3OYJA

Crystal structure of the pfv s217q mutant intasome in complex with magnesium and the insti mk2048
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
368
structure length
368
Chain Sequence
b'LDAELDQLLQGHYIKGYPKQYTYFLEDGKVKVSRPEGVKIIPPQSDRQKIVLQAHNLAHTGREATLLKIANLYWWPNMRKDVVKQLGRCQQCLITNASNKASGPILRPDRPQKPFDKFFIDYIGPLPPSQGYLYVLVVVDGMTGFTWLYPTKAPSTSATVKSLNVLTSIAIPKVIHSDQGAAFTSSTFAEWAKERGIHLEFSTPYHPQSQGKVERKNSDIKRLLTKLLVGRPTKWYDLLPVVQLALNNTYSPVLKYTPHQLLFGIDSNTPFANQDTLDLTREEELSLLQEIRTSLYHPSTPPASSRSWSPVVGQLVQERVARPASLRPRWHKPSTVLKVLNPRTVVILDHLGNNRTVSIDNLKPTSHQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PFV integrase
publication title Molecular mechanisms of retroviral integrase inhibition and the evolution of viral resistance.
pubmed doi rcsb
source organism Human spumaretrovirus
molecule tags Recombination,viral protein/dna
total genus 105
structure length 368
sequence length 368
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2010-09-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
A PF17921 Integrase_H2C2 Integrase zinc binding domain
A PF18103 SH3_11 Retroviral integrase C-terminal SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2300 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3oyjA04
1.10.340.70 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Endonuclease III; domain 1 3oyjA01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3oyjA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3oyjA03
3AA3A 3NF6A 2QKKA 1JL2A 3QINA 1KLNA 3HL8A 3G10A 1IKVA 3K5NA 3NDKA 2B8AA 3O8VA 5I3UA 2E6LA 3HPGA 4NYNA 3SPZA 4FLTA 3QNNA 4FJMA 1FK9A 3MEUA 3AO5A 3DRRA 4ID5A 4B8CA 4OGCA 4BACA 4KHSA 1NK4A 1ASUA 3DLKA 3DLEA 4II1A 3OYMA 1VSHA 1EX4A 3TAGA 4WE1A 2XY5A 2DTUA 4DS4A 3U3YA 1OYXA 3QIOA 1NK8A 2LVMA 2YKNA 2YRVA 3RRGA 2RHZA 3TAEA 3S9HA 4DU1A 5C24A 3OMCA 1RBUA 4E7KA 4IURA 4E19A 3OYFA 3WNFA 4C8KA 1RILA 1HYVA 3SNNA 4RW9A 4CGHA 4CEOA 3Q1JA 2HHSA 3BDPA 2DAQA 1C0TA 4CGDA 1HYSA 4HUEA 2O4IA 4BWMA 2GF7A 1JKHA 4W5NA 3T3FA 3PO4A 1RT6A 2P5OA 3QIIA 2PYJA 1BQMA 1XI1A 3I8DA 4E7JA 3TABA 4DSIA 3PX0A 4KB0A 1TK5A 1QSYA 1RDCA 4GMJB 4OVAA 3O3HA 4RG2A 4LY7A 2AJQA 2GFAA 3AVLA 3ME9A 4CFAA 4JS5A 2G8VA 1VSDA 1S5JA 4BE2A 4B9TA 4KHYA 4CJWA 3DLMA 3O3FA 4CHYA 1HPZA 1KVCA 1KTQA 4HCCA 3ZT0A 4CJEA 4FLWA 4N76A 4F8RA 4FLUA 1LAWA 1F21A 4BE1A 1HMVA 3SUPA 3TAQA 5C0MA 4OKKA 3TARA 2KFZA 1U4BA 2IGIA 3ZT1A 3SQ1A 3TANA 3QJ6A 1SKWA 1EETA 3SV3A 4OPJA 3KTQA 3K5OA 5J2PA 2A1SA 1FKOA 1NJYA 4QW2A 1D8YA 4CJSA 4FXDA 4F4KA 3MO8A 3MXIA 4B9UA 1U48A 4CEQA 4FJ9A 2OZSA 2LCCA 2LTOA 4B9SA 3S6WA 1B9DA 3QNOA 1GOBA 3OYKA 4KI4A 3RR8A 2YNHA 4CK3A 3DLRA 3NTHA 3OB9A 2HHVA 3ZSYA 3AVMA 3EZ5A 3MEVA 2HQEA 3SZ2A 1WLJA 3K58A 3NF8A 4OVLA 4AHSA 4CJUA 4O55A 4FCYA 4F2SA 3OY9A 3P1GA 4N4GA 4CJ5A 3LPUA 4DFPA 4CFCA 4C5IA 4DTNA 3SQ2A 1BCMA 3PO5A 1LV5A 5HBMA 4DTOA 5D3GA 5CY4A 1CZBA 5FDLA 2XDPA 2IOCA 2NLUA 5HRRA 5J39A 3O4NA 5CYQA 3KD5E 4PL6A 3L2QA 5DK5A 4CFDA 3TWHA 3D45A 4Z4HA 3SUOA 3K57A 2XY7A 1NK5A 3CM5A 1Z26A 3QLHA 2KZMA 2FHDA 2B6AA 1NKCA 4KB1A 1A5VA 4DS5A 5EU7A 4KO0A 4K8ZA 3T19A 3OS1A 2K3YA 4CHOA 4ELVA 1RCHA 1VSMA 1IG9A 4N56A 2FBYA 3C6TA 5SZTA 4NZGA 2Z1IA 4UC4A 2B4JA 3L42A 4DSKA 4Q5WA 1NKBA 2R5AA 1KFSA 4FJ8A 3MEWA 2R5MA 4G1QA 3IS9A 4B08A 4AHCA 3NTIA 4HTUA 2OPRA 4CIGA 1RBSA 1UA0A 3IG1A 3LALA 3JYTA 4DSFA 4ZTJA 4KV8A 3ZT2A 1BIZA 4IUVA 3OYNA 1EKEA 3AVJA 3DM2A 3L2UA 2ZD1A 3D0PA 3DRPA 2DIQA 3VQDA 2EQKA 1TKZA 2Y1IA 4FK4A 1GOAA 2XY6A 1T05A 3ASKA 4JRQA 3NNQA 3P8HA 4EP5A 1KLMA 3LPTA 2D0AA 4AHUA 3NAEA 2VG6A 4ELTA 4DSJA 1C1BA 4DMNA 3UWNA 4DQIA 3QKJA 4CEZA 4AHRA 3ITHA 3AA5X 4HCBA 3MEDA 1HRHA 3ALYA 1VSIA 3S3OA 4N4HA 3LZIA 4AHVA 4Z4FA 2HNDA 1S9EA 3DB3A 3HXMA 4KAZA 3SJJA 1BIUA 1FXXA 4EP4A 5D6XA 3SQ4A 5C25A 1Q9XA 3QEIA 4HVJA 4FU6A 1B92A 4DTXA 3DLBA 5FRNA 4A4HA 1Q8IA 3PUFA 3ZSQA 1CLQA 4NYFA 5JS2A 3AVCA 4BDZA 3VQBA 2X6SA 4CGFA 4B9VA 1J9AA 3M8PA 1QSLA 4HUFA 3IAYA 4RW8A 4FJJA 4PWDA 2E4LA 2E6NA 2IAJA 2YNIA 3U6FA 4DTRA 3OYDA 1RTJA 2PYLA 3AVIA 4LH5A 4OLAA 4IKFA 3K5LA 3AVFA 2ZQBA 3QEXA 3DOLA 1G5VA 3NF7A 1TKXA 3RWUA 3HPHA 4KKOA 1WNSA 1X9SA 3LP0A 3CEYA 4C8OA 3CG7A 4NCBA 3RMCA 2Z1GA 4CIFA 3OJSA 3CFRA 4M3UA 4H8KA 3VQEA 2YHAA 4BWJA 4RG8A 4I9LA 3SCXA 3CM6A 5KE2A 3SUQA 3SD4A 4DU3A 1RDDA 5CZ1A 1C0MA 4O4GA 3L2VA 1H3ZA 4Z4EA 1A5WA 1X9MA 1OZ3A 3DB4A 4M41A 4O5BA 2QXFA 3LWLA 1SUQA 2DFHA 3SI6A 1CXUA 4ZHRA 2VWJA 2X4YA 4MFBA 4IBNA 3AVKA 1MU2A 2ITGA 3F9KA 3H6ZA 4FJKA 3DI6A 2MWPA 3AVGA 4FJ7A 2L8DA 3PMIA 3OYAA 4FK0A 4IUTA 1GOCA 3QESA 2ETJA 2BUDA 3CYMA 3P5JA 2IS3A 4CJPA 3OS2A 1NJZA 4PY5A 4X34A 5J2MA 1QQCA 5CZ2A 4OKEA 3OS0A 3OQ5A 3NH1A 3ZT3A 2HHUA 4PUOA 3V1RA 4YNQA 1DTTA 2CKKA 1LW0A 4C5HA 4C8MA 5E41A 4YFUA 3QETA 3ZSZA 1U45A 4DQPA 3NGZA 3OJUA 4OGEA 2A1RA 1WSFA 1WJSA 3KKSA 1IH7A 2L89A 4FLXA 4BDPA 4ELUA 4HCZA 3TI0A 3E01A 4DLGA 3B6PA 3OYHA 5KH6A 3P8DA 3AA2A 2O4GA 2R7YA 3L8BA 3MEEA 3PX6A 1L3TA 1S9GA 2D5RA 1WSGA 3LAKA 4IG3A 4L59A 1NK9A 4EDUA 4DTSA 1SV5A 5J1EA 3LH0A 3PFSA 1LWFA 1RTIA 5HRNA 3UIQA 4CJFA 3ZCMA 4FJXA 1NK7A 2OYQA 1BISA 3VQ8A 1NKEA 4DFMA 1UAXA 5SWMA 1C0UA 3VQAA 3KJVA 2RF2A 3NGIA 4OKJA 1T8EA 3K5MA 4W5TA 1LWCA 2YNFA 3QEVA 4CJLA 2P5GA 4IDKA 5J2NA 4MQ3A 3OA6A 3CFOA 1RDAA 2RKIA 4E0DA 2LRQA 2BKDN 4UQGA 4QQ6A 3E9FA 3PV8A 4C8LA 2OA8A 1ZBHA 1S1VA 4J2EA 3MXJA 1IKYA 1TK8A 2M1HA 3LLRA 4CFBA 5HROA 4KHNA 3NE6A 5KRSA 3V81A 1REVA 5HLFA 3A2FA 4DLEA 3RMBA 4M3YA 2QKBA 3NBPA 2WACA 3E9GA 4C8NA 4OLBA 2D0CA 1KCFA 2GFUA 4LH4A 1D5AA 2WOMA 5IN1A 1BL3A 1NJWA 4KHWA 3O3GA 2DIGA 3MP8A 3EYZA 1IKWA 1RT1A 4E7HA 2EQUA 1L5UA 2JZ2A 2G3RA 4E7LA 3NFAA 3OYIA 3ULDA 2Y1JA 4FM0A 1ZBLA 3GOXA 4FJIA 1UOCA 1N6QA 4FL6A 3FLGA 4M42A 4E89A 1VSJA 4DTUA 4EZ9A 2X78A 3K2PA 2BGGA 4NCAA 4CHPA 2R58A 5KI6A 3CFPA 3HO1A 1D9DA 1WSHA 3DMJA 3VQ9A 1K6YA 1JLGA 3HT3A 3MECA 4DTMA 2Z1HA 2O4XB 3FDRA 4ZTFA 4CJ4A 4O0JA 2G8KA 4B9NA 4R5PA 2JGUA 1HNIA 3AO1A 2R57A 2RJCA 1DTQA 5IAYA 4DG1A 3SPYA 4FJLA 4CJRA 2JLEA 2KQ2A 4W5RA 3C4SA 4KHQA 3CQ8A 2QQRA 3KD1E 3I0SA 3HP9A 1RBRA 3LP3A 3OYEA 4CJKA 3H8ZA 4CJQA 3OYJA 4QCLA 2RI2A 5FRMA 4ICLA 4N47A 1U47A 2JTFA 4DFKA 4Y1CA 1EP4A 3M9QA 1C6VA 2RHXA 2FBVA 4JS4A 3C6UA 3TAPA 3M8SA 2LSNA 1TAQA 4IUUA 2F8TA 2FBTA 1BQNA 3ZSXA 4RW7A 4N4IA 3K59A 2K3XA 1RI0A 3RMAA 4KPYA 2ATQA 4HUGA 4B9LA 1XHXA 1RT3A 4DWIA 4FJ5A 4CIEA 4QOZB 2P1JA 1JXBA 1YVUA 4AHTA 1RT7A 1TK0A 4FYDA 4CF1A 3LP1A 4CERA 1T7PA 4NS5A 1C1AA 4FVMA 3FEOA 4Y1DA 1VSFA 2OZMA 3ISNC 4IG0A 3V4IA 3SUNA 4FW2A 1OZ2A 1U49A 2IC3A 4M3RA 1N5YA 3WNHA 4CK1A 5KCOA 3I0RA 1YTUA 2FC0A 1RDBA 1JLEA 1BI4A 1HJRA 3HJFA 3QBYA 2HHTA 3KLGA 4O44A 1RBTA 4J2BA 1XNIA 5KRTA 2XY8A 1ZBIA 4O0IA 4CJVA 2OPSA 1QTMA 1WSEA 5KTQA 4GY5A 2BIVA 1QE1A 2B5JA 2VWKA 2HW3A 3MEGA 3V9SA 3V9XA 4BD3A 2XHBA 3ZSVA 2PY5A 3DLHA 1NJXA 4E7IA 3KK3A 4LD6A 3HVRA 3RR7A 2RJEA 4M3XA 1RTHA 4I9QA 4FLYA 4QAGA 3ZSWA 4Z4GA 3S3NA 3KLHA 1YTAA 3AVAA 2I5JA 3UT1A 5CYMA 3LANA 4DQSA 2KW4A 3VA0A 4J2AA 3RRHA 3HSTB 3QIPA 4Z02A 3LX7A 2RI3A 3VQ6A 2G8WA 4I2PA 4HHTA 2RN2A 4LD0A 4H4OA 5JS1A 2MWOA 5K14A 2W42A 1R0AA 4H4MA 2BANA 3HYFA 4CEBA 1SKSA 4DSLA 4DF4A 2GV9A 4N5SA 2G8IA 1O1WA 3NCIA 4CF2A 1HNVA 1W9HA 4IFYA 1B9FA 4JRPA 4FZZA 4IUPA 2BDPA 1I3AA 2LDMA 4CGJA 2KZZA 4FJHA 3RMDA 4Q5VA 4CF8A 4B9MA 1ZYQA 2EQMA 1IKXA 3M8QA 1HQUA 3S3MA 3MP6A 2Z1JA 2RJDA 1VSEA 4I2QA 4FZXC 1X1PA 4EZ6A 3SV4A 4PQUA 4Q0BA 4NCGA 1KHCA 4QQGA 3C95A 1JXEA 5HRPA 3SYZA 4E1MA 4CHZA 2YNGA 2O4XA 2EHGA 3AO4A 4B9XA 3TAFA 2PZSA 1WSJA 4AILC 3LYIA 2P51A 1JL1A 2YHBA 1KSPA 1LWEA 4E1NA 2P0KA 5D6YA 3PMTA 3HM9A 1ASVA 1RT4A 4B9WA 4CGGA 3QEWA 4B8AB 3LZJA 3PX4A 1WJRA 3FC3A 3JSMA 1NOYA 2X4WA 1S1WA 1LW2A 1LAVA 4DU4A 3G0ZA 2QK9A 1DLOA 4FZYA 4CHQA 3VQQA 4PLIA 5I42A 2NUBA 1TGOA 4CK2A 3DOKA 1VSKA 3ZT4A 3U3GA 1VRUA 1BI4B 2RI5A 4BE0A 5CIUA 4CE9A 2EKOA 1YT3A 1JLAA 2OPQA 3F70A 2IG0A 3ZEHA 1IO2A 3SQ0A 2G8FA 4J2DA 3TR8A 1SL2A 1TL3A 3KIOA 1JLCA 4Z0UA 3LWMA 4CEFA 4M3ZA 4W5QA 2DY4A 2RHYA 2VG7A 3MEAA 3L3UA 2Q3SA 4PLLA 3FFIA 1BGXT 2YV0X 3V9UA 4ID1A 3NTKA 4FLVA 3KK1A 3MP1A 3L3VA 2RPIA 4CF9A 1WGSA 3TAMA 1S1XA 1RT5A 1S6PA 4DF8A 4FJGA 2ZE2A 3V1OA 1EXQA 1RBVA 5KGWA 1L3UA 2DFEA 3ASMA 2D9TA 1TL1A 1VSLA 1ITGA 4F3TA 3M8RA 4DFJA 1NOZA 3AVHA 3P83D 1G15A 4IFVA 2KTQA 4CJ3A 1ZBUA 1UA1A 4KTZA 2F5KA 1SL1A 3OYCA 4A4FA 3QERA 1X9WA 3VQPA 1KRPA 3T1AA 3VQ7A 4C5EA 4OPKA 1KFDA 3AO2A 3LDSA 4Z4IA 3KLEA 2E6MA 4N41A 3KUFA 1TAUA 4RW4A 1OI1A 1JLQA 4CF0A 4C5GA 4CGIA 4AH9A 2HQXA 1NK6A 2VG5A 1XHZA 1FKPA 3LAMA 3VQCA 1TVRA 3VA3A 4M3WA 4FM1A 2YKMA 2RHIA 4KI6A 2M0OA 5KGXA 1WJQA 3META 4RW6A 3PNWC 1WSIA 3AA4A 2HHWA 3NH2A 4KTWA 4K8XA 1RNHA 5D6WA 4XIUA 3LP2A 1WAFA 4E3SA 2X74A 3V6DA 1U04A 4PA1A 3NGYA 3OYLA 4DTJA 4LSNA 4FW1A 2IDOA 3AV9A 5DMRA 1S6QA 4L8RB 1QSSA 3NF9A 1J5OA 4LSLA 2WONA 3EY1A 4FM2A 1S1UA 1J53A 2KFNA 2XRIA 1JLFA 2HVIA 4CEAA 3BDLA 1QS4A 1WAJA 3EAEA 2PQWA 4CEDA 3V1QA 4FK2A 3NH0A 2G8HA 2HHQA 3L2WA 3KLFA 4BDYA 4I7FA 4M3TA 4CRIA 3C94A 4FLZA 2BE2A 4KTQA 1XWLA 2QQSA 1MHNA 3DLGA 3WNGA 3ZSRA 2HB5A 3OVNA 3B6OA 2RHUA 3DYAA 2FBXA 3OYBA 1CZ9A 1J54A 2HHXA 1UWBA 2RJFA 3OMGA 5FROA 4CJTA 2X4XA 2E5QA 1QHTA 2X6NA 1WN7A 3HK2A 4F2RA 1N27A 2EFIA 2HNZA 4QVZA 4KFBA 1KVBA 1T03A 3VQ4A 4CEEA 1C1CA 4KRFA 2GUIA 5HRSA 2DFFA 1A5XA 4CESA 3F73A 1ZBFA 5KE3A 2VYTA 4KHUA 5T7BA 3PY8A 1S1TA 3NHGA 3KK2A 4GW6A 4JLHA 1SSFA 5C6SA 1JLBA 5HP1A 2HVHA 1W0HA 3VN5A 1CXQA 3MAQA 1BCOA 1VK0A 1NK0A 3O4QA 3ZSOA 4B3OA 4GVMA 1SL0A 2XO7A 1RTDA 4DTPA 1D9FA 3L2RA 2OPPA 3LGLA 1Z25A 4TSXA 4DQRA 2GBZA 4KREA 3VQ5A 1Y97A 3MXMA 1BHLA 2D0BA 5KCHA 2HNYA 3HPOA 2HMIA 1I39A 4CECA 1KVAA 1L3SA 4DQQA 1TKTA 3WNEA 1HYZA 3RTVA 3AVNA 3OYGA 2F8SA 4W5OA 2XK0A 4M45A 1HQEA 1L3VA 2EX3A 3HVTA 3THVA 1Q9YA 2L3RA 4CHNA 1SKRA 2M16A 3QO9A 4F3OA 3IRXA 5C42A 1TKDA 3V9WA 4A4EA 4CCHA 1TV6A 3KKRA 2RO0A 1RT2A 5J2QA 4QQDA 2F96A 3V9ZA 3AVBA 4DSEA 3BGRA 1VRTA 3AO3A 1XC9A 2G8UA 4Z4CA 3LGFA 3KLIA 2X35A 5J26A 3QEPA 4FJNA 3DRSA 2EQJA 1ASWA 4OJRA 4IUQA 3H08A 3HP6A 4A4GA 5M9OA
chains in the Genus database with same CATH superfamily
3AA3A 3M0RA 1YJNI 2FXAA 1TG0A 3HL8A 1D0ZA 5GAOp 4OMLA 1IKVA 4XRSG 3SPZA 4HDUA 1R00A 4FLTA 4JI6K 4GO1A 1FK9A 1BW6A 1ETOA 3MEUA 2M1BA 2E2OA 3ZXSA 3NAUA 4MDBA 2JHJA 4KULA 4L0YB 4RAGA 1PVEA 1ASUA 3QOEA 4LG0A 1PWTA 2RKHA 3FZKA 3DLKA 4X0GA 2DTHA 4II1A 1L3LA 2CQNA 2UV1A 1QLYA 1XTAA 2LF7A 4A62A 3MWTA 1W4SA 2BV6A 1FYMA 1K8AR 2NAZA 3TAEA 1Y7XA 2DT6A 1M1EB 5E3MA 3VRZA 2FB7A 1NGCA 5KK1A 5C24A 4RMOA 2K9QA 2DPPB 5HY6A 5FKLA 3AAPA 1RBUA 4E19A 1K6OA 1AZGB 5HK3A 2X6OA 1YIJA 4UXNA 3WUHA 1OH6A 4DOVA 1VQPT 3EFOB 4KIFA 1HYVA 4MO7A 1JKQC 1TWGJ 4CGHA 2NVYJ 3A5OC 3VW4A 3I55Q 5AQWA 2Q0UA 2O4IA 1E6HA 4IL6C 4QTRA 1K4SA 2E2NA 2A6EF 2RQWA 4FT4A 5C44J 3RKYA 2ZCWA 1KONA 1XS9A 1N9SA 1RT6A 3E5QA 2P5OA 2ECCA 3QAHA 4ABZA 1BQMA 5MLCQ 4A57A 3R6NA 3FZFA 4A5MA 2F4MB 1M5Q1 4Y0WA 1NGHA 4DSIA 3GTQJ 2UWMA 3A8GB 2BHZA 1VQ7Q 1JCEA 3O3HA 3TU4K 1OX8A 4LY7A 1JU5C 3LDOA 1O57A 3KBGA 2E20A 2RQTA 2FF4A 3JTGA 3H46O 4XKBA 4X1VA 3ME9A 1XG1A 2FNPA 1PU7A 2A36A 3VS0A 1DGKN 2CW8A 3QYFA 1S5JA 4B3SK 1WKMA 1U78A 3ZT0A 3CQXA 1YBYA 2NRHA 1X6OA 3CD6A 1FJLA 1QVUA 1RRJA 2B86A 2CT3A 2VQGA 1LAWA 1OCCH 1SFUA 3M1CA 2DW4A 3SUPA 2MPXC 1KU2A 2ATCB 2DYIA 1NJIO 3CD6I 3CXCS 4LIUA 2COZA 2CZ1B 1GV2A 3FMSA 4M74A 3ZT1A 4BEHA 4GBQA 3L6QA 1MPGA 2JVGA 4BY1J 2GWJA 2JS0A 3KTQA 5GINA 1FY7A 2VXDA 2XAFA 5J2PA 1RAIB 1FKOA 3FF5A 4CJSA 3SDZA 2PVOB 1HW5A 3CF2A 4BC2A 2DAOA 3ELKA 4IOXA 1WHGA 2QWLA 2NRTA 3HSCA 4MMLA 3J81Z 4FJ9A 2GWKA 3ZQHA 2YG8A 4IX7A 1B9DA 1GOBA 3TO6A 1Q81U 4IIOA 5CYVA 3RR8A 1QMCA 1FBQA 5H6RA 4CK3A 3OB9A 4CC3A 2HHVA 2R7RA 1RAFB 1WLJA 2LNHB 3GTJJ 4CUGA 4RTYA 3CCEQ 4P55A 3L4IA 1IN4A 4D9JA 1ZG1A 1FSEA 4N4GA 1R23A 2EGCA 4XL9A 1Y57A 3HHGA 4BHCA 3CCJA 4V19K 4DTNA 2YG9A 1OPKA 2LY2A 1BCMA 4CZMA 2CGLA 1MJAA 2ZM6K 2MBFA 3M8JA 2XDPA 2IOCA 4XTZA 3CCJI 2NYXA 1XX5A 1A36A 5KPTA 3DLLF 2CV2A 4CFDA 5E8GA 5EXWA 4PJOB 2P81A 3K57A 3KZYA 4WFNL 1Z26A 1C0GA 5K5QA 2GBQA 2KZMA 4B3XA 5IT9O 2LK2A 3JCMP 2FHDA 2B6AA 1G83A 2K5FA 2F2VA 1A5VA 4JI1K 4L9NA 1JCFA 1OPLA 4K8ZA 3T19A 3VEYA 2ZWHA 2EZLA 1VSMA 2BBYA 2MH9A 3A98A 3MPUB 2FBYA 1QVFS 1D0XA 5SZTA 4NZGA 2IA1A 3N0UA 4R79A 4UC4A 3NEUA 4DSKA 3VKIA 3GE1A 2E1NA 4Q5WA 1KFSA 1VQMA 2R5MA 4C0ZA 4IF4A 4IOAF 4DR4K 3W2VA 2QKLB 2K86A 2IS1A 3QWLA 2O0YA 1VQMI 5E1ZB 3KNTA 4X65K 1MMNA 4I2OA 4Y3OA 1MUNA 3MCAB 3H1QA 4B3AA 3Q7CA 2KXCA 3MK6A 1QA6A 5FD5A 3ZT2A 4E47A 3W6JB 3W6VA 4IUVA 2WADA 1KQSM 3OYNA 3GF5A 3TU5A 2KLOA 4IDHA 1Q95G 1TSFA 3AVJA 3DM2A 2DIQA 3VQDA 2EQKA 1T3LA 3WG9A 3HKZA 3IHOA 3PVQA 4FK4A 5L23A 4GGGA 1T05A 2Z1DA 3ASKA 3WVDB 3ISPA 1M3BA 4JRQA 3NNQA 1YO5C 3P8HA 1FP2A 2EVRA 2UYTA 3EFRA 4EM2A 2D0AA 4RM2A 1J75A 3CJAA 3ML6A 4OWRB 3C65A 1T0FA 4ELTA 4DSJA 3MX5A 2MFZA 1YS7A 4RLQA 4BY7J 2FRYA 1X43A 4DMNA 3UWNA 2VN2A 4DQIA 3QKJA 3HTVA 3ALYA 3QB0A 1R0BG 1QCNA 2LP5A 1TH7A 3CPWS 4JKDA 2VPLA 1X9JA 4BKXA 3IWZA 1SEMA 1KSWA 4LB6B 1IF1A 2A6AA 3U9ZA 2X6YA 5E79C 1FBSA 2W0ZA 4YOXA 1EFNA 3WTWC 4F52A 1YJNQ 2DF6A 2DVEA 1B92A 2XSDC 1BBYA 2ZFWA 4DTXA 1IXDA 4M9ZA 3K0SA 1M90O 2IVMA 2OUMA 2QVOA 5FRNA 4CH7A 4QVDA 1Q8IA 1J09A 5HS7A 2DJIA 3I56T 5L3BA 3X26B 2D8HA 3GDQA 4QS7A 2CZ7B 3CESA 2LCLA 1CLQA 3AVCA 1E6GA 3A01A 2P9IA 2X6SA 2JOYA 3CWTA 1UHMA 4UVCA 1K9MO 1NGGA 2J5PA 1SQKA 2DXTA 2XF5A 4FJJA 1UMQA 4PWDA 3M9AA 2KR3A 3JRCA 1HK9A 1KQSP 2FBKA 2I10A 3QPSA 3U6FA 2KHMA 1S9HA 4OLAA 2YUNA 1B8IB 3HUGA 4G7HF 1RI9A 3QEXA 2J6OA 3PLAA 4F92B 1J5EK 4A54A 1G5VA 4CZGA 3M0QA 3NF7A 1YJWA 2FBIA 4A3KJ 3HSBA 1RC9A 4HKEA 1M30A 3BG7A 5LJ5f 3F9MA 2QA4T 5GAN8 2Z1GA 5ILUA 4CIFA 4EPCA 1ZLKA 1YJWI 2JZYA 3J7ZO 4DR5K 2OAUA 3MWMA 4M3UA 1H92A 2QWRA 1BL0A 3VQEA 1ZLMA 3BZ6A 3HOYJ 3ID6A 3SD4A 3A4CA 1JO8A 4CYDA 2K5LA 1H3ZA 4Z4EA 2LG4A 2CQQA 4IZZA 5LRSA 3ZN1A 4M41A 2QASA 4O5BA 2DFHA 3PIOL 2EJGA 2DD4A 5LHIA 4ZN3A 2HHHK 2R5ZB 1MNEA 1OH5A 3S1MJ 4ZHRA 3H3UA 5LJ3h 3EZWA 3CW7A 2M7AA 3CBMA 1X4OA 2VWFA 3CQYA 1QPMA 3BJOA 3DI6A 3AVGA 2JA5J 2C0IA 4ZDLA 3OYAA 3H45C 2MABA 2LREA 1IV8A 3QESA 4C92E 3X20B 4EW0A 5L8RE 5B8HA 1T6DA 2NNYA 4KIGA 5FU7C 3JAMZ 3CYMA 3QMLA 4MZTA 3R61A 4CJPA 3ZLJA 3WTTC 1NJZA 4X34A 1QZYA 3WXIA 5GTIC 1OCTC 3JB9F 5CZ2A 1W5TA 2EH3A 4ME7A 3OS0A 3ZT3A 5HL7L 3V7RA 3CD6Q 1M8MA 1ZUYA 1SAZA 1UHCA 3VEXA 5E41A 4E9EA 2XV4S 4YFUA 3QETA 2G9WA 1U45A 3K10A 3OL4A 5IHKA 3OJUA 1MZBA 4NLBA 3AFHA 1WSFA 1WJDA 3KKSA 1IH7A 2JMCA 2XGDA 1GL5A 1Y0UA 1Q82U 1WIEA 1M2VA 4FO0A 2CQXA 4CJ7A 3PIPA 2UUCK 1NHAA 4F16A 3LSJA 1SF9A 1NG6A 3IRRA 1PUFB 2CUZA 4IEEA 4WQ5A 1XGNA 3JCMV 3PX6A 3ER0A 2AP1A 5ELZA 2NRVA 3JCMh 3A0HC 4DV2K 4A53A 2DQRA 4K42A 1HNXK 3DBRB 4CCMA 3PFSA 1WHUA 2WAQN 2RH2A 1YITT 3G7ZA 1A6IA 3EUHA 4FJXA 1HD3A 4B9QA 1NK7A 4AG2C 4FM4B 2DMOA 3J81K 2EYXA 1GCQC 1NKEA 4DFMA 5GAN4 2OTLN 4GKKK 1U5TA 4D6WA 5GP9A 4OKJA 1T8EA 1Y71A 4CD1A 3HIFA 5BOXA 3K5MA 2KT8A 4W5TA 3A01B 1W5SA 3CMMA 4R8HA 2P9IB 1OCRH 1STZA 4E4HA 5J1RA 4YY3K 4MQ3A 4LF6K 5L3DA 2RKIA 1LDKB 1U06A 2H3JA 3V8LA 4WF2A 3F5TA 4XAXB 2QDLA 3CCJQ 3H5AA 2ECBA 3LFKA 4PL7A 3UKRA 3HOTA 3E9FA 4XU1A 3HUGB 1SC7A 3A03A 4EGZA 4Z94A 2FA5A 1RAAB 3KZZA 4XOPA 2E2JJ 2YHXA 4XU0A 1VQON 2W6KA 3ESWB 1IKYA 3DBHB 2ZSHB 4CFBA 1UB9A 1CSKA 5HROA 4KBOA 4EJOA 2QAZA 2DA5A 3SWNA 5J47A 1E3PA 5HLFA 3QFUA 2XAHA 3GNFB 1J0RA 2P5VA 2WACA 2HI3A 3AY9A 4E6RA 2P9UA 3G1MA 2ZNZA 3RSNA 4A63B 2GFUA 2WOMA 1NJWA 3OW2P 3LA7A 3EYZA 3L00A 2G3RA 1KZHA 1F4KA 4E7LA 8ATCB 1M3QA 2Y1JA 4FM0A 1IBKK 3C2BA 1W4MA 3SAHA 1PSFA 1VQMQ 1HJOA 4AT1B 3BY5A 4FL6A 1MNDA 1VSJA 4DTUA 3BUZB 2EFWA 1JXOA 2KEAA 4A3DJ 4A3FJ 1ZG3A 5KI6A 1FSHA 1HSQA 1K73C 5A2QO 3HO1A 3A0IX 2E2HJ 4RWTA 1WSHA 2OZUA 3BR0A 3HT3A 2XDDA 1KU9A 3KLOA 2DE0X 4DTMA 4KDPA 2Z1HA 2O4XB 4B1YB 3ULQB 2DL3A 3FDRA 3EDPA 1I1GA 2KQRA 2VKEA 1SD4A 3PNVA 4O0JA 4B9NA 3K4KA 1Z1DA 2HZDA 3FXMA 3AO1A 3FJPA 1ITYA 4G9ZA 5C12A 1XMOK 3RESA 2W00A 1R1VA 2H1KA 3SPYA 4MGRA 2PVDB 1MV0B 2KDOA 4CJRA 2JLEA 1BW5A 1FYKA 2XGCA 5DUIA 2NYSA 3C4SA 2J7IA 1M2VB 2AHQA 3I0SA 3EGUA 3BCAA 3JCMc 1G3YA 2EPDA 4BR9A 2OA4A 1NLVA 3T8TA 2ASMA 1XN7A 1RKWA 4Y28E 3H8ZA 3QPLA 2E1HA 4CJQA 2D45A 5BR8K 3MCPA 4E7ZA 2L9RA 3JCMX 2H94A 4M3DA 2CSQA 1IN7A 3F72A 5FRMA 2W84A 1U2WA 3SYTA 4OB3B 5E84A 1KG3A 4BG9A 1K73R 2A7YA 2RHXA 2FBVA 3TAPA 3I64A 2MAMA 4IUUA 1WWXA 1SD5A 4LFAK 2K3BA 1U5TB 2V79A 3K59A 4Y13A 3B02A 3C12A 2KYMA 1HW2A 3S1NJ 4A93J 1RI0A 4JI4K 2HDWA 3V42A 4DWIA 3HHTB 3A5MC 2EZHA 1K4US 1H88C 3MKZA 4C2MJ 5EOYA 3D1NI 3LP1A 4CERA 3JSPA 1T7PA 1WZOA 1RETA 2A28A 4FVMA 2OZMA 4Y1DA 3ISNC 1MBHA 1XQPA 1GFDA 5GAOr 3V4IA 3SUNA 2IC3A 4LLNA 3UKRB 1S72N 4MNUA 3H0DA 1X2KA 4L5IA 3WNHA 4M4ZA 4M75G 4M77E 5KCOA 3I0RA 2OJ2A 1WPYA 2FC0A 2LC2A 1YJWQ 1RDBA 3L1AA 2KDSA 3CP2A 5M1NA 5FJ8J 3HOVJ 2QQ8A 4J2BA 3CCUT 3SWNB 3FHZA 2KZGA 2PVGB 3WTSC 2NOBA 4HYEA 4CJVA 4IHSA 4XORA 1SFEA 2P9UB 3TL4X 4JX6A 2FZCB 1XMKA 1KQ9A 1FNNA 1YS6A 3LDNA 1QVPA 4ZDPA 4NB4A 2VBZA 3THWA 3O9UA 3EYIA 3EGXA 3OYYA 1UG0A 4B09A 2PY5A 2R93J 3ZQ7A 3CMYA 4RUGA 1SRMA 4LD6A 3HVRA 2CP2A 2O8EA 3RR7A 3AAFA 1JJ8C 4I9QA 3O6BB 4BQZA 3WTZA 2A42A 5GAOl 1GBRA 2CMPA 4HBLA 3KLHA 1YTAA 2I5JA 2C0TA 4NBQA 5KYYA 5AR0A 4EW4A 4S04A 2EIFA 1E4FT 1UJYA 3QIPA 4XOTA 2E3HA 1W6XA 2WTUA 3UPUA 2ZGYA 4GLKA 3I35A 3G1OA 3I0XA 1O3RA 3TSZA 4BREA 4H4OA 4BY6C 5JS1A 3RSEA 2DX1A 1R0AA 2P7VB 2LKPA 3QU6A 3C0BA 3W3CA 2E5KA 3GNGA 4KA4A 2BANA 2YCHA 3HYFA 1P59A 1WJBA 1NYGA 4E9HA 4DSLA 2ASOA 5GMKm 2GTDA 2GV9A 4N5SA 1O1WA 2JJ9A 3NQOA 4HX7A 2QYOA 2BDPA 2R7QA 2LDMA 4U0VA 2W10A 4CGJA 3I9V2 3I4MJ 5BN8A 2VC1A 3PQKA 2PTKA 2QWPA 3RMDA 1AA7A 2KL4A 1UEBA 1JHHA 1RI7A 2MSYA 1XCBA 4DYRA 1ZYQA 4JI5K 3DFGA 3M8QA 2L3SA 3JAMO 4BGDA 1IRFA 2E1OA 1LEAA 3CJRB 3MVPA 5EYRA 1I0CA 3WXMB 5D5XB 2RJDA 1BKBA 4B3RK 2DTIA 5LGUA 2ZGZA 1H8KA 2IS2A 3NWTA 4DR6K 4EZ6A 4BUPA 2RMOA 2PX9A 3GCMA 4QQGA 3C95A 5HRPA 3RYPA 3S2WA 3SYZA 4E1MA 1TQPA 2DBBA 3LDQA 2JPSA 1VQ9A 4FWLA 4H0VB 3G71T 2BGCA 3HTSB 1WSJA 2D6FA 4YG2F 2P51A 2EV6A 4M6VA 3RBBB 4IIMA 1VQLN 2P0KA 3RKXA 2BZ8A 1OX9A 3VYSB 1ASVA 1R6RA 1RT4A 1CKAA 4CGGA 3FHGA 2CYYA 3CTAA 4R55A 2XB5A 3HC7A 3LZJA 3PX4A 4BBSJ 3HBTA 1NOYA 1KQ0A 1T6CA 2VASA 4M6XA 3UATA 2I0NA 4YOUA 2QK9A 1ZA2B 4Q48A 3HL2A 4DK9A 3F8BA 3VQQA 4PLIA 5I42A 1DJ7B 1APLC 3PNYA 1YTYA 1ZGWA 4CD3A 4O6JA 5E17F 5AJ3K 2I7NA 2RI5A 4CE9A 2X0LA 2HSEB 5E8IA 4Z8AA 3M0PA 3G2BA 2CUJA 1JLAA 4MHGA 3F70A 5TRDA 3QBXA 2ME0A 4BBRJ 5E1XA 3ZEHA 3HB9A 2O9LA 3NFCA 5AQQA 3L7WA 2QQAA 2G8FA 5GANe 2FSWA 1WI9A 1U2VA 3O08A 1TL3A 1JTYA 2GBYA 5HLIA 1ACIA 2LY1A 3QP5A 4M9XA 5C4JJ 2W7NA 1EO1A 1QVGS 4XH5A 4XQ3A 4UY8I 3FFIA 1VQNA 1VQ5N 3QWYA 2M4GA 3THWB 1WPKA 5AQTA 1TW3A 3V9UA 4XH1A 1ZRCA 1BA0A 1LJ9A 4DHYA 2DZCA 4HX8A 2RPIA 4HVWA 4CF9A 4A3GJ 2O8EB 1VQNI 5LFAA 1WJFA 4ZJZA 4AFSC 5JMVA 2AA4A 1BN5A 3S1QJ 1AEYA 4JI2K 4DF8A 2VJ5A 4L18B 2V52B 1IXSB 4QIWN 1U6ZA 2V9PA 5KYYB 1TL1A 2NS0A 4KUMA 2DLLA 1ZYRF 1N34K 3P83D 4IFVA 3O8MA 1NM7A 3UR3C 5FU6C 1CQTA 4AIJA 4OINF 1K4TA 5HS8A 1SL1A 3JREA 3ZMUA 2YUPA 2QCOA 3RSEB 3JSCA 5BNGA 1KRPA 1PM3A 4K11A 5A0GA 1X3ZB 1NBEB 3VQ7A 2GX9A 5GAN3 1KFDA 4B24A 1NGBA 2HTJA 2HMPA 4NB5A 3BY6A 2HKXA 3KLEA 1FMVA 3CUQC 2BZXA 3DV8A 1HA8A 4KNYA 2P9SA 2L9SA 5IHNA 3VF4A 2AXTC 3K4NA 1KFZA 2FSNA 2HQXA 3ABUA 4C8QA 2CH6A 3DXMA 2VG5A 1XHZA 4HQEA 3VA3A 4M3WA 4X6AJ 1MWMA 2GOMA 4KI6A 4C8QG 3QZ9B 2DMTA 2YJEA 2ZXIA 4M71A 4EMKB 4FHTA 1WJQA 5HDNA 5KPZA 5GIOA 4PKIA 3PNWC 1WSIA 1WOQA 2QSGX 2DL7A 1RNHA 3M4OJ 4XIUA 3LP2A 3THXB 5M1QA 2AKLA 2ZPHB 3LSTA 1WXUA 2ROTA 5F0FA 5I22A 3NGYA 2MW8A 4LK1F 4UB8C 2RAEA 4DEXA 3M8EA 4XKWA 3VERA 3TP0A 1SFOJ 3K0LA 4OIQF 3R8EA 2DYSH 5H20A 3GW2A 3OH9A 1PU6A 1S6QA 4NO7A 5CQEA 4ZN1A 1QSSA 4BVOA 2OTLT 1LPLA 3NF9A 3F23A 3EY1A 3G6EN 5AQPA 3RPQA 1S1UA 2FZGB 4JKFA 4MDAA 1UFMA 2F48A 2H6BA 3IFRA 2HVIA 1X6BA 3S17J 5H6QA 2E5ZA 1QS4A 4EVVA 1BI0A 5BREA 2V9VA 1LWWA 4OMMA 1Y8RB 1QVGA 2MG4A 3BFMA 1VQKN 3SBGA 4M3TA 2IPOB 3DLAA 4CRIA 3C94A 4HA8A 4KTQA 3PNTA 2K9MA 1ZUUA 2QQSA 5LL6S 1XGMA 1AWXA 1E3MA 3WNGA 4HLXA 2OZ6A 3OHRA 3DYAA 2A3ZA 2K3PA 1CZ9A 3OIPA 1UWBA 1FN7A 2WAQA 3LL3A 1VNDA 1FMWA 4YPHA 4NUBA 2DPNA 1UG2A 1WN7A 3HK2A 2O6GE 3IUOA 3N05A 3U1KA 5AQYA 2JM9A 1KAXA 4A3MJ 1ATSA 2DZ9A 3IQLA 5L3EA 2OTJN 2ZXWH 3LA3A 1KVBA 1T03A 2V26A 3HKSA 1SSHA 4KRFA 5HRSA 3H0HA 4CESA 3E9LA 2CP6A 1IG8A 1R4MB 5KE3A 4KHUA 3I8BA 5T7BA 3ZQIA 3H0GJ 2HL3A 4KGZB 4LN2A 5GAMh 1SSFA 3VN5A 4CHUA 2LSOA 1X1CA 1NK0A 2VT2A 5FLVA 3WT0A 1VQOA 5CVVA 2FXUA 2QLZA 3H9QA 3R9PA 2VODA 3BR6A 4DR2K 3L2RA 3IH3A 2J6FA 2NUZA 3LGLA 3W2WA 2O8CA 1TUDA 1VQOI 5LJ3d 2GBZA 2HZYA 1WJEA 4YTLA 1VZ0A 5KNLA 3MXMA 2IAIA 4MMKA 1BHLA 3BJ6A 2HMIA 1KVAA 4XEIA 1L3SA 3ECOA 3OGDA 2XHKA 1KEAA 4DQQA 2EFQA 2K27A 3VFZA 2MYSA 1HYZA 3WNEA 4OMQA 1UB4A 2ZJQL 2VWBA 5HDGA 2XVCA 1BB9A 3H5RA 3C3WA 1PP8F 3HVTA 3FXQA 2L3RA 1ZG5A 5B5EC 4J9DA 1SKUB 4F04B 1QZEA 3UF4A 4YOVA 1N6AA 1WH7A 4F3OA 2EFOA 3BPXA 3G25A 3KKRA 2RO0A 1HBXG 2DQLA 3CIPA 3H3ZA 2H3GX 4JI7K 3Q0WA 2DA1A 2ESNA 1J59A 3DKMA 3QEPA 3DRSA 4RB0A 3KP6A 4JKEA 2KPMA 1NGJA 3VUZA 5DY9A 3D7SB 5D7UA 2HGCA 3H08A 2HR3A 1ZREA 1KC8U 3DAWA 8AT1B 5M9OA 3MKYB 2L9VA 2M0YA 3NF6A 1JL2A 5LEKA 4XTUA 4DGWB 4A2UA 4CZZA 3K5NA 3NDKA 2B8AA 4NYNA 3JCMd 1Q86C 1A6QA 1JKPC 5LJ3j 1T0FC 3R6SA 3DRRA 2P84A 4ID5A 4JI0K 1KD1U 2V8JA 1CGPA 5LJ3g 1SMYF 3AARA 4LF7K 2PG4A 4CZKA 2FEZA 1X6GA 3DLEA 1FJGK 1VSHA 3TAGA 2DTUA 4G12A 4LB5A 1A5JA 4DS4A 3U3YA 1TP4A 3QIOA 1ORKA 4OFEA 1SFXA 1NK8A 4VUBA 2RHZA 4M73A 3L2ZA 1VOMA 4A59A 4X66K 3HFNA 2L7MP 4DU1A 4A3IJ 4JLGA 3OMCA 2NOLA 4E7KA 3KP2A 4A4KA 2UZKA 4BRKA 4F17A 3WNFA 3MEXA 2QZ8A 3E0JB 2PFUA 1RILA 3D2FA 2Q31A 1VQNQ 4IZ9A 5IT3A 2M8EA 4RW9A 3SNNA 4JI3K 3Q1JA 2FZKB 3BDPA 4WWCA 3VS7A 2P0WA 1GLBG 4GKJK 2W1OA 2RE2A 3N5BB 2F5EA 1AU7A 1JKHA 2ZPBB 4JYKA 2ZBKA 3THKA 3BP8A 2BHYA 4WCIA 1Q86R 4RGXA 2UU9K 1YQAA 3B73A 3F6VA 5DM7F 5D5UB 1S72A 5AZJA 2ZGWA 2LT4A 1K61A 3TSPA 5CQGA 1TK5A 3PJRA 1RDCA 2Q1NA 4P9UA 4OVAA 2ACJA 4J9IA 1UE9A 3A5LC 1S72I 4KMUX 4R56A 2L7KA 4EM0B 5LMNK 1Q7YU 2HKQB 2F69A 3JCMg 3F2KA 4CFAA 5JLHA 2ZJRF 4J9EA 2QUFA 4B9TA 3PIOA 4KHYA 3FJ5A 5AQHA 3BG5A 2E34A 3RCOA 2BZYA 4A3BJ 3V4GA 1JJ2M 1KVCA 4HCCA 4EQQA 2EIKH 1E17A 2R4GA 1TWBA 3GTLJ 1TOVA 1LQ1A 2VKDA 5FKNA 1A0NB 4FLWA 3KX2A 4EEFG 4LD5A 4MDXA 2DOAA 3HM5A 1MNMC 2VXEA 2A5YB 4BE1A 1HMVA 1VRLA 1BA5A 4U88A 5CVJA 2KFZA 1KA8A 2P6TA 3HZ6A 4OMYA 4HW0A 3SEMA 1M1FA 2HQRA 3TANA 4JK1X 3F3XA 3DEUA 2WUSA 2GWRA 1G6NA 3I5UA 4DZPA 1S22A 2M8GX 4OX9K 4OMOA 1I5ZA 2HOSA 1ZELA 4OPJA 3BTIA 1NGIA 1WFXA 2A1SA 4AYBN 5LJ5e 2EA4A 1WEGA 2XPWA 1PSEA 4FXDA 1DPRA 2FPFA 1M1KC 3O5ZA 1DUXC 3DJCA 4H0XB 3DLLA 3MXIA 2MD0A 3CWUA 3WTVC 2EWSA 4NDLA 2HL5C 4QT7A 4CEQA 1U84A 3OR1C 2LCCA 4B9SA 3S6WA 1QO0D 2HYGD 2MC3A 2YNHA 2VGNA 1LCUA 3EZ5A 1USTA 4PFOA 1VQLT 1CKBA 2NNWA 4OVLA 4FT2A 2KRCA 1Z9ZA 4AVZA 4O55A 2RVCA 4FCYA 4F2SA 2IS6A 3SMSA 2A69F 2EV0A 1BI1A 4HSBA 4GLMA 3BPVA 4WQ5C 5GMKi 1M3AA 2G7HA 3LPUA 2KK4A 3HOWJ 3DCFA 5HS9A 5ADXH 5FD6A 3WGHA 4DTOA 1JJ2P 1ORNA 5D5WB 2MGQA 2RA2A 5HRRA 5J39A 5LJWA 4GFBA 2NOFA 5CYQA 3K9JA 2LH9A 3L2QA 3O9RA 1QWFA 4Z4HA 2EW3A 4RCBA 1M1KR 3LCNA 1PVSA 4F93B 2F5VA 4H03B 4AF1A 2O61A 5D4SA 3D2FB 3RJPA 2L0AA 1F5TA 2W41A 3QLHA 2WWYA 3ABTA 4AM7A 3EHQA 3LSGA 2JWLA 1VQLA 1NKCA 1QP2A 4KB1A 2FOKA 1UGPB 4M75E 2YLBA 2ZXJA 4F3QA 3IHUA 3AL0C 5IPAA 3V7CA 3ENOA 2QEXN 1PKSA 1VQ5T 2HS5A 4ELVA 5IP9J 3VS5A 2QM3A 1RR8C 3BROA 1VQLI 4PFZA 3J8AA 3WXJA 2DA3A 2Z1IA 2ROLA 3L42A 4FSVA 3QDKA 3SDGA 5AZJB 1KYZA 1QQOA 3DQVC 4FJ8A 3MEWA 4BRPA 3CLOA 4AHCA 2LNBA 4CCJA 1VQOQ 5IOZA 1HCRA 1RNLA 4NNJA 3VETA 3IG1A 4UNFA 1ZARA 3JYTA 1N39A 4BQLA 3CPEA 4ENMA 2MCNA 2VBYA 4XU2A 3K9KA 4HOBA 4KV8A 4IQ4A 1BIZA 2QENA 1BJZA 2CS7A 5I11A 5JVGF 3LFUA 1I1SA 3CWAA 3I4PA 1I07A 2ZD1A 2VB6A 4PJJA 2V7YA 4E9FA 1IN6A 1J6ZA 2Y1IA 2ITMA 4OAYA 2KRFA 3RR6A 6PAXA 2WFBA 4CZCA 5ICEA 1LJOA 3CCQT 2VKHA 2V7FA 2IIMA 2DXBA 4F55A 1TQMA 1HKQA 2E70A 1DGWY 4FYVB 2YT6A 2COBA 2VG6A 4L5JA 4CBXA 1C1BA 4WK8F 1B1BA 3GIBA 4RAYA 5KYXB 2K4JA 4CEZA 1N32K 4AHRA 3X28B 3ITHA 3MEDA 1JBMA 3X24B 1S9EA 4AIDA 2GQIA 1BYMA 1ETYA 1FXXA 2YJFA 5D6XA 3SQ4A 4KN7X 4LUEA 3O3KA 1Q9XA 4XH4A 1GDTA 4RB3C 1XPXA 4HVJA 3QEIA 2JNGA 2JSPA 2ME6A 1VQPN 2JWTA 2OQGA 4GRIA 4PHTX 4A4HA 1TYQB 4H5RA 4MLHA 3LH5A 2ASPA 2QTVA 1WB9A 2DBKA 4KH0B 1K9AA 1WHMA 5JS2A 1X4PA 1N8RU 5JHFA 3FK7A 3CMEN 4CGFA 4D5CA 3LSMA 1EH7A 3G6ET 1J9AA 4X64K 4HUFA 2H8HA 4ZYGA 2E6NA 2K7LA 4M75F 2XG8D 3FRNA 1W70A 2X9DA 2V6CA 1MGTA 1Q18A 1LFUP 4DEYA 3VWBA 3OYDA 2CH4W 1RTJA 2PYLA 3AVIA 3LWFA 2BY1A 3Q9VA 2RQVA 3K5LA 2W40A 1KG6A 3AVFA 5GPAA 2JA6J 4A12A 3JRFA 1GLNA 2OBPA 2KNBB 1X9SA 3BDUA 5ED4A 4C8OA 5DD4A 2XHCA 2R5YB 1WYXA 3RMCA 1HJDA 2OAZA 3TOAA 2CYZB 2Y0SN 3J7AF 1KQSA 5FKMA 4BWJA 5F04A 5J8CA 4I9LA 3JB9I 4DU3A 3JB9G 1RDDA 3KCCA 3EH1A 5CZ1A 1FOXA 2EAYA 1U1TA 1X9MA 2QBYA 4P5NA 4WFBL 1BI3A 4LFBK 1OZ3A 4M75C 4C30A 3ZX3A 2QXFA 1GCQA 2D0NA 1MV3A 2R92J 3M58A 2X4YA 1RRQA 4IBNA 3AVKA 1S72Q 3H6ZA 4FJKA 2MWPA 4Q47A 4FJ7A 1VQKA 2LLKA 3BOQA 4J6YA 3BZKA 1XCVA 2KT0A 4IUTA 4LDUA 3HPWA 4CC7A 4JPBW 3JCMW 5J1YA 1VQKI 1KG2A 1TT0A 4H5VA 2F7TA 4IQJA 1Y0MA 3QWXX 3OS2A 2J06A 3F8FA 4CZHA 1O7LA 4KH5A 1MDMA 2XB0X 1UHFA 3GFLA 2HHUA 4CSWA 3K7AJ 1CF7A 1IRGA 1TWCJ 2DERA 4PUOA 1DTTA 2BE7D 1LW0A 4BROA 2OTJA 4C5HA 4C3HJ 5AQSA 5EG0A 3JCMJ 1OCOH 1PJRA 3E6MA 4C3JJ 2E36A 3NGZA 4OGEA 2X51A 5ICFA 3OW2S 2XKPA 1WJSA 3BF3A 4RBOA 5DTDA 1RACB 2ZZDA 2OTJI 3CCST 4BRGA 1UGQB 2WSFE 3M3ZA 3J7YP 4LXCA 3V7SA 4UVAA 5KH6A 3P8DA 3FHFA 1FLIA 5M1FA 1QHGA 2R7YA 3DTKA 4OP0A 4DBHA 3MEEA 1V76A 2D1XA 4AM6A 3H1CA 1V5FA 1QZ5A 2LRDA 3CJNA 5FFXA 2KRMA 1K73O 1G3SA 4RCCA 1Q7YO 1AHJB 2F5TX 2PUOB 3CCMN 4EDUA 4B23A 3HSRA 3N4MA 1QKXA 2O01E 4RTUA 1LWFA 5FU7B 4I01A 2L2PA 2RF0A 3HI0A 1WXTA 3CMAT 2QSHX 4C92A 3QICA 1D3BA 4C8QE 5SWMA 2ED0A 1E3HA 5DLOA 5AQVA 3UB5A 3I53A 3FXUA 4C92G 1LWCA 1VQ6T 3QEVA 2GA1A 4E7SA 2P5GA 2TCTA 5KYWA 2K5IA 2E2IJ 1T2KA 2VKVA 2UUZA 4DV7K 3IH4A 1XQSC 3M5RA 4QQ6A 3CXCM 1M9SA 2N8GA 1F1ZA 3FZLA 1RR7A 1Y56A 4Y7NJ 2P9LA 2X3WD 5AFUA 2OA8A 2W4SA 1HXDA 5K1YA 4C9YA 4J2EA 4P1WA 3RQ4A 5FB2A 3LLRA 5J6XA 4WCEL 5BPNA 4CC4B 1PHTA 4LF8K 4KHNA 2EINH 4V2SA 1G2BA 2K6DA 3V81A 2W85A 3TBIA 5K7ZA 2JG6A 4BI8B 2PMZN 1UJ8A 3NBPA 1DP7P 1VQLQ 3OIOA 5JICA 1KCFA 1T08B 3PQJA 3EGDA 1LVAA 4CO8A 4DR1K 1WNLA 1NPPA 4AMCA 1REPC 1IKWA 1RT1A 4E7HA 5J8FA 3ASNH 4JRKA 2ELJA 3DEEA 5GAN2 4FJIA 1UOCA 2P9KA 4J7IA 2YLCA 4M42A 2M9HA 4QKUA 4E89A 3TQ7P 1XSVA 2RNGA 1S7EA 3JB9J 3BE3A 3JCMQ 3K2PA 2QSFX 5AQIA 2P5KA 5DD8A 2BGGA 2XKOA 4BNCA 3O4WA 1N36K 1T98A 2OF7A 3OW2A 5HVQC 3DMJA 2KMUA 3LL7A 1D8KA 4B1WB 4AG1C 4YOTA 3CC4N 1N78A 1K6YA 2D2WA 2NRZA 3K4BA 4AM3A 2FF6A 3FM3A 1Z05A 4Y91A 4RLFA 3MECA 3I5RA 4RS8A 1W2BP 2O3FA 4I6MA 4ASNA 4M7DE 1M8VA 2LX9A 4R5PA 2O5RA 2JGUA 1GT0C 3CC2A 1VF9A 1WEFA 2DTOA 5M1PA 3I56N 5EG0B 2O8FA 1NJIC 3CXCP 1EZZB 1DTQA 5IAYA 4RTTA 3P9KA 4HEA2 2V1QA 3F8MA 2KJBA 3CC2I 1OEBA 5FPMA 1D0YA 2VONA 4A3LJ 4C8QF 2E19A 3J80K 4J9HA 5KQ8A 3H5NA 3VS4A 5J40A 3HP9A 2M0CA 1AOYA 3CCEA 1RBRA 3LP3A 3OYEA 4CJKA 2EJ9A 3LM9A 1QVFM 2Z3YA 4ESJA 2EFPA 2JXBA 1ZBJA 2RI2A 3VEPA 4U87A 1PU8A 1P8ZA 2DA7A 5GANd 1G4DA 4ICLA 4N47A 2IJLA 1LDDA 2HOEA 2JTFA 4FSSA 1WLPB 3KPHA 1VQ4A 3KK7A 2E35A 2P6SA 2HDAA 3THYA 3M9QA 3O8GA 2HBJA 4JS4A 3M8SA 3LA2A 3NHNA 4UHTA 1VQ4I 4OO1J 4CZEA 1D3BB 4B47A 1FIPA 2OC6A 2XGXA 2FX0A 1YQRA 3U21A 2BVMA 5GAGP 2HQNA 3C1DA 3LOCA 2ATQA 2L3PA 4HUGA 5F08A 4C8QC 3PE0A 2P5LC 1YJ9T 2CH5A 2DU9A 1NJIR 4AC0A 4QOZB 5KYWB 3GUDA 1F9NA 1JXBA 3E6BA 1LWVA 3HGGA 1RT7A 2QWWA 2CP7A 4XN3A 3VESA 4NS5A 3FEOA 1VSFA 1X01A 3QDFA 4IG0A 2O8DA 4HVUA 3CC7T 4FWPA 5IHIA 1N5YA 4MZPA 4CK1A 4HF2A 2OANA 1Z91A 2VOPA 3PFIA 4AYBA 1LE8B 3S2HJ 2DEUA 2XDVA 1JLEA 1WGXA 4XQFA 3JRBA 4IJAA 1E2XA 2FF3B 3KLGA 4AUXA 4I6ZA 1I4K1 1RBTA 2QGUA 2OCCH 1J5YA 5KRTA 3CPWM 2XY8A 2DXIA 3L1PA 3EG2A 3IWFA 5CKTA 4KISA 3SBTA 3CP8A 1TUGB 1MMGA 1GLCG 2LQ8A 3EGDB 3DPTA 2FE3A 1B07A 2DILA 1M90U 1OOTA 3G1JA 1E0EA 1QVFP 2BIVA 1KAYA 2D0QB 2HW3A 3ZR8X 3ZQLA 1N8RO 3V9SA 5GANg 2M3AA 4J5YA 2XHBA 4W97A 2QEXT 1NJXA 4CA0A 4M7DF 2OI3A 3KK3A 3L2CA 4JJBA 2RJEA 3R3LA 2P9KB 1RTHA 2F4OB 2RN7A 3SJMA 3DPUA 1ZR2A 2GOXB 4Z4GA 2HVRA 4XBFA 1VQKQ 3H3OB 3KWIA 5DM6L 3IH7A 3RPUD 3LANA 3VA0A 2Y4XA 3G4SA 2NOIA 3FE1A 4BH9A 1VQ7N 3EO3A 3LDLA 1S3JA 4DOWA 2ZPIB 5BQTA 1RIOH 4K43A 4BXUA 2JT4A 4FWQA 3VQ6A 4H0EA 1K8AC 3MN7A 5F27A 2E5LK 3JS6A 3G4SI 2RN2A 2VVKA 3B6CA 4LD0A 2KXDA 1HKGA 4KMFA 4I6MB 4Z2YA 3E19A 3EG9B 3CCVT 4L5GA 3FZVA 2CQ7A 1HOMA 4U7DA 4M77A 1TNSA 2XPVA 3WVEB 1Y96A 1NM1A 3V8KA 2OTJQ 2O8FB 2GGRA 4M7DC 4X1EA 1K76A 1HNVA 1W9HA 4IFYA 1B9FA 3D5LA 3FKIJ 2HSTA 2R7TA 3HRUA 4IUPA 4M77G 3GL1A 5LJVA 1I3AA 4EFHA 3M07A 5LJ3f 2WA0A 3RERA 5FW9A 3NWSA 2K9NA 3I54A 4M3EA 2MIOA 5C0YA 1IKXA 3GLLA 4ILHA 4LDYA 3R0JA 2ADUA 3L09A 3S3MA 1ZC6A 3CPWP 4GVEA 4D0PA 2J4RA 3LQQA 5B3SH 3OTOK 1VSEA 3FMQA 1GLFO 4I2QA 2NOJB 1DDNA 4HF1A 5AONA 2LJ3A 3THYB 1UHWA 2WY8Q 3FMRA 3T7ZA 1JT0A 3HTRA 2YNGA 1WI3A 3D5SC 2JN6A 1OU9A 3AO4A 2Y31A 3K69A 3C7JA 4B9XA 3EUKL 3UA6A 1VUBA 3WEEB 1TTYA 3VU3C 1JL1A 3H9JA 4J8OA 3AAQA 4BY6B 3ZMDA 1NMDA 1KSPA 4V2FA 2W48A 1Y64A 4E1NA 2G6FX 3M8FA 5D6YA 3VOVA 3K1MA 4L6V5 2LC4A 3HM9A 4I09A 1HKTA 2EBPA 4B1ZA 3NMZC 1H89C 1K9MC 2E6ZA 3QEWA 1RRSA 1P6RA 1Z3XA 2XASA 3FC3A 2A6TA 3CUQA 3GTOJ 3CMET 1LW2A 1QHHD 3TQNA 4DU4A 1H1VA 2EPFA 3CUOA 2FG0A 4D8KA 2V9KA 1IG7A 3JCMf 2MC4A 4YFXF 4ZYAA 1PG5B 5AIPA 4ELYC 1YFHA 2ZJPL 4BE0A 2F2EA 3WTXC 2EKOA 1YT3A 3S93A 3VEZA 1ATNA 2OPQA 1RAEB 3L4QA 4XN0A 3FZHA 2IG0A 4OPAA 3BEXA 1IO2A 3T5XA 3SQ0A 2MD5A 1M90R 2R7WA 4V19S 1SL2A 3KIOA 3QFPA 3TEDA 3O9SA 4M3ZA 1VQPA 4ATOA 1FYLA 2VG7A 4IFEA 1BIAA 2E1YA 3C6HA 4PLLA 1LMZA 2BOLA 1MSEC 1BGXT 2YV0X 4JZ4A 5JLWA 4ID1A 1VQPI 3NTKA 1SD7A 4JDSA 3MP1A 3NRVA 1K9MR 3L3VA 4MEXF 5BS6A 1WZ2A 1WGSA 2ZPEB 1S1XA 3TAMA 5I9EB 1S6PA 3MX2A 3DP7A 5CVRA 2ZE2A 3SFIA 5A2QE 3E66A 3DBLB 4OMFB 3RPUA 3KFWX 3P7NA 3V1OA 1EXQA 4M63C 3BG3A 2EV5A 2IW5A 2VV5A 1KAZA 3ASMA 2PZ1A 5AQNA 5GMKh 1ITGA 4F3TA 3M8RA 3VSKA 3O9QA 4DFJA 2DNUA 2P4TA 3OH6A 4CCLA 4CJ3A 2MA3A 1ZBUA 4KTZA 2TRTA 1WUAA 5ICCA 3BC8A 1HU0A 5CKDA 2IRFG 3HHHA 1Y07A 2M7BA 4JJCA 1X9WA 3VQPA 2DKGA 2AXLA 2EQRA 3HSEA 4C5EA 4OPKA 2HKOA 4Z4IA 1YP5A 3CC2Q 3PIOF 3B6AA 3LSPA 3BDDA 4PNOA 3KUFA 1LFBA 2H6CA 3GG4A 5DEQA 4RW4A 2ETHA 5GAOm 1YFNA 4MFDA 2AT1B 1D1AA 3BR3A 4C5GA 2ID6A 5FKKA 1ON1A 2VPRA 2R0QC 2YS9A 2GM4A 4I7HA 3MFKA 1N33K 3CWSA 2VXZA 2ZNYA 1NK6A 2WY7Q 3ZRGA 3T1BA 3RQIA 4HT8A 2YKMA 2DMNA 2E12A 2ZC2A 2PMUA 2ZSIB 2LQKA 1BU1A 4LG0B 3CJBA 4XK4A 3F0CA 4QWQA 1SVMA 4GXOA 4RW6A 1VQ4Q 4KTWA 2NUTA 3GWZA 4RMNA 3DU5A 5KAFC 5E26A 3MWPA 3CCUN 1QQMA 1U04A 3TDZC 3VV0A 4PA1A 1Z77A 5FU6B 3CJQB 1YJNN 3D0SA 3JRIA 3CCMT 3COAC 3PM1A 5CK9A 2IDOA 2R7SA 3RZOJ 1RL2A 2KY9A 2DODA 3M4YA 3OS5A 5DMRA 1ETVA 3BTJA 2LKXA 3F0ZA 4FM2A 1OYIA 3E5XA 4PSWA 3CUQB 2CRGA 3SXYA 2MH2A 1Y0NA 2CSOA 2KFNA 1BIBA 4CW7B 4H4KC 3BQYA 4OMPA 3WQTA 2NVTJ 3EAEA 1FIAA 1X19A 1FOYA 3VEOA 3V1QA 2G8HA 2BXYA 1FEXA 2DL5A 3KLFA 4BDYA 3VTIA 4FOEA 2YUSA 2VJIA 2HXOA 1SRLA 2KKZA 3A02A 4FWNA 4YFKF 3DLGA 3CCMA 3ZSRA 2GIVA 3OYBA 1SAUA 4ITVA 1J54A 3P9IA 2RJFA 2DA9A 3KXTA 1YIJN 1Q81C 4CJTA 3VOEA 3H1VX 2K57A 4B22A 2X6NA 3CCMI 1VQ8T 4F2RA 4CICA 1PDNC 1N27A 5BR9A 3ZGKA 1WHJA 5GPCA 4IHYA 4PCQA 4FOIA 4ESFA 4Q4ZF 1XG7A 2BE9B 1EJ9A 4QVZA 4TV7A 5EC7A 3ZBDA 1W1WE 4LUDA 4F7UA 1C1CA 5DUKA 2W6LA 1I94K 3W3DA 2WB1N 1ZBFA 4JN4A 3VPRA 4N9HA 1AWJA 4PKGA 4F7UG 3MQ0A 1Y39A 2F4IA 4BEHB 2IIRA 3KK2A 4GW6A 2VQHA 4LDXA 2JT1A 5K5RA 3G4SQ 3EETA 3MAQA 5D8KB 4WF9L 1I81A 1R49A 1BCOA 1VK0A 4YIFA 1MH4A 5CJ9A 4ISGA 3RIRA 3O4QA 3ZSOA 4IHXA 2V8KA 1RTDA 3DXKA 3HRGA 1D9FA 4E70A 3BG9A 3G71N 5CR4A 3CC4T 1Z25A 4TSXA 3P9CA 3BZCA 1NLOC 4FYYB 5B1BH 1Q81R 1Y97A 4NXNK 1NG9A 1WXBA 2VJJA 2HNYA 3HPOA 4O3MA 2GQVA 4CECA 4M7XA 2HQ5A 5AQLA 3ASOH 4JD2A 2KT1A 3REBB 3OYGA 1R36A 3QODA 4UB6C 2XK0A 2M2EA 1L3VA 3TREA 2EX3A 5JVTA 4KBMB 3GP8A 1Q9YA 1NE8A 5F0HA 2QI2A 3VYGA 4CHNA 4BC5A 3IRXA 5C42A 1IAWA 3OSFA 3V9WA 1MD0A 1RT2A 2ABKA 3AG1H 2F96A 3F8NA 4M78A 2GNCA 3AVBA 3VYTB 2W82A 2GAUA 2AK5A 2DK8A 4A61A 2YR2A 4IVNA 2CV0A 4AVPA 3LGFA 3UNGC 2D0OA 4B1VA 1USSA 3GBGA 4M78G 2EQJA 4YPRA 3MZYA 3FXLA 2YHWA 2Z0WA 3IKMA 4JRIA 5FFZA 4XU3A 2HDCA 3VF6A 5LJ5g 1VFCA 2W24A 2KJCA 3CVTA 2BTTA 2M45A 5AZIA 3I56A 1RZ4A 3OWTA 4BI4A 1IBMK 1KXPA 4HNUA 3CJ7A 3QINA 3ID8A 1ZSZC 1AHDP 3FIFA 3O8VA 3HPGA 2E6LA 2LQWA 3R6MA 3I56I 4FJMA 2NZTA 2E2PA 1WQ7A 3AO5A 4X9DA 3A5NC 1WVRA 4OGCA 5K5OA 3ZQCA 3ZP5A 4KHSA 4I0AA 1NK4A 2W25A 5FO5A 1S29A 5DCMA 2FLOA 1I5LA 2AZVA 1Z7LA 4G7ZF 1SANA 4PIIA 4QPOA 1BUPA 4GDFA 3OYMA 3CZ6A 3KP5A 5EG2A 1EX4A 5JLFA 4WE1A 2XY5A 5AQUA 4ZYHA 4IHWA 1H8AC 1OYXA 3REAB 2LVMA 1HKCA 2ZPFB 2YKNA 1M3HA 1JCGA 4I02A 4EHTA 6AT1B 2XUBA 1BR4A 2WSEE 1GV5A 1YHQN 3S9HA 3HRMA 4DV1K 1NU0A 1X3NA 2XDBA 2VQLA 1M1KO 2QA4A 1W97L 4LF9K 4IURA 2JPBA 2D1HA 5LLQA 1VQPQ 4B6MA 2B9SA 3OYFA 4IXCA 1YW8A 3HRTA 4CGZA 3M1FA 4DJAA 1YQMA 5EDNA 1YQLA 3RTRA 1VIEA 2QA4I 4Y52J 2ESWA 2DAQA 1C0TA 2LMDA 5F2RA 1HYSA 4HVVA 2Y9YA 1ZRFA 3I55T 4RGUA 2E1MC 2GF7A 2IXSA 2Z5UA 2HBWA 4JYAK 3SZGA 2YU3A 1XTDA 1G3TA 4C0FA 3GFIA 3A1YA 5HLHA 2OFIA 4W5NA 3C2GA 2E3IA 5FWCA 3O8HA 5CHIA 4BRMA 2Z33A 4JK9A 4LFUA 1ABQA 1XI1A 3N97A 3OR2C 4E7JA 3W2AA 3I9QA 1TT5B 3TABA 2LP0A 4XM3A 4KB0A 1QSYA 4CBWA 2VQEK 3OMYA 4GMJB 3R2XC 1X69A 5KPRA 4HV6A 1VQ7T 2YUOA 1RLPC 2GFAA 3A8HB 2JUFA 2UXCK 3JRZA 1N75A 3K4CA 4JS5A 1VSDA 4BRFA 2BY3A 4AD9A 2KRSA 3MZ8A 1N25A 3HKZN 4WQ4A 1E7OA 3LNQA 2MMPA 4JKBA 2ENMA 2Z2SB 4N76A 4F8RA 3CDHA 1S1NA 5AQXA 3M54A 1F21A 1D4XA 5AQRA 4OB1B 1QVGM 5C0MA 4IJNA 1U4BA 4R1HA 2IGIA 3QJ6A 4GV3A 1A04A 2CQKA 4CZLA 3WU1B 1SKWA 2GXBA 2BY2A 1JUMA 1FZPB 1EETA 3CF5F 1FC3A 4M75D 5TJJA 2KGTA 3J81O 1JT6A 1Y1WJ 3KP4A 1M27C 2LF8A 2ZMEC 2FEIA 2AQEA 3H41A 2K3FA 1K0SA 1TBXA 4M7AE 4F4KA 4B9UA 2BE5F 1GXQA 4OIOF 1J2XA 1B34A 2E2QA 1ILYA 2CGJA 1YITA 2O31A 2V7ZA 4ZZLA 3JRGA 3E1SA 4J9FA 4KH4A 4XSZF 2YRDA 5AZIB 1HSJA 3QNOA 4YOWA 4KI4A 2CUFA 1YITI 4C92F 3DLRA 2GXGA 3NTHA 2FPEA 1Q82C 3ZETA 5IH2A 1EV7A 3HG9A 1T0HA 1N5ZA 3NF8A 3MAJA 4FVUA 2NRAC 4CJUA 1WSUA 1EBMA 2EGEA 4C0DC 4J83A 3OY9A 4YOQA 3P1GA 4BQQA 3MHXA 1T39A 4CJ5A 1WI7A 1LEBA 3JRDA 4DFPA 4IHVA 3S16J 1D1CA 1XMXA 1SD6A 3ZMTA 3SQ2A 3AG4H 2X9HA 4N4NB 5HBMA 3ATVA 5D3GA 1PKTA 3A8LB 2FMYA 5CY4A 1CZBA 1W7PA 4DIQA 5IOYA 4YIRX 4CI0C 3AHUA 3N4QA 3O4NA 3CCMQ 3KD5E 4FYXB 3KP3A 1P90A 3D45A 3TWHA 3REOA 1JJ6C 3ABLH 1KU7A 4C92C 3J80E 2Y75A 2D0PA 2XY7A 1NK5A 5HNFA 3CM5A 1GBQA 5KQDA 1MGQA 3TPQA 3FISA 1SZ2A 3KEYA 2E1ZA 3BLYA 4BJ6C 3Q7BA 1ZSGA 2Y69H 2HMAA 2KIMA 1UELB 3QUIA 1J3TA 1JJ2A 2Z9OA 1I8FA 3GBQA 4KO0A 1YUWA 4ZGEB 1WBDA 2K3YA 5I21A 1QZZA 4RAFA 4J00A 1RCHA 1YXQA 2V6EA 1Q82R 1B4AA 5GJVB 3CLQA 3C6TA 3CETA 3GTMJ 4KUDK 1T56A 1RKTA 1KK7A 4LIVA 2FSKA 1NKBA 1GLJO 2R5AA 3MMVA 5M5XJ 1WEIA 3K9TA 3HM8A 3LAJA 4G1QA 1PYVA 1R9TJ 3TVTA 2Y2ZA 3DPLC 2FSJA 1BM9A 4BC3A 5H1SQ 3JRAA 3QDRB 1UA0A 5D6EA 3LALA 3PO2J 3GX4X 1R58A 4BRNA 2CV1A 1K8AU 3D2EA 1HC8A 2UXNA 2NRXA 1OULA 2VKNA 3ECHA 2M87A 2KE9A 2KP6A 1B72A 3L2UA 3D0PA 1K7AA 1NEBA 3DRPA 1NPRA 2IS4A 3U9DA 2DA2A 1XNQK 2JSCA 4A0YA 1TKZA 3KEOA 2QQ9A 4BY9C 4M7AF 3GFMA 2HQHA 2XY6A 4II3A 9ANTA 1VA7A 2L3DA 4EJZA 2F2XA 2LJ0A 5GAMf 1KLMA 3LPTA 3PL8A 3EUAA 1R8OB 1MKMA 3AL0B 1LVKA 3LWHA 4JKCA 4MDWA 4AHUA 2ZF5O 3NAEA 3SDBA 3KWGA 2XKOC 4B4CA 4M75A 2KISA 2QGFB 2HYJA 2I5WA 1ZAOA 3WE2A 2QWOA 1XDUA 2HEQA 4HCBA 2EGAA 1HRHA 5LMUK 2HWVA 2OV7A 3S3OA 4N4HA 2VCPA 1JKRC 5CCAA 4A2BA 1XSXA 5J4VA 4KAZA 3SJJA 3M0UA 2Z99A 4EP4A 2JJ7A 5F1JA 1B34B 1WJAA 1L0OC 4J01A 1YIOA 3J7AO 4DKWA 2STWA 3MKWB 4NXMK 3I0TA 3FLCO 4M7AC 1PD0A 5H2FC 2H27A 2IP2A 1YJNT 1G99A 3DXJF 4FISA 3I56Q 3SZPA 3VUBA 1D5YA 4AU7A 3ZETB 3PUFA 4MLOA 4UUVA 3ZSQA 2A68F 3A5ZB 4BDZA 1MJBA 4B9VA 3PO3J 4XICA 3IAYA 2V75A 3TP3A 4RW8A 4JP0A 3O6WA 1H3HA 2Y0MA 3U2RA 2BZTA 4DYQA 4M3FA 4HCKA 2KFDA 2YNIA 1BBZA 1EH8A 3H0IA 3DKWA 1W7PB 4PFPA 4FPBA 4PSXA 2F5DA 3DTEA 4OAZA 1TWAJ 3DOLA 4MQVA 2DRMA 3KLNA 1TKXA 2LTPA 1X3UA 3CCUA 2YX6A 3HPHA 2QA4Q 4KKOA 2X1DA 2DDBA 3OV8A 5DS9A 1T8IA 1JGGA 3CEYA 3CG7A 4CDGA 1X1AA 3I5SA 4NOYA 4AI4A 3CF5L 1NGAA 5GAEP 3CFRA 4EVIA 1YIJT 3CCUI 2DRKA 2YHAA 3CO6C 3IKVA 5M3MJ 5BPDA 3VS3A 4RG8A 3BQZA 3CM6A 3SUQA 5KCMA 1K1ZA 1AZEA 3P39A 3L2VA 1ETKA 2R7VA 2CFXA 4BGAA 2BYVE 1WH5A 5E3LA 3LWLA 1YW7A 1SUQA 5IP6A 1CXUA 2DDAA 1HF0A 2VWJA 3C0CA 4MFBA 5CR2A 1MU2A 5CE3A 3TO7A 1WHKA 4XIDA 2L8DA 5C10A 4C8QD 2EBIA 4PJLA 4FK0A 2NOGA 3JRHA 3K2ZA 2NVQJ 1GOCA 2JTEA 1VIFA 4W1UA 3WU2C 2ETJA 2WAFA 2A61A 1BA1A 2BUDA 3FKJA 4ESRA 2LFBA 1V29B 4EMHA 3D2EB 3VRYA 2IS3A 1ZN2A 4PY5A 5J2MA 4PJOA 4IRGA 2XSJC 1JI8A 4OKEA 3SEZA 1D5VA 4D7NA 2LBFA 3OQ5A 1B72B 3NH1A 3EHRA 4TVRA 2PJPA 1HUXA 2CGPA 4M77F 4HG2A 3UDCA 4PJOG 1YIJI 3ZPLA 3VPZA 2Q2EA 2CKKA 2V1XA 5M1KA 1IV0A 4C8MA 3CD6T 3ZYYX 1T38A 4JOMA 4BB7A 2DO7A 3GXOA 1YNZA 2WB1A 3VEWA 5ICGA 5BMZA 2L89A 3E97A 1XSDA 5AT1B 2X6XA 3BCBA 4EM1A 4ELUA 4HCZA 1LWYA 4NC6A 2DEQA 4M75B 3TI0A 3FXKA 4XKVA 5B1AH 2HXIA 3H3NO 2X3XD 3ERMA 4DLGA 3B6PA 3AA2A 2O4GA 1N9RA 5JHUA 5E1WA 1L3TA 1S9GA 5JFRA 1WQ2A 2D5RA 5FLXE 2EKHA 4L59A 2E64A 4RTVA 4M77C 4UY8O 1YITQ 3LH0A 3G71A 4LLLA 2YXYA 3H36A 2RREA 1RTIA 5HRNA 4A0XA 4CJFA 3ZCMA 5A0LA 3SAGA 1W2BS 2OYQA 3ZQFA 1WX6A 2ZJQF 3VQ8A 3G71I 4MO5A 2L02A 1C0UA 3VQAA 1X58A 4JHDA 3KJVA 2RF2A 4KT0E 4RTXA 4U0WA 3EGXB 2YNFA 2EJRA 4B43A 4CJLA 4IDKA 5J2NA 2X4HA 4FETA 5JI6A 3OA6A 3CFOA 1RDAA 3BWGA 3Q0UA 2ZCFB 4EIAA 2YHYA 1WBBA 2EJFA 1OH7A 2GLOA 5GMKj 2VLAA 4PKCC 4M7DD 2BKDN 3EL2A 4UQGA 3CCJT 2OAWA 3K4JA 2WTEA 4PUSA 1SG5A 1OYYA 3PV8A 1TXQA 2PN6A 1SS6A 2AS5F 2LYCA 4HXJA 4LNPA 3FBIB 1MMDA 4H0TB 2SRCA 1ZBHA 3QHSA 4UOBA 2DMUA 3M1EA 2FJ1A 2QXLA 1GRIA 1S1VA 2HAXA 2M30A 2M1HA 3DU6A 3LWIA 2R3SA 5KRSA 2VE9A 4JV5K 1YHQT 4BS9A 4IEIA 4KICA 5GAHP 3UA7A 3VENA 3NARA 3PSFA 1ONVA 4M3YA 3E9GA 5LJ3e 4C8NA 4OLBA 3SK3A 5J1UA 2OX7A 3HYIA 1IN8A 3FFKB 5IN1A 1BL3A 2KIQA 3KZIC 4EMGA 3TW7A 3O3GA 3MP8A 4AFQC 1ATRA 3CCQN 4NL2A 2EQUA 2JZ2A 3VMFB 1IB8A 3QZ5B 2ZKZA 2RGVA 1Z21A 5J3BA 4RCHA 3NFAA 3OYIA 3E2UA 5GADJ 1ZBLA 5M1OA 4ZYEA 5IT9K 2EYYA 3P4IA 1KO9A 3FLGA 5EY4A 4EZ9A 2GQQA 1HLVA 1IHWA 1VQMT 1TWFJ 2XU8A 1B8IA 3QG1A 2K40A 4L3QA 2R58A 1NWKA 3O1WA 5EJCA 1G2HA 3CHWA 1YW9A 3CFPA 1W36C 4DB3A 4C2TA 1D9DA 3VJPA 4Z88A 4ZGDB 1BU6O 2NWMA 1YHQA 3OSGA 4UNOA 4U7BA 2X1CA 1JLGA 3MN5A 2V51B 1R5GA 3GZ5A 1UGRB 1ZBXA 2LBFB 5A2QZ 1NZ9A 2WV1A 4F7UE 1TW2A 1YHQI 4IO9F 1BWFO 3BY7A 1KJWA 4DV0K 4ZTFA 4N4OB 2Q2EB 2G8KA 1IHVA 4HZFA 2YDLA 2WAEA 2SEMA 2X1EA 5C2FA 5BRHA 3JW4A 4K2EA 1OQKA 2DL8A 4OPHA 4DG1A 4IOCL 1ZKGA 1E4GT 5JR3A 1LKXA 2R5ZA 4XKCA 2K9LA 3CQ8A 1E3OC 4RTFD 3AGRA 3JCMe 5BRFA 1W2BA 3M0TA 4FSXA 4P9FA 5EEGA 2B0LA 2RM4A 1NMNA 2H8RA 4QCLA 3WHBA 5B66C 2P9PA 3CXCA 3EE8A 1U47A 2LNVA 1YE9A 4DFKA 2QK0A 3ZMVA 1NG2A 1VQ9N 4RM3A 1EP4A 1K8AO 1BG3A 2NRRA 3CVSA 1K8KA 3A8OB 1TAQA 2LSNA 1MWKA 4IXAA 2GCXA 3GTKJ 1U2VB 2K9SA 2DJQA 4RW7A 1TZLA 4A0ZA 2Y48A 4JHDB 2K3XA 3IKTA 1PRMC 3Q3SA 1BI2A 3FXOA 2OTLA 1LOTB 2DLPA 1RT3A 4ELZC 1NBWA 4FJ5A 4CIEA 4B8XA 1YVUA 1QGPA 2OTLI 4M7DA 2LOOA 3HOUJ 4M78E 1TK0A 2HPMA 4FYDA 4CF1A 2FUG2 1TUUA 4PK4A 3ZMZA 1HW1A 1RAGB 3QYGB 1DP3A 1PUFA 4FW2A 1OZ2A 2MLGA 5CLSA 1VYTA 4M3RA 4M7DG 3J7YJ 3RVCA 2FQ3A 1B3QA 3ULEA 4WFAL 4KN4X 1YTUA 3S2DJ 2EYZA 1GXIE 4Y15A 5GTHC 1YWOA 1IXCA 2CG4A 2PAVA 2XROA 2HBPA 3TSWA 3CCUQ 1BI4A 3HJFA 3QBYA 2HHTA 4FQGA 1ULYA 2JVHA 2RC4A 4ENKA 1WHHA 1YJWT 1EWQA 1NK3P 3KYDB 3WXLA 1S6LA 1UUEA 2KBTA 3A8YA 4BL0B 4KGXB 4PJNA 4X62K 5HK0A 1VQNN 1QTMA 5KTQA 1KQ8A 4GY5A 1T33A 2DI3A 1YI2N 3QRFF 4XLEA 3Q0VA 3CCLN 2QG9B 1QE1A 2B5JA 2VWKA 3M7GA 2P9SB 3CJ9A 5IYDJ 2QGGA 3K1PA 3DTIA 5GANh 1RGIA 4BD3A 3CJCA 2Q1ZB 2EIMH 2JTVA 4F7UF 3FBNB 3RDVA 2JMWA 4BQOA 3QO3A 3LQRA 4C8QB 4E7IA 3DXMB 3CCSN 1IW7F 3M3YJ 1TU0B 2XAJA 4FLYA 4QAGA 3ZSWA 2FL7A 4A2AA 3HTUA 4XK8E 5LHGA 3AVAA 4UV9A 5CYMA 4DQSA 4DV4K 4BRDA 4J2AA 4FWMA 3RRHA 3K4LA 1QVFA 2DA6A 1C0WA 4Z02A 3LSHA 1U6GA 4YDUC 4RA2A 5JLXA 2K2MA 2RI3A 2VUBA 4ANJA 2D1KA 2E4HA 3VGMA 1RADB 2PI0A 1YIJQ 1H641 4F9OA 5E3NA 2MK5A 3OA9A 3R6OA 1XQOA 2W42A 2V1UA 4P96A 4XRFA 5C4XJ 4CYCA 4B3MK 4H4MA 2CZ0B 4A5NA 3CMAN 3QPHA 1IGQA 5GAN7 2HVSA 2IEKA 3GOIA 4KHPK 4DF4A 3NCIA 2A3LA 3VYHB 4CF2A 5GAOq 3PTAA 5L3FA 4C2UA 4JRPA 4FZZA 1IRZA 1GVJA 3HOXJ 3WXKA 4GY2B 5LGNA 1VQ6N 3J7ZI 3ZOBA 2K4YA 4B9MA 3EH2A 2E5NA 1P92A 1YCSB 3MN9A 5EX5A 3JXUA 3K1NA 1HQUA 3GO5A 4HTLA 1QCOA 3MP6A 4KIBA 3CDLA 2Z1JA 2P9PB 1S5LC 3N4PA 2VQCA 3MJXA 3SV4A 4FE7A 3QPTA 4M78F 4Q0BA 2A08A 4NCGA 3T1HK 4BJ5C 5D4RA 3G71Q 1K8KB 3K70C 2O4XA 5TKYA 2NVXJ 4H5WA 1YOVB 3LYIA 2M51A 4DZJA 2YHBA 3CPWA 1VI0A 4DBFA 1M4ZA 3DLLL 3WODF 2FYKA 3SAFA 3NVMA 2KHOA 4JX4A 2B7EA 3R4KA 4CC2A 2P0PA 2F9WA 2TDXA 4B8AB 4K25A 2Q0OA 1WJRA 4M7DB 3JSMA 1X27A 4IO9L 3MKLA 2E7WA 2DJNA 5D5VB 1HNZK 1LAVA 4DV5K 4OB2B 1QVTA 2YSRA 1RABB 4M78C 4C0GA 4E2FB 4BR5A 4FZYA 1NYFA 3OW2M 3SHFA 1H9TA 3ULEB 1IN5A 2KKOA 4BHPA 2CGHA 1JKOC 3ZT4A 4KYWA 4N0AA 3U3GA 2JWKA 2EB7A 1VRUA 4KT6A 4MLEA 1QPIA 1BI4B 4BXXJ 1ZK8A 5I2SA 1X75C 2DK5A 4BHBA 1KC8C 1TS9A 1K73U 4IOAL 1U8BA 4R0KA 4J2DA 4MFEA 5F1RA 1WHLA 4CI6A 1QQJA 3TCJA 2O8CB 2X48A 4CEFA 4W5QA 2DY4A 2C6YA 2RHYA 3QBWA 4YIIA 3MEAA 1X1DA 2STTA 3L3UA 4BRLA 1XC5A 5CAIA 1M1GA 5DLQE 2A07F 3IP4B 3GTPJ 1ZGJA 2B63J 2CT4A 3T8RA 3UE5A 5GAGJ 3KK1A 4XSXF 5LRRA 4LE9A 4ISEA 2ZB9A 3FM5A 1KD1C 2DFUA 2CW7A 3PUBA 4KFCA 1RT5A 1K83J 3VYUB 2W04A 2CUDA 1QHAA 2A5XA 3S15J 2FQ4A 1T3VA 5CO7A 1F36A 1RBVA 4WXDA 1L3UA 3KE2A 4RGRA 1VSLA 2BH1A 1NOZA 2P8TA 4JZ3A 1G15A 1HX1A 2KTQA 1AWWA 5BN9A 1UA1A 1YHQQ 4DQ8A 3I33A 3ZX2A 1S7AA 2F5KA 5CKHA 2RV8A 2JPCA 4ENJA 3OYCA 4A4FA 1J9IA 3QERA 4QSHA 3T1AA 4ENNA 4CYCB 4JX5A 1IJJA 1KC8R 3KEQA 1GVDA 3IC7A 1Q81O 3M6GA 3LDSA 2LY9A 3SEQA 5A2QK 2QW9A 1JB0E 4N41A 2WC2A 1TAUA 2PBIA 1OI1A 2V4JC 1JLQA 3EQLF 2Y90A 1YJ9N 2NNNA 4CGIA 2DFIA 4AH9A 4BGBA 1T6SA 4ORZA 5HKCA 1KD1R 5DDGA 2I2LA 1Q1HA 1FKPA 3LAMA 4HWIA 1TVRA 4BRAA 2OFKA 1SHFA 5CHZA 2ED1A 4DCHA 3CC7N 3DKXA 2I7PA 2M0OA 4AIHA 2QYZA 2CH4A 2E10A 4C23A 4DNCA 5KGXA 1Q7YC 4B1XB 2VT3A 3U9GA 3META 2VUMJ 4LJZF 3NH2A