3OYJA

Crystal structure of the pfv s217q mutant intasome in complex with magnesium and the insti mk2048
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
368
structure length
368
Chain Sequence
LDAELDQLLQGHYIKGYPKQYTYFLEDGKVKVSRPEGVKIIPPQSDRQKIVLQAHNLAHTGREATLLKIANLYWWPNMRKDVVKQLGRCQQCLITNASNKASGPILRPDRPQKPFDKFFIDYIGPLPPSQGYLYVLVVVDGMTGFTWLYPTKAPSTSATVKSLNVLTSIAIPKVIHSDQGAAFTSSTFAEWAKERGIHLEFSTPYHPQSQGKVERKNSDIKRLLTKLLVGRPTKWYDLLPVVQLALNNTYSPVLKYTPHQLLFGIDSNTPFANQDTLDLTREEELSLLQEIRTSLYHPSTPPASSRSWSPVVGQLVQERVARPASLRPRWHKPSTVLKVLNPRTVVILDHLGNNRTVSIDNLKPTSHQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PFV integrase
publication title Molecular mechanisms of retroviral integrase inhibition and the evolution of viral resistance.
pubmed doi rcsb
source organism Human spumaretrovirus
molecule tags Recombination,viral protein/dna
total genus 105
structure length 368
sequence length 368
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2010-09-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
A PF17921 Integrase_H2C2 Integrase zinc binding domain
A PF18103 SH3_11 Retroviral integrase C-terminal SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2300 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3oyjA04
1.10.340.70 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Endonuclease III; domain 1 3oyjA01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3oyjA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3oyjA03
2F96A 1X9SA 4FVMA 3C94A 3EYZA 3P1GA 1HYSA 3U6FA 3LLRA 1QHTA 4CEQA 2D5RA 1NKBA 4CJPA 4HCBA 4EZ9A 3K57A 4W5TA 4QW2A 3TAQA 4CFCA 4E89A 2RF2A 2RN2A 5FROA 3ITHA 4H8KA 1X9WA 3O3FA 4Z0UA 4DFMA 3SQ4A 3O3HA 4GMJB 3KLIA 1C0UA 4CF0A 2NLUA 3MEDA 1WSFA 2RHUA 4Z4FA 3KK1A 3PY8A 4KV8A 2DFEA 1VSLA 2G8HA 2B8AA 2YKNA 4HCZA 5J2QA 4AHCA 1EP4A 1ZBFA 2LSNA 1LWEA 2JLEA 5J2PA 4F2SA 3T1AA 4CJVA 3QO9A 4A4GA 3META 2G8WA 2GBZA 3MEWA 3L2WA 3OVNA 4N5SA 4OVLA 3AO3A 2E4LA 1NK0A 4E7JA 3PX4A 4KFBA 3K5NA 5KRTA 3NGIA 4E7LA 3SUOA 3SV4A 4DTJA 4CJUA 3L2QA 4GVMA 1B92A 2KQ2A 4JRPA 3VQQA 4IUQA 4AH9A 4FK2A 1X9MA 4CEZA 3V1QA 2IGIA 2EQKA 1QSYA 3RWUA 5DMRA 3RMAA 4DTNA 5KGXA 2X6NA 1C6VA 3OY9A 4B9WA 2ITGA 5C0MA 2YHAA 5KE2A 4CK3A 1XC9A 3KKSA 3CFRA 1NOZA 1G5VA 2RO0A 1RBTA 4CIEA 3RMBA 1N27A 3RRHA 3AO5A 4C8KA 4M41A 1WN7A 2HHTA 1RILA 2JZ2A 2D0CA 4R5PA 3DLHA 2EQUA 1RDBA 2HHXA 3ZT1A 4CEBA 2HVIA 4M3XA 1SL1A 1TV6A 4E1MA 1DTTA 1QSSA 4CF1A 4CGFA 2VYTA 1WJSA 3AA5X 1RT6A 4OPKA 4DTXA 4BDYA 4CJQA 1VK0A 3MXIA 1HQUA 3O4NA 1CXUA 1TAQA 4CGGA 1TK0A 5JS2A 4BE0A 4ID5A 2YHBA 4FM0A 1FKPA 4CEDA 3BDPA 4KHNA 3AVKA 3SQ0A 3LYIA 3K58A 3SPZA 1WLJA 5IAYA 3HSTB 3DLEA 1Y97A 2HHWA 2EQJA 3VQEA 3KD1E 4ELUA 1QTMA 5C24A 3KLGA 1H3ZA 4G1QA 3TAMA 3ZT4A 2PQWA 4RW7A 4CHNA 3NGZA 3SJJA 4LH4A 2GFUA 4CJFA 4DU4A 1MHNA 2KZZA 3G10A 5HBMA 3ZT0A 2P5OA 4RW8A 3LAKA 3ZCMA 3NE6A 3QESA 2VWKA 1RT5A 1N5YA 3O8VA 1J53A 4M3RA 4B8CA 4KHUA 3DLKA 4F2RA 4DWIA 4CHZA 3QBYA 3HXMA 4KTQA 1WSHA 4B8AB 3NBPA 3EAEA 1K6YA 1JXBA 3ZEHA 2FC0A 4MFBA 5C6SA 3H8ZA 2JTFA 4O55A 2LRQA 2RI2A 1NJZA 3MEEA 2DY4A 1RNHA 1A5XA 3HJFA 4FJGA 4NZGA 5J2MA 2F8TA 3AVHA 2WOMA 1BIUA 4FJLA 1CXQA 3ZSQA 4LD6A 4F4KA 3WNHA 1LWCA 2DFFA 5J2NA 4CFBA 4O0JA 1NKEA 5M9OA 4IG3A 4Y1DA 2ZD1A 1NK7A 4E7IA 4C5HA 3IAYA 4J2DA 1ASVA 5I42A 2EHGA 1TKTA 5SZTA 4HTUA 4FJHA 4FM2A 3MXJA 5K14A 2FBYA 4DU1A 1EETA 4PLLA 5HRSA 2G8UA 4KKOA 4E1NA 2HW3A 2XRIA 4Q5WA 4DSKA 2G3RA 3THVA 4ZTJA 3P5JA 2PY5A 2EX3A 3S3OA 4CHYA 3OS1A 3TARA 3DYAA 3HM9A 1LV5A 4J2EA 1WJQA 4DTPA 3M8QA 1S9EA 3LZJA 5I3UA 2HQEA 2YRVA 4CJ3A 2WACA 4CGIA 3JYTA 1RTIA 3QNOA 1NK8A 2K3YA 1SSFA 3C4SA 1KLMA 3SUQA 2HHUA 1KVAA 1W9HA 4W5OA 1MU2A 2Y1JA 3PMTA 3OMGA 4NYNA 4CGHA 2XO7A 5KCHA 3ZSRA 4HUGA 3HP9A 4FCYA 1T8EA 4OVAA 2YV0X 1C1AA 1KSPA 2Y1IA 3KK2A 4ID1A 1LAVA 1Z25A 3NAEA 4IG0A 2DIQA 1WAJA 2YNIA 3K2PA 3NTIA 3P8HA 1HPZA 4CECA 4DTMA 4BDPA 4LSNA 3T19A 4M3WA 2O4GA 1SKRA 2RJFA 3AVIA 4BD3A 4J2BA 4FM1A 4CEAA 3LDSA 2E5QA 4KREA 1OI1A 4LH5A 3PFSA 3DLMA 1NK5A 3NHGA 1U4BA 2IOCA 3KTQA 1RTDA 1VRUA 4PL6A 2YNHA 3CFPA 3OQ5A 3DLBA 5J26A 1BGXT 2G8FA 3S9HA 1RCHA 4IUTA 4W5QA 3GOXA 1RDAA 3KKRA 2X4WA 5HP1A 4CJKA 2XY8A 4BDZA 3OYNA 4Z4IA 2VWJA 5D6XA 3DM2A 4FU6A 4EZ6A 2BGGA 4N4IA 1RT3A 1XNIA 1VRTA 3MP8A 1YVUA 1WSGA 1CLQA 4I9LA 1WNSA 3PO5A 3V1RA 4EP5A 3OJUA 3LP3A 3K5OA 3H6ZA 2XY5A 2IC3A 1BHLA 3NTKA 4N4GA 1SKSA 3DMJA 3OYGA 1LAWA 4OKEA 3OYAA 3DLRA 2RI3A 4CHPA 3TANA 2YNGA 4CJRA 4OLBA 3NDKA 3AA2A 4M3UA 4PWDA 2B5JA 3DLGA 1JLFA 1UA0A 1TL3A 3C6UA 3SZ2A 3RTVA 5CZ2A 4KI6A 3ASMA 3CM5A 3ZSYA 3L2UA 1UOCA 1IKYA 3ZSWA 4QVZA 3PMIA 4C8MA 3U3GA 3QEWA 2X74A 2VG6A 2GF7A 3QINA 4Z4CA 3DRSA 3PUFA 2HHVA 3V9UA 2RJEA 3P83D 1RT1A 4F3TA 1TKDA 2ZQBA 4H4MA 1VSIA 5JS1A 2VG7A 1X1PA 4DQRA 3T3FA 4FJ9A 5C42A 1J54A 4L8RB 4M3ZA 3FC3A 5KI6A 1RBVA 4CJTA 2E6LA 1CZ9A 5DK5A 2DAQA 2HHSA 5IN1A 3KJVA 1U45A 1TL1A 3KIOA 4CEFA 1BIZA 4B9VA 4X34A 3TAEA 3VQDA 2HNDA 3OYIA 1C0TA 1XWLA 3VQ9A 3OYKA 4B9MA 3OYDA 1YTUA 3ZT3A 3Q1JA 4CHQA 2I5JA 4FJJA 4CFAA 3ASKA 4IKFA 2G8IA 5J39A 2DIGA 1I39A 5HRPA 3M8SA 1SL0A 4CE9A 4EDUA 4Y1CA 3NH0A 2HHQA 3K5MA 3AO2A 5HRNA 1NJYA 1T7PA 4B9UA 2KFZA 1ITGA 4C8NA 3OS0A 2Z1IA 2P5GA 1RBSA 4DFPA 3E9FA 2X4YA 4C5GA 2RHIA 3F9KA 1XHZA 3L3VA 4O4GA 1VSMA 2KW4A 3HK2A 3RMCA 2BE2A 1N6QA 1OZ3A 3L42A 2X6SA 1IO2A 3I0SA 2R58A 1JLEA 2GFAA 4IBNA 3VQPA 3TWHA 3M8RA 4CJWA 2L8DA 3OYMA 5CYMA 2P0KA 3L8BA 3SD4A 4JS4A 1XHXA 4NCAA 2IG0A 5CYQA 4JLHA 1QE1A 1RBUA 3UIQA 3CM6A 1VSFA 2D9TA 3HYFA 1KFSA 4ICLA 3E9GA 2MWPA 1KCFA 4RG8A 3ZSVA 4YFUA 1B9DA 1WSJA 4CHOA 3OJSA 4FW1A 3SNNA 1VSJA 3NF8A 4O0IA 4I7FA 4HUFA 4N4HA 4CJLA 4KHQA 1RDCA 1NOYA 2KZMA 3HO1A 2OZMA 4BE1A 4M3YA 2F8SA 1Q9YA 4DF4A 3VQCA 4B9XA 2WONA 4N41A 3KLHA 4FLYA 2DFHA 3SUNA 4CJ5A 5D3GA 1NK9A 3AVFA 2PYLA 2B6AA 3LAMA 1KTQA 3SUPA 4B9TA 4KAZA 4N56A 1FXXA 3ME9A 4CJ4A 4F3OA 3NF9A 4OPJA 1IKXA 1IG9A 5KH6A 3LPTA 4GY5A 4W5RA 1CZBA 3NF7A 3FEOA 3UWNA 4BWMA 1T05A 1HRHA 1S9GA 4YNQA 3S3NA 1VSHA 4KPYA 3MXMA 1VSEA 1S1XA 4RW6A 3QKJA 1D9DA 4II1A 2XK0A 4E0DA 2E6NA 4E19A 2Z1JA 3EZ5A 1UWBA 2IDOA 3QIPA 3VQ8A 1XI1A 2RPIA 3MEAA 4DSIA 2G8KA 4FLWA 3PO4A 5HLFA 2L89A 1TK8A 2RJDA 1LW2A 1TKXA 3EY1A 3I0RA 3WNEA 1RT7A 1NK6A 4DQIA 4CESA 5EU7A 4IUVA 1C0MA 1GOCA 3C95A 4FZZA 2K3XA 4UC4A 2E6MA 1VSKA 4LD0A 3HPGA 2O4XA 4CF8A 4KI4A 3V9WA 1SUQA 3NCIA 3CYMA 3CG7A 3MP6A 4DQSA 4FLTA 4K8ZA 4CCHA 2CKKA 3WNFA 2XHBA 4CGDA 3MEUA 1OZ2A 3ZSXA 3VQAA 4FW2A 4DFJA 4FK4A 4Q0BA 4E3SA 3KLFA 3QERA 1I3AA 4M42A 2HNZA 1KLNA 2LTOA 1JL1A 3ULDA 4RW4A 1JLGA 2D0AA 2OYQA 3TR8A 3OYFA 3WNGA 4IFVA 3VQ6A 1JL2A 1IH7A 2G8VA 1G15A 2MWOA 4XIUA 2HQXA 1NKCA 4BACA 2IS3A 1S6PA 4CF2A 3LANA 2EKOA 1L3TA 2XY7A 4KTZA 1BQMA 1LWFA 4C5EA 2GV9A 3AVJA 4KHWA 1C1CA 4A4HA 3HPHA 4DFKA 1JKHA 2EQMA 4CEOA 3IRXA 2YKMA 3HL8A 4NYFA 3D45A 4KO0A 2ATQA 3HPOA 2OPRA 3M9QA 2B4JA 2YNFA 3NH1A 2W42A 4ELTA 2RI5A 1BCMA 4RW9A 2Z1HA 4N76A 3SV3A 4HUEA 1JLAA 4IUPA 3B6PA 1R0AA 1SL2A 1ZBLA 3KD5E 2R5AA 3V9ZA 3QETA 5CIUA 4GW6A 1ASWA 1BL3A 3V6DA 1T03A 5KCOA 3DRPA 3QIOA 3ISNC 2KFNA 2BDPA 3M8PA 4FJ5A 2X78A 4IFYA 4LSLA 2R5MA 2R57A 3DB3A 3RRGA 2QQRA 1ZYQA 1TK5A 4CK2A 2O4XB 5CZ1A 1HNIA 1HYVA 1RT2A 1RDDA 1KVCA 3DI6A 1REVA 2OPQA 5C25A 3K59A 3K5LA 3PX6A 4AHVA 2KTQA 3VQBA 2HVHA 4OJRA 3SPYA 3VQ5A 1ZBIA 4KHSA 4PUOA 2QKBA 1O1WA 1L3SA 1S5JA 4DQPA 1YTAA 2D0BA 3QEVA 2NUBA 2M1HA 4N47A 3SI6A 3KUFA 3LALA 3VQ7A 3OYCA 3LZIA 4AHUA 4CIFA 3LH0A 3HP6A 3I8DA 1RT4A 5FRNA 3VN5A 4DSEA 4CJEA 4UQGA 1KRPA 3AVLA 3CQ8A 1W0HA 3AA3A 4Q5VA 4E7HA 2RKIA 1BISA 4O5BA 1IKWA 4CIGA 1D9FA 5SWMA 4DS4A 4A4FA 1B9FA 3TAFA 1KVBA 1UAXA 5T7BA 1BQNA 4FK0A 3KLEA 2P51A 4B9NA 3QEPA 4FLXA 3AVGA 4Z4HA 2EFIA 4FL6A 4AHTA 1TVRA 2QK9A 3P8DA 4B9LA 4NS5A 3OYBA 3LP1A 3OMCA 3H08A 1EXQA 4DLGA 5KGWA 3AVAA 4CRIA 3ZSOA 3OYJA 4ELVA 1S1UA 4PLIA 4DSFA 4PA1A 1TKZA 3U3YA 2F5KA 2Q3SA 4KTWA 1S6QA 3SQ2A 4HCCA 4KB1A 4CERA 3VA3A 1GOBA 1HYZA 2FBXA 4TSXA 2RHZA 4I2PA 4CFDA 4KHYA 3MP1A 4OKJA 3OB9A 2QQSA 4OLAA 3VQ4A 1ZBUA 1FK9A 1U47A 4Z02A 5KTQA 1WJRA 4NCBA 4FJMA 1DLOA 3QIIA 3OYEA 3ZT2A 3MEVA 2OA8A 3DB4A 4IURA 4BE2A 4CEEA 1L3VA 4B3OA 3CEYA 2BANA 2L3RA 3PX0A 1BI4A 1S1VA 1BCOA 4DG1A 2RHYA 3LGFA 3OS2A 3AA4A 1DTQA 1RI0A 2X35A 4E7KA 2OPSA 1TGOA 2ZE2A 3HVTA 3NTHA 4QQDA 2GUIA 2RHXA 4DF8A 3RR7A 3AV9A 2HMIA 5KRSA 2VG5A 4M3TA 2M16A 3C6TA 4KRFA 1QS4A 3LWMA 4DTUA 4FJXA 4CJSA 1ASUA 2BUDA 5D6WA 3V9XA 5J1EA 2FHDA 3NGYA 4FZYA 3L2RA 3UT1A 3TABA 3FDRA 2M0OA 2O4IA 4J2AA 3F73A 4W5NA 4H4OA 3LGLA 2BKDN 1HNVA 1S1TA 3SCXA 2Z1GA 3LWLA 4Z4GA 3L3UA 4CGJA 3BDLA 4CF9A 2P1JA 4F8RA 3NF6A 3F70A 3QJ6A 1NJWA 3S3MA 3DOKA 2HNYA 3TAGA 4WE1A 4JRQA 1KFDA 2OZSA 4FYDA 3AO4A 1WSEA 1ZBHA 4M45A 3QEIA 3PNWC 4HHTA 2QKKA 4HVJA 4Z4EA 1Q9XA 1EKEA 1RBRA 4PQUA 2ETJA 3SQ1A 1JXEA 1KHCA 3AVCA 1WAFA 4I9QA 5FRMA 4C8OA 2BIVA 4IDKA 3RR8A 3TAPA 1EX4A 4DQQA 3OYLA 1JLBA 1OYXA 4DS5A 3LX7A 4ZHRA 5HROA 4FLUA 3A2FA 3LP2A 1L5UA 3RMDA 4QOZB 3DOLA 2R7YA 1QSLA 4FJNA 4NCGA 4OGEA 4CK1A 3AVBA 4LY7A 4C5IA 5E41A 1Q8IA 1S1WA 3PV8A 1LW0A 1J5OA 4OGCA 4K8XA 2RJCA 3MECA 4DLEA 4B08A 3MAQA 1QQCA 4L59A 2LDMA 2HB5A 2A1SA 1JLCA 4QAGA 3O4QA 3NNQA 2PYJA 4O44A 1U48A 3B6OA 1A5VA 4BWJA 3D0PA 3NH2A 5KE3A 4A4EA 2OPPA 1BI4B 4FZXC 2XDPA 4DMNA 4KB0A 3AVMA 3OA6A 4DSJA 4FJ7A 4QQGA 4EP4A 4ZTFA 4DTOA 3ZSZA 3CFOA 3QEXA 1JLQA 4IUUA 4I2QA 5D6YA 1YT3A 1C1BA 1IKVA 3AVNA 3V81A 4AHSA 1FKOA 1GOAA 3IS9A 2XY6A 2LVMA 3MEGA 1D5AA 1WGSA 4RG2A 1HQEA 3HVRA 3DRRA 1VSDA 3KK3A 5CY4A 3TI0A 4FJIA 1RTHA 3QNNA 4JS5A 2FBTA 4DSLA 1NK4A 1HJRA 3AO1A 3LPUA 1TAUA 3MO8A 3V4IA 3FFIA 4MQ3A 4FJ8A 3V9SA 1Z26A 2JGUA 3OYHA 3L2VA 2QXFA 1U49A 4FLZA 3S6WA 3IG1A 2X4XA 1SKWA 4B9SA 4C8LA 2PZSA 2IAJA 2DTUA 4AILC 2LCCA 1WSIA 3G0ZA 1SV5A 3LP0A 1RTJA 1NJXA 2FBVA 3O3GA 1L3UA 3HT3A 3E01A 1J9AA 4DTSA 2A1RA 2AJQA 3BGRA 3FLGA 4FXDA 4AHRA 4OKKA 3ALYA 1UA1A 4QQ6A 3V1OA 4DTRA 1D8YA 4DU3A 1HMVA 1F21A 4PY5A 4QCLA 5FDLA 1A5WA 4FJKA 1U04A 3NFAA 4FLVA 3SYZA 3QLHA 3JSMA 3VA0A 5HRRA
chains in the Genus database with same CATH superfamily
3I54A 1B34A 5CR2A 3K10A 2DI3A 1QHTA 3DBLB 1Y1VJ 5KYYA 5A2QO 2EJ9A 2KRFA 2PEXA 4CJPA 4KISA 3R3LA 4EZ9A 4PJOE 2IVOA 4C92G 3CW7A 4I6MA 2W6LA 5E3LA 4AIDA 3QQAA 2G7UA 1JXSA 4H8KA 4DOVA 1X9WA 2XDDA 3VEXA 3O6BB 3HM8A 1K61A 4HOBA 4DFMA 1D1AA 5CVJA 3RBBB 4A53A 1SFEA 4FISA 1LDJA 1A35A 4KRTA 4LE9A 2DD5A 4A5AA 1AWOA 1WSFA 2RHUA 3KK1A 1FMVA 4JAXA 5EEHA 2DFEA 2XVCA 1ETOA 1HW1A 2O88A 2J5PA 4JI7K 5AQXA 4QLCU 1XNQK 1PC0A 2KRSA 5JVGL 2DQLA 2YU3A 5C44J 1H89C 3K70C 2ZPEB 2V1UA 2WSFE 1QP3A 3HC7A 4F2SA 4IHXA 1D3BB 5IXFA 2Z5UA 4EQQA 1VQLI 4JJBA 3ZMTA 5AFUH 4CZHA 1XNRK 3ABKH 3META 1VIEA 3FMQA 1R58A 4CCKA 5E1XA 2JN6A 2KT8A 4N5SA 5LJ3g 3CC7I 4OVLA 3I55I 2HPMA 4E7JA 1SFOJ 4F7UA 3HGYA 3PX4A 5LGTA 4OMQA 5E8IA 1VQ5N 1WHMA 2RC4A 3HFOA 5LMNK 3ZXSA 4FWQA 2EPFA 1XJWB 3JB9G 3IHUA 3SV4A 4DTJA 4CJUA 3L2QA 4GVMA 4H5VA 5D6FA 1G4DA 5LJ5d 2XF6A 2EIJH 3OL4A 4OPHA 2F1LA 4DR7K 1X9MA 3V1QA 5GTIC 2EQKA 1QSYA 3FFKB 2IGNA 2KZGA 4OIPF 2O8BB 2FD5A 2X51A 1ZSZA 2X6NA 1NGFA 2KE9A 3M3ZA 4UB8C 2ITGA 3D2FA 3OSFA 1IHWA 1BJZA 3K4BA 1AWCA 2OX7A 2I5WA 2CGJA 1KU9A 4J9IA 1G3YA 1F4KA 3LSPA 3CFRA 3T7ZA 4QKUA 1LDDA 5CHZA 2A69F 1ON1A 3UATA 1OQKA 2RO0A 3IV5A 2ROTA 2YLCA 4NQWB 4CIEA 3EE8A 4DBHA 2VKNA 1XGSA 3E1SA 4FWKA 1WN7A 2HHTA 1RILA 2XSJC 4PJJA 1YJ9I 1RDBA 2HHXA 3ZT1A 2HVIA 1SL1A 3M3YJ 2EAYA 3IC7A 2VGNA 3HRUA 1R5ID 3VEVA 5C4XJ 3E2UA 1WB9A 1GCQC 4G6QA 4OMOA 2AP1A 1S29A 1GLFO 4HV6A 4MDXA 4CGFA 3VEOA 4QPQA 4HZFA 1WJSA 4NC7A 1OCPA 4WXHA 3GIBA 5E17F 5C0YA 1WHGA 2HMAA 1LFPA 4BR4A 2FX0A 1IV8A 1ZBJA 3O4NA 1HNZK 1MMGA 1SG5A 1ULYA 2J5OA 1WH7A 1TK0A 3UPUA 2QTDA 5EG2A 3VS4A 2HBPA 4M4ZA 2YHBA 3BDPA 4HX8A 3ZEUA 4KHNA 4LITA 4KH0B 4BEHA 1IV0A 2NXNB 2QQAA 1OVYA 4NO7A 1IRZA 3BE3A 1NGJA 2DA7A 1V5FA 3AARA 3F72A 1IDYA 1MA9B 2CYYA 4C2UA 3SPZA 3HSTB 3IAS2 1KC8U 1PJRA 7AT1B 2JWLA 2DU9A 4XRSA 3PNTA 4KGZB 3O8HA 1LEAA 1XGNA 1VQNQ 3OSSC 4ELUA 5GAEJ 3MCPA 2MD0A 4M7AD 3BEXA 4JBAA 1KAXA 4CHNA 3NGZA 4OMYA 3SJJA 1YI2I 2NUPA 4DHYA 4CJFA 2VKVA 1XS9A 3VS3A 1XQSC 2CW0F 1Q86R 5HBMA 2X1DA 5FU6C 4M3EA 4KUDK 3O9RA 4RW8A 1M3QA 3LAKA 5J8FA 1PU6A 2QXLA 2TCTA 2XASA 2HCKA 3U9ZA 4EEFG 3A8MB 4M3RA 2FXAA 4JPBW 4KHUA 3CC4Q 4DWIA 4MMKA 5LEKA 1HJOA 1I50J 4KTQA 3K7AJ 1DGWY 1WSHA 3S8PA 1TC3C 2Z2SB 5ERIA 2ZMEA 3EAEA 1K6YA 1AOJA 1JXBA 3ZEHA 4MFBA 3C6AA 1ARKA 5GMKm 1BN5A 4JN4A 3CCLA 2CP7A 1N8RU 2D2WA 2O6GE 1LB2A 5FLVA 1B3QA 4A3FJ 2BZ8A 1NJZA 1RRQA 3KZYA 3FJPA 3CCSI 2CREA 2F5DA 1MSEC 4ZGEB 3UR3C 2ZJRL 2V9KA 3OIOA 2YPRA 2PMUA 3BTJA 3I5SA 2YHXA 1A5XA 2KHMA 2IPQX 1S72N 5J2MA 3ZQCA 2WOMA 1BIUA 3S32A 1K78B 1CXQA 1BR2A 3N5BB 5ADXH 4D8DA 2XIGA 2QUFA 3KEYA 5TKYA 4DNCA 2JMWA 1Q82O 1NKEA 3Q0WA 1VFCA 4J2DA 2QDYB 1JKPC 1NLOC 4AI5A 4KIFA 4M75F 1NK2P 1YBYA 3LNQA 2KXCA 2EHGA 5JMVA 5SZTA 1WGXA 1NE8A 4E1JA 4EMKA 3CD6A 1IF1A 1UJYA 3MXJA 5K14A 4DU1A 4PLLA 5HRSA 5IP7J 2HW3A 2XRIA 3M5AA 4DR6K 3THVA 2PY5A 3GEZA 4LG0B 4JQFA 1YFNA 3KHYA 1VQLT 4UVAA 1FW6A 1FYNA 4ZYGA 4DTPA 4ILJA 5J47A 2HYGD 4M7AE 2L01A 3E5XA 3CC7T 3AFHA 1BJAA 3VS6A 4C8QA 1HF0A 4S05A 2K3YA 3O5ZA 1T0JA 2A61A 3C4SA 4YPRA 3G4SI 2GOXB 4MGRA 4W5OA 1GVDA 2R5ZA 1X3WB 4IL6C 4A3KJ 5KCHA 1J2XA 1ATRA 5AIQA 3Q3SA 1R5HA 4HUGA 3DJCA 4LLNA 4YOWA 3I33A 2X9HA 2NVUB 2Y1IA 4KMUX 3KK2A 2DLLA 2YNIA 4CDGA 3NTIA 5IOYA 3DPTA 2UXCK 3VYRB 2O4GA 2RJFA 1VQNN 2XB5A 3AVIA 3LL7A 4FASD 4FM1A 4CEAA 1W7AA 3THYA 3HOXJ 1P6RA 2HNIA 1BA1A 3L00A 3VYHB 2I7PA 1RTDA 4GGGA 3Q7CA 4IQJA 2YNHA 3CFPA 3RKXA 3ABUA 5J26A 3VKIA 2G8FA 3HOUJ 1N39A 3JB9I 3BTIA 3IH2A 3GOXA 5KQ8A 1N33K 4FYVB 5HP1A 1X2QA 2ED1A 5AQSA 2RNGA 3BG7A 3ENOA 2NNYA 2EGCA 3OYNA 2D6FA 4ZGJB 2Q2EB 5L3GA 4D7NA 3ZN0A 2BGGA 1XNIA 1LPLA 3H5NA 1VRTA 3L9FA 3MP8A 1X43A 1WSGA 3MZYA 2NOJB 5K5QA 1RKTA 4LMYA 3PO5A 5AQGA 4EP5A 3OJUA 3LP3A 2WB1N 2HVQA 3H6ZA 2ZAEA 3NTKA 2GUPA 1VQ7I 1LAWA 5LBQA 4DK9A 2DVEA 1FJLA 5AFUA 2LF7A 3SFMA 1VQPQ 2IA2A 3IKTA 5CE3A 5GAN6 1KG5A 2CUEA 3PE0A 2NOHA 2LSOA 2VJ5A 1WLPB 3GBQA 3H46O 3K9JA 4N9HA 3AA2A 3A8LB 3AL0C 1FIAA 1OH7A 4EJWA 3AAQA 1S6LA 2PFBA 1UGVA 4M78C 2QWRA 2VXEA 1YHQQ 3G6EN 3G71I 2WFBA 2HVSA 5HL7L 4C8MA 3BR6A 3CCJQ 4CCLA 1K8AU 4C2MJ 2F4VK 2X74A 5J3BA 1VQ8A 4PKGA 4IHYA 1UTIA 3HYIA 2V7ZA 3ID8A 3HSEA 1ETKA 1OR7A 4ZDPA 2HHVA 3V9UA 2VOPA 1RT1A 4ENMA 1TKDA 1VSIA 2DL5A 1M3HA 5JS1A 2NLXA 2R7VA 3T5XA 4DQRA 3VW4A 3LSMA 3OMYA 2J05A 3RMQA 1S7OA 1JCGA 3JRIA 3BFMA 4MEYF 3I56I 3FKIJ 4EIAA 4M3ZA 4HDVA 4HT8A 3VU3C 1ZTRA 2E6LA 3FISA 4MHGA 2DAQA 4A2UA 3BR1A 4R55A 1U45A 3KIOA 3GWZA 4CEFA 4GKJK 1ESVA 1PSFA 3CCST 3MJXA 1GDTA 3VERA 4UV9A 1BUPA 2QAZA 4BR2A 2IS6A 3JRFA 4FJJA 5GAN5 3QU3A 5DM7R 5IYDJ 4RGXA 4AM3A 2G8IA 4Y3OA 1I39A 1R1TA 3AY9A 4QS9A 1SL0A 2OTLA 3FX3A 2Q8KA 3EKSA 4IHVA 1K73O 4H0PA 2NRRA 1AKHB 2E64A 4B9QA 1GLBG 4DR4K 2AZSA 2E65A 4C23A 2LP5A 1DQUA 3QJYA 1RBSA 3H1VX 2YRDA 2Y30A 4Y4RA 5KN8A 4H0VB 2G9WA 1ZXOA 2AO9A 3EGXB 3CJAA 4A2BA 2HTSA 3L3VA 4B23A 3L09A 4RB0A 1G8XA 5TGTA 4ELZC 2CO5A 3GLXA 2A5XA 3HK2A 2BE2A 4XORA 4H0EA 3EYIA 3EHQA 3L42A 2ELJA 4BRKA 2F4OB 1IO2A 4F52A 3EGDA 1ZKGA 2R58A 1JLEA 3VQPA 3TWHA 3I9QA 3M8RA 2HYFA 1VIFA 4WCIA 1NJIU 3A03A 3LSKA 2RM4A 2P0KA 2YDLA 4B1WB 2GBYA 3L8BA 1GBRA 3BP8A 3PIOF 5ILSA 1QVUA 4JLHA 1QE1A 3M54A 1RBUA 3UIQA 1QGPA 3H3OB 2D9TA 2JMCA 2V51B 4HA8A 5JI6A 1BIAA 3OSGA 3QYBA 1XTDA 4X0GA 2HQNA 5LJ5g 3QDRB 5HLGA 4YFUA 3QDFA 4IO9F 1B9DA 3G4ST 3P9IA 2HSTA 1JRIA 3JCMc 4FW1A 4B1ZA 3NF8A 2VYPA 4M7XA 4M75B 2FF6A 4I7FA 3G3ZA 4F17A 4RS8A 1OEBA 2VI6A 3HO1A 1WI7A 3PJRA 4BQQA 4HXJA 3C7NB 3EG2A 1I1JA 5C15A 3DKYA 3OGDA 1U8BA 4XSXF 3RDIA 1T2KA 5KN9A 4CD3A 3S1NJ 4PJOG 2WONA 1M5Q1 3KLHA 2W7NA 4XTWA 1RRJA 4I0BA 2K9GA 4AM7A 3ZX2A 4OPAA 3L1AA 2KEAA 5D3GA 1NK9A 2B6AA 3V7RA 1OX8A 5AQRA 2DT5A 4B9TA 3CUQB 1T6SA 4L9NA 3ME9A 1VQ5A 4QTRA 4CJ4A 1UHFA 1YHQN 1IKXA 4LDXA 5KH6A 4RA2A 3E0JB 5K7ZA 2HQ5A 2HEQA 1XB4A 1Q82C 5KPZA 2OD5A 4W5RA 1K9MU 2XHCA 3CCJN 3UWNA 3M1FA 4U7BA 1WCMJ 4YNQA 1WJFA 2W1OA 3JSCA 3CMAQ 3I59A 5GAN3 1VSEA 1YITA 2E1HA 3J81O 2RMOA 4I01A 1SVMA 2HQHA 2XK0A 2YHTA 4FYYB 4E0DA 4H0TB 2LZ6B 2WA0A 4RLQA 3GTKJ 2Z1JA 1RZ4A 1KU3A 4EVIA 2ASMA 1KJWA 1UWBA 2IDOA 1T0FC 3JAMK 3VQ8A 1WHLA 3LA3A 2ZJQF 1WEIA 4M7DA 3HRGA 4BJ6C 3KEQA 3A5LC 4HSBA 5AN4A 2GZWA 2WBMA 2FZGB 3QYFA 2M4KA 5CCAA 3CQZJ 4EGYA 3HGGA 1IGUA 4R0KA 1VQ7T 2RJDA 1Y07A 3VETA 3I0RA 4G7HF 1ZLMA 1M90U 5HODA 3CBPA 2HQAA 5AIPA 1HNXK 3X25B 1MMSA 4AFZC 2MLKA 1LNWA 1F43A 3M0TA 4F7ZA 3THWB 4WQ5C 1SUQA 1XG1A 2OJED 1VTNC 4A4KA 1WQ7A 1QQIA 2KROA 1E6HA 3MP6A 3K0LA 2QA4T 4FLTA 1FJGK 1YIOA 3SEZA 1RACB 2IVPA 3DTKA 3G71T 1FT9A 2YSQA 4HNTA 2XC7A 4X1VA 3MEUA 2D0NA 3UA6A 3MCZA 2ZXHA 2JWKA 3UKUB 3ZSXA 3CCRI 3VQAA 2XPUA 4JKGB 5JICA 1D0XA 1ZARA 3RR6A 3REAB 1B6AA 4FK4A 3QRFF 2NWMA 3R4KA 2PN6A 4E3SA 5F08A 3THKA 4M42A 3BZ6A 4A3IJ 3M8EA 1JL1A 2DO7A 3SDZA 1XQPA 2KBTA 4C0DC 2KR3A 3HKSA 2OQRA 3GW2A 4IFVA 3VQ6A 4LIVA 2MFZA 4XIUA 2LQ8A 3MD2A 5DCMA 1NWKA 2JT1A 2L4AA 1YUWA 2EKOA 1L3TA 5J3LA 3ERED 1M2VA 1U6GA 3NEUA 4IXAA 1BQMA 2IS1A 2QK0A 4M9ZA 1LWFA 3D4VA 1JTYA 1ZREA 2NVTJ 3I55Q 1KONA 3RPUA 2DRKA 9ATCB 3Q7BA 1WJAA 2EZHA 2B63J 3M58A 3JAME 3X26B 2EQMA 5GANf 5JVTA 3HL8A 2E3IA 4NYFA 2DILA 2W6KA 2Q36A 2ATQA 3DBHB 1WOQA 1GCQA 2CUFA 1X19A 3M1CA 2VIXA 4C8QD 2B4JA 4R1HA 3BR5A 2W42A 4BRNA 2EIFA 2H27A 2RI5A 1ORKA 1ATSA 3S41A 1NGIA 4H03B 4RW9A 1VQMQ 5HOOA 3TQNA 2CGLA 2BY0A 3ZYYX 2N8GA 3UDCA 1JLAA 4IUPA 4RMOA 1R0AA 2JTMA 2NVYJ 1M1KR 2R5AA 4IJNA 2XAFA 5GAMf 3QETA 2O31A 5CIUA 4B1VA 5JHFA 1PVEA 1BKBA 2DL3A 2EYQA 2YUSA 4M3DA 3D2EB 3H6EA 1KC8O 4FYWB 1T03A 3LQQA 5EGOA 1B72A 3U8XA 4GVEA 1PM3A 2NRXA 1S72A 1QPIA 3K4JA 1I07A 2UWMA 1YJ9Q 4UUVA 4XH5A 2R7TA 2EZKA 2X78A 4LDYA 2DJNA 3CMAN 1X6BA 4EJZA 3BY6A 1KG4A 2O4XB 1SMYF 2BY3A 3R6NA 3LMMA 4PKIA 2OPQA 5CYVA 4EM1A 5AQTA 3K59A 3G1MA 4Y28E 1IRGA 3JV3A 1HPMA 3ZL7C 2E2QA 3UE5A 4J5YA 2XHKA 3VQBA 3SPYA 3VQ5A 3KNTA 1TZLA 1S7EA 2V52B 4PUOA 4DW6A 1JTXA 3ESWB 3CCQI 4TVRA 4H5RA 3GBTA 4DQPA 3R0JA 4J8OA 2B0LA 1JQQA 1YTAA 5AZJB 1RAAB 2NOIA 1N8RO 1XTAA 5DM6F 3QEVA 4L9JA 2O8DA 5AYFA 2NUBA 3FM5A 4OP0A 2DM1A 1VI0A 3RKQA 3VQ7A 3KEOA 4AHUA 4L5IA 3I8DA 4EIKA 4MO5A 1ZRDA 4GBQA 1R22A 4CW7B 5ICFA 3QBWA 2OTJI 2M87A 1OYWA 4KGXB 1MPGA 2L7MP 1DUXC 2C6YA 3F23A 1YI2Q 3SEQA 1HYOA 1K73C 4E7HA 4QIWN 1U1TA 3CC2I 4E2FB 3WU1B 3L4QA 2FQ4A 3MWTA 3LWIA 3HEFA 4C8QE 4CD1A 1D09B 3EKUA 3TAFA 1NEGA 4ESFA 1KVBA 5K7HA 1X6GA 3CQTA 4EHTA 5DD8A 4FSXA 3F2KA 4FLXA 4M7AG 3QO3A 2EFIA 1WBDA 1VQLN 3TTCA 2V1QA 2K9QA 3VYGA 4C3IJ 3HSCA 2JTEA 1PUFA 1ORPA 1UFFA 2DJZA 3M57A 4F14A 4CC3A 3OYBA 4XNFA 3CC7N 2LREA 3LA2A 4BC2A 3QFPA 3F8BA 5GAN7 3FZVA 3VGMA 2IGMA 3I55N 4CRIA 3ZSOA 2K5CA 4ELVA 5HNFA 4PLIA 2X85A 4PA1A 5AQIA 2FSNA 5EG0A 1GVJA 1R1UA 5B3SH 1KIKA 3E66A 2JMAA 3DEWA 1TQMA 4M3FA 3OH9A 4Z94A 2EVRA 2JWTA 5L3EA 5AZIA 3VA3A 2QWNA 1IC8A 1SF9A 1QLYA 1HX1A 2YU9J 4WF9L 4ISEA 2RHZA 1YIJA 5EVZA 3EH2A 4KHYA 1YJNI 3QWLA 3OB9A 3LDNA 2EZLA 4LFUA 3VQ4A 4RAFA 1B34B 1FK9A 4ON0A 1D8JA 4NCBA 4AVZA 3U2RA 2QYZA 4AT1B 1RR7A 3FKJA 5FLXZ 3VOVA 1U06A 5KYYB 2OA8A 1B1BA 1ETVA 5J6XA 4CEEA 1L3VA 3FXOA 1VQ9T 1KK7A 2L3RA 2CRGA 3PX0A 2GTOA 1BI4A 1VQOA 4DG1A 4I6MB 5IT9Z 2FL7A 4DR5K 3OS2A 2AQFA 4C0GA 1Q95G 5IYCJ 4E7KA 1TWGJ 1K83J 3ZMDA 1N9SA 1GLJO 4DF8A 1KQSM 4BB7A 2NUTA 4K2EA 3A1YA 5KRSA 2VG5A 4M3TA 3G0QA 2CH4W 1YJ9N 2YI1A 4KRFA 3LWMA 4JI1K 2BBYA 1K0XA 3GZ5A 3OV8A 5J1EA 3DLLF 2FHDA 2ACJA 4DV0K 3G6EA 2JNGA 3PNYA 3F5TA 4XLPF 2SRCA 2F7TA 1HKTA 2CV1A 3DEUA 3GZNB 4W5NA 3WTTC 3LGLA 2A37A 3P9KA 1HNVA 2LQNA 2O61A 3SCXA 2L3SA 2DBMA 2Z1GA 4Z4GA 2XKPA 2LG4A 3M07A 4CGJA 1YXQA 4CF9A 1S3JA 4F8RA 1T33A 2A6TA 1UAAA 5DS9A 4YOXA 3F70A 2YX6A 3CLOA 1H641 1X1AA 2HNYA 3TAGA 5D8KB 2HBWA 2JUFA 3ECOA 1ZGWA 4F7UB 1I81A 3FRNA 3CESA 4M45A 4HHTA 4HVJA 3HPWA 1YQMA 4U7DA 2A0FB 3GF2A 4PDKA 1HJDA 3KWGA 2RQVA 3V7CA 2XGEA 2LTPA 5GAMh 4JKEA 3SQ1A 4LUDA 1YI2N 2CG4A 2KZVA 2ISZA 3RR8A 1X27A 3JCMf 1Z9CA 1OYXA 4FYXB 1VQKI 4WK8F 4J9BA 1Q86U 1UDLA 3X2QH 1V4TA 4A5MA 1RAFB 1YQRA 3K4KA 1GLCG 3BTLA 4FOEA 4OGEA 2ENMA 4C5IA 4A0YA 4MMLA 1Q8IA 1J5OA 1H92A 3AG1H 2R5YA 4OGCA 4C92C 1NZ9A 4U87A 4XL9A 3KETA 3NMUA 2ZZDA 2ECBA 4EJYA 4M77F 4OMLA 2EV0A 3A02A 1QVFP 2LNHB 4Y91A 3MAQA 4KFCA 2JPSA 2HB5A 1PCXA 3NNQA 3CCQT 4ASNA 1W70A 3D0PA 3CCSN 1EH6A 3C2HA 3LAPA 1T95A 5LHHA 1OPCA 3OW2M 4OIOF 3NWTA 1O4XA 1P92A 4M7DD 2WAFA 2ZFUA 1OH6A 5HDGA 3E5QA 3M5RA 2KLOA 5HDKA 5IT3A 5D6YA 1YQAA 1IKVA 2OTJT 3AVNA 5FW9A 3WVDB 1VQ4T 2KT1A 2YUPA 4AHSA 2GA1A 1LVKA 4IZZA 4XLCA 3VS0A 3T69A 2KYBA 3TDUC 3SB2A 4RG2A 1I1SA 4ZDOA 4BEHB 1H9TA 3CC2T 3INZA 1T6CA 2ZPIB 1YVNA 3GO5A 2R7SA 4NB5A 4IOAF 5JLWA 1VSDA 1TUDA 3KK3A 3WE3A 1JJ2P 4JYAK 1QVGP 3EE9A 3QNNA 3C2GA 4JS5A 2QLZA 4ZYEA 3SWNC 2FBTA 4DSLA 4O3MA 1NK4A 2HBLA 1D3BA 4B1UB 3MO8A 3V4IA 3FFIA 1VQ6T 3CPWM 2OZUA 1KFZA 4K25A 3CCEQ 1ZHFA 3CWUA 1QMCA 3HHTB 2A41A 1KC8C 3BG5A 2V1DA 3I4PA 3L2VA 3I56Q 2QXFA 1E4GT 3CCUI 2YHWA 4XKBA 2GIZA 2X4XA 4B9SA 2O2OA 5CVIA 4C8LA 2PZSA 3C3WA 2BHYA 2LKSA 1SVOA 2D0QB 2LCCA 3G0ZA 1S3XA 4L0YB 3LP0A 3G4SN 5CO7A 1RTJA 3O3GA 8AT1B 2K7LA 2A1RA 2R7UA 2KIQA 2QEXI 4FXDA 2VL8A 3HTSB 2HGCA 3J80Z 4OO1J 1KQSA 5HS9A 4XICA 3THXB 1ZH5A 4QQ6A 4WYBA 5FKNA 3Q0VA 2XGXA 5LHIA 3RPUD 3HOTA 3S1QJ 3JRHA 1D8YA 2L9SA 4R8HA 2YHYA 2NZTA 1KSWA 1N8RC 3K4NA 1ZGJA 1YAGA 4DBRA 2YX7A 4AIKA 2GXBA 4FE7A 2IVWA 4FLVA 1A0NB 1MZBA 5HRRA 4DUYK 4AWXB 3KFWX 3KLOA 1X9SA 4FVMA 3C94A 4M7DE 9ANTA 3P1GA 5AQOA 3U6FA 1Y56A 3LLRA 4NNJA 2P5VA 5AR0A 5BS6A 1IGNA 1NKBA 2DT6A 2HZTA 4GDFA 2FBHA 4CFCA 1ON2A 2RF2A 2IP2A 3QMLA 5FROA 2QQ9A 3ITHA 2P5KA 1N3CA 4XLAA 2VBZA 4Z0UA 1K9MO 3SQ4A 4A0XA 5F2RA 2HDDA 1SSHA 3O3HA 1U1SA 4DYCA 1C0UA 2NLUA 3DEEA 1KQJA 2VKHA 1M1EB 2Q0OA 2MGQA 1Y57A 4J9GA 2MSYA 4JLIA 2CSOA 4BUGA 3C2BA 1K4SA 2LBFA 1VQ7N 4LDUA 2LSNA 3RQIA 4LFAK 4PGHA 1LWEA 3J8AA 4BVOA 4BRPA 4JOMA 4NXMK 3SDBA 4HX7A 3IMXA 1T56A 3JRCA 2PUOB 3F8CA 3V4GA 3WG7H 3CCMI 2XHIA 1UECA 3CMEQ 4NDLA 3OVNA 1M90O 2CGHA 4LF9K 3J80O 2JVVA 2JOYA 1JUMA 2E4LA 4CCOA 1TWAJ 4BY1J 4NLCA 1XDUA 5L3CA 1V29B 2CGPA 1YFHA 3G71N 1WXTA 3ENHA 2A40A 1IBLK 3FZMA 1VQKT 3R2XC 3K5NA 1XQOA 5KRTA 5H20A 3OYYA 4LB5A 4E7LA 1RESA 1FTTA 5GMKe 1B59A 3X24B 3OW2A 2FPDA 3VQQA 2BUPA 3R60A 5HNHA 1NH3A 4CEZA 2DMQA 2QQBA 1LFUP 3RWUA 4XOTA 4QPOA 3RMAA 4DTNA 5KGXA 4RWTA 2JTVA 2FVUA 1ITYA 1XMAA 2NVQJ 3I56N 2COWA 5C0MA 1MDUB 3QZ9B 1PP7U 5BPNA 1X3MA 3U9GA 3GTGJ 1ZUUA 1DT9A 2NRTA 1J7KA 1Z91A 1G5VA 4XRSG 5D5WB 3LSIA 4AFUC 5IWAK 1BB9A 4DEXA 1N27A 1A5JA 2DAOA 2LMJA 4M41A 3PQKA 1LCKA 3RTRA 4BY7J 1K78A 5M5XJ 4HCKA 2EQUA 1G3SA 4CEBA 1TV6A 2E2NA 1LMZA 4WF2A 3D5SC 3CPWA 4JYKA 4B3XA 3KWIA 1QSSA 3GLLA 3JRGA 3C0CA 2QI2A 2XDBA 4PL7A 2ZJPF 5KYWA 4FSVA 1FN7A 2RQRA 1ZHIA 3GL1A 4LK1F 4G7ZF 3MXIA 2L9VA 2OPTA 3HL2A 1LWYA 4M77B 1VUBA 3IUOA 2AKKA 1CXUA 2D8JA 3OSVA 1PU7A 3CCRQ 2IRFG 3ID6A 2DXCA 5JS2A 4XBFA 2EA2A 4L18B 2PI0A 3MFKA 5KVRA 2ABLA 3E6MA 2VKDA 2AK5A 2NYXA 1E3OC 1D4XA 4BGDA 2JVGA 3SQ0A 4U0WA 1SKUB 2HOTA 4EGZA 2D0PA 2DPUA 3C18A 5IAYA 2KKOA 4HSRA 3QYHB 1Y97A 4MFDA 2Y2ZA 2DJQA 4G9YA 1O3SA 2HHWA 2EQJA 3FHNA 1KQSS 1RPWA 3MQ0A 3CCUT 2XSDC 1FPQA 3WXIA 5C24A 3KLGA 3S6IA 1H3ZA 4G1QA 1R7JA 3QG1A 2EINH 4LH4A 2GFUA 4GYGA 3CJ1A 3GX4X 5J1RA 4DU4A 1RC9A 3G10A 3CCVQ 2P8TA 2E8AA 1K8AC 5J1YA 4KUMA 4J19A 3QESA 4YTLA 2VN2A 1N5YA 1RAGB 2EBPA 1YJWI 1NU0A 2CQ7A 2R93J 4AMCA 4B8CA 2H3JA 4JKBA 4LN2A 1UUEA 3RYRA 3LH5A 3HKZN 2RN8A 4Y7NJ 4NL2A 4XKWA 1J59A 1VQLA 1JEGA 1R4MB 2JRMA 3VYSB 2ATCB 5F1RA 5A2QK 1MUNA 2EKHA 2PVGB 3TEDA 2BYVE 3DPLC 2JS2A 3CC7A 4YY3K 2BOLA 2MH2A 4O55A 3OR1C 2JJ9A 5MLCQ 1LQ1A 4M3GA 2FPEA 5CK9A 2O9SA 1HQCA 4JNEA 4A3LJ 2DY4A 3V7SA 2JS0A 1FSEA 1RKWA 4C8QG 5E84A 3JSOA 2ISYA 2JJ7A 5C2FA 3PIOL 5AQFA 4NZGA 4BJ5C 3AVHA 1U2VB 2Q2EA 3NVKA 1UJ8A 3FK7A 5F0CA 2DFFA 5D8LB 2VE9A 3LDLA 2IA0A 4IG3A 4E7IA 3IAYA 1GHCA 5B66C 4P9UA 3S15J 2VPRA 3CPFA 3EGDB 4CYDA 4I02A 4A3DJ 1TKTA 4C0FA 4XK8E 2JHNA 2G0EA 3CXCP 4XRMA 3W3DA 2JW4A 5BNGA 1EETA 4DZJA 2FOWA 3PT9A 4E1NA 3S17J 3F22A 3R6MA 2Z33A 4Q5WA 3AG3H 2QWLA 2JG6A 3H9GA 2EX3A 5BN9A 1T38A 5DPKA 4CHYA 3E3VA 4IOCF 3BTCA 3VDXA 2ZCFB 2XMFA 2VBYA 1X01A 1NJIC 1LV5A 1ZK8A 1WJQA 4D7MA 2DK5A 3SQNA 4HVUA 5I3UA 4CZEA 3OW2S 2OF7A 2YRVA 4CJ3A 3O9QA 4F3QA 4XLEA 3BG6A 4NLBA 2DETA 1Y0NA 3IQLA 5EDNA 5FKMA 2I7NA 4DJAA 1Z67A 4B09A 5TJJA 3PUBA 1P4AA 1QHGA 4E7ZA 1SSFA 1QWFA 1JKOC 3CO6C 2HHUA 3JTGA 1X4PA 4LUEA 2C0TA 3CCRN 4CC4B 2FBKA 4B1XB 1ACMB 5A2QE 2O8CA 2YRCA 1ZA2B 4NYNA 4CGHA 1AT1B 1TOVA 4P9FA 4FCYA 1T8EA 1S22A 2VVKA 5BR8K 1TT5B 1GV5A 1LUJB 1Z25A 4XM3A 2JSCA 3I35A 1WAJA 1WWXA 1PDNC 3P8HA 2LKPA 1T3LA 2Y0SN 4BDPA 3CPWS 3CC4I 4BD3A 3ATUA 3ULRB 1KD1C 2E5QA 1MJBA 1M3CA 2WUSA 4ZYDA 4LH5A 3CHWA 1NK5A 3KTQA 5GAMd 5TKWA 2A28A 3OQ5A 2D5VA 4DR1K 3JR9A 1U9OA 3VEWA 1K9MC 1I3QJ 3S9HA 2IEKA 4JDSA 2DA2A 1AD5A 3A5MC 3I71A 5F0FA 1AKHA 4W5QA 3A2KA 3KP7A 5BREA 1NG2A 2CP2A 2X4WA 4GLKA 3KBGA 4YOUA 3EG1A 2CH0A 2P9LB 1X6OA 1Q1HA 1FBSA 5L8RE 2XY8A 5E1WA 3T8RA 1TWCJ 2R4GA 3QU6A 5LJ3f 3SMPA 1YJNQ 3VF6A 2H8WA 4FU6A 4EZ6A 3EGXA 2RQWA 4N4IA 1HU0A 1NGNA 3MX2A 2EIMH 1YVUA 1KQ0A 3TP3A 2EA4A 3SAGA 4BI8B 1CLQA 3PTAA 1WNSA 2KHOA 3V1RA 2CV0A 2K79A 4HW0A 5GAOl 1M1KU 4I76A 4R79A 1U5TC 3CCSA 4I09A 4HF1A 1SKSA 3C12A 4CZGA 1M90C 2W25A 3IWZA 3ZLJA 3OYAA 5DCFA 5J8CA 2RI3A 2I0NA 1B9MA 5GAOr 2K9SA 1Q82R 4CHPA 4H5NA 3BJOA 4CJRA 3ZQGA 1EO1A 3FHZA 1LVAA 1QBJA 1WFXA 1TLHB 5TRDA 3FJ5A 2X9DA 4PJOC 1FBQA 4M3UA 4KH5A 5A0LA 3ASNH 2Q1ZB 2IGKA 3ABMH 4J7IA 2KGTA 5AQWA 4ENKA 5CZ2A 4M75A 3ASOH 4WTOB 3IRRA 2A6HF 4QVZA 3PMIA 1ZAOA 3C7NA 5ELZA 5DM7L 3QEWA 3WG9A 1IXSB 3IAM2 2VG6A 5DCMB 3GNGA 4Z4CA 3DRSA 3CCLI 3N05A 3CCQN 4H5WA 2E2OA 4A57A 4B44A 4B22A 2FB7A 3A8GB 2YG8A 4JX6A 4N0AA 5LD2C 5E3NA 1BBYA 4CUGA 1O75A 5KYNA 2K4YA 5I21A 2OBPA 1STZA 3QICA 2V1RA 4KBOA 3DPUA 2ELKA 2VWFA 1CZ9A 2P9UB 4WFNL 2HHSA 1S9HA 2OTJN 5IN1A 2KPMA 2UXBK 5FGMA 2IXSA 1G99A 3TAEA 3VQDA 3G4SA 2F4IA 1SEMA 5LMUK 2OJ2A 3W2WA 3O2PE 2ZNYA 4M78F 3Q1JA 1BI3A 2W84A 2VQFK 2I5JA 2WAQN 3CC2N 3WTSC 4MDWA 1TWFJ 5J39A 1E2XA 2L3QA 1D3YA 5EEGA 4CE9A 2AKLA 3AGRA 2HOAA 4BR7A 4Y1CA 4BQZA 1YF5L 2P5LC 1LDKB 4ZNXA 4BS9A 3K5MA 1WJBA 3CD6I 2ZPFB 5IH2A 1BC7C 1BM9A 1OYYA 4B9UA 1JCEA 1W2BA 1RAHB 4N0BA 4EV0A 5LRRA 1FNNA 4FX4A 3CF5L 2DTOA 2P5GA 1B72B 5EXWA 3KZIC 3FMSA 3E97A 2ECCA 2P9SA 4O4GA 4BC4A 1SHGA 1QZYA 2EQIA 2KW4A 1YX3A 2XUBA 4OB0B 3SWNA 5DM6L 5ICEA 4NC8A 4DV4K 1EV7A 3FR0A 1S7AA 4RGSA 5IXBA 2IS4A 1HLVA 4PJNA 2Q97A 3THWA 2VASA 3E6BA 1W5TA 3HB9A 4NOYA 2CZ0B 3H92A 2XDVA 1OV3A 5CYMA 1KAZA 3SD4A 1Z0XA 5KK1A 4NCAA 5FU6B 3F6OA 4ZYHA 3M53A 3CM6A 1OOTA 3HYFA 1RUOA 2AHJB 1EH7A 3MKWB 4J00A 3A5ZB 3AAFA 1MV0B 3WGGA 3UKUA 3ZSVA 1YJNN 4JKGA 2E10A 2OFKA 3VSLA 5BPMA 3OJSA 1VQPI 3SNNA 1F9NA 4HUFA 2O8DB 4N4HA 1VQNT 5LFAA 4CJLA 1RDCA 5FLXE 2KZMA 3AGKA 2NOLA 1P8ZA 5F1XA 1IN5A 1G6NA 4M7DG 3JTHA 2FF4A 2XKOC 1VQ7A 1WJDA 2V26A 2F4MB 4CBWA 2I10A 2RGVA 2F8SA 1V4RA 3CJTB 4I7HA 2XRLA 4N41A 2WY7Q 3VODA 4RTYA 2DA9A 4PHTX 2BW3B 4KICA 4CJ5A 5ILUA 4XU3A 3G1LA 2K5FA 2PUKB 3CC4T 2KFDA 4FT4A 3RZDJ 3H5AA 2MC3A 4W1UA 4LDWA 2QA4A 1KTQA 4N9IA 2P9NA 5D6EA 4ZH4F 1P59A 4KAZA 2V79A 3KP4A 4FPBA 3G71A 4C0ZA 2WTEA 1K79A 3ZMZA 3KP5A 4F3OA 3CP8A 2A36A 1IG9A 1KGSA 3AG2H 2COBA 2NS7A 1CZBA 3A8YA 1Y8QB 3FEOA 1SANA 4IEIA 4IF4A 2GLOA 1MBEA 2A42A 2QEXQ 1S9GA 3S3NA 1VSHA 4KPYA 2P4RA 2JK3A 1SD6A 1PUFB 5DV5A 1X4OA 2E6NA 4D5CA 3TTDA 1I8FA 3CBOA 5JR3A 2JZYA 2LX9A 1DU0A 1XI1A 2RPIA 3EZWA 4BR9A 3LA7A 1MIJA 1XSVA 2WY8Q 2KQRA 2QTVA 5CKHA 1NG7A 5EG0B 2GAUA 4HYEA 3MEAA 2G8KA 4FLWA 1ATNA 5HLFA 3GOIA 5FPEA 3R6SA 2BV6A 1M3AA 1TKXA 3EY1A 3WNEA 1K73R 2OZ6A 2ZJ2A 2I8DA 1WHKA 2DKGA 4ESBA 2DA3A 1MBFA 1VQKN 4FZZA 2K3XA 1VSKA 2O4XA 4BRQA 3TU5A 2FEIA 1XCVA 5I2MA 2F2VA 3LSJA 3NCIA 3JRAA 3BOQA 1NGDA 2JM9A 1HSQA 1VQ8I 1RAEB 5DUIA 3WVEB 2L02A 1WXUA 2CKKA 1IREB 1D0YA 4HTLA 3UB5A 2CDTA 2XHBA 2UXDK 1VYTA 2E5KA 2EFWA 3MVPA 3M6GA 4FW2A 3RMSA 3D1NI 2NUTB 4DFJA 1TUCA 1QP2A 2V1NA 4OF1A 2CW7A 1NTCA 3MEXA 3MKLA 1I3AA 2HNZA 1HUXA 5HLHA 1RFQA 2D0AA 1R23A 4XEIA 2OYQA 1FWZA 1MBJA 1FYLA 5L3DA 3OYFA 3WNGA 2P6TA 3JAMZ 3H0IA 3PIOA 2PG4A 3H3VK 2MWOA 1I5OB 6PAXA 3A0BC 3LAJA 4JJDA 4OAZA 1JGSA 4CF2A 3LANA 2K4JA 1FX7A 3CCMQ 3M4GA 4CZLA 4L0ZB 4ITVA 3VESA 2XPVA 4M7AC 3BT9A 4C5EA 4F93B 2QDLA 1W2BS 1ZR4A 4M72A 5FWCA 4KHWA 4EA4A 5JVGF 1C1CA 4A4HA 1VOMA 4B3RK 5GAEP 4GV6A 2HSEB 3ZQIA 2QGUA 3P31A 2GTDA 3HKZA 5FU7C 2HBKA 1Y6IA 4Q48A 1BYMA 4DYQA 3KVGA 2YNFA 4KUIA 1JGGA 1R0BG 4D5FA 2DERA 4ELTA 3C1DA 3I0TA 1Y71A 4N76A 5B8HA 3IHOA 1HW5A 1SL2A 3KD5E 3BY7A 2KXDA 3AT1B 3CCUN 3H41A 4MLHA 4NBQA 3HSBA 3GTOJ 3FBIB 4PNOA 3AL0B 3KYCB 1QCOA 5LJ3j 1X9JA 3TBIA 3DRPA 4FL9A 2ZPBB 4DA4A 4M78B 1Q86C 3ZOBA 5CQYA 2A08A 2QEXN 2RQUA 1RDUA 4ZZLA 4LF5K 1FZPB 4LIUA 3PVQA 2ZXWH 1ZYQA 5LGUA 3ULEB 4CK2A 4BY6C 2M8GX 5CZ1A 1HNIA 2Q0UA 4EJTA 2LCSA 4HQEA 4CI6A 5TISC 3DI6A 1ETXA 5KAFC 1VQPT 4IOAL 3KTUA 3PX6A 1WIEA 3LL3A 2M4GA 2KTQA 1W4MA 4BREA 3M0QA 2HVHA 4JI4K 4PSXA 1XMOK 2Y69H 5GJWB 5D7UA 3JSPA 4BQNA 1REPC 4KHSA 2A7YA 1L3SA 4XIDA 1YHQT 2VT2A 1TSFA 3A8HB 5FPMA 3O9UA 3F3XA 4BAYA 3GFMA 1SFKA 4RGUA 3F8FA 3CCJT 1J5EK 3KUFA 1VF9A 3H3UA 2ZKZA 4XRFA 1VQ5I 1ZELA 5GAMg 1IZ6A 1W97L 1OCZH 3LH0A 1BDGA 1HDPA 1E4FT 5H6QA 4VUBA 2F5EA 3VN5A 4BRIA 1XX5A 3J81K 1UHMA 3CQ8A 1W0HA 1J9IA 2V8IA 1ZN2A 1YITI 4C9YA 3SZTA 1IKWA 3P7NA 5AQZA 4JK9A 2RN7A 4JZ3A 4IZ9A 1VQ9A 1Y8RB 4XTZA 3LM2A 1YJWQ 2KT0A 3TO7A 4HEA2 3SXYA 2C0IA 4H4KC 5F27A 4A4FA 1V1CA 4HVVA 3P4IA 2AIRB 2E7WA 4FK0A 1BQNA 3K69A 1MKMA 4M75D 4B9NA 4RKUE 3QEPA 3RPQA 1WDXA 4L5EA 3UKRA 2BZYA 3CPEA 4ZDLA 2Y48A 3LWHA 1NGCA 5LJ5f 1U9NA 3V8JA 2KVQG 1TG0A 2AQEA 1JHHA 2R7OA 1ETQA 3CCMN 3JB9J 2E35A 3OH6A 4DV7K 1TTYA 4A3BJ 4V2SA 2YLBA 3AHUA 1EXQA 4DLGA 3VTHA 1RLQC 3HDDA 3TOBA 2HKNA 4OU0A 5DTDA 3PM1A 1EWRA 3TQ7P 2X6YA 1S1UA 1HC8A 1VQMI 2LH9A 4KTWA 1IHVA 1S6QA 2FO0A 4A5BA 1YCYA 2QM1A 1TUYA 4KB1A 1XG7A 1R4NB 1WXBA 1S1NA 4PKHA 3UKGA 2FOKA 1FYKA 2YXYA 2B9SA 3FK6A 2E1CA 5GAOq 1XCBA 2E2PA 1YQKA 1ZBUA 3G25A 1KC8R 4BBSJ 4FSSA 5KTQA 3BF1A 4FJMA 3QIIA 3OYEA 2ZJRF 3DB4A 4BE2A 3TEEA 3QPSA 1R59O 2L2PA 2RA2A 3OA9A 3HOSA 4B43A 4PIIA 3AA4A 1YW7A 1WI3A 1RI0A 2JPCA 2X35A 3HVTA 2Z9OA 3AV9A 1D5YA 1F1ZA 2M16A 3C6TA 1NM1A 2RREA 4DTUA 4FJXA 2DTIA 3BUZB 2XAGA 2BUDA 2K2MA 5JLHA 4JEPA 2X6XA 1SD5A 3G1JA 3BJAA 4I2OA 2QKLB 2QCOA 1E3PA 3UT1A 5CQGA 3QDKA 1HKBA 4QVDA 4BROA 3MMYB 4YFXF 3FDRA 2ZXJA 4JRKA 3TSPA 2O4IA 2LBFB 2K86A 1N8RR 2K5IA 1WPKA 1S1TA 3CCQA 2HPIA 4A3JJ 2DEQA 2R7RA 3L3UA 1PUEE 3NVMA 3U4LA 4M75E 4F92B 2STWA 3UF4A 2VV5A 1NJWA 5F1JA 3FMRA 3S3MA 1OKJA 3FXRA 1LE8B 3FHFA 3HI0A 1UGPB 4WE1A 4JRQA 2F2XA 2DFUA 3PIPA 1IUYA 4FYDA 1YS6A 1WSEA 4PGGA 3CMAT 2CP3A 3VS1A 4KITB 3QEIA 3PNWC 5FFXA 2QKKA 2OTJA 3HOYJ 1JKQC 1YRNB 1VQ4A 1Q9XA 1QHAA 2E34A 4PQUA 3HUGB 1QZZA 1OX9A 1KHCA 1WAFA 2A05A 2QENA 4C8OA 4FQGA 2VXFA 3CC2A 5J40A 4IDKA 3TAPA 2Z99A 3KZBA 4DQQA 4UVBA 1JLBA 3SK3A 3LX7A 4XLFA 2JUCA 1H8AC 1K76A 3THXA 4FLUA 3CDIA 1YJWN 3A2FA 3LP2A 1Q81U 4HLXA 1QSLA 4FJNA 1HLUA 2QSHX 4E9EA 4NCGA 4CK1A 3ZGKA 1VQ6A 3AVBA 4LY7A 2BVMA 3P8BB 3DXKB 2MH9A 4ZN3A 5KPRA 1Y7XA 3HRTA 5DUKA 4K8XA 1FIPA 1V4SA 4C0DB 4CJ7A 3BW1A 2RJCA 2PJPA 3MECA 2M3AA 3S93A 1B8IA 3GG4A 2A1SA 4QAGA 2GQQA 2PYJA 4O44A 2P9PB 3B6OA 4GYIA 3URGA 2KISA 2OPPA 5AQUA 4NB4A 1LOJA 3AVMA 4DSJA 4FJ7A 4EMSA 3M9AA 5KYWB 1Y96B 4QQGA 2KQWA 1ZSZC 3A0IX 4EP4A 4DTOA 8ATCB 4UNOA 1BA5A 4PFPA 1JLQA 2CP5A 2DF6A 1LEBA 1TUUA 1UELB 3WXKA 3D7SB 5FLMJ 5GAOp 3QOPA 3V81A 2LRDA 1FKOA 2E2HJ 3IS9A 4XU1A 4Y13A 3MEGA 3JCMg 5GIOA 1RR8C 2K85A 1GLDG 1O7FA 2DJIA 5GP9A 1W6XA 2LX7A 1HQEA 4DR3K 3HBTA 4K41A 3HVRA 2P4WA 4C92F 3TI0A 1M9SA 1QZ5A 4J01A 4OMNA 4M74A 1NPRA 2J6KA 5D5XB 2XROA 3CCLQ 3I55T 1CZAN 3AO1A 4H0OA 1UE9A 2XF5A 4AIJA 1XOVA 4J83A 4KN7X 1JJ6C 5GMKi 3M4OJ 2AXLA 3Q0UA 2A6EF 1FMWA 1MW7A 4IDHA 3GTQJ 2IIRA 1WKMA 1WZOA 2ZFWA 1U49A 3DLLA 2FG0A 4FOIA 4M63C 4JI5K 4YFKF 3S6WA 1SKWA 2CH6A 4CHUA 2FYKA 1YS7A 3EH1A 4LGWA 1VQMT 1ETWA 1NJXA 3MMVA 1YIJI 1J9AA 4DTSA 3EN9A 2X48A 2RK1A 3BGRA 1U5SA 2DD4A 2XB0X 2JA7J 4EA5A 4XH4A 4LLLA 2VC1A 5GMKj 4LF6K 3CD6Q 3V1OA 1VQOI 4DTRA 2PQ8A 1YJ9T 4YOTA 2NOFA 1FY7A 2QWOA 3JB9F 3H5RA 5ECAA 1SD4A 2JRTA 3VV0A 1A5WA 4FJKA 4KH1B 1U04A 3CC4N 3OL3A 3M7GA 1L0OC 5M5WJ 3I4MJ 2PMHA 3JCMV 3VA0A 2OFIA 3SBGA 2XKOA 2RK2A 3O3KA 2ZMEC 1HYSA 1VQKA 2YJFA 2P81A 4CEQA 1IXDA 3X20B 4HCBA 4W5TA 1Z7UA 3TAQA 3ECHA 4E89A 3DTEA 2DLPA 2RN2A 5FD6A 3TW7A 3J7YP 4WCGA 1ZG1A 3S1RJ 2DYIA 1TXQA 4M77A 2R92J 5D4RA 1FYMA 3GVAA 4GMJB 2ZB9A 3N5NX 1BG3A 3KLIA 4CF0A 1OVQA 4JI6K 4C1NK 1IBMK 1KHIA 4RB2C 4WQ4C 4Z4FA 2WAEA 2R7FA 1Q7YU 1YG2A 2CQKA 2L3PA 3KZZA 2E5LK 2G8HA 2VQLA 2CZ6B 1IB8A 2B8AA 1YI2T 4AHCA 2OAZA 3IRQA 5KYUB 4QVCA 1BW5A 2JLEA 3LM9A 3T1AA 3LFKA 1RAIB 2F2WA 1MMAA 4E7SA 4CH7A 4A4GA 1YWOA 1B4AA 5CVRA 1IJJA 1MMDA 4H0YB 4BRCA 2ZGWA 2GBZA 3FWEA 2O03A 4EMKC 3L2WA 4BQOA 2O8CB 1VAZA 3AO3A 1NK0A 3LWFA 2CYZB 4JKDA 3CCEI 3QWXX 2X4JA 1N34K 2QSFX 2GXGA 4FWOA 2NRAC 5LJ5j 4BYYA 4KFBA 4XN3A 3JRBA 5M1NA 5GMKl 3BQZA 3OS5A 2ZO4A 1FP1D 4MZMA 5H6RA 4AF1A 2BE5F 2TRTA 3BROA 3CCLN 5F04A 4JRPA 4DV5K 3WE2A 3RYPA 3EO3A 4C8QC 2A3SA 4K42A 4AH9A 2BZTA 3L1PA 3CJRB 4X64K 4XLNF 2NNWA 2IGIA 5DMRA 3EGUA 1JUPA 3R9PA 3GYHX 1C6VA 2V8KA 2YHAA 3KKSA 5C2DA 4A12A 3SAFA 3RERA 4IRIA 1NOZA 4L5JA 2P0QA 4A2AA 5CKTA 3BF3A 5M1QA 3EHRA 1UGSB 5FD5A 5ILVA 4LFBK 3RRHA 3AO5A 1KG2A 3K9TA 4C8KA 1EH8A 1NBEB 2J6FA 1U2VA 2JZ2A 3ZQHA 5JVHL 1SD7A 4ZJZA 3AG4H 3EYYA 2JA6J 2XU8A 2COYA 1W36D 4AG1C 1RLPC 3MZ8A 1X3NA 4CF1A 3ZRGA 1X3UA 4AIAA 1VQ8Q 3GXOA 3CD6N 3T0YA 3CIPA 2JN0A 3QPLA 1TWBA 2DW4A 1VYUA 4CC7A 4HF0A 2CT3A 2X6WA 5DD4A 4D1QA 1VK0A 4KA4A 5CAIA 3WGHA 2WC9A 1HOMA 1HQUA 1YE9A 4DOZA 3O08A 3VRYA 2FBIA 1GLLO 4CGGA 4HRIA 2LNBA 4BE0A 3D5LA 2YS9A 3ZR8X 1M1KC 4ID5A 2GA2A 1G3WA 1TW2A 1NGGA 2QG9B 3M8JA 5I2SA 1NBWA 3MX5A 4JI2K 4E70A 2FZKB 2BY2A 4MQ9F 3AVKA 2CUZA 3WTYC 3H36A 2R7ZJ 1Z6TA 3H9QA 4GY2B 1NGAA 1K9MR 1M3BA 3GMEA 3DLEA 2GBQA 1P2FA 1D8KA 4HG2A 2F5CA 3REBB 3QB0A 2BE7D 3KD1E 1QTMA 3CI5A 3FE1A 1JE8A 1WPYA 1XC5A 1DP3A 4G9ZA 2RAEA 1FOKA 3ZT4A 2OTLQ 4RW7A 4RGRA 2V8JA 3ZCOA 1BI1A 3MN6A 2CT4A 2DMTA 1VQPN 1MHNA 2P5OA 4CYCA 4XKCA 2RPNA 2JHJA 5FKLA 3JCMX 2EGEA 2IT0A 4Y33A 3CMEI 5KCMA 1IAWA 4F55A 1KD1U 4OIQF 1KEAA 3DLKA 3TL4X 4WWCA 1NG6A 1FC3A 2DTZA 2E19A 4RB3C 4JD2B 3K4LA 3RUXA 2OC6A 2YX4A 4IWVA 5GAN4 1M90R 4OWRB 2L0KA 4XU0A 1W5CC 2LY1A 4CZMA 2FC0A 4FWSA 4A3GJ 3QP5A 1M1GA 5C6SA 1DEJA 3HTVA 1TNTA 5CKFA 5GAOn 4CICA 2EV6A 1R77A 4DB3A 1WEFA 1IXRC 3CJCA 3SAHA 3MCAB 3ABTA 2RI2A 2Q2RA 4F7UE 4WX9A 3N0UA 5F0HA 1BI0A 4ILGB 4KDPA 1GBQA 3MEEA 3N4PA 5EY4A 5CLSA 3VEPA 2I2LA 1WHJA 1QZEA 2NRWA 3HZJA 3OR2C 2ADUA 3VWBA 2P9LA 3HJFA 4FJGA 2AS5F 2MF2A 2D8HA 3AAPA 2F8TA 2HU9A 4LD6A 4E4HA 1KG1A 4F4KA 2UUCK 2P9SB 3JCMW 5J2NA 1MUZA 2VC0A 3J7YJ 1IZ1A 4O0JA 5DLQE 5M9OA 4Y1DA 3SWNB 1NK7A 2ESHA 2F2EA 2M45A 4C5HA 1YN8A 3DU6A 1NNEA 1ASVA 3TCJA 4F91B 5I22A 4Z2YA 5I42A 1PYVA 1QW1A 3J7AY 2J06A 3QOEA 3ZMVA 1ZG5A 4FJHA 4FWNA 1Z1DA 4FM2A 4YORA 2UUBK 2FPFA 1X2MA 3EUAA 4GO1A 4KKOA 2P9IA 1XQHA 2G3RA 4L9VA 2KYMA 4ZTJA 3P5JA 2R7QA 1ERDA 1SEUA 2HEOA 1HKGA 3OS1A 2ZC2A 3CJ9A 5E8GA 5A2QZ 3DYAA 3HM9A 3GTJJ 4J2EA 1VQ5Q 1S5LC 3M8QA 3LZJA 3EFSA 1R0CB 4BL0B 3SYTA 5CVVA 3BPVA 2HKOA 2WACA 4MO4A 2QQ8A 1YCSB 3FXMA 1VQ8N 1RTIA 1LJ9A 4UUSA 3CCET 4AU7A 3ZQFA 3IH3A 4U88A 3BG3A 3BR2A 1YITQ 2F69A 5JLXA 5CVUA 4RM3A 2XI9A 4F9OA 3I56T 1W5SA 4LXCA 3U21A 1MU2A 4KH6A 3PMTA 1PKSA 1XMQK 3OMGA 4QWQA 2XO7A 3VF2A 3CMYA 3M0SA 2K02A 3HP9A 2ZPGB 4OVAA 1Z9QA 4IQ4A 1KSPA 4BXUA 5H1SQ 4BGBA 4U67L 1LAVA 2P9NB 1SVLA 3CCVI 5ICGA 4IG0A 2DIQA 2LQKA 2DNUA 1BWFO 3K2PA 1N77A 2P9UA 1RIOH 1MDMA 4CECA 4DTMA 1R1VA 3T19A 1QVFM 4CBUA 2LKXA 3TGNA 4BRAA 1IW7F 5E1ZB 5H2FC 3A1PA 4J2BA 4X65K 1KA8A 3LDSA 3RSNA 1QRYA 1CKBA 2EW3A 1VNDA 4KREA 1OI1A 3SEMA 5FO5A 3NHGA 3FSPA 1M1FA 2IOCA 5BPDA 3BQYA 4PL6A 5GJVB 2HMPA 3JRDA 1DPUA 4OMZA 4FETA 2KMTA 2DA5A 5E18F 4IUTA 4RUGA 1P7IA 1U2WA 4M75G 2E20A 3KKRA 3O8GA 4JI0K 5IP6A 1OCTC 2Z1DA 3RCOA 2IVNA 4FWRA 2VWJA 2W57A 5D6XA 3CJ7A 1K9AA 1M4ZA 2D45A 2FXUA 2OCCH 2HL5C 4B3MK 3A8OB 2W03A 1JJ2M 1N32K 2VQHA 5BPLA 2VUBA 1AOYA 3FLCO 2W48A 1QA6A 1QVGM 4RCBA 3K5OA 1BHLA 2PX9A 4AFQC 4AD9A 3VGLA 3SZGA 4XLHA 3DMJA 4OKEA 1GUUA 2MI6A 4J6YA 1RI7A 3J7ZI 3SHFA 4M7DC 1CGPA 2V75A 2YNGA 1MSFC 2XAHA 1W4SA 4OLBA 1CF7A 3KPHA 4PWDA 2B5JA 1AU7A 1UA0A 2DRMA 4ESRA 2DCEA 1TL3A 1WI9A 3SZ2A 3Q9SA 3RTVA 1T3VA 3A98A 3ASMA 3CM5A 4S0HB 2L54A 1OKRA 1AA7A 1NGHA 2DL4A 3WU2C 2DOFA 5GANe 1Q81O 3U3GA 3CMET 3PIPF 1OH5A 2GF7A 1ZX6A 2R7DA 2H56A 1K4TA 2DMOA 1Q18A 5AQQA 3EEQA 1QU3A 4F3TA 2WTUA 4OB1B 2ZQBA 2BW3A 1X1PA 4PCQA 3LOCA 4M77D 3T3FA 4FJ9A 4G12A 1FOWA 3S14J 4KT5C 2AA4A 2NOBA 5GAMe 5KYXA 5KI6A 2YWWA 1RBVA 1Z9ZA 4G6DA 2CP6A 4OIRF 1E7OA 4B47A 1XPXA 1S72Q 2L0AA 2ESWA 3MKZA 1B07A 1BIZA 4B9VA 4X34A 4PJOF 3QFUA 1JJ8C 3ZN1A 2GQIA 4CZIA 4Z6YA 3OYIA 1YITN 2DBKA 1C0TA 3HG9A 1XWLA 3OYKA 1OH8A 4CVNE 2NRVA 1YTUA 1N3AA 3SBTA 2VC8A 2NNNA 3ZT3A 2O3FA 4CHQA 1VQNA 1ODDA 4CFAA 4IKFA 2P7VB 2DIGA 2YG9A 2M51A 3M8SA 3U1DA 5I9EB 1A04A 2K40A 3NH0A 3LSHA 1OU9A 1SAUA 2HHQA 2DPPB 4YPHA 4PSWA 3AO2A 1XN7A 3IFRA 1TP4A 5FKKA 5HRNA 1NJYA 2ROLA 1YO5C 2P0WA 3OS0A 3B6CA 4EJOA 2Z1IA 3RVCA 2O7OA 4UHTA 3E9FA 4C5GA 4BQAA 2RHIA 3CC4A 3F9KA 1XHZA 2K9LA 3O1WA 1VA7A 2QBYA 1A36A 1LNXA 4B3AA 5B1AH 4ISFA 1N6QA 2LVSA 2X6SA 1DGRM 3NAUA 3IH4A 3I0SA 1VQMN 3CCRT 4IBNA 4XH1A 3F6VA 3HOWJ 1RDWX 2WB1A 3S2DJ 4JS4A 1XHXA 2IG0A 4IFEA 3QAHA 4DGWB 1LCUA 1GFDA 3KP2A 2HXOA 2A6AA 2HVRA 1Y64A 2OI3A 2DPDA 1KFSA 3PFIA 3E9GA 1KCFA 4RG8A 1BK2A 2GOMA 3FIFA 1QVFA 1I6XA 2OAWA 4CHOA 1GXIE 2VT3A 2STTA 2X0LA 1VSJA 2HSPA 3OIQA 5KAIC 3VJPA 2EWNA 1NYFA 1IDZA 5CQXA 4MDBA 4O8UA 2OZMA 1UJ0A 4M77E 3GNFB 1SRLA 1MUDA 4M3YA 4NC6A 5KHDA 2PJRA 1ENHA 4UXNA 3K9KA 2DZCA 3CCVT 4LNPA 3QSUA 4FO0A 4FLYA 2G6FX 2DFHA 1KAYA 1HD3A 5JHUA 2CWEA 4Q5SF 2FSWA 2HXIA 3W6VA 5GANh 2RH2A 4OOIA 3CVTA 2PYLA 3TSZA 2DOAA 4XTVA 1GLAG 4FIBA 2KRHA 1N5ZA 3SLCA 1YOVB 4N56A 3RDVA 4GLMA 5DEQA 1MJAA 3VUZA 1NGBA 3VRZA 2O9VA 1JJ2A 3LPTA 5C3EJ 4HV5A 2D1HA 1QVGA 3ATVA 1YIJQ 3LDPA 1BIBA 3NF7A 1MNEA 4BWMA 2L7FP 1KO9A 3GP8A 3UKRB 1T6DA 2VUMJ 1P7MA 1HRHA 2YJEA 5LRSA 5HDNA 3HRMA 2Z0WA 4RTFD 3SFIA 4RBOA 1S1XA 5CQEA 3L6QA 1LPQA 1D9DA 4II1A 3GDQA 1USSA 4BU2A 2CFXA 1MH3A 4E19A 2E36A 2L3DA 1VQOQ 3FHGA 1Q7YO 1EFNA 2CH5A 2GWKA 2ME0A 5IOZA 2F48A 4DBFA 1HK9A 5FLXO 2LQWA 1AEYA 4WQ4A 1RUWA 3GFJA 5HY6A 2O8FA 1KQ9A 3WEEA 5LY3A 3FB9A 5IT9O 1E17A 4M78A 3JS6A 3CWSA 2L89A 1TK8A 1K8AO 2EJRA 2ECZA 1RT7A 1J5YA 3ZQLA 4DQIA 3R0AA 5EU7A 2JM8A 4IUVA 3COAC 4GCVA 2KSSA 2KDZA 3MN7A 1C0MA 3NHNA 1ZR2A 3C95A 2FRWA 4OB3B 3G6EQ 2HI3A 3PNVA 4UC4A 3HPGA 3ULEA 4DBQA 1W0UA 4CF8A 4D0PA 4X9CA 4XTUA 3V9WA 4IEEA 4L5GA 5GAN8 1OCOH 2X1CA 5EJCA 4DQSA 1VHXA 4XN0A 4CCHA 1SHFA 5EZHA 5JFRA 3J7AO 4LC9B 5GPAA 2E88A 2LK2A 1OZ2A 3KYDB 5K7FA 4KJZA 1JT0A 4IHSA 3SMSA 2FF3B 2KIUA 3WQUA 4Q0BA 2V6CA 1H1VA 3QERA 3KLFA 4ATOA 1GLNA 1KLNA 3V42A 3ULDA 2JA2A 4RW4A 1PSEA 1QHHD 1JLGA 1O7LA 3K70D 4RDUA 3OBYA 4PZJA 3TR8A 4YOVA 4XAXB 4XTXA 2COMA 2G8VA 1G15A 2IIMA 1NKCA 2M0CA 4U0VA 1S6PA 2O8EA 2L7ZA 4AIHA 1WEGA 3VF4A 2XY7A 1USTA 3OWTA 3IWFA 1VQPA 3JCMe 5EYRA 4GV9A 5HLIA 2LT4A 3HPHA 2F9WA 2R0QC 4IPAA 5AQVA 2K9MA 1JKHA 4CEOA 2MA3A 4BI3A 2W0ZA 3IRXA 2M1BA 4AC0A 1O9SA 4KO0A 3D5RC 2DXBA 3NQOA 1YHQA 3M9QA 5GAHP 4M9SA 5M1KA 2JPBA 3ERMA 4RTTA 2A5YB 1NJIO 1OU8A 4HPQA 1ZBSA 3CCJA 2K2VA 3NH1A 5BRHA 2QF7A 1U5TB 2M30A 5GADP 1OJLA 4XMYA 2NRZA 2D1KA 4A62A 3B6PA 5AT1B 4ENJA 1ZBLA 1EBMA 3CXCM 4IX7A 5KNLA 1AHDP 5LJWA 2MPXC 4FPAA 1FP2A 2UV1A 4GW6A 3GBGA 3LW5E 1ASWA 3DWLA 1BL3A 1YJNT 3W6JB 3I9V2 1QVFS 3V6DA 4PJOB 3EG9A 5IHNA 2DL7A 2PMZN 4M7AF 5KCOA 3QIOA 4C30A 1P9QC 2E1MC 4ZN1A 2XG8D 2EYXA 3DAWA 1YIJN 2BDPA 2HR3A 4XK4A 2DA1A 4B21A 1QVTA 2V4JC 1IJWC 4FJ5A 2CUBA 3RQ4A 2V9PA 4LSLA 1Q81C 4ISGA 5D4SA 4KULA 1D0ZA 2R5MA 2H1LA 2R57A 3RRGA 4PL8A 1B8IB 1TK5A 1ZUKA 1ETYA 2W04A 1RT2A 1T0HA 4E9HA 1G3TA 3QP6A 4OFAA 3H9NA 1VQON 5C25A 4DYRA 2OAUA 1KD1O 1ZQ1A 3NWSA 2GTJA 4F7UG 4RTXA 4D9JA 1GV2A 3J7ZO 2KI7A 4HQMA 3TKYA 4BRDA 2QKBA 1O1WA 2Y4XA 1JB0E 2A5WA 3E9LA 1JJ2S 3MAJA 3CUOA 2NOEA 4UOBA 2D0BA 2PTKA 2QA4I 1QVGS 5EX5A 3LALA 2DZ9A 3ZPLA 3LZIA 3O9TA 1VZ0A 3TO9A 4LD5A 2WWYA 4CZKA 3HTRA 1RT4A 1W0TA 1KQ1A 4JUVA 1IUFA 1N25A 3LDOA 4FHTA 4DSEA 1Z7LA 4CJEA 4UQGA 1UB9A 1KRPA 3K1PA 4UVCA 2M7AA 2VJJA 4Q5VA 3TSUA 1FTZA 1T0FA 1YNZA 4S04A 4O5BA 1MBHA 1FOYA 3U9DA 2V9VA 2Z3YA 3TO6A 4J8FA 3SHWA 1O13A 2CQQA 2RNAA 3HSRA 5SWMA 2E1ZA 3VYTB 1LE8A 5AQJA 4D8KA 5BN8A 2D4WA 3FM3A 2LMDA 1UHSA 5T7BA 3JCMQ 2O9LA 1WJ5A 4DZPA 3ONQA 2HL3A 3H35A 3AVGA 1YRNA 3JCMh 4FL6A 1Z3XA 1P7JA 3WU0A 2MABA 2F9TA 1TVRA 3HUGA 2QK9A 1QCFA 4WQ5A 3F8MA 5HS7A 4P96A 5D5UB 4XONA 3N4MA 2CSIA 3E7LA 3OMCA 2CGKA 3RSEA 3H08A 3TTFA 2DYSH 1BA0A 1AWJA 3CCEN 2HDCA 4DSFA 2NS0A 4MLEA 1TKZA 1CSKA 4BRHA 2RNJA 2F5KA 3IKMA 2Q3SA 2PBIA 4LDVA 3SQ2A 4HCCA 3DXKA 3KP3A 4CERA 4BY9C 1HCRA 4X62K 1GOBA 4AUXA 3ISPA 3J81Z 3DLAA 1K0SA 4I2PA 3HFNA 1RNLA 3CMMA 3FZLA 4CFDA 2VXZA 3MP1A 1NG9A 3BZKA 4OKJA 5M3FJ 1X2KA 3CMAA 4I98B 1U47A 4IVNA 3WQTA 1YQLA 1ABQA 1DLOA 2ZF5O 4LOCA 2P9PA 3FZKA 3FDYA 3MEVA 3T9NA 3DBRB 2HDAA 1KXPA 3CEYA 3F8NA 1X69A 1A6QA 1ZLJA 4Q47A 1S1VA 1BCOA 4JKFA 3LGFA 4A93J 1DTQA 3AKZA 1Y96A 1I5LA 1WQWA 3E6CC 2OPSA 1TGOA 2ZE2A 3NTHA 1T8IA 2P4TA 2GUIA 2RHXA 1YYVA 2UXXA 3RR7A 5CKDA 2FU4A 1ASUA 4CJSA 2VJIA 3SFZA 3FGUA 1FEXA 3V9XA 2VQCA 2GXAA 5ICCA 4E6KG 4ENNA 2OANA 1H8KA 2NRHA 3TABA 4CBXA 1OCCH 1R9TJ 4YIIA 3DXMB 2M0OA 3ULQB 2DK8A 3CXCA 3F73A 2V7YA 4JHDB 3JB9H 4NXNK 4G8XA 4G6TB 1UCRA 2IW5A 1Q7YC 2DTHA 2UU9K 4GXOA 4OMFB 3HOZJ 3LWLA 4RAYA 2X6OA 3NF6A 5GAHJ 4HLYA 4C1NI 4KIGA 4JZ4A 3DOKA 2KY9A 5DY9A 2KK4A 2QEXT 5GADJ 1H3HA 2KIMA 2VBXA 4RCCA 2LD5A 1KQ2A 1BOAA 2M9HA 2KMUA 4DV2K 5ADXA 1K8KA 4BUPA 2RD1A 1EKEA 4DV1K 1RBRA 3FIWA 3BG9A 4GKKK 1JXEA 3AVCA 3ZMUA 5FRMA 2KRCA 2BIVA 1D1BA 4Y17A 3RESA 3KFVA 3OYLA 1I0CA 2L9RA 1IO6A 2YUNA 4DS5A 3MDQA 2GIVA 2DXUA