3OYHA

Crystal structure of the prototype foamy virus (pfv) intasome in complex with magnesium and the insti mk0536
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
368
structure length
368
Chain Sequence
b'LDAELDQLLQGHYIKGYPKQYTYFLEDGKVKVSRPEGVKIIPPQSDRQKIVLQAHNLAHTGREATLLKIANLYWWPNMRKDVVKQLGRCQQCLITNASNKASGPILRPDRPQKPFDKFFIDYIGPLPPSQGYLYVLVVVDGMTGFTWLYPTKAPSTSATVKSLNVLTSIAIPKVIHSDQGAAFTSSTFAEWAKERGIHLEFSTPYHPQSSGKVERKNSDIKRLLTKLLVGRPTKWYDLLPVVQLALNNTYSPVLKYTPHQLLFGIDSNTPFANQDTLDLTREEELSLLQEIRTSLYHPSTPPASSRSWSPVVGQLVQERVARPASLRPRWHKPSTVLKVLNPRTVVILDHLGNNRTVSIDNLKPTSHQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PFV integrase
publication title Molecular mechanisms of retroviral integrase inhibition and the evolution of viral resistance.
pubmed doi rcsb
source organism Human spumaretrovirus
molecule tags Recombination,viral protein/dna
total genus 106
structure length 368
sequence length 368
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2010-09-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
A PF17921 Integrase_H2C2 Integrase zinc binding domain
A PF18103 SH3_11 Retroviral integrase C-terminal SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2300 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3oyhA04
1.10.340.70 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Endonuclease III; domain 1 3oyhA01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3oyhA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3oyhA03
3B6OA 3AA3A 4K8ZA 4Q5WA 1HYVA 4KV8A 3VQPA 5HLFA 3KLIA 1WJQA 3OYGA 2JLEA 2RF2A 2O4GA 4OPJA 4FJLA 4KTZA 4EDUA 4A4FA 4Z02A 4N5SA 3PUFA 1HYZA 1LAWA 4ELTA 4B9VA 3KKSA 2IG0A 2X4YA 4K8XA 3AVNA 2E6MA 1U48A 1XWLA 3O3HA 3QIOA 3KK3A 3L2QA 1LW2A 1NOZA 2G8FA 1Q9XA 3C6UA 3WNGA 2OYQA 1QQCA 3NTHA 1HRHA 1WSHA 1X1PA 4HUGA 3KD5E 1JLCA 3AVCA 5FRNA 4YNQA 3LP1A 4DTNA 1S1TA 4CIGA 3Q1JA 1TV6A 3LP2A 1XI1A 4OLBA 1FXXA 1GOBA 1TGOA 3DRRA 1QSLA 4E19A 4LH5A 1S1VA 1IG9A 3RRHA 2FBXA 1S9EA 5KCOA 4CESA 3V9UA 1RBSA 1RI0A 4AILC 3MECA 4KFBA 4FK2A 1RBVA 1HYSA 3EZ5A 3IG1A 3LGFA 4LSNA 3SI6A 3ULDA 4JS5A 2GUIA 3NH2A 4C8NA 1KVBA 3AVAA 3T19A 4FZZA 1ASWA 3AVBA 3ASKA 3L2WA 4F3OA 2GFUA 1IKWA 4PWDA 4G1QA 4CEOA 4GMJB 4CJPA 2VWJA 1B9FA 1W0HA 2RJDA 4ID5A 5KRTA 1CXQA 5M9OA 3P8DA 3CYMA 3QEIA 4FM1A 3V1QA 3FDRA 1T05A 2Z1HA 1T8EA 4UQGA 2KFNA 3OMCA 1EKEA 4IURA 2D0BA 3K5NA 3SQ4A 4IKFA 3NF8A 5D6XA 1ZBHA 1UOCA 1A5XA 4DFJA 4FJ9A 4FJ7A 2YRVA 1IKYA 5C25A 1TAUA 4I9LA 2VYTA 4KKOA 4DSJA 3VQQA 2XO7A 2K3XA 4Z4EA 3QO9A 4CF8A 3DM2A 4DTJA 2OZMA 3K5OA 4O5BA 4FLWA 4FK4A 1EX4A 1RDCA 3O8VA 4B9XA 1GOAA 2IGIA 5C42A 3AVLA 3V81A 1JLGA 4O55A 2MWOA 1C0TA 4EP4A 3S3OA 1LWEA 1WSEA 5D3GA 4DS4A 3MP6A 4FJXA 5KTQA 1WNSA 2G8HA 4QAGA 3PO5A 2CKKA 3E9FA 1JLEA 3KUFA 3ZSWA 1VSKA 3LAKA 2VG6A 4ID1A 3IS9A 5C6SA 4FW2A 3V9XA 2P5OA 3DYAA 2ZE2A 2HHSA 4CEAA 4W5OA 5KCHA 2EQMA 3KLHA 2K3YA 2HNZA 1WJSA 3QETA 4FLUA 1XHXA 1S1WA 4I2PA 2XHBA 1LAVA 3WNHA 3M9QA 2YHBA 3L3UA 3LP0A 3QINA 4FVMA 2KFZA 4FJMA 3G0ZA 4BWMA 3D0PA 3ZSXA 1RBRA 2AJQA 3LANA 3G10A 4M3ZA 4E7KA 3SYZA 4Y1DA 3BDLA 1SKSA 4BE1A 3ZSQA 4B8AB 4W5QA 2O4IA 3AVHA 4AHVA 5KRSA 4CFCA 3H8ZA 4C8KA 1NK0A 4BDYA 4CJEA 4F8RA 4IUPA 3CFPA 5J2NA 2DFFA 4E0DA 4M3TA 2XDPA 2YKMA 4FYDA 3HYFA 3AVJA 4LD6A 2GBZA 1LW0A 4JRPA 3V9SA 4CGFA 4HUFA 4CGGA 2RJCA 4CFDA 1NK9A 3QEWA 3OYBA 1YTUA 1J5OA 4KAZA 2VWKA 1VSHA 2OPQA 3NCIA 1C0UA 4ZTJA 4JS4A 4IUQA 3KK1A 1L3VA 3MEVA 4KHQA 4CK1A 3ZT2A 4F4KA 4FJGA 2WOMA 1NK4A 3AVKA 1KFSA 5I42A 2GV9A 4E1MA 4CHPA 1G15A 2HVHA 3LYIA 1ZBLA 3F9KA 1SV5A 3O4QA 5JS1A 5IAYA 3HM9A 4I9QA 5CYQA 2RKIA 3DB4A 5FRMA 4KHNA 4FZYA 4N47A 3MXJA 5CY4A 1S5JA 4B9WA 1JLAA 5J26A 4DTSA 2GF7A 3EYZA 3MXMA 4FJIA 2QKKA 1L3SA 3OYFA 2DY4A 4WE1A 3TAPA 4DQIA 1T03A 1D9FA 1NJWA 5HRSA 5C0MA 1LWFA 2EQJA 1JLQA 5HRNA 5J2PA 2EFIA 2EQUA 3TABA 1VSIA 1WAJA 3KTQA 3UWNA 4ZTFA 3VQAA 4PY5A 3QIPA 4QVZA 3META 5KGWA 3PX0A 5J39A 3VQDA 3B6PA 2P51A 4HUEA 1BIUA 4KHUA 4DU4A 3SQ0A 4II1A 1U04A 2HW3A 2E6NA 3OYHA 1QS4A 3AO1A 3CG7A 5J2MA 2RO0A 3K59A 4KTWA 2LTOA 4CJRA 2R58A 1LV5A 2NUBA 4DU1A 3LWMA 3ITHA 4O0IA 2EHGA 4CFAA 2OA8A 4AHUA 2R5MA 4DQQA 4CIFA 4CF9A 4CJVA 1HJRA 2DAQA 2YNFA 3A2FA 1CZBA 3P1GA 3LZJA 1N6QA 4M3UA 3OYAA 3KLGA 1BI4B 4LSLA 3SUOA 2X74A 4IFVA 3OYDA 4DSIA 1XC9A 1WN7A 3HVRA 1VSMA 2HHQA 1GOCA 3OJSA 3E01A 2XRIA 4IG3A 3OJUA 4FLZA 2RI2A 3NF7A 4FJNA 4LY7A 1BHLA 2RPIA 4UC4A 3DRPA 3HPGA 3QNNA 2QK9A 4EZ6A 4OGCA 3RMDA 2RJFA 1NKCA 2JTFA 3MAQA 1NOYA 2RHYA 3QNOA 3UT1A 4N76A 4DTRA 4QCLA 4N41A 3K57A 1TK0A 4Z4GA 4CEDA 1FKPA 4KTQA 4ZHRA 3F73A 4IDKA 2R57A 1HNVA 1IKXA 5KI6A 3AA4A 4J2AA 4KPYA 1UWBA 3OYLA 4QQ6A 1OZ3A 3OS2A 2RHUA 1QSYA 2A1SA 2DFHA 2XY8A 4CFBA 5CYMA 2WONA 2RN2A 3PNWC 2F96A 3PFSA 1C1CA 3QERA 1MU2A 1KVAA 1ASUA 4JRQA 3OVNA 4CJ4A 2Z1IA 3L8BA 4KI4A 1ZBUA 1RT4A 3QESA 3HL8A 4IG0A 3OA6A 2X6NA 1ZBFA 3LWLA 2L3RA 3BGRA 1I39A 3MEGA 2NLUA 3RMBA 3FEOA 3FLGA 1BQMA 3NBPA 3DOKA 5CIUA 3EY1A 4IUVA 5D6WA 3QJ6A 4O44A 2G8KA 4DS5A 3SUNA 4N56A 3VQCA 3ZSZA 4A4EA 4DSLA 3PY8A 3WNEA 2F8TA 3ASMA 1BCOA 5CZ2A 3JSMA 2RHZA 2PYLA 1BCMA 3P5JA 4DWIA 3SNNA 4KHYA 4DMNA 1NK5A 1VSLA 3OYIA 2YNGA 4MFBA 2BGGA 1RDDA 3SQ1A 2PY5A 3AO3A 3E9GA 1NJZA 1KCFA 4C5HA 2Z1GA 2M0OA 4FW1A 1N27A 3NAEA 1RTIA 4TSXA 2EX3A 3SD4A 4CK2A 3DRSA 1RT5A 2BKDN 4KRFA 5KGXA 3M8SA 3HPOA 4LH4A 3VQEA 3VA0A 3MXIA 2O4XA 4BE2A 2LRQA 3DLBA 4QQDA 3KD1E 3HJFA 5JS2A 2LCCA 2FHDA 2KTQA 2HHVA 3DLHA 3V6DA 2ZD1A 2DFEA 2O4XB 1XNIA 2KZZA 3QEVA 4CECA 4B08A 4DLEA 2X78A 1RDBA 3AVMA 4CGDA 4EP5A 4E7IA 3TAFA 4M3XA 3NGZA 4E89A 2G8IA 1YT3A 3QIIA 3CM5A 3RR7A 4CEFA 2BDPA 2JZ2A 3T3FA 1TKZA 2VG5A 4FLVA 3DMJA 2D0CA 2YHAA 3OYNA 3VQ6A 3SCXA 1WSIA 2LVMA 2X6SA 4CF0A 2ETJA 3O3GA 5HP1A 2B4JA 2IOCA 4Q5VA 2RHXA 2HMIA 4C8MA 1OZ2A 5J1EA 4CHOA 4XIUA 4B8CA 2ZQBA 4O0JA 1KSPA 5KE2A 4JLHA 1L5UA 2QKBA 3K58A 4RW6A 3KKRA 4E1NA 4DU3A 3CFRA 1WSGA 1TKXA 3TR8A 4F3TA 2IS3A 5DK5A 4BD3A 2PQWA 3HP6A 3SV3A 4L8RB 1BGXT 4M3YA 4FZXC 3LZIA 5DMRA 4HCZA 3K5LA 1QSSA 3M8RA 2G8UA 2G8WA 1RBUA 3NGYA 3PMTA 4HCBA 1C0MA 3U6FA 3NHGA 1KRPA 4QQGA 1RT1A 3CEYA 4QW2A 5T7BA 3VN5A 3C95A 3ALYA 4OGEA 2E5QA 5HBMA 3DLRA 4DG1A 4NCGA 3ZSYA 4HHTA 3DB3A 1O1WA 3LDSA 1KHCA 4E3SA 1RTJA 1JL2A 2FBTA 1DLOA 2B5JA 1U47A 5KE3A 2RI3A 4CJFA 1DTQA 4FU6A 3PV8A 4CK3A 1KTQA 3DLGA 1D5AA 3ISNC 1J53A 4GVMA 1JLFA 1S1UA 1RNHA 3SV4A 1VSFA 4CEBA 1IH7A 2LSNA 3QEXA 3AA5X 4OVLA 4RW7A 1LWCA 4DFKA 3K2PA 2QQRA 4N4GA 2Z1JA 2BE2A 4BDZA 1NK8A 4CEQA 4W5RA 1HQUA 1I3AA 1RBTA 3LX7A 1VRUA 4O4GA 4Z0UA 4NCAA 4FLTA 2X4WA 3L2RA 3ZSRA 3IAYA 1KLNA 4BE0A 2RHIA 1SL2A 4DF4A 3SUPA 4NYFA 3V9WA 2L89A 1HNIA 3H08A 2P5GA 1ZYQA 3NF6A 5CZ1A 4RW4A 4Z4HA 3LAMA 1K6YA 1XHZA 4RG8A 1Q9YA 1BI4A 2ITGA 1N5YA 4H4MA 2WACA 2IAJA 1T7PA 4DFMA 2FBVA 3CM6A 4FM2A 1BL3A 1S6PA 2OZSA 3TAMA 4CJ3A 2XK0A 1Z25A 2QQSA 4EZ9A 4DTUA 2ATQA 1BIZA 4B9MA 1QHTA 3OYCA 1UA0A 2PYJA 3BDPA 1U49A 4I7FA 3VA3A 3L42A 1CLQA 4H8KA 4KB1A 1R0AA 1SL1A 2BIVA 1KVCA 3OY9A 3TANA 1KFDA 4HCCA 1BISA 2R5AA 2A1RA 4DTOA 3L2UA 4M42A 4HVJA 4N4IA 3OQ5A 3AA2A 5IN1A 2RJEA 3SZ2A 1SKRA 3MEEA 2YNHA 4AHSA 4NS5A 3P83D 1NJXA 1EXQA 4CJSA 3TAEA 3DOLA 4A4HA 5HROA 3KJVA 3TAGA 1G5VA 1HPZA 4CJQA 4E7HA 1IKVA 1S9GA 2G8VA 4CGHA 3OYKA 3ZSVA 3O3FA 3I8DA 4W5TA 2I5JA 3RR8A 2R7YA 1Z26A 4CJ5A 4OKEA 2HNYA 2IC3A 1VK0A 2E4LA 3AV9A 4Z4CA 4I2QA 2YNIA 4KO0A 5SZTA 3SPYA 4CEZA 4E7LA 1FKOA 5KH6A 3NTKA 1EETA 2YV0X 3NE6A 4M3RA 3QKJA 4IBNA 1L3TA 4IUUA 1S1XA 3HVTA 1OI1A 4CJUA 4CHNA 3RMAA 3F70A 3ZT3A 2B6AA 4OJRA 2HVIA 4DFPA 2HHWA 4PLLA 3AO4A 1TL3A 1C1AA 4DSKA 3NGIA 1TKTA 4DQSA 4BWJA 4PA1A 1BQNA 2IDOA 1NKBA 3TI0A 4FLYA 1ZBIA 2KZMA 1RT7A 3HPHA 4KHSA 2XY5A 3LPUA 1JKHA 2KQ2A 2G3RA 3THVA 5J2QA 4KB0A 1X9MA 3L2VA 3TWHA 4YFUA 4CJLA 4Z4FA 3NNQA 4OKJA 4ELVA 4C5EA 4BDPA 2DTUA 1CZ9A 5EU7A 4PUOA 5SWMA 4H4OA 3H6ZA 4OKKA 3C94A 2BUDA 4HTUA 3HT3A 3GOXA 2OPPA 4C8OA 3AVFA 3P8HA 4CJKA 1SKWA 2QXFA 4PQUA 1TL1A 4CJWA 3LPTA 2HNDA 3JYTA 2DIQA 2HQXA 4IUTA 2Q3SA 4B9UA 4FJKA 4CF2A 3NTIA 4CGIA 3VQ5A 4FJ8A 3HK2A 3AVGA 3OYJA 1W9HA 4RW9A 3RTVA 2HHTA 5HRPA 1TAQA 4CGJA 3S9HA 1J9AA 2RI5A 2VG7A 4PLIA 4DLGA 4CHZA 3S6WA 2XY7A 1U4BA 3LP3A 3KLFA 1S6QA 4OLAA 1C6VA 1JLBA 4C5GA 5D6YA 2EKOA 4AHTA 4FJHA 4ICLA 4J2DA 1C1BA 2BANA 2F5KA 3NH1A 1VSDA 1NK6A 3WNFA 1RTHA 3RRGA 5K14A 4C8LA 4J2BA 2D9TA 3QEPA 3U3GA 4NYNA 3MEAA 3ZT0A 3DLMA 3MP1A 5FDLA 2HHUA 1JXEA 4Q0BA 1TVRA 3ME9A 1UAXA 3AVIA 4DSEA 3IRXA 3KK2A 1WSJA 4C5IA 2GFAA 3FFIA 3KIOA 4CHQA 3ZCMA 5C24A 4QOZB 1TKDA 4W5NA 4CHYA 1WLJA 3HP9A 4NCBA 1D8YA 1JL1A 4CJTA 1WGSA 3RWUA 4BACA 1H3ZA 2YKNA 1RCHA 4B9NA 4FLXA 3V1RA 1Y97A 3AO5A 4AHRA 3FC3A 3ZSOA 1WSFA 3LALA 4NZGA 1YVUA 3PO4A 4DTXA 4AHCA 3HSTB 4F2SA 4R5PA 4OPKA 1X9WA 3ZT1A 1RT2A 1B9DA 3I0SA 1JXBA 4CEEA 1YTAA 3CFOA 2X35A 3DLKA 4FXDA 1X9SA 2HQEA 4Z4IA 2FBYA 2X4XA 3OMGA 1ITGA 1SUQA 1VSEA 2Y1IA 1TK8A 1A5VA 3SPZA 3MEWA 5E41A 4A4GA 3RMCA 1MHNA 3K5MA 2OPSA 2Y1JA 4E7JA 1VRTA 2JGUA 2P1JA 3OB9A 1WJRA 1ASVA 2M1HA 3QBYA 4KI6A 3VQ4A 3VQ7A 1DTTA 2LDMA 4M3WA 3ZT4A 2KW4A 2D5RA 5FROA 3ZEHA 4DQRA 4DQPA 3LGLA 3LLRA 2PZSA 3T1AA 1Q8IA 4PL6A 4B9LA 1CXUA 2W42A 1A5WA 4KHWA 3SUQA 1J54A 4RW8A 1NKEA 3NF9A 4CRIA 3EAEA 3KLEA 3OS0A 4B9TA 1RILA 1OYXA 3VQBA 1FK9A 3C4SA 3DLEA 1B92A 3VQ9A 2HHXA 4GY5A 2L8DA 3C6TA 3PX4A 4B9SA 4RG2A 4FL6A 1RT6A 4OVAA 3SQ2A 4N4HA 3MEDA 2XY6A 4IFYA 1QE1A 4FK0A 2DIGA 1HQEA 4DTMA 3HO1A 3QLHA 1RT3A 4MQ3A 2MWPA 4B3OA 2OPRA 4GW6A 3DI6A 3NFAA 4AH9A 3CQ8A 3TARA 2F8SA 3M8QA 2E6LA 3V9ZA 4ELUA 4CCHA 3MP8A 1HMVA 1D9DA 3MEUA 2FC0A 2P0KA 4L59A 2M16A 1EP4A 1SSFA 4DF8A 1NJYA 1F21A 4Y1CA 3M8PA 1RTDA 1UA1A 4F2RA 4M41A 1QTMA 3NH0A 3V1OA 3OS1A 3PMIA 3S3NA 3S3MA 3V4IA 4CERA 4CIEA 1TK5A 4FJJA 2D0AA 3I0RA 4M45A 1SL0A 3VQ8A 1U45A 4DTPA 1NK7A 5HRRA 2HB5A 3OYEA 5I3UA 3UIQA 1IO2A 4DSFA 1WAFA 1KLMA 4J2EA 4FM0A 3OYMA 3MO8A 4FCYA 2B8AA 1L3UA 3PX6A 4LD0A 3HXMA 3D45A 2EQKA 3L3VA 1VSJA 3O4NA 1REVA 4X34A 4FJ5A 1RDAA 4CF1A 3SJJA 4KREA 3LH0A 4CE9A 3NDKA 3TAQA 3U3YA 3AO2A
chains in the Genus database with same CATH superfamily
4XICA 2DMTA 3B6OA 4K8ZA 1HYVA 3EYIA 1WJQA 4NXMK 2JLEA 2RF2A 2CW7A 5F27A 5D8KB 4XLCA 4KH0B 4DQ8A 4FJLA 2KNBB 4N5SA 4DR5K 3BC8A 3KKSA 1YJ9T 4K8XA 1QKXA 5TKWA 2ITMA 4ZJZA 3FKIJ 3LCNA 5EEGA 1NOZA 2P5VA 4CC7A 1C0GA 1Q9XA 3J7YP 1V5GA 3JCMP 4ENMA 4OMNA 3BZCA 1FBUA 4KUMA 3JAMZ 3NTHA 4A5NA 4HUGA 5GAEJ 3VPRA 3G71T 2EH3A 2P9KA 3LP1A 3N4MA 4DTNA 4OIOF 1S1TA 4CIGA 2BHZA 1VQ5Q 2M8GX 3LP2A 5IT9K 1QZ5A 4NUBA 5GAOn 4OLBA 1TGOA 1QSLA 3ESWB 4E19A 4LH5A 5ERIA 3OGDA 3B6CA 2FBXA 3RRHA 1TP4A 1UG0A 1RBVA 5IWAK 1YG2A 2DXUA 5DM7F 3THKA 4LSNA 2R7FA 3SI6A 1JO8A 4JS5A 2GUIA 2HYJA 3NH2A 3AVAA 4IXCA 4DYQA 3PVLA 2O2OA 1TG0A 3RZOJ 3WGHA 4F3OA 2VT2A 5I9EB 1S3XA 2XHIA 3EKUA 5CR4A 5GANh 4G1QA 4PWDA 3GTGJ 1WJBA 4CEOA 4CO8A 2VWJA 1B9FA 1W2BM 4S04A 3OIPA 3QYGB 1MMNA 5AQMA 4O5FA 2TDXA 1ZC6A 1X2NA 2LQWA 1LNWA 3CMAI 4YOUA 3CYMA 1XSDA 1IV8A 3QEIA 4F7ZA 1MWKA 5HCKA 4FM1A 3V1QA 1HKSA 1S3JA 2KQWA 1ZN2A 3EETA 1YS7A 2XDVA 2IA2A 4UQGA 5C44J 1EKEA 2MH9A 2D0BA 3NF8A 5D6XA 2BVLA 4JYKA 3I55I 1O75A 1UOCA 1NPRA 5FKOA 1IRFA 2DMQA 3CCVT 4KRTA 1WHLA 2EWNA 3CWAA 2CQKA 4QS7A 4BQQA 2ENMA 1TAUA 2JM9A 4RDUA 5LJ5f 3JB9I 4IRHA 4I9LA 2VYTA 3GMEA 1YWPA 4FIBA 2X0LA 2KLAA 1B34B 2OTJN 1HXDA 2LSOA 4WF2A 2HFHA 3G6EN 1BM9A 3C1DA 4PIIA 3QO9A 1O7LA 3CCEQ 3DM2A 4CF8A 4RAYA 2OZMA 1WPKA 4ZYHA 5KYWB 1RDCA 3D1NI 2AS5F 4NNJA 1VQMN 1FIPA 2BGCA 5C42A 2HXOA 3O8GA 4FSVA 1UJYA 4CI0C 1E3PA 1H8KA 2WTEA 4EP4A 5A0DA 1X1BA 3S3OA 3ML6A 3P9IA 1LWEA 3N5NX 5LGTA 4LK0F 3RVCA 3MP6A 1XB4A 1RUNA 5KTQA 1WNSA 5DYMA 1XUPO 3D6RA 1DP3A 1NKUA 2JA5J 2IVWA 1JI8A 3S1QJ 4DR6K 1RFQA 3AG3H 4IIOA 1VA7A 4BRGA 3MX5A 1U5TC 2DQLA 1MBGA 3LAKA 4AYBA 3FX3A 1WJCA 3DYAA 1G4DA 1ZLMA 1YF5L 2P9SB 2B63J 3WE2A 1A04A 1OCPA 5DDGA 4PKHA 1TBXA 2EQMA 2F2WA 4I76A 2K3YA 3CCUQ 3LL7A 1YIJA 1VIEA 2LDUA 1W70A 4AI4A 4I2PA 2XHBA 5CK9A 4RGXA 3MWPA 3L3UA 1GLNA 4FVMA 3BJ6A 3TW6A 2GIZA 2HSPA 4BC3A 3RYRA 1IRGA 3RDIA 1YIJI 3G0ZA 1TNTA 3IH7A 4BWMA 3D0PA 1SFXA 2F9WA 5GAGJ 1NE8A 2AJQA 2NVTJ 4M3ZA 2A3ZA 4RGSA 3BDLA 3EFRA 3ZSQA 1WWXA 4CBXA 1QWFA 4W5QA 2Z3YA 2RNJA 1S22A 3ZRGA 1WHJA 5KRSA 4C0DB 1I6HJ 1C6VX 1NWKA 4CJEA 4Y33A 3CFPA 5C3EJ 4E0DA 4M3TA 1BU1A 4FETA 2JW4A 4H0YB 1UFMA 3WXLA 1LW0A 1KC8R 3S41A 4L6V5 4CGFA 4B47A 1LMZA 2BHYA 3ZCOA 4HUFA 3HG9A 1OR7A 2XIGA 2X85A 1KHIA 2B7EA 3JRHA 4CFDA 1ZX6A 1BA5A 3QEWA 1ZHIA 4UB6C 4WCGA 1LB2A 2DL3A 3A8YA 1XDUA 1UGPB 1KQ1A 1C0UA 4IUQA 3KK1A 2Y31A 2R3SA 1ZA1B 2UUBK 4DR2K 1X1DA 3NFCA 5AIQA 2FOKA 4A3CJ 1NK4A 3UKUA 2A5XA 5F0HA 5CKDA 2QK0A 2GV9A 4J7FA 2CT3A 1M3AA 2BEOA 4CHPA 5JLHA 4KULA 2HVHA 4C9YA 4K0KK 3VOVA 3VWBA 2YX4A 5ECAA 1VNDA 3H46O 1TTHB 1SV5A 2M0MA 1JHFA 1HOMA 3A1YA 3IWZA 1WPYA 1MDMA 3QB0A 3DB4A 5BN9A 4UV9A 2EV6A 2OAZA 4N47A 2K3FA 3A8OB 2FF4A 5GPAA 3J81O 5C10A 2X4HA 4HQMA 4AMCA 4PKIA 5FLXE 2RREA 2Q2RA 3EHRA 4J19A 3BDDA 2A6TA 2CH4A 1NGAA 5HDNA 1L3SA 4WE1A 2ZJQL 2QYOA 3VS0A 3N5BB 2WAEA 2WY7Q 4DV2K 3VENA 4A0XA 3IUOA 1LWFA 3NWTA 4CZLA 2P9UA 1T8IA 3I4NJ 3DLLL 4BY9C 1YJ9Q 4LIVA 3L4IA 4O5VA 1N3CA 1T3LA 4XNFA 2COMA 3O9SA 2KT0A 4KJZA 1FP2A 2LR8A 3O6WA 5LL6S 1WQWA 1LCKA 2YRCA 3QDRB 3QIPA 2NWMA 1UDLA 1BIAA 1UE9A 3META 3LAPA 1MBJA 3TO6A 5JVGL 2GZWA 1MWMA 1VQ4A 1BJAA 2ZJPF 4RKUE 4XIDA 4DU4A 5LBQA 3G71Q 3H36A 4QSHA 3CI5A 1PUFA 1U04A 2E6NA 1KJWA 4DV3K 2IS2A 3RMQA 5GAMh 1ZXOA 2A61A 3AO1A 2E1MC 4XLEA 5C2DA 3K59A 4CJRA 3G0QA 1VQ5I 3X28B 4FYWB 3ITHA 3DWLE 1QVFM 4DNCA 1TYQB 2HNIA 4D0PA 3PFYA 2NUPA 3TU4K 4AHUA 2CFOA 4DQQA 4A57A 2XGCA 2VCPA 5BPIA 1WUAA 2J5PA 4C92C 2L02A 2WY8Q 4C3HJ 5IP9J 8AT1B 2EJRA 4J9FA 1BB9A 3OYYA 4Q48A 4CH7A 3LDLA 1Z21A 3VS5A 1ENHA 1PRMC 3LDNA 1X58A 2O8FA 3AKZA 2H09A 2X74A 4KH1B 2UV1A 2QQ9A 3OYDA 3P7NA 1N33K 1OCCH 1WN7A 2K3PA 4M77G 1YW7A 1VSMA 2HHQA 2K9NA 1GOCA 3OJSA 2DA6A 4GXOA 2DD4A 3GCMA 1N77A 4M78C 4IG3A 1KYWA 4OP0A 2R7XA 2PG4A 4FJNA 1YWOA 1UCRA 5JVTA 4EMSA 2E7WA 2Q0OA 4MLEA 3J80K 4UC4A 5I2MA 3SZTA 3I5RA 4EGYA 4NOYA 1ORNA 3BTLA 1AVZC 1X1CA 2RJFA 4EW0A 4QLCU 2KMTA 2QI2A 1LDKB 3I0WA 1O9SA 4KH4A 1RDUA 1VQPQ 1NOYA 1QVTA 2CUZA 4WYBA 4M77F 4V19K 1TK0A 4WQ4A 1FKPA 1UFFA 1LWYA 3D7EO 4DYRA 2XAGA 4YHHK 4ZHRA 2HEQA 3FGUA 1RPWA 2JOYA 2M3AA 2LBFB 1IKXA 4B1YB 3AA4A 4J2AA 3CCEI 4B8XA 5KN9A 1OZ3A 4BEHA 3PE0A 3K2AA 5CYMA 3R6SA 2DO7A 2MF2A 2XC7A 1ON2A 4JDSA 1ATSA 4A3KJ 2X3XD 1I1SA 1YQAA 3BW1A 2E6ZA 2RF0A 1ETXA 1ZG1A 4XLFA 5K7ZA 5B5EC 4M73A 2XHKA 4JLIA 2X6NA 5JI6A 5ILVA 2L3RA 3HFNA 2NLUA 5AFUA 1ABOA 3TMOA 2R93J 3GF2A 1QO0D 3CCUA 3RI4A 1BQMA 5CIUA 2E2QA 4IUVA 4BI8B 1I5ZA 2QASA 3QJ6A 2ASPA 1M1EB 2I5UA 1U1SA 4IFEA 5A0LA 3CCUI 5IYBJ 2IVNA 1TT5B 2R7TA 1CKBA 3E9PA 2O31A 1NYFA 5GAHP 4NXNK 5CZ2A 1EA3A 5BR8K 1NLOC 2K9QA 1R5ID 1PC0A 1BCMA 4LC9B 4DWIA 4ZN3A 2OX7A 2FBKA 1UB9A 4KT5C 4M77D 4IQJA 5ICFA 3S32A 2EFQA 3FZVA 2HDDA 2OV7A 1K61A 4Y28E 4KH6A 4MFBA 1BC7C 5IP7J 1AOYA 4M7AB 2BGGA 4OMPA 3SQ1A 3MKWB 5FWBA 2ETHA 4BQAA 4IHXA 2Z1GA 2PVDB 4UUVA 3EG2A 5DEQA 3SD4A 2DLPA 3WU1B 3I56T 4U88A 2X3WD 4RCBA 1MW7A 3M8SA 1Q81C 3O3KA 2E5ZA 2LMJA 3DU6A 2YHYA 5GIOA 4JKBA 2E4HA 4BHPA 1OX8A 4BE2A 1K7AA 4UNFA 3M0PA 3SLCA 3LWIA 1QCFA 4RCCA 5LJVA 4G7OF 2ESWA 3NHNA 2LCCA 2KTQA 4RB1A 2CSIA 3CD6N 5D4SA 3M1FA 2EVRA 3V6DA 1XNRK 2FOWA 2ZD1A 1S5LC 1TQPA 3QBXA 3L1PA 2E1HA 5F08A 4A61A 1KQSS 3HKZN 3C18A 4B08A 4DLEA 2O88A 4A54A 2LC2A 1YW8A 1ZQ1A 3AVMA 4YOVA 2R7QA 4GKKK 3TAFA 4KDPA 3K4NA 4M3XA 4OAYA 4HRIA 2MPXC 1YT3A 2P9LA 3JCMX 1XG7A 4E1JA 1LJOA 1D1CA 1FSHA 3ABUA 2RQRA 3Q0UA 3DMJA 1WKMA 2YHAA 1W5TA 3ULRB 1OH7A 4J7IA 1IZ1A 5FKKA 3OYNA 3OR2C 4FASD 1P4WA 3QO3A 2MD0A 1WSIA 2EW3A 1I50J 3T1BA 2NYXA 2ETJA 3WGIA 1DGWY 4WXDA 2R7OA 2KDZA 4ISFA 1VQMQ 3JCMV 2M02A 2D5VA 5C12A 1NGNA 5AQJA 4RTUA 4CHOA 4B8CA 3FMQA 4O0JA 2O9SA 1WIEA 3K10A 1HDDC 4J6YA 2DT7B 1W7PD 5KE2A 3BROA 4JLHA 3IH3A 4EMKC 3D4VA 2V9PA 3PL8A 1JKQC 3QG1A 3BR5A 3A8HB 2ESNA 2F6CA 4C1NK 3QYFA 2NRHA 3KWIA 3W3DA 2PTKA 5DK5A 5CLSA 2CZ7B 3G71I 1KAYA 3SV3A 4L8RB 1U9OA 3KFWX 4EHTA 4AG1C 5M3FJ 1WLPB 2ELKA 5DMRA 2KPMA 3K5LA 3I59A 3FFKB 5GANe 4HAMA 1X4OA 1OFCX 1OR7C 4P5OA 3CC4T 1YRNA 3M8RA 1G59A 2EKHA 2DDAA 1Q81O 1YW9A 4C8QA 3CO6C 2HF3A 2JVVA 5A2QO 3HEFA 1W0TA 2PZ1A 2CJJA 3WTWC 3CEYA 3QYBA 2YG9A 4VUBA 2DTRA 2LJ0A 3C0CA 5AQLA 5IXBA 3DLLF 3ALYA 5HBMA 3B8AX 4IOCL 1VI0A 4HDVA 1C0FA 3F9MA 2K7LA 3WU0A 5F2RA 4M3FA 3CC7A 5AQHA 1JL2A 2O01E 1DLOA 2V8KA 3H5NA 1X3MA 2VB6A 2J4RA 4IPAA 3M4YA 1DTQA 1BL0A 2Y9ZA 3FXLA 4A59A 1ZREA 3CC7I 3CQYA 3UKRA 1ZLJA 4KHPK 2RQTA 4PJOG 3REBB 2CW8A 1V54H 2DXTA 2DRMA 3Q7CA 3H3ZA 1VQPA 2M0CA 1D5AA 3FHNA 2EYWA 3ISNC 1J53A 4GVMA 4I6MA 1OPCA 2GOMA 1X2KA 2E19A 2LRDA 1PU7A 4J9HA 1I27A 1SD4A 2A37A 2IXSA 1VQPI 1JGGA 3QEXA 3AA5X 1O3TA 4RW7A 1LWCA 4DFKA 3X20B 1X19A 2BE2A 4BJ6C 3RNJA 2VJJA 1XQSC 1NK8A 2ABLA 4CEQA 4OMFB 1I3AA 2KRNA 3LX7A 4O4GA 4FYYB 4PJOF 4NCAA 2VQEK 2LKSA 4EVVA 2K4JA 4RB3C 1VRLA 3ZSRA 2KT8A 2RHIA 5HDGA 2P84A 3DXJF 3JAME 1Q81U 2C0OA 4Y91A 3CDHA 4NYFA 1IN8A 3OBYA 3SFMA 5CE3A 3V9WA 2L89A 3H08A 1XTAA 1S9HA 4X9DA 1N25A 1ZYQA 2P5GA 2OQRA 1ZG3A 4MZPA 2D0QB 2HGCA 3D2FB 2KI7A 4DZJA 4NC8A 5C0YA 1WXUA 2W10A 3LAMA 2M34A 1M3CA 3L9FA 3DKMA 2CYZB 1ONVA 2BW3B 3S14J 3ZR8X 1Q9YA 1IGNA 4FOIA 3N4PA 5FKLA 1BI4A 1KD1C 1JJ2M 1RRQA 2MSYA 2P7CB 1U78A 4H4MA 1YQKA 3GE1A 2LNBA 3DXKA 2L7MP 2PVGB 1GV5A 1BL3A 2L4AA 2R5ZB 3GNFB 3KXTA 3PNTA 2XB0X 3CTAA 2HNHA 1VQOT 3JTHA 5KCMA 3ZN0A 2OBPA 4KYWA 3QYEA 1RAEB 1QQIA 2QQSA 4EZ9A 1AWXA 5DM6L 2ATQA 1VQ6T 1M1GA 4B9MA 2WBNA 3OYCA 5J1YA 1RUWA 1J6ZA 1UA0A 3CZ6A 2DLLA 2NS7A 3ZMUA 1ZR2A 3VF2A 4FWQA 2GXBA 1U49A 3PIOL 1MV0B 1YITA 4I7FA 1I6XA 2HQRA 2J05A 3K1NA 3OY9A 3VYRB 4J83A 5IOYA 3KYLA 1MMSA 2NAZA 4PJOD 1D1AA 4ESJA 4IVNA 4M71A 2R5AA 4HWIA 2NVXJ 4WQ4C 2X6WA 3I56Q 1P90A 4A2BA 3L2UA 3GOIA 3SHWA 4BGBA 1H89C 2ESHA 2RJEA 1GLDG 4K11A 5DV5A 1SKRA 3GX4X 2RNGA 3M8JA 2YNHA 2ZWHA 4L9NA 1ATRA 4MFEA 4A4HA 3FDYA 1KQSA 3IP4B 1FOKA 5GMKj 1MA9B 3REOA 2BE5F 4F52A 4XH5A 1IKVA 2ZFUA 1BC8C 2JZYA 4BROA 3VYUB 3OYKA 3I8DA 2PNIA 4M78B 3QOEA 3THYA 5CKBA 2KEAA 4EJUA 4B22A 3F0CA 4QTRA 4OIPF 5LHHA 1ZR4A 1ZAOA 3GLXA 3HRSA 1TC3C 4GVEA 2XRLA 4XTXA 5BPDA 2E4LA 2P9IB 1T33A 5AQTA 5SZTA 1KD1O 1HSJA 3SPYA 3TSZA 4CEZA 2VQFK 1FKOA 5KH6A 1XSVA 3NTKA 4LFUA 2YV0X 2OTJA 3K0LA 4M3RA 4CCLA 4LG0A 3QKJA 3G6EA 1S1XA 2FUG2 3HVTA 3X2QH 5AQKA 3DKXA 2F5FA 5GAMe 1FJLA 4LF6K 2NOEA 3PQKA 1VQMA 2JA7J 2B6AA 4OJRA 4OU0A 2O8BB 4C92G 4DFPA 4OF1A 1KG1A 2ID6A 3CF2A 4WFBL 2M7AA 3SWNA 2BZTA 2E5LK 2EA4A 2J06A 1VQMI 2KYBA 2YLCA 3E6BA 4DSKA 3IAS2 4U0VA 3FXJA 3FB9A 2LP0A 1NKBA 1XOVA 1YI2T 1NGFA 2FVUA 4JKEA 2KZMA 4E7ZA 1RT7A 1B8IA 3HUGA 1N9RA 1JKHA 5GJWB 3OTOK 3FBNB 1W97L 1M3QA 3R4KA 4FPAA 1BI2A 3NNQA 3HIFA 4C92F 1B07A 4F9OA 4PUOA 3GF5A 1SF9A 4H4OA 1XC5A 4JI2K 3I64A 3HT3A 2OPPA 3O9UA 1C0WA 3AVFA 3CW7A 3ABTA 4XTVA 3QYHB 4RTXA 2HNDA 1ZG5A 1ZSZA 2VXDA 4IUTA 3C6AA 4CGZA 3O5ZA 1OCRH 2IIRA 4FJKA 1KD1U 2E88A 4ABZA 5LJ3h 1I81A 3O1WA 3VUZA 1YFHA 3RTVA 3W3CA 4BC2A 1BOTO 2FMLA 1Q81R 1SRLA 3HZJA 4MMLA 3ZPLA 5EG0B 2VG7A 1VYVA 4PLIA 4MZTA 4DLGA 4CHZA 1SFUA 3DLAA 1HR0K 1FNNA 2FSNA 3ZMZA 1C6VA 1JLBA 1R59O 4DW6A 1OJLA 1FIAA 2EKOA 4AHTA 3N97A 2WV0A 2DFUA 3DXMA 1MMAA 1U6GA 3A03A 4DGWB 2M5WA 2IW5A 1X3UA 5J3BA 4YRVA 4O8KA 3QP6A 1Y71A 4BHCA 1VSDA 5D4RA 3MHXA 3JCMh 1NK6A 1K6OA 5E17F 1RTHA 4J2BA 5LLQA 3MK6A 4R8HA 1U9NA 4HF0A 3O1BA 1QVGP 2HZDA 1VQLN 4A5MA 3DLMA 3K70C 4M9SA 5AQFA 3IQLA 3S1MJ 4C92D 3ME9A 1UAXA 4DOVA 1I3QJ 2PMZN 4DSEA 1WSJA 4C5IA 3D2EA 4JN4A 2YG8A 2C6YA 3CD6Q 4XQFA 3FFIA 3SDZA 4XEIA 1OEBA 4EFHA 2JNGA 2ZNZA 2XV4S 4DBFA 4Y52J 1IN4A 1CKAA 3UDCA 2J6FA 4XAXB 4K41A 1YFNA 2QM1A 1H3ZA 1YITT 1BW5A 3DU5A 4OOIA 3H0HA 3VERA 2L3DA 3AO5A 3UA6A 3CPFA 4BAYA 3F8BA 3JB9G 4YFKF 4HA8A 1Y39A 4DR4K 4NZGA 3TW7A 3PO4A 2FPDA 2IT0A 4HTLA 3NPFA 3SQNA 2DD5A 5JVHL 2QWQA 3BF1A 3A5ZB 3GFJA 3QODA 4KN7X 4KNYA 2O0YA 3HM8A 3RSNA 4OMOA 3C65A 4CEEA 1YTAA 1YIOA 3MMYB 3DLKA 4LGWA 1VQOQ 1MNEA 2FBYA 1H9TA 2EJ9A 2IP2A 4DZPA 3GWZA 4MDXA 1VQKN 4EMKB 3MEWA 3RMCA 3JB9F 3CCYA 1K0XA 1MHNA 4A2UA 2EZHA 1KEAA 1VRTA 2EBIA 3I71A 2JGUA 3OB9A 2BOLA 4KIGA 4X65K 1ASVA 3ULQB 3QBYA 5E8IA 2BTFA 3CXCM 5KYXA 5DD4A 3X25B 3P4IA 3LFKA 2HQHA 3FHGA 2COZA 3VQ7A 5AYFA 1DTTA 4OB0B 1B59A 5M1OA 1PD1A 1RRJA 4M3WA 2ZBKA 2MD5A 1E6HA 1XQHA 3TU5A 1OCTC 1SAZA 1VQ9N 3F8CA 4BY6C 4ASNA 5GP9A 4DR1K 1MD0A 3LLRA 1R23A 1G3WA 4C2UA 2A6EF 4J6XA 1WQ2A 4LMYA 3OS5A 2P4WA 5KVRA 1TUGB 4RW8A 5KK1A 4IQ4A 4LF8K 3KLEA 1JB0E 1WSUA 1RILA 4V19S 1IO6A 3PSFA 2QCOA 1HBXG 1O7FA 3NRVA 1ZHFA 1M1KR 1W4SA 1YJNT 2X9HA 1RAFB 5JHFA 2VC8A 4RM2A 1X6OA 3OMYA 1RT6A 2RN7A 3F2KA 1WHMA 4FWNA 3SEMA 4DV4K 3MEDA 4PK4A 2E3IA 3RJPA 3PIOF 3MEXA 1CGPA 1HQEA 1R8OB 3TPQA 4UB8C 5JFRA 4I98B 1RT3A 3ID8A 2RV8A 3M4OJ 3S2WA 1TOVA 2MWPA 2KGTA 3URGA 5EGOA 2LX7A 3VYGA 3JB9D 2W1OA 2PBIA 2PBDA 1Z3XA 4AH9A 4Z94A 3H41A 3TARA 4A93J 3FZHA 2RE2A 1A6QA 2CT4A 3S2DJ 2F8SA 5I11A 4CCHA 3MP8A 3EFSA 1JBMA 3UB5A 4L59A 1NEGA 4AQYK 2M16A 5A2QZ 4DF8A 1G2HA 2OZ6A 4Y1CA 3M8EA 5D5UB 4KIBA 4RLFA 4QIWN 2G7UA 4J00A 3THXB 4M77E 4HLYA 2VXFA 4F2RA 3F22A 1KD1R 1T0FA 3LDOA 4I09A 3LNQA 3FZFA 2BBYA 2OZUA 4JHDA 3OW2P 3S3NA 3QOPA 1FEXA 1YI2Q 4CIEA 3BR0A 3CCJA 3ZX3A 2FX0A 2DBBA 5AQGA 2AKLA 4M45A 4BRNA 4N0BA 3HM5A 1XDSA 2QAZA 1NK7A 5HRRA 3OYEA 2RMOA 4ZGEB 4G6DA 2E60A 1XC3A 3CLQA 1KLMA 4B23A 5GAN6 1JRIA 1MGQA 2E20A 1AHJB 4BXFA 2A08A 3PX6A 1M8MA 4X66K 2Y90A 2O8FB 1JKRC 1RDAA 3SJJA 2NVYJ 4FJ5A 2O7OA 4KREA 2DPPB 4UHTA 3TAQA 4YFXF 1JEGA 1RAGB 3A8MB 2HBPA 3AA3A 3EFOB 5GAOp 4WX9A 5HLFA 3KLIA 1ZA2B 1G6NA 3IRRA 1H0MA 2AZSA 5AONA 3UF4A 2V9KA 3U9DA 1HYZA 3TL4X 1U2VB 4B9VA 2IG0A 3QICA 1DPRA 3H5AA 1VIFA 5BQTA 3K4BA 1FZPB 3QIOA 2LREA 2MC3A 1NGJA 3G1OA 2DDBA 3GXOA 1QGPA 2MGQA 2ZGZA 3TDUC 3WVDB 1ETVA 3ZN1A 3UKGA 1QQCA 4F55A 1QHHD 4XTYA 3CJNA 4HT8A 5AQPA 5TGTA 1HRHA 1OH5A 1DU0A 1MPGA 2QKMB 3MQ0A 3KD5E 1QU3A 3AVCA 2RD1A 4J8FA 5EDNA 1F9NA 1GCQA 2LY1A 3KEQA 3ONQA 2QUFA 5BPLA 1XNQK 3F3XA 1TV6A 3HOUJ 3GG4A 2F5DA 4BEHB 1IXRC 1GOBA 4HVUA 5M1PA 4F7UB 5GMKh 3SWNC 2FA5A 4XKWA 2YI1A 5GAOl 2Q36A 4E2FB 1S9EA 4PFPA 3CD6A 1FBQA 1RBSA 1RI0A 4AILC 1NGIA 4P55A 4JK9A 1WEIA 4JKAA 4FK2A 2O5RA 1HYSA 3IG1A 1QVUA 1Z7LA 3RIRA 1SS6A 2VC1A 4J9DA 3O4WA 2HKQB 2GOXB 3ULDA 1WA7A 2CGPA 2V9VA 3HKZA 2KRHA 3CD6I 2QDYB 3E9OA 5L3BA 4B3XA 1T6DA 4FZZA 2KRMA 5CR2A 3AVBA 4BR5A 3A2KA 4IL6C 2LQ8A 1EQYA 4G7ZF 4OFHA 1IJWC 4BH9A 2QZ8A 5EOYA 3JV3A 1W0HA 4ID5A 5CVUA 5K1YA 2QWLA 5AJ3K 1Y0UA 3P8DA 3KTUA 2O9VA 4PJMA 1WDXA 2VKNA 2COBA 2B0LA 2HKNA 4M3EA 3O80A 1NYGA 1T05A 1T8EA 2K9GA 1X3NA 1GVDA 3DQVC 3OMCA 1AKHB 5B8HA 1ZRFA 3K5NA 2LOOA 3SQ4A 1I07A 4FJ9A 2NRZA 5KYWA 2PUKB 3M0TA 3O5BA 2XF7A 3BEXA 4N4NB 4M72A 5H6RA 4LDYA 3QWYA 4FO0A 2YRVA 1IKYA 3RPUA 4EAHD 4RGRA 3VYSB 3JREA 5GAMg 1WFWA 1A5JA 2JMAA 1VQ8T 3ZX0A 4D8DA 4D9JA 5EY4A 3VQQA 1IHWA 1PJRA 2D45A 3H6EA 3K1PA 4DV5K 2KROA 2E71A 3JB9H 2E2OA 1ETKA 3SXYA 4QWQA 4DTJA 1U2WA 5I22A 3H3OB 3K5OA 3CJAA 4FLWA 2GIVA 1EX4A 3KWGA 2JQ7A 4ZDLA 3O8VA 1FTTA 3N0UA 2ZGWA 3NAUA 5HL7L 1ETYA 1NZ9A 2MWOA 3ZYYX 3ASOH 3S2HJ 3I54A 4H03B 3CMEN 4LUDA 3W2VA 2P9SA 4OB2B 3CQTA 2G8HA 3COAC 4Z8AA 1LOJA 2VKHA 3PO5A 5AQQA 4J5YA 2CKKA 3PNYA 3F23A 2NYSA 4ZZDA 1JLEA 4BY7J 1LKXA 2FF6A 4CI6A 5M1QA 3AG4H 4R56A 5C15A 4HSTA 3IS9A 3ID6A 4FW2A 4L5GA 2XAQA 4EM1A 4X62K 3CCQA 4LF4K 5F04A 4IRIA 1POGA 3KLHA 3I55N 3VS1A 2HNZA 1WJSA 2VUBA 4FLUA 2ECBA 2P9LB 2XASA 4B9QA 1LAVA 2J5OA 3DV8A 5EEHA 3TOAA 2OU2A 2VUMJ 2AHQA 1UHSA 3RZDJ 2KFZA 4BY1J 1G99A 2EV0A 3ZSXA 2O3FA 1RBRA 3LANA 3QDKA 3CCJT 3KP2A 1UJ0A 4Y1DA 2CQNA 2JUCA 4B8AB 2O4IA 3PIPL 1STZA 5AQVA 3VTIA 5ED4A 3Q9SA 2M0YA 4C8KA 2F2XA 3CUQB 3VU3C 1P8ZA 4BDYA 4M7DC 4PL7A 4F8RA 4H5NA 4UUTA 2XDPA 3ENHA 1RLPC 1ON1A 2VWFA 4KN4X 5KYUB 2JTMA 3WODF 1WI7A 3AVJA 4CZEA 4PCQA 2JPSA 3CCRT 3PQJA 4LD6A 2E3HA 2CP7A 1DDNA 3GP8A 5BS6A 4HYEA 1OH6A 4AFUC 3V9SA 3CJ9A 1ZUYA 1QVPA 4CGGA 1KO9A 1SFKA 1YTUA 5TISC 4KAZA 2OPQA 1LVAA 5A0GA 1VQ7N 1H8AC 3AL0B 2GNCA 2BYVE 1ULYA 3R6MA 3ZT2A 4CK1A 1YRNB 1ZGWA 4F4KA 2L2OA 3Q3SA 2OQGA 4YFNF 2XD0A 3AVKA 1GCPA 2ZF5O 5I42A 1BDGA 1I4K1 3E0JB 4LDWA 1FW6A 4PJOE 4RB2C 4BRQA 5EX5A 3MDQA 3I0XA 5FLMJ 1TW2A 3HB9A 5ICEA 3OH6A 3O4QA 3PT9A 5JS1A 2HHHK 2KJCA 5CYQA 3U1KA 1YX3A 4KHNA 1LWWA 4B4CA 4FZYA 4RTVA 2DPNA 3J81E 2H1KA 3CC2N 2H8WA 1ABQA 3CJBA 3GTLJ 2E5NA 1WH5A 1JLAA 5K7HA 4BC5A 1OYWA 4ZZLA 2NRTA 3EYZA 4M75B 2GWJA 2DY4A 4DQIA 5BRHA 1O3SA 1IXDA 4Q47A 3NMUA 1VQKQ 1GUUA 5IT9O 3E2UA 2X9DA 2EQJA 1IBMK 2CFXA 4Y13A 2JJ9A 1QPIA 2FEIA 3UKRB 3JCMe 2HVRA 1K78B 4JX5A 1AT1B 1HW2A 1OH8A 1K8KB 3O2PE 3EUHA 2EQUA 1S72T 1SEUA 1IG8A 3HTRA 4A3GJ 4I6MB 1BIBA 3ZQHA 3EH1A 2Y75A 4WCEL 4J8OA 4DR7K 3RERA 3ISPA 3PX0A 5J39A 1NG2A 4BY6B 1R36A 4MLHA 3B6PA 3ZQ7A 2OTLA 2P51A 1VQ9Q 4IIMA 1PD0A 5D6EA 3VOEA 5HODA 5B3SH 3KCCA 4FYVB 5FPEA 4C8QG 3OYHA 4BBRJ 2CH6A 5J2MA 1GV2A 3NARA 4X9CA 1RACB 4DU1A 1K0SA 3LWMA 2DM1A 3CETA 1MSFC 4B09A 3M59A 4BRDA 3NVKA 1KIKA 2EHGA 1J2XA 4CFAA 2R5MA 1HC8A 1T0FC 4CF9A 2MYSA 1R4MB 3LWHA 1KQSP 3TSPA 1HX1A 4CJVA 1R0CB 3KYCB 2EILH 5BPNA 2L01A 3A2FA 3M7GA 3QZ5B 1N6QA 3E7LA 4WFAL 3OYAA 2MA3A 4C8QF 3G25A 1BI4B 3SUOA 4IFVA 3RBBB 1V55H 1X4PA 5FU6B 4C1NI 1XC9A 3TEDA 1GLFO 2VKDA 4EM2A 4Y92A 1HNWK 3T69A 4W97A 4YIRX 1K76A 3E01A 1LEBA 4CD3A 4LF7K 1XCVA 3GFIA 2XRIA 3OJUA 3ZMDA 4MO4A 2HBLA 2QTVA 2C0TA 1WHGA 1XGNA 2IVOA 1BHLA 1HNXK 2DA4A 3AGKA 1NGEA 4JZ3A 2K40A 3QNNA 3GDQA 4EZ6A 1B72B 1OX9A 3CF5F 4NHJA 5LGNA 1NKCA 4HNVA 4QPQA 3RMSA 2XVCA 2JTFA 2ZJRL 3AGRA 4B48A 1R1VA 1MZBA 1SD6A 4N76A 4ZDOA 4A3DJ 4IWVA 4QCLA 3K57A 1FSEA 4CEDA 2E41A 5LGUA 3JXUA 3CCQT 4IO9F 2BUPA 4ZYEA 1KG2A 4AFSC 1ZRCA 2OFKA 3F73A 1Q7YU 2YX7A 2FRYA 8ATCB 4QQ6A 2K3BA 2RHUA 2HPMA 2A1SA 2DFHA 1YYVA 2XY8A 1NJIC 1GCQC 2RN2A 1OLTA 5FKMA 1I1GA 3A0BC 1WZOA 4FPBA 4BUPA 3VYHB 2XROA 3PFSA 2FSWA 1KVAA 2TRTA 4W1UA 1ASUA 3OVNA 2LVSA 2Z1IA 3VSLA 3M57A 2VI6A 4C8QD 1RT4A 4U7DA 4IG0A 5GANj 3OA6A 3QMLA 4MO5A 4A5BA 5L3DA 1RLQC 2LKXA 1WJ5A 3THYB 1BU6O 2JVHA 3MEGA 2EK5A 1DUXC 4BVOA 2YS9A 2HXIA 3IC7A 4C92E 2Y0SA 4L5IA 2Z0WA 2DTZA 3FLGA 2HYFA 3KP4A 1WQ7A 1KQ0A 2CP0A 1WI3A 3X24B 5E1WA 2QGFB 3ZSZA 1KAXA 2PJRA 2WWYA 3ASMA 4M7AA 4RAFA 2CP5A 1FTZA 1BCOA 5AFUH 1T08B 3U4LA 4CA0A 5EYRA 2HBWA 3F72A 2CUBA 4EIAA 5GAMd 4JUVA 2M4KA 1IG7A 5DUKA 4LFBK 1DT9A 4GYGA 5CYVA 3MCZA 2HEOA 3SNNA 2EJGA 1HKBA 4KHYA 2LJ3A 4H0EA 1MDUB 1K9MC 3TO9A 3LSRA 4UOBA 1Q86C 2FMYA 3RQIA 3U9GA 2K27A 2L9VA 2QSGX 1Z7UA 1VQLA 2KVQG 3IMXA 3G7ZA 2PY5A 3K1MA 2CP3A 1TQMA 1PUEE 3AO3A 3SWNB 1NJZA 1PP8F 3BQZA 4C5HA 4J9GA 1MGTA 4JPBW 5KPRA 2M0OA 4E6RA 1N27A 3IAM2 1RTIA 1KU3A 3RQ4A 5CHIA 3SZPA 1VQLI 2L7FP 4AFZC 3DRSA 1RT5A 4D7NA 5D5WB 2RN8A 3H9NA 3ZQLA 2VPLA 3EKSA 2O8EB 1JE8A 2QQ8A 2F4VK 3J7YJ 2JWTA 3FXRA 3JCMJ 3JW4A 5MLCQ 5DM7L 4BB7A 1VQNA 1H92A 2DN0A 1K83J 2FHDA 4B1VA 1YBYA 1TTYA 3LSGA 1NJIO 2DX1A 3IHOA 4E9HA 2VV5A 1PU8A 3H9JA 3NMZC 4CZIA 1RR7A 4QVDA 3V42A 1XNIA 5AQWA 3J7AO 2KZZA 1QQNA 2Y30A 2QBYA 3CJ1A 1M8VA 2OTLT 1RDBA 1DKGD 2JXBA 4A12A 2F2VA 4EP5A 2DI3A 1CZAN 3GFMA 4RUGA 4YELA 4E89A 3FMRA 3WHCA 1RABB 2GTJA 2VBYA 3RR7A 2JRTA 2DL8A 4CEFA 2QA4T 2PI0A 1VQKA 4B21A 1EZZB 4L9VA 3PLAA 2A05A 4GNIA 4K42A 4C0DC 3VQ6A 4N9IA 1VQKI 4C3JJ 4OIRF 1IXCA 4I01A 1V3FA 1TLHB 1IV0A 1WRJA 4L3QA 5LJ5j 3H0FA 3GVAA 2YT6A 2BE7D 3CJCA 2V79A 5GMKe 4C2MJ 3MWTA 2KE9A 5J1EA 1TUCA 4K43A 4XIUA 3I33A 1OISA 1GHCA 1X3WB 4PUSA 2X48A 3OL4A 5JMVA 3ABMH 1K9MO 4KMFA 3GIBA 1Q86O 3CMEQ 3K58A 2RQWA 3TSQA 2VKVA 4J6WA 1I0CA 2QWOA 3KKRA 4E1NA 4F04B 4DU3A 4EIKA 4C23A 2OC6A 4EGZA 1VQ9I 3I9V2 1TKXA 2IS3A 1ZBSA 4Q5SF 3F8MA 1NGGA 3A02A 3HSEA 2RGVA 1VFCA 3D2EB 4ISEA 3LZIA 2JUGA 2DJNA 3G4SA 1QZYA 3CJQB 3LA2A 2XF6A 5C4JJ 4FQGA 4NB5A 1K4SA 2VJ4A 4XORA 1VZ0A 5A2QE 1GFDA 2LH9A 2K86A 3EHQA 4BBSJ 1M2OA 3J80O 1EWRA 1YAGA 2IA1A 3SFIA 1JXOA 3U6FA 3NHGA 1KSWA 2VKEA 4QQGA 1RT1A 5CKTA 2RAEA 2DK5A 1EWQA 3FBIB 2DBMA 4I0BA 5AQRA 4MEYF 3WTUC 3CLOA 4Z89A 2AQEA 4CJ7A 4F92B 2W0ZA 3M58A 2LTPA 4OGEA 3CQXA 2E5QA 4UY8I 1N6AA 1YJWT 4Y15A 5KAIC 4CYDA 4ZH4F 4DG1A 1IC8A 2JN6A 4HHTA 1E4GT 4OMQA 1E17A 1UEBA 4B1XB 1REPC 3Q5FA 1RZ4A 1YJ9N 4PNOA 5IXFA 3JRZA 1H9GA 4D5FA 1WI9A 1VHXA 4M7DB 2B5JA 3A01B 3C6HA 1NHAA 3REAB 3T8RA 1JKOC 5GAOm 1MNMC 3CPWP 3PV8A 3HHHA 2XGDA 4BRKA 3MN2A 4CK3A 1N8RC 4HXJA 4IHVA 1WBBA 2QEXT 1UG2A 2NNWA 1VF9A 4OINF 3WXJA 3H0GJ 2E1OA 2DO3A 4OIQF 1T6CA 1V1CA 3G71N 5EJCA 3TQNA 3EG9A 4CEBA 1IH7A 1K9MU 2LSNA 1Q86U 3EUHC 4EJYA 2LNVA 1FN7A 3L2ZA 3CCMA 1VQ7Q 2LYCA 2F2EA 2OCCH 2AIRB 4N4GA 4BDZA 3OSVA 2IPOB 3CVTA 4PSWA 3D2FA 4R55A 2VQCA 3HHGA 1RBTA 1VRUA 3K4CA 3SYTA 4XKVA 2V6CA 2X4WA 3L2RA 4BNCA 5BMZA 1KLNA 2BW3A 4BE0A 1W1FA 3C7NB 4DF4A 1RUOA 1TSFA 3RSEA 2VVKA 1FX7A 1HPMA 2OAUA 1NEBA 2XIDA 3IWFA 4RW4A 5CZ1A 2ZCFB 1USSA 3CC2Q 2R5ZA 4NDLA 3GNGA 3R6OA 1K6YA 1ZARA 1NGBA 4FSSA 1XHZA 4YOXA 2RK2A 4XTWA 4XLAA 3H3VK 1P7MA 4IDHA 1VYUA 2BY1A 3LA7A 3GTKJ 1IXSB 2ZJRF 2IAJA 4RM3A 4O3MA 9ATCB 4LFAK 2FBIA 1N36K 1S6PA 4FWRA 3ELKA 3QFPA 2WA0A 2CQXA 1Y8RB 2KRSA 3CCVN 1JT6A 2HTJA 2Z33A 5BRDA 2EGCA 1BIZA 2IGKA 3JCMg 4CCJA 1KZHA 2QKLB 4CZZA 1VQNT 3EGDB 2PYJA 2F4OB 2ZM6K 3BCBA 5FO5A 2LMDA 2PJPA 4HX4A 1WJAA 2GEMA 5AQUA 4KB1A 4PFOA 1SZ2A 2P0PA 5GJVB 1SL1A 4ILJA 3JR9A 2BIVA 5DS9A 1QVGS 1N8RO 4B1WB 2LD5A 2ZJPL 3SDBA 2BY3A 4H4KC 1O3QA 4CSWA 4HCCA 1BBYA 2EZIA 1BISA 3A5LC 2A1RA 1K9AA 2RQPA 3J7AP 4JHDB 4AVPA 4HVJA 4CDGA 1T3SA 1XMQK 4LITA 3AA2A 2W84A 1J09A 2HTSA 4BRPA 4JKFA 4G9YA 3P83D 5FJ8J 1EXQA 1R9TJ 5HROA 3HGGA 1UGRB 3KJVA 2HMPA 2UUAK 2KDSA 5IT9Z 3CVSA 1TS9A 5J40A 2G8VA 4CGHA 3R0JA 2CW0F 3OWTA 2P9IA 4B44A 1JTYA 2EYXA 1VTNC 2PX9A 2FU4A 1IDZA 2R7YA 1Z26A 4XN0A 5GMKi 2E7XA 2FZCB 2RPNA 3HRTA 2OF7A 2IC3A 4YTLA 3GUDA 2IGMA 1UJ8A 1QCOA 4XRSA 2H27A 3S17J 3EG3A 3AV9A 1BI3A 4CD1A 2AQFA 4JD2B 3ABLH 2YNIA 4WCIA 2JTVA 1YVNA 2HF4A 4KO0A 2O8BA 1HDPA 2F5VA 5LEKA 5KYNA 2JJ7A 2KIMA 5BRFA 5CKHA 2D1KA 3G4ST 1EETA 1IN6A 3NE6A 4L0ZB 2ZCWA 1NJIR 1N78A 1AWJA 1OYIA 4CJUA 1K1ZA 1IN5A 1Y6IA 4CYCA 3QXEB 4M7AC 2P0WA 1WH7A 1UB4A 3ZT3A 4EVIA 1Z1DA 1N8RU 4XM3A 1T39A 4FWMA 4G12A 4M74A 3I3LA 3H9GA 2Y4XA 3CMEA 1QMCA 3QPTA 3NGIA 5JLWA 1TKTA 3HOXJ 2RVCA 2AT1B 2D8HA 3M53A 3OA9A 4PA1A 1BQNA 4BUGA 3VSKA 2IDOA 4QS8A 4DQ2A 5BNGA 4FLYA 2FJ1A 3CMEI 4KHSA 3CMAA 3LPUA 3EGXB 2DXBA 2W82A 3QPSA 3THVA 3DEWA 2KFDA 2DETA 4Z4FA 3AAFA 4BG8A 4ELVA 2KISA 2JSPA 1Y56A 5SWMA 1GL5A 3I55A 5IT3A 3H6ZA 2ZKZA 4HZFA 2BUDA 2A07F 4HTUA 3TCJA 1MBFA 3ATUA 1IUFA 3P8HA 2WUSA 2JUFA 3QU6A 1K9MR 1PKTA 1KU2A 2QXFA 3CCLT 4CJWA 1Q86R 1PCXA 2C0IA 2DYSH 3LPTA 3LWFA 1SMYF 5EG0A 2HQXA 1Z3YA 4LDVA 3CCMT 3E97A 4ILHA 2Q3SA 4UV8A 2XAJA 4IOAF 2O8KA 5LHIA 2DTHA 3AVGA 2M9UA 3V4GA 1OPKA 4RW9A 1G3SA 5HRPA 4NL3A 1TAQA 1KG6A 2E8AA 2NZTA 1YLFA 4BJ5C 3WU2C 2RI5A 3KZYA 4B3RK 1TW3A 3ERED 3HSBA 3L1AA 3S6WA 2BH1A 1OKRA 1ZGAA 5D6YA 5EVZA 4BXXJ 4ICLA 1LFUP 4J2DA 3OHRA 1C1BA 1YHQT 4L0YB 1AWWA 2EIFA 2F5KA 2FZGB 2FLOA 3I5UA 4LLLA 4CCNA 2A3LA 3O9TA 3NH1A 2R7RA 1PKSA 1ORKA 4RGUA 1VQ7A 4A0ZA 3RRGA 5GAHJ 3LM2A 5GAOq 1YQMA 3HZ6A 3OW2S 3QEPA 4WTOB 3DFGA 3U3GA 4BQNA 2V6EA 3ZT0A 2JVGA 4NO7A 4H5RA 2W41A 1JXEA 1FWZA 1VQ7I 4Q0BA 4JI5K 3AVIA 4AF1A 3LW5E 2DEQA 2GFAA 3KIOA 4HBLA 2ZPIB 2WAQN 1LFBA 4HLXA 4EPCA 3ZCMA 1BYMA 4EATA 3FZKA 4W5NA 1WLJA 3CC2A 1D8YA 3GZ5A 2NVQJ 4CJTA 5KHDA 2GBYA 4ORZA 4NL2A 2KSSA 2WB1N 1UG1A 3M1EA 1RCHA 1LJ9A 4B9NA 4PJNA 5D8LB 1B4AA 3EG0A 4FLXA 3V1RA 1HU0A 1Y97A 5H6QA 2MCNA 3CC2I 3P8BB 1A35A 3ZSOA 4UNOA 4IHSA 4DTXA 3PTAA 4XKBA 4AHCA 3D0SA 3FISA 4DJAA 1QCNA 4EMKA 3CCST 4RTYA 5FLVA 5LJ5h 1JXBA 3U2RA 3ZETB 4IJAA 1X9SA 5K7FA 1FOXA 2Q31A 1AEYA 4Z4IA 3MVPA 1QVGA 1UMQA 1WZ2A 3J7AY 4BRIA 4KMUX 3VFZA 2MW8A 3SPZA 1W2BS 4IEJA 5E41A 1A36A 2R4GA 3T5XA 4FL9A 1KG3A 1SQKA 2QTDA 4MO7A 2BXYA 2M1HA 3AY9A 2ROLA 2OD5A 3ZP5A 3PO2J 4R1HA 3GEZA 2CV1A 4I99C 3RESA 1TUUA 4KUDK 1F36A 2YXYA 1M1FA 5IH2A 4G6TB 1V4RA 2A41A 5ADXH 2YSRA 4DQRA 3LQRA 3A5OC 4AIAA 4DQPA 3LGLA 1KK7A 3F8NA 3BG9A 1Z6RA 3ZQGA 2W42A 4CVNE 1A5WA 2WC9A 3W2WA 4Y3OA 2HVSA 2OJ2A 1J75A 2L0KA 3KP3A 4ZNXA 3DPLC 1BO5O 1UHCA 3NF9A 4CRIA 4H0XB 4B9TA 4HF1A 1N8RR 4RAGA 2B9SA 4AFQC 2FL7A 2F7TA 2HHXA 2W85A 2KP6A 4BGDA 1X27A 2VJ5A 4GY5A 3FHFA 3C6TA 4WXHA 1Y1VJ 4CXFA 3PX4A 4IJNA 4RG2A 5CKFA 3SQ2A 2KJBA 4CW7B 2L9NA 1OV3A 4C8QE 2Z1DA 2DIGA 3U23A 3JCMd 1KQ2A 3CMAT 1K4US 4F3QA 1TWAJ 4FM4B 4B43A 4B3OA 4UY8O 1SKUB 2NOHA 1JU5C 2W25A 1VQ5A 3VEYA 3CQ8A 4U0YA 3THXA 1DJ7B 1G3YA 5M3MJ 4DOZA 3RPUD 4BG9A 1HMVA 1D9DA 2R7SA 1W7AA 3DTIA 5GMKl 1N75A 5GADP 3J80Z 3I56N 5IY5H 5KNLA 1JQQA 4D7MA 2V8JA 1NMNA 3PGGA 4XSZF 4BVPA 1UA1A 3K2ZA 4WF9L 1QTMA 1PHTA 1D5VA 3NH0A 4HPQA 3MAJA 2EGAA 3S3MA 3TTCA 4KICA 1U06A 2YLBA 3FXQA 3IH4A 2GAUA 2FRWA 3VQ8A 1U45A 2VL8A 2HB5A 3CJTB 3L00A 3ZGKA 3EFOA 1IO2A 4DSFA 1K73U 2R7ZJ 1S7AA 3CBMA 2PU9B 1MBEA 2LLKA 1PDNC 1SMTA 2B8AA 3BTIA 4LD0A 5DLQE 2HSTA 4A53A 1REVA 3F6OA 2X1DA 4CF1A 2ATCB 1VQ4N 1U2VA 1HSTA 2HL5C 4O6JA 4CE9A 2Q1NA 2FXAA 3OSSC 4X1EA 3GZ6A 1BUPA 3CCLQ 4Y4RA 2M4GA 5FFZA 3OV8A 3Q0VA 1Z9ZA 4P9UA 3VQPA 2KR3A 2IIMA 3CCVQ 3WGGA 5E18F 3OYGA 4DV1K 2O4GA 4OPJA 2HQAA 4A4FA 2E2NA 3PUFA 1LAWA 1QHGA 3CCEA 5DD8A 4MDAA 2V1RA 4B1RA 2X4YA 2RC4A 1QQMA 3QZ9B 3PNVA 2IRFG 3AVNA 2E6MA 1U48A 1FYNA 1YIJT 1U84A 3K9JA 2A36A 1P7JA 2G8FA 3WTSC 3C6UA 3OW2A 2OYQA 2F1LA 4F7UA 3MFKA 2YJEA 1WJDA 3MKZA 4XH4A 2E5KA 2VQHA 2EB7A 4FT8A 5FLXK 1QZ6A 3TOBA 3HOYJ 4DBQA 2ZPBB 1SPKA 5F1JA 4BKXA 4FWPA 1RRSA 1TU0B 1SVMA 4F16A 1FT9A 3SBGA 1MH3A 1FXXA 1Q82U 3NWSA 2ZJ2A 4ZGJB 1QKWA 1IG9A 3CC4N 4FE7A 3JCMc 2DMNA 2CH0A 4CESA 3QWXX 4K25A 3V9UA 4KFBA 5IPAA 3BLYA 2E12A 3EZ5A 3LGFA 1IJJA 4H0OA 4A2AA 2FSJA 1UHMA 1HA8A 1ZUKA 1GLLO 1IBLK 4B24A 1HK9A 1YO5C 2H56A 1KGSA 3SFZA 1QQOA 3M3YJ 4KGXB 3L2WA 5KPZA 3M0SA 2EV5A 3S1NJ 4A3JJ 4LB5A 1IKWA 1AKHA 3HSRA 2P8TA 5ICCA 2FPEA 4GMJB 4CJPA 4XL9A 2I7PA 2RJDA 4JKCA 5LJ3j 1QVFS 1CXQA 3ZQFA 2A5YB 4BYYA 2PJRB 4JZ4A 3HKSA 3LAJA 3FDRA 3DLLA 4YDUC 1MNDA 4H5WA 4P5NA 3KHYA 2LT4A 1W2BA 6AT1B 2KFNA 2AKKA 2JWLA 3C2HA 2Q2EA 5HS9A 4IURA 1A5XA 4RTFD 2X51A 3FK7A 3RUXA 4FJ7A 3RR6A 3WUHA 1OQKA 2K5CA 2KHOA 1BW6A 2ZXJA 4DSJA 3L6QA 4A3IJ 5EF6A 2K3XA 2NRRA 2IS4A 4YOQA 4JKHA 2ZZDA 1NGDA 4B3TK 3KP5A 2DJIA 1MIJA 1FOWA 1B6AA 5J1RA 4FK4A 5H20A 5E26A 3JRBA 1D1BA 4B9XA 1Y8QB 1GOAA 5CQYA 3JB9J 2IGIA 4BRCA 3CJRB 3DJCA 3V81A 1JLGA 3HOVJ 1ITYA 1DU6A 1C0TA 3H0DA 2ELJA 2JHNA 2VONA 1WSEA 5D3GA 5JHUA 4FJXA 4KT6A 3SJHA 1VQ4T 3ATVA 3H3UA 4J9EA 3WTYC 1NBWA 1VQ5T 2FF3B 4QAGA 1HF0A 3OSGA 1FP1D 1K4TA 2V7YA 4HW0A 3MD2A 2D0PA 1XS9A 2MI6A 2HCKA 3KUFA 2F69A 3WHBA 2KZGA 2VG6A 2QTXA 2DCEA 1EBMA 3IHUA 3V9XA 2P5OA 2QBYB 4M7AG 2EIJH 2NUZA 2ZE2A 1XMXA 2HHSA 1YJ9A 4W5OA 5KCHA 2EFPA 4LB6B 4E47A 2DA3A 2EWSA 3CESA 1S1WA 1VQON 3WNHA 2K02A 1YJ9I 3M9QA 2YHBA 4EJZA 3CUQA 3QINA 2E1CA 2DXCA 2CGKA 2BE9B 1VQ6N 3LQQA 3CERA 4FJMA 1KC8C 5KYUA 2VOOA 4GY2B 2XF5A 1T98A 3G71A 3MMVA 3SYZA 1LWVA 3HRUA 1PVEA 4BE1A 1AD5A 5FW9A 4D8KA 4M7AF 1TXQA 2GQQA 1AWCA 1NLPC 2VQGA 3AVHA 3C0BA 4CFCA 2E36A 1NK0A 4BR4A 1KU9A 4QVCA 3I9QA 4IUPA 2DFFA 1QVGM 2M45A 3HYFA 3DAWA 3BR1A 2DEUA 2KXDA 1T0HA 4EW4A 4XH1A 2NLXA 3WQTA 4MZMA 2K2VA 1J5YA 2DTOA 1PYVA 4JRPA 3BJOA 2RJCA 1NK9A 3OYBA 1J5OA 2VWKA 5JLFA 2CQ7A 3NCIA 4AG2C 1SFEA 3V7SA 2X1CA 2W04A 2ZO4A 1XN7A 4LD5A 3CCET 4KHQA 4M77C 4FJGA 1NBEB 1U3OA 3CP8A 5KQDA 4E1MA 3EGUA 4XLPF 1ZQ3P 3VS7A 4C0GA 3L2CA 3LYIA 2QSFX 3JSPA 3F9KA 3EE8A 3SZGA 1TWGJ 4M75A 2LFBA 2ABKA 1DIZA 2E1ZA 4I9QA 1X6GA 3EEQA 4FWSA 4IO8A 5FRMA 4U67L 1V4SA 4GV3A 3FLCO 3THWA 2R7WA 1K78A 4B9WA 3CCVA 3WQUA 5J26A 1MUZA 1K8KA 5JR3A 2OJED 4IHWA 1ZUUA 2GF7A 2QKKA 4GYIA 3OYFA 3KFVA 3TAPA 2EYYA 3CCVI 1MUNA 1NJWA 5IT9E 4GV6A 4M7AD 3P31A 5HRSA 5C0MA 2CDTA 1TL8A 3CCUT 3RCOA 3R1XA 3ERMA 3R60A 1YP5A 4A3FJ 2JG6A 1GDTA 2EFIA 2X1EA 3BG6A 4AC0A 3TABA 2PAVA 1YIJQ 1VSIA 2JWKA 2XRNA 4GDFA 1R1TA 3UWNA 2CMPA 1HSQA 4GV9A 3EG9B 2F9TA 4CZMA 2NS8A 4F17A 5KGWA 4LJZF 4LDUA 3C12A 5DPKA 1FYLA 4HUEA 1PWTA 3QWLA 1IGUA 1RAAB 2EIKH 2KDOA 4NLBA 4XKCA 1YI2N 3SQ0A 2Y0MA 4ILGB 2EZKA 1V76A 4II1A 2HW3A 1RKWA 2W6LA 1SHFA 1W36C 1QS4A 3AG1H 2QGGA 5DLOA 4KTWA 2XI9A 1LV5A 2L2PA 5DM7R 3RSEB 3JCMW 2NOFA 5EZHA 4O0IA 3M5RA 1GXQA 5M5XJ 3G1MA 2Y2ZA 4BR9A 4K2EA 4LDXA 1E3OC 1M2VA 4PGHA 1QVFA 2YNFA 3LZJA 2EJFA 5LJ5e 1NPPA 1M9SA 1TQIA 4GO1A 2K79A 1Q1VA 2DT5A 4LSLA 4OMYA 2HS5A 4RMNA 1W5SA 3JRCA 1B72A 2ZPGB 3KEOA 2RDPA 5GAN2 1HLUA 1U0JA 2VASA 1QPMA 2PUOB 3DKYA 1UTIA 2RB6A 2R7DA 1NGHA 2QM3A 4V2SA 4LOCA 4FLZA 2RI2A 1UHWA 1V5FA 5GANf 5HK3A 3NF7A 3LL3A 4LY7A 1IW7F 3E3VA 2RNAA 4JQFA 2JA2A 4UVAA 3ZQCA 1ACIA 2E2IJ 3BF3A 2Y9YA 3DRPA 3HPGA 2QWWA 1NLVA 3HBLA 2QK9A 4OGCA 1J7KA 3RMDA 2DJQA 4R79A 1KC8U 3FM5A 2WTUA 4G9ZA 3MAQA 1HNZK 5L3EA 2UXNA 4HDUA 2KXCA 3QNOA 3UT1A 3RKYA 2W40A 2P9NA 3F10A 4DTRA 4FWOA 3H5RA 2D1VA 2CWEA 3OW2M 5LY3A 2O61A 2D0OA 2HOEA 2F4IA 2DMPA 1T6SA 4IDKA 1HNVA 2HAXA 4RTWA 2TCTA 3NGPA 3DTKA 3VDXA 2L0AA 1GLBG 3OYLA 1UWBA 4KPYA 2E2PA 1CF7A 4B6MA 4N0AA 1QSYA 1OCZH 3LA3A 4CFBA 1N39A 3HOZJ 2KK4A 1CSKA 1E7OA 3I8BA 3VEOA 4OMMA 1NGCA 4ZC3A 1QNTA 3PNWC 2F96A 3A1PA 1JHHA 4KT0E 1LQ1A 4PDKA 3QERA 2XAHA 3IFRA 4JRQA 1VQ4Q 3L8BA 2GM4A 2QWNA 1H1VA 4JX6A 3DPTA 3S93A 3HL8A 1BWFO 1YITN 2LZ6B 2HMAA 5F0XA 2Q97A 1SVOA 5D5XB 3GBTA 1Q95G 2EFNA 2CREA 1M90C 2DTIA 3RMBA 4NQWA 3NBPA 1D3BA 3EY1A 4E4HA 4A5AA 1O13A 4O44A 2G8KA 2EIMH 1N9SA 3SUNA 4N56A 4ENNA 4LE9A 4JNEA 1Y07A 2ZC2A 5ILUA 4DSLA 2A69F 1QZEA 4JAXA 3WNEA 3CPWS 3JAMK 2F8TA 1T56A 3EUAA 2HOSA 1HUXA 4NBQA 2F4MB 1TWHJ 3TKYA 3DF8A 2J7IA 2OA4A 2CSOA 3AHUA 1IB8A 3HHTB 3SHFA 4I6ZA 3HOSA 4NC6A 4V2FA 4CYCB 3AG2H 3E6MA 1E3MA 1HKTA 1JJ2S 1EJ9A 3H0IA 1SG5A 1NK5A 1XCBA 3OYIA 1RGIA 2YNGA 3CC7T 2DKGA 3ULEB 3TEEA 1F4KA 3H92A 2H8HA 2O8EA 1R77A 4XK8E 1SEMA 3E9GA 1KCFA 4M78G 1GBRA 3VRZA 4H0PA 4FW1A 2OUMA 3CC4Q 2EX3A 3VF4A 2LJ1A 1VUBA 3PUBA 2BKDN 2WAQA 4KRFA 2CU7A 4ZN1A 1VQPT 3HPOA 2NOIA 3VQEA 3VA0A 2HBMA 5DUIA 3JRFA 3MXIA 1EF4A 2BY0A 3K6GA 4F93B 4OWRB 2LRQA 2I0NA 2WB1A 3A8LB 2IAIA 3VKIA 1MV3A 5AZJB 1H3HA 1U6ZA 4M78F 3HJFA 4CZJA 2HR3A 2R92J 4XRSG 3VB2A 2HHVA 4XK4A 1KFZA 3DLHA 4PJ0C 1YJNN 3EQLF 4A3EJ 1U1TA 2ECZA 2QWPA 2O4XB 4PJOC 5FPNA 4JJNK 4GKJK 3B6AA 2BZXA 4CECA 2K4BA 2X78A 2X6XA 5GMKm 1K79A 3E5XA 4CGDA 3CDIA 1RL2A 2NRWA 3NGZA 2O8CB 1MJBA 1M90O 2A40A 5HLIA 3CM5A 2XDDA 1N34K 4AVZA 3T3FA 1TKZA 2VG5A 2FYKA 4E6KG 4ESBA 3SEQA 3FZLA 3PIOA 1GRIA 1HW5A 2VBXA 4JEPA 3CUQC 3I35A 4D6WA 4J01A 2LVMA 4UUSB 4OAZA 4CF0A 1NM7A 3BQYA 1EO1A 2VOPA 3O3GA 3BDUA 2B4JA 2IOCA 3ZEUB 2RHXA 4EV0A 4RBOA 1OZ2A 3RKXA 3VESA 1LDDA 3ECOA 3K7AJ 1KSPA 3BR3A 1PRLC 4HCKA 1RKTA 3MPUB 4ATOA 1J9IA 5DCFA 3W2AA 1G2BA 1L5UA 2QKBA 3W6JB 5IHIA 4BQLA 3OR1C 1YN8A 3TR8A 4F3TA 3AL0C 4MNUA 4GLKA 4BD3A 5J6XA 3HP6A 4ZDPA 3QRFF 5GAN4 1BGXT 4ZYDA 1HYOA 2QG9B 4FZXC 3K0SA 4M78D 2QQAA 3CWTA 4BS9A 1DP7P 2XPVA 4HV5A 2G8WA 5GAMf 2F5CA 4M3GA 3FRNA 1RBUA 1QQJA 3J80E 3HOTA 3NGYA 3PMTA 4CBWA 1C0MA 1SC7A 4UXNA 2Z16A 3WG9A 3W0LA 1LPLA 4MGRA 1X43A 3BWGA 5AQOA 2HI3A 4QW2A 4M6YA 4M7DA 5T7BA 3A01A 1N3AA 3U1DA 4H0VB 2LP5A 1VQ6Q 4PL8A 4M75C 4DEYA 1M90U 3BFMA 2K6DA 3A5MC 5AN4A 5M1KA 3LDSA 3TDZC 4E3SA 3M3ZA 4GFBA 4ZYGA 3DBRB 2HL3A 5ICGA 2JHJA 5KE3A 4HG2A 4CJFA 2EA2A 3M0QA 2R5YA 1NG7A 4Y7NJ 4MDWA 1KTQA 4MIMA 3I56A 3DLGA 5B1BH 1LNXA 3QSUA 1YUWA 4JRKA 1JLFA 1S1UA 4DA4A 4RS8A 3SV4A 2L7ZA 1PNJA 3I56I 1ZGJA 5GANg 2CZ6B 3C7NA 2OTJT 1T38A 4M77B 1R5GA 4JK1X 3G6ET 3K2PA 2OFIA 2QQRA 2VE8A 2Z1JA 4HX8A 3I4PA 3FXUA 4BU2A 4W5RA 1HQUA 4JBAA 3KX2A 3LFUA 1R1UA 1VQMT 3KYDB 2K5IA 4EA5A 4L5EA 2RQQA 4GBQA 2Z2SB 4M3DA 3HTUA 3IAYA 3R2XC 4G8XA 1ERDA 3F6VA 2E2JJ 3ER0A 3N4QA 4UVBA 5L23A 1IRZA 3P38A 1HNIA 2Z9OA 4ESRA 3CUOA 3NF6A 3KK7A 2E70A 1ZH5A 2LG4A 3QJYA 1AWOA 1Y96B 5BN8A 2DYBA 3R8EA 3PFIA 1VQ4I 1RAIB 5IP6A 5FU6C 2QF7A 3CJ7A 1CQTA 2YDLA 4RG8A 1WJFA 3GTOJ 3CPWA 3ZMVA 3SAHA 2ITGA 1N5YA 1BR1A 4ESFA 1WOQA 4FT4A 1SANA 4JI8K 2AO9A 1OU8A 5E79C 3EGDA 2KBTA 3FE1A 5GAEP 2FBVA 3CM6A 4FM2A 5GTIC 2VE9A 1XSXA 2BVMA 2OZSA 3TAMA 4CJ3A 1JJ2A 2P9PB 1KAZA 2XK0A 1Z25A 4I2OA 2YJFA 3VW4A 1MMGA 1ETWA 4YEJA 5E3NA 2DFIA 1QHTA 2SEMA 3HC7A 5GTHC 2X4JA 3BT9A 2YCHA 1VQ8N 1BR2A 2FEZA 2ZMEC 3GTQJ 3BDPA 3E1SA 4FX0A 4II2A 4M7YA 4I02A 1NH3A 3RKWA 4RWTA 3VA3A 4H8KA 1UGQB 4HV6A 2RM4A 5AQIA 3CC7Q 1EIFA 2ZSHB 1Z67A 3L7WA 1KVCA 1PU6A 3CC4A 1GXPA 1DQUA 2FRHA 1FMKA 1FMWA 2CUEA 5CVVA 3TANA 4X6AJ 2H6BA 1TZLA 4AD9A 3LSKA 4DTOA 2DBKA 3CC4I 1WCMJ 5GAN7 5DCMA 1KQSM 2BTTA 4N4IA 2DODA 3OQ5A 4FOEA 3U8XA 2CP2A 1F1BB 1EH8A 1NM1A 5IN1A 1W7PB 2GUPA 3SZ2A 1R5HA 3MEEA 4AHSA 4NS5A 3OBWA 4PJJA 1H641 3VGKA 4N0AC 3DOLA 3FIWA 3TAGA 1G5VA 1P6RA 5AZIB 2M2EA 3CXCS 2GX9A 2XICA 2FSKA 2EINH 3H45C 1JXSA 4JD2A 1ZELA 4JI6K 2V75A 3ZSVA 4YPRA 3O6BB 3HSCA 4JK8A 3JRIA 4WK8F 2A6HF 5LJ5g 4ANJA 2DAOA 3H3NO 3I58A 2W00A 2HNYA 2QGUA 3BY7A 4H5TA 4J9BA 1VK0A 1AHDP 2ZPHB 4Z4CA 4I2QA 2LCLA 2DPDA 2ED1A 3LM9A 3CCJN 1L3LA 1W2BP 4LG3A 3HBTA 4HSBA 3RYPA 1D0XA 2UZKA 1S8NA 2KKZA 4DV6K 1L3TA 1LE8A 3W6VA 1UGSB 3CF5L 2DZ9A 3HYIA 3RMAA 4RLQA 3F70A 2NVUB 4AT1B 3VYTB 3CCRN 5E1ZB 3EGXA 3WXMB 1IDYA 4M9XA 4XQ3A 4U87A 4S0HB 2FPFA 4P1WA 5BOXA 1Y0NA 4IO9L 1C1AA 4E9GA 3WTVC 1M90R 1YQRA 5TRDA 2W7NA 4BGAA 4DQSA 5K5RA 2VBWA 4IZZA 4RA2A 2HDWA 1E3HA 3TI0A 1O57A 1ZBIA 1UELB 1SD7A 3TP0A 3HPHA 3FF5A 4A3LJ 4B3AA 3VUBA 2G3RA 3FXMA 4LN2A 4X0GA 1I94K 1YITQ 4KB0A 2YWWA 3L2VA 4CJLA 3S1RJ 3H1QA 3GLLA 2DOFA 3JTGA 2DTUA 1CZ9A 3BPVA 1BBZA 5GAGP 1KYZA 4OKKA 3C94A 3UATA 4OPHA 4BR2A 1T2KA 3TTFA 4C8OA 2MH2A 1VQOA 4M9ZA 4CJKA 3D7SB 3P39A 1SKWA 1TL1A 1S6LA 3JYTA 1VQ6A 2IS1A 1XGOA 2V52B 2L5QA 2E35A 1VQOI 2DA5A 5F6FA 4B9UA 4CF2A 2VT3A 1VQ6I 4QKUA 2WSFE 3HK2A 3VQ5A 4XSXF 3M07A 1HJDA 3OYJA 1W9HA 4F7UG 2HHTA 2Q2EB 5AQSA 3E6CC 2QDLA 1S72N 1MH4A 1BA1A 3LP3A 2RH2A 3KLFA 1S6QA 4FSXA 4C5GA 4YG2F 2Q0UA 3EYYA 3L4QA 3M55A 3A0IX 3VRYA 4I0AA 3BG5A 5F0CA 2UXXA 2BANA 3EN9A 4EJWA 4FYXB 5AIPA 1ZLKA 2Y4YA 1WHUA 1W36D 1W0UA 4M7AE 2IJLA 3HI0A 5K14A 1LVKA 2D9TA 4F7UF 2OTJQ 2IGNA 3SBTA 3SMPA 2O8XA 3D5LA 4NYNA 3MEAA 4LLNA 2FB7A 1X01A 4PKCC 3G6EQ 3MP1A 1TWBA 5J1UA 3IH2A 5FDLA 2HHUA 2KL4A