3OYJA

Crystal structure of the pfv s217q mutant intasome in complex with magnesium and the insti mk2048
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
368
structure length
368
Chain Sequence
LDAELDQLLQGHYIKGYPKQYTYFLEDGKVKVSRPEGVKIIPPQSDRQKIVLQAHNLAHTGREATLLKIANLYWWPNMRKDVVKQLGRCQQCLITNASNKASGPILRPDRPQKPFDKFFIDYIGPLPPSQGYLYVLVVVDGMTGFTWLYPTKAPSTSATVKSLNVLTSIAIPKVIHSDQGAAFTSSTFAEWAKERGIHLEFSTPYHPQSQGKVERKNSDIKRLLTKLLVGRPTKWYDLLPVVQLALNNTYSPVLKYTPHQLLFGIDSNTPFANQDTLDLTREEELSLLQEIRTSLYHPSTPPASSRSWSPVVGQLVQERVARPASLRPRWHKPSTVLKVLNPRTVVILDHLGNNRTVSIDNLKPTSHQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Recombination,viral protein/dna
molecule keywords PFV integrase
publication title Molecular mechanisms of retroviral integrase inhibition and the evolution of viral resistance.
pubmed doi rcsb
source organism Human spumaretrovirus
total genus 105
structure length 368
sequence length 368
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2010-09-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
A PF17921 Integrase_H2C2 Integrase zinc binding domain
A PF18103 SH3_11 Retroviral integrase C-terminal SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2300 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3oyjA04
1.10.340.70 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Endonuclease III; domain 1 3oyjA01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3oyjA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3oyjA03
3M9QA 3V1OA 3WNHA 3M8RA 5IAYA 3KK3A 4QQGA 3WNFA 3M8SA 2RN2A 2G8HA 3CQ8A 4CGDA 5C6SA 1FK9A 4KB1A 4QQDA 1VSMA 3K57A 1IKVA 4CJRA 4DS4A 4CGFA 4JRPA 1SKRA 3VQBA 1WLJA 1WGSA 4FU6A 4EZ6A 1C1CA 1U48A 4AHVA 1FXXA 3PMIA 2KFNA 4CIEA 4AHTA 1XI1A 4FJHA 4RW9A 3OVNA 3ZT0A 4E89A 4CEDA 2OYQA 4IUQA 3QJ6A 2FBYA 3KD1E 2DIGA 3LPUA 4F4KA 3VQQA 2X74A 3O8VA 4C5GA 4OKJA 2BUDA 3QO9A 4KI6A 3OB9A 1NK9A 4LY7A 1HYZA 4E7IA 4B9NA 3ZSQA 3NF7A 3LDSA 1BL3A 3KLGA 4FYDA 3SJJA 4HVJA 2W42A 4M3TA 3K59A 4CRIA 3PO4A 2LCCA 1ZBHA 4H8KA 4C5HA 4Y1CA 3E9GA 4DFKA 4E7JA 3IAYA 3JYTA 3VQ9A 1NK0A 4OKKA 4FK2A 3TAQA 4NCGA 2YV0X 4A4EA 4NCBA 3MEWA 2L8DA 3L3VA 5DK5A 1I39A 3HPOA 2D0CA 4E7LA 1LW0A 2PYLA 3L2RA 3LALA 1NJXA 3VQ4A 3KKSA 4CEOA 4I7FA 2HQXA 2HHQA 4Y1DA 3CFRA 3SD4A 2RHZA 3DRSA 4N4IA 5J26A 5FROA 5D6XA 5J2NA 1GOCA 1VRUA 2GF7A 3TR8A 4W5OA 4DLGA 1TV6A 2ETJA 3OYHA 3VQ5A 2EQKA 3DB3A 1TAQA 1WNSA 1DLOA 4DU3A 3QESA 4I9QA 1LWEA 3TABA 3AVHA 1JLCA 4OPJA 1WN7A 1KFDA 2IC3A 4OLBA 3H8ZA 3NTHA 4BWMA 4BDYA 2R57A 4KHSA 1F21A 3F73A 3MEDA 1U4BA 3UIQA 3VQ8A 3O3FA 3LGFA 4CFAA 3AO3A 4OGEA 1WJRA 4AHCA 3OYAA 3DRRA 2F8SA 3LP1A 1NK5A 2B8AA 3VQ6A 1HYSA 3DLHA 2VG5A 2JLEA 3ZSVA 1KCFA 3OJSA 3U6FA 3L2VA 1J53A 3OYIA 3SUPA 1ZBLA 4CJQA 3OS2A 3OMCA 1BCOA 3QINA 4CJKA 3MP8A 5C24A 3D45A 4CJ5A 4CHOA 1IKYA 2LRQA 3RWUA 4B9SA 4OKEA 4ZTFA 3F70A 3PO5A 3HXMA 1JLGA 4FK0A 4ELUA 5HLFA 1G15A 1KFSA 1DTTA 3JSMA 4ELTA 2GUIA 1SL2A 1JL1A 2WONA 1WJSA 5CYMA 2HHSA 2VG6A 4DQSA 4B9UA 2RJFA 1NOYA 3NBPA 1HMVA 2EKOA 1OI1A 2HNYA 4DTNA 4KB0A 2QKKA 4PLLA 1NKCA 4Q5WA 2K3XA 3SUNA 3UWNA 3U3GA 2X78A 4GW6A 1UA0A 3KLEA 4BE2A 2HVHA 3SQ0A 2O4XA 4HUFA 3NTKA 2DFHA 4FK4A 3OJUA 3AVIA 3HP9A 4Q5VA 2OPSA 3TAPA 1RTIA 1TKTA 1JKHA 1WSHA 4HCZA 2M16A 1Y97A 2IAJA 1YTAA 4FJJA 4BACA 2GV9A 4WE1A 4IBNA 3FEOA 2A1RA 2HHXA 3K58A 4DFPA 3NGYA 1MHNA 1S1TA 1TKZA 2QK9A 4QCLA 3AVKA 4FJ9A 2KZZA 4FJMA 2IG0A 1S9GA 4W5QA 4NS5A 1REVA 1WAFA 3AVNA 1T7PA 4M3UA 3WNGA 3K5OA 4E19A 3QIOA 4B3OA 1J54A 1B9DA 3QERA 4C8MA 3EZ5A 2FC0A 1SKWA 2ZQBA 2HHVA 3RMAA 4PUOA 2HMIA 3B6PA 4NCAA 5KGWA 4L8RB 2X6NA 2A1SA 4N4HA 4XIUA 1KLMA 1UOCA 3MECA 2RI5A 1XHZA 1WSFA 3NGIA 4CGGA 3DMJA 1VSEA 1X9MA 4LD0A 1L3VA 1IH7A 2M0OA 3IRXA 1NJYA 4B9TA 1BCMA 4CJPA 4Z4GA 2OZSA 2E6MA 4CF8A 5KCOA 4LSLA 4RW8A 4CEFA 1VSDA 1UA1A 3MP6A 3V1RA 3QIPA 5J1EA 4CECA 4KTWA 1D5AA 3M8QA 5C25A 4N4GA 3MEGA 4FXDA 4MFBA 3V6DA 3V81A 2FBXA 3MO8A 4HCBA 2X6SA 1LWFA 4FJKA 4RW6A 1QTMA 1TL3A 3RR7A 4E3SA 3DB4A 4OVAA 4FZYA 2RHIA 3G10A 3B6OA 3I0SA 4DQIA 4J2EA 2KQ2A 2XRIA 1L3TA 4L59A 3KLHA 3ITHA 2KTQA 3H08A 4FJXA 3T19A 3VQPA 1B9FA 3NCIA 2G8KA 1BGXT 3ZSRA 4O0JA 4FJ7A 2R5MA 4HHTA 4DLEA 2HHUA 5FRNA 1RBUA 4PWDA 3OYBA 5HROA 2YKMA 2I5JA 5D3GA 2YHAA 3O4NA 5KCHA 2G8IA 1UWBA 3TAEA 1SL1A 2EHGA 4IUUA 3LAMA 4OVLA 1X9WA 1ZYQA 2RJCA 3MEVA 4CCHA 2MWOA 4CHNA 5CZ1A 3DLMA 4DTXA 4DTOA 3KKRA 2M1HA 1VK0A 3K2PA 3AA3A 4KKOA 4DSFA 1MU2A 3PX4A 5C42A 3NE6A 3CFOA 3AVLA 3SQ2A 2GBZA 4QW2A 1C1BA 4J2DA 1W0HA 1C0MA 2IS3A 4M3RA 3BDLA 4CHQA 2ZD1A 3V9SA 4ID1A 4IKFA 2BKDN 1T8EA 1X9SA 1K6YA 2XY8A 4F2SA 1ASVA 4KI4A 3AA4A 4Z0UA 2O4GA 4PLIA 3TAMA 2PQWA 3FLGA 2PZSA 4Z4IA 1BQNA 3V1QA 1RNHA 3VA0A 4KRFA 2OPRA 4CHYA 4CHPA 3P8HA 3OS0A 2CKKA 4DU1A 2XK0A 4M42A 3PFSA 2F8TA 4DTPA 1QSSA 3LP2A 4IDKA 4DTMA 3L2WA 2RO0A 3LZJA 2QKBA 1YT3A 1C0UA 3DLEA 1TAUA 1U45A 4FCYA 2KFZA 4FM0A 5D6WA 4FLTA 3NDKA 4CJWA 3SCXA 2G3RA 4HCCA 4IURA 3V4IA 3VN5A 4IFYA 4CK3A 4O44A 3E9FA 4G1QA 4AHSA 4DSJA 5D6YA 4M45A 5I3UA 4CIGA 4FLUA 2OPQA 3L42A 1W9HA 2X35A 3SQ4A 4QOZB 5J2MA 4DFMA 3OS1A 1JXBA 4KHYA 2P1JA 1ITGA 3VQCA 5IN1A 2G8WA 3ZCMA 2YHBA 1Z25A 4KREA 4A4HA 4II1A 3LPTA 3QETA 1OYXA 2EQJA 4CF2A 4N41A 1RBSA 1IG9A 4BD3A 2XY7A 4DG1A 2IGIA 1WSIA 4FJ8A 2Z1IA 4FVMA 4N56A 1IKXA 2L3RA 4DU4A 5EU7A 2NLUA 3OYGA 1RDBA 1NJZA 3LANA 4J2AA 1ZBUA 2Y1JA 2MWPA 3TWHA 2HHWA 1GOAA 4BWJA 3HVRA 1BIUA 4UC4A 3WNEA 1IO2A 4DTUA 3AA2A 1RDAA 1JLBA 1WSGA 5KRTA 3CM6A 5KI6A 2NUBA 2JGUA 3MEUA 1KSPA 1A5VA 3SUOA 5J2QA 2DFEA 2OPPA 4KFBA 3CFPA 3QEIA 3H6ZA 5KTQA 2BE2A 1VSIA 4N5SA 3VQAA 4K8ZA 1QS4A 4FLYA 5J39A 1RI0A 2BIVA 4IUTA 1GOBA 4Z4FA 3AVMA 3PX0A 3V9WA 1HQUA 4HUGA 3LLRA 2EFIA 3ZSOA 2RJDA 1S1WA 1A5XA 1RTHA 1LW2A 4CF0A 2VYTA 3SZ2A 1BI4A 1RT3A 3OYNA 2HQEA 3FFIA 4BE0A 4FJ5A 4B08A 3HVTA 3QEVA 5T7BA 4M3WA 4FZXC 2X4XA 3LP0A 4I9LA 3LZIA 4OLAA 2XDPA 3EY1A 1RT2A 5KE3A 4C8KA 3AVJA 4HTUA 4KV8A 2PY5A 1JLAA 2BDPA 2YNIA 4R5PA 4QQ6A 1TVRA 3NGZA 1L3SA 3HL8A 1R0AA 4CGHA 2LSNA 3DLBA 4CGJA 3NH1A 4NYNA 5HP1A 4YNQA 1H3ZA 3NAEA 2E6NA 1RT7A 3PV8A 4C5IA 1QSLA 3KTQA 3K5LA 2R5AA 3LX7A 1NK7A 1LAWA 4Q0BA 2JTFA 2E4LA 3HP6A 3OYFA 3PY8A 4ELVA 3LYIA 5M9OA 1NK6A 3OYKA 2WOMA 2LTOA 2E5QA 4FW1A 4W5RA 4RG2A 3IS9A 3VQEA 1HYVA 3SV4A 1KVCA 3RMBA 2B5JA 1CZBA 3KK2A 3AVBA 2X4WA 4E7HA 3V9UA 3SPZA 4CEQA 4B9XA 1WAJA 1VRTA 3ZEHA 1TL1A 3C6UA 3MXMA 4B9LA 4LH5A 1HNVA 1Q9YA 2PYJA 5J2PA 3HPHA 4CEZA 2EX3A 5SWMA 5JS1A 2Q3SA 3CEYA 3S3MA 3C94A 4AILC 2VWJA 3O3GA 4OGCA 3I0RA 2VWKA 1RBTA 3A2FA 2O4XB 3VQ7A 4F3OA 1TK8A 4DQRA 3ULDA 4MQ3A 3VA3A 3AVCA 4NZGA 4O5BA 3P83D 3MEAA 4FLWA 1NKBA 3QEXA 3L8BA 4E1MA 5FDLA 1HNIA 2O4IA 1HPZA 4KTZA 3OMGA 2DTUA 4M3YA 3HO1A 1TK5A 3PUFA 4FZZA 4DTRA 1N6QA 4B8CA 1S1XA 2YNFA 3CG7A 4CEEA 3KLFA 4FJGA 3NH0A 1Q9XA 2GFAA 1U49A 3DOKA 4LD6A 4CJUA 3SI6A 1FKPA 1S1UA 2WACA 5CYQA 4GVMA 2E6LA 1T05A 2EQUA 1L3UA 3C6TA 3TANA 1L5UA 3NF8A 4EZ9A 2D0BA 1S9EA 1S6QA 3ZT2A 4CESA 1YTUA 3SQ1A 4RW4A 4DS5A 1KTQA 1T03A 4GY5A 2RI3A 3HM9A 3TARA 2EQMA 1NK8A 1B92A 4KHWA 2P5OA 4EDUA 2XY6A 2FBTA 2HHTA 1QHTA 1CLQA 4FM1A 4B8AB 1NJWA 4CJFA 1TK0A 4CF1A 1UAXA 4CE9A 3C4SA 1C0TA 1JLEA 5K14A 4TSXA 4PA1A 4CJSA 4FW2A 4H4MA 1LWCA 3KK1A 2YRVA 1Z26A 2QXFA 3RRHA 4O4GA 1C1AA 1D8YA 4YFUA 1JLFA 3K5NA 1SSFA 3ZSXA 4JS4A 4FM2A 2Z1JA 4DSIA 4CERA 4IUPA 4PL6A 3U3YA 5DMRA 4BDZA 3S9HA 3DOLA 3M8PA 3DLKA 1N5YA 4E0DA 4N47A 2Z1GA 3NNQA 1JXEA 1CXUA 4CJ4A 3P8DA 4I2PA 4RG8A 3MAQA 4A4FA 4M3XA 5KE2A 2BGGA 4CJ3A 3RR8A 4O55A 2RF2A 2F5KA 5KH6A 4DF8A 1XWLA 3L2UA 4CJTA 3I8DA 2VG7A 2IOCA 4F3TA 3ALYA 3E01A 3EAEA 4CJLA 4E7KA 4B9MA 3SV3A 4W5NA 3BDPA 3AV9A 5E41A 1SL0A 1IKWA 5KRSA 1J9AA 3LAKA 4AH9A 1FKOA 1ASUA 1LV5A 1RTJA 3MP1A 1NOZA 1VSJA 4FLZA 3OYLA 1RT1A 1EX4A 2Y1IA 2DIQA 1CZ9A 3AO1A 4IUVA 1OZ3A 2GFUA 5JS2A 1JLQA 3QBYA 3SUQA 2KZMA 1RBRA 4B9VA 3KLIA 1KHCA 4M3ZA 2QQSA 3CYMA 1BISA 3NF6A 1LAVA 5HBMA 5KGXA 3TI0A 1RCHA 2BANA 2JZ2A 4QVZA 1BHLA 2LVMA 1EKEA 3V9ZA 3C95A 4FL6A 3HJFA 4CJEA 1SV5A 3RTVA 3HK2A 1VSLA 2D5RA 4W5TA 1TGOA 4A4GA 3OQ5A 2AJQA 3SNNA 3CM5A 2DY4A 2ITGA 3DI6A 5C0MA 3AVFA 3OYDA 2OZMA 3UT1A 4B9WA 4BDPA 4Z02A 1XHXA 3NH2A 2Z1HA 3ASKA 3ZSWA 1X1PA 1ZBFA 3RMDA 3NTIA 3BGRA 2IDOA 1RDCA 3HSTB 3T1AA 3IG1A 3AA5X 4CK1A 5HRRA 2R7YA 1S6PA 4M41A 4CEBA 4CFDA 4DTSA 2P0KA 3OYCA 1HRHA 4IG3A 2R58A 3P5JA 3SPYA 4F2RA 3NF9A 3L3UA 3DRPA 1KRPA 1BQMA 4DSEA 3LGLA 4K8XA 1O1WA 3QLHA 1EXQA 2HB5A 5FRMA 1RT6A 3S3NA 4C8LA 3FC3A 4ICLA 3ISNC 3GOXA 1RDDA 4DSLA 3QIIA 3HT3A 3QKJA 1NK4A 1RT5A 4DF4A 2G8VA 3OY9A 3RRGA 1KVBA 1U04A 2DAQA 3FDRA 4DFJA 4Z4CA 1EP4A 4QAGA 1EETA 4RW7A 3NHGA 3T3FA 1WJQA 1VSHA 1Q8IA 4F8RA 2DFFA 3AO5A 1SUQA 2FHDA 4AHRA 1N27A 2B4JA 3META 3DLRA 3DM2A 3KD5E 3KJVA 4Z4EA 1I3AA 3Q1JA 4UQGA 4JRQA 2QQRA 2ZE2A 5SZTA 3ZT1A 3KIOA 4KAZA 4OJRA 1XC9A 4C8OA 1XNIA 2K3YA 4FLVA 3ZT3A 1D9DA 4NYFA 2D0AA 4KO0A 3G0ZA 4IG0A 4EP4A 4HUEA 2XY5A 3AVGA 2YNHA 2X4YA 4IFVA 1BI4B 1QE1A 3DLGA 1CXQA 1KLNA 1NKEA 4CK2A 4EP5A 2KW4A 3ZT4A 4BE1A 4FJLA 4FJNA 3HPGA 2YNGA 1BIZA 1J5OA 3K5MA 4ID5A 4GMJB 3SYZA 1RBVA 4DSKA 3MEEA 4CFCA 3LP3A 4PY5A 2RKIA 2D9TA 2YKNA 1S5JA 4E1NA 3QNOA 3AVAA 4CFBA 5I42A 4DWIA 2RPIA 1VSFA 4FLXA 3O4QA 4CEAA 4CGIA 3EYZA 4KHNA 4CIFA 1KVAA 3DYAA 2L89A 4LH4A 1G5VA 4PQUA 3TAFA 3HYFA 3D0PA 2F96A 2HNZA 3F9KA 2B6AA 2HW3A 1YVUA 4FJIA 2FBVA 1RT4A 4JS5A 3P1GA 2RHXA 4DMNA 3L2QA 3QNNA 4DQQA 5CY4A 5CZ2A 2HNDA 4ZHRA 1TKXA 2G8FA 3PX6A 1VSKA 3LH0A 4CHZA 4CJVA 3QEWA 2ATQA 3ASMA 1C6VA 2RI2A 2XO7A 3V9XA 1RTDA 4KHQA 3THVA 4JLHA 3OYMA 4ZTJA 3MXIA 4KHUA 1SKSA 3QEPA 4KTQA 4H4OA 4LSNA 4X34A 4DTJA 5CIUA 1U47A 3NFAA 3VQDA 4DQPA 2RHUA 1HJRA 1DTQA 3AO4A 3LWMA 1ZBIA 2HVIA 4C8NA 1QQCA 1A5WA 1ASWA 4OPKA 4I2QA 3OYJA 2P51A 5HRPA 3TAGA 1OZ2A 3PNWC 4Z4HA 1HQEA 4AHUA 1JL2A 3O3HA 3ZSZA 3PMTA 3ZSYA 1RILA 2P5GA 2RJEA 3S6WA 4O0IA 2XHBA 4KPYA 4N76A 2G8UA 3MXJA 3LWLA 5HRSA 3RMCA 3OA6A 1D9FA 3KUFA 3ME9A 5HRNA 2LDMA 1TKDA 2OA8A 1WSJA 3AO2A 1S1VA 3OYEA 1QSYA 4CF9A 3S3OA 4J2BA 2RHYA 4C5EA 1WSEA
chains in the Genus database with same CATH superfamily
1W1FA 3V1OA 3R8EA 1MV3A 5BR9A 1WZOA 3M8RA 1G2BA 5GAOl 3M8SA 4LK0F 2LG4A 2RN2A 4Q48A 4FX0A 1VQON 4CGDA 5C6SA 2PAVA 4QQDA 1LEBA 3JB9J 5BPLA 1IKVA 1EIFA 1ZGAA 1S72T 1TT5B 4JRPA 2AO9A 5AN4A 2P9UB 1QQOA 1SKRA 1WLJA 4FU6A 4QVCA 2IEKA 3M7GA 4FM4B 5F64A 3EETA 3PMIA 4CCLA 4AHTA 4JKGA 5IT9O 2Y0SA 4FJHA 2DD4A 4V2GA 4LOCA 3ZT0A 4CEDA 5M5YJ 2OCEA 4F4KA 4G7ZF 4OKJA 2CH0A 2QK0A 2DERA 5GAHP 3VB2A 2XD0A 3VJPA 3T8TA 3I55I 3ECOA 3HTRA 1SMYF 2IVOA 4AYBA 2RN7A 2DU9A 1BL3A 2PFUA 3KLGA 2XB5A 4RCBA 3LDSA 2NVQJ 4KYWA 1IAWA 3CETA 4HVJA 2W42A 4HSRA 2XI9A 3K59A 5DLOA 2LCCA 1T0JA 4C5HA 2A68F 5AQXA 4I76A 4CUGA 4E7JA 1XG7A 3PE0A 3IAYA 3DWLE 3B6CA 1LKXA 3TAQA 4JI4K 4L0YB 2DJNA 4NCGA 4G7HF 2DXCA 3MHXA 4NCBA 1BC8C 3TSWA 3SAHA 2QVOA 2CV0A 1BI1A 4LB6B 3TBIA 5GAOr 2ATCB 4C92F 5CVJA 3UNGC 1I39A 1YJWT 4K2EA 2D0CA 3N4PA 4E7LA 4IOXA 1MNDA 3CCEQ 1M27C 1UHCA 4J7FA 3VGMA 1N32K 4YIIA 3SD4A 3REAB 4XN0A 2OAUA 4N4IA 2KAFA 5D6XA 5J26A 2XDBA 3JXUA 5CR4A 2KK4A 2NRWA 2OTJN 2F4IA 1IRGA 3TR8A 3HOZJ 3HBTA 2KHOA 3VYTB 1OX8A 2BY3A 1ATRA 2YX7A 1TAQA 4OIOF 4I9QA 3WT0A 3TABA 3AVHA 1K73C 4BQNA 2K02A 3BC8A 4A3CJ 2DL8A 1KFDA 2IC3A 2HI3A 2E2JJ 1WOQA 4ZYGA 3ZPLA 2R57A 1UHWA 3WXMB 2KJBA 3ZYYX 3UIQA 3VQ8A 5AIQA 3CUQB 1QVFS 4G12A 4CFAA 2EYYA 3S2DJ 3AO3A 4A5AA 3JCMb 3PTAA 2D2WA 1MD0A 3T1BA 4C0DC 4M7YA 4HXJA 1R4MB 1VYVA 2JOYA 4IPAA 3VPRA 4P1WA 2JMWA 3VQ6A 1HYSA 4WX9A 2W24A 1BR2A 2JLEA 1B07A 2JNGA 1ZR2A 5CKFA 1J53A 3OYIA 3DAWA 1XCBA 4CJQA 3OS2A 5FWBA 1BCOA 1HPMA 1K8KA 2E12A 4CJKA 1NGBA 1FMVA 1ZA2B 5C24A 1ZK8A 4JEPA 5BN8A 4AIKA 2ABLA 5TISC 1AWOA 1IKYA 1WI7A 2LOOA 4C3HJ 4OKEA 3F70A 3E6DA 3HXMA 3DXMB 2VOOA 2YUSA 5HLFA 2X3WD 1ZGJA 2DX1A 1NWKA 4CC2A 2P9NB 3CPWP 2UUBK 2ZPIB 2W6LA 2NS0A 4CC4B 4DQSA 4RTYA 2VJJA 1VQ8I 2DA3A 1NOYA 3D5LA 3UATA 4AG1C 1OPKA 1OI1A 2HNYA 2ASOA 4AM6A 3JCMV 3M1FA 3CJAA 4RAGA 4A59A 3SFIA 1NKCA 4CZMA 3FX3A 2ME6A 2K3XA 2GOXB 5LRRA 2E65A 3TOBA 2HOSA 3EO3A 2LT1A 4BY6C 3CQZJ 4XKBA 1PD0A 4UNOA 4HUFA 2P9LB 1OU8A 4FK4A 3HPWA 4Q5VA 2P7CB 3CCUI 3FZLA 1VQ9Q 1YFNA 4QT7A 2EJRA 1JT0A 4RM3A 4FJJA 5AQNA 4E6KG 2PFBA 3EGXA 1UJ8A 4IBNA 4KT0E 3E1YA 4N4OB 1V4SA 2FU4A 3JSCA 2HHXA 4DFPA 1TWHJ 1MMAA 3GF2A 3M0RA 3A02A 5FGMA 2LQKA 1YJ9T 1OKRA 4MO5A 3O1BA 4FJ9A 3PFIA 2KZZA 2IG0A 5IXFA 1S9GA 1SVLA 3CMEQ 2GLOA 1M2VA 4LC9B 3SJHA 4M75C 1HOMA 5JR3A 2XGEA 1UGPB 2ZGWA 3S2HJ 4EIKA 1MMNA 1E17A 4E19A 3G4ST 2FXUA 1B9DA 2M9UA 2UU9K 3GTQJ 4DV7K 1X75C 3OYYA 2ZQBA 3RMAA 1WHHA 3KP3A 5GJVB 2VJIA 3SWNB 2A1SA 5E3OA 2QM1A 2YXYA 1WSFA 2OJ2A 5DCMA 4B4CA 2GZWA 4R56A 1IH7A 1H88C 2M0OA 5GAN6 4L5JA 4Z4GA 2FPFA 1IREB 2E6MA 4J6WA 4HQMA 2XB0X 3MP6A 2HKOA 4G8XA 2J7IA 4FQGA 1NGJA 4EGZA 1F1ZA 3QIPA 5LHIA 2DT7B 1YITN 4Y3OA 3F8CA 5C25A 4FXDA 3GL1A 3FXMA 2KYBA 3C7NB 2FRHA 5KYYA 4JQFA 1LVAA 1XC5A 5J6XA 4HCBA 3GZ5A 3QZ9B 3DEWA 2E1OA 3WTYC 3Q7BA 2QENA 3HUGB 4M75D 3OW2M 4ON0A 3CMAA 2O8DA 2FSWA 3FXQA 4FZYA 4XM3A 2RHIA 3GTOJ 3CO7C 2H56A 4JI6K 4DQIA 2KQ2A 4L59A 5FLVA 4Z6YA 4B3AA 2VGMA 3H08A 2W41A 3PGGA 4XK4A 2MBFA 3NCIA 1I1SA 2YU3A 4DLEA 1BOAA 2HHUA 1G3TA 2DJZA 2I5JA 5D3GA 2RF0A 1ETOA 1R00A 3F8BA 4R0KA 3BUZB 3HC7A 2G8IA 3U2RA 2QEXT 2O2OA 3O1WA 3BT9A 1Q1HA 1X9WA 4MQ9F 5AQUA 1VQPA 4F9OA 2LKXA 1NLPC 4JLGA 2A3LA 2F5FA 5GAMd 1I0CA 2ZC2A 5LJ3e 1YI2N 1VK0A 3LSRA 3K2PA 1MU2A 1ABOA 4AM3A 1X3UA 3CCJA 3F8MA 1ZTRA 1C1BA 3A8HB 4BYYA 4OMZA 2JW4A 2WAFA 4XN3A 2IS3A 4M3RA 5CVRA 1MUZA 2ZD1A 4LN2A 2BHZA 1AD5A 1J75A 1KQ8A 3HEFA 1E3OC 3C65A 1JKPC 2QSGX 1K6YA 2QTDA 1XC3A 3CXCP 4KI4A 3SEZA 3J7ZI 3WTWC 2LNVA 3AA4A 4M75E 3CCMT 4PLIA 2O61A 2M34A 2PZSA 4Z4IA 5K5RA 2F5VA 3HOSA 2L2OA 3VA0A 4KRFA 4PGGA 3TTCA 2UXDK 1ZAOA 2O8CB 4LF4K 4U0VA 2TRTA 4ZN1A 2CS7A 4DU1A 2XK0A 4J00A 1QVUA 4DTPA 5M1QA 2X1DA 5EG0B 3LP2A 1FEXA 1CZAN 4N9IA 2NOLA 1IB8A 1TAUA 1U06A 5FFZA 4LFAK 2B86A 3CLQA 2PBIA 1LNXA 4HSBA 2BE5F 5D6WA 3H0FA 3JCMd 2VN2A 3JRAA 3SCXA 3L1PA 4IURA 2W84A 3THWB 5CO7A 4DZPA 4LFCK 4DSJA 5D6YA 1P8ZA 1BG3A 3JB9I 5I3UA 3VW4A 4KUDK 1Z9QA 1SG5A 4FLUA 2FPEA 1MWMA 3VEPA 1WGXA 1ZG1A 5C15A 3J7AP 4HX4A 1JHHA 3BJAA 3NRVA 3BJ6A 2H94A 3I4MJ 3VF4A 4XRMA 3GTGJ 1VQLA 4QOZB 4RTZA 3CUQA 2VQFK 4LF9K 3OS1A 3HXLA 3ZCMA 1PWTA 3HJEA 1U1TA 4A4HA 3WU2C 3CXCM 2FZGB 4D8KA 1OYXA 2EQJA 2MI6A 1PRMC 5F1XA 1IG9A 2OTLQ 5IH2A 3B73A 4CI6A 2BZTA 2Z1IA 3CERA 2JN6A 5GIPA 3E66A 4DU4A 1SD7A 4J9DA 5EU7A 2NLUA 2D1VA 1VQ6N 4J2AA 3T9NA 1NGFA 3TWHA 4XMYA 1GOAA 4LD9K 3LL7A 2KBTA 1IJJA 3DXMA 1BIUA 4A3KJ 5GMKe 4UC4A 2ZJRL 1TWBA 1K1ZA 2P9NA 1IO2A 4LXCA 5A0LA 4DTUA 3HFNA 4HV6A 3ULQB 2W00A 3BG6A 5H1SQ 5JICA 1WSGA 3AFHA 3QJYA 4JKDA 5EX5A 1JHFA 2DA2A 1IV6A 3MPUB 4HEA2 1N6AA 4X9CA 3CCEI 3MEUA 3THKA 3G25A 1KSPA 3M9AA 1BM9A 1X2QA 5HS9A 1Z6TA 5HK3A 4KFBA 2KXCA 2R7DA 1MWKA 3G1MA 4OAYA 3DKYA 1B72B 2ZCWA 3CWTA 4RB3C 3I0XA 3ESWB 3S8PA 1W7PD 1QS4A 2KDOA 1R5HA 2WA0A 8AT1B 2BIVA 2CSQA 5FD5A 3L2CA 1GOBA 4Z4FA 5LJ3h 3AVMA 3UKRB 4L5IA 5FU7C 1HSTA 1NK3P 2L3SA 1OMIA 1HQUA 5IHKA 3CCLI 3HSCA 1LPLA 3ZL7C 2HKXA 1BR4A 1I8FA 3BDUA 2EBIA 2YHXA 3TTDA 1D5YA 3E97A 3CC2N 1UTIA 3EH1A 3LDOA 4HT9A 1RT3A 1TS9A 2R7WA 1WHLA 3O3KA 2ZGYA 2BVMA 5T7BA 4CBUA 1FY7A 1XTAA 2H3GX 3IH3A 3CMYA 1K83J 3COAC 4M7AF 4FSSA 1G3WA 2CYYA 5ERIA 1R7JA 1GVDA 1RT2A 2W10A 3QOPA 5KE3A 4JZ3A 2VASA 4HTUA 4KV8A 1Q81U 1O7FA 2QXLA 5IPAA 1YP5A 3NARA 1SEMA 2LR8A 2JPSA 3QZ5B 4R5PA 2DZCA 3LSHA 4JX4A 3SWNA 2EA2A 5CAIA 5J3LA 1TVRA 3M4YA 1M3QA 3CJCA 4CZJA 2M02A 4CZEA 3QYHB 1X19A 3NH1A 3X25B 1QPIA 2M9HA 3VEOA 3PV8A 4PFPA 3FFKB 1QSLA 4V19S 1MH3A 2MK5A 1HSJA 1XDSA 2DBBA 3K5LA 5D5UB 3C7NA 2X6YA 2KZGA 2K7AA 1Z05A 3G6EA 5LGUA 5IYBJ 5HDKA 3VTIA 2O8XA 2FNPA 3PY8A 4ELVA 2Y0SN 5M9OA 3HUGA 2JJ9A 1R71A 4M6VA 4ZYDA 3W6VA 3IWFA 4WWCA 5CVVA 3JSOA 1VQMQ 2M7BA 4IQ4A 1VQ9I 2LQNA 4CCOA 2ED0A 1BJZA 5J1RA 4XTZA 3VERA 1N77A 3VS2A 1UHFA 4HWIA 4WF9L 3J80Z 3HBLA 2R93J 4HW0A 5DUIA 4DZJA 4PL7A 2HL3A 1VRTA 3ZEHA 4B44A 3WGIA 4M78F 1HD3A 1NLVA 2IIMA 4XTWA 1FOKA 2PYJA 5J2PA 3I5SA 4C2UA 4CEZA 2KFDA 2Q3SA 2ZKZA 3P39A 2I7NA 1SD5A 3O3GA 4YHHK 3CMEI 3PIPL 1NPRA 2DD5A 4D9JA 1HK9A 3O6WA 2MC4A 5E1ZB 1Z21A 3BTIA 3VQ7A 4JK8A 4DQRA 3ULDA 5HS7A 3AVCA 1YIJN 2VC0A 4O5BA 1Z3XA 3L8BA 1ABQA 2BH1A 3FKIJ 2PNIA 3VS5A 1RUWA 1HNIA 3JRFA 1ZBSA 4KJZA 4XTXA 4OAZA 3V7SA 4IQJA 2CQNA 4C92C 3CJ9A 3HO1A 3PUFA 4DTRA 1OJLA 4PJOB 4B8CA 3S32A 1S1XA 4OX9K 4OPAA 3S17J 3LWIA 1QVFM 4UNFA 2VWBA 2FZKB 4A3FJ 3LDPA 1NJIO 4FJGA 1JUPA 3KYLA 1ERDA 4B9QA 4JZ4A 3H9JA 1S1UA 2PN6A 2E36A 4GVMA 5M1NA 1T05A 2EQUA 1L3UA 5LHHA 1B59A 4JLIA 5J1UA 3TANA 4OFHA 3A98A 3HOYJ 5CYVA 4JKCA 3SWNC 3NF8A 1OV3A 4F17A 3BY5A 2D0BA 1S9EA 3ZMVA 2A61A 2O8CA 4XLHA 1FT9A 3OH9A 2EV6A 3RUXA 4A63B 4GNIA 2JA7J 4EMKB 3DXKB 3KZBA 3M5RA 1OH5A 3Q9VA 1BA0A 5EG0A 3RVCA 2EQRA 4B24A 1RL2A 4AI5A 2E35A 3JS6A 3GO5A 2CGJA 1B92A 3ZFJA 2W85A 4PHTX 3KP2A 1NG7A 2FBTA 1XS9A 2HHTA 3E9LA 1CLQA 1AEYA 1F36A 4C92D 2DOAA 1YJNA 1N8RR 4M7DB 1HW5A 3THWA 1W2BP 1FIAA 4MTEA 5DDGA 3MMVA 3C4SA 5A2QE 1JLEA 1OFCX 4CZGA 2KIQA 2Y4YA 3CDHA 4FW2A 3CCQN 4OWRB 2BBYA 5AQPA 4D0PA 4I7HA 1MKMA 1TYQA 3C6HA 1S3JA 5IP7J 3J7AY 4JBAA 1KSWA 1M3HA 1SSFA 5AQMA 1KD1C 2Z1JA 1OCZH 4F14A 4BDZA 3S9HA 1IF1A 5FLXO 1GVJA 1UG0A 2VUBA 4N47A 3N5NX 3KHYA 4W97A 2KQWA 5KAIC 2QQAA 2HZTA 4B47A 4A4FA 3WTTC 4I98B 4O55A 2RF2A 2DK3A 1U5SA 3INZA 5LJ3f 3VOEA 4WCIA 3J7AF 2NNYA 3I8DA 1WIEA 2VG7A 4A93J 2XPWA 2VXZA 3ALYA 2YHTA 3NPFA 1PHTA 4CJLA 3R0AA 4W5NA 4B9MA 3P31A 1MUNA 2ZJPF 2ZNYA 2V1DA 2OU2A 3QMLA 1WFXA 5IT9K 3WTZA 2CO5A 4BRNA 2VE9A 4FWNA 1ETKA 2FZCB 1RTJA 3CC7T 2W0ZA 4MDXA 4C92E 4MLOA 1QA6A 2UXXA 2YX4A 4KH5A 4A2UA 1V3FA 1TUUA 1BW6A 3OYLA 3BY7A 2ADUA 2Y1IA 5KQ8A 3M6GA 1AU7A 2ZFUA 2X3XD 4J9GA 1VQKN 3Q5FA 4K43A 4IUVA 5JS2A 2DPUA 1G6NA 4A4KA 3CJNA 2DA1A 2X85A 4BAYA 2KZMA 3RNJA 1RBRA 1NZ9A 1QVGS 2E10A 1QKXA 3AG2H 2IVMA 5C2FA 3TDZC 2QQSA 5AZIA 1BIAA 3CYMA 1NG6A 2Z9OA 3TI0A 3UKRA 3MN9A 4CICA 4FETA 3CD6A 3FJ5A 4BHPA 4OMQA 3N0UA 3V9ZA 3LA3A 3LSGA 3V8JA 4PJJA 3PVQA 1Y96B 2HTSA 2K4JA 1X1BA 3GBQA 4FWLA 1SV5A 3HK2A 3K1PA 3VETA 2D5RA 4W5TA 2Z99A 3FZMA 3SXYA 2XAQA 1VQOT 2R92J 2HQHA 2WC2A 5LJ5d 2DY4A 2MG4A 3S16J 3L1AA 2HMAA 3SAFA 3OYDA 1PU6A 4BHCA 4F52A 2DA7A 2YUNA 1P7MA 3QHSA 4B9WA 4BDPA 2OTLI 1PKTA 1K8AO 1QPMA 2DYRH 3WGGA 2DOEA 4Z02A 3NH2A 2A28A 5K5OA 3S6IA 3ASKA 3DKXA 3ZSWA 1X1PA 1OVQA 3G2BA 5ELZA 3BGRA 2M51A 5GAN5 3T1AA 2K79A 2HHHK 1RIOH 2KRFA 1LJ9A 2XUBA 1VQ5A 1XX5A 3BR6A 1KAYA 4M41A 1RETA 3ER0A 1WJBA 2NRVA 1K76A 2P0KA 2JHJA 4IG3A 1WYXA 4ME7A 5CKBA 2DFUA 3ZQIA 4PIIA 2F2EA 1EH7A 1QQIA 3F6VA 4E9HA 1JEGA 3CMAQ 5KPTA 1HQCA 5IOYA 3L3UA 1KRPA 1LWVA 1VQPN 4KH0B 2A5WA 4WFAL 3JV3A 4K8XA 5J8FA 3G71A 2CH4W 1T2KA 4FYWB 2IVPA 1Y39A 2HB5A 3RMSA 5FRMA 4ICLA 2GA2A 3CJBA 1NJIC 4BVPA 1ON1A 4PJMA 1NK4A 2D4WA 3FHFA 3I5UA 4CBWA 4IEJA 1KVBA 5E17F 1Z77A 1RFQA 1R1VA 1XB4A 3TOAA 3VYGA 2OTJT 4QAGA 1Q86R 1EETA 4RW7A 5JLWA 1P2FA 4M3GA 2DFFA 5GANg 1GXPA 3K70D 2L0AA 2DTIA 4H0OA 3BY6A 3I55A 3ZRGA 3CCJQ 3KWGA 4AHRA 2BW3B 4GFBA 2WAEA 1T3LA 3C2BA 3PM1A 3HSEA 2A3SA 1N27A 4C8QB 2B4JA 2JMCA 1BI2A 5ED4A 2V8KA 4D7MA 3OSFA 1U8BA 2FF4A 2QTXA 3LMMA 2L7FP 2QQRA 2ZE2A 2H8WA 2UXCK 4C8OA 2DE0X 1JCEA 3GPLA 1D9DA 4NYFA 3CBOA 3L0QA 1ZXOA 2W6KA 4HUEA 4FVUA 4PJOA 1JXSA 1IZ6A 1BN5A 3AVGA 3UKGA 3PQKA 5GAGP 1HX1A 1BI4B 1SHFA 3DPTA 4Y4RA 1QE1A 4MZPA 3DKMA 3CCVA 1NKEA 2P6SA 4ATOA 4EP5A 2WY8Q 4WQ5A 4FJNA 4RBOA 4OMMA 1D3BA 1VQLN 4C1NK 2V7FA 5FPDA 2M45A 1YS6A 4GMJB 2HBPA 1FOWA 1RBVA 3IRQA 4DSKA 1VQ4Q 4M7AA 4U67L 2D9TA 2YKNA 4KITB 1UUEA 5GAOp 1BU6O 3QWLA 3HI0A 1BO5O 4EMKA 2Z3YA 2F4VK 2BTTA 5I42A 3ZMDA 1VQMI 4CGIA 2DAOA 3EYZA 2ZNZA 4IOCF 4KHNA 2O9LA 4IVNA 3OW2A 2IGMA 3OOUA 5KHDA 4O3MA 4JKHA 1G5VA 4GYGA 3MKDA 1QZEA 2F96A 1O3QA 2K5CA 2HNZA 3F9KA 1PSFA 2B6AA 3ZEUB 3THYA 4B6MA 5GAEJ 4M7DA 3KYCB 3K9KA 5EVZA 5AFUA 2HW3A 2FBVA 3FZKA 2ZB9A 1RT4A 2FBIA 2YUQA 4RLFA 4JI3K 4R1HA 2RHXA 4DMNA 1K9MR 4II3A 4JAXA 4Q5SF 3QNNA 5CK9A 4H5NA 1JE8A 4RLQA 1TP4A 2NUPB 3IUOA 1DQUA 5FKOA 1IXCA 2HBWA 1KA8A 4D6WA 1E4GT 1LCUA 1Y1WJ 3SDBA 1VQ8A 1ODDA 1M90O 4ABZA 2RNGA 1NMNA 3H1CA 3R2XC 1OEBA 3V9XA 1RTDA 3THVA 3FXKA 3ASNH 4GRIA 4DKWA 3EE9A 2QA4N 3LQQA 1SKSA 3ZQQA 1AVZC 4A3LJ 3CCRA 3OV8A 2A6EF 4WXDA 4H4OA 4JKAA 4YOTA 1SS6A 4X34A 4DTJA 1KHIA 1U47A 3VQDA 3KVGA 4DQPA 4M77G 5EG2A 2GAUA 1X9JA 4M78A 3K4NA 2J05A 3CCSI 1HLUA 1QLYA 3VRZA 1H8AC 1QQCA 1GLNA 3EG3A 3HZJA 1ASWA 2MW8A 4MTDA 3WTVC 2ACJA 4ZZDA 1JJ2P 4ISEA 5HLIA 2P51A 5HRPA 4PJOC 5LL6Z 4QKUA 3OTOK 2AXLA 4Q4ZF 3SMSA 3ERMA 1LFUP 4AHUA 4Z4HA 2WB1A 1UFMA 4I09A 3ZSYA 1BIBA 1YITT 1KQSS 4WQ5C 3S6WA 2A42A 4N76A 2G8UA 3LWLA 5HLGA 5HRSA 2KYMA 4PJOG 4BY7J 1O57A 4Y15A 5GADP 3BJOA 3UA6A 5HRNA 4HDUA 2E8AA 2FSJA 4KT6A 5DD8A 4J7IA 4PFOA 4EM2A 1GLJO 3OYEA 4M7AC 1UG2A 3S3OA 4O6JA 2D5VA 2JS0A 3SBGA 3IH7A 4J2BA 1MMGA 1OYIA 3GE1A 2QDYB 3SZTA 4EMKC 1OPLA 1POGA 4KBOA 2D0OA 3M9QA 4XKWA 1GBQA 3WNHA 3E5UA 1YW8A 1X1CA 4QQGA 3WU1B 3HSBA 1EWRA 4XH1A 1Y96A 4KN7X 3J7ZO 2V4JC 3TO9A 5JI6A 4XK8E 2OI3A 1Y0NA 1U78A 5LEJA 2YJEA 1J2XA 2KVQG 1M3CA 4HLYA 2UZKA 1O3SA 2MMPA 1KEAA 1M5Q1 5IT9E 2F69A 1E7OA 4D7NA 4FOEA 3VQBA 1GRIA 1M9SA 2VBWA 2L54A 3F0CA 4E9EA 1B8IB 1U48A 4CDGA 2ZJ2A 1FXXA 1WXUA 1F9NA 3ECHA 3ZXSA 1VHXA 2AS5F 4MGRA 2ZAEA 4FPAA 4E9FA 1YI2T 3HKZA 4M7DG 5LL6S 3OVNA 4E89A 4IUQA 2DLLA 3QJ6A 2FBYA 4ZYEA 2DIGA 3UF4A 4ESBA 3VQQA 3AKZA 2X74A 2EH3A 4KI6A 4H0TB 2JUCA 4I6MB 1JGSA 1HYZA 3LSIA 1APLC 4IEIA 1ZSZB 3H9QA 4AU7A 2H6BA 3P9KA 4PCQA 2Z33A 2YG9A 4ANJA 3G6EQ 2OJED 4FYDA 3SJJA 5DY9A 3FMQA 1U0JA 3PO4A 3E9GA 3H3NO 1RR7A 4XLAA 3VQ9A 3DLLL 1NK0A 1T8IA 3VYUB 3UDCA 4FHTA 3BROA 4A4EA 3MEWA 4M78C 1U2VB 2ZXWH 5DK5A 2HKQB 1LW0A 2D45A 2LBFB 1NJXA 3VQ4A 1Q82O 5AQFA 3CF5F 4HOBA 3ZP5A 4F7UB 2JQ7A 4DOZA 1EF4A 4F3QA 3K4KA 2XIGA 4RS8A 1T95A 1BWFO 4M77F 3I53A 4BQZA 4JI7K 4IEEA 3EFOB 2ETJA 1ZELA 3OYHA 2ZGZA 4N9HA 1TXQA 2DXBA 3KEQA 1DLOA 4DU3A 1VIEA 4CZFA 5GANh 2ID3A 1R77A 5ECAA 4GV9A 2HZYA 4OLBA 3H8ZA 3CJTB 4PK4A 5CLSA 3R1XA 3FIFA 1WXTA 3NHNA 2XSJC 3A8GB 2FNAA 1HKTA 3MEDA 1MJBA 2X1CA 3KP6A 2OAWA 1ORNA 2DCEA 5IY5H 2N8GA 4NQWB 1ZYRF 1QZZA 4C8QA 4IO8A 2A05A 1RACB 1XJWB 2V1XA 1KQJA 1SRMA 3LP1A 4DR2K 1NK5A 3IRRA 2B8AA 3U9ZA 5C10A 3DLHA 4B48A 4DA4A 2ESHA 1YX5A 1XD7A 3OJSA 3N4MA 4DV3K 1YN8A 1YXQA 5AQTA 2VVKA 3OMCA 3OBYA 5C12A 3QINA 2DLPA 5DPKA 1IXRC 1YJNN 5L8RE 1QCNA 3LA7A 3HG9A 2P5VA 3D1NI 4A53A 2IGNA 3EFSA 5DD4A 2CP6A 2DYBA 4ZTFA 2LC2A 2RPNA 3ZGKA 1JLGA 2KKOA 2X6XA 1VQ6T 2RNAA 1QQMA 2F9TA 4C2MJ 2K3PA 3RDIA 4XONA 4ELTA 1SL2A 2VKVA 3CMAI 1JL1A 1J3TA 3CMMA 3HRTA 3VF6A 4B9UA 3M57A 1V76A 6AT1B 1HMVA 3KP5A 2EKOA 4HT8A 5C4XJ 3BTJA 2P4TA 3HL2A 2PI0A 3CJ7A 2HNHA 2OAZA 5DCFA 3WG9A 2QKKA 2A40A 2HOEA 2IXSA 5FU6B 2PVOB 1CKAA 4OB1B 1ZREA 3SUNA 3UWNA 3RKXA 1SD4A 2JA2A 3U3GA 4MEYF 1H9TA 3VEYA 4ESRA 4BE2A 4BRDA 5E8GA 5F08A 3NTKA 4C23A 2M0CA 2IA2A 5L3BA 3TAPA 1JKHA 3I56I 3D7SB 4FWSA 1GHCA 3MWTA 1Y97A 2IAJA 2AHQA 4N0BA 2NOIA 1QWEA 1YTAA 2EIKH 1LUJB 3ZEUA 1XN7A 3AAPA 3GYHX 4A3GJ 1U8RA 2GV9A 4WE1A 2NRAC 4C30A 2A1RA 1IGUA 1XUPO 1S22A 3BF1A 3CCJI 4DK9A 3NGYA 3WVEB 5B3SH 4KMUX 1JCFA 4BG9A 5E18F 2YRDA 1QVGM 2EIJH 2NUPA 3CC2T 5DUKA 2FQ4A 2GQQA 1KZHA 4NS5A 4BR5A 1WAFA 5L3FA 3GDQA 2JPBA 2VXEA 3AVNA 3Q0WA 3SJMA 1KO9A 3WNGA 3MVPA 1QU3A 3A0BC 1M1GA 1TUGB 1J54A 2M0YA 5ICEA 1PG5B 5AQIA 3HIFA 1U9NA 4B1WB 2ISZA 2FC0A 1SKWA 1YX3A 4J5YA 3B6PA 3BP8A 1FP2A 1X6BA 4NCAA 2XF6A 5GAOm 3IHUA 4XSZF 1FLIA 4L8RB 4C8QC 2DT5A 2X6NA 4N4HA 4XIUA 1UOCA 3MECA 1XHZA 5GAOn 2F2XA 3E6BA 3ZQHA 4CGGA 1T6DA 3U8XA 1K7AA 3DMJA 1LDJA 2DZ9A 1X9MA 1GCQC 1FZPB 3A2KA 4LD0A 4BKXA 4X64K 3WG7H 1QVFA 2Z16A 1IRFA 1AWCA 4CEFA 3TPQA 2GXGA 4C8QG 2PTKA 1VQ7Q 2EPDA 3KP4A 2CGHA 1VQ4I 4Y92A 3BDDA 3HHGA 1ESVA 3CCLA 4C2TA 2FEIA 3MEGA 2I2LA 4MFBA 3PO3J 2HSPA 4MDBA 2IS6A 5FFXA 1GLAG 2DODA 2FBXA 3MO8A 1Z91A 1XMXA 4PDKA 4Z88A 4G7OF 3C1DA 1LWFA 2A6TA 1ZLKA 4FJKA 4RW6A 1QTMA 1TL3A 1NJIU 3RR7A 2KSSA 3CD6Q 4E3SA 4D8DA 3DB4A 4DBHA 4XKVA 1QCFA 1S7OA 1P92A 1TUCA 1LE8A 4J2EA 2COMA 4J19A 4L5EA 2DW4A 3H3ZA 5M5WJ 4DIQA 3VQPA 5IT9Z 1B9FA 2EFNA 4E7ZA 3OSSC 1AKHB 1XCVA 4HHTA 1XDUA 3JB9G 2ZPBB 5FRNA 1OX9A 2QWPA 4PWDA 5HROA 3T8RA 2YKMA 1VQNN 1N36K 4H5VA 4CW7B 2ZXHA 2PJRA 3TP0A 1UWBA 1YHQQ 2EHGA 2VXDA 3LAMA 3JRIA 2MH9A 1RUOA 4J9FA 4OVLA 4G6TB 3G7ZA 3M1EA 1Y57A 1YJ9A 1ZYQA 1DU6A 4ORZA 2I7PA 2R4GA 4LDYA 3L2ZA 4EW0A 1H641 3L6QA 2FVUA 4CHNA 4DTOA 2DJIA 1W0UA 2M1HA 1CGPA 4G6QA 3QUIA 2XAHA 1VQ5Q 3T5XA 4KKOA 4PNOA 4DSFA 3E7LA 2Q97A 2LZ6B 5GAMg 3AVLA 3SQ2A 4JP0A 1YIJT 2GBZA 1N3CA 5AQGA 1MIJA 1N9RA 2L9VA 1C0MA 3N5BB 2QBYB 4K42A 2O8KA 2QDLA 1Q1VA 2L9NA 1IBMK 4UUSB 2BY1A 4ID1A 1OQYA 4IKFA 4XH5A 2V79A 2PG4A 2LLKA 5IP6A 3G71Q 3KEOA 5GANf 1QCOA 4OMOA 4HQEA 1X9SA 4JV5K 4EW4A 1KXPA 4F2SA 1M1FA 2KRCA 1ZSZA 5KCMA 2B0LA 4ZGDB 3I55N 5BQTA 2V75A 2O01E 2O4GA 2CJJA 2HQNA 3FLGA 1BQNA 5FLXK 4B3XA 3I71A 2JUFA 3A8OB 2E1ZA 2E64A 2OPRA 4CHPA 3LSKA 4IHYA 2CKKA 4M42A 3PFSA 1UHMA 3H3VK 1U2VA 2XAUA 5CR2A 3A01B 3RESA 1NPPA 1DPUA 4MDAA 5GANj 4IDKA 1MH4A 3LA2A 3LZJA 5AQZA 2LBFA 1J7KA 2E60A 1TWFJ 3CMEA 1C0UA 1BI3A 2ZXIA 3DLEA 5TJJA 1RDUA 3S1QJ 1JB0E 1KC8O 2KNBB 4NXNK 3CJRB 4IHSA 4FM0A 3JCMQ 4CCNA 3Q9SA 3M8JA 3WXJA 2G3RA 3M0TA 3V4IA 3JCMg 3JCMJ 4I02A 1E0EA 4CK3A 1I6HJ 4O44A 1NGDA 4NO7A 2FX0A 4JKFA 1LMZA 4AFUC 3E9PA 2H3JA 1ITYA 1NYGA 1NHAA 3ATVA 1SEUA 4OO1J 1NLOC 2X6OA 2KIMA 4ILGB 1YIOA 2P0QA 2DTZA 2HDCA 4OIQF 3CCQT 4HNVA 3VS0A 4CI0C 4HVUA 1G99A 1UE9A 1JXBA 3OL3A 1I3QJ 1YYVA 4E4HA 2P1JA 3VQCA 2LX9A 1SKUB 3RCOA 4Y52J 4WTOB 4CVNE 4II1A 2NRHA 3LPTA 3CCVQ 2V8IA 3U1KA 4NDLA 2DMTA 2R5YB 3MKWB 4DJAA 4DG1A 3H3UA 4C0DB 3D6RA 1WSIA 5IT3A 3BR2A 2L3RA 3CPWS 1PD1A 4WCEL 5DM7R 2XF7A 1T39A 1I81A 4BXFA 2RQVA 3G6EI 1ZX6A 1FTTA 3HVRA 2KIFA 4I0BA 3BOQA 3VEZA 5EEGA 1W36C 2EZHA 3VEWA 1NH3A 3WNEA 2DXTA 4NL3A 4EFHA 5DLQE 2D0QB 2L02A 5IWAK 2ZZDA 1K8AU 3AA2A 1RDAA 3MAJA 4YOQA 4IJNA 3CCMA 4EA5A 5KRTA 5KI6A 4JKGB 2YDLA 3O80A 1VQ8N 5GMKl 5E1XA 1IZ1A 4BQOA 3DTKA 2H3EB 1NM7A 2EILH 4J83A 3HRSA 4BQAA 3X28B 4CJ7A 2K5LA 1Z7LA 2Z0WA 2IVWA 3M58A 3CFPA 2ECCA 3JAMO 1FSHA 4BGAA 1WUAA 3BCAA 1VSIA 3JRCA 3VQAA 1VQKT 3ZBDA 5JVHL 1VNDA 1N25A 2G6FX 4A57A 2OCCH 4F7ZA 4Z94A 3IWZA 4CO8A 1X43A 2E88A 3CCYA 1P7IA 2VT3A 1OH8A 4BY6B 1RGIA 3V9WA 3CCUN 5F6FA 1S5LC 5DM6F 1XMKA 3L09A 2E2HJ 3LLRA 1KQSM 2EFIA 3BR1A 2VQHA 4HZFA 4BXXJ 3ZSOA 5B1BH 1TH7A 4BU2A 1DT9A 1T0FA 1S1WA 1HNWK 2CV1A 3GMEA 2JT1A 4LLGF 5CQGA 4AVZA 3FFIA 2VKDA 3C2HA 3RQIA 3BG9A 1NK2P 4RGRA 1M1KR 3M59A 3CCRQ 2R7ZJ 3QYBA 3IDHA 5GTHC 4Y0WA 3U23A 2PLYA 1NG2A 3HOUJ 4F7UG 3GX4X 3LZIA 2GM4A 2CYZB 5M3MJ 4LF7K 1I1GA 2P9PA 4A6DA 3ZQ7A 1YAGA 4WQ4C 3HM5A 2P7VB 4M6YA 2BOLA 2ABKA 4RA2A 4M75B 2YNIA 1DEJA 1XMQK 3DBHB 4QQ6A 2KJCA 1UGRB 3CJ1A 3IKTA 2RVCA 1N8RC 4CGZA 4CH7A 3DWLA 1Q81R 4RCCA 3GCMA 4LG0B 4H0YB 3ZX2A 4M9SA 2Y9ZA 2G7HA 3W2WA 4NYNA 5HP1A 1IBLK 5ILUA 2AXTC 2V8JA 5LJ3d 3E5XA 3VRYA 3E5QA 4C5IA 2E1NA 3QXEB 3LX7A 3TSUA 3ABKH 3G3ZA 5AQJA 1NK7A 4M9XA 5AIPA 5JHUA 2HBKA 1RDWX 2WAQN 1SFXA 2QSHX 3OH6A 4KNYA 4Q0BA 3EDPA 1K8KB 1VQPT 2EWSA 4YFKF 4P9FA 2E1YA 3OYFA 1I5OB 3P38A 3L4IA 3LYIA 2J5OA 3OYKA 3WVDB 3HKZN 3O5BA 3G1LA 2E5QA 4FW1A 4W5RA 3VQEA 3CVSA 3IKMA 4BI4A 5BPMA 2CP2A 5HK0A 3CC4Q 3AY9A 2X4WA 4E7HA 4II2A 3O8MA 3SPZA 4EA4A 3HGGA 3O08A 1CKBA 4CEQA 5F1JA 3U9DA 2ITMA 1ETXA 1WHJA 3ZMTA 3VV0A 5CE3A 2MIOA 1K73O 1K4SA 1HJOA 3C6UA 4UB8C 2P5KA 3PIOA 1HNVA 2O9SA 2GELA 3HPHA 3WHCA 1MBEA 1P4XA 2EYXA 3S3MA 1SQKA 1P59A 3A03A 2JWLA 4D1QA 2VWKA 4AWXB 1RBTA 3A2FA 4F3OA 3TSZA 5TKYA 4BEHA 5GAMh 5TRDA 5DEQA 2BE7D 2RHKA 2RQTA 1NKBA 9ANTA 1T0FC 5KYNA 2RQUA 4E1MA 5FDLA 3R6OA 1HKBA 2KT1A 1XSDA 2RDPA 2O4IA 2EKHA 2QWQA 4A5NA 3HKSA 1U6GA 1HPZA 4UUVA 4AIHA 1WWXA 2GWRA 3UKUA 2RB6A 3BE3A 3C18A 3CXCS 1TK5A 3TQNA 2ME0A 2DI3A 4LF6K 2Q2EA 2QBYA 4BH9A 2KI7A 4FSXA 4CEEA 5F0XA 3KLFA 4BRGA 2LY2A 1Q9XA 5CCAA 2V7ZA 3SK3A 2COWA 4HV5A 1RKWA 4KIGA 4GV6A 4B1RA 1Y71A 1VQ7I 5CYQA 5C44J 1M90U 3D0SA 1MDMA 1M2VB 3A5LC 3NWTA 1MGTA 3C6TA 2ZCFB 4FWKA 4DR3K 3LSPA 2NRTA 1YW9A 1JRIA 5KYXB 4OB0B 1VQLT 4ILHA 2FSKA 3T7ZA 1RAGB 4BC2A 4BRFA 4JD2A 2F6CA 4RW4A 2DT6A 4JI0K 2CMPA 1KTQA 4LDWA 3QDFA 3CD6I 1B6AA 2EWNA 3A01A 5BS6A 4OIPF 1X3MA 2IS4A 2EPFA 1IV0A 1RADB 3GUDA 3GVAA 4GY5A 3WTUC 3LL3A 4LFBK 4HCKA 4P5NA 3H5NA 5DCMB 2EQMA 3SFMA 3T1YK 2DA6A 1TUYA 4KHWA 3JCMh 3MN2A 2P5OA 2E5NA 3H45C 2XY6A 4UOBA 2DMUA 2NRRA 5F27A 3MQ0A 3D7EO 4N0AC 1RRSA 4QS7A 3FHNA 3PNYA 3MKZA 3LSTA 2MAMA 3LDNA 1A35A 4CJFA 3J80K 4BY9C 2AA4A 1C0TA 3C7JA 5KYYB 2YJFA 5K14A 3I54A 1S72Q 4PA1A 1YHQI 4CJSA 5HNHA 4M77D 1LWCA 1Z26A 1F1BB 1WDXA 3FF5A 1D8YA 4YFUA 3WE3A 3I8BA 2DN0A 4M4ZA 4G6DA 5FLXE 1BI0A 3GBGA 2NOEA 1IN7A 1VQ5I 3ZX3A 1Z3YA 3CQXA 4LITA 1XTDA 3WUHA 1Z9CA 3DOLA 2UXBK 2EFWA 4GYIA 5F1RA 2ZWHA 3DLKA 1N5YA 4U87A 4E0DA 3SFZA 2VONA 2GX9A 1YQMA 3HFOA 2Z1GA 1JXEA 2R5YA 3P8DA 4I2PA 3CLOA 1FYKA 4RG8A 2JWKA 3MAQA 5KE2A 3VU3C 2MPXC 3G71I 2BGGA 2QA4T 1VQMA 2MGQA 4ENMA 1GCPA 1W7PB 2LMDA 2WWYA 3NVMA 1EWQA 2GTDA 2WUSA 1KYWA 1Q86C 4CJTA 2IOCA 1OH7A 1AA7A 4AMCA 5LHGA 3PT9A 1E6GA 3ISPA 1KG1A 2VIXA 4E7KA 5BRHA 2HVSA 2COYA 5HDNA 5E41A 1SL0A 5KRSA 1YJWQ 3LAKA 2LKPA 4AH9A 2CH4A 3FB9A 4DCHA 5CKTA 1TZLA 1AWWA 3BZ6A 2XASA 5C0YA 1VSJA 1TL8A 5J8CA 4FLZA 3OIOA 2ISYA 2ECZA 3K9TA 2QYOA 1QBJA 4JHDB 4M3BA 2CH5A 1R9TJ 4HVVA 3AO1A 4B8XA 3CCEN 3LH5A 2HDDA 2MYSA 1OZ3A 2A5XA 2OANA 4X66K 3K1NA 2K2VA 1C6VX 4B3SK 4B9VA 2PEXA 3KLIA 3MJXA 4M77E 2DXIA 4EJYA 2DBMA 4WK8F 1J6ZA 1YRNB 3A5NC 1ZG3A 2EB7A 1LAVA 4OFAA 1T44A 3C2GA 2XAGA 1RCHA 3TSPA 4QVZA 3F72A 4H0XB 1NYFA 3EE8A 3KBGA 1IJWC 1H92A 3C95A 3SAGA 4D5FA 4XLEA 1BBZA 1Q82U 3CCLN 2KZVA 5E8IA 2UWMA 3HYIA 5FU7B 4QIWN 4XR6A 1TGOA 3CCSA 4A4GA 4ZGJB 4DR4K 1T33A 4JI2K 4NL2A 2STTA 1ON2A 1K6OA 2EJGA 3SNNA 2O8EB 3CM5A 2MH2A 1SFEA 2HZDA 5HS8A 3CCVI 2NRXA 5C0MA 2SEMA 1H1VA 5LJ5g 3CWSA 4AC0A 5DM7F 2GGRA 1ZLJA 1V1CA 3F21A 3BZKA 1WPYA 1USTA 4XRSG 3AL0B 4J9EA 2KPMA 4BRAA 3W2VA 2JK3A 4M75A 5LY3A 3NTIA 4IJAA 3LDQA 1NGNA 1RDCA 1HNZK 4B21A 4OMLA 3CF2A 3CCLQ 2L0KA 5E79C 1C0WA 1MV0B 2P9IB 3AA5X 2A07F 2R7YA 2CUDA 2PMZA 5EGOA 4E2FB 5EXWA 5ICFA 2EBPA 3MWPA 2Z2SB 4LG0A 4CEBA 4CFDA 2FO0A 3VTHA 1ZUYA 1HRHA 1K9MC 2V1NA 2R58A 3P5JA 3F22A 1Q7YR 1XG1A 1OCPA 5EYRA 1KJWA 2EQIA 2E7XA 1SZ2A 2RREA 3DRPA 1QRYA 2CZ7B 4IX7A 3NWSA 1STZA 3QDRB 1GBRA 2YCHA 1EXQA 3VS7A 3R4KA 2UYTA 3EYYA 5GAMf 1RT6A 1VFCA 3S3NA 3FK6A 3NGPA 5H2FC 3AAQA 4DSLA 3QIIA 3K4MA 1WEFA 3HT3A 1R59O 1VUBA 3QKJA 1RT5A 1G2HA 3MEXA 3RRGA 3A8MB 3HZ6A 2DXUA 2R0QC 4EV0A 3PLAA 1VQ9N 5D4SA 1UB4A 3H9NA 4DFJA 5FLMJ 5FPNA 1YJ9Q 4Z4CA 3K1MA 5CKHA 5EOYA 2JT4A 5HOOA 2GIZA 5GAMj 4NNJA 4AF1A 1D8JA 2IRFG 2JZYA 4F8RA 1Q8IA 2I5UA 4XU2A 1YQRA 4RB1A 4BJ6C 3EG1A 3CCRI 4DQ2A 2C0OA 1T6SA 5FPEA 4PKGA 4OMNA 2FE3A 4B1VA 3G4SQ 4XLNF 2D1HA 5AQLA 2OQRA 3O9RA 3J81O 3DLRA 3DM2A 1QVGA 3MK6A 5EF6A 3CMEN 1VQOA 3BCBA 3D5SC 3K69A 3Q1JA 3FHGA 4JRQA 4BGDA 5ICCA 3Q7CA 5AQKA 2L9RA 2V1QA 1JJ6C 4HSTA 3KP7A 3AAFA 1XNIA 4S04A 2K3YA 3QP6A 3VESA 4FLVA 3JCMf 3AGKA 3O9TA 5GP9A 4IG0A 4C1NI 3HRMA 5EY4A 2I5WA 5L23A 1R23A 3ZOBA 4AVPA 1YJNT 4IFVA 1NM1A 1MNEA 2X4JA 1CXQA 4C92B 1RKTA 3HM8A 1ZRCA 1S3XA 4FJLA 5GPAA 3HPGA 1PYVA 3K4LA 3M5AA 2YNGA 1BIZA 1J5OA 4WYBA 2H09A 3CQTA 4FL9A 1YS7A 3K4CA 5JLFA 1BJAA 2HCKA 1OISA 2KRNA 1AHJB 3ULEB 5KYXA 4M3EA 4LNPA 4CFCA 3TL4X 2RKIA 2JSPA 1DGWY 3CPWM 4XEIA 4QPQA 1AOJA 3ZMSA 2Q2RA 3P9IA 3AVAA 2LD5A 2E1HA 2IW5A 4DWIA 1YTYA 4M75G 3H0IA 3CUOA 2HBLA 2RPIA 2JS2A 2OD5A 3FXRA 1W2BS 2LT4A 2KLOA 3AARA 2M30A 1ZRDA 3CC4I 3WEEB 3CWAA 3O9QA 4O8KA 4PQUA 1YCYA 4CZKA 1TC3C 3TAFA 1WHMA 1H0MA 4WF2A 2K86A 2DL5A 1TLHB 5FLXZ 2LVSA 4AT1B 5DV5A 3BR5A 1K9AA 1YVUA 1WJDA 2XRNA 1GT0C 2AIRB 4QS9A 1LDDA 3GTMJ 4YFNF 1KU2A 2UUCK 2LFBA 4YY3K 2OTJA 5K7ZA 2F9WA 5D8LB 4AQYK 3L7WA 2JXBA 2KRSA 4DQQA 4UVAA 5CY4A 4G94A 4QPOA 4ZHRA 4PFZA 1M8MA 4L18B 3PX6A 1R22A 3LH0A 2CW8A 4CJVA 3TU5A 5CQYA 4M63C 2P9SB 1I50J 2LDUA 4YFXF 3ASMA 1IDZA 4LIVA 4KHQA 4ZTJA 2X4HA 5F0CA 2CQKA 4IO9L 2FF6A 2R7SA 1WHKA 3QEPA 4YRVA 2YPRA 3WTXC 1WVRA 4P55A 1FMWA 2RHUA 2JVVA 5F0HA 3CCMQ 1W7PA 1DTQA 3LWMA 2IA0A 2V9KA 1R58A 1Q95G 5GIOA 4C8NA 1KYZA 1PRLC 3I56A 2ELJA 2LY9A 1W5CC 3KEYA 2CSIA 4OPKA 5BN9A 3OYJA 3J80E 4NB5A 5BOXA 2V51B 2WV0A 2VGNA 2FG0A 2FMYA 4ZN3A 3LWHA 2NOJB 3GNFB 2QI2A 3PNWC 2ZJQF 4S05A 2YR2A 1UGSB 2P5GA 2ASMA 2RJEA 4B1ZA 1KQ1A 4MZTA 1RAIB 4O0IA 3MXJA 5A2QO 2FBKA 4JHDA 1X27A 4CXFA 3NVKA 1QWFA 4RGXA 2F5DA 2VBZA 3DEEA 5EJCA 1WH7A 1FJGK 1TOVA 4CC7A 4JYAK 1QSYA 1JXMA 4BC4A 1H3HA 3QPLA 2AK5A 3BEXA 1IG8A 1YRNA 3IAS2 4S0HB 2Y30A 1KU3A 3BPVA 3JW4A 5H20A 1UJ0A 3WGHA 1DP3A 4PKHA 2BHYA 1S72I 1KONA 2AKLA 4MEXF 2GXAA 1MZBA 3CQ8A 2K40A 1FK9A 2FRWA 3KCCA 3ONQA 1KC8U 1VSMA 2QSFX 1YLFA 1VQNT 4CJRA 4DS4A 4CGFA 2HR3A 4IXAA 4NHJA 1UG1A 1NG9A 4E6RA 4IXCA 4ZYHA 1H8KA 3K4BA 2O8EA 2CQ7A 1WHUA 4GGGA 1VQ4A 1ORKA 3TREA 2LTPA 4EZ6A 3UE5A 1I4K1 1C1CA 1AOYA 1YNZA 4MDWA 4AHVA 2X1EA 2EFOA 1I27A 4U0YA 1HLVA 3QFUA 4CIEA 3WODF 4RW9A 4X1VA 4DEYA 2OYQA 2RQQA 3EZWA 2OTLN 1GFCA 1KG6A 2QWRA 3LPUA 3WQTA 2PMUA 2BTFA 4C5GA 5GAN2 2BUDA 3LFKA 3OB9A 4BROA 4KFCA 4B9NA 4E7IA 1IXSB 3AT1B 4Z2YA 1AT1B 2P9IA 3ZSQA 2Z5UA 3NF7A 1TYQB 4JJBA 5I11A 3A0IX 1KFZA 4ISGA 2QWNA 1YJWI 4M3TA 2NS8A 4H8KA 4Y1CA 3PSIA 2RQWA 4OKKA 3U21A 3I55T 1X2NA 3F8NA 2Y9YA 4HNTA 4L3QA 2L8DA 3K6GA 3L3VA 2DO7A 1TBXA 3HPOA 3O6BB 2FEZA 2PYLA 3L2RA 2XIDA 3LALA 3KKSA 4CEOA 1QZ5A 1K4US 4I7FA 1E6HA 2HQXA 4CD1A 2RHZA 1NBEB 3C6AA 1ETVA 3GEZA 5FROA 1YQKA 2Z1DA 1GOCA 1GV5A 1WCMJ 5C3EJ 2DRMA 3NMZC 4DLGA 1JT6A 2P5LC 3VQ5A 2CFOA 2EQKA 1KG3A 1LWEA 2DYSH 1PVEA 2RH2A 4A3BJ 4BWMA 4BDYA 4UY8I 4E9GA 1F21A 1KQSA 3F73A 2DO3A 4A2BA 3JAMK 2M4GA 3LGFA 4RTXA 1YWOA 1E4FT 3ZLJA 4IDHA 1WJRA 4AHCA 4GV3A 5KVRA 1J5EK 4AFSC 2K9QA 4I99C 3PNTA 2F8SA 4EJOA 4DW6A 3UB5A 5AZIB 4HBLA 1J5YA 1KD1O 3QQAA 2VG5A 4B3TK 1U5TB 3ZSVA 1M3AA 3U6FA 2QGUA 3OWTA 4HF0A 3SUPA 4KIBA 3KXTA 2GA1A 2HXIA 3S1NJ 1WJAA 2EYZA 2LREA 3D2EB 2Y75A 1UECA 1A6IA 1RI9A 3D45A 3LM2A 4CHOA 1G59A 3ENBA 2I10A 2EYWA 3F9MA 1OKJA 1XNQK 2FA5A 4B9SA 4O5VA 3PO5A 4IFEA 1I07A 5B1AH 3RPQA 1QKWA 4ELUA 4C92A 1DTTA 3JSMA 2GUIA 4BBSJ 3BR0A 2WONA 5LMUK 3KETA 3QBWA 1F43A 4UVBA 4A0ZA 2R7UA 3V7CA 2AZVA 2HDAA 3AL0C 3I4PA 2HHSA 2C0TA 1YO5C 1YF5L 4JI1K 2K7LA 2RJFA 2W4SA 3OGDA 3NBPA 2PZ1A 3TDUC 4BXUA 2K3FA 3ULEA 4DTNA 3TW7A 4KB0A 3TO7A 1A04A 3Q0UA 1YWPA 3TCJA 3EUHA 2WFBA 5KN8A 4Q5WA 1B9NA 5CVIA 1A36A 1VQ8T 2LNBA 3FXOA 4GW6A 3RKWA 1UDLA 2A36A 3M53A 2HVHA 4E70A 4XU0A 2O4XA 3O5ZA 2ICWG 2CUFA 3HP9A 1LOTB 2OPSA 1VQMN 1RTIA 3WEEA 2KRMA 3GFMA 3EKSA 5HDGA 2JA8J 1O75A 3GTLJ 1YJ9I 4HCZA 2CUEA 4DOVA 2M16A 2E41A 5GTIC 3FBIB 4LIUA 4BACA 3KNTA 1YVNA 2DBKA 3A5MC 2QW9A 2MCNA 3FEOA 2BZXA 3CCUT 2PVGB 1IDYA 2LMJA 1TKZA 2QK9A 3R3LA 3G4SI 4QWQA 1VF9A 2JN0A 4R55A 4DV2K 4KN4X 1IUFA 1R8OB 4W5QA 2RGVA 4J01A 4KHPK 3HTUA 4HPQA 3ABLH 4HVWA 4DYQA 1T7PA 1L0OC 2K9SA 4M3UA 5K7HA 2P9SA 1O4XA 2OC6A 3K5OA 4YOVA 3SEQA 3KE2A 3QIOA 1LVKA 4B3OA 4DR7K 3QERA 4HAMA 4L9JA 4AYBN 2VB6A 2XDDA 3W0LA 4C8MA 3I35A 2HHVA 3I0WA 1YOVB 1K73U 1PM3A 3J8AA 5TGTA 4DNCA 1KLMA 4JN4A 2F48A 2WSCE 3NGIA 1JJ2S 5I2SA 1L3VA 1IBKK 1NJYA 4B9TA 1BCMA 2HWVA 2DQLA 5KCOA 4CF8A 1RRJA 3VMFB 3FMRA 1GXQA 4HDVA 1VSDA 1R0BG 2H1LA 3CCSN 3V1RA 2DVEA 3MX2A 2AHJB 2SRCA 4OPHA 4EGYA 2DF6A 4F7UE 4N4GA 5CPRB 2GBYA 2V7YA 5ILVA 1OQKA 2W25A 4A2AA 4JYKA 2Y2ZA 1ULYA 3V6DA 3F0ZA 1FMKA 4HX8A 2IS1A 3OR1C 3MCPA 2YWWA 2YG8A 4HF1A 3DQVC 1S1NA 1MBKA 3EG2A 3H9GA 4IRIA 4OVAA 2V26A 1BOBA 1YQAA 2QAZA 3G10A 2LKSA 3I0SA 2FUG2 2D6FA 2XRIA 2VUMJ 4FPBA 2CUJA 4RTFD 2JWTA 2Y90A 2A69F 4C92G 3ITHA 2O8FA 1BUPA 4FJXA 3EUHC 3CCSQ 4V2SA 1N39A 3T19A 2QEXI 1NMDA 1D3BB 2WSFE 4L5GA 5LJ5j 2LF8A 4FJ7A 2W03A 1IN8A 1KU9A 2EV0A 5M1PA 2NOFA 1HCRA 3S1MJ 4M7AB 5JVGF 1B9MA 2LNHB 1WXBA 3AG4H 1Y7XA 3M0QA 4A69C 1P4AA 2ZJPL 3O4NA 2IAIA 3ENOA 5KCHA 3PFYA 4XH4A 5M3FJ 3TAEA 4IUUA 4DV5K 4B23A 1MMSA 1H9GA 1WLPB 1ZHIA 2E2NA 2UV1A 1PUFA 4CCHA 2VT2A 1TG0A 5AONA 2YUPA 5CZ1A 4DTXA 3KKRA 3DU5A 1XQPA 2HSTA 2HU9A 3O8GA 5C42A 3NE6A 3CFOA 1YQLA 3THYB 4FSVA 2CT3A 1MUDA 4QW2A 4J2DA 1N33K 2MABA 1W0HA 4FX4A 4DGWB 2VV5A 3MCAB 3CCMI 4CHQA 1OYWA 4YPRA 3ATUA 3JRGA 2WSEE 4M3FA 1SAXA 1T8EA 2GEMA 2XY8A 3F5TA 1PVSA 1TTHB 4DB3A 2ESWA 1OCRH 2DMQA 3ZQLA 4H0EA 4Z0UA 4HF2A 4HA8A 4JUVA 4XSXF 2R7QA 2PQWA 5A0GA 2Q8KA 3QO3A 4IOAF 1RNHA 2LX7A 1X6OA 1BR1A 3I9QA 2LCLA 1X1AA 3PL8A 1X69A 1M1KC 1JCGA 3P8HA 3V42A 2V1UA 3SEMA 4BR7A 4CZZA 2KL4A 3B6AA 2VE8A 1QSSA 2ESNA 2DMNA 1G4DA 1Z6RA 4DTMA 3R6SA 1WQWA 3FR0A 4HRIA 1NTCA 1C0FA 3N05A 4FCYA 2JSCA 3Q0VA 1LOJA 3I3LA 2LY1A 4M78B 3Q3SA 1E2XA 4FLTA 2RQPA 4EM1A 4LJZF 4HCCA 1O7LA 1EJ9A 3VN5A 1VI0A 2I8DA 3GBTA 2YHYA 3EG0A 1Q81C 4AHSA 2VPRA 3DP7A 3BG7A 2TDXA 2E2QA 4CIGA 3SMPA 2VCPA 2FXAA 3U9GA 1VQOQ 1QHAA 4HNUA 2FQ3A 1MBGA 1NGEA 2DRKA 1HKSA 3L42A 5ADXH 2X35A 1W2BM 5KYUB 3SQ4A 2NS7A 3FE1A 1VQ7A 2M8GX 2BXYA 2ZBKA 3IH2A 1IRZA 2PUKB 3CJQB 1ITGA 2G8WA 4FWOA 1IUYA 2YHBA 3MCZA 1Z25A 3W6JB 1R36A 2NXNB 1Z7UA 3KZYA 4KREA 4ZH4F 4B3MK 4LDXA 4CF2A 4N41A 1U5TA 1X2MA 3RSNA 3ID8A 4JRIA 4BD3A 4P96A 2IGIA 4AG2C 2HYJA 3D2EA 4AI4A 4FJ8A 3HGYA 4FVMA 1RZ4A 3NEUA 1YIJA 5GJWB 3AGRA 1D1BA 3OYGA 2VQLA 1ZBUA 5KN9A 5F0FA 4AD9A 2Y1JA 3VYRB 2HHWA 2JMAA 2E1MC 4BWJA 2W82A 1CQTA 2K5IA 3FJPA 4BR9A 2CZ0B 1AZEA 4A6EA 2Y0MA 3BTCA 3OS5A 2JTMA 3P7NA 1DU0A 1EZZB 3FM3A 1Z0XA 3OL4A 3M1CA 3CMAN 5GINA 3TKYA 3RZDJ 3J7YJ 2DPPB 2OFIA 3JAME 2JGUA 2IS2A 1YHQA 3SUOA 1D8KA 2VKEA 1IHVA 2DL3A 5J2QA 2DFEA 2OPPA 1K8AR 4ETSA 1Q7YO 4JK9A 3SBTA 3PJRA 2QWLA 3CW7A 3K2AA 1V29B 3LSJA 2D1KA 4BRPA 4BNCA 1WZ2A 3EHRA 4XTUA 5KTQA 2OTJQ 3A8LB 3JCMP 3CCET 3K70C 1FN7A 1CSKA 4ZJZA 4A62A 1U84A 4IUTA 2ED1A 2FLOA 3T1HK 4DR6K 4XNFA 4KGXB 3PX0A 4FIBA 3ID6A 1E3HA 1B34B 3I56N 2GBQA 4HUGA 4VUBA 1UGVA 2L3QA 4HX7A 4OFEA 4RTWA 3ABTA 2DMPA 3DU6A 3VEXA 4DOWA 1RTHA 1HDDC 1LW2A 3ML6A 1NEGA 1RNLA 2VYTA 3SZ2A 3RSEB 2XMFA 3OYNA 3FMSA 3M4OJ 3CCJN 4FJ5A 4RDUA 3CCLT 3QEVA 4FZXC 5AZJA 4RGUA 2X4XA 1RLPC 2IIRA 2P84A 4YEJA 5BREA 4C9YA 4I9LA 3CCQA 2W40A 2DTOA 4OLAA 2QCOA 4HYEA 1GLBG 1PC0A 3EY1A 3THXB 1G8XA 2F5EA 2IBDA 4IOCL 3I56Q 4I2OA 2LJ3A 1RESA 2VQGA 2BDPA 1JTYA 2LK2A 3MN6A 1ZC6A 2ZMEB 3WXKA 4J9IA 3ZX0A 3NGZA 2A5YB 3RQ4A 1L3SA 3GTJJ 4BQLA 2E2IJ 2JRMA 2CFXA 3TU4K 1R0AA 2MC3A 3J81K 3I9V2 3HTVA 4CGHA 1BU1A 2F2VA 1U5TC 2VI6A 2O8BA 1X4OA 3VS4A 1WJEA 4DYCA 3RTRA 4YNQA 1GLEG 2M8EA 1H3ZA 3N4QA 3NAEA 1RT7A 2HDWA 4IHVA 3KTQA 4NC6A 1FBSA 4LD5A 1PP8F 5LJ3g 1QP2A 3MZYA 3OW2P 2CG4A 3W3DA 2YUOA 2DPNA 2H8RA 3EGDA 2HPMA 1LAWA 5E3LA 1VQ4N 3MKLA 5GAN3 2BY2A 3GIBA 2JTFA 4BRCA 4CD3A 4FOIA 1ATNA 4YOYA 4U7DA 3HP6A 1ACIA 3CPWA 4DHYA 5M1OA 2L2PA 3TEDA 4CCKA 2O03A 2WOMA 3H0HA 4WXCA 3VOVA 3IS9A 2W7NA 3R0JA 3ABUA 4LDVA 4LUDA 3SV4A 1KVCA 3DV8A 2EJFA 5GPCA 3RMBA 4XU3A 2WY7Q 1X2KA 2B5JA 3H5AA 2X51A 3ZETA 5CVUA 1VQKA 2GTOA 2EINH 1WRJA 4R79A 3BPXA 3C0BA 2Q1ZB 4XIDA 4U0WA 1WAJA 5HNFA 1OOTA 1VQ9T 3L9FA 2E70A 9ATCB 1TL1A 1Y8RB 3MXMA 4B9LA 1GXIE 4LH5A 4UXNA 4A5MA 2VWFA 5JS1A 1HF0A 3C94A 3A8YA 4AILC 2VWJA 3ULRB 4ZZLA 2CV2A 3D5RC 4MQ3A 1U6ZA 3VA3A 2K85A 2A3ZA 4GLKA 4GLMA 1PU7A 2O5RA 1MBFA 2E2OA 3MEAA 4FLWA 2BXZA 2IPQX 3QEXA 2HEOA 1WX6A 1OLTA 1DUXC 3CMET 4AFZC 4KTZA 2X6WA 1U9OA 1Z67A 5B5EC 3SB2A 2DTUA 2AKKA 2R7RA 2HF4A 4FZZA 1NGCA 1EV7A 2VLAA 2BUPA 1UGQB 1UFFA 2NAZA 2XV4S 2MFZA 4CBXA 2YNFA 3CG7A 1D0ZA 4ENJA 1D0XA 2GFAA 1U49A 3DOKA 4EHTA 1SSHA 2YSQA 4LD6A 3VUBA 3RIRA 5E84A 4HKEA 2FD5A 4ZDOA 4BRQA 2O7OA 4O5FA 1WFWA 2CW0F 4AFQC 2F4OB 4ELZC 1WH5A 4OB2B 1YITQ 5HVQC 5KNLA 2CP0A 2DL7A 2KGTA 1ZUUA 3JCMX 2VL8A 3LFUA 4EZ9A 4ZDLA 2V6EA 5GANe 3ZT2A 3UPUA 4IF4A 1M90R 1YTUA 3SQ1A 1FP1D 3DTEA 2FL7A 3F10A 1M30A 1DIZA 3MWMA 1T03A 4C0GA 1JUSA 2O0YA 1DGKN 3WXIA 3H0GJ 1SVMA 2A7YA 1QHHD 1SFUA 4RAYA 2RI3A 3P8BB 1PU8A 4RB2C 1S7AA 2P9UA 1TQMA 2VQEK 2OF7A 2ECBA 1WJ5A 1OCOH 3O2PE 4ZNXA 1TSFA 2E20A 5D5WB 1V4RA 5I21A 1QHTA 5LRSA 5K1YA 1U1SA 1X3WB 2P0WA 4B8AB 2P4WA 4KT5C 5BRDA 1QMCA 3FK7A 4R8HA 4CF1A 1HBXG 2EGCA 1UAXA 5GMKm 4UHTA 3V8KA 5GMKi 5B66C 5A2QK 4J6XA 2KE9A 1Q7YC 3FLCO 3KK1A 2YRVA 1X3NA 4EJVA 1RUNA 1NBWA 3RRHA 1MBHA 4O4GA 1C1AA 1JTXA 5KYUA 3J7AO 3FXJA 1V5GA 2OX7A 5MLCQ 4MO4A 3RYPA 2QGFB 3ZSXA 1X58A 1LE8B 4FM2A 2DOFA 4DSIA 4IWVA 1YI2Q 3ZQCA 3F8FA 3U3YA 2EFQA 5DMRA 2R7XA 3V4GA 1RR8C 3GW2A 3CF5L 1J09A 3DKWA 3MX5A 3ELKA 2OZ6A 2K6DA 5IXBA 3CI5A 1ZQ1A 3LWFA 3ZQFA 2WADA 5J40A 3EH2A 4CJ3A 1VRLA 3X26B 4OMYA 4YOUA 2F5KA 4M7AG 3KYDB 5KH6A 2PJRB 2K4YA 1XWLA 4DF8A 3JAMZ 4HLXA 5FJ8J 4JX6A 4IO9F 1DDNA 3SDZA 1KU7A 1X4PA 3CC4A 3CC7I 4BUPA 1W6XA 2KMUA 1N3AA 3EAEA 3G6EN 1IC8A 3BDPA 1IKWA 2D0NA 1BC7C 4PZJA 2Q31A 2R5ZB 1BA1A 1QVPA 2DA4A 1RLQC 3MP1A 1ZBXA 6PAXA 3TTFA 1SD6A 4EAHD 1RABB 1RT1A 3CXCA 2L9SA 1EX4A 1JJ2M 3B8AX 4LGWA 1NGIA 3KFWX 1BOTO 1T98A 2GFUA 4ESFA 1SFOJ 3QBYA 2NNNA 3IC7A 4BC3A 3RMQA 4M3ZA 2NOZA 3DPLC 3M54A 2OQGA 1BISA 3NF6A 2DYIA 4DV1K 2NYXA 5HBMA 5KGXA 4JI5K 2XGCA 1VQOI 4CCMA 1IG7A 1B34A 1I6XA 5LGTA 1EKEA 4DBFA 4FL6A 3DBRB 4KUMA 3HJFA 4X65K 1C0GA 2QM3A 4H5TA 4XU1A 1Z9ZA 4BRHA 1V5FA 4E47A 4PKIA 3VPZA 4CJEA 2D8HA 2JJ7A 3QBXA 2QUFA 3S14J 3RSEA 5E3MA 1XGSA 4F04B 3OQ5A 1R6RA 3PIOL 3KZZA 4KA4A 5GAN7 4DQ8A 1D5VA 2O31A 2W04A 3BR3A 4XTVA 2RN8A 3O8HA 1Q82R 1SMTA 2ITGA 1Q18A 2MOXA 2E7WA 4M78G 4LB5A 4CA0A 3AVFA 1PUEE 3UT1A 4IZZA 3VS1A 1GLLO 2HQAA 1N34K 3THXA 1HYOA 2CREA 2RK1A 4P5OA 1XHXA 4CZLA 1M4ZA 3IMXA 1ZBFA 1VQ6Q 4OOIA 3RMDA 2HD0A 4BGBA 2XG8D 2DL4A 2L7KA 3HSTB 4QLCU 2ZMEA 4DYRA 3IG1A 2OTLT 4CK1A 4DUZK 2P9LA 2D1XA 4LUEA 5M1KA 1S6PA 3S93A 2QA4A 1WKMA 3BW1A 5D5XB 3C0CA 4LLNA 3OYCA 5EC7A 4XLCA 1KD1U 1IGQA 1XPXA 4UY8O 1MW7A 4WXHA 4F2RA 2STWA 4PJOF 2DTHA 2X48A 1M1KU 2EYQA 2J6FA 1S72A 1GCQA 1O3TA 1BQMA 4DSEA 2UXNA 1ZRFA 1O1WA 4B3RK 4UVCA 3QLHA 1A0NB 1EBMA 3VGKA 5LLQA 1USSA 1LCKA 2KMTA 3F6OA 2KLAA 3EQLF 4YELA 2YSRA 3WE2A 1RDDA 4BR0A 2OTJI 1CF7B 1T0HA 2Y4XA 3F23A 1JKOC 2CDTA 1KG5A 2YHWA 4IIMA 4HG2A 1U04A 1A31A 2FF3B 2NVYJ 2RQRA 2IGOA 4KGVB 1HKQA 1I5ZA 3CO6C 1EP4A 3S1RJ 1LEAA 3E19A</