3OYJA

Crystal structure of the pfv s217q mutant intasome in complex with magnesium and the insti mk2048
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
368
structure length
368
Chain Sequence
LDAELDQLLQGHYIKGYPKQYTYFLEDGKVKVSRPEGVKIIPPQSDRQKIVLQAHNLAHTGREATLLKIANLYWWPNMRKDVVKQLGRCQQCLITNASNKASGPILRPDRPQKPFDKFFIDYIGPLPPSQGYLYVLVVVDGMTGFTWLYPTKAPSTSATVKSLNVLTSIAIPKVIHSDQGAAFTSSTFAEWAKERGIHLEFSTPYHPQSQGKVERKNSDIKRLLTKLLVGRPTKWYDLLPVVQLALNNTYSPVLKYTPHQLLFGIDSNTPFANQDTLDLTREEELSLLQEIRTSLYHPSTPPASSRSWSPVVGQLVQERVARPASLRPRWHKPSTVLKVLNPRTVVILDHLGNNRTVSIDNLKPTSHQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PFV integrase
publication title Molecular mechanisms of retroviral integrase inhibition and the evolution of viral resistance.
pubmed doi rcsb
source organism Human spumaretrovirus
molecule tags Recombination,viral protein/dna
total genus 105
structure length 368
sequence length 368
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2010-09-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
A PF17921 Integrase_H2C2 Integrase zinc binding domain
A PF18103 SH3_11 Retroviral integrase C-terminal SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2300 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3oyjA04
1.10.340.70 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Endonuclease III; domain 1 3oyjA01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3oyjA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3oyjA03
4CGGA 4KFBA 3O3GA 1QTMA 5DMRA 3DLKA 3NF9A 5KRTA 1YT3A 4NYFA 4CJKA 1JLFA 4DQSA 3U3YA 2LTOA 4NCBA 2FBXA 4BWJA 3O8VA 4FM0A 2Z1IA 2RJFA 3LWLA 3ZSWA 3L8BA 4L8RB 1C1BA 4C5GA 3V9UA 1S5JA 3NBPA 2D0CA 2EHGA 4B9XA 3HVRA 3MEEA 2RJCA 2OYQA 1L3SA 4DTUA 3AVGA 3CYMA 4DQQA 1T05A 1HNVA 1TAQA 3AA4A 4K8XA 4CE9A 1U48A 4DU3A 2QQSA 2RJEA 1BQMA 3CFPA 2DTUA 4Q0BA 1JLGA 3DOKA 4N56A 4O44A 2EQUA 4DTJA 4M45A 1JL1A 1OZ3A 1IKXA 1A5VA 4OLAA 3OMGA 4CJSA 2P5OA 1J54A 1TKZA 4E7LA 4E3SA 2GFAA 1SKRA 1C0TA 3NDKA 1U49A 3RRHA 4XIUA 4FJHA 2DAQA 4EP5A 3LPUA 2OPSA 2P51A 5KCOA 3PUFA 1KLNA 1XNIA 1BISA 2LVMA 3DM2A 1ZBIA 1TV6A 1JLBA 3HVTA 2EQMA 1KVBA 4FJIA 3DLMA 5HLFA 4KRFA 3NCIA 1KHCA 4CF2A 4IUPA 4BD3A 4CJEA 4OKKA 1T7PA 3ZSRA 1A5XA 4AILC 4BE0A 3TAPA 1MU2A 5J2QA 4CGHA 2E6NA 4PUOA 4Z4FA 3ZSOA 1WGSA 1ASVA 1RTIA 2QKKA 1HMVA 3MEGA 4N76A 3RMCA 3DLRA 2YKNA 3VQ4A 3LYIA 1N5YA 3DOLA 1BIZA 3M8QA 1NK7A 3FEOA 4K8ZA 2BDPA 1WAJA 1RT5A 4CHZA 4CESA 3VQBA 3V9WA 1KVCA 1TAUA 3LDSA 1NOZA 1XHZA 3K5NA 5D6WA 3SJJA 3C4SA 3VQ6A 3MAQA 4Y1DA 2D9TA 4B9UA 5CZ1A 4FVMA 4O4GA 3QESA 4B9MA 4DS5A 2YRVA 2ITGA 4CJUA 3QNNA 3LX7A 3S6WA 1JLQA 3SQ1A 3FC3A 4ID1A 1B92A 4KHWA 5HP1A 4M3XA 4B9TA 3S9HA 4I9LA 3ZEHA 2X4WA 3NH1A 4FZYA 2A1RA 1KRPA 3PMTA 3LZJA 2L8DA 3NTHA 1J5OA 4Q5WA 3VQPA 3H8ZA 4E7HA 4W5QA 1CZBA 2GFUA 1BCMA 2R5MA 2K3YA 2E5QA 4J2BA 3NGZA 3RTVA 4CK1A 3LALA 5CYMA 3MEVA 4E7IA 4DF8A 3HO1A 1TGOA 1L5UA 3AVKA 3PMIA 2HVHA 5J2NA 4DSLA 2KFNA 3CEYA 3LAKA 3NH2A 2G8WA 4I2QA 2JLEA 5M9OA 4O5BA 4FM2A 3ZT4A 1ZBHA 1BCOA 3QKJA 1VSEA 1IO2A 3DMJA 4F4KA 3LAMA 2E6LA 4CEQA 4Z0UA 3PO5A 4CFBA 2D5RA 4QVZA 1RT6A 3K57A 3LGFA 1QS4A 3AA2A 3ITHA 4KHQA 1N27A 3V9SA 3C95A 1Q9YA 3WNFA 3SUNA 4KO0A 3KD5E 4FJNA 3SUQA 3QEVA 2VG5A 3OY9A 3C6UA 3A2FA 3D0PA 4DSIA 4IG3A 4ELTA 1RBUA 1DTQA 2ZD1A 2F8TA 3BGRA 4CERA 3OA6A 4DQRA 3SUOA 4OVLA 3OYFA 4B3OA 3HM9A 3KUFA 1L3TA 3AV9A 3DRSA 2L3RA 2OZSA 1D5AA 4RG8A 1X9MA 3OYNA 4KHSA 1RT4A 3CM5A 4JS5A 1LV5A 1EX4A 1S1XA 3L2UA 4Z4GA 3U3GA 1W0HA 4BWMA 3K58A 5D6XA 2XDPA 3NHGA 2HNDA 1L3VA 4DFPA 4C8LA 4DWIA 1I3AA 4QAGA 4DLGA 5KE2A 5HRRA 4J2AA 2JGUA 2HHTA 3AO1A 4CHQA 3U6FA 3VQQA 5C42A 4IFVA 4CJPA 3NGYA 3MP8A 4C8NA 3MP6A 4DS4A 3ALYA 3CM6A 3HK2A 3OS1A 3PFSA 1QQCA 3DI6A 4KI6A 2L89A 2W42A 1HPZA 3F70A 3DLEA 1RBSA 4GVMA 2GF7A 3KLFA 2OA8A 4RG2A 2HVIA 5HRSA 4W5NA 2VWJA 4W5TA 1RBTA 3NTIA 3SYZA 3OYGA 2DFEA 4F8RA 3KK3A 2YHAA 3MO8A 4CEEA 2G8KA 2M0OA 3O4QA 1W9HA 1VSDA 3OYDA 3UT1A 1TKXA 3SCXA 3QNOA 2FBYA 4OJRA 2JZ2A 1X9WA 3LP0A 2BIVA 2LRQA 1WSHA 3EYZA 4NCAA 1Q8IA 4A4HA 4YFUA 3O4NA 4IURA 1BHLA 1Z25A 2O4XA 5KTQA 1WJRA 4DSKA 4DLEA 5FDLA 3KTQA 2G8IA 5SZTA 4CHYA 4E0DA 2QQRA 2BANA 3OQ5A 3V4IA 3SPYA 1QSLA 4Z4HA 4C5EA 2D0AA 2Y1IA 4F3OA 2FHDA 1I39A 1LWFA 4RW4A 4HCBA 4BDZA 3H6ZA 3LP3A 3K2PA 3HT3A 2HB5A 1CXQA 2B6AA 3IAYA 4CF0A 1BL3A 4B9NA 3DB4A 3KLGA 1EP4A 4MQ3A 3QBYA 3NF6A 4CIGA 4O0IA 3K5OA 3T19A 3VQ5A 2LDMA 3L3VA 1FKOA 4B8CA 1ZBLA 2BUDA 1CLQA 1U45A 4FW1A 4C5IA 3OS0A 1WSFA 3NTKA 3RRGA 2RI2A 3NGIA 3SV3A 2IOCA 3EY1A 2BKDN 1QE1A 4IUTA 3HYFA 2RHXA 4E89A 3AA3A 3TAEA 2EX3A 4H8KA 5KI6A 4CEZA 4CIEA 2O4XB 4WE1A 4CJRA 3M9QA 1S9EA 4OPJA 4O55A 2ETJA 1WAFA 4IDKA 4AHVA 4OPKA 3TAFA 2A1SA 1S6PA 2KQ2A 4CRIA 1TL1A 3ZSXA 1WJSA 2YNIA 4LSNA 3FLGA 1B9FA 5CIUA 1C0UA 3ASKA 3QINA 3ZSQA 2YHBA 3Q1JA 1LWCA 2Q3SA 3MEAA 3QIPA 3QEIA 1S1WA 4ELUA 1SUQA 3P8DA 3TAMA 1DLOA 4LH5A 4Z4CA 4J2DA 3VN5A 2XO7A 4M3UA 1U4BA 1SSFA 2HMIA 4FJMA 1RT3A 4FJ7A 2QKBA 4W5RA 2B5JA 3PNWC 3VA0A 1QSSA 4DSFA 4QQ6A 4EP4A 1NKBA 4M3WA 2GBZA 4HUFA 2YV0X 1NOYA 2JTFA 1TL3A 3LLRA 3KJVA 1WSIA 3C6TA 3QO9A 1UOCA 1NKCA 4DU1A 4FJ5A 3EAEA 5D6YA 4FK4A 3AVNA 2KZMA 4Q5VA 4RW6A 3NFAA 4CHPA 2LSNA 5E41A 2VWKA 4FZZA 5K14A 2EQJA 3AVHA 4BDPA 3TANA 3AVAA 2DIGA 2KZZA 3V1OA 3L2RA 3VQCA 4KREA 1UAXA 3VQ8A 4DTPA 3CFOA 1L3UA 3P83D 2R5AA 1XC9A 4IFYA 3KLHA 2ZE2A 2FBVA 3K59A 3M8PA 1Z26A 1T8EA 4DF4A 2F8SA 3SQ2A 1Q9XA 4JRPA 2RPIA 2RHZA 3UWNA 1VSKA 4IUUA 4DMNA 4ID5A 1HNIA 5J26A 2XRIA 3FDRA 4JRQA 3DRPA 4QQDA 2X78A 2BE2A 4E7KA 3AVJA 2R7YA 2DY4A 4II1A 2KW4A 4CEOA 4HTUA 5D3GA 2P1JA 1VSLA 1BGXT 1VSHA 4DFMA 3META 1S1TA 3L2WA 4Z4IA 3TAQA 2Z1HA 2X4XA 1BIUA 2RKIA 1S6QA 3T1AA 1D8YA 3AVBA 1GOAA 3RR7A 2PYLA 3KKRA 4FL6A 2RO0A 4DQPA 5FRNA 2YNGA 4DTOA 3TWHA 2O4IA 3QEXA 4OVAA 3AO4A 3L3UA 4E19A 1ASWA 4B9SA 3K5MA 2YKMA 3VQEA 5C25A 3M8RA 3H08A 5DK5A 5C6SA 1S1UA 4KHUA 4FYDA 1U04A 4DTMA 4CIFA 1NK6A 3OJUA 1A5WA 3WNEA 5KH6A 1EKEA 2VYTA 1WJQA 5SWMA 2F96A 1FXXA 1FK9A 4KHYA 1RT2A 4A4GA 3ZSVA 3E9FA 3SNNA 1C1CA 3L42A 3AVMA 2YNFA 3UIQA 5CY4A 1NJYA 1ASUA 4FXDA 4IUVA 1NK0A 2IGIA 1CZ9A 3AVLA 2EQKA 5KE3A 2E4LA 2E6MA 4M3TA 5FROA 4FJ8A 4DFJA 3ZSYA 3V1QA 2PYJA 3NH0A 4ELVA 1HYZA 1RCHA 3RMBA 1O1WA 1WSGA 5J1EA 2X6SA 3IRXA 3KD1E 5J2PA 3TR8A 2XK0A 4B9LA 2GV9A 3QERA 4M3ZA 4RW8A 1ZBUA 3QJ6A 3AO3A 3P5JA 4E7JA 4CFDA 4CEFA 3PO4A 4CF8A 3KIOA 4BDYA 2IC3A 4CHNA 3LP1A 1G5VA 4FU6A 2DFHA 4EZ9A 4CGFA 4LY7A 4OKEA 2R57A 1WN7A 1D9FA 1JLEA 3RMAA 1T03A 4CEDA 2R58A 5FRMA 4FLUA 4DTXA 1KFDA 1TKDA 1NK9A 3RMDA 1SKWA 4CCHA 4QCLA 4LD0A 4ZTJA 3RR8A 1D9DA 4PY5A 5HBMA 4N4GA 1TVRA 2G8HA 4QQGA 3T3FA 2WONA 3V81A 4DQIA 2KFZA 3THVA 4M3RA 1C6VA 1QHTA 3EZ5A 1IG9A 1LWEA 2EFIA 1NK8A 4G1QA 1HQUA 4E1NA 3K5LA 4FCYA 1MHNA 4H4OA 1XI1A 3G10A 4CF9A 4AHSA 4N47A 4CJWA 4PWDA 1J9AA 2IG0A 4CJFA 1XHXA 4ICLA 2FC0A 2G3RA 2NLUA 3NF8A 2PY5A 4EZ6A 4FW2A 1RDDA 4GMJB 5CYQA 2FBTA 4PLLA 3DRRA 1F21A 4UC4A 1SKSA 3QEPA 1VSMA 1EXQA 1IKYA 2WACA 2RI5A 3HJFA 2RJDA 5KGWA 1JL2A 3ZT3A 3MEDA 4L59A 4CGDA 3C94A 5KGXA 2D0BA 3HPHA 2O4GA 3QLHA 4B9WA 1TK8A 5I3UA 2HHQA 1ZBFA 4YNQA 4LSLA 2ATQA 4BE1A 2CKKA 1JKHA 4IKFA 4A4EA 3E9GA 1RTHA 2OZMA 1HYSA 3V1RA 3WNGA 1KCFA 1EETA 4M42A 3ZT1A 4A4FA 4CFAA 1LW2A 4RW7A 1RILA 2I5JA 1JLCA 4KTQA 4HUGA 1J53A 3MECA 1NK4A 3I0SA 3PX0A 1NJZA 3SUPA 1NKEA 4E1MA 3OYKA 4OKJA 3HP9A 2G8VA 3OB9A 3SD4A 1RDBA 2IAJA 4CJVA 4KPYA 4TSXA 1N6QA 4DFKA 3CG7A 4CJ5A 4KB0A 2RHUA 3OYCA 4DSJA 4I9QA 1BI4A 2KTQA 2XY5A 4PA1A 2HQEA 4I2PA 2DIQA 2HHXA 3PY8A 3SQ4A 4PQUA 3DLGA 4KHNA 4CECA 1KTQA 3HXMA 1TKTA 4HVJA 4HUEA 3ULDA 4FJLA 3S3NA 3AVIA 2ZQBA 2HHVA 3KK2A 2HNZA 5HRPA 2Z1JA 5KRSA 3F9KA 4N4IA 1JLAA 5I42A 3O3HA 1FKPA 4CGJA 3HPOA 3KKSA 1SL1A 4FLZA 2Y1JA 2HHWA 3ZSZA 3AO2A 3I0RA 4LH4A 3JSMA 3NE6A 3AO5A 4CGIA 4FJKA 4AHUA 5IAYA 1VK0A 3P8HA 1CXUA 3S3OA 4RW9A 1OYXA 3I8DA 1HJRA 2B8AA 1BI4B 2RHYA 3MP1A 1SV5A 1WSEA 4N5SA 2X6NA 3ME9A 1C1AA 2X74A 4J2EA 4KI4A 4C5HA 4M41A 4FJXA 3B6PA 5J2MA 1SL2A 1HQEA 2G8UA 4UQGA 3S3MA 4C8MA 4Z02A 3MXJA 4F2SA 4GW6A 1HYVA 1K6YA 3D45A 1REVA 4IG0A 4CFCA 4JLHA 3VQ7A 3M8SA 4O0JA 2B4JA 2K3XA 4BACA 3QEWA 3MXIA 1GOCA 3LP2A 3B6OA 4ZTFA 4N41A 4CHOA 4LD6A 2HQXA 3QIIA 1OZ2A 2AJQA 1RTDA 3BDLA 4EDUA 1HRHA 1KVAA 1YVUA 3OVNA 2IS3A 1VSIA 3LPTA 2WOMA 1ZYQA 1RTJA 4CJLA 4ZHRA 1WSJA 2VG7A 4FM1A 3CQ8A 3NNQA 3TI0A 5IN1A 3TARA 2XY8A 1Y97A 3MXMA 4CEBA 4F3TA 1RNHA 3KLEA 5JS2A 3KLIA 3SI6A 1U47A 3DLHA 5C0MA 2RN2A 4I7FA 4AHRA 4FK0A 2IDOA 3V6DA 1NJWA 1S9GA 2RHIA 3AA5X 3ISNC 1TK5A 4BE2A 4KB1A 4PL6A 3DYAA 3QETA 4CJQA 3LGLA 2P5GA 4FLWA 1RDCA 2X35A 3OYAA 1WNSA 4M3YA 4CK3A 4KV8A 1IH7A 4OLBA 5HRNA 4DSEA 4OGCA 3P1GA 3HP6A 1YTAA 4PLIA 1UA0A 1RI0A 4HHTA 4NS5A 3BDPA 4B9VA 4IBNA 2Z1GA 3OYMA 4N4HA 2DFFA 3VQAA 4NZGA 2RF2A 2NUBA 3DLBA 1RT7A 3SPZA 3G0ZA 4KAZA 4DTSA 1TK0A 2HNYA 2XY6A 4FK2A 3NAEA 3VQ9A 4H4MA 5HROA 4OGEA 2GUIA 1VRUA 4JS4A 3RWUA 1VSFA 4AHCA 3LWMA 4CK2A 3ASMA 3PX4A 1IKWA 4NCGA 3SV4A 4FJ9A 3ZCMA 4Z4EA 1NJXA 2OPPA 4CF1A 3HSTB 2G8FA 1IKVA 2PZSA 1RDAA 4QW2A 5J39A 3TABA 3SZ2A 2EKOA 5C24A 3L2QA 1UWBA 1ITGA 3F73A 1RBVA 3GOXA 3ZT2A 1LW0A 2M1HA 4QOZB 3IS9A 4C8OA 4FZXC 2MWOA 4FLYA 3O3FA 1LAVA 1LAWA 1R0AA 2BGGA 4C8KA 2M16A 2P0KA 4DG1A 3OS2A 3CFRA 4FJGA 3LH0A 1X1PA 3OYJA 3TAGA 4X34A 1YTUA 1X9SA 4NYNA 2PQWA 3LZIA 1H3ZA 3OYEA 3HL8A 3AVFA 1JXBA 4CJ4A 3V9ZA 4F2RA 2LCCA 1VRTA 2QXFA 4DTNA 4FLTA 4FLVA 3MEWA 1KLMA 3V9XA 2HW3A 2MWPA 2VG6A 5KCHA 4FJJA 4FLXA 3KK1A 1B9DA 2XHBA 4W5OA 1JXEA 4CJTA 4HCZA 4B08A 3OYBA 5CZ2A 2X4YA 3NF7A 1RBRA 1RT1A 3HPGA 4AH9A 1G15A 4IUQA 1KFSA 1OI1A 3LANA 2OPRA 3WNHA 4HCCA 4AHTA 3PV8A 1NK5A 1C0MA 2HHSA 3VQDA 4KTWA 5EU7A 3OYLA 3QIOA 1KSPA 2F5KA 2HHUA 2YNHA 1XWLA 4CEAA 4B8AB 4CJ3A 3OMCA 1BQNA 4GY5A 3SQ0A 5JS1A 3L2VA 1S1VA 3FFIA 3DB3A 3ZT0A 1SL0A 3AVCA 1WLJA 4KKOA 3MEUA 1VSJA 1QSYA 3VA3A 4DU4A 4Y1CA 4R5PA 2QK9A 2OPQA 3OYIA 4KTZA 4MFBA 3JYTA 3PX6A 3OJSA 1GOBA 2RI3A 1DTTA 5T7BA 2XY7A 4DTRA 3E01A 3IG1A 1UA1A 3OYHA
chains in the Genus database with same CATH superfamily
3V8LA 4C30A 4YRVA 1D1CA 4X1EA 1ZRCA 3GBTA 1BR4A 4M7DC 1QNTA 1MUDA 4CZLA 2QA4N 4DQSA 3U3YA 2FBXA 2E3IA 5FU6B 3BW1A 4FM0A 4RGXA 4E2FB 3KP2A 3ZSWA 4OMLA 2P5LC 3CC7T 5CVJA 4K0KK 3CJ1A 4B9XA 3HVRA 5I22A 3K2AA 2A68F 1W0TA 2LJ1A 4M78G 1YNZA 2RJCA 3WT0A 4J9BA 2OYQA 2QKMB 2CQQA 1L3SA 1U9NA 2GWRA 4EPCA 4DGWB 4DTUA 3AVGA 3CYMA 1A35A 3RTRA 3R3LA 2XF7A 1ABQA 3RESA 2O8BA 2FF3B 3CFPA 3IWZA 2DTUA 4MLOA 3GYHX 2F5EA 4DTJA 1JL1A 2QWPA 1A5VA 4DOWA 5A2QO 4OLAA 4C0ZA 4CJSA 2IVNA 4E3SA 3O5ZA 1Q81C 1U49A 4XIUA 2R5ZA 3RZOJ 4HZFA 2W84A 2CGHA 3LPUA 4ON0A 3CMET 2P51A 2GEMA 3PUFA 3I5SA 4DNCA 1HKCA 4B43A 1BR2A 1XNIA 3O8HA 1YITI 1ZBIA 2FRWA 5FU7C 1VQMQ 1TV6A 2FL7A 5HLFA 2Z0WA 4KRFA 1O57A 1RI7A 2HQNA 2KDSA 2MW8A 3F2KA 1D5YA 3ZSRA 3TAPA 5GAOp 4J6WA 5AZIB 4CGHA 1KK7A 5I9EB 4Z4FA 3GLXA 2P7CB 3CMMA 2P4TA 4DOZA 1S9HA 4IOCL 5F1JA 3I0XA 4PGHA 1I6XA 2VBWA 1KC8C 1TWBA 2QKKA 2DOFA 5HVQC 2ZF5O 1O3TA 2FPEA 1N9SA 4M4ZA 3K4NA 1VQMN 4DUYK 3G6EQ 1N5YA 1BIZA 2WAQN 2CH0A 3FEOA 3CC4Q 4JI4K 4CCNA 1WAJA 4HEA2 5IHNA 1RT5A 1VQKA 4BC4A 4QKUA 4CHZA 3U4LA 1A0NB 3F8NA 1VQPQ 5IY5H 4OMZA 3IH4A 4R56A 1VF9A 4F9OA 3P9CA 2EZHA 2HDWA 4LMYA 1YVNA 4XRSG 4AFQC 4BR0A 4ZYEA 4B9UA 3JRDA 2EQRA 3BWGA 4B9MA 2ITGA 1WH7A 3HB9A 1YI2I 3V42A 2GTOA 2DTRA 3G6EN 2R5ZB 4ID1A 2RDPA 1C0GA 3DKWA 3CC4N 5HP1A 2COMA 2YUNA 1YIOA 1Z9QA 5GANh 4I9LA 1C0WA 4HT9A 4PJNA 4ISEA 2MD5A 1TUGB 1VQPN 2EINH 2A1RA 4LJZF 3F8FA 3LZJA 2L8DA 5GAMj 3O6BB 3NTHA 3EQLF 3O1WA 3ZMZA 4W5QA 5FLXK 1X9JA 2LQWA 2KT8A 2GFUA 4HX7A 1BCMA 1A6QA 2R5MA 2HQAA 3I56I 2W7NA 2Y0SA 2E60A 2QAZA 3I53A 3TOAA 4EM2A 3QRFF 1VQ4A 4J2BA 5FU7B 4B09A 3CMYA 2HTSA 3VSLA 3HO1A 2CGKA 1EIFA 2TRTA 4LFUA 2CQ7A 1E4FT 3PMIA 4HKEA 1OMIA 4RCBA 4DV4K 1VQNQ 1WI3A 1WPYA 2KKOA 2QF7A 1MKMA 4Y17A 4YIIA 1LOJA 3X26B 3ZN1A 1P7IA 2BTFA 4O5BA 3K9JA 1BCOA 3RKQA 1VSEA 4E9GA 3QYBA 1Y1WJ 1IDZA 3DMJA 3LDNA 3LAMA 1OVQA 1HW2A 2OZUA 4EA5A 2QKLB 2Q31A 4L9NA 3I55I 5TISC 2UXBK 1MMGA 4CFBA 1KQ9A 4NC8A 2IJLA 3FKJA 1QHHD 3K57A 3LGFA 1XQHA 1UELB 2FZCB 1VQNN 3HM5A 3ITHA 4YDUC 4KBOA 1YCYA 4M7DG 4BY6C 2LMDA 2K40A 3U2RA 1UMQA 1N27A 4LIUA 5GANe 1YFNA 2GXBA 4BNCA 3CCET 2K9NA 3WNFA 2QSGX 3DP7A 1PHTA 5CQXA 1F4KA 4RB0A 1HX1A 3C6UA 2DA9A 1UGVA 1HNZK 1VQ8T 4EMKC 4BHCA 4RB2C 1WHUA 3THYA 3VEZA 3FXUA 1HKBA 4F17A 2NOEA 2RVCA 2AZVA 3VU3C 2DA2A 4QSHA 4HV5A 1K4US 4RMOA 3SHFA 5KN8A 1S1NA 3FXQA 3KUFA 3AV9A 2XVCA 3LSPA 4LUDA 1FMKA 4RG8A 4QS9A 2FRHA 1LV5A 4NBQA 1KSWA 3VEXA 1S1XA 4Z4GA 5GAMd 2CZ6B 5D6XA 3U9ZA 2XDPA 3F3XA 4WCEL 4JYAK 3F8MA 4YFXF 3VSKA 1OEBA 3JCMQ 2CW7A 2W40A 5LMUK 4GNIA 1T3LA 4DWIA 3HPWA 4QAGA 4DLGA 5KE2A 4JJNK 2NVTJ 3CCLA 3CCVA 3AL0C 2F4MB 2DOEA 2EYQA 4TVRA 4A3FJ 2P9KB 3U6FA 2CREA 4HSRA 3NGYA 3MP8A 3R60A 2ZPHB 2LDUA 4DS4A 3CM6A 3HK2A 1WBBA 4JJBA 5AT1B 4E6KG 4RM2A 2JA6J 2JWLA 3FBIB 2V51B 3CF2A 3GVAA 1HPZA 2MC4A 1DJ7B 3F70A 3G4SI 3DLEA 4FPBA 2CFXA 4RB1A 1XG1A 2HVIA 2IS1A 3MZHA 1TWFJ 4ZN1A 3ABKH 1RDWX 1OKJA 1GL5A 2IIMA 2X6XA 3CP2A 1VQ7Q 3THYB 5GINA 4OMQA 5AZJA 4YG2F 1FIPA 2G8KA 2M0OA 3O4QA 1W9HA 5GMKi 3I5UA 4Y3OA 2ZJQL 4BRDA 1D8KA 4C8QC 3QNOA 2O8CA 4XTYA 1IHVA 1TNSA 4EMKB 4KA4A 3GCMA 5D6FA 2ZXIA 4BJ6C 4JOMA 1TOVA 1XSDA 3H0HA 2G9WA 2HSPA 4JZ4A 3LP0A 4C23A 4RB3C 2LRQA 5A0LA 2HKNA 2KJBA 4HW0A 3JSCA 2LSOA 1VQ7N 1JKPC 3IWFA 5LJVA 2W6LA 5AIPA 4NCAA 4A4HA 3TSUA 5IH2A 1U84A 3KEQA 2EPDA 3G1OA 3A01B 1XX5A 4JKGA 3UPUA 1WJRA 2Z9OA 2VI6A 4D7MA 5J4VA 2CP3A 5ICEA 4BHPA 5I2SA 4JYKA 4HBLA 3U1DA 3IRQA 3F5TA 5IT9Z 2XDBA 4DYCA 5L3CA 3W2VA 1QSLA 2FOKA 4FPAA 4J9CA 2VKDA 3AL0B 3CC2I 4C5EA 1QLYA 2FHDA 4HCBA 4RW4A 2NRRA 3DXMA 4BDZA 3L00A 4II2A 2CW8A 1UE9A 1MIJA 4JK7A 2DA6A 4B9NA 2EB7A 3K2ZA 2Y2ZA 1TQIA 2GIVA 5AZJB 1F9NA 3TSQA 4JK9A 2KJCA 2DK8A 3CF5L 1P6RA 5F1RA 2LDMA 4KGXB 3W0LA 4EVVA 2M9UA 3CD6I 1YAGA 1ZBLA 1V4TA 3SAFA 3BG5A 2FLOA 2YRCA 4HOBA 3OS0A 2DYIA 1JUSA 2L0KA 4IEJA 3WEEB 2P9IA 3ERED 1WSUA 3TAEA 1NLOC 3EYYA 2HSTA 4CEZA 4CIEA 4JKGB 4OPJA 4BXUA 2ETJA 1ZAOA 3BFMA 4KDPA 1OPLA 4AHVA 4OPKA 2M30A 2KQ2A 4CRIA 3P31A 3ZSXA 1M8VA 2YNIA 5A0DA 1IG8A 4LSNA 2XRNA 2EZIA 1M3AA 2NNNA 3IH2A 1P92A 2VJ5A 4FSVA 2HF3A 5C12A 3Q1JA 5B66C 1XGNA 2E2OA 1K8AC 3C6HA 3QEIA 4Y4RA 2XPVA 4PJOG 1IXDA 2VLAA 3W3DA 1V4SA 4CO8A 2VQLA 4ISGA 3TAMA 1HOMA 4LH5A 5EXWA 4Z4CA 4J2DA 5GPAA 1SRMA 3CCMT 3RPUD 4HG2A 3FZMA 4DZPA 2QKBA 1OVYA 4JK8A 1P59A 4BUPA 3PNWC 3QSUA 3ZGKA 3VA0A 5KAFC 4KMUX 1QSSA 5LJ5h 4DSFA 1MBFA 2GM4A 1SS6A 4CHUA 2Y4XA 2M2EA 1K61A 4ZYDA 1NGBA 2QWMA 2JTFA 1TL3A 3L9FA 2XKPA 2FBIA 1WJ5A 5TKWA 1FT9A 3C6TA 3QU3A 1UOCA 5IXBA 1UTIA 4RTZA 3WVEB 4DU1A 1NGIA 3CDLA 4FJ5A 1FIAA 2AQFA 1H88C 1R36A 3QBXA 4C9YA 4J19A 3HOTA 1T0JA 3VUBA 3E1YA 4UNFA 3J80O 2M4KA 2CQKA 1VQ9A 1YG2A 3HOSA 4EAHD 2UXDK 2CH6A 2EQJA 5K14A 3J7YJ 1YHQA 3GTMJ 4P5OA 3DKYA 1GVJA 4I98B 2X1EA 1NYGA 5CR4A 3VQCA 1N36K 3VQ8A 4RWTA 2R5AA 2FF6A 2BVMA 2M0YA 1VHXA 1BI3A 2NS8A 2HDAA 3VYRB 4YPRA 3KLHA 4Y52J 4RDUA 2BE9B 3QJYA 4AYBA 1W7PD 1BBZA 1JXOA 3K59A 4ENNA 2OTLI 3D0SA 3EFRA 4C8QG 4P96A 3KWIA 4I2OA 1MZBA 4JRPA 3M4OJ 1VSKA 2O5RA 4IUUA 4DMNA 5ILVA 4OB3B 2Q1NA 5LJ5e 5KYUA 3VOVA 2GA1A 4JRQA 1X1AA 1LFUP 2W85A 4QIWN 2V75A 1W0UA 2ID6A 4FWKA 4QQDA 2X78A 4UVBA 4ZGJB 2RH2A 2R7YA 2YHXA 4II1A 2F5VA 4CA0A 2YX7A 4U87A 2DODA 5CKFA 4JRIA 2P1JA 2DRMA 5LRSA 1GCQC 1R6RA 1BGXT 4M7AD 2B9SA 3KVGA 2E4HA 3IH7A 4DFMA 1VTNC 1H89C 3L2WA 4XLEA 2J06A 1VQOI 3CJNA 4GGGA 1QRYA 2Z1HA 3SBGA 4LDWA 2GUPA 3BZKA 1D09B 2GLOA 2L4MA 5D5VB 3JB9H 4W97A 3MFKA 3CJTB 1J0RA 2PYLA 2J5OA 1NG2A 3BQYA 3CCQQ 2MSYA 5K7FA 2M34A 1RAFB 4DTOA 3G71A 1RACB 2F4OB 1WJFA 3AFHA 1IV6A 3HHHA 3CPFA 2XAFA 4WCIA 1MBHA 1VQ6A 4E19A 1ASWA 2YKMA 3H1QA 1S1UA 4MIMA 4XU3A 2IA0A 3WGIA 3HBTA 4FYDA 1LQ1A 1K76A 2YUSA 5HDGA 4K41A 1A36A 2HQRA 4DTMA 1RKTA 4G6TB 5KYUB 5KN9A 3VTIA 4CIFA 2R7TA 2VYPA 3FZFA 3QG1A 3CCQN 3HOUJ 1VRLA 1FX7A 1QU3A 3WNEA 1EKEA 2VJIA 4BRCA 2XGCA 3W2AA 3CJ9A 1M2VA 5SWMA 2C0IA 3WGHA 3SAHA 1FK9A 3D5LA 3D7EO 4RGSA 2XGXA 1U5TC 1RT2A 3HI0A 3EGXA 1J7KA 5FFZA 3SNNA 2PVOB 1KEAA 3ZMVA 3AVMA 2DERA 5JICA 3CCJT 2AKLA 4PSWA 5GJWB 4PJOE 5M3FJ 2LF8A 2EFPA 3LQRA 3OA9A 2NUPA 4H0PA 1VYTA 2YLBA 2IGIA 4Z88A 2BW3A 5KE3A 5BRHA 4U0YA 2E6MA 4M3TA 2A5WA 3EN9A 3CP8A 4Q4ZF 3J7YP 1RAGB 3ZSYA 4O5FA 2MG4A 2ZPGB 3O6WA 3ZR8X 4IXAA 1RCHA 3CQYA 1VQ5T 1UGRB 1WSGA 3MX5A 3ERMA 5J1EA 1YITT 5GANg 3RMQA 3ASOH 4LC9B 2ZXJA 3CPEA 3GEZA 2A3SA 3TR8A 2XK0A 2VOOA 1HD3A 3FZLA 1GLEG 4RW8A 1UGSB 1TUUA 1OPKA 3P5JA 2QWNA 1TS9A 2JWTA 4E7JA 5I11A 2LREA 5CKDA 3PO4A 1WWXA 1MGTA 1HQCA 4IWVA 1BOBA 1W5SA 2P7VB 3JCMX 1KIKA 5DTDA 1HBXG 4J83A 3HSEA 1WN7A 1D9FA 2KIUA 3E6BA 1YIJQ 1T03A 2JUGA 1NEBA 5IT3A 4I0AA 1KA8A 1N75A 5KQ8A 2HCKA 1FTTA 3EGXB 5HOOA 3ESWB 4ELZC 4LD0A 2M87A 3DQVC 5FW9A 1D9DA 4CI6A 3M8EA 4L5EA 3LSJA 2XAHA 1LFPA 3DPLC 2ZZDA 4M7YA 4NC7A 3CMAT 1YIJN 2WONA 4RTXA 2ZM6K 4XRFA 2E2IJ 2DE0X 1YI2T 3JRAA 5IPAA 4FM4B 3ULEA 1C6VA 1QHTA 4O8KA 4M75D 3J8AA 3EEQA 4UUSB 2A28A 2EFIA 4E1NA 1NJIU 5E17F 3LA3A 4F91B 1MHNA 2EIFA 2PLYA 2BV6A 2XDVA 3PSIA 4CF9A 4AHSA 4KMFA 1U6ZA 3Q7BA 4LF5K 2NRVA 2EK5A 1X2NA 1U1TA 2G3RA 2NLUA 3E1SA 1LEAA 2PY5A 4DR2K 2JG6A 1OQKA 3H45C 2M9HA 1N77A 4ILJA 1XG7A 4U0WA 3M57A 2AHQA 2OD5A 4PJJA 1GDTA 3Q5FA 5E79C 3RSNA 2VUBA 2X48A 1ZA1B 1K78A 3LDPA 5GAHP 3MZYA 1IBKK 1R71A 4UC4A 3QU6A 3VS4A 1IKYA 4L9TA 4XOTA 4M72A 2KDZA 4EGYA 2X9HA 2CT4A 1GRIA 5AQRA 3FF5A 2ECCA 4UB6C 2RJDA 3ZT3A 3MEDA 2UU9K 1M90C 2CP6A 5KYXA 1QWEA 2PMUA 1KD1C 3I55T 3QLHA 4B9WA 4WF9L 1QQJA 1E4GT 3OIPA 1YJWN 3WQTA 2XSDC 4ENJA 1PSEA 3QWYA 4XU0A 3D2FA 4KUIA 3OW2M 1M3CA 2XGEA 4OWRB 1HYSA 3NWSA 2VUMJ 2YUOA 4U67L 4PJMA 4C92E 5M1PA 1WOQA 2K2VA 4OINF 1IC8A 1ACMB 4L6V5 4M42A 1XSXA 2ZPIB 4CFAA 2DMPA 3J7AF 2DTHA 5GAN8 2ZPFB 3WGGA 1HKQA 3QYFA 2JTEA 1B6AA 1JLCA 4XNFA 2P9NB 1FMWA 5BPDA 4LG3A 3SUPA 2VBZA 3DKXA 4C2UA 4PFPA 2P6TA 3IFRA 3CUOA 2ZJPF 5C4XJ 2MI6A 3OB9A 3PNYA 5FPEA 2QGGA 4CJVA 3WE2A 5BPLA 5DM6F 3CG7A 2HNHA 4KB0A 1WQ7A 1U8RA 3OHRA 1FBQA 2JMAA 4H0OA 3OYCA 4UUVA 2HHHK 1I3QJ 3ZQLA 3BZ6A 5KYXB 2HQEA 2K9GA 2K6DA 4IO9F 1MW7A 2YG8A 2HHXA 2YUPA 1ZBJA 1EV7A 1HSQA 4H03B 3TO7A 3DLGA 1HKGA 3MJXA 3LMMA 1G3YA 4KHNA 1BO5O 2DEUA 3W2WA 1TKTA 5CO7A 2IS2A 3G4ST 4FJLA 1VIEA 1T38A 3S3NA 1ZRFA 3SEMA 3HOVJ 1OQYA 5HRPA 5H2FC 5LEKA 4IOAF 2HYFA 3RQ4A 5HKCA 2B63J 3VRYA 2E1HA 1R49A 2MMPA 5JMVA 1KAXA 3KKSA 1SL1A 4JUVA 4GRIA 3NVMA 2AO9A 1YQRA 5FPDA 4LH4A 4CICA 4IFEA 2GQQA 1R5HA 1AT1B 1VK0A 3CC4I 2VBYA 2BZXA 4ENKA 4LDYA 3IDHA 3ZMSA 1OYXA 1P4WA 3I8DA 2Z33A 1VQPI 2E7WA 2B8AA 5IXFA 1WSEA 2V1NA 2F6CA 3B6AA 3HEFA 3VPRA 2M1BA 2HBJA 4FWQA 4H0VB 4FYYB 1OYWA 2KHOA 3B02A 4WQ4A 3ID8A 3ZXSA 5LGUA 2VQGA 2AT1B 1REVA 3TREA 4IG0A 4RTVA 3RNJA 5FO5A 2JHJA 2RMOA 3QBWA 2JW4A 3JSPA 3CC2T 2YCHA 5C2FA 2K3XA 1I0CA 1XNQK 4AG2C 4BRMA 4WFBL 1R1UA 1NNEA 3MXIA 3V7RA 2WC2A 5BREA 2BE7D 2AJQA 4EDUA 2CSIA 1FC3A 4KH5A 1ZLJA 1R0BG 5LLQA 3CJBA 5KYWA 3LPTA 2V7FA 2Z99A 1ZYQA 2LX9A 3G25A 5LJ5g 2OTJA 2A7YA 2VG7A 5C44J 3CQ8A 3NNQA 2FB7A 1VQNI 5DM7L 4B23A 1VQKI 4PL7A 1SD4A 1WHHA 3TP3A 2RGVA 4HLXA 4F3TA 4FQGA 1KAYA 2RQQA 1RNHA 1N39A 3CZ6A 1OULA 4GYGA 5AQZA 2DO7A 3F0CA 3KLEA 2LMJA 2NOHA 2R93J 2CUBA 2HR3A 1NM1A 2GGRA 4M77D 5AQKA 4IXCA 2IDOA 3V6DA 3K70D 2L5QA 5KVRA 2QW9A 1IAWA 1QVFP 3HOWJ 2RK2A 3FHZA 4PL6A 2HQHA 3DYAA 1GBRA 2K86A 3R8EA 3IKTA 3BJAA 5LGNA 2QQ8A 4JKAA 2BE5F 2KAFA 2EFQA 2JMCA 3LGLA 4CJQA 1YJ9A 2L2PA 3OYAA 1WNSA 5GAOn 3L1PA 1J59A 3JCMg 2F5TX 3I58A 4XONA 4KV8A 3Q3SA 3H5NA 4KIGA 4YFNF 2A5XA 1EA3A 3WU2C 4MO7A 2UUAK 3IAS2 4F7UE 3VYSB 1NGNA 1IH7A 5HRNA 5KAIC 4Y13A 4WQ5A 1YTAA 3NQOA 2DAOA 4DR3K 4RCHA 1UA0A 2ID3A 1GV5A 4D8DA 3OSSC 3BDPA 3RZDJ 3OYMA 2PVDB 4DEXA 3CCRQ 4R55A 1Q7YR 3G0QA 5KYWB 3M4GA 4LLGF 2NOGA 3ZQFA 4F16A 2OAZA 4XKBA 2FVUA 5BN8A 3ZOBA 1E0EA 1BA0A 1JCGA 2A6HF 2XY6A 2KBTA 4FK2A 5B8HA 4OGEA 3IMXA 2UYTA 1YF5L 3RWUA 1H9TA 3PSFA 3HKZN 4AHCA 2BVLA 3MKWB 1S29A 1H3HA 1HW5A 2HTJA 2VBXA 4PJOA 1IKWA 2ED1A 2NOFA 1T8IA 1ZC6A 3CCRN 3HSRA 3PJRA 5E3MA 2X3XD 4BI3A 2YU3A 1EJ9A 2E3HA 2CZ1B 1LJ9A 3AG2H 1IXCA 3TABA 3SZ2A 2HYJA 2EKOA 5C24A 1GUUA 2VJ4A 4JJDA 1LOTB 3REAB 1ITGA 5HS9A 2HMAA 4J9HA 2XU8A 2QZ8A 3QWXX 3ZT2A 1TSFA 2RKHA 4RAYA 3CCSQ 2GX9A 3C7JA 2M1HA 4QOZB 3A5OC 2IPQX 4FZXC 3U8XA 2MWOA 5AJ3K 1XQSC 3HSCA 4V19K 4A54A 1LAWA 2JA2A 4GYIA 1VQ7I 3QOEA 2M7AA 1B7TA 2MC3A 2JSCA 4JI3K 2E7XA 2QCOA 1ZQ1A 3BC8A 4I6MA 2VQEK 4A53A 1TXQA 5GAMh 4U7BA 1NGHA 2MIOA 2GXAA 4QVCA 4NYNA 3QAHA 2VT2A 1KQSA 1QCOA 1AKHA 4I99C 3CCSN 3AVFA 1VOMA 1JXBA 1M1KR 3EETA 3V9ZA 2LCCA 3LFKA 1MBEA 2A41A 1Q82O 1FYKA 2EFOA 1KQJA 2QYOA 1H92A 3CCLI 1U2VB 4FWLA 1KQSS 2MWPA 2W0ZA 3CCVI 5LMNK 2V52B 4FJJA 1Q86C 1T3SA 4CSWA 4BJTA 4CJTA 2LVSA 1VQOT 3PNTA 3TQ7P 5AQOA 1RRQA 1LCKA 4EHTA 2X4YA 3NF7A 1WZ2A 3M54A 3ID6A 1DDNA 1IREB 1RBRA 4XORA 2HGCA 1SHFA 2EIJH 2PMZA 4BRFA 2EILH 2YJFA 2OPRA 2NVXJ 1NK5A 2E1YA 4CZHA 2UUCK 3F10A 3UA7A 3VQDA 3GIBA 4N0AC 2R7VA 3HXLA 2WA0A 4LFAK 3N4MA 3ONQA 3HOZJ 3PIPL 2F5KA 2PFBA 4KISA 2MFZA 2RAEA 2MLGA 4KH0B 1XWLA 4WYBA 5FKOA 4CEAA 3URGA 3DEUA 4B8AB 4IX7A 4CJ3A 4ORZA 2KIMA 2HXOA 1BQNA 2HNIA 4GY5A 3BPXA 2K7LA 1MH4A 1DGRM 1S1VA 3WQUA 3DB3A 5GAMe 1Q18A 4N0AA 3UA6A 2WV1A 3MEUA 1FYMA 4MDWA 4A3CJ 1G2HA 4JHDB 2QEXT 2VE9A 4CUGA 1AKHB 4B22A 5FKNA 4J9IA 3P9IA 4DIQA 1MUNA 3OSFA 2P5VA 1BIAA 3JW4A 9ANTA 1RLQC 4Z89A 3OYIA 2IBDA 4KTZA 2VODA 1GLFO 1H8AC 3OJSA 2VXFA 4OB1B 2R7FA 3OL3A 1XQOA 3L6QA 5AIQA 1G3WA 2DZCA 1MWMA 4A57A 3A5LC 1SSHA 4VUBA 2NOBA 5GANj 1JKOC 4M9ZA 1X01A 2E5LK 1XDSA 2I7PA 4ZYHA 2H8RA 3CPWM 5B1BH 5LY3A 2DXIA 3NF9A 1BA1A 3R4KA 4NYFA 4C92A 1WEFA 2LT4A 2KDOA 3E19A 1SEMA 1FP2A 3L8BA 3O2PE 4FWSA 2LYCA 4LB5A 3J80K 4DBRA 3K4KA 1C1BA 4OPHA 1V4RA 2QTDA 2A05A 4EMGA 5E26A 1M1KO 4JI1K 1V76A 1Y1VJ 1R0CB 1BI1A 1LEBA 1ZK8A 1X4OA 5D4RA 3P7NA 4QVDA 4OIOF 4M6YA 4BEHA 3GZ5A 4DR5K 4MZTA 2DL7A 4M7AF 1T39A 3JAMK 4DQQA 2QQ9A 3LFUA 2QQBA 2HSEB 3JCMW 4ZYGA 4DU3A 1BQMA 3M5RA 1X2QA 4EEFG 1HSTA 2EQUA 4PJLA 4R8HA 3I3LA 1Y7XA 1S72T 2FU4A 1TYQB 5K7HA 2P5OA 1ZSGA 1ZUYA 1TKZA 5IP7J 1GLDG 4AMCA 4A2UA 2K02A 3H35A 1MDMA 1C0TA 4RGRA 1MUZA 4M63C 2DAQA 3VMFB 2PTKA 3DU6A 1E3PA 3HIFA 1NTCA 5KCOA 1I5OB 5LJ5f 2P9UA 3DM2A 4DR7K 3HVTA 1KVBA 2VCPA 4FJIA 2C6YA 3DLMA 3K9KA 2R3SA 3OH6A 4CZMA 4IUPA 4F7UF 3JRBA 1HXDA 2CP2A 4BD3A 1T7PA 1V55H 1A5XA 4EATA 4FE4A 1W7AA 4BE0A 5J2QA 5AFUA 3DEEA 3DPUA 3MN5A 3DFGA 1X43A 2RREA 3SZGA 3ZSOA 2GELA 2FRYA 5GANd 5GAN5 3MEGA 3BG6A 2LJ3A 3RMCA 4BEHB 2JJ7A 1P4XA 4EIKA 1K9MR 4K8ZA 3I56A 5DUIA 2L7MP 2KP6A 1QMCA 5L3DA 3VQBA 1RRJA 2Z5UA 3LQQA 4PFZA 1IV8A 2XAGA 1W2BM 2YPRA 3ZRGA 1DPUA 3K5NA 5D6WA 1U1SA 3SJJA 1B9MA 2L2OA 4UY8O 3C4SA 2A6AA 3MAQA 4FYVB 1PP7U 2JT1A 4FVMA 3QESA 4AC0A 3TU5A 2MABA 2WADA 1F1BB 3N5BB 3QNNA 1MDMB 3M0TA 4B1YB 5IT9O 4XU1A 3OMYA 3P39A 3GL1A 1B92A 2W6KA 1VQ9I 4B3XA 4B9TA 1WDXA 3NH1A 1W7PA 1VQLT 2O03A 2EJ9A 1QVGP 4FHTA 3M7GA 1PU6A 4ZN3A 1U3OA 4Q5WA 1N32K 3VQPA 2QASA 3PO3J 1QPIA 3CCQI 1CZBA 4JRKA 1Y0UA 5FLMJ 1MNDA 1R58A 3F6VA 2OI3A 5BN9A 4OMFB 3A0HC 3KK7A 4M7AC 2IGOA 2B86A 5CYMA 3QDKA 4HVUA 2QM3A 3FXJA 3VEPA 3AVKA 4JJCA 5LFAA 1L3LA 1M5Q1 2MH2A 1XNRK 5JLHA 2KEAA 5JVGF 5F1XA 2NS7A 4DR4K 4EW4A 2VV5A 2MA3A 3ZT4A 1Z67A 3DAWA 1JB0E 3QKJA 4JKFA 1IO2A 2ATCB 5CYVA 4F4KA 1FYNA 3LDLA 5BNGA 1KFZA 1JE8A 5GAEP 4RTUA 3SZTA 4NXMK 4GY2B 1RT6A 1ZUKA 5C2DA 3CCUQ 4XTVA 2YX4A 3M53A 4AFUC 3AA2A 1X69A 4KHQA 4CVNE 1W7PB 5ILUA 4A3GJ 1BU6O 4AWXB 4KO0A 2FUG2 3MKYB 5D6EA 2VG5A 3O9TA 3W6VA 1YWPA 3A2FA 1ODDA 2K5CA 1NEGA 1Z1DA 4IG3A 2MK5A 2Q0UA 4N9IA 4YY3K 1K9MO 5I21A 4F7UA 2KRSA 2ZD1A 3DBRB 3D6RA 1V5EA 3CCUN 1O3SA 4CERA 4CDGA 2D2WA 1VQ6I 2DMOA 2COWA 3RDIA 4HQMA 2IW5A 3OBYA 4RCCA 5H1SQ 1L3TA 2CV2A 1OX9A 2OZSA 4OB0B 1D0YA 1W0HA 4BWMA 4P1WA 1KC8U 2H56A 3M07A 4M7AB 1XB4A 3IHOA 3FZHA 4KITB 3CC7Q 3QICA 5GTHC 1IG7A 4DFPA 2OCEA 4A0XA 1I3AA 4W1UA 3DTEA 5EEAA 1YIJI 1RC9A 3JRIA 2JT4A 4MNUA 2V1UA 2HHTA 2O88A 1GLBG 4CC4B 1EH8A 4CJPA 2KIFA 4OF1A 4BGAA 2DYBA 2AP1A 2CSOA 1Q95G 3PFSA 3O08A 1Q81R 1QQCA 2M8GX 4ZJZA 5AONA 4WF2A 4XK8E 1PVEA 5LJ3h 5J8FA 3CC7N 2WAFA 3SQNA 1RBSA 2VE8A 3KLFA 2OA8A 3U9DA 4RG2A 3R6SA 5J4YA 4W5NA 2PN6A 2VWJA 1JHHA 3FX3A 2FPDA 1QVPA 4F7UB 3FKIJ 2PEXA 1KHIA 3CMEQ 1TTHB 3R6NA 3A8OB 4F8RA 2DX1A 3MO8A 1YS7A 2H8WA 3KP7A 4EJVA 3THKA 5F2RA 1LWYA 4RAFA 1W5TA 4RM3A 4BQAA 3T1YK 3D2EA 3RIRA 3MPUB 5AR0A 2COYA 4A62A 4CI0C 2V6CA 3CMEN 1KU7A 4M75C 3A0BC 4KH6A 1FZPB 2JA8J 2K3BA 3ZN0A 1Z25A 4G7ZF 3BQZA 3H0DA 1YJWI 4FISA 3CD6A 4KT0E 1VQKT 3KTQA 4C3HJ 1VFCA 2G6FX 1YRNA 4E0DA 4CHYA 4DQ2A 2LLKA 3B73A 1RAIB 2AZSA 3H92A 3RJPA 2ACJA 2BANA 3OQ5A 3DXKA 2EJRA 5AQTA 1ABOA 1SD5A 2DXTA 2L3DA 2LY1A 4V2FA 1JBMA 1SD6A 2KRFA 4Z4HA 3JCUC 4MHGA 1QVUA 2DFIA 3MCPA 2Y1IA 2PAVA 4F3OA 1LWFA 3C7NA 5E1ZB 5AQWA 3DCFA 3PIOF 3H6ZA 5DY9A 3P38A 5HDNA 5CVIA 3LP3A 1YJNA 3MWTA 4LGWA 3O80A 3O3KA 2IA2A 3HJEA 2B6AA 4NLCA 4KH1B 3DB4A 1EP4A 3FJ5A 3NF6A 1X6BA 3ENHA 4O0IA 1FTZA 2EQIA 3K5OA 2C0OA 1SQKA 2FPFA 3S1RJ 2NXNB 4LLLA 2HBKA 1XCVA 3FR0A 1VQ4T 5HODA 1WSFA 1OJLA 4EMSA 3NTKA 3RRGA 1GXIE 4CCJA 1BC8C 1AZGB 1OU8A 3SMPA 1Q81O 4LF6K 3RI4A 2DYRH 2RHXA 4YIFA 3FZKA 4D0PA 3KZYA 5BRFA 5KI6A 1P7JA 5KK1A 4WE1A 4CJRA 5IOZA 5LJ5d 2EV5A 2CH4W 3TAFA 3H0GJ 1S6PA 1EH7A 4WXDA 5EGOB 2KQRA 1ZH5A 1V3FA 2IVMA 2Z2SB 3A8HB 4M75B 4JKDA 2YU9J 1B9FA 2Y75A 5CIUA 3GNFB 2ZGZA 3QINA 1TU0B 1R1VA 2XPUA 2YHBA 1UHSA 3C7NB 3ZMTA 4A3BJ 3MEAA 4A4KA 1NG6A 3HZJA 3GTOJ 4NQWA 3MEXA 3SEQA 1DUXC 4FVUA 1IBLK 4FJ7A 2ZBKA 4W5RA 5K5QA 1QQIA 1SFOJ 4XTXA 5LJWA 5M1KA 3ATUA 1DQUA 3LW5E 2HBMA 4E9HA 3FMQA 3CCEQ 2ECBA 2E2PA 3A03A 2GBYA 4QQ6A 3ZFJA 5GMKj 4EP4A 2QTVA 1YWOA 3JCMd 3V7SA 1VQ8Q 1NOYA 1N33K 2VKHA 2LQNA 3LLRA 2OTLA 3MDQA 3J7AO 5BPNA 1ZXOA 3PUBA 4I01A 3QO9A 4BS9A 1K73O 2JWKA 4DJAA 1NKCA 1KAZA 1X3UA 4M6VA 3DJCA 1TT0A 4M77F 4QS8A 1UG0A 3CCEN 3EYIA 4D8KA 3ZQCA 2XAJA 1RABB 5F0FA 2Q2EA 1A5JA 5LHGA 4XSXF 4RW6A 1IZ1A 2DRKA 1IDYA 4CHPA 2LSNA 4HCKA 2XHIA 1VQ8N 3CCLT 3AVHA 1QW1A 3TANA 3CCVT 3AVAA 5GIPA 2EGCA 2H3GX 3LSGA 3L2RA 4GLKA 3LA7A 1UAXA 4LE9A 2Q2RA 1QQOA 1JCFA 3P83D 1AD5A 2EV6A 5KPTA 3DBHB 4RKUE 5EJCA 4EQQA 1VQOA 3PIOA 2B0LA 3NARA 3F22A 1T8EA 4QS7A 4DF4A 3G7ZA 2DO3A 4Y0WA 1U06A 2E64A 2RHZA 2P9SA 3EUHA 3T7ZA 2ZXWH 1ZARA 1WHJA 1Q82U 2XRIA 4LLNA 2V8JA 2VASA 4LB6B 3HSBA 3H36A 5ADXH 4M75G 5CE3A 2FXAA 8AT1B 3AVJA 2MYSA 2YI1A 3CXCM 2VVKA 2WB1N 1A31A 2EJGA 2Q2EB 3BF1A 2YLCA 1S1TA 1BIBA 2XHCA 3TAQA 1IN7A 2IAIA 1ZGAA 2RKIA 1S6QA 3MMVA 3K69A 3T1AA 1FEXA 2ISZA 3THXA 1GOAA 4PL8A 4RTYA 1HU0A 4FSSA 1MUYA 3TSZA 2EV0A 1OU9A 2P9PB 4FL6A 4NO7A 4LFBK 4DQPA 1KU9A 1BK2A 1JU5C 2L9SA 3QEXA 4EHUA 2PMHA 3AO4A 4G6DA 1NE8A 4B9SA 3RPQA 1K8AU 3VQEA 4LXCA 5IHKA 2DN0A 1W6XA 1JGGA 1EF4A 3H08A 3FM3A 1SRLA 4BR2A 4KHUA 2NVQJ 2EYWA 3WTUC 1U04A 2QDYB 2HMPA 3S41A 5F27A 1AWXA 3ZMUA 4M77C 2HL3A 4HX8A 3NPFA 2E10A 2XF6A 1PU8A 3EFOB 2E70A 3GFMA 2FSNA 3CCRI 1FXXA 4M78D 3HGGA 4MEYF 1HPMA 2FF4A 4KHYA 1IXSB 2EWNA 3GX4X 3OBWA 1SF9A 4B3RK 4HNTA 3E9FA 4S0HB 2YHWA 5DCFA 2X4JA 4HF0A 4EW0A 4DHYA 1WEIA 2BZ8A 2WSEE 2FSKA 3I33A 3JSOA 4IIMA 2YR2A 1V5GA 3KLOA 4A3JJ 3TOBA 1JUPA 1ASUA 2XUBA 4FXDA 3AVLA 3D5SC 2EQKA 2W00A 3I0TA 3K1PA 4BRHA 4FJ8A 4LN2A 5IYCJ 4FWOA 3BR2A 1WXUA 5GAN3 3O4WA 4JBAA 2NZTA 2MLKA 1HYZA 4YOYA 1O3RA 3VPZA 3RMBA 1J5YA 1IV0A 3LL7A 1KG3A 4XQ3A 2GWJA 3I35A 3KD1E 3CJAA 2LC4A 2YXYA 5J2PA 1XC5A 5GAGJ 3JCMJ 1YQLA 2GV9A 3QERA 3FJPA 4M3ZA 3HDDA 2JA5J 1ZBUA 3AO3A 3FHFA 2QTXA 6AT1B 4CEFA 4IIOA 4CF8A 3KIOA 2CP7A 4IQ4A 1G5VA 2KE9A 1ZTRA 3HFOA 2DPDA 1BN5A 4JI7K 3CCMQ 2P0QA 1JLEA 2KLOA 3RMAA 4HDUA 2VQHA 4WCGA 3EG3A 4XBFA 3RMDA 5DYMA 2V7YA 1ETOA 3ABUA 4CCHA 1WHMA 4M77B 1J3TA 3OYYA 4ZTJA 4KGVB 2JVVA 2OF7A 1GT0C 4KUMA 5HLTA 2JPSA 2VWBA 3IKMA 4HF2A 3RR8A 4NDLA 3THWB 4BY7J 2R7OA 4IHWA 4N4GA 3QP5A 3CCMN 1M1EB 1TVRA 2JM9A 4KJZA 4OFAA 2WWYA 3T3FA 3L4QA 4DQIA 2XROA 4ZNXA 2KFZA 2F48A 2RA2A 3JRGA 1VQ9T 4M3RA 2W04A 3M58A 3KYCB 3ZQIA 2HOTA 2QWWA 1N8RO 1IG9A 5GAMf 2MBFA 5LL6S 5FKLA 1HQUA 1YHQT 4JNEA 5HLHA 2R5YB 3N97A 5B3SH 4OO1J 5IYBJ 2QA4A 4BUGA 2JPBA 1AOYA 4PWDA 1QZEA 4YFKF 1FOKA 1XHXA 1B72A 4BR4A 4PKIA 4CYDA 1KQ8A 3CBOA 2FBKA 2P0WA 3K1MA 1CQTA 4GMJB 5CYQA 2DF6A 1Z21A 1SAZA 2BYVE 4PLLA 5M1QA 1NHAA 1NK3P 2ZGYA 1ILYA 2BXZA 4B3SK 1SKSA 1VSMA 3E6DA 3I54A 1JUMA 2WACA 3OW2A 2XIGA 2RI5A 3ENOA 2DXBA 1G59A 2WAEA 2GWKA 5AQJA 4Q48A 3MN7A 3I59B 3DU5A 4UV8A 2RQWA 5TRDA 3ZX2A 2D4WA 2D0BA 4E4HA 2QDLA 5B1AH 2LKXA 1KXPA 1GVDA 1PUEE 4XLPF 1AEYA 3V7CA 4XAXB 2DTZA 3S2WA 4C1NK 3AY9A 1ZBFA 3GO5A 4LSLA 4DZJA 1DT9A 2CKKA 3SB2A 1MDUB 4IKFA 3C12A 2E71A 2OZMA 5C0YA 2Y69H 3V1RA 3WNGA 3ZYYX 1KCFA 4M7DD 3QP6A 5D8KB 3EFSA 5CCAA 3VF4A 1GFDA 5LJ3g 2PUKB 4KFCA 3DLLF 1LFBA 4A5BA 4OMMA 1XMOK 1O9SA 4A4FA 1TUDA 1RGIA 1LMZA 3QFPA 4A59A 1EZZB 1LW2A 2I5JA 3G71T 4HUGA 1J53A 3MECA 1B72B 1XOVA 4J7FA 1QVTA 4E1MA 5E3NA 1VQ6T 3OYKA 4AIDA 3UKGA 5C4JJ 1VQMA 4B1RA 4AFZC 3HRUA 2IAJA 2JPCA 1ZGWA 2LOOA 1NKUA 5FLVA 1M9SA 2WAQA 2O8EA 1XMXA 4BRIA 3L1AA 2FQ4A 4MDXA 1RAHB 4OU0A 1WEGA 5DM7R 4YOUA 1DKGD 4M3GA 3C6AA 3D1NI 3QYHB 1BI4A 1WB9A 2C06A 4NB5A 2KTQA 5EDNA 1IGNA 4AQYK 1F36A 3FHNA 2RHKA 4I2PA 3EKUA 2O8FA 2Z16A 3UR3C 3PY8A 5BQTA 3NAUA 3G6EA 4FX4A 4MZMA 3BY6A 1M2OA 4HAMA 1YQAA 2XAQA 3CC4A 1E2XA 5F0CA 5KHDA 1FOWA 4CECA 1X27A 1E3OC 1KTQA 1TUYA 2JSPA 3HXMA 1SMYF 4KN7X 3SAGA 4F04B 1VQPA 2ASMA 3CCJQ 3VERA 1UG2A 3ULDA 4AFSC 2L9VA 3AVIA 2JN0A 2CQNA 3VESA 1MV0B 3KK2A 2HNZA 4FE7A 3WXJA 3KP6A 3CUQA 4EIAA 2DA5A 2ZJRL 1B1BA 1B59A 5KRSA 4N4IA 4DK9A 3DBLB 2CV0A 3BCAA 3I5RA 5J1RA 4CGJA 5HK3A 1SC7A 3BEXA 3HPOA 1VQ5Q 1EWRA 4X0GA 4BBRJ 1YITQ 2Y1JA 2HHWA 3ZSZA 3CCJN 3VW4A 3AO2A 3CTAA 2CZ0B 2EKHA 1BOTO 3I0RA 4P9FA 5GAN7 1M1FA 2O8EB 1J09A 2CUJA 1NPPA 1RAAB 4FJKA 2EWSA 3L2CA 4RW9A 3CHWA 1N3AA 1BI4B 3MP1A 2HDDA 4DEYA 1VQ5N 3ME9A 1C1AA 2X74A 4KI4A 1IJWC 4C5HA 1YITN 4M41A 3O9QA 4FJXA 3B6PA 5J2MA 1SL2A 1E3MA 3H46O 1KQ0A 2G8UA 4R79A 2P6SA 3S3MA 5BMZA 2O8FB 1Y07A 2D6FA 4C8MA 1VQNA 3CBMA 1M90U 2O8BB 4GW6A 1K6YA 1DGWY 1HYVA 1NGEA 1KD1U 4JLHA 5BS6A 4AU7A 1SVOA 1IN5A 4V2GA 5L3BA 1D3BA 2EH3A 2LD5A 1VNDA 3LSIA 1K4SA 2XKOC 5J47A 4BACA 1Y0MA 3CUQB 3DLLA 3CMAQ 5J3BA 3LP2A 3B6OA 1SANA 2X85A 4H0TB 4KH4A 4N41A 1Y64A 1ZLMA 1YI2Q 3S14J 5HNHA 4KYWA 1ZA2B 1M1GA 4LD6A 1W70A 2HQXA 3S8PA 4PGGA 3SFIA 2Q0RA 1GCPA 4AG1C 3OVNA 2M4GA 2XKOA 3ZMDA 2IS3A 3JAME 1VSIA 2IP2A 4XOPA 3TO9A 1PYVA 2VB6A 5K5RA 4ZHRA 3V8JA 4FM1A 4DCHA 4J8OA 3CMAN 3D7SB 1HLVA 3SFZA 2AXLA 3TVTA 1JJ2A 1TWCJ 3TARA 1HK9A 5K1YA 5FPNA 2QGFB 1YI2N 1FJGK 3MXMA 4CEBA 2F7TA 2FEIA 1VAZA 3CBPA 1BG3A 2HOAA 2LJ0A 1UFFA 3ZCOA 2M8EA 2QSHX 5JS2A 1M90R 1T33A 2DNUA 2XSJC 4D5CA 1JJ2S 4XK4A 1KD1R 2W03A 2PI0A 1NJWA 3J81E 5AQHA 3AA5X 4X6AJ 2OAWA 4KB1A 1QPMA 4GXOA 3CWAA 1XJWB 5IT9E 2JUCA 1RDCA 4JN4A 3BY5A 1C0FA 1T98A 5EZGA 1GFCA 4OX9K 4HT8A 4M3YA 4F52A 3I55Q 4NB4A 1FW6A 2DKGA 2W10A 2MAMA 3P1GA 2L54A 4PJOD 4FO0A 4ENMA 2BTTA 4B3MK 3O8GA 1RI0A 4LF4K 4BBSJ 4NS5A 2ESNA 1O4XA 2KK4A 1R00A 2MOXA 4IBNA 4M7XA 2DFFA 3VQAA 2RF2A 1MBKA 1IGQA 4LK0F 1E3HA 3DLBA 2HZDA 4M78E 3GFJA 3CCYA 3G0ZA 4OIQF 4KAZA 4DTSA 1TK0A 2HPIA 1HLUA 1GBQA 3NAEA 3VQ9A 3I55N 1BWFO 1PG5B 2CS7A 2DT7B 2NUZA 1VSFA 3AAPA 1ZX6A 4LF7K 1VQ7A 5E8GA 3LWMA 3CC7I 3ASMA 3VGLA 2WBMA 4NCGA 3SV4A 1NG7A 2FXUA 3IUCA 1CZAN 5DS9A 2OPPA 1ZG1A 2G8FA 2Z1DA 5EEHA 1IKVA 2LG4A 2DTOA 2BOLA 2PZSA 2F5DA 3S93A 4GKJK 3E9LA 3GWZA 5HLGA 2X6OA 3L2QA 1UWBA 1QZZA 2HKOA 3GOXA 3JB9G 5D4SA 2M7BA 3WXKA 2BY0A 1K73U 1ATSA 3IV5A 3E0JB 3CESA 2BEOA 1I1JA 5L8RE 3PVLA 3CMEI 3TU4K 2NVUB 1AWWA 3G4SQ 4DG1A 4FJGA 3CFRA 2DJZA 3WE3A 4IHSA 4FSXA 2Q1ZB 4X34A 4O6JA 3LZIA 2FEZA 2FD5A 4PKHA 1H3ZA 2GOXB 3OYEA 3A8MB 3MHXA 3E7LA 3JAMZ 1LNXA 5GAN2 2AKKA 1X3MA 2EA2A 4H5TA 1H641 1KG2A 5ERIA 4FOEA 1TWHJ 2O31A 2H27A 3QFUA 3G4SN 3KK1A 5FWBA 2XIDA 1B9DA 2H1LA 2CYYA 4FWNA 2XHBA 1JXEA 1YOVB 4HCZA 4JI5K 3UKUA 3EG2A 3H41A 2VXZA 5DPKA 3I4MJ 3T1BA 2ZAEA 1G15A 1TWGJ 4IUQA 1KFSA 3LANA 2FA5A 1JT0A 3SLCA 4FIBA 3WNHA 4FT2A 3J81Z 2KZGA 3K1NA 2YX6A 3T69A 2E1ZA 1LVAA 3DV8A 3LM9A 4B48A 4A69C 2P8TA 3QZ5B 5EU7A 1FNNA 3OYLA 3ZPLA 2NNYA 1ZRDA 1VI0A 3VETA 1R1TA 2AHJB 5ICFA 1J2XA 3CC2Q 5JS1A 1Y8RB 1IRXA 2QM1A 2RD1A 1NH3A 3GP8A 3NEUA 1MJBA 4YORA 3E97A 3KCCA 1FN7A 4BRAA 3HBLA 3R6OA 4KKOA 4OAZA 4M9XA 1VSJA 3BF3A 1Q82C 1BW6A 2R7DA 1OYIA 2RPNA 4DU4A 4C92D 5CQYA 3SMSA 3CPWA 1P8ZA 2K4BA 2QK9A 2VPLA 3FWEA 2I8DA 3JYTA 4A0YA 2OC6A 3PX6A 2OTJT 1R4NB 2RI3A 2AK5A 1DTTA 2O8CB 2X6WA 2VC0A 1JJ8C 3AG3H 3CC2N 1YBYA 2XY7A 1JI8A 3CPWS 1YX5A 3UKUB 3OYHA 1POGA 1TTYA 4KFBA 1XMQK 1NZ9A 3CVTA 4K11A 4M7DE 3KP3A 1QTMA 3H1VX 3VYTB 2O2OA 5KRTA 2TDXA 1YT3A 4OPAA 4CJKA 1JLFA 5AQVA 2VQCA 3GW2A 1PCXA 2K57A 4BWJA 4B1ZA 4IOCF 1OLTA 1YJNI 2RNJA 3LWLA 3EH2A 4B6MA 3FXRA 3TGNA 4L8RB 4QPOA 2OQGA 1YJ9T 1S5JA 2L3QA 4AM7A 4V2SA 4X66K 1TNTA 3MEEA 2JMWA 3R6MA 5CPRB 2KR3A 2BHZA 4U0VA 4QPQA 4BVPA 1TG0A 3W3CA 3HGYA 3DXMB 5D5WB 4MO5A 3EUKL 1EFNA 4HDVA 1T05A 3EG9A 1HNVA 2KRNA 4FWPA 1TAQA 2NOJB 4BU2A 1ETKA 1U48A 4KBMB 1S3JA 3WTVC 1VQ8I 5J3LA 1JLGA 3DOKA 2Q0OA 3HRMA 1N9RA 4O44A 4CGZA 4XTUA 4M45A 1OR7A 2RF0A 1TWAJ 3OMGA 3J7AY 1XDUA 1J54A 1XTAA 4I0BA 3CDIA 2GFAA 2ZB9A 3VFZA 1LPQA 1UUEA 3IAM2 1M4ZA 3ZEUA 2GCXA 2XMFA 4EP5A 2FYKA 2OPSA 2LH9A 3M59A 1EH6A 3VKIA 2J6FA 1SVLA 5KYNA 1X6GA 2P9IB 4PHTX 1Q86U 2NRZA 1JLBA 1RRSA 3KLNA 3X25B 2ELKA 3K4JA 1KHCA 3A02A 2FMLA 4CJEA 1M1KC 1ZBSA 5CHZA 1MU2A 2JRTA 2NOLA 4OOIA 2E6NA 1PP8F 1W2BA 4IVNA 4EM0B 4F93B 4A3LJ 4Z2YA 3C2GA 4M78F 3JCMh 4HV6A 3AAFA 2IVOA 2YKNA 3VQ4A 1KG6A 3LYIA 3H3OB 3CCQA 2A3LA 4YIRX 4XH1A 3M8QA 2DT5A 1NK7A 2O9VA 1W2BS 2KY9A 1CGPA 3WTYC 1ZHIA 3A8GB 4CESA 3WTSC 2FOWA 2NS0A 1TAUA 5TKYA 3MWMA 1SHGA 4XN3A 5CJ9A 1XHZA 2R92J 5BPMA 3SWNA 1IHWA 1N8RU 2SEMA 1O3QA 2DL8A 3VQ6A 3TEDA 2RM4A 3Q0VA 4EJZA 2D9TA 2KT1A 4A93J 3JCMb 4O4GA 4KRTA 4CJUA 2ROTA 3LX7A 3BT9A 3S6WA 1JLQA 3SQ1A 3ZEUB 3FGUA 4JLIA 1BA5A 9ATCB 4KHWA 4B1XB 4M3XA 2CGJA 3A5MC 2N8GA 5LJ3j 3ZEHA 1LDJA 1ITYA 1KG5A 1T0HA 4A2BA 2VC1A 4LD9K 1J5OA 4B4CA 4ZZLA 3KYLA 4N9HA 2PU9B 3H8ZA 2FSWA 4E7HA 1MMNA 3BR0A 5GTIC 3R61A 4MEXF 1VQOQ 3PLAA 3VV0A 2E5QA 3FXMA 1XGSA 2CH4A 3NGZA 3RTVA 3ABTA 3QPTA 2H3JA 3C65A 4E7IA 4DF8A 3K9TA 1TGOA 4GVEA 1L5UA 1NLPC 3JCMe 1ORPA 2F9TA 4DSLA 2KFNA 3CEYA 1QA6A 3SXYA 3ZETA 3C0BA 3NH2A 4LF9K 2ECZA 2ME6A 1UZCA 1LE8A 1ETYA 1X3NA 1KG4A 4I2QA 2JLEA 3IP4B 1MH3A 1T56A 4B47A 1ZBHA 5J1YA 3GF5A 2I7NA 4CW7B 1ZUUA 4ZDOA 2E6LA 3NMZC 2QUFA 4CEQA 4Z0UA 3AAQA 3PO5A 2DL3A 1WHKA 2VL8A 2F69A 3KTUA 5GMKh 4QVZA 4R1HA 3CQZJ 1OCRH 4LFCK 1QS4A 2QEXQ 1NGFA 2ZKZA 1WBDA 3U21A 2DD5A 2K5LA 2DA4A 2HVSA 1Q9YA 2NUTA 4XKWA 3JS6A 3RVCA 1TT5B 1YIJA 3SUNA 4B21A 3SUQA 1ERDA 4ZC3A 2EPFA 1LDDA 2G7UA 3OY9A 3CLOA 1U78A 3VYGA 4DSIA 1BM9A 4J7IA 3FBNB 4IHTA 4HNUA 3X2QH 1LB2A 4M78C 1QBJA 4ELTA 2E19A 1X4PA 1RBUA 2ZMEA 1DTQA 1ETQA 2W25A 1K4TA 2F8TA 2ZJQF 4F7ZA 3VB2A 1YS6A 3BGRA 1YQMA 4DQRA 2QEXN 1HKTA 2R7UA 5C3EJ 4OVLA 2XI9A 3QO3A 2CDTA 3KWGA 3HM9A 3K6GA 5LJ3d 3DRSA 1X9MA 1LDKB 1RT4A 3CM5A 4M78A 1EX4A 3A98A 1OKRA 4H4KC 1YN8A 1APLC 1LE8B 1G4DA 3NMUA 2HNDA 3OOUA 4C8LA 1UHMA 3CCMI 2L01A 3A5ZB 4GV3A 4HXJA 4LK1F 2I5WA 2PUOB 1GLLO 3GZ6A 4J2AA 3MKLA 4MLHA 1K83J 1U6GA 4CHQA 2COBA 1WJCA 3MQ0A 5C42A 5GMKe 4IFVA 1X19A 4C8NA 3MP6A 1NG9A 2HEOA 1SFUA 3ALYA 4QLCU 2P81A 1WKMA 6PAXA 4M7DF 4X62K 2L89A 1M3HA 2W42A 1U5SA 2A0FB 4M3DA 5E8IA 2WY7Q 4BH9A 1M2VB 5I2MA 5CKEA 4DBFA 3GZNB 3FMSA 2JN6A 1YJWA 5D7UA 3KP5A 2BUPA 1S72Q 1K9MC 3T0YA 2OZ6A 5BR9A 4GV9A 3CF5F 4J9EA 2CP0A 2ZMEB 3NTIA 3SYZA 3M8JA 3OYGA 3Q0UA 2NUPB 4XMYA 4IOXA 3KK3A 4C8QE 5BRDA 2BW3B 3DEWA 2ZFWA 2CSQA 3NGPA 4IHXA 3LSHA 1SPKA 3HOYJ 4WTOB 1TKXA 5M1OA 5M1FA 4M78B 1R22A 2CH5A 3GOIA 1S72N 4RTWA 1WGXA 4ZGEB 4IO8A 1X9WA 1AZEA 4ISFA 2A6TA 2DQLA 1OCTC 2BIVA 2ED0A 1FJLA 1WSHA 1RLPC 3EYZA 5K7ZA 3O5BA 2AA4A 1PU7A 1Q8IA 4X65K 3O4NA 4F14A 1BHLA 2CT3A 5L23A 1U8BA 2KPMA 3CVSA 5KTQA 4DSKA 4JP0A 4JDSA 4DLEA 3I56T 1YO5C 5DV5A 1MBJA 3VS2A 2CJJA 2X3WD 5AQSA 4XRSA 4NHJA 4MGRA 2PJPA 4TV7A 4MO4A 4YOXA 4UV9A 3V4IA 3SPYA 4HSBA 2WC9A 3LAPA 2A08A 2EA4A 1UHFA 3UKRA 2IVPA 1ZHFA 2PBIA 4HYEA 1BL0A 4IZ9A 3J7AP 4XR6A 1O75A 2ZNYA 3JRCA 2P4RA 2O7OA 1G83A 3K2PA 3HT3A 2J5PA 2HB5A 4L0ZB 3IAYA 5FKMA 3KLGA 5AQIA 2DT6A 1HCRA 3QBYA 4CIGA 4JX5A 5FJ8J 2QA4I 3NWTA 1VQLQ 4E7SA 1UG1A 2K7AA 1ZG3A 1BYMA 3L3VA 1FKOA 4B8CA 3ULEB 1YP5A 1NJIR 2EFNA 2YUQA 2PQ8A 2BUDA 1CLQA 2D0NA 1U45A 3TSPA 4DBQA 4C5IA 2YSRA 3EH1A 1NPRA 1Y71A 4P55A 3NGIA 3SV3A 2LFBA 2IOCA 2BKDN 5A2QK 3HYFA 3MN9A 4BJ5C 3LA2A 2EX3A 3T9NA 4H8KA 1QVFM 1B3QA 2OFIA 1OH6A 1VQLN 2I2LA 4O55A 1S22A 3A0IX 3QODA 3HTSB 1TL1A 5AQLA 2ENMA 1NWKA 5AZIA 1GLNA 3R9PA 3BZCA 2ZCFB 3FLGA 3FRNA 3C18A 2XRLA 4A0ZA 1B34A 1V1CA 3UKRB 4II3A 3ASKA 1C0UA 4M7DA 3ZSQA 2EGEA 1K78B 1XQPA 2DI3A 4A2AA 3RBBB 2PVGB 2FMYA 3QIPA 4A6EA 3VENA 1SFEA 1S1WA 4JAXA 3SDGA 4ELUA 4HVVA 3ML6A 4N4NB 1SUQA 3KBGA 3PQKA 4BQZA 1DLOA 4BXXJ 3VN5A 2XO7A 2RN8A 4M3UA 4EFHA 1WJAA 2HMIA 4FJMA 2DDAA 3LSTA 3CCJI 4XLFA 1SZ2A 2OBPA 2B5JA 5E3LA 1RETA 4IF4A 3SZPA 1WXTA 2WTEA 2A3ZA 4ANJA 4ABZA 3D2FB 3E5QA 3NFCA 2QVOA 4DV2K 4WWCA 4HRIA 5JVTA 1NGGA 1MWKA 2YV0X 1XTDA 1WQWA 2VKVA 2ICWG 3DTIA 1VQ5I 3OTOK 3BDUA 3GFIA 2P0PA 2MGQA 2F9WA 1VQMI 5E20A 4B44A 2V26A 3OSVA 4C0GA 3T1HK 3EAEA 2KLAA 3AVNA 2ESHA 3M0PA 2KZMA 4Q5VA 1SMTA 1ZREA 1T95A 3SFMA 2JXBA 5E41A 4FZZA 4BDPA 4XM3A 4CZCA 1B34B 1Z7UA 2L3PA 2DIGA 4M7DB 2RNAA 4BC2A 3J7ZI 3QMLA 4KREA 3JTGA 3G6EI 2DILA 4CCOA 4WQ4C 4RLFA 1YFHA 2RB6A 4IFYA 1Z91A 2V6EA 2J05A 1YUWA 4PJOF 1NJIO 4ZZDA 3FMRA 2XC7A 1MD0A 3RDVA 3N05A 1Z05A 5CLSA 1Z26A 3EG0A 1KQSP 3GTGJ 3SQ2A 1Q9XA 1I07A 1ZN2A 2M0MA 2QYZA 3CXCA 2E1OA 1QKXA 2X4HA 5J26A 2A61A 4UB8C 1ORKA 4C0DC 5C15A 3VYHB 3CMAI 4H0XB 3F6OA 4CZGA 2XF5A 3FHGA 1IN8A 3DRPA 2OA4A 4H5NA 1X1DA 2XV4S 1K73C 2DVEA 3GMEA 3CXCS 1KONA 1XGMA 4KIFA 3O8MA 2KW4A 2V1XA 3F8BA 1M27C 5E1WA 2DEQA 3IKVA 2QBYA 2ZPBB 4CEOA 3MN2A 4HTUA 5D3GA 5KYYA 1VSLA 4IDHA 2JA7J 2PX9A 3HKZA 1LNWA 2V8KA 3I9QA 2X4XA 1BIUA 1GHCA 3CCRA 1OX8A 3CD6T 3RR7A 4BRLA 3Q9VA 1PM3A 2DLLA 5J6XA 3KKRA 5GANf 1NBWA 3TO6A 2DA7A 4YEJA 1K79A 4CBXA 3BTLA 2CW0F 4DBHA 3QUIA 5JR3A 5FRNA 1VQKQ 3TWHA 4A3EJ 5HDKA 2STTA 1KYWA 2JHNA 4OVAA 4U7DA 4XL9A 2OQRA 3OGDA 4C8QF 1PVSA 3MKDA 2TCTA 3K5MA 4BY1J 2DJIA 5DK5A 2GIZA 5C6SA 4IL6C 2KROA 1YJNT 2W82A 4P9UA 2FO0A 3LWHA 2P9KA 4AIAA 4D7NA 2L0AA 3K4LA 4AVPA 2BY2A 2NVYJ 4WQ5C 1QZYA 1X1BA 2X6YA 3K4BA 2ZSHB 1UHCA 2F2WA 3TTDA 1I94K 1VQKN 3VS3A 5KH6A 4X9DA 2F96A 4C0DB 2QBYB 2K27A 2H8HA 2EAYA 4A4GA 3ZSVA 5F64A 3CCSA 3GBQA 5KYYB 4BL0B 5E1XA 1CKAA 4JLGA 2F1LA 1C1CA 2LTPA 5HL7L 5EOYA 2YNFA 1IN4A 4YDUA 4OIPF 3WTTC 3UIQA 1VQ4Q 3S16J 5CY4A 1S5LC 2D1KA 1NJYA 2DQRA 2UXXA 1JQQA 2DU9A 4IUVA 4PJOC 2I10A 2HBPA 3QYEA 3S32A 3U9GA 4L3QA 5FROA 4DFJA 5HLIA 1QKWA 3V1QA 3M3YJ 1RI9A 4EMKA 2IGKA 4ELVA 5F04A 3AHUA 3T8RA 4Z6YA 2LP0A 1O1WA 1ZYRF 2QXLA 1F5TA 4IHVA 2XHKA 4S05A 3LSKA 2Y0SN 3FK7A 4M3FA 2X6SA 1VQ4N 1ON1A 4B9LA 3BR3A 2OU2A 5CVRA 2F5CA 3S1QJ 1Z0XA 4H0EA 3A01A 4CFDA 2IC3A 2E36A 3LP1A 2HVRA 4WK8F 4XTWA 1PUFA 2DFHA 3PT9A 4C92F 4CGFA 2GA2A 3FE1A 4LY7A 1RR7A 4OKEA 2HQ5A 5FLXE 2R57A 4GO1A 1G99A 2R58A 5FRMA 4FLUA 4DTXA 1KFDA 1NK9A 2EYYA 4DV1K 4QCLA 5MLCQ 3A4CA 1KU2A 2WSFE 4XEIA 3RCOA 2OTLT 1NMDA 4BY6B 2ISYA 4NUBA 2LK2A 1FMVA 2J6OA 4EJYA 4HNVA 5HBMA 3BROA 1K0SA 4C2TA 2M0CA 3K0SA 2G8HA 2ME0A 3ZLJA 3V81A 2HEQA 4LDVA 2KSSA 4ZDLA 2UZKA 2FZKB 3X24B 4KUDK 3MN6A 1W97L 1MJAA 4PZJA 1P2FA 2RQUA 2ZCWA 1NK8A 2EYXA 1R5ID 2HD0A 3VEVA 4PJOB 2CUEA 5IYDJ 1I8FA 3WEEA 3CCLQ 4H4OA 3CJ7A 4OAYA 3CCVQ 4JKHA 4C8QA 1QHGA 2KRHA 3KZIC 3SDZA 4CJWA 2OV7A 3IHUA 1WYXA 1J9AA 3KXTA 4ATOA 3MCAB 1SEUA 4ICLA 3EHQA 1KO9A 2E1MC 1J75A 1PUFB 2E2JJ 3NF8A 2DJNA 1PKTA 4FW2A 1RDDA 2JNGA 5L3GA 2ABLA 2FBTA 1Q7YO 4L5GA 2BZYA 4DOVA 3DRRA 2VQFK 1KGSA 3CCLN 3AARA 2FZGB 4AM3A 3CCVN 4D9JA 2NRAC 1I4K1 1M3BA 1QVGM 3TEEA 4MZPA 3HJFA 2DD4A 2H94A 1JL2A 2YHTA 4L59A 1R5GA 2EZKA 3N4QA 2OUMA 4CGDA 1FP1D 1BI0A 2IRFG 4I6MB 3VEWA 3LNQA 4LITA 1MPGA 2QWOA 3R0JA 4WXCA 1MNMC 5I3UA 1GXPA 1N8RC 2V1RA 4DQ8A 1OPCA 1SAXA 4YNQA 1Z6RA 2FE3A 1QQNA 4BE1A 3M0UA 4A4EA 3E9GA 1RTHA 2L3SA 2FG0A 2L9RA 1EETA 3LWFA 2R7RA 1LVKA 3ZT1A 2X9DA 2LY2A 4OMPA 4C92C 4A3KJ 2XB5A 4C8QB 4KN4X 4MFDA 1JKRC 1N78A 2P84A 4KTQA 3E9PA 5JI6A 3R2XC 2VN2A 3PX0A 3RKYA 1I5LA 3VJPA 1NKEA 4J9GA 4OKJA 4BC5A 4IPAA 2UWMA 3HP9A 1ATNA 4I02A 4E9EA 4KHPK 1IJJA 1ON2A 2JTMA 3JCMV 5AQGA 3KEYA 1N6QA 3TPQA 4DFKA 2E1MB 1ZSZC 2RHUA 3JR9A 5FLXZ 2RC4A 4DSJA 4I9QA 2QENA 2Z3YA 3M56A 2W41A 4MDAA 2DK3A 4XH4A 4JK1X 2XY5A 4PA1A 1V54H 2DIQA 1T08B 4J6XA 4E7ZA 1U0JA 4BI4A 4DR6K 2E5ZA 1ZSZA 3KX2A 4Y28E 2KRCA 2KI7A 2K9SA 4B3AA 1ZBXA 3RUXA 1BJAA 2EW3A 2D0QB 4A6DA 4HUEA 1T44A 2HVQA 2ZQBA 5LHIA 1S8NA 2ZPEB 3RSEA 5AQUA 2KRMA 5ED4A 2FX0A 1WI9A 1RFQA 2ROLA 2Z1JA 2HFHA 1QO0D 4AD9A 3ZP5A 1BKBA 3M1CA 5I42A 4EJWA 2VXDA 3O3HA 1P90A 1FKPA 3OV8A 1VA7A 2VWFA 2FQ3A 4K43A 3H5AA 4EA4A 1BI2A 3ASNH 5DM7F 4AUXA 4C92B 2LX7A 3ZX0A 2D0OA 4E47A 2HOSA 3JSMA 2LQKA 4UVCA 1VUBA 1FYLA 2ZJPL 4CGIA 1YW9A 5AQYA 1F43A 5FWCA 1XGOA 3JAMO 2MD0A 1K9AA 1SVMA 1FLIA 4BREA 1HJRA 1BW5A 2E2NA 4C3IJ 4YELA 5ICGA 1SV5A 5DM6L 3F8CA 1I81A 3I4NJ 4IQJA 1R23A 3C3WA 5GAOq 3HSFA 2LNBA 4LDXA 5JLWA 4UQGA 2JOYA 4Q47A 3HFNA 3VEOA 4Z02A 2YDLA 2YHYA 1ENHA 2WTUA 1ZSZB 3MXJA 4IO9L 2A42A 8ATCB 3D45A 3JCMf 3VQ7A 4YOQA 2XD0A 3M8SA 3BTIA 4CZJA 3COAC 1PNJA 4JI6K 2O9LA 1O7LA 4PJ0C 5KPRA 1RR8C 2IGNA 3JV3A 3QPHA 3J81O 3FIFA 1ONVA 1YE9A 3C2BA 3RSEB 1T0FC 4ITVA 4G7OF 1IF1A 1BDGA 4XN0A 3BJOA 3RR6A 4BAYA 3H3NO 2Y0MA 3CWUA 2HYGD 5CKHA 3CCUA 4OIRF 4BQLA 3ZQQA 3LH5A 1VQ9Q 1RTDA 1Z3YA 3BPVA 2LR8A 1KVAA 4IOAL 2P9UB 1YVUA 5LBQA 2QA4T 2A6EF 1YHQQ 1W36D 4FTHA 3O9SA 3CWSA 1NBEB 4IRHA 2WOMA 1T0FA 4I09A 4M6XA 4BKXA 3NRVA 1RTJA 1AHJB 4XQFA 3A1PA 4CJLA 4RTTA 2KHMA 2O0YA 2XG8D 1GCQA 4DYQA 3IL2A 4D5FA 3FIWA 2XY8A 2W48A 2HXIA 1RDUA 2IVWA 4FYXB 3N4PA 4K25A 5AYFA 3NHNA 2XGDA 3TKYA 4KGZB 1AHDP 1VQ9N 4NL2A 4KT6A 3BUZB 1ZELA 1YHQN 3MK6A 1REPC 2RN2A 4AHRA 4FK0A 3TW7A 4EGZA 2ZGWA 3AGKA