA 4CF0A 1WSFA 3AVHA 4CF2A 2WONA 4PWDA 3DRPA 3TAFA 2L8DA 2BUDA 2YRVA 4CGIA 4RG8A 5SZTA 1KSPA 3KK1A 3ZSWA 3RR7A 2OZSA 1TKTA 1VRTA 2HNDA 4A4GA 4FM2A 4QQDA 1CXUA 1GOAA 1GOCA 4OLBA 4IURA 1WSGA 3ZSVA 5J1EA 1REVA 3NHGA 4FJHA 4FJNA 2BE2A 5J2PA 4NZGA 1T05A 2R5MA 1CLQA 4PQUA 2B6AA 2LTOA 2GFAA 4C8OA 4UC4A 4CRIA 1JXBA 2DFEA 1S1XA 4CE9A 1BQNA 1RI0A 2WOMA 1VSJA 1BISA 4FU6A 5M9OA 3HYFA 3DI6A 3NCIA 4CJWA 5KH6A 1QTMA 2LSNA
chains in the Genus database with same CATH superfamily
4N0BA 3FBIB 3EE8A 2P5KA 4GNIA 4BS9A 4LF4K 2FBKA 1ABQA 2XO7A 2ZSHB 3OYLA 4DV2K 3MWPA 2XSJC 1WHMA 3SBGA 2P5VA 2EFIA 3M1CA 5GAEJ 3HFOA 3BCAA 1I50J 4R79A 2FLOA 3QBYA 2Z9OA 3K1PA 1ZKGA 4BJTA 3DLGA 1QPIA 2QWQA 1XG7A 3U23A 3NE6A 3IUOA 3E9FA 1TUCA 4KN4X 2V1NA 1N5ZA 3G6EI 2FC0A 4AHUA 3EKUA 4BI3A 1GXQA 3NQOA 3AO1A 2V6EA 3VGKA 5TKYA 1SL1A 4M75A 4H5NA 2VASA 2VC8A 2P5OA 3SZPA 1LQ1A 3K4CA 3WT0A 2E2NA 3CCLQ 2KR3A 2YPRA 4XTWA 4RW7A 1GCPA 3KLOA 3G1JA 4C8QE 1TQPA 1SFOJ 2VWJA 1Y1VJ 1NK9A 1AHJB 3KKRA 1ERDA 1TAUA 2LLKA 1KQSA 1JBMA 3I55Q 3TBIA 3M4YA 3P8HA 3TO9A 1JLQA 5BREA 3DV8A 1GBQA 3VYTB 4CCKA 2MPXC 2AIRB 3F3XA 2K3BA 3U1KA 4F2SA 3WNFA 5AQOA 2VB6A 4DFKA 3OYYA 1RI9A 1EQYA 3IFRA 3GTGJ 2QTXA 1IF1A 4RW4A 2D0CA 4UVBA 2R7SA 3J8AA 2BV6A 2CV0A 1EXQA 3DBLB 2JM9A 5LL6Z 3SQ0A 2XF5A 3KTUA 3M56A 4B8CA 3UPUA 4J9CA 2HXIA 2RI2A 4OKJA 1SHFA 2FZGB 3Q0UA 3QKJA 1V3FA 3LX7A 5FPNA 2PEXA 2OJ2A 2E6LA 2X4XA 1BUPA 3VS4A 1NMNA 2GWKA 4IBNA 2H8RA 6PAXA 2PVGB 3JCMg 3O80A 4AF1A 1FEXA 1GLFO 3PIPL 4C30A 5AQNA 4JAXA 3RPQA 1NE8A 5LJ5f 4LOCA 3QPSA 3OJSA 5CQGA 3J7AY 2YG8A 2JQ7A 2D0BA 5F2RA 4FW2A 3M0PA 1X3NA 4Q47A 2ZXJA 5LD2C 3AT1B 1RAFB 1MBHA 3CCRI 5GAHJ 2P9KA 1W36D 1HU0A 2DDAA 1APLC 2A6HF 3HHHA 4HSBA 3OV8A 4PJOE 3KK7A 3FXOA 1M90R 4IIMA 4CGHA 4YDUA 2ITGA 3NFAA 5LJ3e 3I59B 1XTDA 4AWXB 3VQEA 1RUNA 3DBRB 1WJBA 4Z4IA 3ZSXA 1ZH5A 4DF8A 2RVCA 5I11A 4M3UA 4BRLA 2F2WA 4FL9A 2I7NA 3H9JA 4EJUA 3OH9A 4C0DC 4RB2C 3D7SB 4AVZA 3ZX3A 1I1GA 3LW5E 1KD1U 3QYFA 4A62A 3BZ6A 1PRLC 2WAQN 2R5ZA 3RKYA 4X34A 5FFZA 3JYTA 2PQ8A 4MFEA 3WVEB 1ZARA 1K7AA 2QTDA 2KGTA 4NNJA 1J7KA 4U87A 5GAOp 3CD6Q 2MAMA 1CQTA 3VYRB 5J3BA 3H46O 4MQ3A 3F2KA 4DCHA 2IA1A 3IWZA 4BDZA 3EH2A 2HEQA 3CMEA 1YQLA 4M7DF 4XR6A 5IT9O 4IFYA 2UUBK 2HOAA 5FLXE 4CEOA 3CXCS 1ORNA 1YITA 4BBSJ 4B23A 2KQWA 4NHJA 2AXTC 4IRIA 2Y9YA 5IXBA 3H08A 3I55I 4MZTA 4ZNXA 1XSXA 2R7RA 1NGEA 3J81E 3CC4I 4X66K 2HTJA 2KRHA 3AVAA 5D8KB 2PLYA 4KGXB 1Q81R 3H0GJ 2ZAEA 4G94A 3A8OB 2E65A 4CJUA 1AOYA 1XI1A 3HOWJ 4M3FA 1LOJA 3K10A 3HP9A 1FOWA 3LPTA 1UWBA 7AT1B 3JR9A 4YFUA 2HNHA 4L9TA 5KQDA 3E19A 3AAQA 2HNIA 1S1VA 1RADB 2LQNA 5CQYA 2L4AA 1KU9A 1K9MC 4D8DA 1D0YA 2JSCA 1NGIA 2HF3A 4J6XA 4CJTA 3C2GA 3CMAT 4A4HA 4XIUA 4CESA 2H3EB 2MH9A 1JXEA 4B9LA 1BW5A 3R8EA 4RB1A 4X9DA 1OPKA 5FLMJ 4FLVA 4CI6A 4JLHA 4M9ZA 4D1QA 4FPBA 4F14A 1JO8A 5LHHA 1XGMA 2KW4A 3O9UA 3X20B 2OAWA 2ZPEB 4JKGB 5GAGP 2YCHA 1SVOA 4XN3A 3ERMA 4AI5A 3W3DA 3OHRA 3I55A 1QWEA 4FYDA 2GBZA 4DZJA 2DFFA 2CP3A 1HNZK 1P9QC 3SWNA 4Y17A 4ME7A 5F6FA 2AP1A 4B1YB 1YJWT 3JRHA 1X1CA 3DRPA 4ILJA 2YRVA 4RG8A 3UE5A 4D7NA 4LFBK 2M2EA 3U2RA 1ZUYA 5GAN2 3FMSA 1REVA 2NVYJ 5CLSA 5BPDA 4B6MA 2GFAA 2HU9A 1AZGB 2L54A 1GRIA 4D6WA 2LH9A 1VSJA 2FPFA 2PJRB 4FSSA 1PVSA 2GQIA 5B1AH 3OSGA 3RRGA 2P9SA 2L3SA 3ZQHA 2CSIA 3K5LA 4B9WA 5FU6C 4PJOB 3Q5FA 2XHKA 1HSQA 4F7ZA 4WCIA 4DTXA 4FYWB 2K27A 1A35A 2JG6A 3EFSA 3O08A 4M3YA 2Y2ZA 1MNEA 3NGPA 4FJXA 3VF6A 4H0OA 4WWCA 2I0NA 3KLEA 3KFWX 2LJ1A 2F7TA 1ETVA 4M3RA 4FLXA 3LP3A 2MK5A 3KVGA 2YSQA 3GDQA 4CICA 1IGNA 3F5TA 3CCQN 1UZCA 2JPCA 1G3WA 4C0ZA 3KWIA 1V55H 4DKWA 4IL6C 4NYNA 1XHXA 1EA3A 1G8XA 3JCMd 2V7YA 3LSGA 5JS1A 4BBRJ 1T38A 2NVTJ 4BRNA 1XNRK 1ORKA 1H9GA 2K79A 2EFNA 1ZAOA 5GAGJ 1DGKN 2PU9B 1QSLA 4E70A 1P4WA 3MX5A 2RV8A 2X51A 3IUCA 3PSIA 2WY8Q 1VQMI 2X4YA 4DV7K 4LD9K 4BR7A 4CGGA 4M77G 2O31A 3PO4A 5GAOq 2ELJA 1K78B 1FJLA 4DNCA 4E7KA 2CREA 2QWNA 5DM7L 4CFDA 1VSHA 2CRGA 2HBWA 3PIOL 4O5BA 3G6EN 2QBYB 2EV0A 2WC2A 1XQOA 2KBTA 1NK8A 1B8IB 4M45A 4MO4A 4CERA 4YOWA 2Y75A 5J8CA 1QHAA 3BTJA 4A3JJ 2QA4N 4M7YA 1EKEA 3RMCA 3JB9D 4CYCA 2L9SA 4H0VB 2H1LA 2ME6A 5HLHA 4CCLA 4EEFG 3OIQA 1SD5A 4X1VA 3GTQJ 3ECHA 3I4PA 2RQWA 2KHOA 2KK4A 5EX5A 3BJAA 2MLGA 2BDPA 1CF7B 4ELTA 4A0YA 1I8FA 3ZMSA 3QPTA 4LN2A 1P8ZA 5IT9Z 1LW2A 4FETA 1VQ7T 5CCAA 3LP2A 2HHTA 3QNOA 2OBPA 2E5NA 2K2MA 2QF7A 1BCMA 1XMXA 5L3DA 2MW8A 2STWA 1VQ7A 1RRJA 3T69A 2EZIA 3VV0A 2PNIA 1I6XA 1XDUA 3M4GA 4QQ6A 4HF1A 5GAMj 1H88C 1LDJA 2DL8A 2CGJA 3D6RA 5CHIA 4IUQA 2OPPA 1O7LA 2IGIA 1R0CB 3L6QA 3CC7Q 2OTLT 2DCEA 3BY6A 3JCMe 2DAOA 3G25A 1VK0A 5LJ5d 4KJZA 1VQ4I 3H3ZA 2MC3A 5KPTA 3FBNB 2W04A 2K9QA 3EKSA 3LH5A 3VEWA 1JEGA 1E3PA 1S9GA 5AZJA 3BTLA 1B4AA 2B5JA 3CMAQ 4JJCA 2ESNA 4GLMA 5KYNA 1QVTA 3EG1A 3CCMI 5E1ZB 3SMSA 2DE0X 2DXBA 4YPHA 3HOTA 2JA6J 1OEBA 4YFXF 1WEFA 4C1NK 2XICA 3JCMQ 1H3HA 5ILSA 1IZ6A 3TVTA 1P7JA 2O4IA 2L7MP 1DT9A 4HVJA 3J7AO 1GLDG 3QPHA 2HOSA 1HD3A 1OULA 1R5HA 2A5XA 1TW2A 1AA7A 4B1WB 3SYZA 2FSWA 4G6QA 2VKNA 1VA7A 2O03A 4U88A 4FJLA 1OVYA 4H4OA 4CZJA 3L2UA 1MDMB 2F9WA 2QWRA 4J9FA 2LT4A 3H1CA 1LWYA 4PKIA 1NGCA 2FEZA 1X1BA 4LNPA 4LD0A 3QIOA 4KNYA 5AZIB 3MPUB 2CP6A 3SD4A 3D5SC 4C2UA 1H9TA 3ZQFA 2KEAA 3TAGA 4E6RA 1MHNA 4M78A 2B0LA 4J83A 2DXCA 1KC8C 3CCUN 2XAHA 4EA4A 4OINF 2ZJQF 1T98A 4HWIA 4WF9L 3OW2P 2M30A 4MNUA 1LOTB 4HNUA 3UWNA 4F2RA 4KTQA 3SQNA 1IO6A 4Z88A 1N8RR 1Z9CA 1EFNA 4QKUA 3CD6I 1CZ9A 3VFZA 3QBXA 5EZGA 3QOPA 3K4BA 4L5IA 1X4PA 1KXPA 1ZGAA 3I56I 3L3UA 2P6SA 2DETA 2V8JA 1S22A 4H0PA 1WHLA 3BTCA 1FTTA 3JTHA 3K1MA 2ISYA 2UUAK 2ZMEB 1JCEA 2WV0A 4BY1J 4UVCA 1UGRB 1JJ6C 1RAAB 4LH4A 4XRSA 2E1NA 1BN5A 1Z0XA 1Q81O 1SKUB 1G83A 9ANTA 5GAN5 1QP3A 4EGYA 1NK0A 3LSTA 4EMHA 2AQEA 3VS7A 2DT6A 1MUDA 2EGAA 3QO9A 2WBNA 2KKZA 2KFNA 2RHXA 4XOPA 1UG1A 2O6GE 1QVGA 4CJPA 4NCAA 1H1VA 4Z94A 3T3FA 1OV3A 3ID8A 4FZYA 2LTPA 1YTUA 2VXFA 1VQLA 1G59A 4A0XA 3M1FA 3THKA 4K8ZA 1BOTO 3CPWA 3EGXB 2F5EA 4E7LA 1FYMA 5I42A 2DJQA 3GBGA 2JA7J 3A02A 1MUZA 3L1AA 1BK2A 2YU3A 4M7DC 3ULDA 4BRFA 1BOBA 2GIZA 2DEQA 2GNCA 2RQRA 5JR3A 2L2OA 1S72T 3H5AA 4NZGA 4M63C 3KLNA 2LTOA 1JXBA 1OH7A 2DFEA 4CE9A 5KAFC 4B4CA 1YI2A 4M7DE 1NKCA 3CPWM 1R7JA 5FLVA 1VQ8N 3IKMA 3NH0A 5FFXA 1T0FC 3LWHA 4K11A 4HOBA 1DDNA 2RQPA 4FVMA 2VC1A 3WNHA 4A3LJ 3O9SA 2P8TA 3R1XA 4Y7NJ 2M9HA 4DIQA 2P7VB 3ZEUB 2MWPA 5TGTA 4B1XB 2ZPHB 3D0PA 2Y30A 4BQQA 2P51A 3QFPA 3O3KA 2LJ0A 4XBFA 1HA8A 3F72A 3CTAA 4NO7A 3X2QH 1RTJA 4PKHA 1B6AA 5KYWB 2COMA 3CLQA 1ODDA 1RBTA 3RKXA 4CYDA 4HSTA 2ELHA 4MLHA 3SEZA 2AJQA 1E4GT 3CC4Q 5H1SQ 2EAYA 4EIKA 3LGFA 1IG8A 2OAUA 1QCOA 4XU0A 2YHAA 4E9EA 3DXMA 3OS2A 1Z26A 1X69A 1Y8RB 2P9SB 2K2VA 3CQXA 4Q4ZF 4M9XA 3D5LA 2NWMA 3WNEA 4Y1DA 4JZ3A 1NGDA 3L3VA 4XK8E 2HDAA 2E1MB 4FK2A 1UJ8A 1SKRA 3V1RA 3CC2T 5H20A 2DYBA 1NBWA 4ZH4F 1PRMC 1OH5A 3NPFA 2KIQA 4NLBA 2MF2A 2GXAA 4KTZA 2DPPB 1XPXA 3LYIA 2IOCA 3HTVA 1W5SA 4CUGA 3RQ4A 3CJNA 4HKEA 2LKXA 4KH5A 4XH5A 4CEEA 4CJKA 2VT2A 3OSFA 2R7FA 3IS9A 1OCOH 4FWLA 4C5IA 2GTDA 3S6WA 1L3SA 2I5WA 3SJHA 3L7WA 5DMRA 1QZZA 4ZHRA 2EH3A 2DA3A 1S9HA 4CEZA 3TO6A 4LSLA 2WTUA 1YIJT 3TU5A 2XRIA 1WPYA 2EA2A 3CXCP 2G8KA 1BU6O 3NH2A 3WGHA 3CC2N 2KI7A 5FWBA 5M5YJ 5KQ8A 1F9NA 4BY9C 1ACIA 3O8VA 3CCYA 1ZX6A 1IN6A 2XDDA 2E5KA 3AA4A 2IVPA 3RNJA 1SL2A 3NNQA 5DCMB 2LRDA 1WGXA 2P4TA 2QW9A 5A0DA 1P90A 5B66C 1IBLK 1F21A 5GMKj 4BY7J 3CCLN 4NDLA 1L5UA 2P9PA 1YN8A 1ZUKA 2YKNA 3RKQA 4EJZA 1PP8F 4MQVA 5HLFA 3LP1A 4XQ3A 1O9SA 4RBOA 3QWLA 1B9NA 1PWTA 2IPQX 4WFNL 3P83D 4B43A 4DR1K 4J2DA 4C8QD 5A0LA 2JLEA 1IREB 2P0PA 3UKRB 3RUXA 2QCOA 1J59A 5BPNA 5GINA 3HSFA 3FMRA 3CERA 3HRTA 2DOFA 4BC4A 2LNVA 1PUFA 2L3PA 1TWBA 1UHCA 2ZMEC 4DV0K 4L8RB 4BR2A 3S41A 5I2MA 2A3SA 3BY7A 4QSHA 3KYLA 1ZA1B 1T6DA 3H9QA 4BR9A 2F5FA 3I59A 2JT4A 1TNSA 1NWKA 5J2QA 5LJ5h 2FBXA 1QVGP 4FL6A 3N5BB 1REPC 4MZMA 1Y1WJ 3PUBA 3EPZA 1BI2A 5BRFA 2NOJB 1QHGA 4HVWA 1FSHA 1R58A 4ABZA 4FJIA 3ULEB 3GIBA 3HHGA 2HVQA 5C25A 1QZEA 1BIUA 4BXUA 2ICWG 5F0CA 1M8MA 5BNGA 5KPZA 2QQBA 5GAEP 3FB9A 1NBEB 4W5TA 1V54H 5HS8A 2Z1HA 2OZ6A 4XM3A 2E41A 1DU0A 3HBLA 4IOCL 1YJNN 3NFCA 1TKXA 4KUMA 1L3UA 3RPUA 3CDIA 3EEQA 3MEVA 1VQ9A 3KP3A 2V4JC 4I6MA 4W5QA 4PNOA 3F8FA 4CHZA 3TTDA 3TDZC 2X6OA 4NLCA 4XQFA 1IBMK 1H0MA 4FM0A 5KYXB 2OAZA 2DA5A 4HV6A 4X64K 4AI4A 1MSEC 3NRVA 2MD5A 2MSYA 2CQNA 3CHWA 2HDWA 3DTIA 2W7NA 4B8AB 2WSCE 4L18B 3IHUA 4X62K 1LWWA 2DMTA 2VN2A 3K7AJ 4QQGA 1PP7U 1O3RA 4FWMA 1LNXA 1WSIA 1Z6RA 1SVMA 1WEIA 4XLCA 1UOCA 4ISEA 2IDOA 1HNXK 4O6JA 4FVUA 2DERA 2BY2A 1YW8A 3CP2A 3HXMA 4BG8A 1U8BA 2YWWA 2HHWA 3U1DA 4GYIA 1Y57A 3E6BA 3OYHA 1W2BM 2DXUA 2RF2A 4XTYA 4IUVA 1N5YA 1PG5B 2GCXA 1ILYA 1C1CA 1MMAA 3E0JB 4F55A 1KSWA 1WB9A 2GQVA 1B9MA 4Z4GA 4KHSA 2YLBA 2CZ7B 1U48A 3C7NB 3VENA 2DD5A 1LUJB 2ZPGB 1VQKA 2ETHA 4DQQA 4GRIA 3S1NJ 4EZ6A 4DTOA 3HGGA 3T9NA 2KT8A 2CZ1B 1VZ0A 3G4SN 4PCQA 4ZN1A 1W4SA 5KE2A 1HKSA 5DD4A 3M55A 3J7AF 4JOMA 2R5AA 1HOMA 4CD1A 3LA7A 1ULYA 5D3GA 4BAYA 3K6GA 2KROA 2QXLA 4M75G 1J9AA 5K5RA 2GA1A 3U8XA 3TAFA 3H0FA 5EG2A 3ZSWA 1N36K 4FM2A 4WXDA 4GLKA 3S1RJ 1FIPA 2CW8A 4F93B 1D09B 3LM2A 2DK8A 4OFAA 3PNYA 1T95A 2COZA 3EGDA 3VUZA 3BDUA 3NCIA 2LSNA 4RCCA 4OWRB 1BI3A 2ZFUA 3VF4A 3QDKA 4PA1A 4FWRA 3HHTB 3RDVA 3GTOJ 1YX5A 3JSOA 3RVCA 4H5VA 1TKDA 2E3HA 4MMLA 3BR6A 1K0XA 4OMYA 1OCTC 4ZGEB 2HMIA 2LY2A 5EOYA 4CHYA 1TK5A 3QODA 4H0EA 4L59A 5GANe 1YXQA 1ZR2A 5DUKA 4Y52J 2CMPA 3ECOA 3JRFA 1AT1B 1TWAJ 5EJCA 4ZDPA 3S14J 3PE0A 2BANA 1TL3A 2VODA 3O5BA 3ZN0A 5A2QO 4V19S 3M9AA 3FHNA 2ZGYA 2OV7A 5K14A 2J5PA 1JXMA 2Z1JA 1NEBA 1OPLA 1VSEA 2XRNA 1ACMB 2XGDA 3CUQB 2DNUA 3MZYA 3CCUA 4HXJA 2DYSH 1BI4B 3SQ2A 4TV7A 3G71I 2EKHA 3VPZA 3WQTA 2RPIA 1ZBSA 3IH2A 2JVHA 1XSVA 4RTTA 2J7IA 3K69A 4Q5SF 2ZKZA 3KBGA 3M0QA 4UB8C 3D0SA 2HD0A 2HKNA 3KK3A 3K5MA 4PSXA 5DK5A 5GAOr 1BJZA 2BZYA 4PJMA 4BRAA 3LM9A 2IAIA 4XKBA 1X3UA 3OQ5A 3PM1A 3F0ZA 2R5YA 1VQMA 4JUVA 3VUBA 4DLEA 2LYCA 2ID6A 5CK9A 1UA0A 1Q1VA 2V7ZA 5GAMh 1VQPI 2F96A 2GQQA 2LBFB 2G9WA 4BI4A 3VEXA 1NJWA 1G2BA 4IRHA 1RT2A 3PLAA 1W7AA 1ZRFA 2DRMA 1K4SA 1S72I 2J06A 5DYMA 5CVJA 5ADXH 2V7FA 3TW7A 3A8YA 4C1NI 2HQXA 3KFVA 4IG0A 3CC7A 4HX8A 4DTUA 2Y0SA 3ZSOA 2TRTA 3P9KA 3GBTA 2O9LA 2KPMA 4KV8A 2A6TA 2DTIA 1JJ2M 3H5NA 4K43A 1S7AA 4BVOA 4JI0K 4XSXF 3WTXC 4PJOF 2DA4A 4IZ9A 3S8PA 1LWVA 1YI2I 3GBQA 5CE3A 4JN4A 3MEGA 4O8KA 5AQSA 3THVA 4JI6K 3HOVJ 2XU8A 2YNGA 3VQ7A 3GCMA 5KCHA 3KIOA 4W97A 4FPAA 4YRVA 3K0LA 1MH3A 4L9VA 2CP7A 1JGSA 3MKZA 1NG9A 3TP0A 3GEZA 1VQKN 4FZXC 3WHCA 2MOXA 4L9JA 1MUNA 1D8JA 1VIFA 2P5LC 2ZO4A 4Q5WA 1NM1A 5JHUA 1G3TA 1UDLA 4LDVA 3HT3A 1X2KA 1IC8A 3OVNA 3QYGB 2DEUA 2LC2A 4OIRF 1XJWB 3V9UA 4CJRA 3EG3A 2P9UB 4FJMA 5JFRA 4M7AB 1TNTA 1I4K1 4XTZA 3A01B 3HSBA 5E3NA 4BE2A 2BW3B 5AQTA 1S72A 3A98A 1GLEG 4DR2K 2VG5A 2YRCA 1XB4A 2NS0A 4L9NA 2G7HA 3UB5A 3B8AX 2DMUA 2ZQBA 4AILC 1ZK8A 4X9CA 4DB3A 2RK1A 2WAFA 2DA6A 2K6DA 3TEEA 1PVEA 4CECA 3VS1A 3NH1A 1R5ID 5GIPA 5DEQA 1D0XA 2ECCA 2R7WA 2JJ9A 4RTFD 2XY6A 4R0KA 2DIQA 1MJ9A 2PBDA 4AHCA 3ENBA 1RACB 1I1JA 1G3SA 1K61A 2IXSA 2OTJQ 3T1AA 3G6EA 1IN8A 1X9MA 1YQAA 4PL7A 1YJWA 3KCCA 2JTEA 2OX7A 1MA9B 1PUFB 4RG2A 2V9KA 3GFMA 1U9NA 2E2IJ 2Q8KA 5CYVA 5AZJB 3DLAA 5KYUA 1YE9A 4ORZA 1J2XA 4MTDA 4J7FA 3BT9A 2RHZA 3ASNH 4BXFA 4U7BA 4J19A 1ZQ1A 1P59A 1HSJA 4FYXB 5FU7B 1U6GA 4DYQA 2UXCK 3LQRA 1WWXA 2HOEA 3SUPA 5LBQA 5HLTA 1FPQA 1RRSA 4L5GA 1L3VA 3C12A 2QAZA 3VS5A 1IKYA 2DFIA 1NEGA 1UFFA 3QSUA 3R6OA 1ABOA 2FX0A 2RI5A 3EGUA 2L3QA 1TYQA 1ZSZB 2K3PA 3HZJA 2HF4A 4KN7X 2BBYA 4VUBA 2PMHA 1WBDA 2HVIA 2A61A 2DOAA 4OJRA 1MPGA 4G12A 1RT5A 1NLPC 1VQLQ 1VQ8T 1YTYA 4BWMA 3FK6A 3VEOA 4FT8A 4Y28E 3JAMO 4C92E 4IOAL 2EA4A 4EMKB 3VWBA 3V8JA 1YO5C 4A4FA 1ATRA 1PU6A 3U4LA 3L2RA 2LNHB 5M5WJ 1FJGK 3V8LA 4AFUC 2L2PA 3DAWA 1M3HA 2Z1IA 2M3AA 5ICCA 1QVUA 3CPFA 3CQZJ 3THXA 4GKKK 4J2EA 1YOVB 3QIIA 2MMPA 2L9RA 2E6ZA 3AVCA 3QU3A 5EEGA 4Z4HA 2XROA 1FTZA 1MW7A 3HPWA 3S17J 4LF5K 1QPMA 2CH0A 3K70D 4M72A 1TU0B 4M78C 2D6FA 2A69F 2BHZA 3VW4A 4IURA 3IL2A 2PUKB 3EG9B 3WTSC 3BG7A 1CLQA 4UC4A 1IG7A 4E6KG 1RI0A 2O88A 2QWWA 2VBYA 5DD8A 2XPVA 2VPLA 1W2BP 3D2EA 3ABKH 3TAPA 2VOOA 2ACJA 5GANh 1I0CA 2Q0RA 4I9QA 2ZJRL 5D4RA 4CIGA 3IKTA 4EA5A 2FF6A 3VEVA 1GHCA 2VT3A 1VQ5I 5J6XA 3GTMJ 2JPSA 4LMYA 1F36A 2PJPA 2YRDA 3E7LA 3CFOA 3C2HA 4JKCA 3H3UA 3JB9H 1Q82R 2O4XB 4FZZA 2H8WA 1KTQA 2E2QA 4N0AA 1J5YA 1CSKA 2F4MB 1JKHA 1RDWX 2NUPA 3QJ6A 2K9GA 2D1HA 4A3IJ 5KYYB 4PLIA 3AV9A 1KVAA 4UQGA 3VDXA 4G9ZA 1SG5A 4C3IJ 1UHMA 2F48A 3CJRB 1VOMA 2G8WA 1NK2P 4PWDA 2PY5A 4OGCA 2HXOA 1KRPA 5GAN3 4L0ZB 3EE9A 1MSFC 2OC6A 4KA4A 4EGZA 1QRYA 2JUCA 4FIBA 3VQ4A 1JLCA 1PJRA 5CVUA 3RR8A 3MEUA 3CCEA 2I7PA 3DCFA 2V1QA 3BY5A 4NC8A 1YWOA 2CV2A 2R7XA 3LA2A 3G71N 1CKBA 2FYKA 5KYUB 3A0IX 3FKIJ 4ANJA 1HPZA 3UKUA 3G1LA 4I09A 2FF4A 3ZMZA 3C65A 5ERIA 1BL3A 4G6TB 4Y92A 4YELA 2FQ3A 3D2FB 4O0JA 1IBKK 2HDDA 3CCQA 2DVJA 4FT4A 3UKGA 2O8DB 4XOTA 1DPRA 2D45A 4LF8K 3REBB 1YIJA 3ROUA 1MV3A 4Z4EA 1BA1A 2QM1A 3ZFJA 4UV8A 3FXMA 1T6CA 3KZYA 1C1BA 4CIEA 4FE7A 1K8AC 1ZELA 2R5ZB 1C0GA 1Z7UA 1XCVA 1LFUP 1AU7A 3AVBA 2F5KA 4G7ZF 3GUDA 1VQ7Q 2DL7A 2VYTA 2G7UA 1ZHIA 2O4GA 2ZCFB 2K5IA 3C4SA 4N76A 4M7AC 2O9SA 3MVPA 1S3XA 4CK1A 3KEOA 3EHQA 1TXQA 3JS6A 1HQCA 1VUBA 1Q82U 1BO5O 3MCZA 1NJIC 1Q7YC 3PT9A 4LB5A 1O57A 1GDTA 1TG0A 1QQNA 4QS7A 3K4JA 5GJWB 3TR8A 1QW1A 2RA2A 1B72A 1A5VA 5KPRA 2DILA 4DBQA 2V1UA 2DW4A 4N9HA 3DYAA 4JKBA 3VRYA 3CXCA 1OOTA 2GBQA 1KQSS 2Y0SN 3HUGA 5KYXA 5B1BH 2KY9A 5KNLA 1ETOA 5KTQA 4O8UA 4M7AF 1LWFA 3VEYA 1BDGA 3M4OJ 2OFIA 2V75A 3CCEQ 3S32A 1MJBA 2DPDA 1OU9A 1Q7YO 3DLRA 3CCRT 1IG9A 3WXIA 1KU3A 4WXCA 5JLXA 1GFDA 5JVGL 2NXNB 2MD0A 5JLHA 4MLOA 2A5YB 2CJJA 3CPWS 4LUDA 3RSEB 5FD6A 3VA0A 3C6HA 4XLNF 1PYVA 4DQRA 2GXBA 3AVIA 2AQFA 5KVRA 2P9IA 3K9KA 1E4FT 5LRSA 5CPRB 1WJEA 4ZZDA 2VQLA 5C4XJ 1M9SA 3DLKA 2RN2A 3NGYA 1WPKA 3AA5X 4XLFA 3WXJA 1MKMA 5CIUA 2EIMH 2HZDA 4YOUA 3I56N 2NOGA 1XS9A 1P6RA 2OU2A 3JV3A 4RWTA 1UFMA 3KTQA 1HPMA 1Y07A 2W42A 2IGOA 2P9IB 2CT3A 3MEAA 3DBHB 4OAZA 5JHFA 3AHUA 2YNIA 3JCMW 4ZYEA 1ZN2A 4B9TA 4JD2B 4K41A 5AN4A 3KD1E 2DZCA 3H0IA 4LDUA 1BJAA 5F0XA 2QZ8A 2ED1A 4F92B 3IC7A 3S1MJ 1K8KA 3KP6A 5DY9A 1Q86C 4B9MA 3GTPJ 3SMPA 1K78A 2PG4A 2WV1A 2JNGA 4CD3A 3EFOA 2QENA 2K3YA 2DD4A 4CBWA 4NXNK 2XKOA 5AQHA 3CVSA 4PKGA 3T7ZA 4FM1A 1YS7A 1MBGA 4PJ0C 1WHGA 3D7EO 4JI5K 4KAZA 4RW8A 1YITN 1IN7A 5EVZA 4HW0A 3BEXA 4OGEA 1KFSA 3HTUA 4KO0A 4NQWB 3F8BA 5E3OA 2P9NA 1RBRA 4LY7A 3ZCOA 4JI3K 2VJIA 1HW2A 4EIAA 2ROLA 3WTZA 4OIOF 2FBVA 3AARA 3L9FA 4C2TA 1PU7A 3R4KA 2JS0A 4O0IA 4FX0A 1W70A 2E71A 3CJTB 2DRKA 1XC3A 3HKZA 2RHYA 3CMAI 3FHGA 5TJJA 2FRHA 1K0SA 3IH4A 5BS6A 3PNWC 4KHYA 2DBMA 1LKXA 2DMOA 3ZSYA 2Z1DA 5FKOA 2CUEA 2QBYA 1TP4A 3RR7A 1K73C 4X6AJ 1VRTA 2DK5A 1WSGA 4NBQA 2DT7B 5J2PA 2R5MA 5CVVA 1PU8A 2KP6A 4H4KC 3R6MA 5AQUA 2QK9A 1EH7A 2UZKA 1M2VB 2ZPFB 3DLLA 4A93J 2PMZA 4FX4A 4HLXA 3RMAA 3AVJA 2YUQA 3SUOA 2JN6A 1WBBA 1J09A 2ZD1A 1ZSGA 2P0KA 5BR9A 3Q9VA 5IOZA 3SAGA 3CPEA 3V1OA 3I56T 1ATNA 3O8HA 5ICGA 4AIHA 4KYWA 5GAN6 1SD7A 3QP6A 3LANA 3S2DJ 1MJAA 2EPFA 1N39A 3BE3A 3FEOA 1J6ZA 2DMQA 1RT6A 1GLNA 4A61A 4JLIA 1IXDA 4DU3A 4AUXA 1S72N 4AVPA 1F5TA 2ZM6K 1SSHA 5D6XA 3CD6A 3JB9J 5L3EA 4HPQA 2O3FA 5AFUA 1VYTA 2E35A 1VQNQ 5E8IA 4DUYK 3FGUA 3TTCA 1TK8A 5IN1A 1R6RA 4EDUA 3V81A 2OA4A 2HBPA 4IO9F 3K4LA 2E6NA 5FROA 4FOIA 1WJRA 2PYLA 4JI4K 3CCVI 4YOVA 2EBPA 1LWCA 3HSRA 1NZ9A 5E8GA 1ZLKA 3V1QA 4KIFA 2L7ZA 2LQ8A 1PC0A 3QHSA 4E19A 1RZ4A 1JJ2P 3BR0A 3QETA 1VSMA 1YFHA 1I94K 4Y15A 4HAMA 2QGFB 1OJLA 4IF4A 3MKLA 4CGDA 5CKTA 2RH2A 2M5WA 5ILUA 5IOYA 1KQSM 2F8TA 1GXIE 4A3FJ 1ZUUA 2GEMA 2EQUA 5F08A 4RB0A 4FYVB 1SAZA 5ELZA 4EMKA 3GO5A 3SCXA 3D5RC 1C6VA 4BJ6C 3B73A 1MMDA 2CH5A 3KP7A 5CKEA 2A6AA 3OYBA 1NOYA 2A3LA 3K5NA 4M41A 2JN0A 2W1OA 1R36A 2G8FA 1XHZA 3GE1A 3VQCA 1D5YA 3MZHA 3E9OA 4I2OA 1KG6A 2YDLA 1TWGJ 1YCSB 1S6PA 3M58A 1RDBA 4YDUC 1TZLA 3F10A 3RI4A 3VRZA 1LWEA 3M8JA 5MLCQ 4BWJA 4HLYA 4BEHA 3HRGA 4IQJA 3PL8A 2BUPA 3HP6A 2DA9A 5K5OA 2DODA 3QB0A 3BPVA 2KNBB 4DU4A 3D1NI 1BGXT 2GUPA 3LH0A 2QWLA 4GVEA 1IO2A 1YF5L 4KI4A 2A05A 1QHTA 1VQOI 5GAMg 2ECZA 3WVDB 4CZHA 2EQIA 4OX9K 1IRXA 4AU7A 3S2HJ 1HSTA 5HNHA 1JKOC 3C7NA 4CZMA 2L0AA 5C4JJ 1FZPB 2XAJA 2JPBA 2KFDA 4LDWA 1HNVA 4DS4A 2RD1A 2ATQA 3NF8A 3PVQA 1XGOA 3GPLA 2Q0OA 3BDPA 4K8XA 2XI9A 3QDRB 2VQHA 4BRPA 1RCHA 2WTEA 3DPUA 5AQVA 2H6CA 2ETJA 1Z9QA 1Z6TA 1BR4A 2R7DA 1VQ6N 2EFPA 1WJAA 3OMGA 4Q5VA 1F1BB 1E6HA 5KRSA 5LGNA 4XTXA 1KU2A 2WBMA 2LFBA 1TQIA 2RM4A 2B7EA 3HKSA 5JVHL 3E9PA 3VA3A 4A5BA 2OTLN 1FYNA 3AGKA 1K83J 5DLQE 4BR5A 1O4XA 3ZSRA 1YITT 2GTJA 1X3ZB 2L3RA 3L2CA 2DI3A 2HSTA 1W7PA 3HVRA 1VQ4T 3VOEA 3GG4A 2BTTA 4HVVA 1VHXA 3OMCA 1D3YA 4N0AC 1GCQA 5JLFA 4OLAA 2VG6A 5B5EC 1JL2A 2GZWA 4FSXA 1ZSZA 1ON1A 2XAUA 4MFDA 2Y4XA 1RILA 2ZJRF 1WZOA 4HCBA 1ASVA 5L8RE 2FVUA 4CZCA 3FFIA 4P9FA 3ZT2A 3LZJA 3BWGA 4KICA 4YHHK 2JZYA 2X3XD 1Y0UA 3K5OA 1KU7A 5DPKA 2V9PA 3IV5A 4J2BA 2KZMA 4MDXA 2VJ4A 1M4ZA 1TS9A 4CDGA 3DWLA 4RAFA 3K59A 2QQ8A 4E89A 3M0RA 3CJQB 2V8IA 1UHWA 2M4KA 5BPMA 4IPAA 3SFZA 4NXMK 1GV5A 4HCCA 3AY9A 2HHHK 1YFNA 4B9SA 4FASD 3VTIA 1SEMA 4I98B 2XASA 4C8NA 4EVIA 1EIFA 5LJ5g 1NOZA 5C10A 2O8DA 2WWYA 1M90U 5HRPA 3LAMA 4PJLA 2UWMA 5M1OA 3JB9F 3VU3C 5E79C 4EAHD 4CYCB 2CKKA 1G4DA 1T3VA 4OIQF 2EKOA 1NGJA 5GP9A 3F21A 2PVOB 1BC7C 1U2WA 1AVZC 3WGIA 2JWKA 2DU9A 4R8HA 4GY2B 1QNTA 4Z2YA 3COAC 4CGIA 3EFRA 2K3FA 4LXCA 3PFIA 3KWGA 2TCTA 1PM3A 1CXUA 2QYOA 3KETA 4AFQC 3NHGA 3CMET 4M6VA 4AMCA 4CC7A 4RMNA 4UV9A 1VRLA 1RPWA 3SAHA 1GCQC 4FU6A 1XDSA 4JI2K 3AG2H 1UG0A 2NOBA 2O8FA 4A3MJ 2HQHA 3MN7A 5GAMe 5AFUH 1IV6A 1DTQA 3D2FA 5IT9K 4ISGA 3OYNA 2FSKA 1VQNA 4DHYA 2JUGA 3HOSA 5BN9A 1OX8A 5C44J 4I02A 3M57A 1RT4A 5IHNA 2FPDA 3RTRA 4PZJA 3CWUA 4RLFA 1HQUA 3DMJA 4Y13A 4DBRA 2P9KB 3HTRA 2IS2A 2DM1A 4LD5A 5E3LA 3ZEUA 3MXIA 1I3QJ 4B1UB 2PAVA 1IN5A 3HOXJ 2OCEA 4A3GJ 3WU1B 3VQ5A 4C92D 4QTRA 4EP5A 5AJ3K 3JW4A 2L0KA 2IBDA 3PIPF 3KEQA 5C42A 2VI6A 3DPLC 2ZMEA 4CCMA 4XAXB 2BOLA 2XRLA 2VGNA 3CCRA 2W57A 2QA4T 2P9NB 2CSOA 1MZBA 3LSJA 1LB2A 3O3GA 1VYVA 1OR7C 2OPSA 3QFUA 4AM3A 1KZHA 4QLCU 3VGLA 4J8FA 2GXGA 4KUDK 3LALA 2V1RA 3KLIA 4BDPA 2ZXIA 3DLBA 1KHIA 2LVMA 2X1DA 4OF1A 3CC4T 5AQJA 2DMNA 4RA2A 5LEKA 2ESHA 5J39A 2OZMA 1MDUB 5AT1B 4A6DA 4IDKA 4DA4A 1D5VA 4YFKF 1UG2A 1DUXC 5HLIA 1FW6A 2ZNYA 1ZBXA 4AT1B 3OR1C 3AKZA 1WEGA 1KVBA 2JA2A 3BTIA 4DQIA 1VQNI 2BE9B 1U5TB 4CHPA 1HYSA 1PUEE 3F70A 4NYFA 2HFHA 4ICLA 4B9UA 3TEDA 2IVMA 3P31A 2LP0A 2OYQA 3TTFA 3Q3SA 2VXZA 2IIRA 4OAYA 3VQBA 3K9JA 3CMEI 1GVJA 3BF3A 4J2AA 4C8LA 2MYSA 1IAWA 1O3TA 2NLUA 1N8RU 4RAGA 4PHTX 3N97A 3MFKA 4LK1F 1X2QA 3VEZA 4U67L 5EYRA 4ZYHA 3QLHA 2E19A 3MXMA 2EHGA 3FM5A 3THYA 2BE5F 3I0TA 1X1PA 1SS6A 1MUYA 1RR7A 2K4YA 2HHXA 2IIMA 1N3CA 1TL1A 2RREA 3DEWA 4DMNA 2LF7A 2Q2EB 1T56A 1QQJA 1BYMA 1TWFJ 3P1GA 4XN0A 3PO3J 1NTCA 5ECAA 3CUQA 4YIRX 1QZYA 3BDDA 3SHWA 5DLOA 4QIWN 4NL2A 1RAGB 5BQTA 5BR8K 3OYGA 3O6WA 3V6DA 1HC8A 1TSFA 3VS6A 3CCEI 3G4ST 4M7DB 4FJ9A 1PCXA 3B6OA 5IP6A 5J4YA 2ZFWA 3EYIA 1W4MA 4B8XA 5K7ZA 4G9YA 1YJWN 4LLNA 2CO5A 1NJIU 5FKKA 5C2FA 2E2HJ 1YQRA 5F64A 4LG0A 2RE2A 4N47A 2G0EA 3FXLA 3ZQQA 5GMKh 3OYDA 1P7IA 2DPUA 1VQ4Q 1WX6A 4JJNK 3GLXA 2GAUA 3I5UA 3CWAA 3SNNA 5TRDA 3RIRA 4DOVA 1HXDA 4K2EA 2ZGWA 4CEQA 2NS8A 2PQWA 4UB6C 2H94A 4ZGJB 4BREA 2DMPA 2OTJT 2NOIA 2QWPA 2R93J 5AQKA 3X24B 2JRMA 1RLPC 1FOXA 2QEXI 4Q48A 5C0MA 4A6EA 5AQRA 2ZE2A 4RKUE 3KHYA 4CZEA 2F5VA 1F43A 1YRNA 2E5LK 2WUSA 4CJFA 3BG5A 4JKHA 1S1UA 1SZ2A 2DXTA 5FKMA 1V5GA 4RAYA 4MEXF 1BQMA 1U5TA 1KG1A 1HK9A 1M3AA 4DS5A 1M27C 2E2OA 3IAS2 2JMCA 1V1CA 4A3KJ 4Y3OA 1QZ6A 4BQAA 1RGIA 3EY1A 3FWEA 5FDLA 1PDNC 1VQON 2OD5A 3CJBA 1FKPA 2VGMA 1UB9A 3H9GA 4J9HA 3M59A 2CFOA 1B07A 4IFEA 4BC2A 4DSFA 3FKJA 3FXJA 1GOBA 2ATCB 4MO7A 1HJRA 4OVAA 4E47A 4M77C 4M78F 1X2NA 2YUSA 4ZYAA 3BQZA 1XGNA 3FZHA 1OVQA 2VXEA 4G8XA 3JCMP 2JXBA 1IKWA 2EQMA 3ZN1A 3ABUA 1I1SA 4IHSA 4IUPA 3HFNA 2ZSIB 3EUHC 3L8BA 2CH4A 3HDDA 5HDKA 3TAEA 1XUPO 3WEEA 2D1VA 4CJ5A 1OX9A 3AL0C 3FXRA 3AVMA 2KYBA 1ETKA 3THWA 2R7VA 2CP5A 2EWSA 2G8HA 2HMPA 4I2PA 1M3CA 3DU5A 5FU7C 1HKCA 2R7YA 2IGMA 3CC7I 2P84A 4OFEA 5AQPA 4BH9A 3WGGA 3O9RA 2BEOA 4QW2A 3JCMb 1W2BS 3E9GA 3HJEA 4A2UA 3DOLA 1EZZB 5ADXA 1HYOA 2DFUA 2A1RA 3L2VA 2YV0X 4JHDB 4F7UB 1A36A 3UT1A 1RDCA 1EF4A 2RGVA 3TWHA 1U49A 3M5AA 3LZIA 3JAME 1MBEA 3PIOF 3FK7A 2IA0A 3MN2A 3CC7T 5C0YA 2CFXA 3CW7A 4ZYGA 4C5HA 4EHTA 4IJNA 1QVGM 1N9RA 3GVAA 4CF2A 1YHQQ 3JCUC 1VQ5N 2CWEA 3A03A 3GZNB 2VYPA 2NRZA 1F1ZA 3ZR8X 3LAPA 3ID6A 1AWXA 4X1EA 4BRQA 3G7ZA 5E17F 3EFOB 5KH6A 5IWAK 1K73O 5IHIA 1LCKA 2HHVA 1R23A 3D2EB 2XIDA 1XMKA 4M6XA 4CJVA 1OCZH 4JI1K 3LSHA 3VYGA 2KLOA 3PJRA 4IQ4A 3DF8A 4LIUA 4XU2A 1I5ZA 1OLTA 2OTJI 1K9MR 2LP5A 1B34B 4HT9A 2DL3A 1RT3A 2QASA 3KEYA 3AO3A 4KGZB 2E4HA 1NG6A 2Q97A 3FX3A 2J6KA 4A5NA 3SB2A 2XPUA 3M53A 4M42A 1YWPA 2FBIA 3R6SA 3T0YA 3MECA 1S5LC 1VQ8I 1ZSZC 2RQVA 5I2SA 1BWFO 1LFPA 1QKXA 4ZGDB 4P55A 4JJBA 4M75C 2O5RA 3O6BB 3HBTA 2JGUA 2WAQA 2D8JA 2P6TA 2E2JJ 1VYUA 3CJAA 2QQSA 3U9ZA 4DQ8A 4CIFA 1VQKQ 3LWFA 2HBJA 1VSIA 4M75E 1H92A 5LJ5e 1YJ9N 3TO7A 2CH6A 2EGEA 1VFCA 4WF2A 2QLZA 4KMUX 3VSKA 4OMOA 2FXUA 4QS9A 2CUBA 3EETA 1WSJA 1T03A 4I0BA 4HBLA 4JEPA 1WQ2A 2BVLA 3C18A 4BDYA 4OPHA 1XMAA 4RCBA 2FL7A 1RDAA 2B4JA 1YJNI 1IXSB 4ISFA 5E41A 2C0OA 3E5QA 3P8BB 1NNEA 4BRCA 1YBYA 5I3UA 3ZMDA 4UNOA 2FBTA 5GMKm 2GOXB 1UTIA 3D45A 3CCQQ 4B9QA 1SQKA 3CWTA 3MHXA 1W1FA 1WHKA 1BI1A 3HGYA 2HKQB 3KNTA 2YI1A 5BPIA 3RERA 4NL3A 4M7AE 3CCRQ 1I27A 1WJ5A 1S6QA 2DDBA 2SEMA 2X1CA 1UJ0A 1HMVA 1T39A 1BIAA 4ETSA 3E6DA 1H8KA 3RMBA 5KN8A 2JTFA 4YNQA 4M77E 1IXCA 4I7FA 3ER0A 4J6YA 1AKHB 3G6EQ 4WQ4C 3H92A 2CGHA 2P1JA 5EY4A 4OB2B 4I7HA 3HSEA 2E5ZA 2LT1A 2NUPB 4HHTA 4KT0E 1U2VA 1WVRA 1FMVA 3RYPA 1OKRA 2AS5F 1XC9A 2M8EA 3CCJQ 3FIFA 2DAQA 2QA4Q 5CKDA 2M34A 2DA1A 1YJ9I 4JQFA 1YJNA 2QDLA 3MEXA 2HI3A 2YS9A 3TSQA 1QCNA 3VS0A 2M1HA 2FA5A 4KGVB 2F5DA 1OR7A 4G1QA 4K42A 1KQJA 3VS2A 2DTHA 1YJNT 2H1KA 3CVTA 4FOEA 2O61A 3AL0B 1PKTA 4BJ5C 4KUIA 4BR0A 4ENJA 3HPOA 4B3SK 3RRHA 2R7QA 1S1TA 3I9V2 3HYIA 2DYRH 2NOHA 4V2FA 5J1YA 3CIPA 1SFUA 4CJQA 3M8PA 3ZL7C 1TTYA 1S8NA 4JD2A 1N25A 3BLYA 3EG9A 1N75A 2VXDA 4YIIA 5GTIC 1HBXG 4EV0A 3KK2A 2P9LB 3VSLA 1UGQB 2J6OA 3CPWP 1WAJA 4I9LA 4KITB 3MX2A 3HK2A 2LRQA 3HO1A 3FF5A 3HSCA 3OYFA 5F0HA 5IP7J 1LMZA 5C15A 5I21A 1FK9A 2L89A 3HM5A 1SHGA 1HKGA 2E1MC 2VQGA 4A57A 3PX0A 3K1NA 3QIPA 3FC3A 2EIKH 1N34K 4DWIA 2RJEA 2HGCA 2GX9A 4YOTA 5HK0A 2XAQA 4EVVA 3BROA 3QRFF 4WE1A 1Y7XA 2IGKA 3SQ1A 2KIMA 4HG2A 2J05A 3O9QA 5BMZA 3VQ9A 1SVLA 4WFAL 4RGXA 3CCJI 4LFAK 4A4EA 1WCMJ 3VB2A 3CCMQ 3QEIA 4B48A 4OMNA 2VVKA 5CYQA 1YIJN 1RAHB 2E36A 3PX6A 3SV4A 3JAMZ 3EZ5A 3ATVA 1A04A 3M5RA 1UELB 1TV6A 1WHUA 2SRCA 5H6RA 2FZCB 2ESWA 2LF8A 1ZBHA 3SEQA 4EHUA 2GFUA 3EHRA 3F23A 3OB9A 3UA6A 2HSEB 5KRTA 2IS1A 3I55T 3G71A 3VETA 1JKQC 3SDBA 4QT7A 3MP6A 2GF7A 2LX7A 2QKLB 2QA4I 2VKVA 3ULRB 4M77B 3CYMA 3MMVA 2H6BA 2NOLA 1IGUA 3MAJA 4FWOA 2NRAC 3JRGA 3CCVT 1ONVA 1VQMT 3DLLL 5LLQA 2HEOA 1IUYA 1QBJA 2O8EB 3CDLA 3I9QA 4HNTA 2I8DA 3J7YJ 5KN9A 4CJSA 1AKHA 1MU2A 4YY3K 3GF5A 3A0HC 2LCLA 3CCUQ 4PGGA 2VONA 1TWHJ 3V4GA 2VWKA 3H9NA 2QQRA 1UGVA 2VC0A 1IJWC 2VWFA 3HL8A 4DTJA 3G0QA 5JMVA 1KQ1A 4JRIA 4XEIA 1WN7A 4JX4A 1R71A 1ZR4A 1VNDA 1RTHA 3K9TA 3ME9A 1DGRM 4BQOA 1EX4A 4CF0A 3AVHA 2DBBA 3IHOA 4CC2A 3E6MA 1R1TA 3RBBB 3EH1A 1VQ6A 3WEEB 2EJGA 1FMKA 1V4TA 2WA0A 3C0BA 2X9HA 5LJWA 2F2XA 1QTMA 5F1XA 2MABA 2LQKA 3JAMK 3ZP5A 1FOYA 4LSNA 1VQ8A 3VMFB 3IAYA 2BY3A 4PJOD 1HDDC 1WJFA 3H45C 4L5EA 5LMNK 2PJRA 5DS9A 3CCST 3LSRA 3PNTA 3QU6A 3DFGA 2JS2A 5LJ3j 3LSPA 2BIVA 3ZOBA 1X2MA 5DCFA 2HSPA 4MGRA 2EINH 3AO4A 1VSFA 2F4IA 3FRNA 2CDTA 3ZQCA 3C1DA 4CGFA 2KRSA 3O5ZA 1R1UA 2AT1B 3S3NA 1ETYA 4CZLA 1HNWK 4FWSA 1UECA 5KE3A 1ESVA 2GA2A 2Q1NA 1FBQA 2DO3A 4IIOA 3I5RA 1JLGA 1K9MO 4LLLA 4RUGA 1JT0A 4S0HB 3THYB 3LWMA 5DUIA 1OH8A 1YI2N 2EYZA 3ML6A 4KHQA 4WQ5A 1PD0A 4CSWA 1K73U 1MIJA 3KKSA 4TSXA 1SFKA 2CUZA 2M8GX 4H0TB 2E12A 1NGGA 1SFEA 3V7RA 4B9XA 2UXNA 2EBIA 1KQSP 3URGA 1LEAA 4M3XA 3CUOA 3AVNA 5L3BA 4N56A 5IAYA 5FRNA 3SUNA 1TQMA 1D5AA 2IS6A 4JKFA 1T8EA 2JK3A 3HSTB 1RLQC 2RN7A 5L3CA 2CQQA 3WU0A 2X9DA 5GMKl 3FSPA 1J9IA 1I39A 1HR0K 4FK0A 1GVDA 2EIJH 2PYJA 3LNQA 4FCYA 2I5JA 2A3ZA 1A5WA 3A8HB 2IS3A 4AH9A 4ZYDA 4U0WA 2UUCK 1QGPA 3SUQA 2P9LA 1N8RO 5K1YA 4DFPA 3L2ZA 4FYYB 3CD6N 4XONA 3AAFA 3CLOA 2UV1A 1R1VA 1D1BA 1FXXA 1BOAA 4IO8A 3TARA 3ZX2A 2MH2A 2K7AA 1RETA 3ZLJA 2VKDA 1OI1A 4GXOA 5AR0A 4FLYA 4A12A 2KQRA 2QG9B 4ITVA 4BRKA 2M51A 3WXMB 3OYIA 3H3VK 3SLCA 3LDOA 3T1HK 3VJPA 4C8QG 2PBIA 4HT8A 3JCMV 2NUBA 2OTJA 1KD1C 2ENMA 2LG4A 1KQ2A 3JRCA 3LWLA 3OL4A 4MEYF 4OIPF 3BUZB 2YX6A 3N4PA 2IVNA 4LE9A 1ZQ3P 5LHGA 1D3BA 2LC4A 3M07A 5EGOB 4BE1A 3QWXX 3WTVC 3JSCA 1C1AA 2ELKA 3SHFA 2CUDA 1O75A 3DJCA 3HG9A 2B9SA 4CJ7A 4C5EA 2OA8A 1VTNC 4BB7A 3M0SA 1ZREA 4DR4K 3WXKA 5EG0B 1BA0A 2VPRA 1KG2A 2E10A 3R0AA 1MBJA 1UHSA 5IXFA 2UUZA 1ZG3A 2EJRA 3R6NA 4OB3B 3VERA 1BC8C 3O3FA 4PKCC 1W9HA 1UHFA 4FLZA 5GADJ 1Y96B 1XNIA 2CUJA 2PUOB 3CCLA 3FZMA 1R0AA 4XTVA 4LDXA 4FQGA 2RHKA 4EJOA 1Y0NA 2ED0A 2QKBA 3SQ4A 2DLLA 1KLMA 4C5GA 3IAM2 5LFAA 4KH0B 2HR3A 1ORPA 2WACA 5IH2A 1OISA 1M1KO 4GYGA 2EFQA 5EG0A 3BP8A 2V1DA 3LAJA 4C23A 4FW1A 4XRMA 1DP7P 2A68F 1CGPA 2AO9A 2K86A 4M3DA 3ESWB 1IZ1A 1KAXA 1BKBA 2XDVA 4QVZA 3CMYA 3A01A 3VYSB 3HUGB 3A5ZB 5FLXO 3FXQA 2DOEA 2LMDA 1JRIA 2NRWA 2LR8A 4JJDA 1SPKA 1EWQA 2DYIA 1K6YA 2HPIA 3CCVA 3JRAA 5DTDA 2X6SA 1HLUA 1MMGA 3OR2C 1SUQA 3F8NA 1HNIA 2VL8A 1M1KC 3HB9A 2E1YA 2DZ9A 1UJYA 3RPUD 1SMYF 1QP2A 2JTMA 1S3JA 4Y4RA 1HX1A 4BGBA 4HNVA 3TANA 4H4MA 4B1RA 2HQRA 4XRFA 1Z91A 3SV3A 2EILH 4QCLA 4LG3A 2X35A 4QAGA 3MN5A 1AWWA 2DL5A 1R5GA 4BL0B 3GF2A 2DN0A 2K5LA 4PFOA 4UOBA 4F91B 3TDUC 2HDCA 1WI7A 4J00A 2NRTA 3SFIA 4FSVA 1YS6A 5CQXA 1YIJI 1RIOH 1W0UA 2ASPA 2ZJQL 1YJNQ 4IOAF 3BW1A 4OO1J 1SRLA 1XNQK 1K8AU 1OZ2A 3ZT4A 5EC7A 5BRDA 1J3TA 3MJXA 3BG6A 1RTDA 3I56A 2JWLA 1EETA 2VKEA 4JS4A 5FKNA 2KKOA 4W5OA 5CR2A 2QXFA 1HKTA 4FJ7A 3JCMX 1J5OA 3PX4A 2Y1IA 2M7AA 2FMLA 4BC5A 5IY5H 2BUDA 2W48A 1BW6A 2OQRA 1X27A 4A4GA 3G6ET 3L4QA 4A3DJ 1WFXA 4E7ZA 2C0IA 2Q36A 2FBHA 4M7DG 4CRIA 2F2EA 3HYFA 1EBMA 4CJWA 4RCHA 3EYZA 3PO2J 3E1SA 4NC6A 3J81Z 4S05A 4FJ5A 1BR1A 2ZB9A 2M9UA 2OQGA 2K4JA 4N4OB 3OYAA 3M0UA 4CBXA 3NGIA 4F16A 5KI6A 1D8KA 3J7AP 3DXKB 3BDLA 1TK0A 3WHBA 1JLEA 2XY8A 2YUNA 4EMGA 5LJ3f 1NGNA 4E7SA 3K2ZA 4R1HA 1FMWA 1U84A 1IKVA 3H0HA 2J5OA 1FNNA 3CG7A 3IP4B 3FMQA 4K0KK 4AHTA 1Q82O 2WSEE 3VQAA 1XG1A 1WQ7A 3O4WA 2NNNA 4CC3A 2UYTA 3LAKA 4OB0B 4DZPA 2GIVA 3FZVA 3PGGA 5J26A 1G99A 4RS8A 4CA0A 3UKUB 2RI3A 2NZTA 3CC7N 5GANf 4JRKA 1VQ6T 2V79A 3E5UA 3L1PA 1U3OA 4YIFA 2KZVA 3OW2S 4CZFA 3LLRA 5CHZA 3NMZC 4DR5K 5T7BA 3H3OB 2Z33A 3V4IA 1T2KA 1O7FA 1H89C 3H0DA 3QERA 1EH6A 3QJYA 1BA5A 4PK4A 3ASKA 2ADUA 2COYA 2HW3A 1G3YA 3MP8A 3IRXA 4CF1A 3EZWA 1IJJA 2CW0F 3CMAN 4HDUA 2AHQA 1XMOK 5CYMA 2ZPBB 2LVSA 4AFZC 1N9SA 2NUTA 1ZXOA 2W00A 1QKWA 3GMEA 5FKLA 2YNHA 3ERED 2QGGA 3RMDA 3QYBA 2ZZDA 3KJVA 4BVPA 3ISNC 3VQPA 5KCMA 1JJ8C 3CFRA 3SXYA 1N77A 1V4RA 2L5QA 1TUUA 3L2WA 2XKPA 3IRRA 4Z89A 3OGDA 2CGLA 1QCFA 2CS3A 5AQMA 3MEWA 4BGAA 5B8HA 1T0HA 1DJ7B 4II3A 1M5Q1 3C95A 2OF7A 3OMYA 1JLFA 2BTFA 4LC9B 1EV7A 1BBYA 1HW1A 2CUFA 2NS7A 3ZETA 3DKYA 1NK6A 5LGTA 2WAEA 2NOZA 2OTLQ 2YUPA 3EN9A 4C92B 4CHNA 3FR0A 4CCJA 2ISZA 3QYEA 3CCMT 2R58A 5HLGA 4M74A 1SD4A 3I4MJ 1QVFP 3BZKA 2FPEA 2BW3A 1CZAN 2IC3A 4H0XB 3OBYA 1HW5A 3ZSZA 1KGSA 1R8OB 3CXCM 3HZ6A 4XSZF 2N8GA 2EIFA 1RDDA 4M3ZA 1NGBA 3NWTA 1DP3A 4EJYA 2NYSA 4M73A 2CT4A 3I8DA 1A5JA 2NUZA 3FZKA 4FWQA 5A0GA 3TPQA 1DLOA 4BE0A 2HQAA 4FJJA 4DGWB 1B72B 1S1NA 4K25A 3TSZA 3S1QJ 1Y56A 3VF2A 3IG1A 2X4WA 2OPTA 3THXB 2VJJA 4CGZA 4E9HA 1NGAA 3LCNA 4GV3A 3NEUA 2FJ1A 1ZA2B 2UU9K 2M02A 3CF5F 4M7DD 2ZNZA 3GOXA 2ASMA 3A8GB 5GAMf 1VAZA 3SJMA 4P5OA 4OVLA 4XICA 1JLBA 2X6XA 4XTUA 1NHAA 3X28B 1KG5A 3TI0A 1TT5B 3GZ6A 1DPUA 4OMLA 4YG2F 1OYWA 1E7OA 2V26A 3TGNA 4D8KA 1W7PB 2HB5A 4CJLA 3BR2A 4IEEA 1KAYA 3SI6A 3NHNA 1RR8C 1SMTA 4M3EA 4IX7A 3NAUA 2QYZA 2FF3B 1TAQA 4B3RK 4EQQA 3PV8A 4G6DA 3WUHA 3T1BA 2PZ1A 2W25A 3LSKA 5LEJA 2BH1A 4JLGA 1GL5A 2GTOA 1E3MA 2LKPA 3Q0WA 4C0GA 5DM6F 3AGRA 1Z77A 2R5YB 2COBA 1MNDA 1NK3P 4U0YA 3J80O 2BZXA 2EQJA 2Q2EA 1BL0A 1TGOA 3OJUA 3VYHB 3RZOJ 1X9WA 2LREA 2HYFA 1RC9A 4QVDA 5J3LA 3EDPA 3TU4K 1X58A 2IPOB 1TUYA 3EYYA 4JZ4A 4C92A 5LGUA 1X75C 4HV5A 1G5VA 1O1WA 5JLWA 3H1QA 1WUAA 3ZPLA 1QQMA 2KIUA 2Y1JA 2KZGA 2E1OA 1VQPT 3B6AA 4CHOA 3I4NJ 4B44A 1WXTA 4BHPA 2RJFA 2HS5A 1JCGA 1JI8A 5D5UB 3G10A 4HYEA 1K9MU 1GLCG 4ZZLA 3CDHA 5D8LB 3CO6C 4C0DB 3LPUA 3O2PE 3W2AA 1LJOA 2AZSA 3A0BC 4IXAA 4OKEA 3JSPA 2EZLA 5LHIA 1Q81U 2RHIA 4M3BA 4CCHA 1JLAA 4IHVA 3SPZA 4A3EJ 5IT3A 1ZRDA 4BGDA 2JHNA 4W5NA 4J9GA 1UB4A 1IW7F 3SWNC 4KT6A 3H6EA 4CCOA 1Q95G 2IEKA 3ZYYX 2ASOA 3O1WA 4EM1A 2M0MA 3PQJA 1T08B 2ZWHA 3V42A 4B09A 3VQDA 5AQQA 4II2A 4Y1CA 2XV4S 1WSUA 1ZGJA 2JZ2A 2LX9A 5M3FJ 1DIZA 4BY6C 4FJHA 2DT5A 2WFBA 1S1XA 2WOMA 3CCQI 4IDHA 1V4SA 1V5FA 1N32K 4O3MA 1N6QA 1NH3A 2FSNA 5E18F 2QEXQ 4BR4A 4CZZA 4WK8F 3I5SA 3A5OC 4RTWA 4IEJA 1AHDP 1VRUA 2VWBA 3HOYJ 2K3XA 3CC2Q 4IOXA 3SFMA 3K70C 4XIDA 2JVVA 1X6GA 2YLCA 2EVRA 1BG3A 3META 2K5FA 3PMTA 3KZZA 5DDGA 1U47A 2MBFA 2BY1A 5HODA 3L09A 3A8LB 5D6WA 5DM7R 3WTUC 3IRQA 2DXIA 1KA8A 1ASWA 4OPJA 2KRMA 2HOTA 1ZLJA 1NU0A 5M1FA 3FXKA 2E7XA 3GFIA 2CYYA 4DU1A 4B47A 4MQ9F 2OTLI 1FIAA 2X1EA 2P0QA 4KBOA 4Z0UA 3ZX0A 3BF1A 2EGCA 4IRGA 3Q7CA 3AG1H 3K58A 2DJNA 3DEUA 3LFUA 5BOXA 3SYTA 4JYKA 4WQ4A 3DOKA 2Z3YA 1MH4A 1A6IA 5HOOA 4W1UA 3RSEA 1D8YA 2V8KA 4JS5A 4C8MA 2DTUA 4KI6A 2DY4A 5H2FC 1XGSA 2I5UA 4ELYC 1BI0A 4OOIA 3O3HA 4JKGA 4LH5A 3IKVA 2AKLA 5D4SA 4AM6A 3O8MA 3MWTA 4PY5A 3P9CA 3LSIA 2DBKA 2EZKA 3NBPA 3W6KB 1WJDA 1QVFM 4DV5K 2VQFK 5HS7A 1T3LA 3LL3A 2GGRA 3M3YJ 1JCFA 3ZQGA 5F1RA 3ZMVA 3JREA 3CC2I 2IVOA 3OS5A 5E1XA 1YT3A 4NQWA 4YOYA 3ZT1A 4DUZK 4HDVA 1LJ9A 2WB1A 1VQ5T 4A3CJ 4F7UG 1QZ5A 1YW7A 1W36C 4B9VA 1U4BA 1D9DA 4Y33A 5GAOn 2QSFX 5E20A 4EATA 5JVGF 4H5WA 1R00A 1D1CA 3BQYA 1VQPA 4ZC3A 1PSEA 3KYCB 2IRFG 3T8TA 3HOUJ 5GAN8 1X4OA 3HPGA 1FN7A 4J9DA 3DRRA 1FP2A 2TDXA 1LCUA 1AOJA 4J01A 3ZMTA 1NLOC 5C2DA 4FWPA 3HTSB 3R60A 2D8HA 3WTWC 2BE7D 4BHCA 3HPHA 4WQ5C 2JVGA 3BZCA 3CQTA 2K5CA 3ZCMA 2MI6A 2Z2SB 2FD5A 2D1XA 3BR5A 3S9HA 2FSJA 3V9WA 3DRSA 4XRSG 4ELUA 3ZXSA 4PDKA 2FEIA 3VPRA 3HI0A 5GPAA 1FY7A 1C0UA 4BQNA 1W7PD 4NUBA 3TW6A 2B86A 3C6AA 3P38A 2IP2A 3HXLA 3RCOA 1U04A 3CC2A 3TABA 1VQNT 1UCRA 1LW0A 1RTIA 3RQIA 2VUMJ 3H1VX 4ZTFA 1VQ7N 3NGZA 3BC8A 2MG4A 4AG1C 1T8IA 4GV6A 2K7LA 1R59O 2YHXA 2XKOC 1MMNA 2Y0MA 4BQLA 4RGUA 1SAXA 2VJ5A 1G6NA 1VQOT 4N41A 1WOQA 1RKTA 3CJ9A 2FMYA 4E1NA 3BJOA 2QKKA 4JI8K 5M5XJ 4OPAA 4CEBA 1ZBIA 4OFHA 4B1ZA 4YEJA 3G4SA 3BR3A 1STZA 2JJ7A 2Q2RA 2X48A 4C8KA 4HCKA 1Q9YA 1JXSA 4PSWA 1J54A 2Y90A 1RBVA 2Q3SA 1VQ9Q 1QA6A 4EW4A 4U7DA 1IN4A 1JTYA 2A42A 1WNSA 4RLQA 4E7IA 2D0NA 2HNYA 3OYJA 3Q7BA 1WJSA 3U21A 2HCKA 3CCSI 4PJOG 3Q1JA 4BKXA 2E6MA 1KYWA 3DTKA 2EFOA 5GMKi 4DTRA 4HQMA 3RKWA 3J7ZO 4A2BA 3TAQA 2H3GX 1WI9A 1WH5A 1I07A 2F9TA 2HQEA 3FHZA 3V9XA 3IMXA 1ZBLA 1RL2A 2QGUA 2EV5A 1W0HA 3LL7A 1SANA 1KD1O 3DM2A 4FO0A 4V19K 2Z99A 3I33A 5IP9J 3PFSA 4KTWA 3OYEA 4B3XA 3OYKA 2PFBA 3PO5A 1M8VA 2KIFA 3MKDA 3ATUA 4PLLA 1ZC6A 2STTA 1B59A 1NK5A 1OPCA 3LDPA 5GPCA 4BQZA 4KH6A 1ZYRF 2JA5J 2KYMA 1M2OA 4R5PA 2ZCWA 4BY6B 2X85A 2XF6A 2VIXA 3N4QA 3QYHB 2O9VA 1RUOA 1SAUA 2E64A 2LCCA 1NKBA 4A63B 5AIQA 1YQKA 4DQPA 3LDLA 3C3WA 1N3AA 4PUSA 4UNFA 4I01A 4FJNA 4QPOA 1BR2A 3P39A 1YJ9T 2LMJA 3CCSA 1MBFA 4HSRA 5SZTA 1VQPN 1VQ9I 1JT6A 1GOAA 2ITMA 1RDUA 5J1EA 1T05A 2FZKB 3EL2A 3HKZN 2W82A 1ZG1A 1MWKA 3CC4N 2E5QA 2F4VK 1FBUA 3K57A 1YP5A 1B3QA 2XC7A 1I3AA 3AVFA 3KZBA 1OCRH 1OZ3A 2X6YA 4WX9A 1TUGB 3WU2C 3RZDJ 1LDKB 3E01A 4UY8O 3I58A 1HJOA 1QQCA 2R4GA 1QE1A 1OH6A 1YYVA 2D0PA 4E7HA 3U9GA 4FJKA 4ESFA 1LFBA 3DLEA 3HVTA 4BRIA 2O8CA 2ZJPL 3DKMA 2HHSA 5FGMA 3D4VA 3H35A 1H641 4HCZA 4AHSA 1W5TA 3VTHA 3WE3A 1C0FA 4G7HF 1KVCA 4XNFA 2DJZA 3AVLA 2VE9A 3RDIA 3HRUA 4RM2A 3AVGA 2HHQA 3WTTC 1DEJA 1YIJQ 2QEXA 5GMKe 2W85A 4EFHA 2HKOA 3MN6A 3RSNA 3DKXA 1U06A 4IWVA 2JA8J 3UDCA 3WG9A 4PJNA 3FZLA 4BEHB 1N6AA 1RT1A 1DTTA 4I0AA 3A4CA 1GLAG 4M77A 1FSEA 2BGCA 1W6XA 4IFVA 1EO1A 1JHFA 3KLGA 1X3WB 3FXUA 1U9OA 2BXYA 1Z25A 1YIOA 1SRMA 4QS8A 2RQQA 3ITHA 2QVOA 4M9SA 1HJDA 1EJ9A 3PIPA 2LNBA 4YOXA 1Y96A 1UMQA <