3OYHA

Crystal structure of the prototype foamy virus (pfv) intasome in complex with magnesium and the insti mk0536
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
368
structure length
368
Chain Sequence
LDAELDQLLQGHYIKGYPKQYTYFLEDGKVKVSRPEGVKIIPPQSDRQKIVLQAHNLAHTGREATLLKIANLYWWPNMRKDVVKQLGRCQQCLITNASNKASGPILRPDRPQKPFDKFFIDYIGPLPPSQGYLYVLVVVDGMTGFTWLYPTKAPSTSATVKSLNVLTSIAIPKVIHSDQGAAFTSSTFAEWAKERGIHLEFSTPYHPQSSGKVERKNSDIKRLLTKLLVGRPTKWYDLLPVVQLALNNTYSPVLKYTPHQLLFGIDSNTPFANQDTLDLTREEELSLLQEIRTSLYHPSTPPASSRSWSPVVGQLVQERVARPASLRPRWHKPSTVLKVLNPRTVVILDHLGNNRTVSIDNLKPTSHQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular mechanisms of retroviral integrase inhibition and the evolution of viral resistance.
pubmed doi rcsb
source organism Human spumaretrovirus
molecule tags Recombination,viral protein/dna
molecule keywords PFV integrase
total genus 106
structure length 368
sequence length 368
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2010-09-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
A PF17921 Integrase_H2C2 Integrase zinc binding domain
A PF18103 SH3_11 Retroviral integrase C-terminal SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2300 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3oyhA04
1.10.340.70 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Endonuclease III; domain 1 3oyhA01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3oyhA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3oyhA03
4KKOA 2IOCA 2G8UA 3ZT0A 4R5PA 4HHTA 3AV9A 4FJ5A 3KUFA 4C5HA 4EP5A 4FXDA 3LP1A 3AO1A 2HQEA 4FW2A 3NAEA 1NKBA 3ASKA 4DSKA 2ZE2A 3AVCA 3ZT3A 3M8SA 4AHUA 4N41A 2E5QA 3LGFA 3P8HA 3OYLA 5J2NA 2XY6A 1SKSA 4E1MA 4KRFA 5IAYA 3NCIA 3D0PA 4B9TA 3OYNA 3S3OA 1LAVA 5KRTA 2HHTA 1WSIA 3K58A 3VN5A 4DQSA 4DSIA 3P8DA 3L42A 1NOZA 1KLNA 3ITHA 4J2BA 1SKRA 2L89A 3ISNC 4CJRA 5E41A 3KD5E 2EQUA 2R5MA 1WSFA 2GV9A 3L2RA 4HCZA 3L2QA 3SJJA 4J2DA 5KCHA 3SUQA 3VQDA 3AA5X 4CJ4A 4CJUA 1RBUA 3SV3A 3F73A 1XHZA 1J5OA 1DLOA 4G1QA 3HPOA 1RT3A 3OYFA 3QIIA 3A2FA 2RJEA 1NJZA 4FM0A 3MEUA 1W9HA 4CK2A 4CEFA 3S3NA 1TAQA 1VSDA 4OKKA 1B9FA 2NLUA 4EDUA 4CJFA 4CEZA 2BKDN 2D5RA 3QEPA 1S1WA 3C94A 3T1AA 1BCOA 4RW9A 5C0MA 1RILA 1VRTA 3ZSWA 3VQEA 3DOKA 2VG6A 1LWEA 2HQXA 1WAJA 1N5YA 1ASVA 4I2QA 4BDPA 2OYQA 4MFBA 2DTUA 3SPYA 1UOCA 1YTAA 3OS0A 3O8VA 3MP8A 4W5TA 5T7BA 3SQ1A 3NNQA 1DTQA 3ZSOA 1QQCA 4HUGA 4FJ9A 1VSFA 2BGGA 1KSPA 3AO3A 1QHTA 2XK0A 1BISA 4CJSA 2G8HA 3B6PA 3U6FA 5KI6A 3K59A 1UA0A 2ITGA 3FDRA 4UQGA 1Y97A 4AHCA 3NFAA 2JTFA 4BD3A 3HXMA 1WSJA 2X74A 1XHXA 2LDMA 1A5VA 3DI6A 4Y1DA 4NCGA 1FKOA 1D5AA 5CZ1A 5K14A 1NOYA 3MP6A 1LWFA 3LZIA 4FM2A 3CFOA 4N5SA 1VSLA 2HNZA 4Y1CA 5I42A 1RT2A 4CRIA 4A4FA 3PV8A 3E9GA 3MEDA 2BDPA 2PZSA 1LW2A 4OPKA 1C0TA 2OZSA 1GOCA 3UT1A 2FBTA 3VQAA 3TAGA 4PY5A 4FW1A 2WACA 2KW4A 4CF8A 3LWMA 4CF1A 4F8RA 4DFJA 4MQ3A 4CGHA 3CM6A 1RBTA 1RT1A 4C8MA 1NJWA 1U48A 1VSKA 4Q5VA 4KAZA 4ZTJA 4KI6A 4KHWA 2YNFA 3ZT1A 1IO2A 1BQNA 3L2WA 3RMAA 4K8ZA 2RJCA 3KKSA 1RI0A 5J39A 3MEGA 4DU4A 3JSMA 3NF6A 4QQGA 3V9SA 2MWOA 2LVMA 2RI2A 3TANA 5KE2A 2DAQA 1TK8A 3TABA 2HHSA 4FLWA 1RT5A 4DQQA 1NKCA 4O0JA 1RBVA 3HYFA 4B8CA 4Z4CA 2G8VA 3DRPA 4KV8A 5HRPA 1U4BA 3AVMA 3QEWA 2O4IA 2G8KA 4FVMA 3NHGA 4K8XA 2A1RA 4AHSA 3LGLA 1JLBA 1KVCA 3SQ0A 4KHSA 4H8KA 3VA0A 3FLGA 3VQ9A 2Y1IA 4FU6A 4CJLA 1L3TA 4CJKA 4FLXA 3KK2A 2GF7A 4Z0UA 4AILC 4CJVA 4BE2A 3QETA 1TL3A 3V81A 2B8AA 3QINA 2K3XA 4Z4HA 1ZBIA 1WJRA 2XY5A 4CGDA 2HB5A 4IG3A 2P0KA 3QEXA 4JS4A 2QK9A 2KZZA 4KTWA 3LX7A 3DLEA 3P5JA 1S1VA 4IUPA 1TGOA 4E3SA 3QIOA 4FM1A 3OJUA 3TAFA 2BE2A 3LPTA 4PQUA 4ZTFA 1WSGA 1LWCA 4ID1A 1T03A 3PO5A 3DRRA 1ZYQA 4OJRA 2L3RA 4E7KA 5FDLA 3NF8A 2XO7A 2X78A 3TAPA 1TKZA 3I0RA 3SZ2A 3HT3A 1HYZA 3BDLA 2RHXA 2Z1GA 3OYHA 1BHLA 4KHUA 5DK5A 3HSTB 1J53A 3OYCA 2FHDA 2VG5A 3NGYA 3VQQA 1VSIA 2OPRA 3RR7A 2YNGA 2YNIA 1HRHA 4DS5A 4CFAA 2X4XA 3C4SA 4GY5A 3H6ZA 4OKJA 2PYJA 4M3XA 1MHNA 2FBVA 2BUDA 4DQIA 4KB0A 2E4LA 4CGFA 3O4NA 3PX6A 2Z1JA 3HPHA 2X4YA 5C6SA 3MXIA 4PWDA 3F70A 1RCHA 4CHZA 4DLGA 2Q3SA 3LZJA 3V9WA 4KPYA 1WN7A 5FROA 4FJXA 4M3TA 3OYGA 4B9SA 1MU2A 4HCCA 1IH7A 4DSEA 5KCOA 4B3OA 1JLEA 5SZTA 5D6YA 3I8DA 4DSFA 3NE6A 1W0HA 3OYJA 1RNHA 4BDYA 4N4GA 4B8AB 3VQ5A 1S6PA 5KRSA 2LRQA 2GUIA 4LY7A 3T3FA 4FK2A 3HO1A 1RTDA 3ZSYA 1SL1A 3TWHA 2OPSA 3CEYA 3DLGA 3MXJA 4I2PA 1U49A 1B9DA 3L3VA 1QSSA 3HJFA 3LP0A 3V1QA 3V1OA 2VG7A 3M8QA 3QESA 1NKEA 4CJWA 4JS5A 1SUQA 4DLEA 1Q9XA 4A4EA 4FJKA 1WGSA 2P5OA 2G8WA 2LTOA 1IG9A 2DY4A 5FRNA 3NF9A 3HP6A 4KHYA 5DMRA 3MEEA 1Z26A 4OLAA 2E6MA 4QCLA 1CZ9A 4CGJA 4A4HA 4DFPA 4F3TA 4PLIA 3O3HA 1LW0A 4N56A 2XRIA 2VWKA 4KHNA 2D0BA 3OS2A 3OY9A 2EKOA 3NTHA 5HRRA 5J2QA 1I39A 3V4IA 2EHGA 3DLMA 4FL6A 4KTZA 4BE0A 3NH2A 4PUOA 4HUEA 2RF2A 3SQ2A 1O1WA 1A5WA 1LV5A 3HVTA 1JLCA 3JYTA 1SSFA 3HVRA 2RHIA 4Z4IA 4QQDA 4CEOA 2XDPA 4QW2A 2IC3A 3DLKA 4EP4A 1TV6A 4CFDA 4M3ZA 5KGWA 2F8SA 4CEEA 2E6NA 5CYQA 4DTUA 3MAQA 4W5QA 4CK3A 3FEOA 1A5XA 5J26A 4E7LA 2QXFA 5C42A 4M3UA 3MP1A 4QQ6A 4ID5A 4CE9A 2KZMA 1N27A 4IKFA 3OYIA 1TL1A 3VQ7A 5D6XA 3EY1A 1KHCA 5EU7A 2XY7A 4CEAA 1HJRA 3QKJA 5SWMA 3QNOA 4CJ5A 1RBSA 3SUOA 2O4GA 4GMJB 3NH0A 1U47A 4FZZA 4CESA 2RHZA 3ZCMA 2I5JA 1NK6A 3KKRA 4X34A 1C6VA 2Z1IA 4FLZA 1IKWA 1C1AA 2IGIA 4CECA 1X9SA 3AA3A 2HNDA 3NGIA 4HCBA 4M3YA 2PYLA 2RPIA 5C24A 3AVGA 4IURA 1JLFA 1S9EA 4M3RA 4CEBA 4E7JA 1NK9A 3V9XA 4OPJA 1T7PA 4Z4FA 3KJVA 4DF8A 3TAMA 4CHPA 4E89A 4E7IA 4HTUA 1BCMA 1HYVA 3QNNA 2G3RA 3H8ZA 1WNSA 2EFIA 4IUQA 3BGRA 3WNEA 3H08A 1U45A 4E0DA 1J54A 3LYIA 4IFVA 2E6LA 1KVAA 3FC3A 3LAMA 2EQMA 4L8RB 1F21A 3CG7A 4CJTA 2LCCA 4B9NA 4M42A 1IKYA 2M0OA 4H4MA 1CZBA 4E1NA 5C25A 3O3FA 2M1HA 3S9HA 4DSJA 2EQJA 4IUTA 1KFSA 1FKPA 2X35A 3AO4A 1EXQA 4DQRA 2RI5A 3TR8A 2HHWA 3K5OA 1Q8IA 3K5NA 3KLGA 3PX0A 1TVRA 5HP1A 4L59A 1WLJA 4CHYA 3DLBA 1QS4A 4DWIA 2D9TA 2HHVA 4CHQA 3ZSVA 3HM9A 2DIGA 4CJEA 2JZ2A 3C6UA 2K3YA 4CFBA 3TARA 2ETJA 5D6WA 4OGEA 3EYZA 3VQPA 3M8PA 1RTJA 4NS5A 1T05A 3OMCA 3QERA 4HVJA 1CLQA 3KLIA 1S1UA 1HQEA 3ZT2A 4FZXC 2KTQA 3QEIA 3NTKA 3E01A 2PY5A 4CF0A 2KFNA 1TAUA 2OZMA 4CIGA 2QKKA 3LH0A 1C1BA 1S5JA 3QO9A 4EZ6A 4UC4A 3AVNA 3EZ5A 1HNIA 4ICLA 1KLMA 4QVZA 4OVLA 4CEQA 4ELUA 3LANA 1D9FA 3SUPA 3NBPA 1XI1A 3MEWA 3CM5A 4CCHA 4EZ9A 2FBYA 4FJHA 1C0UA 3ZT4A 4O5BA 1BI4B 5I3UA 2RHUA 2YKMA 2RJDA 1HQUA 4DTRA 4Q5WA 3ZEHA 2P51A 3I0SA 4KFBA 2GFAA 4KO0A 1JLQA 2WONA 3HK2A 1WSEA 3VQBA 2JLEA 3KD1E 3ME9A 3LWLA 2HHQA 3ZSXA 1QE1A 2O4XB 3K5LA 3VA3A 4B9MA 4NCAA 2HW3A 4W5NA 3ALYA 3AO2A 1B92A 3U3YA 4F3OA 4I9QA 4ELTA 1NK5A 2FC0A 1RTHA 4BDZA 2IG0A 1DTTA 3C6TA 4YNQA 4E19A 2RJFA 2YHBA 4CIFA 3DM2A 4A4GA 4CJ3A 4W5OA 2D0AA 1VSEA 3V1RA 2GBZA 1H3ZA 2YHAA 1UA1A 3F9KA 3LDSA 3RMBA 3UIQA 4FJLA 3ZSQA 4FLVA 2R5AA 4J2EA 4DG1A 2HMIA 4N4IA 1EX4A 1C1CA 2IS3A 4FJJA 2G8IA 5CIUA 4FLTA 4ZHRA 4FLUA 1J9AA 3HPGA 2OPQA 3QJ6A 1FK9A 3AVAA 1FXXA 3RR8A 5HRNA 4IUVA 1S1TA 3D45A 4B9VA 1Z25A 3QIPA 3O3GA 1JL1A 1HPZA 4Z4EA 3NF7A 1L3UA 5FRMA 4RW6A 4DTXA 3NH1A 2AJQA 5JS1A 1ASUA 1NK7A 2F5KA 1SV5A 4F4KA 1X9MA 1HNVA 4M3WA 3KLHA 1JLAA 1ZBUA 3V6DA 5CY4A 3MXMA 1D9DA 2B6AA 1S1XA 2DFFA 3AA2A 1Q9YA 4CF2A 1BL3A 2XHBA 3DYAA 4N47A 3NTIA 3P83D 3OYMA 1T8EA 4C5EA 1JXEA 1KRPA 2YKNA 3VQ4A 4IDKA 1RDCA 3NGZA 4C5GA 3DLHA 1KCFA 3OYKA 3KLFA 4IG0A 1QSLA 3K57A 4DQPA 4WE1A 4RG2A 4B9XA 2ZQBA 4M41A 3M8RA 4CGIA 1EP4A 2KQ2A 1REVA 4N4HA 3GOXA 3K2PA 4C5IA 1RDDA 2B4JA 3OYBA 3QLHA 4DTSA 5J2PA 3SCXA 4RW7A 4B9LA 1ZBHA 3IRXA 1R0AA 2ZD1A 1NK8A 2YRVA 1XC9A 3OYAA 2L8DA 4FJIA 3OYDA 1YVUA 4DFMA 5D3GA 3TAEA 1RT7A 4DU3A 4KHQA 2D0CA 3LPUA 3G0ZA 4RW4A 3OYEA 1RTIA 3FFIA 4E7HA 3ZSZA 3RMDA 4AHRA 4DS4A 4KI4A 4NYFA 4TSXA 2VWJA 3DMJA 3WNGA 3EAEA 4DFKA 4GVMA 4O44A 1NJXA 5CZ2A 2OPPA 2NUBA 3T19A 4KTQA 3HL8A 2W42A 3AVFA 3U3GA 3L2UA 4Z02A 1BGXT 3C95A 4FJNA 2O4XA 2R58A 3META 4PL6A 3PUFA 3SPZA 3IAYA 3THVA 3SD4A 3KTQA 3OS1A 4FK0A 3DLRA 5HRSA 1ZBLA 4DF4A 1BQMA 4AHVA 1VK0A 4DTJA 4BACA 3PY8A 3PMIA 5KE3A 3L3UA 1RT6A 5HBMA 1K6YA 4CERA 3NDKA 3SV4A 1OI1A 3WNHA 1CXUA 5IN1A 2Z1HA 3WNFA 1SL0A 4ELVA 4Z4GA 1S9GA 3RWUA 1G5VA 4O55A 2DIQA 3RRHA 4CJQA 2R57A 3BDPA 1TKDA 1C0MA 3VQ8A 2DFEA 4JRQA 2BIVA 1GOBA 3RRGA 1JXBA 3DB3A 4Q0BA 4B08A 4XIUA 3OB9A 3VQ6A 1G15A 3ULDA 4C8NA 4FJGA 4KB1A 3L2VA 4RG8A 1QSYA 1VRUA 2QKBA 3SUNA 1VSMA 5KGXA 3PMTA 1EKEA 3QEVA 2ATQA 3IS9A 4W5RA 4LH4A 1IKXA 5CYMA 2WOMA 4NYNA 5HLFA 2X4WA 4I7FA 3MO8A 3SQ4A 2F8TA 1HMVA 1VSJA 1ASWA 3KK3A 4DTPA 3G10A 4PLLA 4O0IA 4JRPA 4B9WA 1CXQA 1WAFA 3MEAA 5KH6A 4I9LA 3K5MA 2IDOA 2YNHA 2G8FA 4N76A 2QQSA 4IUUA 2HHUA 3VQCA 1HYSA 2XY8A 4CHNA 3CQ8A 4DTNA 4C8KA 4QOZB 4HUFA 4F2SA 1NK4A 3RMCA 1SL2A 5JS2A 3DOLA 3MEVA 2RO0A 2KFZA 4KREA 1OYXA 2HNYA 4B9UA 2EQKA 4LH5A 4BWJA 2X6SA 3RTVA 1NJYA 1WJSA 1WSHA 5J2MA 4OKEA 4AH9A 2Y1JA 2HVHA 1U04A 4CIEA 4DMNA 4II1A 2YV0X 3AVIA 3IG1A 1UWBA 2JGUA 3P1GA 5KTQA 2R7YA 3LALA 2M16A 1XNIA 2X6NA 3KK1A 3L8BA 2A1SA 1JL2A 4PA1A 3V9UA 2B5JA 3AO5A 4LD0A 1KVBA 3UWNA 1IKVA 1KFDA 3ASMA 3HP9A 3MECA 3QBYA 2RHYA 3LP3A 4YFUA 2F96A 1L5UA 4NCBA 4CK1A 3PO4A 3AVJA 3CFRA 1BI4A 4CF9A 4H4OA 3CFPA 1D8YA 3OA6A 4CHOA 4NZGA 3ZSRA 1ZBFA 3CYMA 4O4GA 2MWPA 1VSHA 3OJSA 3V9ZA 1RDAA 2PQWA 3E9FA 1RDBA 4DU1A 3PX4A 4DSLA 1S6QA 1BIUA 4DTMA 3KLEA 4IBNA 4CEDA 3SYZA 2IAJA 4DTOA 2OA8A 2VYTA 2RN2A 1TKXA 4FLYA 4FJ8A 1N6QA 1UAXA 4C8OA 3AVKA 5J1EA 1NK0A 3LLRA 4AHTA 2FBXA 3O4QA 2P1JA 3KIOA 4LSNA 3SNNA 4C8LA 3TI0A 4CJPA 5M9OA 1OZ3A 1LAWA 3PNWC 3Q1JA 1JKHA 1WJQA 3PFSA 1TKTA 1XWLA 2BANA 3DRSA 3LAKA 3LP2A 4M45A 3SI6A 4OVAA 1BIZA 4FJMA 4OLBA 2HHXA 4CFCA 3S3MA 4JLHA 1X9WA 3AA4A 1JLGA 2LSNA 3AVBA 2CKKA 4IFYA 3B6OA 4CGGA 3OQ5A 3AVHA 4GW6A 3TAQA 3AVLA 1TK5A 1X1PA 2P5GA 4BE1A 3M9QA 4RW8A 4FZYA 2EX3A 1OZ2A 4F2RA 1SKWA 1YT3A 3OMGA 1YTUA 2RI3A 2RKIA 4FCYA 3S6WA 4LD6A 1GOAA 3OVNA 4FJ7A 4OGCA 4J2AA 4QAGA 1RT4A 1ITGA 2QQRA 1I3AA 4BWMA 1RBRA 4FK4A 4LSLA 3DB4A 1EETA 1TK0A 1L3SA 1KTQA 1L3VA 5HROA 4FYDA 2HVIA 1QTMA 2DFHA 2GFUA
chains in the Genus database with same CATH superfamily
2UZKA 3U4LA 2GTDA 3AV9A 3AG3H 4HVUA 2CP0A 1ACMB 1LFPA 4XAXB 5CK9A 3VN5A 4WCIA 3LH5A 4Y13A 1SKRA 4BL0B 3ISNC 4MZMA 4CO8A 2GV9A 3CPWM 5KCHA 3SUQA 3RSEA 4BQNA 1KG6A 4XTYA 1IJJA 4IX7A 1K7AA 3MEUA 3HRSA 1TAQA 3J81O 3GF2A 1IN6A 2XDBA 2OCCH 4M75F 4PCQA 2ZSIB 2NRTA 3KZZA 3BG3A 5C0MA 2BV6A 4I2QA 2RHKA 4R8HA 5BRHA 3NNQA 1QQCA 3CCST 5JMVA 1AVZC 3B6PA 3NFAA 2WSCE 1Y1VJ 4AU7A 2V75A 2QA4T 1ZBXA 4XH4A 3CCMA 1PU7A 3ZEUB 1JUMA 1WRJA 2KW4A 2DT6A 4C8MA 3K0LA 3R6SA 3FHGA 5E3LA 2NZTA 2IGOA 3RMAA 2RJCA 3V9SA 1MA9B 2LVMA 2CQXA 2ZCWA 4CCKA 1RAIB 2PVDB 2DA6A 2GNCA 5DCMA 3LGLA 5BS6A 1KQ0A 3LWFA 1YJNI 3V81A 1ZSZA 2B8AA 4BR0A 4KIGA 1VYVA 3JCMW 2LVSA 3LX7A 3B6CA 2X9DA 3CCJQ 3QIOA 3HTVA 5IT9K 3CCLI 4ZTFA 1LWCA 2HHHK 5H6QA 5GTIC 4WQ4C 2QBYB 2K4YA 3I5SA 1SAXA 1WI9A 2K57A 4K42A 3ZMDA 1WGXA 4E1JA 5IHNA 2EIFA 1ZA1B 1U3OA 3KVGA 3CD6A 3RR7A 1PWTA 3H3UA 1QHAA 2EJFA 2MABA 4JQFA 1NGGA 4DR1K 3V9WA 3BTCA 2JWTA 3MZYA 4DBFA 3DTIA 4HCCA 1DDNA 5M5WJ 2O8EA 4DSFA 1W2BM 3CMYA 5GAN8 1XNQK 2OTLN 1MH3A 4AF1A 3AG4H 3HGYA 4D9JA 3CC4A 3MFKA 4DW6A 5EEGA 2G8WA 1N75A 4Q47A 3PFIA 2QI2A 3N05A 3A4CA 3J81E 4C9YA 4ABZA 5LJWA 1YITQ 3VEWA 4WFAL 1Q81C 2RF2A 1J6ZA 1JLCA 4M9ZA 4DTUA 2FF6A 4CZCA 4ZNXA 2MD5A 3ATVA 3CJ7A 4A61A 2QDLA 3IRRA 2FZKB 1OCPA 5E1ZB 3R2XC 1K61A 1IW7F 3GMEA 2JTMA 1IN7A 1YG2A 4IURA 4BG8A 3HPWA 3DF8A 1BCMA 3BGRA 4I6MA 4Q48A 1CZBA 2EQJA 3VGMA 2ZJ2A 1N78A 3CBMA 2RNJA 3BZCA 4DV4K 3N4PA 2OQRA 1SFUA 1M1FA 4JKFA 2JJ9A 4RTYA 2LT4A 4FIBA 3E9OA 1U6GA 3GFLA 3DEWA 4BC5A 1LE8A 1J3TA 4LG0B 1XB4A 1H88C 2QGGA 4C92E 4PHTX 2KYMA 2PNIA 2HBPA 5I3UA 2VT2A 1KAYA 4MDWA 2H8RA 5LJ3f 4AI5A 4WFBL 3RJPA 4MO7A 1WDXA 3E9LA 1PVSA 4FYVB 4B1UB 4A63B 2HKNA 4G6DA 4BRNA 2P9PB 4GVEA 1U5TB 4XKVA 1X4PA 4DB3A 4FLUA 2JW4A 1W2BP 2E1YA 2E2QA 1SFKA 3M54A 1JL1A 3H92A 2ESHA 1H641 2NS7A 5LL6Z 2BTFA 2B6AA 3THYB 3EFSA 3VFZA 3BG6A 4N0AA 3NTIA 3GZ5A 1ETVA 3MKDA 3K57A 3CCMI 4KMFA 3ZQHA 3CWUA 2YRVA 4NHJA 8AT1B 1AWWA 1WJDA 1M8MA 1SHFA 3K4NA 3S16J 2D0CA 3CCSN 3KEYA 4OU0A 4DS4A 2M0CA 3U3GA 1UJYA 3W6VA 2ZXIA 5DM7R 2FSWA 2E70A 3CC2I 3CP8A 4QT7A 5F6FA 2DOFA 3IAYA 4A3IJ 1KYZA 3DPLC 2Q2EA 1W36D 3U23A 4AWXB 3G1OA 3BDUA 4C8NA 2L7FP 3JSOA 3QP6A 2LKSA 5GAOl 5B1AH 2A6AA 3FJPA 2QQ9A 2F8TA 1MUZA 2BW3A 1BOTO 5FLXK 5FKKA 5LFAA 2YNHA 2HHUA 3QP5A 1VFCA 2QQSA 2HOSA 4H0VB 2Y75A 4B3SK 1S29A 1D0YA 4RTFD 1JKPC 3P7NA 1P4WA 3B02A 3LDLA 4OKEA 2L54A 1RGIA 1J75A 4AT1B 4PA1A 5KCMA 1PUEE 1MJAA 2O01E 3MQ0A 3HP9A 4NCBA 1UG2A 4HSTA 1VSHA 2K9LA 2ISYA 4CI0C 3QPHA 1WYXA 5LJ5f 1YHQQ 2EA4A 3HSBA 4C8OA 4AHTA 1SVOA 4LSNA 3OSGA 5BRDA 5BN9A 4CFCA 5K5QA 2KRCA 1ZA2B 5BRFA 3TAQA 3AVHA 4JEPA 2FOKA 1VTNC 2JA8J 2ZNZA 2OAWA 3S6WA 4LD6A 4QAGA 2RK2A 3FZHA 2R5ZB 3ZGKA 3G1JA 4FJ5A 3FMRA 2DTZA 2ZE2A 1QCOA 1QMCA 5GAN6 2E71A 1QO0D 1KD1C 1KG4A 2MC4A 2LF8A 1WSFA 2X3WD 1NPPA 1GXIE 2CDTA 1UHSA 3QIIA 1HD3A 3S3NA 2NLUA 3QICA 2D5RA 2VLAA 1VRTA 3SZTA 5AQOA 5AQUA 3UB5A 4YRVA 3F23A 3CC7I 2ZJQF 4M78C 3MP8A 4CGZA 1F43A 1AWJA 4HUGA 4C92G 5K7FA 4LGWA 2I5WA 4UY8I 3DI6A 5CZ1A 1NOYA 1IO6A 3JRCA 5GAN5 1RR7A 3NRVA 3DU6A 3DXKB 2E5NA 1QW1A 1I50J 4CF8A 3VTIA 2R5YB 3A0IX 4LMYA 2DD4A 1FIPA 4MQ3A 4DFJA 1MMDA 3JREA 2HOTA 3ZMZA 3CC7A 1IO2A 2WV1A 3KKSA 3HRTA 3MEGA 3HOWJ 1YTYA 2DDBA 5FLXO 3W2WA 2JPCA 3K4KA 4A5MA 4HRIA 1B34A 3SQ0A 3FLGA 3MKZA 3GW2A 1WJRA 2XY5A 3EPZA 4J9HA 5GAEJ 3W0LA 2KT1A 1ESVA 4HQEA 2QTXA 1ZRFA 3QYBA 5KN8A 5L8RE 4QLCU 1E2XA 1OYYA 3J7YP 1FNNA 3IC7A 2XGEA 1IUFA 1XQSC 4RTXA 1YFNA 2GBYA 1IGNA 2FHDA 3VQQA 1XCBA 2KJBA 4KNYA 2ZXWH 5I22A 3G4SI 2QWRA 1VQ9Q 1DU6A 1KAZA 3HPHA 4EJZA 2VODA 4M3TA 1A31A 4L0YB 5LMNK 3RYRA 4DOWA 3I8DA 3CMEN 1S6PA 2ZMEB 4FK2A 3HOUJ 5EF6A 3U8XA 1ILYA 4JKGB 1XNRK 4CJWA 4X66K 2KKOA 4FJKA 2KRMA 1Z7UA 1CZ9A 4ZYGA 2NRZA 4CGJA 4XOPA 2CSOA 4II2A 4JLIA 4DR6K 2IIRA 3IFRA 3PVLA 4FWPA 3VS1A 3KX2A 1X3ZB 4B47A 4B1WB 2O2OA 3CC2N 3BQYA 3QNOA 1U47A 1HX1A 3BT9A 2Z1IA 1IKWA 1GXQA 3BPVA 4E7JA 1NK9A 3L2ZA 2E20A 2L3PA 4E7IA 3D5SC 2BY3A 3TTFA 2HDCA 3WEEA 1MUDA 2L3QA 3EGXA 3ABUA 1SFEA 2LKPA 4A3BJ 1UDLA 3FDYA 4H4MA 2PZ1A 1Z67A 3TW7A 1FKPA 4D7MA 3K5NA 4WXDA 3GL1A 1QS4A 2A42A 4M7AE 3HM9A 1P92A 5CYVA 2DTOA 5KPTA 4CA0A 4EAHD 3ZQGA 1CLQA 2ACJA 3ZT2A 3SAHA 4RMOA 4CF0A 1MDUB 1TAUA 1Q82U 2E2OA 5DLQE 4P9UA 4Y15A 1VQKI 4FJHA 2EYYA 5CKHA 2GGRA 3NFCA 4HF1A 2J6OA 4JAXA 2D0OA 2YKMA 4KT0E 2O0YA 1HW2A 3I4MJ 2GFAA 4E9HA 4JYKA 4NCAA 2NOZA 4M63C 3A8LB 4E19A 5J8CA 1G3WA 5I9EB 2Z3YA 3EE9A 3G6EQ 1UA1A 2OBPA 4DYRA 1HW5A 3PIPF 1AZGB 3M0TA 5KNLA 4F93B 5C4JJ 1PP8F 4CZHA 1Q1VA 5HDGA 2A05A 1NGBA 4DV2K 9ANTA 1W1WE 1J9IA 1LDJA 4OINF 3M3ZA 1D9DA 4CF2A 1SFXA 3A01B 4NBQA 3NQOA 1JXEA 2PN6A 3VQ4A 2VJJA 1QWFA 1U84A 4BRPA 1WXTA 4XONA 2A6HF 1EP4A 3OSSC 4C5IA 3SCXA 5BPNA 1WXUA 2IA2A 1TUGB 2MW8A 2ENMA 1FTZA 2P5KA 1X1AA 1WIEA 4RLFA 2DILA 4U87A 2YX7A 4BBRJ 2D5VA 4PL6A 1VQ5A 5AQHA 4DR3K 5L3GA 1ZBLA 3S6IA 2W40A 4IRIA 3CJQB 1Z6TA 2Z16A 4BACA 3HB9A 1GLNA 4M9SA 3QDKA 1SL0A 5IN1A 3WNFA 3F6OA 1YRNA 4XIUA 3VQ6A 4XU0A 4UUSA 3LM2A 3CETA 1X4OA 2ATQA 4Z4EA 1JQQA 2UUZA 4RCCA 4GFBA 2YUPA 5IYDJ 3FHNA 4OMLA 4C8KA 3GBTA 4HAMA 1ZK8A 3QZ9B 1XQPA 2QWPA 1SS6A 1WXBA 1OVYA 2OTLI 2YUSA 4M3DA 2JSPA 2XHKA 4II1A 5HNHA 2M16A 3IL2A 4HWIA 2VWBA 4ZDPA 5LRRA 4H4OA 2P5LC 3A98A 2PMZA 3LDPA 4CBWA 1RAAB 3DLLF 3AGKA 1QA6A 4LF4K 3CO6C 1Q86R 5KQ8A 2KRNA 5EG0A 1ON2A 1YQRA 3FKJA 1OZ3A 3G3ZA 5M9OA 1LAWA 1RAHB 5CVJA 1JKHA 5IOZA 3ZP5A 4A3JJ 2WC2A 2A41A 2M3AA 4XKBA 3OQ5A 2P5GA 1AA7A 3U21A 4CYDA 1POGA 1YW9A 4RW8A 4F2RA 3F21A 1M1GA 2E88A 4DUYK 3HBLA 3FZVA 4B1RA 2O8EB 1V55H 4XLFA 4BNCA 5CQGA 1G3SA 3O9SA 3C2GA 3OYLA 2CH6A 5F1XA 3C2HA 5IWAK 1D5VA 3P8DA 3DXJF 1KLNA 3MN6A 1RL2A 1D0ZA 5E26A 3BPXA 3O9QA 5FFXA 1MGTA 1MMAA 4OKKA 3CD6I 1WCMJ 1O7LA 1WSUA 3DOKA 2EYZA 3G1LA 1ZSZC 2V1RA 2CUJA 1K78B 1TT0A 4M7DB 1ZKGA 3AO3A 1U2VB 4CJSA 1SSHA 2XK0A 5BNGA 5D5VB 3QDRB 5E1XA 1UB4A 3SLCA 1OLTA 3DEEA 4Y1DA 2FMYA 1W5CC 1NMNA 2BDPA 1M8VA 2DZCA 5D5UB 4L0ZB 4F8RA 4JX6A 5LHHA 5E18F 5LJ5h 5HLIA 3IH2A 4X0GA 1M3AA 2PLYA 1RI0A 4LF6K 5HLGA 2RQPA 2HHSA 4L18B 1VAZA 4IQJA 1RBVA 1OISA 4K25A 4IHXA 1APLC 2YI1A 3VA0A 3WXKA 3ZMVA 1VIEA 3CMEQ 4CJLA 4DIQA 3FBNB 4BR9A 2A3SA 3BR1A 4UNOA 2W03A 1Y96B 3G6ET 3RCOA 2ETHA 1HR0K 1HOMA 5AQXA 3ZQLA 4EVVA 5AZIB 3HT3A 4NQWA 1VQNI 1ACIA 2YRDA 3U1KA 2FBHA 2YNGA 4GBQA 1TUDA 4CGFA 2ITMA 2Z1JA 3TTDA 4CXFA 4GNIA 4KPYA 4LFAK 2R7SA 3LZJA 5KVRA 5FROA 3FXMA 1MU2A 1NGJA 4P96A 1KQSM 3CCUN 4HZFA 2EGAA 2HEQA 1PUFA 5BOXA 1K73C 1YX3A 5JLWA 5M1QA 2LNHB 2XKOC 1XN7A 2DA2A 1UFMA 3PL8A 2LTOA 1PP7U 1XOVA 1Z26A 2K7LA 1Y7XA 3FZKA 3V4GA 3CCJT 1JJ2P 4KHNA 3ZMTA 2QWLA 4BE0A 2XRLA 2HFHA 1LV5A 3J7AF 3EG9A 3HVRA 1EFNA 2JA6J 1FEXA 1NG2A 3FKIJ 1OYIA 5GAMh 3VF4A 4IKFA 2QEXI 3PO3J 4J01A 2XY7A 3BG7A 4XRMA 4KT5C 4AFSC 1PKSA 4KUDK 3KKRA 3CCVI 1LWYA 5EXWA 1O57A 2KJCA 4U0YA 3TAMA 2QA4Q 2DEQA 1R5HA 1IN5A 2JA5J 4CJTA 4B44A 1QU3A 4M42A 1KG1A 2M0OA 3O3FA 2M1HA 2K40A 1C0GA 5GAOn 3WG7H 2RI5A 1K4TA 4UUVA 4IFEA 4JK1X 4CCNA 4XTXA 4A0ZA 4DHYA 1BIBA 4BBSJ 3W2VA 3P9CA 3ID8A 3DBRB 5AJ3K 2JM9A 5LLQA 3KLIA 2KFNA 1Z21A 1R71A 2V52B 2O61A 2H56A 1I8FA 4RTUA 3LDNA 2XG8D 2EFWA 1XI1A 1VQLT 1VQMT 3HHHA 3E5QA 2C0IA 4E6KG 3EUHC 4FYWB 4IHTA 2HD0A 2DF6A 3ZEHA 2V6CA 1NE8A 1YS6A 3VOEA 2WONA 4GV9A 3LWLA 3HOSA 4B9MA 3CD6N 3VB2A 1LJOA 2Y48A 3P8BB 3H0HA 3CBOA 4A3GJ 3KCCA 5JLFA 3V1RA 5FKMA 1BC8C 4HXJA 5FPDA 4C92D 3L6QA 4RGUA 2DK8A 1M5Q1 1FXXA 4IRGA 1SZ2A 2Z33A 5AYFA 1GVDA 2IA1A 2DFFA 3FE1A 2P9LB 4BRLA 5BN8A 1XTDA 3O4WA 1WHJA 1G99A 4IDKA 1D1BA 2EIMH 4R1HA 1IHVA 1VQLQ 5IP7J 5E1WA 2HL3A 3UKUB 3GYHX 3IRQA 2E1HA 4XKCA 2E1ZA 1P7IA 4DU3A 1FLIA 1VQ7T 4RW4A 3OYEA 1HKCA 3BTIA 3BJAA 3GDQA 2STWA 4YELA 1JJ2A 3L2UA 1IDYA 2R58A 2Z99A 3H46O 4JK9A 2I8DA 2J5PA 4ZJZA 3PY8A 2UXBK 1K6YA 1QQMA 3WNHA 1VQ7A 1S9GA 2FJ1A 1WB9A 2E36A 1C0MA 2LLKA 2QSFX 1UECA 1LJ9A 2A61A 1V29B 2DBMA 3VS7A 5BMZA 3IS9A 3CJBA 5HLFA 1NKUA 1HDPA 1ZTRA 1N39A 4QIWN 3KK3A 1MNMC 4O0IA 3CF5F 3CCRT 3ASNH 1WI3A 3VRZA 3A0HC 2K27A 4HF2A 4F2SA 1SL2A 5JS2A 2RO0A 4HSRA 2VVKA 3WHCA 2EQKA 2LX9A 3M4OJ 2R7YA 2FBKA 2RQQA 1KQ8A 3KP3A 1OYWA 3ABTA 4PFPA 2WY7Q 2CV0A 3OA6A 4CHOA 3JCMQ 2PQWA 3G71T 4DBRA 1Q82C 2DA7A 1NG9A 3T1HK 3JTHA 3FSPA 3O4QA 3SFMA 1LNWA 3C65A 1C0FA 1IB8A 4JHDB 1BIZA 4E9GA 2X6YA 3MAJA 4KMUX 2NUPA 3KP2A 2UXNA 3F2KA 2XGDA 5A0DA 2EX3A 4FZYA 1UGRB 3HL2A 1JCFA 1DGRM 4J2AA 1K8AU 3I58A 2M7AA 3DB4A 1EETA 4XH1A 2HVIA 2RK1A 5ED4A 1JB0E 2XHCA 4I0AA 1VQ6T 2AXTC 4LLLA 4JKGA 1QPMA 2A3ZA 4B9TA 3CQTA 5DDGA 1AOYA 3TP3A 2QEXA 2BHYA 1JXOA 4CD3A 2RN8A 1MWMA 4HCZA 3L2QA 2LYCA 4A3DJ 4A4KA 4IOXA 4CK2A 1B9FA 4EDUA 3BY5A 1S1WA 4LD9K 1YQAA 1VQ5I 4S05A 3TOAA 3CDHA 3P9IA 2R7RA 2CG4A 4BHPA 2QLZA 3D0SA 4I09A 5E3OA 4OIPF 2LP0A 2K2VA 3GFMA 1WSJA 1STZA 3MWTA 1LW2A 4RM3A 2XB0X 5JLXA 1C0TA 3VQAA 2L2OA 1GFDA 1NTCA 2V9PA 2QW9A 4CF1A 2O8FB 2DL4A 4YTLA 3UPUA 1IGUA 4DA4A 1MDMA 3UA6A 3M0QA 1QZ5A 1IV0A 2RI2A 5KE2A 3TABA 2J5OA 4BHBA 2RA2A 2ZJPF 5KYWA 2MIOA 2X6OA 3VQ9A 1L3TA 3GTMJ 2GF7A 5JR3A 2DA9A 2MAMA 3GLXA 4P5NA 3LQRA 2EWNA 2AT1B 3TSWA 4ENNA 4NC6A 1W5TA 1PU8A 3GVAA 4E3SA 5GAMf 2DLPA 1Q81U 3E6BA 4X64K 1ZYQA 4V19S 4OFAA 4EMKC 1YS7A 3I0RA 2VPRA 1R23A 3GUDA 3ZR8X 4A57A 3FK7A 2LNBA 1KG5A 5J3BA 4X9DA 1ZHIA 1HRHA 3L1PA 1YNZA 2FSKA 4QS9A 4PDKA 1W97L 3EH2A 4ZYHA 4EIAA 1YBYA 2AHQA 1VQNQ 2X1DA 2JG6A 4C8QB 1QVFS 3OIOA 2JHNA 3D5LA 5IT3A 4XH5A 1NU0A 2IAIA 1YQLA 1YCSB 3WVEB 4NUBA 2D0NA 2DY4A 1V4TA 1SFOJ 3A5ZB 2E1MC 2E7WA 1X1BA 3I55T 2HZDA 4N56A 4KH5A 3CLOA 2H8HA 2QKLB 2EHGA 2CREA 3G4SN 2YG8A 2BUPA 2OPTA 1FIAA 3HSCA 3I55Q 4L5IA 3DLKA 2QEXN 4M3ZA 1AU7A 3IAM2 1Q95G 4L6V5 2VC0A 4QTRA 3M6GA 1YITA 4UV8A 2M0MA 3FLCO 1WWXA 4BAYA 4CJ5A 4CC2A 1RBSA 3SUOA 3JRHA 3JR9A 4EM1A 2OTJI 1BU1A 3LCNA 1QRYA 3LA2A 2ZGZA 1E3MA 5LHGA 1K79A 5GAMj 1T0JA 3JAMK 4CH7A 1N33K 3TTCA 3TSPA 4HQMA 2QGUA 3U2RA 5CVRA 2E6LA 2EB7A 2EIKH 4LIUA 2A28A 3C18A 1IKYA 2HYGD 4XNFA 2Z9OA 2IVOA 2EGCA 4L59A 2HHVA 3SFIA 3CF5L 4M7DG 3GXOA 1BI1A 2ETJA 3M8PA 2MBFA 3QERA 2CUEA 3CDLA 1ITYA 4J7FA 5AQJA 4JI8K 2E41A 1ZLMA 3V7CA 2L7ZA 3LW5E 3QEIA 4DBHA 1UG1A 5ILSA 1C1BA 1S7EA 1S5JA 4M7YA 1MV3A 4C92A 2K02A 4LLGF 3RYPA 3MEWA 3D1NI 3RBBB 2DN0A 4KO0A 3HOZJ 1SPKA 1GRIA 4FSVA 3VQBA 4CC3A 3ZSXA 1OJLA 4KFCA 1YIOA 3WGIA 1I27A 4UXNA 1B7TA 2L9VA 3C6HA 3THKA 2QENA 3QO3A 5F0CA 4FLVA 2E2IJ 4E4HA 3CCUA 2A3LA 4EW4A 4XU2A 4AM3A 4B9VA 4BR4A 2PJRB 3SDGA 1NM1A 1TTYA 1HA8A 1M2OA 2NOFA 5IP6A 1JHFA 3OS5A 4XN0A 1UJ8A 4F7UB 2FBIA 1ZR4A 3L1AA 2RMOA 3NGZA 4AVZA 5M1KA 4K2EA 3D2FB 3SZPA 3ASOH 4JKBA 1SD6A 2PAVA 3IRXA 5FLXE 1NG7A 1IZ6A 2VWJA 4IHSA 1B9NA 2B9SA 5JVGL 4A5BA 4ASNA 3T19A 1VQ6Q 1BGXT 4P1WA 3JAMZ 1HSJA 3H3NO 1XC5A 5L3DA 1DGKN 2YJEA 4DTJA 2MA3A 2EA2A 2QASA 5A2QO 3NDKA 2G7UA 4PSWA 4LXCA 1U5SA 4PJ0C 4YY3K 3DQVC 2H8WA 2J05A 1E6GA 1R58A 3AKZA 1QZ6A 4YOVA 3I56Q 3OHRA 2O31A 4YDUA 3DKWA 3E66A 2RM4A 4N76A 2EPFA 1UGSB 3VQCA 3S2WA 4MEXF 1YJ9Q 4FPAA 3LSHA 4GV3A 3DOLA 3BCAA 3SHWA 5FU7B 4ESBA 1RIOH 1DEJA 2PVOB 2VXZA 2Y1JA 2CGHA 2DK3A 2YV0X 1B6AA 2K6DA 5KTQA 3ULQB 2G6FX 3A8OB 2QKMB 4J19A 4XTUA 3V9UA 2PJPA 3S15J 2ZJPL 4QS7A 1A5JA 1YJNQ 4DOVA 3PO4A 3UE5A 3FXRA 2E2JJ 1J5YA 4Y17A 1G83A 3CYMA 4XN3A 2FNPA 3KLEA 1E4GT 2FXUA 2A40A 2GXAA 1VQNN 4X1EA 4KH1B 3H0GJ 3HM8A 3CCMN 3DV8A 2HGCA 1WHGA 4FWRA 1X6BA 4IVNA 4HX7A 1HNWK 3PIOL 4EMKA 2RE2A 2DFUA 5CQXA 1N5ZA 3C12A 4XOTA 1OOTA 4MTDA 4WF9L 2YSRA 1SMTA 4BHCA 4OF1A 4CZIA 3X2QH 3F8FA 1REPC 4MLOA 1PU6A 3FXKA 4M77F 2O8CA 3L42A 2K4JA 5ILVA 2DNUA 1QHHD 2VXDA 1A6QA 2R5MA 3WTXC 4GRIA 3AA5X 1J5OA 1LNXA 5CKEA 4WCEL 3E9PA 5DM6F 4A6DA 4GKKK 3M9AA 4UVCA 1XMQK 1W5SA 1JGGA 2HVRA 5HLTA 2KQRA 4RM2A 1FYLA 2VG6A 3TOBA 2G9WA 2QWWA 1UOCA 3O8VA 3LDQA 2CZ1B 1Y71A 4NXNK 2VKDA 3SDZA 1EZZB 1VSFA 1I5LA 3MWPA 5M1OA 3O2PE 2CH0A 2X74A 1VQPT 2G8FA 1AKHA 4Y92A 1YIJI 1S3XA 5TISC 2OI3A 1WQ7A 2DJNA 1I07A 3BE3A 4FW1A 3J80K 2KKZA 4JYAK 3B73A 2YNFA 1PCXA 2NNNA 3TANA 2YSQA 1ARKA 1ORKA 2CS3A 4DQQA 1WHHA 3QJYA 4FLXA 4UNFA 2Y90A 1R1TA 4R55A 3CPEA 3TU5A 3JCMJ 2KZZA 1S1VA 1I3QJ 4FX0A 4KUIA 3WU0A 3R8EA 2JK3A 4AIJA 1IGQA 2GXBA 4Y52J 2D8JA 1S72Q 1ZLKA 1JGSA 3OYHA 2DEUA 3HSTB 5AQFA 3PT9A 4HVWA 4CFAA 3G71A 3CXCS 3VF6A 5ADXA 1J2XA 2BUDA 5C44J 4M73A 2KBTA 4UOBA 3TSUA 2DYIA 1N3CA 2NVXJ 1YHQT 3AY9A 1QQOA 1IH7A 2ADUA 4JI6K 5DD8A 2LRQA 1W1FA 3KETA 3MVPA 3T3FA 2RF0A 4FYYB 3CEYA 4RKUE 4BJTA 4DV3K 4ZZLA 1D8KA 1Q9XA 4G94A 3FR0A 3R6MA 3O3HA 2EIJH 2DQRA 1TYQA 1UHWA 1H9GA 2XASA 4M9XA 4Y4RA 5CLSA 3CJTB 1ERDA 1VQ4T 2KZMA 4ID5A 5ICCA 1ETYA 1U5TC 1MUNA 4GCVA 1Z91A 4B6MA 4MQVA 1YJWA 2EJ9A 3TMOA 4I6MB 5FW9A 1PD0A 1S9HA 4A0YA 4Z4FA 4J6XA 3GX4X 2XAQA 1T0FC 4IFVA 1N77A 2V9VA 4L8RB 1X6OA 2ZGWA 2D1KA 5ICFA 1Z9ZA 2O8BA 3T0YA 1Q18A 3ZYYX 4YDUC 1Q8IA 2CWEA 2CQNA 3I59B 2P0PA 5HP1A 1NGFA 2D9TA 4K43A 4CJEA 1MMNA 2K3YA 1X2KA 2BEOA 1IXDA 3THWB 1B07A 1QVTA 1F9NA 3C7NA 2HDAA 3EZ5A 1BI3A 4BRFA 1GLFO 3GFJA 4CCHA 2EFOA 2NVUB 3O08A 2MYSA 1SRMA 3CMAA 1WSEA 2HHQA 2MF2A 4II3A 2CS7A 4JI4K 2W6KA 2Y69H 5LGUA 4MFEA 1JXMA 1IN4A 2HSEB 4Z94A 4DOZA 3H1QA 2KT8A 4JHDA 3T9NA 2CV1A 3A8MB 3F9KA 1IZ1A 4V2FA 1JTXA 3ZSQA 4N4IA 2A08A 4FLTA 3QBXA 2CH5A 4IUVA 1T39A 4OP0A 4NLCA 1TXQA 1BR1A 2VQFK 2CQ7A 2F5KA 2X4JA 1HNVA 3QYFA 3CCEQ 3MXMA 2GAUA 3DYAA 2L2PA 5LEJA 3JAME 5LJ5e 1VI0A 3G6EN 3KLFA 1P8ZA 4IG0A 1QSLA 3R9PA 1XGMA 4OMFB 4BRQA 5F0FA 1A0NB 2NXNB 1MV0B 1MMGA 3O8HA 3DP7A 2IIMA 5DEQA 2XC7A 2A69F 2CV2A 4XTWA 2MFZA 3UF4A 5GADP 1W4MA 1NJXA 4DBQA 1Q86O 4FT4A 4KTQA 3BJOA 4EHTA 3META 3SPZA 3S17J 1G3TA 1OU8A 2PMUA 1YJ9N 1WHKA 2DYBA 2DMOA 4EM0B 2KL4A 5FO5A 2ZPFB 2DMTA 1UEBA 4YFKF 3DB3A 2CSQA 5CKBA 3FMQA 1QSYA 2RH2A 2CT3A 4IZZA 4KH0B 1EKEA 1O75A 1PM3A 1PSEA 3CC2Q 4M7AG 3BF1A 3MO8A 3SQ4A 4JJBA 1VSJA 1ZGJA 3K5MA 5LL6S 2OU2A 1IRGA 2DLLA 1D4XA 1RAGB 4XTVA 4EV0A 3OV8A 1HU0A 3CQ8A 4QOZB 3EQLF 3OSFA 2KFZA 1MWKA 3RTVA 3M0RA 2XAHA 3CMEI 1WJAA 4GV6A 2HVHA 3K2AA 4OMZA 4D7NA 5DCMB 1S72N 1HK9A 3K4BA 2X6NA 4JI2K 4XLPF 2SEMA 4AQYK 1TWFJ 1TUCA 2H09A 1KC8O 4XK8E 3Q7BA 2CGLA 1S6QA 2LQWA 2OZUA 2JS0A 3DLLL 3WQTA 3CJCA 2EINH 2Z1DA 1A6IA 2K4BA 1T33A 3F22A 4LOCA 3AVKA 2XUBA 2I0NA 1CKAA 5FPEA 4CJPA 1ORPA 5LJ3g 1S72I 3Q1JA 1TKTA 5GADJ 4LFBK 2HU9A 5GTHC 3J7ZI 4IFYA 2DPUA 3JRAA 4CGGA 3HUGA 1GCPA 4J5YA 4ENMA 3MHXA 1V4RA 1EWQA 1RT4A 4ENJA 2M87A 3VYRB 5HROA 4C8QA 1EWRA 2GIZA 2EQRA 5B3SH 4FXDA 1PVEA 3NAEA 2FPDA 2ICWG 4N41A 2E5QA 1SKSA 4L3QA 4XTZA 1WSIA 5F08A 1T95A 1NOZA 2NVYJ 3JB9H 1YJ9I 2A37A 2HXIA 3VQDA 5KYXB 3ZBDA 3MCZA 1TG0A 1SEMA 2LJ1A 1VSDA 2YPRA 2O8XA 3GO5A 1DP3A 3T1AA 4DKWA 3BP8A 2R7XA 1LVKA 1TT5B 5ICEA 4QVDA 2ABKA 2VBYA 3RSNA 1BISA 2JVVA 5TRDA 2KROA 1UA0A 1XHXA 1F1ZA 4RMNA 1VSLA 5F04A 3D7SB 3E9GA 3HM5A 4RTWA 3EE8A 3UT1A 1NYGA 4M78F 3EYIA 3WQUA 4JX5A 1RBTA 3JSPA 3ZT1A 3L2WA 3OBYA 2X51A 5J39A 1ABOA 4C0DC 2ASPA 3DJCA 2LK2A 3JCMf 1U9NA 2YX4A 3E19A 1KVCA 3GEZA 3FWEA 3JRGA 2QWNA 2O8DB 1JJ8C 1QVGP 2K3XA 3CCLA 3W6JB 4MLHA 3I56A 2P0KA 5ICGA 4HDVA 4XEIA 1TGOA 2LCSA 3L9FA 1VQMA 1FJGK 2WFBA 1TKZA 2X4HA 2KDOA 3UA7A 1VQ8Q 2DO7A 3L09A 2VG5A 1VSIA 2YNIA 1GVJA 2PMZN 3SWNA 5KHDA 4KB0A 4O3MA 1TH7A 4MDBA 4PWDA 3I64A 1QGPA 1WN7A 2Q0RA 3OYGA 1K9MO 3ZRGA 2VQGA 5SZTA 3LSMA 2DPNA 3BJ6A 1CKBA 1V1CA 2OPSA 3MXJA 4IRHA 3LP0A 1R22A 4O5VA 3MX2A 3MEEA 4PJLA 3JCMh 3A5MC 3OY9A 3A5NC 3NH2A 3VERA 4J9IA 3FFKB 3HTSB 3CCSA 1SSFA 2HSPA 5HS9A 2LBFB 2GBQA 5GAGP 3HTRA 2IC3A 3F10A 4Z88A 2DTRA 4KRTA 5GANe 4DV6K 3E5UA 2BE9B 1A5XA 5GJWB 2NRRA 3OYIA 4BY7J 4A54A 1FP2A 1YFHA 5IT9Z 3HRMA 4C92C 2JWLA 1WZ2A 1HJDA 2LQNA 1QP2A 4H0PA 3MDQA 3CZ6A 3ESWB 3ZCOA 4ENKA 2XF6A 1OEBA 3M57A 1B72B 5HS7A 3CCSI 4CHPA 4E89A 2B7EA 5EVZA 2G3RA 2E4HA 2ZPHB 1K0SA 1Z0XA 5CVUA 3MZ8A 3LAMA 2NRVA 2EQMA 1F21A 4ILGB 1FWZA 3JB9F 2BY1A 4C8QF 1EXQA 2KPMA 3KLGA 2GEMA 3JXUA 3C6UA 1YJWN 4OGEA 3EYZA 3F8CA 1N8RU 4I6ZA 2VUBA 2YXYA 3OTOK 4HVJA 4EA4A 3CMAT 1W36C 2X85A 3E01A 2PY5A 2P9UB 2QKKA 5LBQA 1IRFA 1TQMA 4QVZA 2I5UA 2DVEA 1NNEA 2CQKA 2WADA 4PJJA 4M3FA 5CKTA 1EQYA 2RHUA 2YS9A 4F16A 4DTRA 2HBJA 1VQ5N 2VBZA 3PSIA 3QOEA 1JKQC 4ISGA 1PRMC 3S1RJ 3ZETA 4W5NA 1SQKA 3VKIA 3A03A 4F3OA 1NK5A 2FYKA 5GMKm 4IDHA 2AQEA 4YNQA 4PIIA 4B23A 3EUKL 5LJ5d 4GYIA 4CIFA 1QHGA 2D1VA 4JBAA 1XDSA 3ONQA 3UIQA 3HBTA 4DG1A 5C3EJ 3CJ1A 3BTLA 2NYSA 5KYNA 4BQAA 3L4IA 1NJIC 1HCRA 1J0RA 3DWLE 3VF2A 3LSIA 4Z2YA 4XSZF 1Z25A 3QIPA 3HOVJ 1C0WA 1ASUA 2NYXA 1K9MC 4B1YB 4HV5A 4EZ6A 1JLAA 1S1XA 2KXDA 3O8MA 1JRIA 4L9JA 2X1EA 3J80Z 4C5EA 1WJFA 4BXFA 2E65A 3OYYA 2KQ2A 4N4HA 4WCGA 2KHMA 1R5ID 1QVFM 2DJIA 4BRAA 2HYFA 1NK8A 2ZD1A 1XC9A 3OYDA 4DFMA 1OCTC 2K5CA 3LPUA 1OH8A 3EFOB 1T8IA 3HSRA 1HSTA 4YPRA 4O44A 1UE9A 4Y33A 2A68F 3MN9A 1ATSA 1ABQA 3LSRA 3THVA 4DF4A 2V7ZA 2OV7A 1ZQ1A 1NJIU 3A0BC 2YLCA 3C2BA 1G5VA 3QFUA 1JXBA 4Q0BA 4AFUC 4FHTA 1TUYA 3CC4I 1YHQA 2YHWA 3PMTA 3ZPLA 3TPQA 2E5ZA 3OBWA 3D6RA 2CGKA 1JUSA 4B1XB 2RC4A 3DPUA 3QQAA 1GLBG 3ULRB 4R56A 3DXKA 5GIPA 3CCVN 3MEAA 3PNYA 1N8RO 2K3FA 4HUFA 1GUUA 4XLHA 1RR8C 1DT9A 4LNPA 4J9EA 4ESRA 1ZG1A 1OYXA 2HNYA 1USSA 2DQLA 1BU6O 4AH9A 3FIWA 3P1GA 3JAMO 1ZG5A 3KK1A 2M4KA 2P0WA 4LD0A 3K9JA 4P5OA 3WXIA 1WBBA 1BI4A 4PKCC 3V7RA 5FPMA 1NM7A 3CXCA 4BR2A 4U7DA 2WTEA 2VE9A 2B0LA 3IHOA 4YOTA 3RMQA 4E7ZA 1IF1A 1F1BB 1NGIA 4RBOA 3CCEI 2HQAA 3BW1A 1XWLA 4F52A 3PIPA 1KQSP 2A36A 1YE9A 4BG9A 2XGXA 2QSGX 2NOLA 1SKWA 1M3BA 4OMMA 4EJWA 3RI4A 1MKMA 3RZOJ 3M1CA 2E1MB 2OAZA 2GIVA 4R5PA 3VDXA 2ZBKA 1B3QA 3CC7N 3EG1A 4HT8A 3G25A 1QVFA 3KP5A 2X48A 1Y0NA 1BI0A 3PJRA 1G4DA 5K5OA 4CJRA 2DDAA 1GFCA 2EQUA 2WC9A 1V4SA 4U0WA 1FX7A 1W9HA 4JI1K 3TO6A 3FHZA 3QEPA 4C30A 5J40A 3M1FA 1FYKA 4BY1J 1K78A 4ISFA 2E1CA 4I2OA 2L9SA 2BGGA 5AQPA 2O3FA 3K59A 3HJEA 2M02A 3GOIA 4NDLA 3ABKH 3TVTA 1FKOA 1K8AO 1PC0A 4KGXB 2OZSA 3LQQA 5HK3A 4CGHA 1NJWA 2F69A 4KAZA 2BXZA 4ZTJA 2ZSHB 3FXLA 2XPVA 4QQGA 1XJWB 2WAEA 4MMKA 3ERMA 1T38A 4Y28E 5ECAA 2R7TA 4AM6A 4M75A 1KC8U 4Z0UA 1KK7A 1OCRH 3OMYA 3QINA 4G6TB 2W1OA 2HF3A 1UJ0A 2Z2SB 3AARA 1RLPC 4OO1J 1Z9CA 4R0KA 2P9KB 3SZ2A 2P9SB 3SB2A 5J8FA 1Q82O 2QGFB 4KHUA 2RPNA 1U9OA 4MHGA 1TWBA 3ZX3A 1QKXA 2F7TA 2PYJA 1M90U 3O4NA 1IXRC 5E84A 2V1UA 4BJ6C 1YN8A 4BRCA 1V5GA 4DSEA 5KCOA 3EN9A 1LOJA 1D5YA 5DYMA 2K9SA 2QWQA 2BE5F 4XRSA 5D6EA 3QESA 1N25A 4JS5A 3VETA 4LFUA 4BI8B 4U67L 3JRFA 5E8IA 2RV8A 1HJOA 4XLAA 4DFPA 2EV6A 3L00A 2JMAA 1YWOA 3IH3A 4J83A 3JYTA 1EJ9A 4QQDA 2XDPA 2VKVA 4EP4A 3SQNA 4IZ9A 4LD5A 1T6SA 5DY9A 4HOBA 2AKKA 1XMXA 1CSKA 4IXCA 4EQQA 1OMIA 2VC1A 2ZMEC 2I5JA 3O3KA 2G0EA 6PAXA 3CC7T 3BG5A 2G7HA 2GOXB 5D4RA 2HNDA 1IUYA 1N6AA 4XK4A 4IUQA 1J54A 3J8AA 5FD6A 3X20B 5FU7C 2PJRA 1BBZA 2VKEA 2MD0A 3VS2A 1VQ8T 5CR4A 1ETKA 3JCMd 4HLXA 3PX0A 5AQVA 2OFKA 1S8NA 3EHRA 3IMXA 1BDGA 1X1DA 1U3EM 1MBGA 4IOAL 4KIBA 4AYBN 5D4SA 2HDWA 5GANf 2VXEA 5GAMd 2DXUA 1PYVA 3SWNC 2WV0A 4OIQF 4FPBA 3W3DA 2C0OA 3G0QA 4A3FJ 4O5BA 2QTVA 5AQKA 5IY5H 4BQLA 3I56T 3I0SA 1TC3C 4KHPK 4C92F 3O5ZA 3KD1E 3I4PA 1JJ2S 3UKRB 2HW3A 4BXUA 5EC7A 2JRTA 1DTTA 2XF7A 2KFDA 2JVHA 2UXDK 4DV5K 3IWZA 3K4LA 3G4ST 4GY2B 5EZHA 1EX4A 2VL8A 3ZL7C 2DKGA 4EW0A 2QYZA 4BY6B 5HRNA 3D45A 3NF7A 4FT8A 2Y0SN 1LFUP 3V6DA 1ZBUA 4J9BA 3CJ9A 4N47A 4M7DD 4UV9A 1VNDA 5E8GA 3KWIA 1TNSA 4C5GA 1VQ8A 1YITT 4AIAA 4FM1A 4JD2B 1T3SA 3GOXA 4IO8A 1ZBHA 2GZWA 1YVUA 3S41A 4Q4ZF 3ZSZA 1T6CA 4DR7K 2O7OA 2JMWA 3EAEA 5CZ2A 2OA4A 2W42A 1T2KA 3CW7A 3OW2P 3LFUA 2O4XA 3G4SQ 2W48A 3KTQA 2WSFE 5HBMA 2EZIA 2VGNA 2PBIA 4O55A 4CJQA 1TKDA 4L9NA 4B22A 5LY3A 4DV1K 3REBB 2X9HA 3RQIA 1R36A 3R61A 3NPFA 3IKTA 4YIIA 4AIKA 3DLLA 3CCJA 2ESNA 3VYGA 2JUCA 4FQGA 4BEHA 3MKLA 2K9GA 4YOUA 4C0GA 1D3YA 2NOHA 5IHIA 3V8KA 4B9UA 1OH6A 2X6SA 5J2MA 2QK0A 1BA1A 3AVIA 3CCLN 3L8BA 4K8ZA 2RQVA 2F96A 3OOUA 3AVJA 3CFPA 4ELYC 4F9OA 3VENA 2FF4A 5CO7A 1SG5A 5CJ9A 3DLAA 1Q7YC 4FLYA 2Y9YA 2LP5A 3PQKA 2KY9A 1NK0A 4W1UA 1MBEA 1QKWA 4D8KA 5AZIA 4CD1A 1ZBSA 2CP5A 1IHWA 3RKYA 3M55A 2LSNA 3AVBA 1JHHA 3B6OA 4FWOA 4GW6A 1TTHB 2DX1A 2YHXA 3EETA 1GOAA 2E35A 1JKRC 4FJ7A 2QQRA 2TDXA 3JSCA 1TK0A 1L3VA 5HNFA 4M3GA 2KSSA 1K76A 4XL9A 4WTOB 3FXOA 4KN4X 2DL8A 2KMTA 3PSFA 3S8PA 3MKWB 2CP6A 3RIRA 1MIJA 5DLOA 1EA3A 5IP9J 1QVUA 1WLPB 1O13A 2QA4A 4HNUA 4CJ4A 4CEFA 2H6CA 1USTA 2QQAA 2GLOA 3RUXA 4DCHA 2HQXA 2UUCK 3SPYA 4O5FA 2M8EA 5KYUB 1QVFP 4L5EA 1BUPA 1QHTA 1ZX6A 4JRIA 3OW2A 4CBXA 4BS9A 1I1GA 2GOMA 4C3JJ 5CKDA 5I42A 5EJCA 2Q2RA 1M1KU 4EJTA 1QVGA 2BTTA 1U48A 5AQYA 2UV1A 1YJWT 4FL9A 1VYTA 1KZHA 2XSDC 4BI4A 3KZYA 1XDUA 3ZN1A 1NKCA 4O0JA 4B8CA 4NC7A 4YPHA 5C10A 4A53A 3VSKA 4RGSA 1OX9A 5EEAA 1YYVA 1AHJB 1D1AA 2LNVA 1KC8C 2UU9K 4EGZA 5HCKA 1KQSA 2UXCK 2WAFA 1WSGA 1JO8A 1VHXA 2L3RA 4I76A 5FDLA 1J7KA 5TKYA 1ONVA 3R6NA 3NGYA 5LJ3d 3CXCP 1YJNN 3H6ZA 5CHZA 4UUTA 5ILUA 1MHNA 4HV6A 1AZEA 2BY0A 2X1CA 2KR3A 4H03B 3CPWP 4DLGA 1K9MU 2DT5A 2PG4A 3CQYA 3WEEB 4B9SA 4JI3K 4CSWA 2ZPEB 1JLEA 1W0HA 4DNCA 4B8AB 2E2PA 1UZCA 4FSXA 5KRSA 4H5RA 1W6XA 1RTDA 3AL0B 2ECCA 1NKEA 2B63J 4DLEA 4M78B 3WE3A 2HF4A 1ON1A 4HVVA 5D5WB 1XGSA 2VWKA 1KYWA 3LA3A 5B5EC 1O3RA 2FOWA 4H5NA 3CDIA 2LT1A 4Z4IA 4DEYA 4QW2A 4AC0A 5KGWA 3QDFA 5HK0A 3MAQA 5J26A 3CD6T 3BUZB 5EU7A 3BR3A 4MZTA 4JV5K 3X26B 1YW8A 2V7YA 3SEMA 2OZ6A 2IGIA 1X9SA 4M78G 4WX9A 4CEBA 3GE1A 2Y0SA 2STTA 2L7KA 1W7PB 4AG1C 4LITA 2LCCA 1MH4A 5LEKA 3BOQA 3S9HA 2DU9A 4E6RA 2OX7A 4M77G 1U6ZA 1X19A 1LE8B 3OMCA 3WUHA 2W04A 3HIFA 3E6DA 1JT6A 4UC4A 5CAIA 2HVQA 5BPMA 1MBFA 1VQPA 5JFRA 4OVLA 3CM5A 2ASOA 1NLPC 1KHIA 3D2EA 1HQUA 3G6EI 2C06A 2KEAA 1K8KB 1Y56A 4PKHA 4LC9B 3BROA 2YUNA 5GAOp 4NB4A 1L3LA 1VQ9T 2IG0A 2P9PA 3C6TA 1MUYA 4IHYA 1W70A 3CBPA 4W5OA 3CCJN 1YI2N 2MLKA 1HYOA 4EHUA 1M1KC 4B3TK 1NGDA 5GANh 2PU9B 4HBLA 4ANJA 1L3UA 3RDIA 1VQ7N 3I54A 1SV5A 2D2WA 4QWQA 5J6XA 3JS6A 3JCUC 4XU3A 3I35A 3PUBA 4PJOA 4ETSA 1RDCA 1N36K 4WE1A 2HMPA 4M41A 4V19K 4CGIA 3J7AY 5J2PA 1GXPA 3OYAA 1VUBA 2ZFUA 3HG9A 2JT1A 4E7HA 2CYZB 4AHRA 1MNDA 2DOAA 3DMJA 3H5NA 2LQKA 2P7CB 3H9NA 5CE3A 4IOCF 4FK0A 3VMFB 3HDDA 3CC4Q 5KE3A 1TS9A 4EM2A 3SJMA 1J59A 1SD4A 3RWUA 3RRHA 1NJIO 1FBSA 3OB9A 4UHTA 5K7ZA 3CCLQ 4IO9F 1YQMA 1D1CA 3OL4A 2V1NA 3NMZC 4G7ZF 4M4ZA 3QWXX 2O8FA 1ZUYA 3RPUA 4DTNA 2MLGA 3RPUD 1NK4A 3ZLJA 5LJ3e 2VJ5A 3FXJA 1YVNA 3L7WA 3RTRA 2ZB9A 1YJNT 1MSFC 4DMNA 2Q36A 2VC8A 1XNIA 1HKGA 4GO1A 4GLMA 4YFUA 2R7QA 4KB1A 1SHGA 1VQLI 5IXBA 5AFUA 2WAQN 2IAJA 4IWVA 3SAGA 1N6QA 4CHUA 1N9SA 1R77A 2XPUA 5HOOA 3H5AA 4C8QC 1GLLO 1ATNA 2HKXA 1GHCA 1QLYA 3SI6A 4JN4A 1ZC6A 2FO0A 4IIMA 2YUOA 2R5ZA 2RKIA 1VQMN 2HBKA 2VGMA 4FK4A 1RESA 4N9HA 4LSLA 4I99C 4DQ8A 4W97A 1VQKQ 3D7EO 3M56A 2OJED 4KKOA 1XGOA 3I0TA 4ME7A 5DM7F 3M5RA 1IJWC 3SHFA 3AO1A 5B1BH 3ZT3A 2O8CB 1M9SA 1R0CB 3LGFA 2EZLA 3R6OA 1M3CA 4C3IJ 1Z1DA 3VRYA 5LRSA 2A7YA 2M4GA 3VGLA 4RUGA 2A5WA 1IAWA 1IXSB 2K9QA 4HA8A 1RT3A 1FOWA 4CEZA 4JKHA 2ME6A 5J4YA 4OIRF 1ASVA 2OYQA 1FMKA 4EA5A 1GBRA 1YTAA 3CCQI 2AIRB 4BGAA 1LMZA 2HZTA 4S04A 4HEA2 3CCSQ 2OD5A 4QKUA 3U6FA 3GFIA 4AFZC 5TKWA 1Z6RA 1Y6IA 4FJMA 2GA1A 2LDMA 3M5AA 1KU3A 2NLXA 5EG2A 3LZIA 5GANj 3CFOA 4D1QA 3BG9A 3LNQA 4CRIA 2VQHA 2DBBA 1RI7A 3GTQJ 2HQHA 4FX4A 3VYSB 2ZPBB 1UCRA 2V8KA 1Y8RB 3TKYA 4Q5VA 2JN0A 3CCRI 4DU4A 2DE0X 3EYYA 3UR3C 3PIOF 3DCFA 1YXQA 4FLWA 4AVPA 2G8KA 2NOBA 3Q0UA 1UMQA 2WSEE 3PE0A 1MBJA 4CGDA 1WEFA 1Q1HA 5BPDA 1F36A 3P5JA 3VS3A 2KT0A 1SF9A 4PQUA 4LDWA 4P55A 3PIOA 2NRHA 5AZJB 4JK8A 3CCVQ 2QCOA 1RABB 2R93J 2F4MB 5ERIA 4Y7NJ 5CVIA 5DM6L 2FBVA 4MFDA 4DQIA 2COWA 2X0LA 3PX6A 4FOIA 1Z05A 1H8AC 1OR7A 3EH1A 2H27A 1LCKA 2GWJA 2JXBA 5D6YA 3OGDA 4RWTA 3NE6A 3OYJA 3THXB 3VQ5A 5I11A 4LY7A 3JB9J 4BUGA 4FTHA 1U8RA 2XDVA 1QQNA 1MW7A 1ZSZB 1VQ6I 3F0ZA 1IG9A 4KHYA 4F7UA 2DTIA 4QCLA 3K9TA 1QPIA 4GGGA 3I4NJ 1K9AA 2V4JC 3OS2A 4JD2A 3V4IA 2YU3A 3Q9SA 5IHKA 3SQ2A 3HXLA 2GXGA 4H5TA 2LFBA 3WTUC 4WQ5A 4L5GA 3T69A 2VASA 5CYQA 2HPMA 4KT6A 4LG0A 1FYNA 4DJAA 3SYTA 3MN5A 2LX7A 4O8UA 4PJOE 2HKQB 3NH0A 2DERA 5ADXH 3CC7Q 2XICA 1FOYA 2RPIA 1XSXA 2CUBA 1S9EA 1A35A 2WWYA 1UB9A 1V3FA 1LCUA 4E0DA 4RGRA 4BRGA 1HBXG 3VU3C 4WXCA 1F5TA 5GANg 5FJ8J 3UATA 3U9GA 4OPAA 3SFZA 3H5RA 3LL7A 3KP6A 5IT9E 3MCPA 2XD0A 5D6WA 1DGWY 1LDDA 2NRXA 2R3SA 1ZQ3P 3MPUB 3HTUA 3C7NB 4H0EA 1T3LA 5EEHA 1BB9A 4OMQA 2OZMA 2A07F 4PNOA 5AQMA 4EGYA 1KD1O 4ICLA 3EFOA 1KLMA 2PFUA 4BC4A 3NBPA 3E7LA 1QCFA 1C0UA 3MZHA 3WTVC 4V2GA 2GCXA 3JW4A 2KIFA 2JLEA 2JPSA 4WQ5C 1X58A 1VQ4N 5MLCQ 5JHUA 3AHUA 4FETA 2FC0A 2MC3A 3I8BA 3JRDA 5K1YA 2IT0A 3RMBA 2KQWA 2M30A 3OR1C 2OC6A 1C1CA 2IS3A 1J9AA 1ETXA 3GP8A 2OPQA 1FY7A 4DZJA 4FT2A 1VQ8N 1S1NA 4YFNF 3DXMA 2VOOA 2NUTA 1IV6A 4L9TA 4MIMA 4X9CA 3CCQA 3VJPA 2K85A 1Q9YA 3OYMA 1T8EA 1OR7C 1MJ9A 3DLHA 4PJOC 3ULDA 5M3FJ 3CI5A 1VQ9A 5LJ5j 3QWLA 4XORA 3WG9A 4AM7A 3I55I 1Y64A 4B3RK 3K69A 4ZYAA 5M1FA 1BI2A 4PZJA 4GDFA 2NAZA 5EGOB 3G0ZA 1DPRA 3TO9A 2W6LA 2HBMA 3LSJA 1B8IA 5DPKA 1Y57A 1OPLA 2W84A 3H36A 2DBKA 4F17A 1BR4A 1XX5A 2CO5A 2O9LA 4OMNA 2CT4A 5HRSA 4LJZF 3PMIA 3SV4A 2OTJT 1I5OB 2DIQA 4N0AC 1BOAA 2QXLA 2E3HA 4A5AA 1M90C 3J80O 1VRUA 3SUNA 1VSMA 2Y9ZA 4MMLA 4JKEA 3X25B 3AL0C 1TNTA 5KYYB 3FXUA 4A59A 3JCMb 1FTTA 4PLLA 2IS4A 4UB6C 1WAFA 5KH6A 3K9KA 2OTJA 2R7UA 2JVGA 1EV7A 4MO5A 2E6ZA 1SAUA 5CR2A 4JNEA 1MSEC 4DYQA 4BWJA 1ATRA 3Q3SA 4A62A 3H1CA 3IG1A 1R49A 3AT1B 2IVPA 3ZX2A 1SD5A 3AO5A 3UWNA 3QBYA 1RRQA 2YRCA 2GM4A 3OIPA 3ZSRA 2DAOA 3ULEA 3PX4A 4HPQA 4XICA 3WXMB 4CEDA 1EO1A 4G6QA 2Q2EB 2BZTA 2LD5A 3I3LA 4FSSA 1Q81R 4FYXB 2KDSA 4LG3A 5JVTA 5CHIA 3LP2A 4M45A 2HR3A 3KK7A 3EHQA 1AOJA 5EY4A 2FSJA 4BUPA 4JZ4A 2V26A 3FMSA 3F8NA 3O6BB 4M78D 4J9DA 2H94A 4F7UE 1UHMA 1QQIA 2IOCA 1WFWA 3SEZA 3WXJA 3ASKA 3CMMA 5J2NA 2VCPA 4RB1A 3S1NJ 1X3UA 2GWKA 4M75B 1U1TA 1WEGA 4JKCA 4WF2A 2IJLA 4D8DA 4CJUA 1NMDA 3IH7A 2BXYA 5FGMA 2EFNA 2DVJA 3AFHA 4JZ3A 3C94A 1EIFA 2COYA 2DL3A 2LDUA 4RW9A 2LJ3A 3WXLA 4BRIA 3FISA 3QSUA 3M1EA 2HSTA 3CC2T 1DTQA 3LMMA 3VS4A 4UQGA 1VQLN 3M4YA 2JTFA 1HDDC 1A5VA 3KP4A 1D5AA 4IHWA 1UGPB 4EATA 1ZLJA 2PZSA 2HNHA 2VE8A 4H0TB 3K7AJ 4ESFA 1VSKA 3ZQFA 3Q5FA 1BQNA 3KYCB 1GCQC 2L0KA 3JSMA 2XHIA 3MMVA 1X69A 2G8VA 3FIFA 3RZDJ 2OF7A 4KV8A 1QZZA 2YUQA 2EBIA 4GLKA 1VQKT 3BQZA 1RDUA 4BE2A 3W3CA 4BJ5C 1TL8A 5FB2A 3EGUA 3GZNB 3IUOA 2JHJA 4IUPA 5F0HA 2CP7A 4JUVA 1T03A 2Q0OA 2M9UA 2ZXHA 3TAPA 3BTJA 4CZEA 1RUNA 2E1NA 2EJGA 2F5FA 3OYCA 1M30A 3VSLA 2OPRA 3H35A 4IJAA 2CFXA 4KBMB 4GY5A 2I7NA 3H6EA 2JRMA 2X4YA 2H3JA 3M8EA 3CUQC 4M7DF 2KGTA 1RAFB 3RKWA 1BR2A 4B3OA 3H9JA 2FUG2 1BM9A 2H3EB 4FWQA 2GUIA 3HO1A 2P9NB 1GBQA 3N4MA 3V1QA 4FO0A 1RADB 3RESA 2P5OA 2O88A 2E6MA 3CCUT 4A4HA 2EW3A 2ZFWA 3I0WA 4L9VA 2EKOA 4J9FA 3DEUA 3P39A 1K73O 1GLAG 4DZPA 4JX4A 4IEJA 3EGDA 1NYFA 5JLHA 2P81A 4U88A 4CEEA 2O03A 2CZ7B 2Q0UA 2WB1N 1R8OB 3IDHA 3VQ7A 2V6EA 3HI0A 3H9GA 4JKDA 5GAEP 2XMFA 1Q7YU 4FZZA 1NK6A 2AZSA 2KRFA 4M3YA 4LDYA 3QRFF 4HCBA 3AVGA 1NG6A 4MGRA 4OPJA 1LQ1A 2HYJA 2F4VK 2L02A 1I5ZA 1YIJT 2BBYA 4IUTA 4JLGA 1O3TA 1LPQA 1FW6A 2HHWA 1KD1R 1TVRA 1MZBA 4C2TA 5ELZA 4ZGJB 2ESWA 1RFQA 3FRNA 1WOQA 2CJJA 2VIXA 4LDXA 2IW5A 2BVMA 2HTSA 4KDPA 1YHQN 1HQEA 1X27A 4RA2A 3G2BA 3G71Q 3MN2A 2OFIA 2LCLA 3A5OC 2EBPA 1VQKN 3U1DA 3ZT4A 2H3GX 5AFUH 3AAQA 4Q5WA 4HF0A 2IVNA 3HK2A 1BN5A 3ME9A 2ASMA 2O4XB 1YI2A 3JCMX 3ENBA 2V79A 3AO2A 4BR7A 2M1BA 4DUZK 3RMSA 1RKTA 1DP7P 4YIFA 2VJ4A 1NJIR 1X3WB 1YP5A 2M51A 4IPAA 1M90R 2CFOA 3DTEA 3CPWA 5CIUA 1O7FA 2XIDA 3HPGA 1FK9A 3RR8A 2VBWA 2KIMA 5DUIA 3CVTA 3KYLA 2COZA 1NK7A 1TW2A 1LVAA 4BR5A 4BC2A 4C8QG 3AA2A 3CTAA 3FF5A 2KZGA 1Z7LA 2SRCA 5CKFA 1E0EA 2MGQA 3JB9D 4PL7A 3QYHB 2ZQBA 2LF7A 3M8RA 3WTTC 1XSVA 4AMCA 2KIUA 1RDWX 1X75C 1TWHJ 2QQBA 1RTIA 3RMDA 1JTYA 1VQLA 2NOJB 3SZGA 3WNGA 1KGSA 3JCMV 3OS1A 4A3LJ 3DU5A 3T7ZA 1OCOH 4J8FA 4AD9A 4CERA 1R0AA 4C0FA 5GAOm 3MEXA 1BA0A 3OOPA 2R57A 4JJCA 2OTLA 5EG0B 2Y30A 1Y39A 2D6FA 4M3BA 5GAHJ 4RG8A 3FZFA 1TUUA 3W2AA 5I2MA 3JTGA 2EJRA 4IF4A 1RI9A 4IUUA 1YO5C 4H4KC 1B9MA 3TEEA 1Z77A 4BH9A 2M5WA 2OJ2A 4M7DC 2FQ3A 2ECBA 1SC7A 4Y0WA 1D3BB 3A8GB 4NO7A 1UWBA 4IXAA 2DXIA 2A1SA 4CBUA 1K1ZA 2GUPA 4ITVA 5E3MA 1FN7A 4CF9A 2XVCA 2MPXC 2OTLQ 4BRMA 1TQPA 3T8TA 1RDBA 3TCJA 1TW3A 2IVWA 5A0GA 3I0XA 3AGRA 1VQNT 2ZPGB 3TU4K 1RNLA 4LDUA 5GAOr 4C8LA 1DQUA 1YJNA 4V2SA 4UY8O 3PNWC 1XQOA 3DRSA 1PRLC 4OVAA 3ZOBA 4ATOA 3CESA 2JTVA 1H8KA 2BGCA 2ZJRL 3OMGA 5C15A 3CPFA 3OVNA 4OGCA 1K73U 1ZELA 3VPRA 1QTMA 4Y3OA 2UYTA 1IV8A 4BU2A 2EZHA 1XCVA 1BK2A 3KUFA 4DSKA 4ORZA 3CHWA 1VQOT 2A6TA 2XY6A 3OYNA 2HVSA 1I1JA 4DSIA 4A3MJ 4JOMA 5AR0A 2ZCFB 4OMPA 3RVCA 5BPLA 3M0SA 5DS9A 4FM0A 1ZH5A 2PUKB 4XQFA 1P90A 2BY2A 3ZSWA 4A6EA 4NNJA 1P7JA 3B8AX 1WAJA 3SK3A 2DTUA 2VQCA 3CCVT 1PDNC 3GLLA 5T7BA 3X28B 3ZSOA 4PKIA 5HS8A 4N9IA 1KSPA 5DV5A 2G8HA 4WQ4A 1LKXA 2VKHA 3OA9A 3FDRA 4XLNF 4C8QD 3HXMA 2KISA 4CHYA 2F5TX 1LWFA 2F2EA 2XB5A 2LY9A 4A4FA 5AQLA 4MO4A 1MDMB 1BIAA 2M7BA 2A6EF 2XV4S 5J1UA 4PY5A 1RT1A 5GAMg 4H5WA 1WFXA 2ISZA 3K2ZA 2RD1A 4U0VA 1VQOQ 2MWOA 1VQ6A 3S14J 1TK8A 2ID3A 5KYXA 4UB8C 1KU2A 4JP0A 2YLBA 2O4IA 1VQNA 4PK4A 4R79A 2IRFG 2WAQA 2CGPA 3WHBA 2VT3A 3H3VK 2DMUA 1D8JA 4FU6A 3CMET 4AILC 4J6WA 3R3LA 1VQMI 5EZGA 3FHFA 1ZBIA 4LF7K 3WTZA 2D1XA 4B4CA 3QMLA 2IS1A 3ISPA 2P9KA 3WTYC 4KH4A 3GTLJ 2J6FA 5GINA 2I2LA 4BQZA 1FPQA 2L3SA 4A3EJ 5I2SA 3V42A 1N3AA 4GKJK 4N4OB 1A04A 1Y8QB 1S72T 2NOIA 1DJ7B 3MXIA 4XRSG 2X6XA 2D45A 5BQTA 3FJ5A 4XMYA 2FPEA 4IHVA 4KULA 1NK3P 3LFKA 1E3OC 3TWHA 3FXQA 3H3OB 3G1MA 1SAZA 3WGGA 4A4EA 4DR4K 1P4AA 2HAXA 1Q82R 4XRFA 5IYBJ 5LJ3j 4CICA 3DBLB 4FL6A 2KXCA 1HNXK 3F8MA 2KZVA 3H9QA 3OL3A 2RHIA 4PJMA 2P6TA 2NRWA 1TWGJ 1IC8A 1VQPN 2E6NA 1KSWA 4CK3A 5FLXZ 4EMGA 3KLNA 1K8AR 1WA7A 1ZGAA 5D6XA 1KHCA 2QBYA 2PI0A 3VEOA 2K3BA 4FE4A 4MZPA 3I55A 2DMPA 4M75G 1VIFA 5C24A 1T0FA 3QU3A 3TREA 4HTUA 3JB9I 2EFIA 3H08A 1X3MA 2JA7J 2YG9A 3CWTA 2DOEA 2OTJQ 3NEUA 4BKXA 3N0UA 3AO4A 1WBDA 3K5OA 1OULA 4KN7X 2Z5UA 2ECZA 3H0FA 3F6VA 4DWIA 5E20A 2JZ2A 1YI2T 1OKRA 1KA8A 2K5FA 3VUBA 4C92B 1FC3A 2WY8Q 2P9LA 4FZXC 4FWSA 7AT1B 3SXYA 1RZ4A 3BLYA 1OPCA 3VS6A 3O9RA 4CEQA 3G71I 2MK5A 4ZYEA 3EKUA 5F0XA 4BC3A 1BI4B 2HWVA 2V8IA 1YAGA 3M0UA 2JNGA 2DETA 5GAN3 2BHZA 2ELKA 2KDZA 3ALYA 4M7AA 3KNTA 4BDZA 4NC8A 2A5YB 2QQ8A 4A4GA 2D0AA 4BQOA 1VSEA 4F14A 1C6VX 3K1PA 1PKTA 5FU6C 2G8IA 2WA0A 1GLDG 2ZJRF 3I9V2 4RW6A 4DTXA 1R4MB 3AG2H 1JKOC 1X1CA 2QF7A 3KYDB 1BL3A 2LC4A 1B1BA 4LIVA 1MD0A 2YKNA 4HCKA 1KCFA 3LM9A 4HNTA 3BZKA 4A3KJ 4RW7A 2O9SA 2L8DA 4FJIA 2GTOA 5D3GA 1RT7A 3EG2A 1V5EA 2C6YA 3IKMA 4H5VA 3A8HB 2FLOA 5HDNA 1JBMA 4P9FA 1YQKA 4IOCL 2VV5A 3PO2J 3EEQA 5GAN2 3CMAN 1P6RA 4CCMA 3RNJA 4ZN3A 4AHVA 2W00A 3L3UA 3BR0A 1OQKA 3I55N 3KFVA 1AEYA 1T6DA 2PBDA 1S7AA 1IG8A 4RTTA 1OCCH 4RAGA 3J81Z 2QA4I 1M4ZA 3ENOA 1JT0A 4K11A 3BCBA 2W24A 5KGXA 1K0XA 3QEVA 3KTUA 2DA3A 2HQRA 3JV3A 1HMVA 1I94K 3V8JA 4B9WA 2V7FA 3NWTA 2K3PA 4CVNE 4OMYA 1IRXA 2DA5A 4CYCA 1AWOA 4HW0A 5L3CA 4ZDLA 1M2VB 2HBWA 4IEEA 1R0BG 4LN2A 3ZMSA 2QDYB 2BZXA 1U04A 1TZLA 1Y1WJ 2VI6A 3ZQQA 1HKBA 2JGUA 3NAUA 3ABMH 3VW4A 4RCHA 1WJCA 1KD1U 5D8LB 1KFDA 2FA5A 2QVOA 3CCLT 1WQWA 3OSVA 4O4GA 2R0QC 3E9FA 5AT1B 4B3MK 3I5RA 3HOXJ 2VYTA 2FU4A 3A1YA 1MNEA 5H1SQ 3TI0A 3VV0A 2UUAK 1EF4A 2VQEK 4PFZA 1WUAA 2HHXA 4FOEA 3AVLA 3FM3A 4C0DB 2VN2A 4C2MJ 3OH9A 2F5EA 4FCYA 1KJWA 4RLQA 3OW2S 3RKQA 2E8AA 4XIDA 4XU1A 1RBRA 2JJ7A 1L3SA 5DCFA 4MDXA 4M75E 3ECOA 2G8UA 4HT9A 4HHTA 2KP6A 3ZX0A 1NKBA 4ZYDA 3JRBA 1XUPO 4YFXF 4E1MA 4K0KK 1KQ2A 1ZARA 5KRTA 2O5RA 1LAVA 3E5XA 3ITHA 2O8DA 5E41A 1SVMA 2MH9A 1VQMQ 1BJAA 4XM3A 3J7AO 4LK1F 3WT0A 1KG3A 1XHZA 3JRZA 3HPOA 3OYFA 1NJZA 2RJEA 2RNAA 3NVMA 2VQLA 4VUBA 1RRJA 3K70D 4M77B 1XQHA 1BCOA 1RILA 3VQEA 1N5YA 4BDPA 1HKQA 4ON0A 2AQFA 3E97A 2JM8A 2QWMA 1PD1A 2L4MA 5KI6A 2FRHA 1Y97A 4M7DA 1AHDP 3CIPA 1FJLA 2DW4A 1BKBA 2KE9A 4OPKA 2EFQA 3TGNA 3CC4T 3WU1B 3THXA 3CO7C 3HFOA 3TAGA 4TV7A 3T1YK 4KI6A 4BREA 3QAHA 2NNWA 2P4WA 2P9IB 5H20A 1RLQC 3H1VX 2DAQA 4H0YB 5HRPA 3NHGA 2A1RA 1B59A 1NPRA 3VS5A 2K86A 2DA4A 1RC9A 4CJKA 4AUXA 1S72A 1UHCA 1J09A 4IG3A 5EX5A 4CZMA 2QK9A 5GANd 3DLEA 2MH2A 3I71A 3TAFA 3LPTA 1TQIA 4OJRA 5AONA 3NF8A 1QBJA 5M5XJ 2HNIA 3PVQA 1BHLA 2VKNA 3MCAB <