3OYHA

Crystal structure of the prototype foamy virus (pfv) intasome in complex with magnesium and the insti mk0536
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
368
structure length
368
Chain Sequence
LDAELDQLLQGHYIKGYPKQYTYFLEDGKVKVSRPEGVKIIPPQSDRQKIVLQAHNLAHTGREATLLKIANLYWWPNMRKDVVKQLGRCQQCLITNASNKASGPILRPDRPQKPFDKFFIDYIGPLPPSQGYLYVLVVVDGMTGFTWLYPTKAPSTSATVKSLNVLTSIAIPKVIHSDQGAAFTSSTFAEWAKERGIHLEFSTPYHPQSSGKVERKNSDIKRLLTKLLVGRPTKWYDLLPVVQLALNNTYSPVLKYTPHQLLFGIDSNTPFANQDTLDLTREEELSLLQEIRTSLYHPSTPPASSRSWSPVVGQLVQERVARPASLRPRWHKPSTVLKVLNPRTVVILDHLGNNRTVSIDNLKPTSHQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PFV integrase
publication title Molecular mechanisms of retroviral integrase inhibition and the evolution of viral resistance.
pubmed doi rcsb
source organism Human spumaretrovirus
molecule tags Recombination,viral protein/dna
total genus 106
structure length 368
sequence length 368
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2010-09-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
A PF17921 Integrase_H2C2 Integrase zinc binding domain
A PF18103 SH3_11 Retroviral integrase C-terminal SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2300 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3oyhA04
1.10.340.70 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Endonuclease III; domain 1 3oyhA01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3oyhA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3oyhA03
4O5BA 2PYLA 3KK1A 3ZT1A 4NZGA 2HNDA 3U3YA 2G3RA 4CF8A 1RT7A 4J2EA 3OYHA 1RT5A 4I7FA 1JKHA 1J5OA 4FZZA 5CYQA 4QAGA 1VSLA 2OZSA 1DTQA 5K14A 4CCHA 4N5SA 5FRNA 3MP6A 4PUOA 2HHVA 3VA3A 1X1PA 4OLAA 4K8XA 5HRRA 1JLEA 3AV9A 3F9KA 1KFDA 4DQPA 4KKOA 5J39A 3PX4A 3OQ5A 1ASVA 3L2RA 2M0OA 1LW2A 4CJLA 1J9AA 1SL1A 1NJYA 1NK6A 3B6OA 3PX6A 4W5OA 3NBPA 3AVBA 3NFAA 4I9QA 3TABA 1UA0A 4BE2A 2RPIA 3MP8A 4CJRA 4CHPA 1D9DA 1HNIA 3MP1A 1X9WA 3ALYA 3SNNA 2FBTA 3I0SA 2IAJA 4KTWA 5CZ2A 4NCGA 3EAEA 3V6DA 1BISA 5J2PA 4E1NA 1IH7A 3OJUA 3RMDA 3H8ZA 3HPOA 4ELTA 4FK0A 3OYGA 1TK5A 4QW2A 3DRSA 3CM6A 4PQUA 2HW3A 4MQ3A 3RWUA 3FDRA 4BE0A 4DTNA 1O1WA 2BUDA 3NDKA 5FROA 3NTKA 1NK8A 3E9FA 2YNGA 4LH5A 4DMNA 4Z4IA 2LSNA 5SZTA 5C24A 4OPKA 4E89A 5KCHA 2JGUA 4QVZA 3OS0A 4CK3A 2E6NA 4FK4A 2EKOA 2DFFA 3DOKA 3WNEA 2F8TA 4ZHRA 4A4HA 1CXQA 3SUNA 2XY6A 1SKRA 1UWBA 3LWLA 4DSLA 2JLEA 2XK0A 4IUQA 2IDOA 1X9SA 4NYFA 1VSFA 1Q9XA 4CFDA 1A5WA 3LYIA 3MXJA 3KK2A 3CG7A 3UT1A 2E5QA 1RDBA 1JXBA 1QSLA 2F96A 3EZ5A 1NJWA 3PMTA 4B9LA 4E7IA 4JS4A 4HCZA 1HQUA 1RBVA 4H4MA 1KTQA 1QE1A 1D8YA 1SSFA 4E3SA 1ZYQA 3AVNA 4A4GA 1C1CA 2X74A 4LD6A 3O4NA 5C25A 4IBNA 3SUPA 4PL6A 2Z1IA 3DLEA 1SL2A 5HRSA 4B08A 3L2UA 4FM0A 4CGJA 2XDPA 3ZSZA 3DLGA 4CF2A 1RT6A 4CJVA 4ID5A 4IFYA 4O0JA 1WSFA 2RHZA 4FZYA 2DFHA 4CGFA 2I5JA 1LAVA 3NF8A 4M3ZA 2GFUA 3V1OA 4FJ7A 4E19A 3DYAA 1S1XA 4Z4GA 3OMCA 3LZIA 2OA8A 3G0ZA 3ZT0A 3HP9A 3SQ1A 2RI5A 1TL3A 3MXIA 2KZZA 3SPZA 4J2DA 2WONA 1NKCA 1WLJA 1TAUA 4G1QA 1HQEA 2X6NA 3HYFA 1RT2A 2YKMA 2F5KA 3UWNA 1BGXT 2KTQA 4DG1A 3WNHA 3HT3A 2LTOA 5CZ1A 3RR7A 3AO3A 3EYZA 3QINA 2ITGA 4DSIA 3MO8A 1KFSA 4Z4EA 1BL3A 3AO5A 1SUQA 4O0IA 3K58A 3UIQA 4DLGA 4KHNA 2G8VA 2X4XA 3P5JA 1RTJA 4CF1A 1SV5A 1OI1A 2RHYA 3V4IA 1S1WA 4CHNA 1BHLA 3TAFA 2JTFA 4MFBA 5EU7A 3P8HA 4CJSA 2CKKA 3KKRA 4KI4A 3M9QA 3E9GA 1WAFA 3PMIA 3LWMA 2B8AA 4CK2A 4OPJA 4DTSA 3KLFA 3RRHA 3P8DA 3TANA 4FLYA 3SZ2A 1EETA 5E41A 4E7KA 3E01A 2HHWA 2DFEA 4TSXA 3LANA 1D5AA 4H8KA 1YTUA 3QNOA 2HHUA 1FKOA 3V9SA 3RTVA 1VRTA 4KI6A 2RJFA 1EP4A 3AVCA 2FC0A 2LDMA 4Z0UA 2XHBA 4CJFA 4FJ8A 5KE2A 3AA2A 4YNQA 4PWDA 4B9XA 1WJQA 3QBYA 2OPPA 4OGCA 1CZ9A 1VSEA 1KCFA 3QEWA 3TAQA 4DWIA 4CJWA 3V1RA 4PA1A 4IFVA 5D6XA 2ZD1A 3QO9A 2QK9A 3S3MA 1WJRA 1KLNA 4B9TA 2VWJA 2P5OA 5HBMA 5D6YA 2KFZA 2E4LA 2A1RA 4HVJA 1J54A 4CJUA 1NK7A 4RW4A 3T19A 3DLRA 3PO4A 4FJJA 3LGFA 4CEZA 4FW1A 4FJXA 3KK3A 2YV0X 2HMIA 2PYJA 3PY8A 5HRPA 1RBTA 4I2PA 1X9MA 4CK1A 1Q9YA 1WJSA 4FJKA 3S6WA 4DFKA 1NK5A 4CRIA 2O4GA 4CJ4A 1L5UA 5CYMA 1KLMA 4ZTJA 3LAKA 4I2QA 3ZSRA 4KREA 1L3TA 4CEEA 4BACA 4B8CA 2AJQA 2BKDN 2QQSA 4RW9A 3SD4A 3WNGA 3NF6A 1I39A 1C0TA 1RTHA 1RDDA 2NLUA 4CESA 1N6QA 3F70A 1R0AA 5M9OA 3C6UA 4C5HA 1JL2A 1B9DA 3ZSOA 2X4YA 4CF0A 3M8RA 3QESA 4KHSA 4DSFA 5FDLA 3OY9A 4FM2A 1S1VA 4DTPA 1J53A 4O4GA 3SJJA 4KAZA 5D6WA 3IS9A 2XY8A 2IOCA 4CJEA 1RCHA 1T7PA 1TKXA 3ZSWA 3QKJA 3TAEA 4M41A 3NF9A 1UA1A 5I3UA 1BCMA 3OYDA 1XHXA 2GBZA 3VQ9A 1U49A 4CJ5A 1VSIA 2VG5A 4CIEA 4FLVA 2JZ2A 3KUFA 2GV9A 3SUOA 2R5MA 1LWFA 2D0CA 3I0RA 4CHOA 4BE1A 2EQJA 1RDAA 5KTQA 1WSHA 3KIOA 2LCCA 2G8FA 4EDUA 3LPTA 3VQDA 4DTJA 4LY7A 5J2NA 1WSJA 4OLBA 3AA3A 1S1UA 1IG9A 4CJTA 3META 4CHQA 5KGXA 4DTUA 1KHCA 1CLQA 1JLAA 4AHUA 3D45A 3HM9A 3K59A 2D0AA 4M3WA 4B9UA 2X4WA 3AA5X 1WSIA 4GVMA 3L2QA 2HHQA 4AHSA 3K5MA 4KHUA 3VA0A 1RBRA 4CJPA 3NTIA 1S5JA 3T3FA 4CGIA 1T8EA 2DY4A 5JS2A 5SWMA 5J2QA 4II1A 1RNHA 3MEAA 3LP1A 1TAQA 1RBSA 5KE3A 5J2MA 4ZTFA 2MWOA 5CY4A 4B9NA 3H6ZA 1ZBFA 3O8VA 4DU1A 4RG2A 1EKEA 1FK9A 4FLXA 4H4OA 3F73A 1D9FA 3OYIA 3LGLA 3KLEA 3DOLA 2OPRA 2R57A 2RJEA 1QSYA 3OVNA 4NCBA 1FKPA 4F3TA 3C94A 5KCOA 3PX0A 3DLMA 4IUPA 4BWJA 4YFUA 2GFAA 1LV5A 4FJNA 4AHTA 3NGZA 3OYLA 3VQAA 4B9MA 1BI4B 2HQEA 1TKDA 2QQRA 3AA4A 4IKFA 4FM1A 3L8BA 3BDPA 1TK8A 1VRUA 3VQBA 1KSPA 5IAYA 4BWMA 4K8ZA 1B92A 5J1EA 2RHUA 2BGGA 4B3OA 3SCXA 4FLZA 1XHZA 2IGIA 5KI6A 2RHIA 4IUUA 2NUBA 4CFCA 2L89A 3L3VA 3OYMA 2EQKA 3M8PA 1GOBA 2RO0A 3VQ7A 3S3OA 3OYAA 4M3XA 3QJ6A 2YKNA 4CGGA 4ID1A 1WSEA 4C8OA 2VG7A 2HHTA 3AO4A 4FJ5A 3QEPA 1TGOA 3PO5A 1QHTA 4KO0A 5J26A 2WACA 2HQXA 3NH1A 1RT4A 3TAPA 3M8QA 1NOZA 2LRQA 4NS5A 3LP0A 3V9WA 2RJCA 4IUTA 2GUIA 3SQ0A 1LWCA 2RKIA 3RMAA 3LLRA 3KTQA 3I8DA 3OS1A 5T7BA 4DFPA 3VQEA 1VSKA 1T03A 3KLGA 4EP5A 1L3VA 1NK0A 4CERA 3VQ5A 1YT3A 2HVIA 4E7JA 4DTMA 3TWHA 1WAJA 1KVCA 3THVA 4FCYA 1HPZA 3HXMA 2QKBA 1W0HA 1MU2A 1XC9A 3LX7A 1WNSA 4DQRA 4X34A 1NKBA 1ITGA 4W5QA 4J2AA 1ASUA 3C4SA 4CEFA 1U47A 3DB4A 2EQMA 2Z1HA 3HPHA 2XO7A 3HPGA 3IRXA 3LH0A 4CGHA 5I42A 4KB0A 4EZ6A 3ZSVA 3ASMA 1SKWA 2XY7A 4DQIA 3MEGA 4DTOA 4NYNA 2Y1JA 1JLFA 1BI4A 5HROA 5IN1A 1SKSA 2FBXA 2ZQBA 1WN7A 4QOZB 3A2FA 1C0MA 1HJRA 3V9UA 3P1GA 1L3SA 4DFMA 3LPUA 3LAMA 4LSNA 3TR8A 4FK2A 3L42A 4DLEA 1MHNA 4N47A 1RT3A 1VSDA 2IS3A 4CFAA 1BQNA 3ITHA 2EFIA 1LAWA 3DLKA 4CJ3A 2RN2A 3PNWC 4DFJA 4CGDA 4C8LA 3NGYA 2MWPA 5C6SA 3OA6A 4F4KA 1U48A 3K5NA 3DM2A 2G8WA 4B9VA 4FL6A 4RW8A 3NGIA 3NE6A 1KVBA 2X78A 3NHGA 3DB3A 1IKXA 1H3ZA 1B9FA 1IKVA 1IKYA 3OYFA 1CZBA 1U45A 1DTTA 3O3FA 3SV3A 4DF4A 2FBVA 1YTAA 4W5NA 3KD5E 4FJ9A 2BE2A 5FRMA 4DF8A 2IC3A 3S3NA 2K3XA 5JS1A 3V1QA 4UC4A 3ASKA 3MXMA 3AVJA 3CQ8A 2YNHA 3U3GA 2B5JA 3K57A 3QLHA 3QIPA 1VSMA 3L3UA 3VQ4A 2Z1JA 1XNIA 3SUQA 4C5GA 1C0UA 4C8MA 2PY5A 3HO1A 4BD3A 4CEBA 3KLHA 2BDPA 2RI2A 1S9EA 4ELUA 4DSJA 1JLQA 2DTUA 4OJRA 4CIGA 1C1BA 2RHXA 2EHGA 3V81A 2PZSA 1U04A 4M3YA 4A4FA 4N4GA 5KRTA 2EX3A 3QNNA 4IURA 1Y97A 2P5GA 1WGSA 4C8NA 3TAMA 3K5OA 3VQ6A 1A5XA 1I3AA 3TAGA 3SPYA 4B9WA 3NH2A 2D9TA 3OS2A 1HYZA 4A4EA 2YHAA 1RI0A 4FW2A 4CEOA 1JLBA 3MECA 2VYTA 3KKSA 4M3UA 1RDCA 3AVFA 4HUGA 1JLGA 4Q0BA 2B4JA 1OZ2A 4FJMA 1ZBLA 5CIUA 3WNFA 3LP3A 3RMCA 2D5RA 3HJFA 4LH4A 1TL1A 3OYJA 1C6VA 4JLHA 4EP4A 4L8RB 3QETA 4Y1DA 4CHYA 5HLFA 4KFBA 4M3TA 1BIUA 2M1HA 1WSGA 1YVUA 1S6QA 3TARA 4Z4HA 1NK4A 2LVMA 1IO2A 2WOMA 3M8SA 4KHYA 2D0BA 1OYXA 1G15A 3HSTB 4OGEA 5HP1A 3O4QA 1XI1A 1VK0A 4IUVA 4B9SA 2G8KA 3MEEA 1HMVA 4M45A 3FLGA 1QTMA 4B8AB 2X35A 4N4HA 4IDKA 1K6YA 3QEIA 2FBYA 4ICLA 3JYTA 3ZT2A 4PLIA 2DIGA 4FZXC 4Y1CA 3C6TA 1QQCA 3DRPA 4N4IA 2L3RA 2RJDA 3RR8A 4BDPA 3JSMA 2ZE2A 1S9GA 3HK2A 3CFPA 4C5IA 4DQQA 4AHCA 4Q5WA 1TKTA 2R58A 1VSHA 1U4BA 1UAXA 4DSKA 4OKEA 4E0DA 1N5YA 3G10A 1ZBUA 3KLIA 3VN5A 3IAYA 3OB9A 1NOYA 3HL8A 3FC3A 1NJXA 2IG0A 3SV4A 1T05A 1QSSA 2DAQA 4IG3A 2Q3SA 4N56A 4KV8A 3CEYA 3OYBA 4CF9A 4FXDA 2B6AA 3PUFA 1OZ3A 4CJKA 1RBUA 2M16A 4QQGA 1IKWA 3VQ8A 3QERA 3KJVA 3H08A 3QIOA 5DK5A 5KGWA 4AILC 1HRHA 4Q5VA 2L8DA 1A5VA 1RT1A 1JLCA 2XRIA 3MEDA 2YNIA 3KD1E 1REVA 3NF7A 3QEXA 2OYQA 1QS4A 4C5EA 4FJGA 2GF7A 4PY5A 2HNYA 4R5PA 4QQ6A 3K5LA 1FXXA 1NK9A 1VSJA 1NJZA 2Z1GA 1HYSA 2R7YA 4DTXA 2OPQA 2ETJA 2YNFA 2HHSA 4KB1A 1RTDA 2VG6A 2KW4A 4FLTA 4EZ9A 3ZSXA 3RRGA 4JRPA 4CHZA 1L3UA 3OYEA 3NNQA 1Z25A 3QEVA 4QCLA 1BQMA 2P1JA 3LP2A 3EY1A 4LSLA 2EQUA 2HHXA 4QQDA 4Z02A 4OVLA 2O4XB 4DSEA 1ZBHA 1GOCA 4RG8A 3ZT3A 1TVRA 4RW6A 1S1TA 2W42A 3CYMA 4AHVA 3ZSQA 4M3RA 3MAQA 3DRRA 4CEAA 1NKEA 4O44A 4AHRA 1G5VA 2FHDA 1C1AA 3ZEHA 4KHQA 1BIZA 3OMGA 4XIUA 4FU6A 2HVHA 2A1SA 3MEUA 4I9LA 2VWKA 3O3GA 1EXQA 2QKKA 1HNVA 3C95A 1SL0A 3NCIA 3IG1A 3V9XA 3AVGA 4FVMA 1BCOA 4GW6A 3Q1JA 3OYCA 4AH9A 1TKZA 3ZCMA 3PFSA 4GMJB 4IG0A 3RMBA 1UOCA 3OYNA 2QXFA 3OJSA 4E7LA 4O55A 3U6FA 1CXUA 3DLHA 2E6MA 3L2WA 4Z4CA 3CM5A 2YRVA 4L59A 4W5RA 1W9HA 3AVMA 2XY5A 2KZMA 1ASWA 3AVAA 5DMRA 4HCBA 1EX4A 3VQQA 4DTRA 4JRQA 4F3OA 5HRNA 3DI6A 3SQ4A 3AVHA 4E1MA 2P51A 3ZT4A 3L2VA 3PV8A 4KHWA 1JXEA 1XWLA 4M42A 3NH0A 3MEVA 2BIVA 3MEWA 2ATQA 1S6PA 3FFIA 3LDSA 4PLLA 3DMJA 2DIQA 4CIFA 4CFBA 3VQCA 4KTZA 3ME9A 4NCAA 4WE1A 4CJQA 4F8RA 3B6PA 2RF2A 4CEDA 1RTIA 2R5AA 2G8HA 5KH6A 3AO2A 3K2PA 4DS5A 4FYDA 4HHTA 1DLOA 4RW7A 3T1AA 2K3YA 1LW0A 4HCCA 2HNZA 2P0KA 2O4IA 1HYVA 3LZJA 2O4XA 5C0MA 3ISNC 4N41A 2BANA 1KRPA 3AVLA 3HVTA 4F2SA 4FLWA 3AVKA 3V9ZA 4BDZA 4OVAA 1RILA 1TV6A 1KVAA 3SYZA 4C8KA 3HVRA 4J2BA 4F2RA 1Q8IA 1Z26A 1TK0A 3AVIA 3CFOA 2RI3A 4CECA 5D3GA 2OPSA 2KQ2A 3LALA 4FJIA 4JS5A 3NAEA 3BGRA 3D0PA 4UQGA 3GOXA 4OKKA 2E6LA 1N27A 4W5TA 4KRFA 2PQWA 4ELVA 3VQPA 4FJLA 3O3HA 3FEOA 4N76A 3SI6A 4KPYA 4KTQA 3QIIA 4Z4FA 2X6SA 3BDLA 2YHBA 1JL1A 1GOAA 3TI0A 1F21A 5C42A 4HUEA 2F8SA 1LWEA 2Y1IA 1ZBIA 5KRSA 4GY5A 4CEQA 4HUFA 4LD0A 4DQSA 3HP6A 3AO1A 4CE9A 2HB5A 4DU4A 2G8IA 3DLBA 3ULDA 4HTUA 4OKJA 3NTHA 4E7HA 3S9HA 4FLUA 4DU3A 2OZMA 3SQ2A 4BDYA 3OYKA 3ZSYA 3P83D 2G8UA 3CFRA 2KFNA 4DS4A 4FJHA
chains in the Genus database with same CATH superfamily
4O5BA 4PFOA 2PYLA 2IIRA 4NZGA 3U3YA 2H6CA 1K76A 1VQNA 4D7NA 4FYVB 2RN7A 2CDTA 4A59A 3LSIA 1NM1A 1RT7A 4J2EA 1I1GA 2H94A 2R7FA 4I7FA 2DYBA 3R6SA 1NEGA 1YX5A 2Z1DA 2YWWA 1DTQA 5K14A 4M7AF 3ABUA 3CC4T 1LFBA 3W2VA 3J80O 2D0NA 1FMWA 2ISZA 2HF4A 1XMKA 2DOAA 4PJLA 4OLAA 3FZVA 2HEOA 4K8XA 2FMLA 1JLEA 3AV9A 3CJTB 2VXZA 4YORA 2KE9A 4BR4A 3LOCA 1KFDA 2F5CA 4CZEA 5GAMj 1BBZA 2P84A 4KKOA 3SAGA 2Y69H 2M0OA 1J9AA 5M1KA 3B6OA 3PX6A 5F0CA 4W5OA 3NBPA 3IKMA 1RRQA 4EATA 3NFAA 3CQZJ 3LSKA 3EH2A 1P7JA 2ROTA 2RPIA 2CU7A 1Y57A 3MP8A 4CJRA 3EO3A 2ZJRL 3M6GA 3MP1A 3F0CA 3LDLA 2J5OA 3G1MA 1X9WA 3ALYA 3SNNA 4N0AA 4BUPA 3I0SA 5CZ2A 2FF3B 1V4TA 4LDYA 3VEVA 2BHZA 2QKMB 1BI3A 3H5NA 1TK5A 4JHDB 2LQ8A 1Q1VA 2PVDB 4PQUA 2LC2A 4C3HJ 3CC4I 3EPZA 1XD7A 1K7AA 4WFNL 4UUVA 1BK2A 1CKBA 5DM7F 2BUDA 2RC4A 1FBUA 2HDCA 2QAZA 2VBWA 3VF6A 3GMEA 4KH6A 1OYYA 1NJIR 3WTUC 2DAOA 2DJIA 5BN9A 1GCQA 5L3CA 2E3HA 2CV1A 1K0XA 2KIUA 4Z4IA 3RTRA 5SZTA 5IXBA 2IPOB 3DKWA 5AFUA 2XGDA 4XLPF 4PKGA 4LC9B 2E6NA 2NOGA 3GVAA 3WNEA 2H27A 1OJLA 2VODA 1LJ9A 4A4HA 2UYTA 2R5ZA 2RQQA 1SKRA 1SVOA 4DSLA 3ASOH 1KEAA 3CWTA 2OTJN 4KMFA 1H88C 2DD4A 1K4TA 2ZPBB 2DL3A 4H5TA 5CQXA 4ASNA 4JEPA 1W6XA 3P8BB 1ARKA 1ODDA 3CPEA 4YEJA 4XK8E 4C8QA 3VYTB 3KK2A 4B48A 4X6AJ 2MPXC 1ETXA 2E5QA 3L09A 1RDBA 3HI0A 1JXBA 1H9GA 4BKXA 2K7LA 2KI7A 4WCGA 2F96A 1RKTA 6PAXA 2PFUA 4BC3A 2HYJA 2RE2A 5LLQA 1Q82R 3HYIA 3W2AA 2UXDK 4JS4A 1VQ8A 2ED0A 4HCZA 3AGRA 4H4MA 5F08A 2X6YA 1SSFA 2QSFX 4E3SA 3SDGA 4N9IA 2BV6A 2X74A 1Y8QB 3HPWA 1NZ9A 4S0HB 2RPNA 4XLCA 3O4NA 1K9MO 3S1MJ 2H6BA 1J5YA 4OMNA 2UV1A 1WQ7A 4CZIA 3JR9A 1M1EB 2A42A 1R1VA 5A2QO 1YW8A 2VJ5A 4BQNA 3PT9A 3KP7A 2NNYA 1MDMB 4A3JJ 6AT1B 5HRSA 2F6CA 4ON0A 1MMNA 5FPDA 2Z33A 2CT4A 3QICA 3SWNA 3HB9A 1YJNA 4M77B 1VQ5N 2DFHA 2DMQA 1OLTA 4HVUA 1CKAA 3FJPA 1ZAOA 2CQ7A 1D1CA 3E7LA 4KMUX 3G25A 5KNLA 1VQ9A 1LAVA 2R3SA 3NF8A 3QBXA 4M3ZA 2XVCA 2ETHA 1R5ID 1SG5A 1Q82U 4CZZA 4AI5A 1WFXA 1FBSA 2CH4A 3BG3A 2RI5A 3JCMV 1TL3A 3D7SB 2H8HA 2XAFA 5FGMA 2W82A 5H6RA 4RDUA 2CV0A 4U0YA 1TUGB 3TQ7P 3P7NA 2RN8A 1U0JA 2JZYA 2QASA 3U21A 1I3QJ 2L02A 1TAUA 4G1QA 2ELJA 3CJRB 3CPWP 4F17A 3HYFA 1QVTA 3ZQIA 3UWNA 3SK3A 3T1HK 4ZGJB 1YRNB 1K4US 4PDKA 4DG1A 1S9HA 2HWVA 1GFDA 3H5RA 1TNSA 2HI3A 4HLXA 1Q81C 5AQPA 3RR7A 5B8HA 2OZ6A 5B66C 3H3UA 3EYZA 1XSXA 5DDGA 2XAJA 2YJFA 2LKPA 4O0IA 3DWLE 1MBJA 4PKIA 3P5JA 2V8IA 1ORKA 1RTJA 1OI1A 1NNEA 1NBWA 3SEMA 2M7BA 1B59A 2QQ8A 4B4CA 3TAFA 4YFNF 3F9MA 2CSOA 1WI3A 4PJMA 1G3TA 1Z0XA 4CJSA 2EFWA 4KISA 3W3CA 4MZTA 2XI9A 1HBXG 2IBDA 4M3EA 3WTVC 4BRPA 2ZF5O 1UGSB 2FU4A 2VIXA 4ESJA 3PMIA 2B8AA 5GAMg 1YS7A 4OPJA 4UXNA 3KLFA 2E6ZA 4FLYA 1ON2A 1EETA 4E7KA 1A6IA 4X9DA 4XTVA 5F64A 1T6CA 1T33A 1KG5A 5EOYA 2F69A 3TO9A 1D5AA 3BZ6A 3V8KA 2FX0A 2E7XA 4I09A 1G99A 3V9SA 1KAZA 3BR6A 3MJXA 3W2WA 1VRTA 1CZAN 2NOHA 4GVEA 2MLGA 2K4BA 5AJ3K 3CCQQ 2L9SA 2CP0A 3AVCA 1D1BA 4Z0UA 4GGGA 4FJ8A 1D3BA 2D6FA 4NNJA 2A6EF 2E60A 4A3BJ 1OH6A 4B9XA 2HR3A 5EEAA 2YHYA 3ENBA 4OGCA 3A8OB 5FFXA 2HFHA 4W1UA 2VASA 3LSJA 2EJRA 2DL8A 1IO6A 2Y9ZA 4IFVA 5D6XA 1VQ4N 2ZD1A 4CZGA 1J09A 1FMVA 4D1QA 1R00A 5C4JJ 4PGGA 2DTOA 4J6XA 4FVUA 4CBUA 1LCKA 5D5VB 4B9TA 4BR7A 4O6JA 3SDBA 3O8GA 4RWTA 2XICA 4HVJA 3FGUA 3BTCA 3COAC 4BJTA 1YIJN 4RAGA 1XCBA 4CEZA 3S2DJ 4FW1A 1QLYA 1YJWA 4FISA 2KBTA 3DXMB 4FTHA 1N9SA 2EAYA 2X6OA 3QWLA 3B6CA 2PMZN 2NOFA 2DD5A 2CGKA 2YV0X 5KCMA 3CLOA 4B1UB 1YYVA 4AU7A 3F2KA 1X9MA 2BOLA 4MO7A 5JLWA 2D2WA 2WAEA 2LG4A 1L5UA 1IUFA 3S93A 4ZTJA 2F5TX 4IOAF 4C8QG 1L3TA 4CEEA 4O8KA 3QWXX 2ZJ2A 1U9NA 1BW5A 2HMPA 2ADUA 3TDZC 2QQSA 5D5UB 4RW9A 4ELZC 3VF4A 1C0TA 1Y96A 1RDDA 2BTFA 2STTA 2NLUA 4CESA 1Q95G 2EW3A 4M78E 3AGKA 2KRMA 5M9OA 3K0LA 5A0GA 3PIPL 4HF1A 3P4IA 2HBPA 2YLBA 4DSFA 3ZP5A 2IVNA 5FDLA 1P2FA 1S1VA 5HLHA 1BC7C 1RI9A 4B3MK 1NGFA 2JOYA 2HVRA 2IS1A 3R60A 5LJ5j 2IOCA 4X66K 1UFMA 1TKXA 4RBOA 3RCOA 4Y15A 1YO5C 2JTMA 2YG8A 2CSIA 4G6TB 1USSA 2D1KA 2HSTA 1JO8A 1SFKA 1XHXA 3HHGA 2QWPA 1U49A 5CR2A 1ZUUA 3MN2A 4CJ5A 2VG5A 3MN9A 2M9UA 3PVLA 3HBTA 4FLVA 4BRGA 1KD1O 1X2NA 1RFQA 4DW6A 3A03A 4QS9A 1LWFA 2VWBA 3GG4A 5LL6S 2D0CA 2MAMA 3I0RA 1ORNA 3REOA 4WQ5C 1LDDA 1OEBA 3KIOA 4Y4RA 2G8FA 4EDUA 4LF8K 1VQ5A 1HW5A 1R1TA 4BHBA 4ELYC 2L0KA 2LYCA 4LY7A 1WJCA 5L3FA 5IHKA 1WSJA 4BR9A 1TYQB 1B34A 3AA3A 1S1UA 2DA4A 4P9FA 4K0KK 2DPDA 5KGXA 3M56A 2NUPB 1RDWX 1TH7A 1V3FA 1PU8A 3S2HJ 2AHJB 1POGA 3VPRA 1NPRA 2FPDA 3K59A 2CFXA 4M3WA 4GV6A 1W1FA 3I0TA 3TEDA 2CH6A 1IAWA 1KQSA 2QG9B 3PO3J 1VQMT 3SJHA 4XBFA 2RQUA 3HOVJ 4CGIA 3FHZA 1ZYRF 3A2KA 2DL7A 2AIRB 2XGEA 4KT5C 4IZ9A 5KYWA 5A0LA 1X6BA 3PVQA 1AOJA 4BRNA 5SWMA 3DAWA 2XMFA 3CC2N 1TAQA 4NC6A 4HYEA 1ABQA 5J2MA 1IB8A 4B8XA 3HKSA 3WE2A 2X48A 3KZYA 1IUYA 5CY4A 2CUFA 1Z3XA 1M1KR 4B9NA 3NHNA 2E41A 4A69C 3G4SA 2VWFA 2A3ZA 4OP0A 5I2MA 2JJ9A 2R57A 2Y4XA 3UF4A 4F14A 4NCBA 1FKPA 3G6EQ 1ZQ1A 3PX0A 3VS0A 3QJYA 4M75B 3M0SA 1IC8A 5AQWA 4YFUA 1T6DA 2A3LA 3M8FA 1MMSA 2BZTA 3JCMJ 1LV5A 3CMAT 2YXYA 4WQ4C 2HZDA 5GAN3 4AHTA 1UHSA 2K79A 3NGZA 1YFNA 2HQEA 1YN8A 5HS7A 4IKFA 2NYXA 1TBXA 3CCRI 1K78B 2RREA 1VNDA 3C2BA 2EKHA 4RTZA 4K8ZA 2ZMEC 3M58A 5IP6A 3SCXA 4FLZA 1M1KU 4NQWA 3WTZA 1LE8A 3CCJN 2LMDA 3HUGA 4C92D 4DR2K 3VS1A 2V26A 1KC8R 4PFZA 4CFCA 5LD2C 1R49A 2L89A 3CXCM 3J7ZI 2ZNYA 5HCKA 4F7UA 3ERED 2RO0A 3VQ7A 1T44A 4C92B 2O5RA 2R7SA 1X1AA 5CKTA 2HYFA 4ZZLA 2O7OA 2MABA 2K9LA 4OMPA 4EIKA 3GBQA 4ID1A 2P6TA 4C8OA 3QOEA 2PU9B 1JHHA 3GTGJ 2FZKB 2J6OA 4M6YA 4JK7A 5GAHP 3PO5A 2ZJQL 2P9KB 1JTXA 3GYHX 2L9NA 2EZHA 1MBEA 4KO0A 1HF0A 2KQRA 4LFUA 1XJWB 5J26A 3O80A 1GDTA 3CCVT 1MJAA 1IV0A 1R77A 2NRAC 3THYB 4RUGA 5D5XB 1I4K1 3TP0A 2WFBA 4NS5A 3LP0A 2DFIA 1KC8U 1B72A 3BR2A 3S8PA 4ISGA 3R61A 1LWCA 1NE8A 3I8DA 4P55A 1XPXA 2DFUA 3CMEN 3HRTA 4FYYB 4QS8A 1BU6O 3VOVA 1HW1A 4R0KA 1T03A 1VQMQ 1L3VA 2PMZA 4BY1J 3E9LA 3ATVA 3RUXA 2Y30A 5GJVB 4E7JA 3RNJA 5JVGF 2HSPA 4DTMA 4CBXA 3M1CA 3T8TA 4F7UF 3K4LA 5E1XA 4HV5A 4QT7A 4FCYA 3HXMA 4RA2A 4JAXA 3RQ4A 4RGSA 2EYYA 1ZELA 2ZSHB 3CUOA 1HNXK 1JGGA 4KUMA 2PEXA 1UG2A 1B8IB 1XC9A 3E6CC 3F8CA 3I58A 1QQOA 3Q3SA 3CCVI 4J9EA 4J2AA 1ASUA 3C4SA 1U47A 1Y56A 1B6AA 4BGBA 4M7DA 1ON1A 5LJ5g 2FSWA 2VC0A 1EF4A 3VODA 5GAOr 4EZ6A 3CMAQ 2YRDA 4ENJA 1SKWA 3CC7T 2MF2A 4S04A 4DTOA 5TJJA 3WG9A 4NYNA 1K9MC 4QKUA 1BI4A 5HROA 2MMPA 3V7CA 2HHHK 2FBXA 1WN7A 3I33A 4QPQA 3ZOBA 2YPRA 4LG0A 3RZDJ 1JKQC 3V9UA 3P1GA 3LPUA 3TR8A 4DLEA 1MHNA 2R7OA 4N47A 3SXYA 4J9GA 4MIMA 3I3LA 4YIIA 4B22A 5CYVA 3QUIA 3DLLA 2IS3A 3QPTA 4BY6B 1X6GA 2AXLA 5C44J 3RESA 3JRDA 1LAWA 4HX8A 4MO4A 2YT6A 4BRCA 4JK9A 3P9KA 5HY6A 3TO7A 2HKXA 1TLHB 2NRTA 5GAEJ 1XQSC 3K5NA 2G8WA 1VQPT 1U1SA 4DBFA 1BR4A 2O8XA 2X78A 3QPSA 1GHCA 4JJCA 3K9JA 2HF3A 3HRSA 4HWIA 3UNGC 4ME7A 1IKVA 1H1VA 3U9DA 2Q0UA 3OYFA 2JT1A 1YWOA 4KULA 4M7DF 3SV3A 2IVMA 2HQHA 3L7WA 4W5NA 2NS0A 3KD5E 1G2BA 2KXDA 3VV0A 3Q0UA 1AHJB 3S3NA 2KRHA 1N9RA 4UC4A 3SHFA 2EJ9A 3N97A 4B23A 3K57A 3CC2A 3BTIA 3QG1A 4DR1K 1JXSA 5M3MJ 4C5GA 1S72Q 4BGAA 1GVDA 2PY5A 4AI4A 2DZCA 3SEZA 3DPTA 4BD3A 4CEBA 2JJ7A 5GAN5 5E3LA 1MIJA 1S9EA 3DLLF 4ELUA 4DSJA 1AZEA 2KT8A 4AFSC 1TL8A 1JLQA 3MVPA 5BREA 4C23A 3JW4A 3CCSQ 2OTLN 5K5OA 2QBYB 4M75C 1C1BA 5IOZA 2RHXA 2EHGA 2XDDA 1VQPI 1TUYA 5AQZA 2BE5F 1PC0A 2AQFA 1JJ2M 3QNNA 2HS5A 5AZJA 3MWPA 4BRIA 1TUUA 3RYPA 1JKPC 3VQ6A 2HOTA 1XUPO 2HQNA 4B9WA 3OS2A 4M77E 1WHLA 4BXXJ 2HOSA 1RI0A 2YHAA 4BQLA 1VFCA 5E26A 3ZQCA 3UB5A 3ZRGA 5IOYA 5HL7L 4P9UA 2VYTA 1WPKA 3AVFA 5LY3A 4HUGA 5KYUB 4Q0BA 4L5GA 1UZCA 3JRBA 2IRFG 3CCEQ 1M2VB 5CIUA 3CC7Q 3BZKA 1B4AA 3CCJA 3Q7CA 4B6MA 3VUZA 3HJFA 2MA3A 3NEUA 4HZFA 4JLHA 4XRSG 3T69A 4UUSB 4EP4A 4L8RB 3QETA 4IRGA 1E0EA 1YHQI 4PHTX 3GP8A 5FKNA 2CWEA 2R92J 1XTDA 1WSGA 5CKDA 4Q5SF 4JV5K 2WOMA 2W85A 3EYIA 3M8SA 4KHYA 1HKGA 4MTDA 1MH3A 3E66A 1ZC6A 3KPHA 2E88A 1XI1A 2A37A 1GLDG 2CGJA 4B9SA 1ZLMA 2CW7A 4UB8C 2K3BA 4EMKA 1VQPQ 2C0TA 4R8HA 2KK4A 1T0JA 2CH5A 2X35A 3WXJA 3BROA 4IDKA 4L0YB 1EQYA 2WBNA 3CJ9A 2ZCFB 4UV8A 5LHGA 4XLHA 3EUKL 4FZXC 3C6TA 4OFHA 3OW2M 3DRPA 4N4IA 1AWWA 3GL1A 3CMEA 1VQKQ 4AF1A 1WCMJ 2RDPA 1N34K 1QQNA 3SHWA 3CWUA 3JCUC 4JI2K 3I59B 1VQOT 1Z7UA 4I2OA 4ESBA 5KPZA 2QWWA 1M90O 4HRIA 4MEXF 3G10A 4IRIA 3OV8A 1AWXA 2MW8A 3HSEA 5CHIA 1RAAB 1MPGA 3BP8A 4DZPA 1NOYA 3MN6A 3OH9A 3HL8A 1R36A 1AWJA 4D0PA 3SJMA 1DDNA 1IHWA 1U6ZA 1T05A 3QZ5B 2K9GA 4YFKF 4N56A 4KV8A 3CEYA 3OYBA 4IIMA 1JCFA 1SD6A 3S1RJ 1YI2Q 4CJKA 1TW3A 4QQGA 4FOEA 2MH2A 3DTKA 1IKWA 3VQ8A 3KJVA 1AEYA 5DK5A 2K5FA 2JPCA 5KGWA 1NPPA 1TUCA 5I11A 5DM7L 3KP6A 4Q5VA 3RYRA 4MZMA 1Q81R 1TTHB 2XRIA 5EXWA 3WXIA 1RUNA 1NJIO 5F1RA 3SZPA 5DYMA 3CCUT 3NF7A 1PUFB 2NRZA 2LBFB 2GF7A 2OJ2A 1PP7U 3GX4X 2HNYA 5C4XJ 1KD1C 4R5PA 4A61A 3F0ZA 2HQAA 2ZFWA 3LDNA 1Q1HA 4X62K 1VQOI 5DUIA 2Z1GA 2R7YA 3OL4A 4DBQA 1Z9CA 2JMAA 3M5AA 3G71N 4BY6C 5CKFA 1WJBA 3JRGA 1RETA 1NG6A 1FWZA 1AWOA 3L1AA 4JRPA 1ZLJA 1GLAG 1YLFA 4CHZA 4QCLA 3QEVA 4C9YA 2M8GX 4WTOB 2NRVA 1D5YA 4D8DA 1TUDA 2RQVA 3I56T 1YQRA 2NLXA 4OVLA 3HXLA 4YPHA 2LQKA 4AIKA 5D6FA 4RLFA 4J00A 2YHXA 1K73O 2VJJA 4RAFA 1ZSZA 1Q81U 1TVRA 2L7KA 2LMJA 1VQNT 1Q82O 3D0SA 3DXKA 3O8MA 3FXOA 3ISPA 5HNHA 1E7OA 2QTDA 3QODA 3ZSQA 3WGIA 3H9GA 1G3WA 3GTJJ 4FYWB 2EBIA 2E34A 4CEAA 3NFCA 4XTXA 3WT0A 3FXRA 1G5VA 2FHDA 3C7JA 2VKEA 2LKXA 4PUSA 1SVMA 1X4OA 4KHQA 3BPXA 4JJBA 3SB2A 3E0JB 4XLAA 4XIUA 1CF7B 2Q2EB 1YJ9Q 2XU8A 3O3GA 1LPQA 2QKKA 1FLIA 1HNVA 3NCIA 1ATNA 4FVMA 3JSPA 3E2UA 3CD6N 2MC4A 1RIOH 1TKZA 3HBLA 3DP7A 3I56I 2OTLA 5TKYA 1I6HJ 1XGOA 2E36A 3LWIA 4E7LA 1MA9B 3U6FA 1KU3A 1CXUA 5AZIB 1VQNI 3L2WA 3WE3A 2RQWA 4S05A 3EFOB 1JKOC 2OC6A 4DGWB 3FX3A 1PKTA 1USTA 3AVMA 2XY5A 4NL2A 1NGBA 3ULEB 1Z6TA 3AVAA 3FR0A 2H56A 1U6GA 4LIVA 1W97L 1MSFC 3BW1A 2K3PA 3CUQB 3OW2P 2IXSA 3ZN0A 1W7PA 3SQ4A 1E3OC 1D0XA 2STWA 5M5WJ 4FWSA 2X9DA 2P51A 3PV8A 4EMGA 1PU7A 1JXEA 2O8KA 2QENA 3H92A 5AYFA 1IN6A 2ZXHA 3CCUQ 2DJNA 2H3GX 2V6CA 2DPUA 3CC4A 1NMNA 3FFIA 4PLLA 3VMFB 4PGHA 5I9EB 4CIFA 2VI6A 3GZ6A 5EGOA 3CDIA 2ITMA 1XTAA 3HFNA 4CJQA 4F8RA 4AFQC 2DBKA 2RF2A 5EC7A 2Q31A 1N33K 1GV5A 4MDWA 3I53A 3LSGA 2R5AA 4J9DA 2ZPEB 4HF0A 4RW7A 2K3YA 1FT9A 1LW0A 1K61A 3TSZA 3I56Q 5GIPA 2O4IA 4MMLA 1PDNC 2QCOA 2Z16A 2O4XA 2XUBA 1SC7A 1KRPA 3PIOA 1S5LC 3F6OA 4F2SA 1EH7A 3S15J 2JT4A 2F5VA 3GUDA 3JTHA 3IV5A 1OU9A 4M75E 1VQNQ 3AFHA 5CVIA 1V4SA 1TV6A 5HKCA 1QVPA 4PJOB 3SYZA 4C8KA 2A5YB 4LFAK 4OFEA 1VQ8T 4L9NA 2YUPA 4B1WB 4BJ6C 2LY9A 1BIAA 4XAXB 3GFMA 1Z26A 3AVIA 1UGPB 2RI3A 1H641 2YLCA 3QDFA 4I6MA 1NMDA 1KQSP 3BGRA 2VXDA 3GOXA 4OKKA 2E6LA 1QPMA 4H0VB 2CZ1B 2RNGA 2QM1A 2DMPA 4ELVA 4H5NA 1FMKA 3VQPA 3EG1A 3THXA 1N36K 3JTGA 2VE9A 3JB9D 4U0WA 4GCVA 5L8RE 4IHYA 3EG9B 3JCMh 4KNYA 4KTQA 2CH0A 1V1CA 4Z4FA 2X6SA 3BDLA 4B3AA 5B3SH 4J9HA 4XTZA 4HUEA 5AQUA 2F8SA 3O3KA 3BF3A 5CO7A 1VF9A 5LRSA 2G0EA 5IT9Z 3S6IA 4AMCA 4GY5A 3K70D 1P7IA 2O8FB 4LMYA 3K0SA 3VRYA 1MGQA 3VEPA 2HB5A 1B3QA 5F6FA 1TWFJ 3PIOF 2A69F 3OWTA 3BG5A 1VQ8I 1GLLO 3F8NA 5LGNA 4OKJA 4OF1A 3X28B 4E7HA 1J2XA 4B1VA 3GTQJ 1PSEA 3S9HA 2ZNZA 5ILUA 3CCLN 3UDCA 4BDYA 4H0XB 1XMOK 2A61A 4RKUE 3G71A 2YG9A 4DR5K 2G8UA 2ZFUA 4AFZC 1G4DA 3IWFA 1E6GA 2FNPA 3ZT1A 4IOAL 4L5JA 2OZUA 1LOJA 1SS6A 2HNDA 2ROLA 2G3RA 1NGCA 4I7HA 4B21A 5GANd 2LKSA 2IEKA 2Z5UA 1QCOA 1JCGA 2JRTA 2YX4A 1DGKN 4FZZA 2LQWA 1WXBA 3S17J 4QAGA 1YITN 3TSUA 1M3QA 4DR3K 2OZSA 4ILJA 3GNFB 4CCHA 4CVNE 4BC5A 5FRNA 2YUOA 1M1FA 4Y13A 2HHVA 2A5WA 2PVGB 2P9LB 2QEXI 4G7OF 2E2PA 3E97A 3DU6A 3M53A 3NARA 5IPAA 1R0BG 1M2OA 3OQ5A 1ASVA 3L2RA 1LW2A 4CJLA 1SL1A 3CCRN 2LSOA 1CGPA 1SEMA 1TWHJ 4P96A 3U4LA 3HM5A 2BYVE 1QP3A 2FB7A 2OAUA 2EIMH 2RQTA 1OX8A 3M4YA 3TABA 2ESWA 5LMNK 2VXEA 2L9RA 4ENKA 1QVGM 1FNNA 1SD4A 3F8BA 4EMSA 2V1RA 4CHPA 1X2MA 3WTTC 4OX9K 4H5WA 3RSEB 4IOCF 2NOLA 2DA1A 1WI7A 1Z67A 2P9UA 3CD6A 4KTWA 1QBJA 3EAEA 3BLYA 2DMUA 5J2PA 4WFBL 4E1NA 1XX5A 4ZC3A 3FXJA 3H8ZA 3RMDA 4LB6B 3HPOA 3M1EA 3OYGA 2JG6A 3VUBA 4BROA 3CM6A 4GKKK 2VQCA 2HW3A 2CGLA 3K9KA 1YJNQ 2JPBA 5FU7B 1KYWA 5LJ3d 3E5XA 4BE0A 2FO0A 2HQRA 1MWMA 4B3TK 2DQLA 5LRRA 1VQ9Q 4YRVA 4JKCA 3H0DA 2NUTB 3CUQC 3IH4A 3GOIA 4XK4A 2YNGA 5GAOp 1HDPA 3FJ5A 1FOXA 4LH5A 3EGXB 4RCHA 3EUHC 1PD0A 5D8LB 4XR6A 4DMNA 3VKIA 4NLCA 1HKSA 2LSNA 2L3DA 2HBKA 5AQGA 4E89A 4G9YA 2O6GE 2HPIA 2DFFA 3CJAA 3DOKA 1IZ6A 4E4HA 5IT9E 3M54A 2F8TA 3NWTA 2BY2A 4ZHRA 1CXQA 1ZGWA 1ENHA 2EIKH 1UWBA 1R71A 3LWLA 1NGHA 2IDOA 3KZZA 4NYFA 5CQYA 3WEEA 4QVCA 2NRHA 2OBPA 4ZJZA 1PU6A 3LYIA 1A5WA 3MXJA 5FD5A 2NVTJ 1BDGA 3JCMe 2JNGA 2ASPA 4DQ2A 2HBMA 3UT1A 3BG9A 4P5NA 1QSLA 1QVUA 2OX7A 1OCZH 3K2ZA 4I0AA 3DEEA 1LWYA 4P1WA 1GLBG 4LGWA 2OTJT 4C92G 3PMTA 1K9MR 1VQ7N 2CS7A 2OA4A 3DKYA 1AD5A 1RBVA 4XOPA 2VKVA 1FZPB 1QE1A 4BRKA 3TU4K 3AVNA 2I0NA 1C1CA 2I7PA 1MJBA 1LWWA 2OFKA 4OAYA 5LFAA 2DYRH 3UKGA 1UDLA 4PJOC 1KC8O 1HK9A 4JZ4A 4M3GA 3REBB 2COYA 4V2FA 4PL6A 5M1QA 2Z1IA 3DLEA 1SL2A 1M90C 1OISA 2M1BA 3L2UA 4FM0A 3Q0VA 3RDVA 4CGJA 2DILA 5GANg 3ZSZA 3LAJA 2EFOA 4ID5A 3THWB 4IFYA 5AQLA 2A07F 3ZETA 3J7AP 1WSFA 3QWYA 1BUPA 4CGFA 2O9VA 1BOBA 4M71A 1S7EA 2GFUA 3V1OA 4FJ7A 3LA3A 1GUUA 1S1XA 3I71A 4Z4GA 2E8AA 1X27A 3OMCA 1K9MU 3G0ZA 4PZJA 2QSGX 5AQYA 1GXPA 1IRXA 1TTYA 2XRLA 4YIRX 4N0BA 2LD5A 2P9NB 3MPUB 2KZZA 2IS4A 4M7AB 3HOYJ 1VQ5T 4OOIA 4EV0A 4J2DA 2P9PB 2OTJI 2PUOB 5AQVA 4BL0B 3IHUA 3ENOA 1NKCA 4BXUA 1E3PA 2XIDA 3U2RA 5E1WA 1HQEA 1RR7A 3C2GA 4IL6C 2X6NA 1NJIC 1W36D 3K2AA 1O7LA 2ME0A 4CHUA 5IT9K 1BGXT 5DPKA 3I35A 2FPFA 2V1UA 3VEOA 2KYBA 2VGMA 2V51B 4J9FA 2NRXA 2JMWA 5BMZA 1R23A 4AIDA 1X9JA 4EJWA 3KLNA 1IBLK 5CR4A 3ZQ7A 3ATUA 1TU0B 1KFZA 2W41A 5K5QA 3EUAA 5GAGJ 3E1SA 3M0UA 2ITGA 4DSIA 2FOKA 1KFSA 3MX5A 4Z4EA 4XTYA 3IH2A 1HYOA 2ELHA 1RAIB 1SUQA 4O8UA 2G8VA 5JVGL 4XNFA 2I10A 2X4XA 4Z88A 3CCLA 2DF6A 1QVGP 5J3LA 1SV5A 2RHYA 1SFOJ 5CVUA 3V4IA 1UTIA 1YJWQ 2M8EA 3CF2A 4CA0A 1IV8A 1XC5A 5GMKi 4GYIA 1EZZB 5LJ3g 3BQZA 5BNGA 2MC3A 4EJUA 3PO2J 1T38A 1K73C 1IDZA 1Q18A 5AQNA 2BW3A 1K9AA 2CKKA 2MH9A 2CP6A 3HG9A 2K7AA 2NS8A 3FM5A 1UB9A 1IG8A 4OMYA 4KI4A 3GE1A 4QTRA 2QDLA 1HU0A 1YITA 3C2HA 2OJED 4C2TA 2FRYA 1MWKA 4IZZA 4R55A 5GAOl 4AG1C 4DTSA 2O8CA 2E5NA 2A28A 2IS2A 3TANA 2PX9A 1VIEA 1KU9A 4KBMB 5HK3A 3SZ2A 5E41A 3E01A 2M45A 3MN5A 3LANA 2KNBB 1AKHA 3QNOA 1E17A 2HHUA 1BB9A 1WFWA 1FKOA 3FXUA 2MCNA 1IZ1A 1UHCA 3RTVA 4EW0A 5HLTA 3CCRA 3M3YJ 1RI7A 4JI7K 1EP4A 1Z7LA 1GLNA 2LDMA 4CJFA 2E1MB 5KE2A 1MDMA 4YNQA 2VGNA 3CJCA 4KA4A 3QBYA 4F91B 1F5TA 1ZN2A 2OPPA 1HSQA 5HS8A 3RIRA 3OIQA 2GAUA 1VSEA 3QEWA 2ATCB 4C0FA 1SHGA 4OMMA 4D6WA 4I0BA 3K4NA 4J8OA 4BI4A 4WQ5A 4CJWA 4PA1A 5C12A 1FY7A 4JLIA 3C3WA 2Z99A 1MD0A 4Y33A 3GTPJ 3TREA 4U7DA 4HAMA 1Z91A 2P5OA 5HBMA 1YHQN 2KFZA 1BYMA 2E35A 4MNUA 2MOXA 5FU7C 3ZQQA 4YOVA 1J54A 2IAIA 4JKFA 4GO1A 4CJUA 4AC0A 1NK7A 4BB7A 1JRIA 1UJYA 3MKYB 1VQ5Q 4FT4A 4XORA 1VQ4T 2LNVA 1GRIA 1OCRH 2NVQJ 2GA1A 3OSFA 4RM3A 2ZGZA 2VKHA 1G3SA 2BVLA 3IP4B 4JBAA 2JUGA 2PZ1A 1D5VA 2IGOA 1RBTA 3TW6A 4I2PA 2D5VA 2M9HA 3O6WA 4CK1A 1Q9YA 3LM2A 1WEGA 1YRNA 1YIJT 2E19A 1ESVA 4DFKA 4CRIA 2O4GA 5JVTA 4CJ4A 2QGUA 4ZDPA 1HSJA 3N4PA 4I2QA 2R5ZB 4ILHA 4KREA 4BQZA 3DLLL 3FBNB 2BKDN 2SEMA 1T8IA 3EG0A 1SFUA 1PHTA 3WNGA 4BNCA 4C8QB 3ZBDA 1RTHA 3RPQA 5M1FA 3JCMf 3MK6A 1T95A 3K4KA 1BU1A 1N39A 2IVOA 1WX6A 1JL2A 2P0QA 2EYWA 2X4YA 2X1EA 4KHSA 2XB0X 2B63J 3DBLB 3OY9A 1MV3A 4FM2A 1J53A 2KDOA 4KAZA 3G4SQ 5D6WA 1FX7A 2R7ZJ 4JOMA 1VQ4I 1XSDA 3C7NA 1RCHA 2M0YA 3TAEA 1KD1R 2IGMA 4XU2A 4M41A 2VJ4A 3NF9A 3ZMSA 1L0OC 3CCVA 1EWQA 1W2BM 2EGEA 1STZA 5M1OA 3VQ9A 2ZMEA 2JVHA 4GBQA 5K1YA 1YIJI 2JZ2A 2YDLA 4FSVA 2RQPA 2GV9A 2R5MA 4NB5A 4FSXA 1EFNA 1LKXA 2LQNA 1KG7A 5KTQA 3H1VX 1WSHA 3LPTA 2ZM6K 2DETA 4DTJA 3HGYA 3EEQA 3TSQA 3GPLA 5A2QZ 4DV4K 2VV5A 1V29B 5J1RA 2ECCA 4EA5A 4H5RA 1WJAA 3GFJA 3META 3KFVA 1KHCA 1A04A 1JLAA 3LL3A 4QS7A 1BL0A 3MKZA 4B1XB 4DA4A 3HIFA 1P4XA 1SRMA 3C0CA 3MMVA 3HC7A 1FP2A 2LVSA 1PP8F 3WUHA 1G83A 2W10A 5IY5H 2OD5A 4DQ8A 1KD1U 2BH1A 3VYUB 2V1QA 3IHOA 3HOZJ 3GF2A 3TW7A 2AA4A 5AQQA 2JA2A 2EJGA 1WSIA 3L2QA 2HHQA 4MLHA 1OQYA 3VEZA 3AHUA 2CT3A 3VA0A 3GZ5A 4IO9L 5AQIA 4ZYDA 5D4SA 1WHHA 5FLXZ 3O4WA 5LMUK 2DY4A 5JS2A 1NWKA 1KU7A 4JRIA 5LHHA 4EHUA 3K4CA 3GFLA 4II1A 3MEAA 1E6HA 1RBSA 4LLGF 2XSJC 4IVNA 3HTVA 3E6DA 2LZ6B 4OB2B 4ZTFA 2MWOA 3O08A 2QW9A 1CQTA 1UECA 3DXMA 2YCHA 1QVFA 1ZBFA 2HOAA 3O8VA 3KYDB 4XH1A 1FK9A 2ZB9A 5EDNA 4KT0E 1D9FA 2BVMA 3OYIA 3HHHA 1QHHD 4IEIA 3CC2T 2ZBKA 3DOLA 4XU1A 2RJEA 5GPAA 1R1UA 5GAMh 3ZR8X 2RQRA 2L3SA 4PJOE 5E3OA 4BRMA 1WOQA 4BWJA 4IJNA 2UU9K 3M8EA 4EGZA 4PJNA 3NGPA 1ZUKA 3D5LA 2K4YA 4Y92A 2P4RA 4B9MA 1TKDA 5DEQA 3AA4A 5FW9A 5GAN6 1VRUA 1MBHA 2OV7A 4YIFA 4BWMA 4EQQA 2L7ZA 1QKWA 5J1EA 3F23A 2BGGA 1GBRA 1J59A 3LWHA 3CCQN 1RABB 2UUCK 1DT9A 1Q81O 2F48A 3QOPA 1XHZA 3BY5A 3LFUA 5KI6A 2K3FA 2RHIA 3CLQA 1B9NA 4BBRJ 2NUBA 3MCAB 3OL3A 5C10A 2CJJA 5J6XA 1BWFO 4O5VA 4UHTA 4WF2A 2GOMA 1LVAA 1S7OA 2W25A 4CD1A 4Z89A 3OYAA 4M3XA 3QJ6A 1E4FT 3ELKA 4XRMA 4DJAA 2FSNA 3D2FB 3H5AA 1WSEA 2WY8Q 3J80K 5GMKh 3CCJT 5KN8A 2DT7B 2DMTA 4D5CA 2JRMA 1RGIA 3HZJA 5CJ9A 1H89C 4D7MA 2DA9A 2L4AA 2DA5A 4J83A 3WXKA 2JUFA 3HZ6A 2FZGB 1TG0A 1N77A 4BR2A 1RESA 1NOZA 2LRQA 3VSKA 4HPQA 3V9WA 1YHQA 1QZ6A 4F93B 4OFAA 3RKYA 2YR2A 3SQ0A 4KH4A 3EKSA 4JKGA 8ATCB 2GXAA 3KTQA 3JREA 1HKQA 4RTFD 2O8EA 2DTZA 4XKBA 1TT0A 2YSQA 4DFPA 3ABMH 1I8FA 4PL8A 3KLGA 1W2BP 3SZTA 1Y7XA 1YT3A 2HVIA 4CDGA 4L18B 1JU5C 4JI3K 4EGYA 1Y64A 3T5XA 3DTIA 2Q1NA 1WAJA 3N4MA 5IXFA 1KVCA 2KSSA 1U1TA 2KZGA 1J6ZA 1Q7YR 3WQUA 2OQRA 3CMET 2CZ7B 4I98B 2QKBA 1W0HA 3DF8A 1SFEA 5DCFA 1MU2A 4EIAA 2R7RA 3S2WA 5HVQC 4KIFA 5ICFA 4WFAL 2EZIA 2E1OA 4X34A 2K86A 1UE9A 4C8QC 2VC8A 1Y96B 3CC2Q 3FM3A 3KEQA 1VTNC 2HD0A 5TGTA 3DB4A 2EQMA 3CXCS 4BR0A 1I1JA 2OFIA 2NS7A 3LH0A 4CGHA 4NLBA 2PAVA 4JKAA 4OPAA 5IHNA 1FSEA 4R1HA 2F4VK 3T0YA 3ASMA 2XY7A 2XF6A 4DQIA 1IN4A 1SAZA 2NAZA 1JLFA 5BPMA 1OCPA 4FQGA 1I6XA 1LCUA 3H36A 5DLOA 5IN1A 1SKSA 4D9JA 2ZQBA 4JK1X 1DKGD 1S29A 5LBQA 2IJLA 4KUIA 1WH7A 2DA7A 2DNUA 4DFMA 4LSNA 5GAN8 2KJCA 2W40A 3O2PE 4FK2A 3L42A 3PTAA 2PFBA 4LK0F 4CFAA 1XGMA 3ITHA 2EFIA 1HSTA 2RN2A 4IFEA 3ECHA 3ONQA 1T39A 2FVUA 4DFJA 4XLNF 4HNUA 3A5OC 2XKOA 2MWPA 5GAMe 3SFIA 2RGVA 5AN4A 3U23A 1WA7A 1U48A 1YOVB 4FSSA 1B34B 3DM2A 4BY9C 4FL6A 4H5VA 5A2QK 3CCJQ 4PFPA 3HTUA 4UNFA 2QDYB 2V8KA 4ISEA 3NHGA 1X2QA 4A3FJ 4IHSA 1BJZA 2DRKA 3LSRA 3JRAA 1PRLC 4JDSA 1DTTA 1OU8A 3O3FA 2WY7Q 3ZMUA 4M75F 1YTAA 5CKBA 1NYFA 5DM6F 2BE2A 1U5TA 3N4QA 3L0QA 2QWQA 2UXNA 3IRQA 3UPUA 5KYWB 3ASKA 1LEAA 2QGGA 4AM7A 4FE4A 5FLXK 4A6DA 2YNHA 3I4MJ 3KK7A 2EQIA 4K2EA 2B5JA 2E10A 2KKOA 3QLHA 1K83J 3QIPA 2PLYA 3T9NA 3G6EN 2P9IA 3L3UA 1WHGA 3ZEUB 3SUQA 4J9CA 3JB9G 2NNNA 3PSIA 2QK0A 2VT2A 5FKLA 1T08B 2K9NA 3FMSA 3VRZA 2EK5A 3E9OA 2BDPA 4CZJA 4HXJA 5GMKe 2QEXN 3ESWB 1HR0K 5E20A 2KL4A 3KBGA 3VFZA 4GY2B 2GWJA 4JD2A 5CKHA 2JM9A 2DT6A 2CP5A 2DTUA 2QTXA 2L01A 2PZSA 2AQEA 1E4GT 3CMEQ 5BR9A 2C06A 4CCKA 1BOAA 1W0UA 1Y97A 1JGSA 4OIQF 3TOBA 4C8NA 3H6EA 2VC1A 3E3VA 4BRAA 1W5SA 4JPBW 4KUDK 3F5TA 5AQJA 3BOQA 2OTLT 1WZOA 3HRGA 2AZVA 4RMOA 3TEEA 4F16A 1LVKA 3KKSA 1RDCA 1Y39A 4NQWB 1ZKGA 4QVDA 2B4JA 5CQGA 1ZBLA 3EQLF 4GV3A 3HUGB 3PIOL 3RMCA 1QO0D 4M7AE 4WX9A 1M27C 2EPDA 1DU6A 4LH4A 1TL1A 2EFPA 1C6VA 2NYSA 4FPAA 1KZHA 2ZPGB 4CBWA 4CCLA 3VU3C 4Y1DA 2EVRA 3FZMA 9ATCB 4JUVA 2BXYA 3OSSC 4WCIA 4M3TA 1YQKA 2Z3YA 1W5CC 1NK3P 4YFXF 1LNXA 3BDDA 4RMNA 2Q0RA 3GBTA 4LDUA 4XN0A 4Z4HA 4LXCA 1NK4A 4L3QA 4RTUA 2LVMA 5GAOq 2AP1A 3ZX3A 3E5UA 1IO2A 5FJ8J 4WXHA 3CPWM 3JCMb 2ZJRF 2D0BA 3R3LA 2M34A 3V7RA 3KXTA 4A3LJ 5HP1A 1WYXA 1VK0A 5BRDA 2ZZDA 1MUYA 2VPRA 2JWKA 3VEWA 1ACIA 3FWEA 4DV6K 4GFBA 1SVLA 3FLGA 2OTLI 1B72B 2KR3A 3QEIA 2FBYA 1SZ2A 4YHHK 4M78C 4PLIA 2DIGA 1U78A 1Q86C 3TL4X 4FX0A 3ID6A 2KRCA 5D8KB 3I9QA 4UVAA 2LNBA 2RF0A 2LJ0A 2CO5A 2CSQA 1M90R 2QWRA 5HNFA 2LRDA 3QXEB 3ZX2A 4BYYA 1YW9A 3JSMA 4AT1B 1JJ2S 2DK3A 4B44A 1S9GA 4LN2A 3FHGA 1GL5A 3WTSC 1HKBA 4C5IA 2WV0A 1RACB 4OIRF 4BUGA 4Q5WA 2FF6A 2R58A 2DXCA 3VS6A 4HA8A 5LJ5h 1UAXA 2XPUA 1WXTA 4OKEA 3VN5A 3J81Z 1HOMA 5IYCJ 2H8RA 2RH2A 1IXRC 3UKRA 3TSPA 3D7EO 4M7DD 3GEZA 4IOCL 3FSPA 2V1XA 2LP5A 1X3MA 2IG0A 1QSSA 4IG3A 4M7DB 3E9PA 4LDVA 4FWRA 3F6VA 5CE3A 2A5XA 1WBBA 4CF9A 3L2ZA 1XCVA 1M90U 2WV1A 4AIJA 4CI0C 2NRWA 1WLPB 4W97A 4AILC 2KPMA 2PNIA 2HVSA 5GAMd 4XONA 1S3XA 2XF5A 2YI1A 3D1NI 3DQVC 4A5MA 1P4AA 1KAXA 5FWBA 3GLXA 3Q7BA 3KD1E 2H09A 1B9MA 3QEXA 3E5QA 2QQAA 2OTLQ 4LG0B 4A0YA 3IRRA 2JS2A 1FXXA 1WJFA 1NJZA 1YQMA 2ETJA 5KYUA 2IW5A 2HKNA 4HLYA 1RTDA 1TOVA 2VG6A 4JYAK 3QSUA 4IQ4A 1XMQK 3LL7A 3C12A 2RV8A 1SD5A 2W24A 4I02A 1KJWA 4OWRB 1L3UA 1K73R 1BQMA 1NJIU 2QGFB 5GAMf 4LSLA 5KAIC 4BEHB 4UOBA 3OW2S 2HHXA 2GTDA 3G71T 4BGDA 4DYRA 1RZ4A 5CQEA 3QRFF 1ZBHA 2J5PA 4NHJA 1RPWA 4RG8A 4KT6A 2BZXA 2M87A 3HGGA 3O5ZA 2XRNA 3CC4Q 3K1MA 4E9HA 3BR0A 4XN3A 3WU0A 1QRYA 3CYMA 4MDXA 2GWKA 1YG2A 3I55N 3BF1A 2GQQA 3H9QA 2WAFA 2CG4A 1MNEA 1ZRDA 3CWAA 3PNYA 4AHVA 3CQXA 1S72N 1VYVA 5GAHJ 4WF9L 5IT3A 3M7GA 3DFGA 5AQKA 5BPLA 4FIBA 4NO7A 5LEKA 2O3FA 2BBYA 4C8QE 4WYBA 1HJDA 4AHRA 2BE7D 4KBOA 3VETA 2EYZA 1C1AA 2CREA 2OANA 3ZEHA 3CCSN 3TCJA 4LD5A 1K73U 2YRCA 4M7AG 4YELA 4FU6A 3QP5A 5I22A 4DOWA 2VWKA 4EHTA 2PN6A 1KA8A 1SL0A 4EJTA 2PG4A 3EDPA 2QEXA 2KP6A 1BCOA 4GW6A 4KJZA 2FA5A 1OQKA 2P81A 4IEJA 5CKEA 3CQYA 3ZCMA 3G71I 4AM3A 2BZYA 5AZJB 2KRSA 2P5VA 1FBQA 2QXFA 4IDHA 3OJSA 4O55A 3A5LC 4IF4A 3CCEN 3EE9A 3K10A 4RB3C 1S3JA 2W00A 2DX1A 5L3GA 1ZSGA 3RR6A 3CM5A 2YRVA 2K85A 4W5RA 1W9HA 3CO7C 4ZYHA 3MMYB 3CD6T 2VCPA 1FJLA 2GM4A 2W48A 3VQQA 3DCFA 2E71A 2A6AA 3PGGA 1OH8A 4OPHA 4ILGB 4AVPA 5ECAA 3AVHA 3J7AY 2LY2A 3VS5A 2GXBA 3KWGA 3R8EA 3ZT4A 3L2VA 1OMIA 3HOUJ 1IN5A 4HDUA 3QZ9B 4HW0A 5J3BA 3DMJA 4C30A 3SMPA 4CFBA 1E2XA 3H41A 3VQCA 4LDXA 3U8XA 3OR2C 4NCAA 4HCKA 1EH6A 5J4VA 2FMYA 1XMXA 3FXLA 2GLOA 2Q97A 1F36A 1IDYA 2O8DA 4V2SA 3W6JB 1T2KA 4MZPA 5KH6A 2RD1A 1P9QC 1J75A 3K2PA 2KMUA 3AG1H 4FYDA 4HHTA 3AG2H 1QCNA 1VQKN 2R7QA 4HCCA 5ADXH 4EMKB 2P0KA 3S32A 3ZQFA 1HYVA 2G9WA 3CD6I 3G71Q 2JVGA 3IFRA 5L3DA 3MAJA 2DE0X 1T98A 3BCAA 2ID6A 2FG0A 4ZYGA 3C18A 2X6XA 2LCLA 2KRFA 1AOYA 4FLWA 3V9ZA 4BDZA 1JUPA 4OVAA 3MKDA 3WTXC 2YU3A 1NM7A 1EJ9A 1H92A 5JMVA 3HVRA 2X4HA 3V8JA 3SYTA 2JVVA 4XQ3A 4BRQA 4F2RA 4LB5A 3WODF 1Q8IA 3SAHA 5D4RA 1IG7A 3AAQA 1BBYA 4H0YB 5F0FA 3CFOA 4CECA 5GMKm 3LALA 2QYZA 1PJRA 2K9QA 1HCRA 3OBYA 4KN7X 5I2SA 4Z6YA 5JLXA 2ZSIB 2QYOA 2E4HA 2H8WA 2KAFA 3J7YP 3T8RA 2PQWA 1ETQA 1YI2N 3KZBA 3ZL7C 3CO6C 2WTUA 2RNJA 2JK3A 2DEUA 1ZH5A 3O3HA 2Q2EA 3MWMA 3SMSA 3SI6A 2QZ8A 2UXCK 3J81K 2Y9YA 3FZKA 4BY7J 2WC2A 2H3JA 3ASNH 4K11A 2QTVA 2EZLA 1VZ0A 1BR2A 4BC2A 5K7FA 2GIZA 3V8LA 4X1VA 1ZBIA 4CEQA 3R1XA 3TOAA 1C0WA 4DQSA 2F1LA 1XGNA 3MKWB 3HP6A 4CE9A 1I94K 4DU4A 3LA7A 4GXOA 1Z1DA 2G8IA 2DOEA 3CD6Q 1VQLN 3CF5L 3ULDA 3IH3A 5LGUA 3RSNA 1V5EA 2OTJA 3CUQA 3GLLA 4A5BA 4Y0WA 4U88A 3ZSYA 3P83D 2LCSA 3CFRA 1KO9A 3EUHA 3BY7A 4DS4A 4X9CA 2CS3A 1P6RA 3KK1A 2FNAA 2DTRA 3IUCA 4JN4A 1I50J 3V7SA 3ABTA 2DVJA 5HLGA 5E79C 3HOXJ 1REPC 1FEXA 2W04A 3CCLT 2UUBK 3OYHA 5GMKl 3KVGA 1IRGA 1D0ZA 4YOWA 3VTIA 5CYQA 2EFQA 3ZCOA 1ONVA 4N5SA 4A3IJ 3DXKB 3BZCA 4PUOA 2DXTA 3I55A 1U5SA 3RERA 1S72A 2OAZA 5EG0A 5GP9A 2JHJA 1YJ9N 5KYXB 3PM1A 2O8BA 3GXOA 2RNAA 3N5NX 3HKZN 1N75A 2ID3A 4M77C 1YITT 3MFKA 2DCEA 4KIBA 2EWSA 3PX4A 4WK8F 1NJYA 1J7KA 3R0JA 3VDXA 1Y0NA 3INZA 5IH2A 3UA6A 2ME6A 1UJ0A 1GV2A 2BUPA 4EJZA 4I9QA 2R0QC 4DUYK 4OIPF 2KDSA 4ZGDB 2BHYA 2EV6A 5DCMB 1MUDA 1SF9A 2DVEA 3CVTA 1HKCA 2LREA 3CCRT 3OA9A 4EJVA 2HTJA 3H0HA 1ITYA 2IAJA 3CCLI 2EB7A 2IA2A 2X51A 2Y75A 1BISA 2KHOA 1IH7A 1LDJA 1KIKA 4ELTA 4FK0A 5IT9O 3EFRA 2WAQN 5DY9A 5LJ5d 4ZDLA 4MQ3A 2M2EA 3K9TA 3FDRA 3RWUA 3KHYA 2OPTA 1O1WA 1W7PD 3HFOA 1D8JA 1DU0A 4I6ZA 3FKIJ 3NTKA 4JI5K 1M8VA 3K1NA 1YITI 3W6KB 1W7PB 1WQ2A 3NQOA 3R9PA 1OULA 2Q2RA 1JQQA 3VYGA 1U3EM 3DKMA 4YOUA 3QYGB 2O8FA 2JGUA 3BR3A 4CK3A 3I0WA 4CI6A 1M4ZA 2CQNA 4FK4A 2EKOA 3NMUA 4ATOA 1QZ5A 2HZYA 1M9SA 3SEQA 3SUNA 2XY6A 2HNHA 1NGIA 5LJ5f 5GADP 2JLEA 2YX7A 2L2OA 4PJOF 4UY8O 1RAGB 4IHWA 1OV3A 3GBGA 3FHNA 3R4KA 1MBFA 1Q9XA 2P9SA 2BY1A 1NEBA 1NLPC 1BIBA 5GIOA 3RMQA 3IMXA 4B3RK 1VQ6N 4HX4A 2W84A 3ID8A 3CG7A 4BXFA 2ZJQF 1QP2A 4MDBA 5E18F 3EZ5A 1NJWA 4EJOA 3ECOA 4DBHA 4B9LA 4EMKC 3FE1A 5H6QA 1N3AA 3CCLQ 3T1BA 2YSRA 1HQUA 1KTQA 1P90A 1D8YA 3WHBA 4CW7B 4LD6A 1O57A 1TT5B 3MZYA 3LDQA 4F9OA 2L54A 5ILSA 2MSYA 3CTAA 1U2VA 1K8AO 2BY3A 1ETWA 4F04B 2VPLA 5BR8K 1RRSA 3SUPA 1BO5O 3I54A 4MGRA 3CW7A 1VQ7T 3QDKA 3QFPA 2XDPA 5KK1A 4C3IJ 2E2JJ 2VBXA 4C1NK 4M78D 1RT6A 4CJVA 1QGPA 4I6MB 4XOTA 1N8RO 1J5EK 3OSVA 4O0JA 1XMAA 4Q4ZF 4CD3A 3C1DA 3BG6A 2VOOA 4XKWA 5KHDA 1FPQA 2WB1N 1VQ4A 1NU0A 4E19A 5IP9J 4M4ZA 3THXB 5GJWB 3QHSA 5FWCA 1QU3A 3LZIA 3HP9A 2FOWA 3SQ1A 5EZGA 1AZGB 4OINF 3WXMB 4PCQA 3E1YA 3VJPA 1YIJA 1O3SA 5J47A 3CCRQ 2WONA 1XG7A 4IOXA 4XM3A 4GRIA 3VS2A 1U8RA 1M3AA 3DXJF 1R7JA 1RT2A 2YKMA 3OBWA 2IVWA 2F5KA 1MGTA 3WU1B 2KHMA 1NK2P 2QUFA 3WNHA 2CQXA 2LK2A 1P4WA 1OFCX 2LTOA 2NZTA 3AO3A 1VQ7I 2MI6A 1VQLA 4H0PA 3QINA 3G3ZA 4YPRA 3MO8A 3BR1A 3SBTA 1Q7YO 4DLGA 3UIQA 3I64A 4KHNA 2VJIA 5JLHA 1V76A 2D1HA 2P6SA 1FP1D 2JA6J 2DK5A 3ULRB 1Y6IA 1XS9A 4CF1A 2FLOA 4G6DA 2IIMA 4V2GA 1S1WA 4BI8B 2EWNA 1BHLA 4AUXA 5BOXA 3UR3C 4HOBA 2JTFA 2JA7J 4MFBA 3SDZA 5EU7A 1V5FA 1IBKK 2KY9A 3WVEB 2V9VA 3EG3A 4E70A 3CETA 4J6YA 3P38A 3ENHA 3KYCB 5ERIA 2P8TA 4N4OB 1Z3YA 3RDIA 1QVFS 4CICA 3CDLA 3MDQA 2GQVA 4CK2A 1BA1A 3ZN1A 4CSWA 3M57A 1IF1A 4J9IA 3RRHA 4OMFB 4A3EJ 4EEFG 3EG2A 3ERMA 5KAFC 3GW2A 2DBMA 1WRJA 3PNVA 4KHPK 2DFEA 5J4YA 2WWYA 4TSXA 3HKZA 3QU3A 1YTUA 1HPMA 3C0BA 4NC7A 1WJ5A 1MBGA 5J1UA 3GNGA 4CZCA 4KI6A 2RJFA 2K5LA 3OSGA 1SAXA 2FC0A 3JRIA 5J8FA 2EBPA 4G7HF 2DU9A 5CVRA 4PWDA 2BZ8A 1WJQA 1KG4A 1YJNN 4BBSJ 2LJ1A 5EEHA 4E9FA 3TAQA 1KCFA 3VYRB 3THWA 3CPFA 4DWIA 3CCVQ 2B0LA 2P9UB 2HEQA 2V1NA 1VQ9N 3SZGA 5FLVA 2QK9A 2EH3A 1U8BA 4XU0A 2XGXA 2VWJA 3J7ZO 3SLCA 4OMZA 3GTLJ 3O9RA 2A1RA 2MD5A 3BE3A 1NGJA 2WAQA 1Q86R 3WQTA 2KT0A 2ABKA 4RW4A 3DLRA 1J3TA 1YP5A 3PO4A 4FJJA 2K5CA 3LGFA 2DMNA 3ML6A 4FJXA 2ZO4A 1Y71A 2E1ZA 2OQGA 5DM6L 1XSVA 4O3MA 4UB6C 1KSWA 4EFHA 3KK3A 1IHVA 2HMIA 3WTWC 2LDUA 4AIAA 1YHQT 3PY8A 5HRPA 3X26B 1KG1A 2QA4N 1OCCH 2F7TA 2JN0A 3G73A 3TGNA 4RLQA 1WJSA 4FJKA 4CCJA 2FEIA 3UE5A 2VQEK 2V7YA 4JK8A 2QWNA 2P0PA 2AHQA 5CYMA 1ZK8A 1KLMA 3R0AA 2DXIA 3LAKA 2F2EA 4BACA 4KH5A 2Y31A 4B8CA 2J05A 3WEEB 1H8KA 2AJQA 1E3MA 3SD4A 2Y90A 2XIGA 3NWSA 1ERDA 4RCCA 1W7AA 1I39A 1Q86U 4ZGEB 2FL7A 4EVVA 2B7EA 1R9TJ 3F70A 1R0AA 1TWAJ 3D5RC 2X9HA 1VQ6A 1WJDA 3M9AA 4C5HA 1D1AA 4B3SK 3E6MA 3ZSOA 4F7UG 3RI4A 2WSFE 1BJAA 3QESA 1OVQA 1HNZK 2D0QB 3OH6A 4XU3A 5GTHC 2MBFA 5GANh 2CV2A 3M55A 2QXLA 4E1JA 4Y28E 1DP7P 5IP7J 2DXBA 3AY9A 2XY8A 2H3EB 2CYYA 4C92C 3ZSWA 3SFZA 1PKSA 1WB9A 4IRHA 3QKJA 2JN6A 3F22A 3JCMW 2A6HF 4Z8AA 2W1OA 4OMQA 3BFMA 2DTHA 1UA1A 2AKKA 4HSBA 1KQ0A 3HEFA 4BC4A 3K7AJ 2GBZA 1IGUA 1T0FA 4DEYA 3AL0B 4HVWA 3KUFA 2XGCA 3SUOA 4LK1F 5ILVA 1YTYA 3FXQA 2A7YA 4CHOA 4BE1A 2DYIA 3ZETB 2LCCA 1TQMA 2NVXJ 2DTIA 2L0AA 4UUTA 4OB3B 2DO7A 2GEMA 4A57A 4M6XA 2V4JC 1J0RA 4F7ZA 4OLBA 3V42A 2VYPA 2WB1A 2VBZA 1GLEG 2JSCA 5ED4A 4CHQA 4CH7A 4RB0A 4DTUA 3Q5FA 1SHFA 3HTRA 3BEXA 4UNOA 3D45A 5EF6A 4XLEA 2J7IA 4KITB 1H0MA 2ICWG 2OU2A 3UKUA 1IXCA 2KRNA 2XAHA 3AG4H 4GVMA 2HDAA 1PVEA 3K5MA 2RHKA 1P59A 5MLCQ 3CXCA 1RBRA 2NOZA 1IREB 4CJPA 5AIQA 3T3FA 5DD8A 2DQRA 2J4RA 5J2QA 1ZBXA 2EYXA 1RNHA 2I5WA 2D1VA 4U0VA 3JAMZ 5KE3A 4XQFA 3K4JA 1X6OA 5LJ3h 1YJWN 4L9JA 1Z21A 4PNOA 3M5RA 2KJBA 4DV5K 5GMKj 1XGSA 4M7DG 3H6ZA 4II3A 4RG2A 2LT4A 1YHQQ 3AKZA 3A01A 4FLXA 2E1NA 2VL8A 5JFRA 4H4OA 4Q48A 3M0QA 4BR5A 1X58A 2ISYA 2W0ZA 3KLEA 1S1NA 1WHMA 4NL3A 2OPRA 1QSYA 3MD2A 3KP3A 1A5JA 4ORZA 2DLLA 4P5OA 3C94A 4M9SA 3RPUA 1MMAA 1ZX6A 4IUPA 4M73A 2GFAA 4FJNA 2BW3B 3O1BA 3WVDB 2R4GA 2M0CA 3OYLA 3S1QJ 1W2BS 3VQAA 2QQRA 3O6BB 5EZHA 1HLVA 4FM1A 3BDPA 3K1PA 1TK8A 3VQBA 1YBYA 5FKKA 1H9TA 3WU2C 4ZDOA 3U1DA 2BEOA 5LJWA 1B92A 1KU2A 1JE8A 2RHUA 2V9KA 1T3SA 3HOSA 2O8CB 2J06A 4B3OA 5I21A 2HDWA 2KFDA 1KQSM 4CZMA 3E6BA 2COWA 1X3UA 4HSRA 2JXBA 1AKHB 1JBMA 2EQKA 3CCMN 2EYQA 3CIPA 3M8PA 1GOBA 1GXIE 4M72A 2BE9B 1XQPA 3H3NO 1HXDA 2W03A 4IX7A 2ESHA 2YKNA 2DRMA 4CGGA 1MSEC 3CCQT 1DGWY 5EX5A 3R6NA 1YCSB 3AO4A 4M77D 4UVCA 2DEQA 3TMOA 1TGOA 1IRFA 3KCCA 3VOEA 1QHTA 1EH8A 4V19S 1HW2A 5KYYA 3BDUA 3E19A 2JWLA 2WACA 3WGHA 2VVKA 4XSZF 3NH1A 4BRLA 5L23A 3DEWA 2DM1A 2IP2A 1UHWA 3M8QA 3O9SA 2PJRA 3I5UA 3DWLA 1NHAA 5GANe 5FLXO 2HKQB 1FIAA 2RJCA 2DDBA 1FIPA 4L9TA 2GUIA 2Y2ZA 3LLRA 3FZHA 4C8QF 1I1SA 4CYCA 4MO5A 4MQVA 3MEXA 2QVOA 2P0WA 1P7MA 5E1ZB 2IA0A 3LNQA 3VQEA 4FPBA 4EVIA 4EP5A 2COMA 4CERA 2A3SA 2Z2SB 2LR8A 1X1BA 3HTSB 3EKUA 1VQOQ 1ZRFA 2Y4YA 2QA4A 4A0ZA 3TWHA 3CCQI 1E3HA 4FWQA 3D4VA 4JLGA 1T0HA 1HPZA 5E17F 2F5FA 5AQSA 3A98A 2HKOA 4M3FA 2EGCA 4MLOA 5K7HA 4DQRA 3P9CA 4H0EA 1BC8C 4B3XA 3G4SN 1BOTO 4IWVA 3JAME 2ACJA 4X1EA 3NRVA 4CCMA 4CEFA 4ABZA 4XICA 3LWFA 3HPHA 3HPGA 1MBKA 3EGDA 3IRXA 2DA3A 5I42A 2HL3A 4PJJA 4QPOA 4CZLA 2Q0OA 3MEGA 5EJCA 1K8AC 2ED1A 3KEYA 3C7NB 4A5NA 1X1CA 4EJYA 1IW7F 3A2FA 1C0MA 2WBMA 1KGSA 3WHCA 3KFWX 1HJRA 1R8OB 4L5IA 4RTWA 4DV7K 4HNTA 4XSXF 1ABOA 1L3SA 1QMCA 4Y17A 3LAMA 5LJ3e 4RTYA 2ZMEB 4IEEA 4DBRA 1N8RC 2D1XA 1RT3A 3AL0C 3RKQA 5E8GA 1VSDA 5E3MA 2DDAA 3FZFA 3KYLA 1HC8A 4GNIA 2HYGD 4HKEA 2E5ZA 3M07A 2L3QA 1IRZA 3DLKA 2JSPA 4CJ7A 3PNWC 2V7FA 1OVYA 1JJ2A 5C2FA 2NOBA 3P31A 2VQLA 3HOWJ 4A54A 2V1DA 5GPCA 1HX1A 4QSHA 5JLFA 4A3DJ 4FL9A 5M5YJ 1MH4A 2DLPA 2V52B 1N5ZA 4RW8A 3D2FA 1V54H 2X1DA 3NGIA 1V4RA 1RL2A 3H35A 1KVBA 4ZZDA 1IKXA 2J6KA 1H3ZA 3M8JA 3VGKA 1ZG1A 2XDVA 1CZBA 1U45A 1BG3A 4DF4A 1GXQA 2LX9A 4BJ5C 3OOPA 2GNCA 4A2AA 2R5YB 5FRMA 4DF8A 4KICA 2O03A 3A5NC 2X4JA 3V1QA 3FXMA 2QWOA 1G3YA 3AVJA 2OCEA 2F4OB 4C0DB 4UY8I 3CQ8A 1Y0UA 4LG3A 5BN8A 3PNTA 4K25A 4NBQA 2LNHB 4M78A 1Q7YC 2PJPA 1VSMA 2N8GA 1KYZA 3VQ4A 2Z1JA 3HL2A 1XNIA 4DR6K 1C0UA 5IYBJ 3JAMK 1N3CA 4C8MA 1V55H 3QYEA 2JM8A 1LMZA 4BI3A 1R5HA 3FIWA 1CSKA 3I5SA 2M02A 2YUNA 2TRTA 1K8KB 1AVZC 2RI2A 3BJ6A 3KP2A 3ZYYX 3JRFA 4C92E 5EYRA 3LSTA 3M0PA 1VUBA 4OJRA 3H0IA 3G6ET 3V81A 4M3YA 4A4FA 1GLJO 5KRTA 1K79A 2VLAA 1WGSA 1BKBA 3K5OA 2P5KA 2E1YA 1I3AA 3EN9A 4YOYA 2QEXT 3GDQA 3TAGA 2V7ZA 3SPYA 1YF5L 1XG1A 2KKZA 3OW2A 4A4EA 2GBQA 4J8FA 4CEOA 2R7UA 1HKTA 1JLBA 3LCNA 3L4QA 2A68F 3MECA 4M3UA 4BVPA 4R56A 2LLKA 1JLGA 5AONA 2XC7A 4HQEA 2YHTA 5AQMA 1OZ2A 1I0CA 2J6FA 3LP3A 1WZ2A 2MLKA 1YX3A 2X1CA 2ENMA 4LITA 3RKXA 2DL5A 4F55A 3CCMA 4A62A 5L3EA 1EBMA 1QZYA 1XB4A 3KE2A 4M78F 1X2KA 1MDUB 2W57A 4CHYA 2DODA 1R5GA 2M7AA 3LMMA 3MHXA 4KFBA 4Z2YA 1WNLA 1BIUA 3WXLA 3FBIB 1EO1A 1FOYA 4E9GA 2DXUA 2M1HA 1BR1A 2F5DA 4RTXA 2OAWA 3JSOA 3JB9H 1S6QA 1YVUA 3CI5A 3G6EI 1ZREA 3TARA 3BJOA 2F2XA 1SMTA 2XG8D 1U9OA 1RNLA 2XAUA 2D4WA 4JX4A 3PQKA 1OYXA 1G15A 4OGEA 3HSTB 4QLCU 1Z9QA 3O4QA 1FTTA 1OCTC 1VIFA 4IUVA 1I07A 4KRTA 4DOZA 4AYBN 3HSRA 2Y48A 3MEEA 4M45A 2O9SA 4H03B 3ZX0A 1QTMA 4ANJA 1K6YA 5FFZA 4Z94A 3REAB 4ICLA 5GANf 3JYTA 3ZT2A 4JKGB 2X85A 4LIUA 5CVJA 2O8EB 5D6EA 1WH5A 1QQCA 1DEJA 1JKRC 1B07A 1VQ8Q 1MMGA 3RR8A 2FBIA 2ZE2A 2CGHA 4BAYA 2IT0A 3HK2A 3CFPA 5KN9A 3QFUA 1SFXA 1TWBA 4DQQA 4AHCA 2G7HA 3DU5A 2HBJA 3MKLA 1IGQA 1ATRA 1VSHA 1A36A 1ETYA 4DSKA 2MIOA 3IUOA 2Z0WA 1ZBUA 2MD0A 5FD6A 1AA7A 3ZEUA 1DP3A 3IAYA 2CP2A 1LEBA 3OB9A 2XV4S 3MCZA 1UGVA 2EJFA 1JTYA 2NVUB 1QA6A 1X69A 3FC3A 2CZ6B 1NJXA 4M75D 3I0XA 3G7ZA 4FT2A 5GAOn 4C2MJ 3MZHA 2DAQA 2PI0A 2VQGA 2Q3SA 3WG7H 1AHDP 4JRKA 3RMSA 1PCXA 2QQ9A 3G1LA 5FO5A 2B6AA 4ZYEA 2JPSA 1OZ3A 1WGXA 1OPCA 4YDUC 1MUZA 3QERA 2IS6A 3D2EA 4LOCA 4ZN3A 3H08A 3MX2A 3QIOA 5FPEA 3RQIA 1S7AA 1OH5A 3ZGKA 3FMRA 1ZR4A 2QEXQ 2Q36A 5DLQE 1A5VA 3C6AA 4A3KJ 2ZXJA 1M3CA 1JLCA 4Y52J 1NTCA 1REVA 2OYQA 2M51A 4C5EA 4FJGA 2FRWA 1X3NA 4A3MJ 1VQMI 1SSHA 2GIVA 3EL2A 4QQ6A 1SQKA 3K5LA 4LUEA 1NK9A 4A12A 1VSJA 3CPWS 4DTXA 4NUBA 5LJ3f 1NBEB 4LNPA 2OPQA 1W70A 2R7WA 3VPZA 4KB1A 2F4MB