3OYHA

Crystal structure of the prototype foamy virus (pfv) intasome in complex with magnesium and the insti mk0536
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
368
structure length
368
Chain Sequence
LDAELDQLLQGHYIKGYPKQYTYFLEDGKVKVSRPEGVKIIPPQSDRQKIVLQAHNLAHTGREATLLKIANLYWWPNMRKDVVKQLGRCQQCLITNASNKASGPILRPDRPQKPFDKFFIDYIGPLPPSQGYLYVLVVVDGMTGFTWLYPTKAPSTSATVKSLNVLTSIAIPKVIHSDQGAAFTSSTFAEWAKERGIHLEFSTPYHPQSSGKVERKNSDIKRLLTKLLVGRPTKWYDLLPVVQLALNNTYSPVLKYTPHQLLFGIDSNTPFANQDTLDLTREEELSLLQEIRTSLYHPSTPPASSRSWSPVVGQLVQERVARPASLRPRWHKPSTVLKVLNPRTVVILDHLGNNRTVSIDNLKPTSHQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular mechanisms of retroviral integrase inhibition and the evolution of viral resistance.
pubmed doi rcsb
source organism Human spumaretrovirus
molecule tags Recombination,viral protein/dna
molecule keywords PFV integrase
total genus 106
structure length 368
sequence length 368
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2010-09-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
A PF17921 Integrase_H2C2 Integrase zinc binding domain
A PF18103 SH3_11 Retroviral integrase C-terminal SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2300 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3oyhA04
1.10.340.70 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Endonuclease III; domain 1 3oyhA01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3oyhA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3oyhA03
1JLEA 1QE1A 3ZSYA 3ZT3A 4L59A 3VQ6A 1RT1A 3WNGA 4EZ9A 4ELUA 3LYIA 1S5JA 4O0IA 4N4IA 1RTDA 4FJMA 3MECA 4KB1A 1RBUA 4LSNA 1NKCA 5EU7A 1UOCA 3NHGA 3NE6A 1FKOA 3D45A 1BCMA 3TABA 3S6WA 2EX3A 2XRIA 1W9HA 4WE1A 2M0OA 5J2QA 1JLBA 3MEUA 3OMGA 3PMIA 4BE0A 4N4GA 2F96A 4O55A 2EQKA 3VN5A 2FBYA 3TANA 2DIQA 3M8RA 2RHYA 3F70A 4OPJA 2HMIA 1RNHA 1VSFA 5D6WA 2FBTA 2X6NA 3NF9A 3V1QA 3M8SA 1Q9XA 3L3VA 3RR8A 1LW0A 4CJRA 3HVRA 2HHWA 1C1BA 1KLMA 1KTQA 4AH9A 3HM9A 3OYGA 3RRGA 3QLHA 1BL3A 2JLEA 3DLGA 4CIGA 4B9XA 4ZHRA 4N5SA 1HQEA 1BI4A 3OYAA 3FLGA 1J54A 1S9EA 2HB5A 3CYMA 4CFBA 1TGOA 3LWMA 1WJQA 2HQXA 3H8ZA 2IDOA 1KRPA 3TAMA 4IFYA 3NF8A 3AVLA 5KE2A 2XHBA 4X34A 1RDCA 2YRVA 4RG8A 4CJSA 3K59A 3NGIA 1X1PA 3KK1A 4KHSA 1WGSA 2AJQA 1XHZA 4ICLA 1T05A 3SI6A 5HLFA 4CJQA 3DM2A 3HT3A 2R58A 1ZYQA 1HYVA 3VQAA 3V9ZA 3SJJA 2HHQA 1U04A 1ITGA 2F8TA 4GMJB 1NOYA 2GUIA 4FCYA 4YNQA 4O0JA 4AILC 3TAQA 4Z0UA 2K3XA 3QJ6A 3WNEA 5HRPA 4GW6A 4J2BA 2ATQA 3SUPA 3S9HA 1X9WA 4BDYA 3TAGA 3ZT1A 1NJWA 1WLJA 4B9VA 1BQNA 1XHXA 3NAEA 3T3FA 4E0DA 2RJEA 4CGHA 2ZD1A 1U48A 4CF8A 3PV8A 4Z02A 1VSIA 3NCIA 3QERA 3SPYA 3O3FA 1S1UA 1TKXA 4KO0A 3KKRA 2EQJA 5CZ2A 3HVTA 4CK3A 4CIFA 3V9WA 2FBVA 2QKKA 3B6PA 2RI5A 1IG9A 1VSKA 2G8WA 2O4XA 1GOBA 1JLQA 1KCFA 5KI6A 3CQ8A 1ASWA 5I3UA 1XI1A 2BIVA 1RTIA 4ZTFA 4NS5A 3AA4A 4E7JA 4J2DA 1VRTA 1YT3A 3AV9A 3AO1A 4DFKA 3SCXA 1LV5A 1QSYA 2WONA 4A4GA 3ITHA 2EQUA 1BCOA 1TVRA 1EX4A 3VQDA 4XIUA 3EY1A 1S6QA 4AHCA 5D6XA 4Y1DA 1WSHA 4FLXA 2OYQA 2DFHA 2X74A 3META 3LLRA 2D5RA 3AVAA 4DFMA 3MXMA 1REVA 1LW2A 2LSNA 1SKSA 4CEAA 3KIOA 1QSLA 3H08A 4QOZB 1WN7A 4H4MA 3PX4A 4M3ZA 3DYAA 3CM5A 3QEIA 4I7FA 4CK2A 4IUVA 5KRTA 3KD1E 4I9LA 4CESA 3RMDA 4KI4A 4C8NA 2DIGA 4BDZA 2G8UA 1YTUA 3C6TA 2YHAA 4KTZA 4LH4A 3NNQA 3AVFA 3AO2A 5C24A 1TL1A 1D8YA 4CGDA 1HYSA 1UAXA 4HUGA 3SQ1A 1N27A 1RT5A 2Z1GA 3DLHA 3PO4A 4CERA 2DFEA 4JRQA 3SQ0A 3C6UA 3TARA 1BHLA 4KV8A 5KGWA 4DU1A 2YNFA 1JXBA 4B9NA 3VQQA 3KD5E 4DS5A 3MEGA 3MEWA 1NK9A 1LWEA 4N4HA 2GFUA 1JL1A 4DSEA 2R57A 1LAVA 4DSIA 2JZ2A 1LWFA 3OYIA 2EFIA 5FRNA 3FC3A 1KFDA 3MXJA 1OZ3A 4CEBA 3AVHA 4JS4A 1R0AA 3DOLA 2LCCA 1C0MA 4KTWA 3NH1A 4FLZA 4I2QA 4CF1A 4FLVA 3EAEA 4ID1A 3ZSVA 5SWMA 3H6ZA 2IS3A 1W0HA 3KLEA 1L3VA 4KHQA 2Y1JA 4KPYA 3DRPA 3O4NA 3E01A 2KW4A 2QQRA 3DLKA 3T1AA 3IS9A 2EKOA 3EYZA 2NLUA 1SUQA 2IC3A 4R5PA 4FM0A 1YTAA 4KREA 4KHYA 1EKEA 1T03A 4IURA 4KFBA 2XY6A 3UIQA 2RF2A 3P8DA 3QNOA 4CGGA 3LGLA 4JRPA 3VQ5A 4C8KA 3KLIA 1SKRA 1SL1A 2MWPA 1ASVA 4FXDA 1J9AA 2QXFA 1O1WA 1TAQA 4W5RA 2W42A 3EZ5A 4KB0A 1OZ2A 3OMCA 4PLLA 1H3ZA 3TI0A 4W5QA 3ZSWA 3PUFA 4DQPA 4FM2A 2PQWA 1Y97A 4PL6A 3WNHA 4KRFA 1NKBA 4C5HA 4KAZA 4M3UA 3HXMA 3ALYA 3ASMA 3QIIA 3KJVA 4OGEA 3AVBA 4CJ3A 5M9OA 2PY5A 3PX0A 3KTQA 4Z4IA 1IO2A 3AO4A 4DFPA 2RHUA 3UT1A 4F3OA 4RW4A 4K8XA 5CYMA 3PO5A 4C5IA 4UQGA 4DLGA 4FK0A 4NCAA 2YKMA 3CG7A 1MU2A 3P1GA 4B9MA 4FK4A 4DSKA 4CHPA 2PYJA 4DQSA 4F2RA 4E19A 5T7BA 4A4FA 4DTRA 2P1JA 3K2PA 5CY4A 4L8RB 1NOZA 3PX6A 1J5OA 3ZCMA 4E89A 3L3UA 4PLIA 1HNIA 1IH7A 4O44A 4IDKA 2HNZA 4FJ5A 3QINA 2KZZA 3L8BA 4G1QA 1KVAA 4Q5WA 4CEZA 3SNNA 3SQ2A 5KTQA 1TAUA 3SYZA 2F5KA 4QQ6A 3CM6A 2ETJA 2VYTA 1QTMA 1L3UA 2BE2A 2HHTA 2D0CA 4NYNA 3VQEA 4QQDA 1NK4A 2KQ2A 4CGFA 1NJZA 4A4HA 3VQ8A 4CE9A 1S9GA 3M8QA 1BGXT 2R5MA 1GOCA 3LP2A 4QAGA 3JYTA 3K5MA 3K5OA 4OVAA 3V1RA 4HHTA 1VRUA 4IG3A 4MFBA 5K14A 5CIUA 2PZSA 1TK8A 1D9FA 2RI2A 1RDAA 5J2NA 3QEWA 3IAYA 3AVKA 4FJXA 5C6SA 1KSPA 5C0MA 2GF7A 3DLRA 3ZSRA 3ZT0A 3VQ4A 2B6AA 4B8CA 3OYNA 3P8HA 4FLTA 2BGGA 3MEVA 4E1NA 1C6VA 4F4KA 4BWMA 3M9QA 3OY9A 3VQCA 1JLCA 1NK7A 1G15A 2B5JA 4H4OA 1L3SA 3FEOA 1QHTA 4CEFA 3MAQA 1ZBHA 1WSEA 4BD3A 1TKTA 5HP1A 2D9TA 4FL6A 4FJIA 3CFPA 4FJ8A 3MP6A 3AO5A 4IKFA 4FZZA 3OS1A 4Z4GA 1EETA 1NKEA 1CZBA 4FW2A 3U3YA 3LH0A 3DOKA 4DTUA 3PNWC 2EHGA 2R7YA 4DF8A 4C8LA 4AHVA 4FJJA 4I9QA 3LP3A 3C95A 5C25A 4DSFA 4M3YA 3L2VA 1S6PA 2DFFA 2YV0X 2IAJA 4OVLA 1NJXA 4Q5VA 1IKXA 4NYFA 4B9SA 3LPTA 2RJDA 4QVZA 4FM1A 1RT6A 1RTHA 1JL2A 4FJKA 2B4JA 2YHBA 3I0RA 2DAQA 2NUBA 4CFDA 3NBPA 3V81A 2HNDA 4CHNA 5FDLA 4CEOA 4E3SA 5HROA 2HHXA 3LWLA 4N41A 1WSIA 2P51A 2HVHA 1A5WA 3IRXA 3QETA 2YNGA 4FZXC 5HRSA 3VA0A 3OYJA 3HYFA 2G8VA 3MEEA 4ID5A 4DSLA 3FDRA 4CF9A 4E1MA 3CFRA 3SV3A 4E7KA 4UC4A 4CFAA 5KH6A 1F21A 3AA2A 2R5AA 3U3GA 2VG5A 4CK1A 3JSMA 3K57A 3HP6A 4B9TA 3MP1A 1VSDA 5I42A 1OYXA 3CEYA 3MO8A 4Z4HA 4FLWA 2RJFA 5DK5A 2HQEA 1JXEA 4AHRA 4FJHA 5J2PA 1MHNA 4CEDA 4HVJA 2LDMA 4A4EA 2O4XB 2M1HA 1WSGA 3L42A 4CEQA 2RI3A 1LAWA 4DTXA 4KHWA 4E7IA 4CJKA 1N5YA 5SZTA 2YNIA 1S1WA 1RI0A 2E6LA 1ZBUA 2OPQA 5KCOA 3I8DA 3LZJA 1BIUA 3V6DA 4IUQA 3AA3A 3AVNA 2QK9A 3DB4A 3AVMA 3IG1A 4DSJA 3OJSA 2HVIA 1RILA 3U6FA 3LAKA 4PWDA 3S3MA 2L3RA 3UWNA 2JTFA 4HCCA 4ELTA 4FJNA 1Q9YA 4LD0A 2Z1JA 4F8RA 4LY7A 4RW9A 2BDPA 4CEEA 3OYLA 4RG2A 1DTQA 1GOAA 4OKKA 4YFUA 2OZMA 3PMTA 2EQMA 4B3OA 5J39A 1KVCA 4CGJA 4KI6A 4PQUA 2KFZA 1HQUA 4FLYA 3M8PA 3ASKA 3VQ7A 4B9WA 4EZ6A 2RHIA 3GOXA 4DTJA 4DF4A 2P0KA 3TAFA 4DQIA 3HK2A 3QIOA 2M16A 5HRRA 3WNFA 1VK0A 4TSXA 1C1CA 1N6QA 4CJLA 3MEAA 1HRHA 1QS4A 3T19A 3TR8A 4DLEA 1L5UA 4FU6A 4CJUA 5HBMA 2WOMA 3NDKA 4CECA 4HUEA 4FZYA 2RHZA 3ULDA 3OA6A 4Y1CA 1A5XA 2CKKA 4LH5A 3TAPA 2OZSA 1SKWA 4HCBA 1WSFA 1XWLA 2KTQA 2DTUA 2Z1IA 3F73A 1WSJA 2D0AA 3SPZA 3OYBA 1B9DA 1BQMA 1HYZA 1RT7A 1VSEA 2RPIA 3KKSA 4MQ3A 1WJSA 4RW8A 4CF2A 4DQQA 4IFVA 4OPKA 4DU3A 3QKJA 3QEXA 1SL0A 4B9LA 3G10A 1Q8IA 3OS0A 1ZBIA 1BIZA 4CIEA 4EP4A 1BISA 1RCHA 3RR7A 4M3RA 4RW6A 1DTTA 2ZE2A 4IUUA 2GBZA 3KK3A 4KTQA 4EP5A 2BANA 3G0ZA 4CJPA 4BACA 2B8AA 3C4SA 3V1OA 4Z4FA 2KZMA 3ZEHA 3O3GA 4Z4EA 2I5JA 3I0SA 2PYLA 2HHSA 3OYCA 3DLMA 3L2RA 1B9FA 3RMAA 3LP1A 3FFIA 1FXXA 4FVMA 4OLBA 3QBYA 1UA0A 2X35A 1WAFA 4B08A 4CHZA 2ITGA 3SQ4A 3OVNA 3HSTB 4AHSA 3VA3A 1UA1A 1TKDA 1NK6A 4OJRA 5KGXA 3OYEA 1U47A 3C94A 3NGYA 3KLFA 1T7PA 2HHVA 5KRSA 2ZQBA 1C0TA 2IOCA 1WNSA 4CGIA 1JLAA 3VQPA 3DRSA 4CJ4A 1KFSA 4BDPA 5D3GA 4QCLA 2LRQA 1HMVA 2A1SA 3HP9A 3DB3A 1D9DA 3AA5X 3DLEA 3NTKA 4O5BA 4FK2A 4F3TA 4DG1A 4DQRA 4LD6A 1U45A 5J26A 1FKPA 2VG7A 2X6SA 1CZ9A 2E6NA 3BGRA 4NCGA 4OKJA 4CJTA 3K58A 4BE1A 3LPUA 4JS5A 2XY5A 3SUQA 3VQ9A 4FJLA 4KHUA 4B8AB 4DFJA 5CZ1A 5J2MA 4GY5A 3AVCA 2E4LA 4Q0BA 3F9KA 3NGZA 3V9UA 2F8SA 4CHOA 3SV4A 3LANA 1B92A 4CJFA 2RKIA 3ZSQA 2YNHA 3LDSA 4NCBA 3QIPA 2XY8A 1BI4B 1I39A 4LSLA 3QEPA 3PFSA 1XNIA 3V9SA 1U49A 4DTSA 4M3TA 4DTNA 3S3NA 3OYMA 3AVIA 3DI6A 1WJRA 3O8VA 3AVJA 4KKOA 4W5TA 3K5NA 3D0PA 3QEVA 3SUOA 4C5GA 3THVA 3HO1A 2O4IA 2D0BA 2O4GA 1RBVA 1T8EA 4AHUA 1LWCA 1RTJA 1TKZA 3MXIA 3OYHA 3L2UA 4DWIA 2L89A 4C5EA 3RRHA 3DMJA 2G3RA 1K6YA 3LALA 1X9SA 2DY4A 3QESA 4BWJA 1D5AA 2HHUA 1ZBLA 3OS2A 1NK0A 4N47A 4I2PA 1JLGA 4JLHA 3K5LA 1SSFA 4OGCA 4DTMA 2E5QA 1J53A 3RTVA 4DMNA 4B9UA 4ELVA 3SUNA 1S1XA 1VSMA 1C1AA 4FW1A 1UWBA 3NTIA 3RWUA 4II1A 3PY8A 2X4XA 4Z4CA 4E7HA 1NK8A 5IN1A 2OPSA 4QW2A 2P5OA 4F2SA 4FJ7A 5JS1A 3AO3A 3MP8A 2IGIA 3NF6A 3ZT4A 4CCHA 4O4GA 4N76A 4EDUA 3Q1JA 2HNYA 2GV9A 3TWHA 4DS4A 1RBTA 3HPGA 3P5JA 3OQ5A 3L2QA 3LP0A 3O4QA 5JS2A 1U4BA 4FJGA 3OYDA 2XDPA 4FLUA 2QQSA 4C8MA 4DU4A 1WAJA 4GVMA 4QQGA 5J1EA 2Y1IA 3ZSOA 4FYDA 5FRMA 1Z25A 4H8KA 1KLNA 3KLGA 1CXQA 3NTHA 1RDBA 5IAYA 3ZSXA 2X4WA 1Z26A 4ZTJA 2GFAA 1RT2A 1RT3A 3ZSZA 4CJ5A 3L2WA 1TV6A 5HRNA 3SZ2A 2VWKA 3TAEA 3OYKA 4BE2A 2LVMA 3MEDA 3NF7A 2VWJA 1TK0A 3OYFA 1JLFA 1RDDA 1TL3A 3DRRA 1L3TA 4M3WA 2QKBA 3HJFA 5CYQA 1DLOA 4RW7A 4DTPA 2BKDN 2P5GA 2IG0A 3CFOA 3NFAA 1S1VA 4HCZA 1HPZA 1C0UA 1RBSA 2VG6A 3KUFA 3NH0A 3V9XA 2JGUA 1FK9A 2OPPA 1NK5A 5KE3A 5DMRA 5D6YA 4W5OA 4HTUA 1VSLA 4J2EA 3DLBA 4PA1A 2RHXA 3E9FA 3HL8A 4DTOA 4NZGA 1G5VA 3S3OA 2L8DA 4CRIA 4OKEA 3HPOA 2A1RA 4KHNA 4M42A 1I3AA 4PUOA 1YVUA 1X9MA 3LX7A 3BDPA 1OI1A 3VQBA 3KK2A 4HUFA 2G8FA 4CJEA 1CXUA 1QSSA 5KCHA 2FBXA 4K8ZA 4J2AA 3KLHA 4PY5A 3ME9A 3ISNC 2RO0A 1ZBFA 4M45A 3HPHA 2MWOA 2LTOA 4E7LA 1IKWA 1ASUA 2E6MA 5E41A 1IKVA 4IG0A 1SV5A 4N56A 3V4IA 4AHTA 3P83D 3RMBA 3LZIA 1TK5A 2KFNA 2Q3SA 1KHCA 3OB9A 4OLAA 4CJVA 2Z1HA 2X78A 3BDLA 3LAMA 2XY7A 1HNVA 4M41A 2FHDA 1EXQA 3QO9A 4CF0A 4CJWA 5C42A 1RT4A 2BUDA 1XC9A 2G8KA 2G8IA 4IBNA 2FC0A 4CHQA 3ZT2A 4CHYA 2OA8A 2RN2A 3E9GA 3B6OA 1A5VA 4M3XA 4FJ9A 2XO7A 3OJUA 3A2FA 4CFCA 2XK0A 3O3HA 1CLQA 3NH2A 1IKYA 1S1TA 1EP4A 1SL2A 3LGFA 3SD4A 1KVBA 1VSJA 2OPRA 1QQCA 3QNNA 3RMCA 1NJYA 2G8HA 2WACA 5FROA 2K3YA 1RBRA 1VSHA 3AVGA 4C8OA 2HW3A 4W5NA 2RJCA 2YKNA 2X4YA 1HJRA 4IUPA 4IUTA 1JKHA
chains in the Genus database with same CATH superfamily
4M72A 1ZR2A 1TP4A 2PVOB 4UVCA 2RV8A 5FJ8J 4ZJZA 2QSHX 1KQ8A 4EW4A 4MO4A 2FB7A 3IKMA 4A53A 1SANA 4E9FA 2EIFA 1VQPT 5LJ3e 1QCFA 4YFKF 2JHJA 4N4GA 4DZJA 3TANA 5LJ5f 2GQVA 1SQKA 1APLC 4CZZA 2O6GE 5EX5A 1G59A 2OFIA 5BR8K 1XC5A 4ABZA 3NRVA 4A6DA 4WQ4A 3GTLJ 2FF6A 1ENHA 3HIFA 1U84A 3A5ZB 1YYVA 4OMPA 1QZEA 2CUFA 4HPQA 1VQMQ 1BIAA 1SAXA 2I8DA 3IWZA 4PJOG 2QA4Q 5A0DA 4M77E 2W40A 2XU8A 2UWMA 3R8EA 3T3FA 2RJEA 1SVMA 2IA0A 5BNGA 1O3QA 1S9HA 3SFIA 4CUGA 2VXZA 1QW1A 3AA4A 4J9DA 3AO1A 3F9MA 2WONA 2C0TA 1TVRA 1NBWA 3QMLA 3KZZA 4HG2A 3GIBA 2A07F 1W4SA 1ERDA 3LLRA 3F8FA 1GV2A 1SKSA 4CI0C 2Q2EB 1QVPA 1WJDA 3AAQA 4I7FA 4M6YA 3JB9I 5M1KA 3KD1E 2I5UA 3RMDA 2WV0A 5GAGP 3AVFA 3HSFA 5K7HA 4YFNF 2Z1GA 3SEQA 3CJCA 5AQXA 2CO5A 2XIGA 3MEGA 3RZDJ 2W82A 3AVHA 3J7AY 3ZSVA 4JJCA 2IS3A 4WX9A 2HS5A 3DRPA 2HVQA 2QBYA 2VPRA 3CCLI 3OH9A 5ILSA 3CD6T 2DA7A 2IIMA 1B34A 3QDKA 6AT1B 2L3SA 3G71Q 1SSHA 2W04A 3DU5A 4BC2A 1J9AA 4W5RA 4QWQA 3EQLF 5FPMA 5CKHA 3PSIA 1YHQN 4MFEA 5H2FC 2L7ZA 1QP3A 2D1HA 2J6OA 4G6TB 3JCMh 1QCOA 2F6CA 4F3OA 2RHUA 2NOFA 2CS3A 1GLEG 4C5IA 2JQ7A 2XKOA 1YJ9N 3KZYA 1NOZA 4AIHA 2ZB9A 1SFUA 1KYZA 3O2PE 4CCJA 3A0IX 5TKYA 3WT0A 3FBIB 2VYTA 3MPUB 2CH4W 4MGRA 3AL0B 4NYNA 4FT8A 2UXDK 5LJWA 1PCXA 4B3TK 4M74A 4A4HA 2CFXA 1BGXT 3LP2A 1IN8A 4MFBA 2V6EA 2KDOA 4FJXA 5EG0B 2PUKB 2FPDA 3OIPA 4X9DA 1KYWA 1NK7A 1ZUYA 5BQTA 1TZLA 4B3AA 4NB5A 2FRYA 4IKFA 3KP3A 1OYIA 4DF8A 4UB8C 4UNOA 1P4WA 4BXUA 4PZJA 2FSJA 4BXXJ 1OCZH 3QQAA 3WU0A 4HNVA 3TU5A 3V81A 2IGKA 2MK5A 1D5VA 4J6WA 2QUFA 3M0QA 1WJAA 4DGWB 2M5WA 3BJOA 3VEXA 3FXLA 2ABLA 3OGDA 2E5ZA 2JMAA 2ZMEB 2YNIA 2XHKA 3W6VA 2E6LA 3V6DA 3CPWM 1BIUA 3LZJA 4EA4A 3AA3A 4ISEA 3DB4A 4QVDA 3S3MA 1VQNI 1RAIB 4YFUA 1R6RA 2VQEK 1WBBA 1XC3A 4DQIA 1JGSA 4UV8A 4DR5K 2CUZA 4ON0A 2WOMA 3BTIA 1ZTRA 2RHZA 4AF1A 2OZSA 4WFNL 2K02A 1RAFB 4UY8I 4AQYK 3GTKJ 3G25A 1RI7A 4JNEA 3IH3A 4KITB 4DU3A 2E2PA 3RKYA 3I56Q 5BPMA 1K6OA 2NRAC 1P2FA 2EYYA 4LIVA 1PUFA 4M71A 3H0DA 3ZEHA 3O3GA 2LQNA 2VIXA 4EVIA 1VQPI 5IT9K 2L9NA 1TWFJ 4HQMA 2YHWA 3A02A 2GOXB 4ILJA 4FZXC 2PU9B 3CCJQ 4JD2B 1Z3XA 5KRSA 3E1YA 2IOCA 4CA0A 2FQ3A 4RTZA 3H3NO 4KBOA 1AEYA 4UHTA 1XX5A 4BHPA 4FK2A 2UUCK 4C3JJ 4LUEA 3RSEB 4G9YA 4GY5A 2GGRA 1B92A 3G1OA 4TV7A 1EWRA 1BB9A 2V6CA 2MPXC 1WJRA 1MWMA 1KD1U 3EFOA 3ULQB 2IGMA 4XH1A 1JT0A 1VQ6N 1D5AA 3BF3A 2V79A 2D8JA 3UR3C 1YN8A 1OVQA 2A6TA 4YOYA 4M7DE 1NK8A 5FLMJ 4KIGA 4JK1X 2GV9A 4O6JA 4MHGA 1NK3P 3LH5A 2K5FA 3OQ5A 3L2QA 1DP7P 2DA9A 4GCVA 4J9FA 5GAN3 1AVZC 5KPRA 2LTPA 4M3WA 3CCQT 4RTVA 2HBJA 3JB9G 1S1VA 2DO7A 1AWWA 3NH0A 5D6YA 2RNGA 2EBPA 4OKEA 1EQYA 3DXJF 1YITT 2RQUA 3DFGA 3SWNA 2ZZDA 4M7XA 4HKEA 3THXB 1SV5A 2EGEA 4BJTA 4CH7A 2X78A 3IHOA 2XY7A 3THWA 2V7ZA 5I2SA 2FBHA 1ZG5A 4A5AA 5GAEP 4EMKA 4M3XA 5C10A 1SAZA 3O3HA 3HC7A 1IG7A 2A69F 1Q81O 5F1XA 2O31A 3E9PA 1EO1A 3GXOA 2J7IA 3A5MC 2CGJA 2P5KA 4FASD 4KB1A 2XKPA 2XMFA 2KZVA 4U0VA 2WWYA 2HR3A 2B9SA 1R5HA 4WE1A 4MZTA 2E7XA 3MEUA 5BPNA 3FWEA 2EQKA 2DIQA 4NHJA 1MUZA 1FTZA 1Q95G 2X6NA 2E41A 1QQIA 1N33K 1E3OC 4YFXF 3FZFA 3CCMQ 3BR5A 1Y0UA 2JLEA 1QQNA 3V9XA 4RTWA 2M0YA 1YWPA 1VQ9A 2KKZA 3TAMA 4B3XA 2ZKZA 2P4RA 1KU3A 3KK1A 2AS5F 4ICLA 4CJQA 1K4SA 3JRIA 4GMJB 5AQIA 5AQTA 2NAZA 3SHWA 1Q1VA 4BDYA 1SKUB 1XHXA 4KO0A 3MZYA 2Z9OA 3HVTA 3GEZA 2EVRA 2QKKA 3RMQA 1ZELA 2E71A 4E1JA 1YT3A 3K0SA 1K78B 4DBQA 4XRMA 1QZYA 2X74A 3AVAA 3FXMA 2QWNA 1N9SA 3DYAA 2W24A 2D0PA 2X51A 2EZKA 5A2QE 1NJIC 1WQWA 1QVFA 4M9XA 3EUKL 3HOVJ 1W2BA 4LF8K 3I56N 3C6UA 5KGWA 3FRNA 1VQNT 2GA2A 4XAXB 5MLCQ 4DS5A 3J81K 2W4SA 4J9CA 3G73A 2JTMA 4IFEA 2K40A 3ZPLA 1JTXA 1G2BA 5J40A 2MYSA 1L3VA 3U9ZA 1K78A 1S1NA 3RDVA 3NHNA 3LL7A 3QNOA 4CI6A 2V8KA 3LGLA 4KUMA 2X1DA 5HLGA 3CPFA 1ASVA 4FXDA 4MNUA 1U1TA 3OMCA 3H0FA 2X3WD 4OOIA 2VT3A 1Z05A 1AZGB 3FZVA 3COAC 1TUYA 2NOGA 3FDYA 3ID6A 1XGNA 2XICA 3DKYA 2NOLA 4CHUA 2P1JA 3KFVA 1J5OA 3TOBA 4ESFA 2E65A 1RKTA 3WTYC 9ATCB 4Q5WA 3SQ2A 3GF2A 1STZA 3LA2A 5HCKA 2MC3A 1PVEA 2VE8A 4XN0A 1TSFA 2DVEA 2QWWA 2RK2A 3BTJA 2XRNA 1N8RR 2DD4A 5CIUA 2ASOA 3SAGA 3A8YA 1B34B 5C6SA 5DCMB 3MHXA 4ESJA 2JUFA 3ML6A 2MGQA 2BGGA 2VKNA 3P8HA 1C6VA 3KE2A 3OY9A 5GMKm 5IT9Z 2XPUA 1TKTA 4FL6A 3S17J 4P9UA 3CMAA 3G71I 2NVQJ 3HEFA 1S6PA 3J7ZO 4B1WB 2VXDA 4HA8A 4M78A 4KT5C 1G3YA 2DOEA 4NXMK 3I64A 5F64A 3I0RA 2RB6A 4X65K 4DHYA 1JQQA 1E4FT 1CZAN 3QB0A 2NRTA 4DSLA 1BK2A 3O9QA 2V9KA 5KH6A 1IGUA 3VS1A 1AZEA 1JXEA 5JHUA 3KVGA 2O4XB 5JFRA 2M7BA 4DTXA 2DERA 5GP9A 5LGTA 1IC8A 3QAHA 1Y6IA 2BY1A 5KCOA 3K2AA 2YXYA 4CSWA 3OJSA 3W6JB 3CC4Q 3DKXA 2R7VA 4F8RA 3OYLA 4EJVA 4DR2K 4B3OA 2KFZA 1YJWI 2P9UB 2XROA 3ASKA 1XCVA 3T19A 5F0CA 3KEOA 1WFWA 2HI3A 2DZ9A 2DLLA 2EB7A 4WCGA 3HFOA 3J7YP 3I55N 4Y1CA 4GLMA 4YRVA 1VQ5A 4RKUE 4PKGA 2RPIA 1SL0A 5AZJB 5M1FA 4EP5A 3VB2A 2ENMA 3MWTA 2VL8A 5C3EJ 4XSXF 3DLMA 1ZSGA 3SK3A 3FFIA 1FXXA 1TG0A 1AA7A 3TTDA 3EL2A 1HOMA 3C3WA 1HF0A 3CERA 3O6BB 1NK6A 1MIJA 1D0ZA 1T7PA 3KLFA 4C92F 4D9JA 1U3OA 2LRQA 1YJWT 3CC2T 4FWNA 3PNVA 1G99A 2HTSA 3EG3A 1Y8QB 1D3BB 5I11A 2VG7A 1PRLC 4CJTA 3I56A 3LPUA 3CLOA 4KHUA 3ZEUB 4WF9L 1GV5A 4H0YB 1T6SA 3JCMe 3ZQ7A 4UUSB 2R3SA 3F22A 2F2VA 3CC7Q 2X48A 2D0BA 2O4GA 5D5UB 1HUXA 5ADXH 4V19S 4V2SA 3BW1A 1UWBA 2O03A 3DXKB 5LJ5d 2VOPA 2W84A 3LSPA 1RAGB 1OCPA 1ARKA 2F5CA 2G0EA 2HMAA 4FJGA 2H3GX 4H0OA 4KN7X 2ASPA 1X27A 4CYCA 4EJOA 5J1UA 2L3PA 2XV4S 3CMEI 1VAZA 4ZTJA 4EQQA 1Z9CA 3FK7A 3OYKA 2LVMA 3U2RA 3KYLA 3OW2S 2LKSA 4RW7A 5IP6A 2V1QA 2RQRA 3TDZC 4C30A 4H0VB 5DMRA 3E5UA 2ZPGB 4JLIA 1ZRFA 4NLCA 3BJAA 2A1RA 4JK9A 3I0XA 1PU7A 1HC8A 4HUFA 3HOZJ 1QSSA 1ZLJA 2PQ8A 3DWLE 3FISA 3CMEA 2E6MA 1ASUA 2QGGA 3F72A 4BC5A 4X6AJ 3ZQHA 3CCUN 2PNIA 4CJVA 3ELKA 2Z1HA 2FMYA 2BUDA 2MLGA 1OPLA 1UHSA 2VQCA 5HLTA 5D8KB 4AYBA 4BJ6C 4C0GA 2KE9A 3NH2A 2NRRA 5FLXE 3CJ9A 1QQCA 2DJZA 1XB4A 3AVGA 1FBSA 4K2EA 5CKTA 1Q9XA 3ABMH 3ZT3A 4EZ9A 3MECA 4LSNA 3DTIA 1FTTA 2EW3A 1DEJA 1A31A 3IV5A 3U1KA 4E4HA 1BCMA 2F69A 4U88A 2EX3A 1TQIA 1W9HA 3VTHA 1NK9A 2MD0A 2Z0WA 4LDUA 1RNHA 4C2TA 4JZ4A 2WAQA 2O8CB 2DEUA 2FG0A 1HKSA 4F04B 4DR4K 1J7KA 4C8QC 1TGOA 3CCUA 1K9MR 2ME6A 4X34A 2YRVA 4HDUA 3DLAA 1O57A 4KDPA 1M9SA 3TL4X 4YG2F 4OFHA 1I6HJ 2YHXA 3ZP5A 1NJWA 1HKGA 1WGXA 1HD3A 2XIDA 2YCHA 3CXCM 4J9BA 4M3FA 2OQGA 4XNFA 1GDTA 1KCFA 5TISC 2DA2A 4ZTFA 2BY0A 3WODF 2FPEA 2FO0A 3HI0A 2GXAA 2KHOA 1Y8RB 2XAFA 3META 2KY9A 2D5RA 1ZRDA 3LCNA 3WXLA 4QOZB 3JRAA 4H4MA 3PX4A 5KRTA 4BR5A 2TDXA 4B22A 2CWEA 1IN5A 3WTSC 2PI0A 1Z9QA 3DLHA 3SQ0A 3C7NA 1QHGA 3TP3A 5KPZA 4B8XA 1IJWC 1QHHD 2DEQA 4QS8A 3SZPA 2DCEA 1OEBA 1LWFA 3PO2J 5FRNA 1SD5A 2QXLA 1OYWA 4FLVA 5EZHA 2CZ0B 3AG1H 4H0XB 4PJJA 4B9QA 5DS9A 4B09A 3GFLA 2QM1A 4EMKC 3BLYA 3HZJA 2UXXA 4KB0A 1OZ2A 4L6V5 1PKSA 4W5QA 2GBYA 2QWMA 3OH6A 3BQYA 3WNHA 1NKBA 2RC4A 1BOBA 1H0MA 2DFUA 2E2HJ 2PY5A 2LNVA 4RB3C 4DSKA 5A0GA 2BVLA 1WHJA 1WXUA 2VQFK 2GIZA 3L1PA 3PX6A 3L4IA 4B23A 2P6TA 3G4ST 4KH4A 3HXLA 2ETJA 1SMTA 3URGA 1T39A 1KZHA 1QVGS 1GXPA 5LGNA 4IJNA 3J7YJ 4BR0A 4LK0F 4M63C 3NQOA 4IG3A 2QW9A 2V26A 5J2NA 5D4RA 2K5CA 2DOFA 3H5AA 3OYNA 3MN9A 1MPGA 4RGUA 2YR2A 4WFBL 4CEFA 1V55H 1WSEA 2EK5A 3K1MA 4FW2A 4ZYEA 4E70A 1BIBA 2O0YA 5AYFA 2GTOA 4B9SA 2WFBA 3L2ZA 4YY3K 3M58A 5HROA 6PAXA 1M2VA 3GLXA 1A5WA 2M4GA 1BI3A 3CC2Q 2RQTA 2LMDA 4Q4ZF 4DV3K 3DTKA 4LFUA 1VSDA 1R5ID 2BV6A 4ZDOA 3L42A 3BZKA 2HBLA 1YIOA 3QUIA 3ZN1A 1ABQA 1SF9A 3WXJA 3VF4A 4B3RK 1ZBXA 3FKIJ 4L5EA 2BTTA 4PJOB 4KI6A 4PQUA 1LJOA 3CCRA 3M8PA 4J7FA 2E3HA 1LOTB 5E84A 1VQOT 2Z3YA 5B8HA 2ZSIB 3CCEA 4DLEA 5HBMA 1WWXA 2QQ8A 2M1BA 4LB6B 3ZX3A 2RNJA 4WQ4C 5GAOm 4CZJA 3QXEB 3SZGA 4QSHA 3HHHA 2DK8A 2FF3B 2ZE2A 1FYNA 4FQGA 2GBZA 2I7NA 3RMSA 2A36A 3CCLN 2LZ6B 5LMUK 4C8QB 3QBYA 1UA0A 1LOJA 4B08A 3BG3A 4MDWA 3THKA 1UA1A 4RAZA 1H8KA 2COWA 1TWHJ 2A3LA 1W2BM 3DRSA 3U8XA 5D3GA 5CLSA 3SMPA 1QVFM 5I22A 3HP9A 5EY4A 4F3TA 4I76A 2XUBA 4LD6A 3SB2A 3BGRA 3K58A 1QU3A 4B8AB 4PIIA 1KEAA 4RMNA 2OA4A 4XR6A 1VQ8A 1VI0A 5ICEA 2CYZB 1N8RU 4DTNA 3CCMN 3O8VA 1G3WA 4GYIA 1KONA 2LJ3A 2Q97A 2O3FA 3M8FA 4L0ZB 5AZJA 3K5LA 3MVPA 5EG0A 1YBYA 1AWXA 5CVRA 4BRFA 3CWSA 4Z4CA 3VS6A 4A61A 1YTYA 4CCHA 2XD0A 1I1JA 3E2UA 2H8WA 5E8GA 4XN3A 4WQ5C 5IXBA 4GVEA 1N39A 4FLUA 1NYFA 5BPDA 1WAJA 2VJIA 1YJWA 2FPFA 4OP0A 1FIAA 1QQJA 2QKBA 2L9SA 1HPZA 2PFBA 1VQLN 1U5SA 1XS9A 4A3DJ 3D7EO 3I4NJ 4FOEA 4G8XA 1GFCA 1YAGA 3P83D 3MX2A 1EXQA 5C42A 1RT4A 2V9VA 2VXEA 3ID8A 1ZAOA 1NHAA 2XO7A 4D8KA 1SL2A 1KVBA 3RMCA 2HDWA 4C8OA 2WACA 2CUDA 3S1QJ 4OIPF 1E2XA 4YPRA 3HSRA 4ENJA 1IBKK 1RTDA 4FJMA 4CW7B 3RQ4A 2EWSA 1YUWA 4EMSA 3GMEA 1T6CA 2XF6A 3CWUA 5D6EA 3M8RA 3HBTA 2FBTA 1KQSM 2OTJQ 1BA5A 4BR2A 4DYRA 5GAEJ 3DLGA 4B9XA 2HB5A 3FXKA 1LMZA 1I1SA 3LQQA 3H8ZA 4LK1F 1TWAJ 2E12A 1DKGD 3K7AJ 4LUDA 4ZYGA 2DA5A 2MMPA 1IAWA 3DPUA 4O8KA 4AILC 3VPZA 2K3XA 5HRPA 4JKEA 5IT3A 1WLJA 3CCJN 1IGQA 3SPYA 3A0HC 2QWRA 4A2UA 4LD9K 2FUG2 3ERED 1MV0B 3QODA 1GRIA 2CGKA 1ZLKA 2CGPA 5B3SH 5KCMA 4A4KA 4D8DA 2EQUA 2OQRA 5L8RE 2OUMA 4W1UA 3V8LA 3T9NA 4JKGA 2LSNA 5J1RA 4B44A 3BQZA 3VEWA 1SVLA 4RAYA 3B73A 4ZYDA 1POGA 4KI4A 2DIGA 4DNCA 4LH4A 2NUTA 3AO2A 5L3GA 1FMWA 3VJPA 4CGDA 5KYWA 2GLOA 1Q7YR 1U6GA 5AJ3K 2D0OA 4RTTA 1E3PA 2X6YA 5DPKA 4CZIA 1IN7A 3MX5A 4JPBW 2EFIA 5GANd 2FLOA 2ZWHA 4IJAA 1ZYRF 3H6ZA 4BY6B 3UKRA 4FM0A 3HJEA 3D5LA 4LN2A 1FPQA 4N4NB 4EIAA 3F8NA 1USSA 3TO6A 1RLQC 3DAWA 3M5AA 3A8MB 3X20B 2K79A 4M4ZA 2IXSA 3FKJA 4DJAA 3K4KA 1ATSA 3AVBA 5M9OA 4FWSA 4L5JA 4K8XA 4RW4A 2YI1A 3SJMA 3K10A 4NCAA 2D6FA 3EGDB 3PIOA 3WE2A 3N5NX 3ONQA 4FVUA 3G6EN 1W6XA 4PLIA 1N77A 5JLWA 2DILA 4U87A 3GP8A 2JN6A 3IRQA 1MA9B 5DM7L 2J4RA 3WXKA 4J7IA 1LUJB 1KC8U 4KH1B 3K5MA 4QAGA 1GOCA 2KJBA 5FO5A 4M77C 5FU6B 5GAMd 3LWFA 4JAXA 2M45A 3VV0A 2XKOC 1RDAA 1MUYA 5GAOq 1ZREA 4KGXB 2W85A 1ILYA 4FYVB 3VEOA 4IIOA 3OS1A 4ZGJB 3CCSN 2LY9A 2VB6A 1BG3A 2R7DA 5TKWA 2VGNA 2A40A 5HDNA 1YI2A 2CZ7B 1Z7UA 1C0WA 1WQ7A 1GCQC 5C12A 1FNNA 5M5WJ 4BUPA 3MEEA 2OV7A 4A3GJ 3CFRA 4DIQA 2CP3A 1KQ1A 3IQLA 3V8JA 5CKFA 3U3GA 3E9OA 2GUPA 5I42A 3M0TA 4X9CA 2RJFA 3P7NA 1Y56A 3D2EA 2OZUA 2FX0A 1M1FA 1HKCA 4WCIA 4KJZA 1S1WA 4M42A 4PJOD 1N8RC 4ME7A 4JQFA 4HT8A 3U6FA 2Y4YA 1VF9A 1W1WE 2DZCA 1VQ6Q 2ED0A 5AFUA 4JX6A 2YHYA 2H8HA 1B1BA 4EM2A 1XJWB 3JCMf 5B5EC 4TSXA 1H92A 3MEAA 2ZPEB 3SZTA 3I53A 1TTHB 1I94K 2HF3A 5M1NA 2Z1IA 3F73A 4DBRA 3L0QA 1FMKA 2UYTA 1I07A 1KC8C 3CCUI 3OS0A 2O8DA 3VYGA 1T3SA 4K25A 2A6HF 1A6QA 3C4SA 4B6MA 5K5OA 4FWPA 4L18B 2ZPIB 4XK4A 5EVZA 2H27A 3RMAA 2CYYA 3HDDA 5DM7F 1U47A 3GWZA 1KQSP 2BUPA 1VHXA 1TQMA 4PGGA 1N3AA 4NXNK 4DQRA 1FKPA 1T03A 4NCGA 3FR0A 1O9SA 3JRFA 5M1QA 2L0AA 2Z1DA 4IRHA 1G3TA 3NGZA 3QO3A 3LANA 2EIJH 1UTIA 4LSLA 2L7KA 4KGVB 4Y17A 2L3DA 2E60A 1KG4A 1EA3A 3K69A 1PD0A 2NVTJ 1RTJA 2DY4A 1I0CA 3VMFB 4B9UA 3JTGA 4OMOA 1U6ZA 3BG5A 1NG6A 2EZHA 4G94A 1R71A 3EN9A 5HDGA 3EG2A 4F3QA 1YHQA 2K9QA 5GMKe 3T69A 3JCMW 4DQ8A 3AGKA 4JKAA 4EDUA 2H1LA 3FB9A 2IS6A 1YX5A 4C8MA 4QQGA 1X75C 4FYDA 2C6YA 1TW3A 4BVOA 2BZ8A 2P9LB 5LHIA 4A2AA 2X4WA 4ITVA 2GFAA 1RT2A 3L2WA 3PO3J 2TRTA 3MEDA 3JAMO 2X4HA 3IHUA 2DKGA 4CO8A 4HRIA 1M3AA 2I2LA 2HL5C 2DD5A 3PGGA 4AIJA 2DRMA 1QLYA 2HWVA 3GVAA 1PKTA 3NFCA 2AK5A 1OI1A 4E9HA 2ZO4A 4RCHA 1IKVA 4JI8K 4LG0A 3RMBA 2Q3SA 2KHMA 2DA4A 3OBYA 4EW0A 5I21A 3JCMP 2JN0A 4EPCA 2G8IA 5IOYA 1FYLA 3MKLA 3A2FA 1X3MA 3BC8A 3IL2A 3QNNA 1NJYA 3VDXA 2PX9A 5LL6Z 1H1VA 4IUPA 3JTHA 3ZSYA 1MH4A 4L59A 2P5LC 4RMOA 3RDIA 4ELUA 1S5JA 3DJCA 1FBUA 3CBOA 4FWLA 2JVHA 1FWZA 4CCLA 3IH4A 1W5CC 1MMSA 4BE0A 4EJZA 4OPJA 2HMIA 1BO5O 3O3KA 4MZPA 1SD6A 1QKWA 4PFZA 3OWTA 2KAFA 1W2BP 1P4XA 4A3KJ 2LKPA 1LW0A 2EYWA 3QLHA 2WUSA 1WHMA 4L0YB 1K61A 1S9EA 1K8AO 2A68F 2DXIA 4RCCA 5KE2A 1ZBSA 5JVGF 3M3ZA 1KQSS 4YDUA 2LP5A 1FX7A 2V1DA 3LA7A 3J81Z 4O0JA 3L4QA 1PRMC 1Z0XA 3AY9A 4IOXA 3PNYA 1X9WA 3Q0VA 2UU9K 4B3MK 4CCKA 1PU6A 4Z02A 3PV8A 2GA1A 3RTRA 2HVRA 1VSKA 4BBRJ 1JLQA 3C2BA 1LWVA 4NS5A 2OAZA 5LJ3f 4BEHA 4DFKA 4ZDPA 3KWGA 3NGPA 4PL7A 4XIUA 2PZ1A 4LB5A 3F0ZA 1R0BG 3CM5A 4LGWA 4ZGEB 4OPAA 4CK2A 4M75C 2JXBA 2J6KA 2VV5A 2YHAA 4KTZA 4CVNE 5LJ3j 4XLEA 1WEGA 2L9VA 1MJAA 4FOIA 4KRTA 1BHLA 5E8IA 1DP3A 5AONA 1LWWA 2A08A 3QFPA 4FLZA 4I2QA 3L6QA 1VQKQ 2DNUA 3SJHA 5AQNA 1HX1A 1BOAA 1AD5A 2XHCA 4C92E 5CQEA 2MLKA 1R36A 2JZYA 2F9WA 4AM6A 1GXIE 2LX9A 3GDQA 2RHKA 4PJ0C 3ZSWA 4AG2C 4NDLA 4AD9A 3OSVA 4OGEA 1F1ZA 2HZDA 4IXAA 1JJ2S 5T7BA 1KG2A 4DTRA 4IHYA 2ZXJA 4R1HA 1WXBA 2V4JC 4KMFA 2E19A 1YG2A 3FXOA 4A3IJ 3I58A 2ZMEC 1JJ2A 4J00A 2KQ2A 1K7AA 3S15J 4RCBA 5KQDA 5BOXA 2FNPA 3QEWA 1TYQB 1WHLA 3CMAN 4BHBA 3VQ4A 2B6AA 3SLCA 3K0LA 4YDUC 2KXDA 3H46O 2YHTA 2FEZA 3GNFB 3N05A 3TTFA 1Y1VJ 1G8XA 1F5TA 2CREA 1M3CA 3U3YA 3JAMZ 4XTZA 3CCVQ 2Z99A 2ZCFB 2EGCA 1WJ5A 1N34K 1VQ7I 2WC2A 5K7ZA 4FM1A 5E26A 3QRFF 5K5QA 4XLAA 4WTOB 2YHBA 2F9TA 2UV1A 4E3SA 3C1DA 5TRDA 2UXBK 1VQ7Q 1FJGK 3OYJA 3BTLA 2W41A 4ID5A 1VOMA 3S2WA 2R5AA 3LSRA 1K76A 4AHRA 2HEOA 2DMUA 2VASA 1W97L 2K5IA 4BU2A 3HTRA 1VQ5T 2HAXA 2QKLB 2IVNA 2GIVA 1SPKA 1RACB 1RILA 2L3RA 1AHDP 2CS7A 1WNLA 2KGTA 2EQRA 4M9ZA 1PD1A 1X3UA 4XU3A 1T38A 2HDAA 4FLYA 1Q1HA 2YT6A 3G1JA 2ADUA 2K4JA 1IHWA 4QS9A 1WI7A 2Q0RA 4NLBA 4UOBA 5DCFA 3H36A 1QZ5A 3ULDA 1WJCA 3J80Z 4LH5A 2KTQA 2NOEA 5IPAA 2D0NA 2QA4A 3M8EA 2D0AA 3OYBA 2H6BA 4CF2A 1NK5A 4UNFA 2NLXA 1WJSA 5HS9A 4MLEA 4B9LA 1LPLA 4RW6A 4IUUA 4IQ4A 3V1OA 4Z4EA 1UUEA 3PTAA 4M7DD 1QWEA 3FLCO 3H5NA 4BC3A 3OVNA 4AHSA 3C94A 1Q86R 2D4WA 2O61A 2CGHA 4OMQA 3I5RA 1RUWA 4DG1A 4FYXB 2VBYA 3TI0A 1ZGWA 3MN2A 4S04A 3CQZJ 3Q0WA 2F5VA 3DBRB 3ZSQA 1LDJA 3QZ9B 2OTJN 4BRHA 1NYGA 4KKOA 5GTHC 2ROTA 3QYGB 2QA4N 2A28A 2BE5F 2YJFA 4C5EA 3C7NB 5CPRB 1JLGA 4OGCA 5LEKA 1UEBA 2JWLA 3P31A 1E17A 4F17A 2LSOA 3DPTA 2P5OA 4AIAA 3MP8A 3VS7A 3NF6A 3K1PA 3F6VA 4JRKA 3JRZA 3P5JA 1U4BA 5JS2A 4LF5K 1BBYA 3WTVC 3QP6A 1ACMB 3M8JA 4M6VA 1W0TA 3TAEA 5KK1A 1MBJA 2VWJA 4I6ZA 4CZEA 1V1CA 2Q2EA 3LDQA 5M5XJ 4KHPK 5GIPA 2ABKA 4HCZA 4BQLA 4S0HB 3LDOA 4PA1A 2DBBA 2OANA 2RHXA 2F5DA 1YW8A 2L8DA 2YLCA 1VYUA 4PUOA 1T0JA 3D2FB 5JVGL 2ZNZA 5LEJA 3ISNC 2YX4A 3CCRI 1EH8A 3LZIA 2Y69H 3A8HB 3LSHA 3OB9A 1P7MA 1YIJT 3BDLA 3LAMA 4M41A 1P6RA 2HKNA 4HVWA 4ZZLA 1HKQA 4A2BA 3CC4T 2DN0A 4ZNXA 1XSVA 1K8KA 2GXGA 4IL6C 5K7FA 2JS0A 4FWOA 3ABUA 5K1YA 3GX4X 4HLYA 2KRCA 4IFVA 1XUPO 2LKXA 2B7EA 4M7DC 3GTPJ 1NKCA 2F48A 2ACJA 3NE6A 1LCUA 1FP1D 4H5NA 2K2VA 3SAFA 1WX6A 5GAN4 1WDXA 3HM8A 2ESHA 2XGXA 1I8FA 1UGQB 3D4VA 3KETA 2YRDA 2Y9YA 5EJCA 1NBEB 2ZXIA 2ISZA 1P8ZA 5BREA 3THYA 3CQYA 3WG9A 3MKDA 3LQRA 1C1BA 4AM3A 3HPWA 3TTCA 2XPWA 1NGIA 3MK6A 3SFMA 1X1PA 3PLAA 1T05A 3R60A 2JK3A 1MMDA 4CZHA 4O3MA 2JJ7A 1ITGA 4YHHK 2GUIA 2WAEA 2DL5A 4L5IA 5J8FA 3TSZA 1MDMA 4BGDA 3I55A 3IKVA 3EUHC 4A3JJ 4B1XB 3JCMc 3O3FA 2F1LA 4CIFA 2HZTA 4OF1A 4QTRA 3AG2H 1QSYA 2MAMA 3OHRA 2DFHA 1Q18A 3LSTA 2P9IA 2OI3A 2P9KB 2RF0A 4M3ZA 2QI2A 1HJDA 3M3YJ 2YSQA 1VUBA 4IHSA 1YI2I 1OYYA 2QKMB 3M07A 4RA2A 3PO4A 4WF2A 1MDMB 4J9EA 3HSCA 4DR3K 2NRZA 5KYXB 2R57A 4LF6K 2LG4A 3H9NA 2LD5A 1C0MA 5HODA 3W3CA 4CC2A 4IOAL 3MKYB 3DLKA 3T1AA 1YRNB 2OTJA 1Y0MA 4KFBA 1X2NA 3WGIA 4Z89A 2NVUB 4RB1A 2KRSA 3TBIA 3HRMA 2GAUA 1H3ZA 5D5VB 1BC8C 1TWBA 3PVQA 4DQPA 3PUFA 2PBDA 5AQVA 3SDZA 2QQBA 4CJ3A 4NC8A 5KHDA 5GAHP 5J3BA 1AU7A 4FK0A 3PO5A 1OR7A 4E6KG 2YKMA 3P1GA 2EH3A 4L9VA 1ZGJA 4H0PA 2RPNA 1LKXA 1MDUB 1FN7A 1M1EB 1UGPB 2DDBA 1UZCA 1X1DA 2JVGA 1D8KA 4D0PA 1S9GA 1X19A 4JZ3A 4OVAA 1OCRH 2O88A 5EG2A 4NQWB 3QSUA 3ZSRA 1MNDA 2KT0A 3H1VX 1RUOA 3EGDA 4BWMA 1JLCA 5DM6F 1X6OA 1NG2A 2M02A 4DR7K 2NOHA 4J01A 2VWBA 3VF6A 2R7YA 2KXCA 3VS4A 1W7PB 1E3MA 2RJDA 3ZETB 3P9IA 2JM8A 3HG9A 3OYYA 3GFMA 3CCSQ 3QBXA 4CEOA 3K70C 5HRSA 2LQKA 1IXRC 4DV2K 2OD5A 4CF9A 4E7KA 4JKFA 2I5WA 2EJFA 5GPCA 4CDGA 4Z4HA 4BAYA 5DK5A 3T0YA 3VF2A 4U0WA 2LT1A 2R4GA 1J9IA 3BY5A 2OPQA 2DA3A 1G3SA 4M78D 4A0ZA 1U8RA 5FLXK 2FA5A 2FVUA 2KDZA 5GAN8 1BA0A 1V29B 3HKSA 2HVSA 2XGDA 4FHTA 3CCEN 1VQOA 2P0PA 4CEEA 4D5CA 4U67L 4A54A 3GOXA 5BRHA 3HK2A 5HRRA 1ACIA 3TR8A 2YWWA 1FY7A 2P6SA 1NM1A 1T2KA 2PMZN 5EYRA 2ATCB 4XTUA 3VRYA 1XMKA 1S3XA 1I5LA 1W5SA 2GWRA 3VOEA 1UECA 1BIZA 2VJ4A 1ITYA 1DTTA 5HVQC 3KK3A 3G0ZA 2K86A 2B8AA 3FF5A 2DPPB 1U3EM 4DUYK 4BG9A 3L2RA 5FD5A 2IPOB 1UDLA 2CUJA 1DU0A 3EETA 4ENMA 2ITGA 5KGXA 2YPRA 2L2OA 2ZQBA 2BYVE 3OMYA 5DLOA 1V54H 4JKHA 5EZGA 3F21A 4EJWA 5J26A 4FJLA 5AIQA 3ULRB 4JRIA 4DFJA 3JCMg 3AVCA 4J8FA 3UNGC 5HK3A 2F8SA 2EYQA 4BR4A 4CJFA 4BL0B 2DF6A 1IF1A 3ZMTA 3LWHA 3V9SA 1X3NA 1MJBA 2VE9A 3BG9A 4W5TA 1CGPA 4XU1A 3UA7A 2NRHA 2P4WA 2CMPA 1NGHA 3OYHA 1IV0A 5D8LB 1X9SA 2X6WA 5EDNA 1ZBLA 4I2PA 3CCVI 4FE4A 3P9KA 3CJQB 2E1CA 2VOOA 4AVPA 1DUXC 4ELYC 3ZMVA 3LP0A 4GVMA 5CR4A 3VEPA 4MLHA 1KLNA 5CK9A 3ZSZA 3SZ2A 1RT3A 3GBTA 4M75A 3M53A 1NEBA 3NF7A 3VU3C 4Y3OA 2BKDN 2JTVA 3CFOA 4WXHA 2HPIA 1SS6A 1UJ8A 1C0UA 2M87A 2V1RA 1T3VA 2JA8J 5DM7R 4E7ZA 3LDPA 2VKDA 4JI0K 5LGUA 2FOWA 3VQBA 3WHCA 1DGKN 2IS1A 2FL7A 1ETOA 1O7FA 2KIMA 4N56A 2X1CA 2DYRH 1KHCA 5AQJA 4HVVA 3TW7A 4XLNF 1IZ6A 2G8KA 3K9JA 3PM1A 4IBNA 3LDLA 5CHIA 3VOVA 1A5VA 2XF5A 1WEFA 4CFCA 1H8AC 2VKEA 1JJ8C 4W5NA 1AWOA 3SDGA 5ELZA 3VEYA 2QDLA 1R23A 2QTVA 3H0HA 4ILHA 1RBUA 2VXFA 2E2NA 1M3QA 1UOCA 5A2QK 3DBLB 4PJMA 2M0OA 5HDKA 2RHYA 4DZPA 2OBPA 2OTJT 3CC4N 2L5QA 3E6MA 1IXDA 1BI4A 3FLGA 4P55A 3LWMA 2NXNB 4HTLA 4HVUA 5AQQA 4IWVA 1WGSA 4M78G 1T6DA 3SI6A 3HRSA 1X43A 3TOAA 3DEEA 4DV5K 2DETA 2O8CA 4EV0A 3SUPA 3TAGA 4UUSA 5GAOp 2GNCA 1U48A 2GZWA 3CBPA 3V9WA 2JNGA 1KC8O 1PUEE 1L3LA 2RI5A 3ERMA 2QWQA 4OIOF 5DD8A 1GOBA 1ZRCA 1QGPA 1UFFA 5KAFC 3C0CA 4M78B 4B1UB 3R9PA 1BCOA 3VQDA 2LF7A 3JSCA 1FZPB 3CCLA 3ZQFA 2HDCA 5D6XA 5L3BA 1K0SA 4LXCA 4DBHA 1JHHA 2CP5A 5HNFA 2FBKA 3DWLA 2VQGA 2W0ZA 2XPVA 4A5MA 2ELHA 4IIMA 4BI3A 4UUVA 1UAXA 3E5XA 2EV6A 2IVMA 1N27A 2DJIA 3EG0A 1LWYA 1J75A 1PHTA 4DSIA 2JZ2A 4CEBA 4II3A 2XDVA 3REOA 2LCCA 3CD6Q 1Z9ZA 1TT5B 1H3HA 3QHSA 4CD1A 2NLUA 4R5PA 4BY1J 2XY6A 1I50J 2PMHA 3KLIA 1RRQA 1UFMA 4IEJA 2ETHA 3B8AX 1TAQA 4BRAA 3O1WA 1U78A 2ZSHB 1Z3YA 4E6RA 2DI3A 2IP2A 4AC0A 1PYVA 1NWKA 1IZ1A 3JCMV 1P7JA 3FZHA 5CYMA 4UQGA 4I09A 2C0OA 3OL4A 3S1NJ 1M27C 3A0BC 2EPDA 1BA1A 1BN5A 1HNIA 2RNAA 3E66A 3RSEA 1D8JA 2FNAA 4KFCA 5KTQA 1GVDA 3HBLA 3P4IA 2O8FB 1BUPA 1VRUA 5K14A 1X1BA 5LJ5j 4N4OB 4JN4A 2D1VA 2GF7A 1ZSZA 1JHFA 4KGZB 2VVKA 3ZEUA 4E1NA 4TVRA 4F4KA 1OJLA 2HQNA 5DLQE 4RTYA 1JB0E 1AKHA 4FJ8A 3EEQA 2KK4A 4Z4GA 5DD4A 4YPHA 4DTUA 4OB3B 4UVAA 1VQ9I 8AT1B 4LG3A 1NJXA 2DFFA 1ABOA 4NYFA 3I59A 1RT6A 1IRFA 4OX9K 2WBMA 3FFKB 4LG0B 3GTJJ 3PVLA 3FDRA 2QYOA 5CQYA 1M1KR 1A0NB 4JKGB 2WAFA 3JSMA 4IPAA 1T0HA 4B43A 4HVJA 1K8AR 1T56A 4F7UB 5EGOA 1TUCA 2ZFUA 2ZNYA 4BJ5C 1YQKA 1VQ4T 4X0GA 1K8KB 3UWNA 3GUDA 3G2BA 4HF1A 4PKCC 3TSQA 5F27A 2AIRB 2W7NA 3THWB 2BH1A 3SYTA 4YOVA 4DTJA 1IG8A 4M73A 1C1CA 1OH5A 3CMEQ 4FZYA 1SC7A 2JTEA 1J59A 3SPZA 1B9DA 3ZMZA 4AIKA 3NEUA 3I0TA 3CCYA 2R7UA 1Q8IA 4M3RA 4A0XA 3DQVC 2NNWA 4BNCA 4BACA 3HUGA 1GCPA 2YG9A 3I0SA 2QCOA 1VRLA 3HYIA 1MW7A 4GY2B 3LP1A 4YOUA 2KVQG 3CMYA 3N5BB 3RYPA 4ZYAA 5IYCJ 1BBZA 2HHVA 4BVPA 3QBWA 3VQPA 5A0LA 1S29A 3RCOA 3JXUA 1D9DA 4O5BA 3C6HA 2HOAA 2ZC2A 2QVOA 1GLCG 3BY6A 4LF7K 4H5RA 3CPWP 3CC2I 1VIFA 3KYCB 3X26B 3QEPA 1VQPQ 1VQLA 4DTSA 3AVIA 5FKLA 4JI3K 3AVJA 2O4IA 3VYHB 1VQ8I 2L89A 3IKTA 2EAYA 3DMJA 2G3RA 4GV6A 2R7WA 3NVMA 1GT0C 4C92C 4ELVA 2FSWA 2L7FP 1XCBA 4G6DA 1U2VB 5GAGJ 4FJ7A 1FIPA 5GAOn 2XAJA 4G7ZF 4Y13A 3O4QA 4KT0E 4A57A 2M3AA 4K42A 1J6ZA 2A37A 3EGUA 2M8GX 1HLVA 5FRMA 3ZSXA 2PTKA 1VQOI 1UJYA 3OW2A 3HJFA 3F23A 3J8AA 1KXPA 4BR7A 3HTVA 4IHWA 5IYDJ 2LCSA 4GKJK 4HTUA 4QS7A 3TSUA 3CC7I 4DTOA 3CCMA 1RABB 5L3CA 2BHYA 3TU4K 2EYXA 5EXWA 2G8FA 2GELA 1SG5A 5AQSA 5CR2A 1WI9A 3CO7C 1BW6A 4OMFB 1VQ7N 3FGUA 1WJBA 2M51A 1LE8B 4B4CA 4CF0A 1T44A 4M77F 1VQNA 2ZJQF 3ZT2A 5FD6A 2HU9A 3TKYA 4XOTA 1KQ9A 1N75A 1BOTO 5FROA 2DK3A 3OBWA 2YKNA 1AWJA 3LAJA 3FIWA 4AFZC 4XTWA 3S93A 3FHNA 2LRDA 2M0CA 4FT2A 1M8MA 2P84A 4OIQF 2O01E 2XRIA 5J2QA 3OMGA 4O55A 3OV8A 4XBFA 1FLIA 3CC2A 1UHWA 1YQMA 3M0PA 2K4YA 2LNHB 2BGCA 5CKBA 2OTLN 1KLMA 3RRGA 4HX8A 1JUPA 1J54A 3A4CA 2H1KA 2R7ZJ 3QJYA 1W7PA 1OOTA 2ZPBB 2CDTA 4EIKA 2R58A 3G3ZA 1R1TA 1U04A 4JI4K 3KCCA 3FMQA 1D09B 3C18A 3HGGA 2NOZA 4QIWN 3WEEB 1GLBG 4Q48A 2EFOA 4B9VA 3NAEA 1HW2A 4CF8A 5AQGA 2E1MB 2HBPA 3CXCS 5KQ8A 2Y75A 5LLQA 2CGLA 2XB0X 1FBQA 1PJRA 3RI4A 4A69C 4WYBA 2F7TA 1BI0A 4Y52J 3ZRGA 4GXOA 1KU9A 1MUDA 3HGYA 3ZCOA 3KIOA 1M2VB 2DTRA 2WC9A 2HGCA 4QT7A 3JREA 3VUZA 4CESA 3AG4H 4L5GA 3X2QH 3ENHA 1ZN2A 5KN9A 2PLYA 4AI4A 1D8YA 1TL1A 3HOXJ 2VC1A 2MI6A 2QWLA 3ZQIA 2CUEA 4DU1A 3R4KA 2QWPA 4IZ9A 1SAUA 3RPUD 1K73C 3W6KB 1IUFA 3BCBA 1WSUA 5KVRA 2EBIA 4JS4A 3DXMA 1MBKA 4M75E 5FU6C 4F7UE 3I33A 3CXCA 4O5FA 4MTDA 4B48A 2A42A 4HZFA 2YG8A 1K1ZA 2NUPA 4EHTA 2LP0A 4IURA 3VGKA 5BMZA 3ER0A 1RPWA 3VQ5A 1ETYA 2W42A 3RKQA 5AQYA 2CQ7A 2QEXI 4PL6A 4ESBA 2F2XA 2CH0A 1ETWA 3UKRB 4Z4IA 3I5UA 1Z91A 3ZGKA 4DLGA 3CG7A 4GO1A 4FTHA 2R5ZB 1M90U 2BE7D 1QBJA 2OAWA 4AFSC 2O9VA 1O3SA 2BXZA 1R4MB 3L8BA 1YJWQ 1P4AA 3CM6A 3H92A 2BE2A 3KK7A 4WK8F 1TK8A 1X3ZB 3IAYA 2CW7A 2AKKA 1YHQT 2WB1N 3AARA 2XSDC 4V2FA 1VQPN 2RA2A 3MZ8A 3M9QA 3VQCA 4JYKA 3M56A 1QHTA 3L09A 4BD3A 3C7JA 5HP1A 3CFPA 4DB3A 4FZZA 4I0BA 1KG6A 4A5NA 1AOJA 2EHGA 4M7DB 1SFKA 4CBWA 1USTA 3K70D 3RKWA 4IOCL 1GLAG 4FJKA 2JWKA 2NUZA 1B8IB 3ULEB 1KFZA 2EJRA 5CYVA 4Q47A 5K5RA 1IDZA 2HHXA 4C0ZA 2HVHA 3AT1B 4NQWA 3QETA 4KPYA 2VI6A 1P90A 3VA0A 4E1MA 2MSYA 2MIOA 3D0SA 3CEYA 4FJHA 3C2HA 1MHNA 4PJNA 3LSGA 5IT9O 4G7OF 2HSPA 5GMKj 1S5LC 2AXLA 3QWLA 3BT9A 5F6FA 4AVZA 3CCRT 3E0JB 3MD2A 4FM4B 3AVMA 2QEXA 5KYUA 2D2WA 2HVIA 2V1UA 1HJOA 4KBMB 4OFEA 2EQMA 4EZ6A 2A6EF 2M16A 1VK0A 1QS4A 1RUNA 2IJLA 4LFBK 4Y15A 1XD7A 1A5XA 3VS2A 3M1FA 1UB4A 3L1AA 3SEZA 1VSEA 1NGCA 1RT7A 4OPKA 1A36A 1JXSA 5EEGA 4Y7NJ 1C6VX 2R92J 1TU0B 3DU6A 3I4MJ 4CJPA 5EGOB 3I8BA 5KYUB 4M78C 1VQLI 1RL2A 2HKQB 2CT3A 4CC4B 3F3XA 1R49A 2JUGA 3SQ4A 3VA3A 4XICA 4K11A 2C06A 1F4KA 3A8LB 3NGYA 1RFQA 5IYBJ 4CC7A 2DXBA 1M8VA 1CZ9A 2E6NA 5HS8A 1H9TA 1K73R 2O9SA 2WTUA 3ZX2A 3P38A 3HB9A 2P9IB 2EA2A 5J2MA 3H41A 4IF4A 2HTJA 2E4LA 3LNQA 3V9UA 3H5RA 2AXTC 2DX1A 2YNHA 3GF5A 3O6WA 3H9JA 3FIFA 5FLVA 2CP6A 2E1NA 3DI6A 3KPHA 5E17F 3THVA 3N0UA 4WQ5A 4DWIA 4KTQA 2DTOA 1J09A 1U5TB 4BQOA 3HRGA 2HHUA 1XMAA 1XQOA 2QENA 3MCPA 2RKHA 1WZ2A 3KFWX 5JS1A 2KP6A 1WA7A 3KEYA 2VONA 3KWIA 3Q1JA 3Q9SA 3H3UA 1XMQK 3JCMX 1U06A 4M3DA 1EIFA 4JD2A 5KNLA 5CO7A 2XSJC 3G1MA 4CJ5A 4N0AA 4JX4A 1TK0A 4HYEA 4XKWA 4RM3A 4PJOC 1VSLA 1P7IA 3DLBA 2DMQA 3HOTA 4LF9K 3HPOA 4FX4A 4KH0B 2NZTA 4I7HA 1LEAA 4RTUA 4B1YB 4JI1K 2J6FA 2JPBA 2KYBA 3E5QA 3ME9A 2YRCA 4M45A 3HPHA 2MWOA 1IKWA 1WH7A 5ICCA 5E41A 3VODA 4PJOE 4C8QG 2ESWA 1MH3A 4AM7A 2K3BA 3GTOJ 1H641 1Q82U 5FFXA 3SAHA 4MO5A 2QEXT 1R58A 5AQZA 2FRHA 5J8CA 4KA4A 1CLQA 3LGFA 1RAAB 4K41A 4D7NA 2YSRA 4DK9A 2ZPFB 4C8QA 1ZARA 4H0EA 3WNGA 3BROA 2W00A 4DOVA 4LFAK 4GFBA 1RLPC 1U0JA 2R93J 3TABA 2ID6A 1ETVA 4J83A 1VTNC 3JRHA 4WCEL 5D6WA 3NF9A 4F91B 4CJRA 4EAHD 2FEIA 3Q5FA 3HT3A 4CIGA 3QPLA 2HQXA 4GGGA 3KP5A 4C0DB 4KHSA 1GL5A 1WPKA 5DTDA 5F1RA 2P0WA 3PQKA 3I4PA 2KL4A 1D3BA 4DYQA 3HHTB 2C0IA 4YNQA 5GJVB 4Z94A 1S7OA 2J5PA 2CZ6B 4DOWA 2Q31A 2VKHA 2ZD1A 3JRCA 3IMXA 1X2MA 4XLCA 1TKXA 3BR2A 3ABTA 1SHFA 2FBVA 1KJWA 1E0EA 2G8WA 3R2XC 1BW5A 1D4XA 4F7UG 1LPQA 2ITMA 4A4GA 4M77B 4BC4A 1X1CA 1O13A 4Y1DA 5D5XB 1JE8A 5GPAA 1YI2Q 1LQ1A 4DFMA 2JRMA 1LW2A 2F4VK 2HBKA 1XQHA 3KX2A 1EJ9A 2MW8A 5E3NA 4Y0WA 4MDBA 3JW4A 3C6AA 3UKUA 5FW9A 3K9KA 5C24A 1RT5A 3QYEA 1RDUA 3VSKA 2CZ1B 3TARA 1VNDA 1D5YA 2DTIA 1SD7A 3QFUA 2AP1A 4EFHA 2KSSA 2JMWA 1LWEA 2CJJA 1NM7A 1WZOA 2R7OA 1R1VA 3GZNB 4P5NA 3F5TA 4HV6A 2KYMA 1MGTA 1SUQA 1TXQA 1JKOC 4KHYA 3CCJI 2X3XD 1EKEA 2HNHA 2XHIA 1VQ6A 2MH9A 4DQ2A 4C92D 4C3IJ 3NWTA 2KZGA 2D0QB 1SKRA 5H20A 1T0FC 1AT1B 1ZQ1A 3KEQA 5D5WB 3LDNA 3T1YK 3ROUA 2PQWA 3UKUB 3BZ6A 2H3JA 2E4HA 1HKTA 1ETXA 2GWJA 3WQUA 1QVGM 2K2MA 3HRTA 2UXCK 3FM5A 1VFCA 2DYBA 2D5VA 3HOUJ 4DQSA 4F2RA 3OL3A 1GHCA 1TLHB 2OJED 4BROA 1Y07A 1ORPA 3CD6N 2K7AA 2IGOA 5B1BH 2DMNA 4XIDA 1L3UA 3HL2A 2TCTA 2LC4A 3PT9A 1B72A 2O2OA 3CCLQ 1NJZA 1Z67A 4KIBA 2BW3A 3DF8A 3JYTA 4LE9A 3QOPA 1UGSB 2I10A 2EA4A 2RI2A 3VPRA 2I7PA 5CHZA 2GOMA 2LR8A 1IN4A 2IPQX 4B8CA 5FLXZ 5EEAA 3GPLA 3OSFA 2B5JA 3CWAA 3BZCA 1ZBHA 1K4US 4X62K 1EETA 1CSKA 3EUAA 4AHVA 3KXTA 1M1KC 3T1BA 1NPRA 2CQXA 5FGMA 4FSXA 5LFAA 2BBYA 1TOVA 4MMKA 3R1XA 4CFDA 2E64A 1BL0A 1ZUUA 3I55Q 1MNMC 1FYKA 4ZN1A 4H5VA 5LJVA 3CMEN 2IA2A 5JICA 2IS2A 2X4JA 2XAUA 1NGAA 4FLWA 1AKHB 4ZN3A 1XG1A 3S14J 1SFEA 2DBMA 3IUCA 3V7SA 3BCAA 3CCST 2DU9A 4BUGA 3I8DA 5GAN5 5BN9A 4IUQA 3LFUA 2FSKA 2YU9J 1NJIU 4G6QA 3ISPA 4PFPA 4XQFA 2NS7A 4XKCA 2WY7Q 2Z1JA 2QGUA 1E6HA 2BDPA 5FKNA 2OZMA 5F0HA 5GAN6 2PMZA 2CG4A 5JI6A 4J9IA 2BY3A 1ZQ3P 3O1BA 1N6QA 1HRHA 4FU6A 2DL7A 4OAYA 2DODA 4FL9A 2Y2ZA 1NH3A 3TAPA 1EFNA 1WSFA 4IRIA 4J9HA 2NS0A 4MQ3A 1D0XA 1BI1A 2E70A 3RR7A 1RCHA 3QDFA 4E9GA 5M1OA 3I55I 1GCQA 3K2ZA 3CZ6A 2A3SA 3EUHA 2KZMA 2I5JA 2E2JJ 3GO5A 4MMLA 2Y31A 4CHZA 5C44J 2UXNA 3S2HJ 4A3FJ 4C2MJ 2HSEB 4Z6YA 1KD1C 1H89C 3QWXX 3SUQA 4JS5A 2DE0X 2EZLA 4M3GA 3UATA 4I6MA 4CHOA 1JJ2M 4J19A 1V5EA 1ONVA 4KYWA 2ZJQL 1R0CB 1YITI 4N47A 4F52A 3FK6A 3EG9A 2XF7A 1G83A 5CCAA 4DMNA 2EZIA 1KQSA 4Z8AA 1GLLO 4II1A 3PY8A 4XRSG 3LSMA 3ABKH 5GAMe 3ZT4A 1YHQI 5KYXA 2FQ4A 3A1YA 4LIUA 5E1XA 1E6GA 1ZSZB 2QQSA 3HOWJ 4JP0A 2CQNA 4P9FA 1QQOA 3KLGA 1RDBA 2YX7A 3A01B 1HA8A 4U7DA 2VBWA 3CCSA 3OYFA 1Z6RA 4RAGA 4DW6A 3KP2A 3U23A 2NRVA 1K9AA 3S1RJ 4W5OA 2KNBB 1YJNI 1ORKA 2MBFA 1OPKA 3FSPA 1M1KU 2CV0A 1A35A 2FRWA 2R5YB 1YVUA 1CXUA 2ID3A 1ODDA 2VQHA 1PP7U 4KH6A 3VSLA 2K85A 1KAXA 4GKKK 4AHTA 1FEXA 1BWFO 1Y39A 4PL8A 4B47A 3QPSA 4F7UA 2LT4A 2A5WA 1VQ4A 2J06A 2FC0A 2OA8A 2RN2A 1ZXOA 2DOAA 1U8BA 2HPMA 1S1TA 1VSJA 2GEMA 1R00A 2K7LA 4HW0A 3K5NA 4BEHB 3HO1A 1VQMT 4XLHA 2JT4A 3LWIA 3LYIA 3NARA 1S72T 2PAVA 4XTYA 1FKOA 3GFIA 1QVFS 2CV2A 2DTHA 5IHNA 1VSFA 5LD2C 4C1NI 3R61A 3RR8A 3I9V2 3ZQLA 4F7ZA 5GAMg 1HQEA 3EHRA 3NF8A 3AVLA 2P7VB 3OR2C 5CVVA 2CH4A 2XHBA 1VQ9T 1VQ4N 1HSQA 1HYVA 5LJ5e 3BOQA 3V9ZA 2HHQA 4W97A 4C2UA 1D1CA 3QG1A 5AQFA 3H0IA 4OINF 4Z0UA 3WNEA 5GANh 2QWOA 1NGGA 4J2BA 3O4WA 3S9HA 4LLGF 4CGHA 3Q3SA 1S1UA 2M9HA 2QA4I 2M2EA 2ISYA 2DBKA 5CVUA 1XI1A 2JM9A 3CCUT 5AQUA 2YUQA 4FETA 4AHCA 4P5OA 1VA7A 3MXMA 4CZLA 1WN7A 3N4QA 5EEHA 4ISFA 1U2VA 2OPTA 2WSFE 2E20A 4FWRA 2G8UA 1ZH5A 3REBB 1HYSA 2NUPB 4HUGA 1RZ4A 1M2OA 3FXQA 3CVTA 3AFHA 2HD0A 2ELJA 3FXJA 2O8KA 3MMYB 4BXFA 3DOLA 1C0GA 2VJJA 5I9EB 2W25A 2DT5A 2IVWA 4BB7A 2JVVA 3VYTB 1K9MC 3AHUA 5E3LA 5LJ3h 2VGMA 2KT8A 4R0KA 3QOEA 1Z6TA 1LNWA 1IXSB 2M0MA 4OMYA 3VETA 1U1SA 2OF7A 4IO9L 3VGMA 3EZ5A 3S6IA 1UELB 5JVHL 1YX3A 2HBMA 3ZMDA 4C5HA 3HXMA 4B3SK 3FHGA 3ZX0A 3CBMA 1M90O 1YXQA 3ENOA 3PIOF 4NNJA 4ASNA 3L3UA 5IHIA 2SRCA 4FJ5A 4YOQA 2DYIA 4RLQA 1JT6A 1YJ9A 2XRLA 5FWBA 2R5MA 1TTYA 2W6LA 3K5OA 3V1RA 2ZPHB 2DPDA 2PZSA 3S1MJ 4LLNA 2B0LA 5C0MA 4AUXA 3VESA 1GFDA 3OOUA 1QPMA 4HX4A 1G15A 4H4OA 4EJTA 2HKOA 1CZBA 3LH0A 4A3MJ 1YQLA 1HKBA 3L2VA 1NE8A 1IKXA 3G4SN 2XDBA 4BQZA 1B59A 5J1YA 2PN6A 1UHCA 3O5ZA 2O8BA 3HHGA 4AT1B 4QPOA 4CFAA 2KT1A 1F21A 2IA1A 4B9TA 2OTLI 1HCRA 2IT0A 3MP1A 2KROA 3K4MA 3MO8A 2W48A 5J2PA 4CEDA 2LDMA 3D5RC 2DXTA 5D4SA 4CJKA 5LHGA 2L4AA 2KLOA 3H3OB 3IG1A 4DSJA 2Q8KA 4QVCA 1EV7A 3PL8A 2W57A 3EYIA 5KYYB 4HCCA 5E3OA 1VZ0A 5ILUA 5AZIB 2F2EA 1KVCA 4CGJA 3EFSA 1KA8A 3WTWC 3JAMK 1YW7A 4J9GA 3A5NC 4DF4A 2CP0A 2DMOA 4M7DG 4O5VA 4CJLA 1R5GA 1OULA 2QYZA 3CC2N 1V76A 3K6GA 2KEAA 1SKWA 4KT6A 2E34A 4G9ZA 1WSJA 3MN6A 1Y96A 4MIMA 2ZXWH 1JJ6C 1WVRA 3J7AF 1QA6A 4HAMA 1NGEA 2EPFA 4YIFA 3ZQCA 4E47A 4K0KK 1GLFO 3BY7A 3PIPF 2NVYJ 3M7GA 3OYCA 1B9FA 1PNJA 5M1PA 3F8MA 4RGRA 1PC0A 3ATUA 3W3DA 2KLAA 1VQON 1W5TA 5HLHA 3U1DA 2E2QA 4C8QE 1SMYF 2XY5A 1XN7A 5IT9E 3VQ9A 4JI2K 5J47A 2LQWA 1WB9A 1J5EK 1IGNA 2CSOA 3R0AA 2YUSA 1YJ9T 3D0PA 3TQ7P 4RGXA 4AHUA 1LWCA 5LBQA 1K6YA 3CCMI 2HHHK 3OS2A 3INZA 1BR2A 3RTVA 5DCMA 1VSMA 1C1AA 4BGBA 1K73U 4FW1A 1O3TA 1YJWN 3RERA 1EH6A 4QW2A 2AZVA 2XDDA 3OIOA 2K4BA 3CCEI 2DL4A 4XLFA 4BH9A 4L9TA 2AHJB 2FMLA 1XTAA 1YITA 5J1EA 1HW5A 2B63J 1ZKGA 2COBA 5ICGA 2ZM6K 1W0UA 1HDDC 3ZETA 4C92B 1RDDA 2E2OA 1QVUA 2BZXA 3X24B 1UGRB 1XQPA 2VG6A 1YE9A 1FK9A 1R22A 3HL8A 2FBXA 3VYSB 4CCMA 1JXMA 1T95A 1R77A 3FJPA 1ATRA 3FZMA 4IG0A 2WV1A 3WHBA 2QLZA 4NL3A 3GFJA 1BU6O 2P9NA 1G2HA 4OO1J 4CHYA 3E9GA 2QTDA 1IKYA 2A05A 1K73O 3PIPL 2HW3A 3T8TA 1R4NB 5JHFA 2GX9A 4DV6K 1JLEA 4AWXB 1RT1A 1QVTA 5EU7A 3I3LA 3DPLC 2V51B 3S6WA 2O8DB 5BPLA 2NOBA 2F96A 1W1FA 4NL2A 3VERA 1WOQA 5DY9A 2XAQA 3MDQA 1ZHFA 2X0LA 2K9GA 2NS8A 4EEFG 1TW2A 3OYGA 3CDLA 3O9SA 3GG4A 1VYVA 3CYMA 1BJZA 1KRPA 5BRDA 4IFYA 1WHHA 4M78F 4IQJA 4CJSA 4HV5A 2YUPA 3CCRN 4F16A 4A3EJ 2F8TA 2P5VA 4H0TB 1QRYA 3ZMUA 3VENA 3EFOB 2CUBA 4GW6A 1VQ9N 1U2WA 5FKKA 3JSPA 4BI8B 4H4KC 2DJNA 3QU3A 3KLNA 3WXMB 4WWCA 4LMYA 1YCYA 2PVDB 3E19A 1NJIR 3PE0A 1NLPC 5GAHJ 1F43A 5KI6A 4PGHA 3SCXA 3CQTA 1OVYA 1QWFA 2O7OA 2ZBKA 3EGXB 3QPHA 2CU7A 2O8EB 1VQLT 1REVA 1YW9A 4GLKA 2XAGA 4CEAA 5JLFA 4BDZA 1I81A 1R8OB 4HLXA 3EDPA 4CZCA 2STTA 3BTCA 5DEQA 1HNXK 1FSEA 2DFEA 4JRQA 1HSTA 4EJUA 2QDYB 4MEYF 2DLPA 5KAIC 3MEWA 2GQIA 4N4HA 2GFUA 3CW7A 2NYXA 3MXJA 3M59A 3NH1A 3BFMA 1W7AA 4ID1A 3JAME 2JG6A 2EKOA 2JS2A 2IC3A 4RLFA 3UIQA 1MSFC 2LY1A 5F04A 2PBIA 2NNNA 4IDHA 1IRXA 2DL3A 2EINH 1UJ0A 2BZTA 1DIZA 3ALYA 3MWPA 1QHAA 3V4GA 1XNRK 1VQKI 3ULEA 3ZMSA 3MQ0A 5JLHA 3MCZA 2Y30A 5A2QZ 3L00A 3HSBA 5FLXO 3M55A 1YS7A 4O44A 4IDKA 3ZQQA 3J80K 1YO5C 1MD0A 3GNGA 4HEA2 2VBZA 2VYPA 3CHWA 4DCHA 1QTMA 2HHTA 5GAOr 4QQDA 2WADA 4CGFA 3M8QA 4M6XA 4PKIA 2KFDA 3VKIA 1HYOA 3AVKA 4GV3A 5HKCA 3ZT0A 2XVCA 1YNZA 3R6NA 4L9NA 1HQCA 5CVIA 4DV4K 3BPXA 1N6AA 4DUZK 5AQWA 3DXMB 1R1UA 1L3SA 5GADP 3CJ1A 3MAQA 1N25A 3E7LA 2IW5A 3N4MA 3AO5A 3PNTA 1NKEA 3UE5A 2ZJPF 4C8LA 2Y0SA 3PNWC 2IVPA 4K43A 2F4OB 3MFKA 2IAJA 1WUAA 4Q5VA 2GWKA 3FM3A 2BW3B 2DAQA 2HNDA 3B02A 4CZKA 3IRXA 2HSTA 2QZ8A 2JHNA 1HDPA 5M3MJ 1K9MO 4C8QF 5F08A 1OYXA 5GJWB 2YUNA 2YS9A 1Z77A 5LHHA 4Y91A 1IREB 1JXOA 4EGZA 1ORNA 1N5YA 2K9NA 2KI7A 1RI0A 1ZBUA 3GTQJ 1V4RA 2OAUA 2QK9A 3CC4A 4DR1K 4PWDA 1DQUA 1UCRA 1QP2A 2KQWA 4RG2A 2FXUA 2FZKB 1OH7A 3RZOJ 2QQ9A 1HQUA 4VUBA 3WNFA 5E1WA 4NC6A 3RR6A 3J7AP 2JWTA 4HUEA 1E3HA 4JKCA 3OA6A 2LFBA 3BR3A 1WRJA 1CKBA 2DT6A 2OTLQ 1BQMA 4DQQA 1DGRM 4A12A 2Y9ZA 3RYRA 3ECOA 4X64K 1TNSA 4CIEA 2UUBK 1YIJN 1M5Q1 2ZJPL 3EHQA 2AKLA 4A0YA 1IBLK 2CSQA 2LNBA 4ZDLA 1M3BA 1RR7A 4A3LJ 1Z21A 3HSTB 1KC8R 2EJ9A 1XGMA 4OJRA 4ELZC 1C0TA 2CQQA 4IOAF 4DYCA 1YQRA 4G12A 3VS3A 2R7XA 4KIFA 1FOYA 4C3HJ 4I02A 3C2GA 2PG4A 4LJZF 1YF5L 1LDDA 2BOLA 2A0FB 3D6RA 3VS0A 1GLNA 5KN8A 1NTCA 3WQTA 3A5LC 3QIPA 3TSWA 1I39A 1BI4B 1XNIA 4M3TA 5DYMA 3CD6I 3WE3A 1JTYA 4ESRA 3L2UA 3I71A 3RBBB 1NGFA 4FX0A 3M1CA 4XTXA 1O7LA 5BPIA 2P7CB 1K8AC 4GNIA 3RWUA 4M7AC 3CI5A 2OPSA 2F2WA 3AO3A 4A3BJ 3CCVT 2JA2A 4BY9C 3G6EI 4B1RA 1VQ4I 2OFKA 2WSCE 1P92A 1KAYA 2MC4A 3VFZA 1YOVB 1CKAA 3NTHA 2FXAA 3JCMQ 1BR1A 4OMLA 3EFRA 1GBQA 4ETSA 4HNTA 4BE2A 3DRRA 1X58A 1J2XA 4PCQA 4DTPA 3BEXA 1UGVA 2IIRA 3GBQA 1IRGA 5BS6A 1GUUA 3RPUA 2WA0A 4UUTA 3GYHX 3SBTA 4LDXA 4CJEA 4OMMA 5LJ5h 1PWTA 4XK8E 3O08A 3JRDA 1ZBFA 3GW2A 4BHCA 4QKUA 3LA3A 3LSIA 3K9TA 4HSRA 5AQLA 3K1NA 4MEXF 1HNVA 5EF6A 1B72B 3CD6A 2RK1A 1TBXA 2KRFA 2KDSA 2Y0SN 1A5JA 1I3QJ 1SRLA 2E6ZA 2OJ2A 4DV7K 3CCQN 3CMAI 3CJ7A 1VSHA 3N97A 4IUTA 5E20A 2L2PA 4C92A 1TC3C 4M7AE 4MO7A 3CQXA 3NHGA 1IB8A 5ECAA 4BR9A 3PSFA 3VTIA 2YU3A 1VQ8T 4YELA 2KRHA 2XGEA 4IVNA 2VKVA 3L3VA 5AT1B 2X1EA 1W7PD 1KG7A 2RGVA 4N5SA 1ZGAA 3A1PA 4MDXA 4ZHRA 1SEMA 5H6RA 3CCUQ 2P9KA 3I54A 1TYQA 1RDCA 3NGIA 5C2DA 4XKBA 4HQEA 2KJCA 4JDSA 1WJFA 1V5GA 2HOEA 2E1YA 5ICFA 2ECCA 5HNHA 3UA6A 2L9RA 2DK5A 2X9DA 1WEIA 3RJPA 3VYRB 3F2KA 3KKRA 4CK3A 4H03B 3SBGA 4EATA 3B6PA 4KH5A 3G1LA 4BYYA 3CQ8A 1ASWA 5LJ5g 4E7JA 1NKUA 3AV9A 4M7DF 3K4NA 3EZWA 1TNTA 1EX4A 1S6QA 4PUSA 4J6XA 1UG0A 2ZGYA 3CCET 3WTXC 3D7SB 2XASA 4M77D 4AMCA <