3OYJA

Crystal structure of the pfv s217q mutant intasome in complex with magnesium and the insti mk2048
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
368
structure length
368
Chain Sequence
LDAELDQLLQGHYIKGYPKQYTYFLEDGKVKVSRPEGVKIIPPQSDRQKIVLQAHNLAHTGREATLLKIANLYWWPNMRKDVVKQLGRCQQCLITNASNKASGPILRPDRPQKPFDKFFIDYIGPLPPSQGYLYVLVVVDGMTGFTWLYPTKAPSTSATVKSLNVLTSIAIPKVIHSDQGAAFTSSTFAEWAKERGIHLEFSTPYHPQSQGKVERKNSDIKRLLTKLLVGRPTKWYDLLPVVQLALNNTYSPVLKYTPHQLLFGIDSNTPFANQDTLDLTREEELSLLQEIRTSLYHPSTPPASSRSWSPVVGQLVQERVARPASLRPRWHKPSTVLKVLNPRTVVILDHLGNNRTVSIDNLKPTSHQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular mechanisms of retroviral integrase inhibition and the evolution of viral resistance.
pubmed doi rcsb
source organism Human spumaretrovirus
molecule tags Recombination,viral protein/dna
molecule keywords PFV integrase
total genus 105
structure length 368
sequence length 368
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2010-09-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
A PF17921 Integrase_H2C2 Integrase zinc binding domain
A PF18103 SH3_11 Retroviral integrase C-terminal SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2300 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3oyjA04
1.10.340.70 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Endonuclease III; domain 1 3oyjA01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3oyjA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3oyjA03
1GOBA 4A4EA 1LW0A 2X6NA 3K2PA 3BDPA 1UWBA 2O4GA 5KE3A 2VG7A 1NKBA 3T1AA 2DTUA 2RHUA 2YNGA 3MXIA 4AHCA 1RDCA 2FBXA 5CIUA 1IH7A 3NF6A 4CHZA 2KZZA 3OYIA 1WSGA 4LH4A 4CEEA 4J2BA 2E6LA 4LSLA 2RHXA 1KVAA 1RTHA 4CEQA 1D9FA 3EAEA 3SD4A 1A5XA 2G3RA 3V9XA 4F2SA 3U6FA 4KO0A 1R0AA 2P5GA 1JLQA 3P83D 4KKOA 3NTIA 4CEOA 4FM0A 4DTUA 1LV5A 2G8WA 3FC3A 3PX0A 3HPOA 2R5AA 3S9HA 2XHBA 2IDOA 1BCMA 4CJKA 3RRHA 2OYQA 5D3GA 5K14A 2RF2A 3QINA 1RBSA 1BGXT 1TV6A 3OVNA 4N47A 4DTJA 3SQ1A 1NJXA 3KLIA 1NK4A 4DF4A 2IAJA 4CJWA 5T7BA 3NGZA 3S3MA 2GF7A 2XRIA 2F5KA 5FROA 4A4FA 4CESA 4DSEA 3QERA 5HP1A 2G8IA 2EQUA 4QQGA 1BI4A 3OYJA 3O4QA 3DLMA 3HVTA 2XO7A 3TANA 4DFPA 1C1AA 1BI4B 1ZBUA 3B6OA 3HL8A 2OPSA 3CYMA 1L3TA 3AO5A 3RRGA 3G10A 1JLBA 4HCCA 4AHUA 3ZSQA 4X34A 1TL3A 3SQ4A 1VSJA 1SKRA 3NE6A 4I9LA 2XY7A 3TABA 1NK8A 3SJJA 3SUOA 1RT7A 1G15A 4CF8A 3CQ8A 2G8KA 4DG1A 1UAXA 1HNVA 1RTJA 1EXQA 4CIEA 4N5SA 1B9FA 3MP8A 3OY9A 3ZEHA 3AVHA 4M3XA 1S6PA 4M45A 4CJRA 2X78A 4Y1DA 4BWMA 1U49A 4CF2A 3AVAA 1ASUA 3V1OA 3DLRA 2ZE2A 2L89A 5D6WA 1W9HA 3ULDA 3DLHA 1S5JA 4FJIA 2HNDA 4OPKA 4A4HA 2FHDA 3S3OA 3K5NA 3LGLA 3M9QA 1JLEA 3LANA 2FBVA 4NZGA 4FLVA 2HVHA 3LPTA 3V9ZA 1VSHA 1F21A 1WLJA 1Z25A 3DYAA 5KTQA 1IKYA 3KLFA 3NHGA 3K5MA 1Q9XA 3CM6A 2BKDN 3DRSA 4FJGA 2WONA 3L3VA 3TAEA 1FKOA 4W5RA 4FLWA 3PX4A 3RR8A 2B8AA 3OA6A 1VRUA 3IS9A 1KLMA 1RNHA 1VSEA 4FM1A 3P8DA 4F8RA 3QNNA 1CLQA 3QIOA 4W5TA 3L2WA 1NK6A 1D9DA 4CF9A 4PA1A 3CM5A 2DY4A 3LP3A 3EYZA 4JRQA 1S1VA 1IKVA 3RMBA 1WSIA 4B08A 3LLRA 5KRTA 4KAZA 3BGRA 2ATQA 4IDKA 2RJDA 1N27A 1TVRA 5HLFA 4DTPA 1LWEA 4F4KA 4HUGA 3MO8A 1CXQA 5DK5A 4CF0A 5FRNA 3ZSXA 4JLHA 3SUPA 2B5JA 5HBMA 3KK2A 4FLUA 3H6ZA 3V1QA 4FXDA 3L3UA 3TARA 1UA0A 3TAFA 3VQAA 1D8YA 3AVNA 3QEVA 3VQ8A 2QKKA 1C0TA 4QAGA 4PQUA 2XY8A 1VSIA 1J9AA 3AVIA 2W42A 3SI6A 4Z4EA 3SQ0A 2YNIA 3TAMA 1NK5A 4OKKA 2D9TA 2M1HA 1KTQA 4ICLA 1SSFA 2RI3A 3LGFA 5IAYA 1WSFA 2XK0A 5CYQA 2R58A 5KGWA 4DTXA 1IG9A 4HCBA 2KFZA 4OPJA 4F2RA 1RT1A 4FZYA 3TI0A 1ZYQA 2LTOA 3H08A 1QSLA 4CE9A 4E7IA 4A4GA 2LSNA 3AV9A 4PY5A 4FZZA 4Q5WA 4H4OA 3PO4A 4OVAA 2HNYA 3C6UA 3C95A 5IN1A 4AHVA 3RMDA 1SKSA 4QQ6A 1RCHA 1TAQA 4PLLA 4O0JA 4Z4CA 4E3SA 4M3WA 4RW8A 3CEYA 3P1GA 1QQCA 1WGSA 3RMAA 4N56A 1QS4A 4O0IA 2X4XA 1U47A 4B8AB 1DLOA 4CFCA 2EQMA 1NK9A 3NTKA 3OYMA 2BANA 4FW1A 3WNGA 3KLEA 2HQXA 1LAVA 1REVA 4CK2A 3SV4A 5I42A 4CGFA 3OS0A 1KRPA 1QSSA 2PY5A 3FLGA 1HYSA 3LAMA 4FLTA 4FJMA 1ASWA 4FVMA 2X35A 4DTMA 3L42A 1NOZA 2L3RA 1QE1A 5KI6A 3LWLA 1XNIA 1I3AA 4IKFA 4C5HA 2X74A 3PFSA 1WJRA 4DU1A 1ZBLA 4HTUA 3OYDA 2VWKA 3LP1A 4GW6A 2GFUA 4DSLA 3AVLA 3IAYA 4W5QA 3D0PA 4OGEA 5FDLA 2HVIA 1SL1A 1U45A 4N41A 4DQRA 3ZSYA 5J1EA 4DS5A 3ZSRA 2LRQA 1SL0A 3OQ5A 3ALYA 5CZ1A 2HNZA 1RDBA 2KZMA 3MAQA 4N4IA 5HRPA 4FCYA 3OYEA 4IURA 5CYMA 1DTTA 1CZBA 4QQDA 3QEPA 3B6PA 5KRSA 1MU2A 2QQSA 4IUUA 1JXBA 1RTIA 3RWUA 2RJFA 4IBNA 1SUQA 5KH6A 4BACA 3MP1A 1A5VA 1RT3A 2DIQA 3LX7A 2IOCA 3HPGA 3MEVA 2HQEA 3ASKA 1CXUA 3LPUA 4Q5VA 3CFRA 3S6WA 2YNFA 1T8EA 2KFNA 1HRHA 1KCFA 4BDYA 3HYFA 4II1A 4CRIA 3LYIA 1C0MA 3I0RA 1LWFA 1TKXA 3MEDA 3QIPA 1EX4A 1U48A 2LDMA 4RG2A 4CEDA 4KV8A 2PYLA 1ZBIA 4N76A 1TK8A 2BGGA 2P0KA 2P5OA 5CY4A 4K8ZA 5M9OA 1BQNA 1FKPA 1NK7A 3ZT4A 2HW3A 3RR7A 1EETA 3HXMA 1RBUA 4CFBA 2QXFA 3QLHA 3QEXA 4HHTA 2E5QA 1I39A 3V9SA 2PZSA 2VG5A 3NF9A 3AVMA 4ELTA 2OA8A 1H3ZA 1JLGA 4J2EA 3ZCMA 1UOCA 3ZSVA 2WOMA 2RO0A 3NBPA 3VN5A 4E19A 4DFMA 5FRMA 1JL2A 4C8MA 3ZT2A 3LZJA 2DFFA 1T05A 4DSFA 3LDSA 3DLEA 3DLGA 4FW2A 1XWLA 2YV0X 3VQ7A 3VQ9A 1LAWA 1U04A 1JLFA 3OYHA 4R5PA 4WE1A 2ITGA 4DS4A 1TKDA 4C8NA 2G8FA 2BDPA 4RW4A 2RHYA 1KVCA 3C94A 2YKMA 3OJSA 3NTHA 1QHTA 1EP4A 2P51A 3AO3A 4E1MA 3EY1A 2G8HA 2PYJA 3C6TA 4CCHA 3M8QA 5SZTA 3MEAA 4M3UA 1WSEA 3G0ZA 1XI1A 1YT3A 1XC9A 3VQCA 1S9EA 2D0BA 3KD5E 3A2FA 3TAQA 2QQRA 4KRFA 3VQBA 4KI4A 3F73A 3MP6A 3F70A 4C5EA 2B4JA 3HM9A 2NLUA 4PUOA 4FK2A 3AA3A 5HRNA 4KHUA 1TKZA 2RHIA 4E7LA 3CFOA 2AJQA 1HYZA 3SNNA 1HYVA 3DRRA 4QVZA 3QO9A 4CHPA 5KGXA 4YFUA 4FJ8A 1KFDA 3KKSA 1WN7A 4UC4A 4E0DA 4J2AA 2HHTA 1OI1A 4FLZA 2PQWA 3AVCA 3S3NA 3VQDA 2HHXA 4I2QA 4DFKA 3KK3A 4KFBA 4ID5A 2G8VA 4I7FA 4NYFA 4IUPA 3LH0A 1VSMA 1ZBFA 4FZXC 1IO2A 1RT6A 4L59A 3OYGA 1OYXA 2HHVA 3LWMA 5JS1A 2RJCA 4AILC 1HMVA 3HSTB 4CF1A 1VSDA 4LH5A 3K59A 4C8LA 5J2NA 3JSMA 4CGDA 1C6VA 1FK9A 3AO1A 5J2QA 3PO5A 4QW2A 3AO2A 1YTAA 3KKRA 3LP2A 4ELVA 4Z0UA 3QETA 3Q1JA 1BIUA 2EQKA 3VA3A 4H4MA 2Z1HA 4RG8A 3OYKA 3OJUA 1RI0A 4ZTJA 4FJXA 2A1RA 4M3TA 3MXJA 3VQ6A 4CJEA 1TL1A 3MXMA 4NCBA 3CFPA 3HT3A 3HJFA 5I3UA 3ITHA 2YHAA 2KW4A 4IG0A 3NH1A 4HUFA 1UA1A 4B9NA 1B92A 1D5AA 4B3OA 4Z4IA 4O55A 3P8HA 3TR8A 3MEUA 1NK0A 4KHSA 3EZ5A 3M8SA 4CEZA 3NH0A 4FJJA 3OYFA 2YHBA 1K6YA 3I0SA 4B9SA 2OPQA 4Z4FA 5D6YA 4L8RB 1RBVA 3MEEA 3SZ2A 3SYZA 4B9TA 1SKWA 4DWIA 5D6XA 3OYLA 3OMGA 4C8OA 4OGCA 4O4GA 3FEOA 4RW9A 3JYTA 2D5RA 4BE1A 4ELUA 2BIVA 4CJ3A 3MEGA 4FJ5A 3QKJA 2X6SA 3LALA 2E4LA 2ZD1A 4CECA 5SWMA 2YRVA 4CHNA 4JS4A 1Q9YA 1J5OA 2CKKA 3H8ZA 3PNWC 5J39A 4FK4A 2FC0A 2RI5A 4IUTA 3ZT1A 4FJKA 5KCHA 2X4WA 4HCZA 4G1QA 4TSXA 3IG1A 2O4XA 3ME9A 2YNHA 2OPRA 2Z1IA 1RILA 3F9KA 3I8DA 3QIIA 1XHZA 2OZSA 4LY7A 4C8KA 3C4SA 3HVRA 2G8UA 2Q3SA 1OZ2A 3GOXA 4OKJA 1FXXA 2GFAA 3SV3A 4J2DA 4M3ZA 1WJQA 2I5JA 4GVMA 1QTMA 3O3GA 1HPZA 1QSYA 4AHTA 4W5NA 4DQSA 4DSJA 4KTZA 2XY5A 3K5LA 1TKTA 2B6AA 2R7YA 3VQEA 3V9WA 4B9VA 1NJWA 4W5OA 1S1WA 3KIOA 4C5IA 3QEIA 1T03A 4GMJB 3QJ6A 4IUVA 1SV5A 4CJUA 3SPYA 3VQ5A 1X9SA 4I2PA 4FLXA 4RW7A 4Z02A 3DLKA 1NOYA 4OKEA 3KD1E 5DMRA 4HUEA 4BE2A 2P1JA 3ZSZA 2Z1JA 3DI6A 2JGUA 4CJQA 5HRSA 4KHNA 1JL1A 5J26A 1J53A 3AA2A 4KTWA 4NYNA 4F3TA 4EZ9A 4KB0A 1KVBA 3WNFA 4KTQA 1S1TA 3WNHA 4QOZB 4LSNA 2MWOA 4CFAA 4FLYA 1WAJA 4YNQA 3E9GA 5JS2A 1IKWA 1IKXA 4BWJA 2O4XB 5KE2A 3QBYA 2IG0A 2DFHA 1MHNA 3K5OA 1Z26A 3PX6A 2A1SA 2MWPA 3LAKA 3KLGA 1KLNA 1KFSA 3K57A 1ZBHA 1C0UA 2D0CA 4MFBA 1HNIA 1L5UA 1RBRA 2LVMA 1WJSA 1VK0A 2M0OA 2L8DA 1LW2A 2JZ2A 3PV8A 3UIQA 2HHUA 3SCXA 3BDLA 2K3YA 2M16A 5C0MA 4HVJA 3ASMA 1X1PA 4B9MA 3NCIA 4K8XA 1KSPA 4M42A 1N6QA 1NKEA 3V81A 4CGIA 4CK1A 3KLHA 4DTOA 4AHSA 4CJFA 2HMIA 4NS5A 3AVKA 3NDKA 4FK0A 2IC3A 4AH9A 1JLAA 1G5VA 4DTNA 2JTFA 3PUFA 1RTDA 3RTVA 3TAPA 4E89A 4Y1CA 4XIUA 5J2PA 4M3YA 3V9UA 2KQ2A 3VQ4A 2QK9A 5KCOA 4CJLA 1O1WA 4OLBA 2EHGA 4OVLA 5HROA 5C42A 3PMIA 5CZ2A 2BUDA 4LD0A 3DB3A 3V1RA 3ZT0A 3VA0A 4CEBA 4DF8A 4E7HA 4CFDA 1L3SA 1RDDA 4FJ9A 4OLAA 1RDAA 3O3HA 3L2RA 1C1BA 4FYDA 2EKOA 4PWDA 2OZMA 2HHWA 2D0AA 2Z1GA 3DOKA 5C24A 1ITGA 4CJSA 2EX3A 3AA4A 5HRRA 4JS5A 3E9FA 3TWHA 1RT4A 4DTRA 2R5MA 3DM2A 2Y1JA 2DAQA 1YVUA 4CJ4A 1XHXA 4FL6A 4IG3A 4KI6A 3RMCA 4KREA 2R57A 4PL6A 2RHZA 1ASVA 4NCGA 3MEWA 1TGOA 2EQJA 3AA5X 4O44A 2ETJA 1GOCA 3KK1A 3O8VA 3E01A 2K3XA 4EZ6A 3KJVA 1NJYA 2O4IA 1Q8IA 2VG6A 2NUBA 2FBTA 4CEFA 2BE2A 4CERA 4CJVA 4CHYA 1W0HA 4EP4A 4DSIA 4M41A 2HHSA 4CIFA 4E1NA 4PLIA 4RW6A 2DIGA 4IUQA 1KHCA 3OB9A 4E7JA 4DU3A 4NCAA 4C5GA 2F8TA 4CGHA 1X9MA 3LP0A 4KHYA 3AVFA 1NKCA 1VRTA 4CJPA 3PY8A 2F8SA 4DFJA 2XY6A 2DFEA 4DTSA 2RKIA 4CHOA 4E7KA 4ZHRA 3M8RA 3KTQA 4F3OA 4GY5A 5J2MA 4Q0BA 2KTQA 4FJNA 3NFAA 3K58A 1GOAA 4DLGA 5C25A 2OPPA 1L3VA 1TAUA 2GBZA 1RT5A 1DTQA 1HQUA 1NJZA 2RPIA 1S6QA 4QCLA 4DQPA 2HHQA 1RT2A 1T7PA 2X4YA 4CHQA 2GUIA 3D45A 1S9GA 3ZSWA 1BHLA 3HPHA 3AO4A 1Y97A 3DRPA 3AVBA 3ZT3A 2GV9A 2VYTA 4EP5A 3T3FA 1WAFA 3OYNA 4FJHA 1BISA 4DLEA 2QKBA 5E41A 3MECA 3ZSOA 4FU6A 3OS2A 2E6NA 1LWCA 3VQQA 4DSKA 3SUNA 1TK5A 2E6MA 4FJ7A 3P5JA 4B9LA 1A5WA 4UQGA 3AVGA 1EKEA 3NAEA 4CGGA 4BDPA 4Z4HA 4BE0A 3OMCA 1N5YA 2LCCA 1WSHA 1TK0A 3OYAA 3L2QA 1RBTA 3L2UA 3U3GA 3NNQA 4CEAA 4KHWA 4CGJA 2F96A 3SQ2A 1U4BA 4BD3A 4KHQA 3NGIA 1JKHA 4M3RA 4DU4A 1L3UA 3PMTA 4CJ5A 4DQQA 4JRPA 3TAGA 4CIGA 4OJRA 4BDZA 4H8KA 2FBYA 1BQMA 1VSKA 3O3FA 4IFYA 1VSFA 3L2VA 4N4HA 1HQEA 1S1XA 2IS3A 3DMJA 4CJTA 4O5BA 3NF8A 3NF7A 3VQPA 4DMNA 3QNOA 3HK2A 4ZTFA 4Z4GA 3HP9A 3LZIA 4LD6A 1J54A 3META 3NGYA 3T19A 3OYBA 4B9WA 1JLCA 4I9QA 4B9XA 3IRXA 3HO1A 3OS1A 1C1CA 4MQ3A 3KUFA 1S1UA 2VWJA 2RN2A 3U3YA 2HB5A 3FDRA 1WSJA 4IFVA 1VSLA 3DOLA 3L8BA 3DLBA 4B8CA 4B9UA 3UWNA 4KPYA 2IGIA 1X9WA 2EFIA 3V6DA 4N4GA 5C6SA 3HP6A 4CK3A 2WACA 2YKNA 1WNSA 3QESA 1YTUA 1CZ9A 4FM2A 4EDUA 3NH2A 1JXEA 3O4NA 3DB4A 1BCOA 3QEWA 1OZ3A 4ID1A 3M8PA 2Y1IA 3SPZA 2RJEA 3WNEA 2ZQBA 2XDPA 2RI2A 3OYCA 4AHRA 3ISNC 1SL2A 3UT1A 1BIZA 1HJRA 2JLEA 3THVA 3SUQA 3CG7A 4DQIA 3AVJA 4FJLA 1BL3A 4KB1A 3V4IA 5EU7A 3FFIA 1B9DA
chains in the Genus database with same CATH superfamily
1ETWA 3CCMA 1BR4A 2JJ9A 1R5ID 3NPFA 2YNGA 5GPCA 4IXCA 5LJ5e 2X4JA 4KRTA 1U06A 1GXQA 2VQFK 4M7DE 4LSLA 4MZMA 5CO7A 2KXDA 2YUNA 4C0FA 4Y91A 4DV6K 3THWB 3ZRGA 3QINA 3O9TA 3AAPA 4WCGA 4CJWA 2Q36A 3TEDA 3QERA 2X3XD 2XGDA 2O9VA 1VQOA 3HTVA 4BXUA 3TOBA 3A98A 1O3TA 1W2BP 4LF8K 2AXLA 2EPDA 4PKGA 3NE6A 4NBQA 2XY7A 1Y8RB 3GTJJ 2FXAA 4CF8A 2W85A 2X1EA 4GRIA 1UAXA 2FJ1A 2LF7A 3CCJN 2FO0A 2ZE2A 2L89A 1IHWA 1QHAA 4N9HA 3HOYJ 4DQSA 2Q8KA 1IKYA 3L3VA 2B8AA 4M7AD 4FM1A 3G2BA 1T95A 2LKPA 3PVQA 5CYVA 4CC3A 5IHIA 4B08A 4KULA 3RYRA 1SD5A 2NRZA 3M1FA 4JLHA 1M4ZA 2VUBA 2BEOA 3AGRA 4YIRX 3MX2A 1PU7A 4JI5K 3INZA 4FOEA 4HOBA 5CQEA 1VSIA 4RLFA 1RR8C 2MIOA 1DUXC 4Z4IA 3LSTA 2ELKA 1A6QA 4A53A 4PY5A 2OTLA 2DYSH 3VRZA 4MMKA 4BQNA 4Q5WA 3JSPA 4FO0A 4HV5A 1YG2A 2Z2SB 2Y75A 1YW7A 2E5ZA 1KG3A 1Q81C 1GDTA 3NTKA 4FW1A 1ETQA 1QSSA 1WXTA 1KQ9A 3VS5A 3VTIA 4AVPA 1NWKA 2XVCA 4II2A 4BKXA 1KQSM 2FUG2 3IL2A 4UOBA 3CMAI 4BI4A 3ZSRA 1VQ7I 4XBFA 1HNZK 4G94A 1J3TA 1R1UA 1XB4A 9ATCB 3PE0A 4DB3A 5KRSA 3ZMDA 2V9PA 3S1NJ 4IUUA 1WIEA 1RTIA 3K2AA 4BACA 2DIQA 3HPGA 3LX7A 2HQEA 2JSCA 3LPUA 1Z3XA 2JMAA 4CI0C 2XDVA 3EETA 1RAHB 1HA8A 3I4MJ 5KN9A 2JS2A 4B1WB 1OMIA 3DEWA 1VQKA 5BR8K 3AL0C 3PQJA 3T69A 1W1WE 3AL0B 4U0YA 4EW0A 4EMGA 2OA8A 4FWMA 2M0MA 2CT3A 2XGEA 5J4YA 3Q0VA 3CUQC 3ZT2A 1PP8F 2W25A 2FMLA 2BZ8A 1TWBA 4IZZA 2I0NA 1SSHA 4B4CA 4RW4A 1ZBHA 2YKMA 4E1MA 1EP4A 1TNSA 5IXBA 4IIOA 2PYJA 1QA6A 3RKWA 1D0XA 1S9EA 4KFCA 2H3EB 1J59A 4KRFA 3PFYA 2WAQA 4KHUA 2GXAA 4K41A 2M51A 3DKXA 3MPUB 3CCVQ 1NJIC 3QSUA 1VQNN 1FIPA 3DLLL 3X24B 3ASOH 1GXPA 4C8LA 5H6RA 4CGDA 4ELVA 4JKGB 4CO8A 3G1JA 3MXJA 5AQFA 4S04A 2QTVA 3LL3A 3HT3A 2J6FA 3BR1A 3N4QA 2PMUA 1UA1A 3M56A 4HPQA 5IP9J 4FWSA 4XLFA 4CZJA 4Z4FA 3C6HA 1E4FT 1SKWA 4FWOA 3CC7I 1B59A 2BIVA 4IEEA 2X6SA 5L3CA 5SWMA 2DX1A 1N5ZA 1J5OA 2CKKA 4ILJA 2JRMA 3BDUA 4BRPA 1Q86R 3NHNA 4EA5A 4CI6A 2G8UA 2HMAA 4ISFA 4E9EA 2D1HA 2QWLA 3QDFA 4R56A 4HX7A 2XSJC 5IYDJ 1TQIA 1V5GA 4IUVA 1MBJA 6AT1B 1YE9A 3A8LB 4YOUA 4WYBA 4BE2A 1GV2A 3GDQA 2O8FA 1YJNN 1VQPA 4LK1F 3DLAA 2D0PA 5J1RA 2VI6A 1HBXG 5D4SA 2LNVA 2P6SA 1MWMA 3G71I 2UXCK 1XG1A 3WXJA 2E7WA 5K5QA 2DPUA 3KZBA 5J2PA 3IFRA 5EF6A 2EZIA 5KCOA 4YIFA 2RH2A 2A6TA 1L3SA 2E2QA 4AQYK 3MN5A 1WJCA 4FE7A 3TWHA 1S5LC 3O8HA 3R6NA 4FISA 4FL6A 5KPRA 3CCVT 2ETJA 3WXKA 4BY6C 3E5QA 2DA6A 3CCEA 4L5JA 5BN8A 1K8KB 4QPQA 4Q5SF 1ZBJA 1ITYA 1NE8A 1VQLT 3CP8A 2XASA 1K79A 3L0QA 2ITMA 5BPNA 2NS0A 1TAUA 1M90C 4FWNA 1VQOT 2YHTA 2DOEA 2OC6A 2DA1A 1YJ9Q 4A61A 4DLEA 1VQKQ 4EJZA 3MJXA 3SUNA 4B9LA 1EKEA 3CBPA 1BI0A 3CCLN 2NOIA 3VEZA 1GLAG 3CHWA 3I5UA 1TT5B 2QWRA 4C1NI 2LBFB 4AM3A 3M57A 3DU5A 1T6DA 3EL2A 4DQQA 4F92B 1XN7A 4IFYA 3C0CA 1S1XA 1FSHA 4DMNA 1W5TA 4I7HA 1T08B 1H8KA 3CBOA 2AKKA 3JW4A 1VQON 4B9WA 2M9HA 2EYYA 4BJTA 4UNOA 2HBWA 3LSJA 2E2NA 4IFVA 3WU1B 1VSLA 1QVTA 2IGIA 1M3BA 4HW0A 3J80O 1YTUA 3CLQA 2MAMA 4LFAK 2P9LA 4WFNL 4PSWA 5AQVA 1MUNA 5LMUK 2MH2A 2E4HA 2JW4A 2EW3A 5HK0A 2WA0A 1H1VA 3EG9B 3P7NA 1IH7A 3NF6A 3OTOK 4N9IA 2XHCA 1D3YA 3EAEA 4F2SA 4DZJA 4KO0A 4BS9A 1JLQA 3FXKA 3NTIA 2ZWHA 4P5NA 1OCCH 3RRHA 3DXKA 1FOXA 1SFXA 3NMUA 1R0CB 1M1KO 1BK2A 4KHQA 3G10A 2IS4A 5DM6F 4M7AG 3VKIA 4X9CA 3ZMSA 5L8RE 2G8KA 4M7XA 4ZN1A 2VWFA 3D7EO 1S5JA 3S3OA 5DD4A 1FLIA 1QW1A 2VQGA 2BKDN 3H3OB 2ZMEC 1KLMA 4Q48A 4JRQA 3BGRA 4F04B 1VQ9A 2V8JA 4N4OB 1USSA 3T0YA 1KQSP 4RTVA 4J9GA 5HBMA 1JJ8C 2LKXA 2JTEA 4YOQA 4L5GA 2W42A 1J9AA 1IHVA 2CGHA 1MV0B 1X75C 3MCZA 1SQKA 1HPMA 2DT6A 5KGWA 4CCKA 4WFBL 3J81K 3M54A 2FBHA 4F2RA 1P6RA 3T1YK 1CQTA 3JRDA 1QVFA 2UWMA 3CJ9A 1TT0A 4RW8A 1NGFA 4UUTA 3ZFJA 1DLOA 1LVAA 2EQMA 3FGUA 1LPLA 3GFIA 2BTTA 2GLOA 4L5EA 2RQWA 2ZMEB 1TLHB 1KU7A 5M1PA 2K3PA 4I2OA 4DUYK 1XNIA 3JXUA 3TREA 4BY1J 3S16J 5KAIC 2PMHA 2D1KA 3FIWA 5FDLA 1TQMA 3GZ6A 3MN7A 3Q5FA 4FVUA 2KZMA 3MAQA 1YYVA 3OYEA 4JX5A 2GTOA 1APLC 1DTTA 3CD6I 2NOEA 3QODA 4FSXA 1A5JA 5J1UA 3SB2A 4NL3A 1G3SA 4XK8E 3TO7A 3KVGA 1W70A 3IC7A 1NGIA 2WB1N 5FLMJ 2W40A 3K9KA 2COYA 4HT9A 4PL8A 3HXMA 1K9MU 1IDZA 1UECA 3UF4A 1UG2A 4MLEA 2P9UB 3O3KA 3ZSVA 1Y07A 4A57A 2EQRA 2I8DA 2MK5A 2VKHA 2YV0X 2WTUA 1JKRC 2G8FA 4D1QA 4JX6A 3OOPA 3HUGB 1YFNA 1NGJA 2HDWA 1X4PA 1D3BB 1IV8A 1CSKA 3V4GA 2LX9A 2VXEA 1EH6A 3HJEA 4CHPA 3BR2A 1YITT 4DFKA 1UHWA 4M72A 5HVQC 1R1VA 4IUPA 4JBAA 2RJCA 2DTZA 2CMPA 4BR2A 2FG0A 3D5SC 3UA6A 3S17J 1YIJN 4AI4A 2D8JA 3P4IA 1FJGK 1BA0A 3E7LA 1V1CA 3VQ6A 4CJEA 4M6YA 2MLGA 3O8MA 1PSEA 3ITHA 1MSFC 1VQ5A 1XDSA 1S72T 2TCTA 5JR3A 4ME7A 1U2VB 2Z0WA 3TOAA 5D6XA 1YWPA 3FEOA 4R79A 5J39A 3GFLA 4E9FA 4MHGA 1R23A 2FC0A 5GTIC 3A5LC 2STTA 2OZSA 3FM3A 5E8IA 1ZA1B 1IN6A 3TSZA 1X2KA 2HQHA 2NOGA 2M45A 1S1WA 1QZEA 3I56T 2C0IA 1D09B 3CQZJ 4QLCU 1KC8R 3KP3A 4Z02A 3A8YA 3LDLA 1YJWN 2CSQA 2JGUA 5HRSA 1NYGA 4AF1A 2EV6A 4MTEA 1W7PA 1X6BA 2EIKH 2E2OA 2A08A 3QBYA 4FX4A 1NLPC 4MFBA 1PM3A 2QGUA 1HNIA 5DUIA 4M7DA 3UIQA 2OTLQ 3LCNA 4ORZA 3KP7A 4DUZK 3C1DA 2WSCE 1VUBA 2VASA 5AQXA 4DQ2A 3H35A 4MO7A 1K7AA 1PNJA 3G6ET 5E17F 4QS9A 1AWCA 5EC7A 4DQ8A 2HEQA 5E1ZB 2GOXB 2L9VA 3JCUC 1VQ7Q 4Y1CA 2EFWA 5IH2A 1YJWT 5CCAA 5EEGA 2RN7A 3E6MA 4UY8I 4H5TA 1GCQA 1LWWA 2Z1GA 1UJ8A 3N97A 4ZJZA 1LWVA 4PL6A 4O44A 2KDOA 3CDIA 3GFMA 2FNPA 4WXDA 2IVOA 1P4AA 4CIFA 1WX6A 1XPXA 3THYA 4F7UE 5CVVA 3EE9A 1OH5A 1JUSA 3AVFA 4DFJA 1IN5A 1VZ0A 4RB0A 4H03B 3CC4Q 4FJNA 2QDLA 2YRDA 2OPPA 2GBZA 1NJZA 1K8AR 2KZVA 2DJQA 3X2QH 4B1XB 1T3VA 1RDWX 4IJNA 1W97L 3W6KB 3SMPA 4HX8A 5AN4A 3WXIA 3X28B 4IVNA 2LCCA 2MLKA 2EFNA 4A0XA 3PO2J 1WQWA 2LC4A 4RTXA 2V1RA 2F96A 1U4BA 3NGIA 5B3SH 2FE3A 5HS9A 3TTFA 3C7JA 1BQMA 3VSLA 4YIIA 4KHPK 4BHBA 4Z4GA 2OTJT 3IAS2 1AHJB 4PJOB 3FZHA 1WQ2A 3WEEA 4IRIA 4UV9A 1JT0A 2OD5A 1Z05A 2Z5UA 4JKEA 1O9SA 2YJEA 4CK3A 1WNSA 3E6CC 1YJWQ 1SS6A 2L7ZA 2FRWA 4WXCA 1EH7A 5M5WJ 3WU0A 4DK9A 2QA4Q 2DYBA 1VQ9I 1XC3A 2QEXQ 1D5VA 2V52B 4ITVA 4RUGA 3CC2A 4A63B 1O3RA 4LH4A 2JUCA 2YHWA 1USTA 1BBYA 2E8AA 4JK8A 1EF4A 4KKOA 2IVPA 2LSOA 5GAHJ 2OYQA 3WQTA 3KLIA 1IZ6A 1Q95G 3THXB 3J7AF 1BI4A 2LCLA 4X66K 3RRGA 1L3TA 1FP1D 4CC4B 3G4SI 4HCCA 1X3ZB 2K4JA 2AA4A 1MV3A 2PG4A 3TABA 3SJJA 4DG1A 1EJ9A 2CP7A 1M1FA 1B9FA 1I5OB 3GBQA 7AT1B 1YO5C 5D6WA 4FL9A 3DPUA 5ICEA 4AVZA 3LGLA 3LANA 2HVHA 2R7DA 3TPQA 4FLWA 3WU2C 3CF5F 1RNHA 3CUQB 3QIOA 2XF7A 3GCMA 4IF4A 4KITB 1DGKN 4IDKA 1RAEB 4DTPA 2FRYA 4S05A 2YG8A 2DW4A 3SUPA 5CR2A 4DNCA 4G6QA 2DEUA 1N32K 1K6OA 1OFCX 1M90O 4PQUA 1QVFM 2XIGA 2DOFA 5CVJA 1VQLI 1MNDA 2L3DA 2V8KA 2L9NA 5KYUB 3G1OA 3TI0A 4PGHA 1NEBA 4OVAA 2HNYA 3C95A 3RMDA 4CXFA 4XIDA 3H3NO 5GANd 1YJNT 3KLEA 2H3JA 1WJAA 3A03A 1KYZA 3FX3A 1GLFO 4KYWA 4LDYA 3CCEQ 3VS3A 4CZHA 4XLNF 3JRCA 1NJIU 5HLIA 2ACJA 1K4TA 1SEUA 3VF6A 3U21A 5HRPA 4V2SA 3CLOA 2FQ3A 2IVWA 1XQPA 2HOTA 1JHFA 2AO9A 4H5NA 2JWKA 3TVTA 1R8OB 2IOCA 2EFPA 1WHHA 1ETKA 2F5CA 1C0MA 3QIPA 4ZYAA 3UKRA 2RNGA 2CSIA 2L2PA 5GMKe 4RG2A 3I59A 2CUEA 5IXFA 4H5VA 4PKHA 5F0HA 2NOFA 2X1DA 2OFKA 3T1HK 5CKEA 3IWFA 1U6GA 1VNDA 3VF4A 2CREA 1VQ7N 3ZCMA 3UR3C 3CCVI 3NBPA 5FRMA 4KH6A 1DDNA 1XDUA 2CZ1B 2H56A 1JLFA 2EWNA 3JB9D 2E19A 2KZGA 4C2MJ 1YW9A 4EMKA 5FLVA 3HPWA 3JS6A 3D0SA 3KD5E 2Q2RA 2RQPA 2KDZA 1SVLA 1HDPA 3P9CA 2ELJA 4M3FA 2Q1NA 3WE3A 1JBMA 3LDNA 3O1BA 5AQRA 1ZBFA 4YOXA 2A41A 3W3DA 2QW9A 1LVKA 1QHGA 1F5TA 4Z0UA 2XKOA 3ZETB 3MXMA 3VEXA 3W6VA 2LLKA 4AUXA 2KVQG 3H1VX 4RGRA 1NK0A 2YHBA 4CC2A 5KYXA 1I1GA 5D5UB 2E12A 1TTHB 2RF0A 2Y2ZA 3CETA 4BQZA 3CC7A 1YW8A 1V3FA 2H6BA 1XHZA 1M2OA 5EJCA 2EINH 2KY9A 1LWYA 2PEXA 3CCJI 1MIJA 4J9EA 4M3GA 3O3GA 1QSYA 1YIJQ 1VQ9T 3KLOA 2E3IA 2ED1A 1NJWA 3QEIA 4WXHA 1MMDA 2YX4A 4XH4A 3FB9A 1YJNA 1MDUB 2ENMA 1IREB 1QNTA 3PSIA 4XQ3A 1N3AA 4B21A 3WNHA 2E71A 2QKMB 1HC8A 5KNLA 5KE2A 4RTTA 2BHYA 3KLGA 2E5NA 2YU9J 3PV8A 3SCXA 5C0MA 4DGWB 2UZKA 4CK1A 4DTOA 1FX7A 4QPOA 3AVKA 2NUZA 2OFIA 4RAGA 4A59A 4CCJA 1S8NA 4BRFA 2WBMA 3FK7A 2P8TA 4ON0A 1TQPA 2AZVA 4JZ4A 2GIZA 3L2RA 2JT1A 1D5YA 1RESA 2D0AA 3N4MA 1STZA 3K1MA 3FXQA 3W6JB 4IG3A 1VQKI 2D8HA 2ZXIA 2K3XA 2ZO4A 1UJ0A 4XLHA 4CJVA 1MJAA 1LCKA 3OV8A 4LK0F 3GG4A 3ML6A 1EA3A 4RTZA 1VRTA 2Q1ZB 4DTSA 4Q0BA 3L4IA 4N4NB 3CBMA 2OTJA 1PDNC 2HNIA 1E17A 2CSOA 4LF6K 3PNVA 4NC6A 1T7PA 2GUIA 3ZSWA 2QK0A 2VYTA 2CH4W 3HZJA 2QKBA 4M77E 4OMNA 3CPWS 4XEIA 3O5BA 2F7TA 2KJCA 1D1BA 1VQNT 3CCSI 4CJ5A 3DBLB 3CXCP 4JK1X 2BY0A 4OJRA 3E1YA 3E6DA 3H0HA 3LA7A 1U8BA 1KQJA 1HQEA 4N4HA 1IN7A 1G8XA 3LZIA 1EH8A 3VPRA 2YHXA 2XAUA 3CC7T 2IEKA 1JLCA 3SEZA 3U3YA 2R5YB 3DLBA 2KNBB 1UELB 2PN6A 2WACA 1TYQB 4JK9A 3BR5A 4ZN3A 2XDPA 2RI2A 4EJOA 1RR7A 2RKHA 1LW0A 2WC2A 2FBXA 2FF3B 4XH1A 1LE8A 2K9SA 4F93B 2ZNZA 1RUOA 1IJJA 1D9FA 1A5XA 4M7AB 4ATOA 3FZMA 1NJXA 4OMPA 3OL4A 4FX0A 2UUBK 1XGMA 2VQCA 1RDUA 5AIPA 1ZBUA 3R60A 3HDDA 3SQ4A 1SKRA 2FZGB 4QVCA 3RSEB 1KAXA 1NG7A 1S1NA 4N5SA 2VJJA 4M77F 4CIEA 4M3XA 3A0HC 3K7AJ 5IT9K 3AVHA 2YWWA 3PLAA 2W4SA 4IPAA 2PTKA 2HDCA 4ESBA 1E6GA 4OIOF 2LNHB 3Q7CA 5D7UA 1UG0A 2UXXA 4QKUA 3H3VK 1WLJA 2RGVA 3HKSA 1XMOK 1W7PB 5DM7F 4JKBA 1SAUA 1K78A 3EFOB 2R7RA 3VEWA 2VN2A 2JSPA 2XDDA 1NGBA 3SEQA 3M0PA 2YX7A 4JI8K 5K1YA 5AR0A 3CCMI 4CF0A 2W7NA 4B1VA 1BC7C 2VC1A 3VU3C 3WHCA 3IAM2 4FXDA 1BIAA 1D8YA 5FKMA 1U5SA 2LRDA 1C0TA 3U2RA 3WHBA 4JRKA 2YNIA 2M1HA 2VJ4A 4IOXA 4C8QA 4OPJA 3K4NA 3EGXB 4JZ3A 4A4GA 4HNTA 1YI2N 2MW8A 3M0UA 5C3EJ 5AQHA 3LDOA 2EYXA 3DLLF 3MKWB 4IOAF 3ZYYX 1WGSA 5J6XA 4YTLA 4CFCA 3CQXA 1REVA 4LDUA 4JDSA 1VQ5N 1XTAA 2HSPA 2CQXA 1P92A 1VHXA 2X74A 5LJ3j 1T6SA 3H5NA 1K76A 4Y17A 4U67L 3VS4A 1WPKA 4M3EA 4CCMA 5GANe 4GKKK 1NMDA 4BY9C 4BGAA 2OTJI 4N4IA 1TUYA 1TWFJ 3ZQGA 2FPEA 4QQDA 2M0YA 1GFCA 3A5MC 2LQNA 1AHDP 1FBSA 1NPRA 3R6SA 2RHKA 5J47A 1RUNA 1KQ8A 4HV6A 5BR9A 5CVIA 4BDYA 1WXBA 1U48A 3D2FA 3JTHA 5IHKA 3LL7A 1VQ5T 3CVTA 2PUOB 2DETA 1JJ2M 2CV1A 2B0LA 2RB6A 1OYIA 4UXNA 5KYWA 2F2VA 3VN5A 2DBBA 4C8MA 2ROTA 4B3XA 4OMQA 3DLGA 3THXA 2A40A 5TJJA 4RTWA 3AO3A 1VQMT 4OMZA 2CP3A 3G0ZA 3OSGA 3H9NA 2O8BA 5TGTA 3TEEA 5BPLA 4QIWN 2VL8A 3QO9A 3WTYC 1TWCJ 5GAN2 1M1KC 5CVUA 4OFAA 3Q3SA 1LDJA 4HF2A 2CGKA 2HBKA 1Q1HA 5J2QA 2XAGA 3Q1JA 3JCMf 1VQNI 2FZKB 3TKYA 3I9QA 4FYVB 2OTJN 1TTYA 2JM8A 1RETA 2NRAC 5FJ8J 3G6EQ 5IY5H 1MD0A 4FWPA 3RZOJ 3O6BB 9ANTA 1YJ9N 5HNFA 3CCRT 3ULRB 4FJ5A 2CJJA 1RL2A 2CGPA 1GLBG 3QOEA 4PCQA 5A2QZ 2Z1IA 3C7NA 2Y48A 1TP4A 1YX3A 4JKGA 2E65A 3LA3A 1T33A 2OZUA 3C2GA 4GVMA 1DU0A 5FKNA 2B6AA 3CMEQ 1Z1DA 3E3VA 1B9MA 1KU2A 1SV5A 2JA5J 1KIKA 1IO6A 2OTLN 5LJ5f 1J53A 1ON2A 1Y64A 2JXBA 1SAXA 3OIOA 3BTIA 4PIIA 2PVGB 2I5UA 2QM1A 3MWMA 3ULEA 2OQRA 3SWNB 2M16A 4MZTA 4M42A 3QO3A 2BY3A 4CGIA 4A3LJ 1MUDA 3O08A 1WWXA 1YLFA 3M6GA 3UDCA 4DV3K 3JRZA 1YQKA 2E10A 3J81E 2BUDA 3V1RA 1LJ9A 1BOTO 1UAAA 3J81Z 5L3EA 4OF1A 2K79A 2ZPEB 4IOCF 2UXNA 4NCGA 5M3MJ 1IBKK 3JCMW 3KK1A 2P9NA 1VQ4I 2M8EA 4CHYA 4O8KA 4BY6B 2GQVA 4E1NA 4PLIA 1C0GA 4D7MA 1GHCA 2COBA 4IRGA 1PRMC 1NKCA 4XTVA 1K4SA 4A5AA 1K83J 4J9DA 5J2MA 1KG4A 3FWEA 1L3VA 3TTCA 2M87A 2HKOA 3R9PA 4D9JA 1N8RC 4KBMB 5IWAK 1S9GA 2EA2A 2FZCB 2DPNA 1BHLA 4K42A 1WBDA 1Y97A 1QU3A 3T3FA 2DJZA 4MLHA 4DSKA 2P84A 1X01A 3VESA 1YITN 1PJRA 2LF8A 3FF5A 4H0YB 3TDUC 4CGJA 4JRPA 2QYOA 1U9OA 2KFDA 3EO3A 4PFZA 2V6EA 1XSXA 3ZN0A 1IRZA 1V54H 4EMKC 4O5BA 2FX0A 1RLPC 3HIFA 4GLMA 1PUFB 3PQKA 1AKHA 3NGYA 4E47A 5GAOl 4HKEA 2KHMA 5EXWA 2O9SA 4JI6K 4KN4X 4IHVA 2ESWA 1X9WA 5GAOn 1W0TA 2HAXA 3ZQ7A 3FHFA 3BCBA 4KN7X 2RJEA 4L0YB 1BIZA 1HJRA 4KB1A 5EU7A 2BGCA 3JRFA 2IGMA 1GOBA 3K2PA 3CCJT 3ISPA 4C0ZA 3T1AA 5D8LB 4AHCA 5HCKA 4D7NA 4HEA2 5GAEJ 2G3RA 4KIGA 4DTUA 2G8WA 2AK5A 2XF5A 4F16A 3FXRA 4HAMA 3CCJQ 3IUOA 4HSBA 1R36A 4N47A 3NGZA 3S3MA 1NGNA 2XRIA 2SRCA 1ZG5A 3SLCA 3QYEA 2HI3A 5E3MA 4X34A 3G4SA 3DWLE 1GCQC 5GIOA 5EG0A 3BQYA 1EXQA 4CF2A 5AT1B 4Z6YA 1DGWY 1W9HA 1IB8A 2DFIA 2WTEA 1YIJA 1E3HA 3F6OA 1TS9A 1VAZA 4FLVA 5LJ5d 3ELKA 1VSHA 2KIQA 5FKKA 4WCEL 5CKTA 3IS9A 3G3ZA 3I3LA 2ELHA 3CM5A 3CC2I 3LLRA 5KRTA 4NUBA 3LWFA 2GTDA 3MN9A 3KPHA 2R7WA 2E20A 4YFXF 5C2FA 5CKDA 1W2BA 1E3PA 2M7BA 1REPC 4A3KJ 2E1CA 2RQQA 1RT1A 4OWRB 4PK4A 1QQJA 3TBIA 3JCMd 3JB9I 5I2MA 6PAXA 2DERA 2X85A 1QBJA 2P9NB 4M7DG 2XPWA 3CCSA 2BANA 2CV2A 3OS0A 4F7UA 2UXDK 4DTMA 1ZN2A 3JRAA 1ZQ3P 2R7XA 4C5HA 2IIRA 2VWKA 3EUHA 1Q81O 4G7OF 2ID3A 1YQMA 1X2NA 1SL1A 2MCNA 2EWSA 5JLHA 4WK8F 5LRRA 2A07F 4M7YA 1RDBA 5GMKh 4F52A 4JAXA 4BRMA 5CYMA 1YHQN 4NC7A 3EKUA 2DYRH 2QSHX 4EMSA 1PVSA 1BB9A 1IN4A 3ASKA 5F1JA 1HRHA 3VEYA 3U9GA 3MDQA 3ZX2A 3GMEA 3M3ZA 1QMCA 3JREA 4NOYA 1EETA 2A5XA 3RQIA 2QXFA 2XICA 4BGBA 4BI3A 4X9DA 4O8UA 3EQLF 1H3ZA 2V79A 2CQKA 2EYZA 3QDRB 2DFFA 3E6BA 2XUBA 3HUGA 1TKDA 1BOBA 3ZX3A 3JR9A 4IXAA 4GDFA 3NTHA 2ECCA 2P51A 3EY1A 3U4LA 3M8QA 1WSEA 3T7ZA 2DQRA 4FPAA 4AIAA 3TGNA 4YOVA 3BG7A 4FYXB 3OSVA 2RHIA 3SZPA 2HPMA 2VPRA 4YFUA 1UGRB 4LD5A 4I09A 1KFDA 5AJ3K 4YY3K 4PJOG 1NHAA 1Z0XA 4GFBA 1BA5A 1OI1A 2HZDA 4BC4A 1OYYA 3NEUA 4L59A 3QP6A 3DP7A 3FZFA 1U3EM 2K7LA 1YJNI 2XAJA 2CRGA 5DTDA 1EFNA 2Y0MA 1UGVA 1DIZA 4NCBA 3CC7N 3CCJA 1FNNA 4B9NA 5LEKA 2VT3A 1F4KA 1K6YA 4M78A 2M4GA 2PMZA 1I5LA 2EH3A 3MEEA 3V8KA 1M8VA 3TQNA 3T9NA 1PUFA 4HNUA 5AQSA 2E34A 2ZXHA 3BZKA 3WXMB 3VEVA 2CGJA 3AG2H 2RI5A 1J0RA 2KISA 2COMA 3QIIA 4YPRA 3EH2A 4UUVA 4JKCA 1TUDA 2GBQA 4DR4K 2LH9A 1C0FA 1HLVA 2L7FP 5FPNA 2XDBA 2VJIA 2XF6A 1B9NA 1HNXK 4EV0A 1T44A 2HD0A 1OCRH 4RW7A 2P7VB 2QGFB 3K2ZA 1JHHA 3ZSZA 1BU1A 4XMYA 2Z1JA 2NYXA 2CW7A 4P55A 3E0JB 3QPHA 2ISZA 1ONVA 2JUGA 4G8XA 4BEHA 2OX7A 2O4XB 3GTQJ 1L5UA 1WDXA 4DR5K 3BP8A 2Q0UA 4KH4A 4FYWB 3NCIA 5LBQA 2DTOA 3KLHA 3TSQA 3FZLA 3THYB 1N33K 4AH9A 4DTNA 4OFHA 3WTWC 4MEXF 3KE2A 4E6KG 1O1WA 2EHGA 1MNEA 2F2XA 2ICWG 2EYWA 1JTXA 3I5SA 4PWDA 2OZMA 5KYWB 3GPLA 2HBJA 5GAGJ 2NAZA 2DAQA 2P5KA 4CECA 4DV1K 4XOPA 4ZYDA 5I21A 1RABB 2LQWA 3E01A 2DD4A 1Y8QB 1LOJA 1JQQA 1W0HA 1B72A 1KHIA 4JI1K 2O8BB 2O31A 3HBTA 2LCSA 1ZAOA 1QP2A 3MX5A 2RKIA 2A05A 5C25A 3QZ9B 1D0YA 1A36A 4D5CA 4M78E 1TXQA 1B1BA 5BMZA 1W2BS 2HOEA 2PMZN 3VQQA 5LJWA 2RVCA 2AZSA 3M1CA 4IL6C 2DKGA 1N5YA 2MFZA 3MMYB 4ESJA 4HDVA 2GCXA 3REOA 4MGRA 3WG7H 2ASMA 3M5AA 4H8KA 3O3FA 5D6EA 4CJTA 1DU6A 2QM3A 2M4KA 4EGYA 4LB5A 3FKIJ 1ZSZA 3OYBA 1S72Q 4NQWB 4GVEA 3ERMA 2KIFA 1VIFA 4KPYA 1N9RA 4B8CA 4G9ZA 3A02A 1RI9A 4EDUA 3CJ1A 1WH7A 4KISA 2OCCH 4NNJA 4A4EA 3I59B 1UWBA 1TUGB 3MXIA 4M3DA 5GAMe 1X1AA 2KZZA 2K9NA 1WSGA 2YXYA 5ILUA 1M1GA 4CEQA 3BTJA 2ZZDA 1R0AA 2P4WA 1VQMN 1VQ9N 5BNGA 2ASPA 3HRGA 3GXOA 3SZGA 2FBIA 3PT9A 5HP1A 3B8AX 3ZMVA 2PU9B 4AYBA 3HVTA 4BRGA 2D0QB 4L9TA 2DL7A 4UV8A 4XTXA 5JLXA 3ZEHA 3Q9SA 4DJAA 1S6PA 4L9JA 4EPCA 5D5XB 2TDXA 3VPZA 1JUPA 1J2XA 1SHFA 3EGDB 4GLKA 2E2PA 2P0QA 3KLFA 1LDDA 4J6WA 3FDYA 5IOZA 1YAGA 3ROUA 4W5TA 5EGOA 1SAZA 4PA1A 1KG2A 2XB0X 1X1CA 4ETSA 2HSTA 3M0TA 1TVRA 3D2EB 3MO8A 3CESA 3TP0A 2IPOB 2PZ1A 1MGTA 3ZP5A 1VQ4T 1WB9A 3C18A 3KK2A 2Z16A 1UA0A 3BW1A 4HCKA 3Q7BA 1I94K 3CPWP 2YSRA 4KIBA 1KTQA 5IAYA 2JVGA 2KR3A 4AIJA 2GXBA 4JJBA 4HCBA 1S9HA 2WY7Q 1N3CA 2CYYA 1Y1WJ 3PSFA 3VS0A 4LUDA 4AHVA 3EZWA 1SKSA 5GAEP 3ULEB 4AWXB 4B8AB 1BJZA 4CSWA 1WJFA 3ESWB 2HR3A 4OAYA 3OYMA 1LAVA 3HB9A 3WQUA 4EJUA 2L3RA 1QE1A 3KNTA 3OYDA 1ETVA 4JKAA 2FEIA 5CKFA 3CF2A 2KDSA 1B4AA 4DQRA 4DS5A 2LRQA 1KC8U 3L1PA 3CW7A 4IQ4A 3QEPA 4J00A 1I27A 1T0JA 5GAMd 1JXBA 3KFVA 1ZELA 1PG5B 5CQGA 1CXUA 4Q5VA 3O9UA 2EBIA 5E1WA 2HEOA 1K8AO 1EX4A 2LDMA 3AAFA 5F0XA 1TK8A 2LD5A 2P5OA 4GBQA 2OA4A 4FTHA 1FKPA 4C0DB 3RR7A 2ZCWA 1K0SA 1XC5A 3CCRQ 1GXIE 3V9SA 4C0DC 2VG5A 5DCFA 3BEXA 4RWTA 3CCEN 4B3MK 3LMMA 4BBSJ 3NMZC 3L1AA 4P9UA 2HQRA 1YIJT 4PGGA 4JPBW 4UHTA 1U04A 3O80A 4E1JA 4C9YA 3QOPA 4FJ7A 1ON1A 4EVVA 4DV4K 4LGWA 1L3LA 2NS8A 3F73A 2K5FA 2QWNA 1S72N 2ZFWA 2GGRA 1UGSB 1OOTA 1WI3A 1HYZA 1XTDA 1IUYA 1VQMA 1JJ2P 2QG9B 4GNIA 3MKZA 1Z21A 2OJED 2EBPA 3OBYA 3O4WA 1OKJA 4KNYA 3ZMUA 2EVRA 1OYXA 3IDHA 3IKMA 2E5LK 1KG1A 3RCOA 2V1NA 3H9JA 1P7MA 1C6VA 4M7AC 2PBDA 2P81A 3QETA 1QVFS 4BREA 1LB2A 3OJUA 4JJDA 2A1RA 1M2VA 2CYZB 3HHGA 1NJIR 3NH1A 2DK3A 3C6AA 4HF1A 3NH0A 3FHGA 1D1AA 1KA8A 2ZGWA 3TP3A 4OO1J 4DWIA 1XSVA 2VOOA 3VF2A 4M7AA 4JN4A 3QKJA 3WTUC 4CHNA 1G83A 3WVEB 2KLAA 3C7NB 3LFUA 5KCHA 3OW2P 1WI9A 3IG1A 3F9KA 4FSVA 3I8DA 4UVCA 4EM2A 3GLLA 2L0KA 1M3HA 4A3GJ 4KTZA 1UCRA 1RUWA 2BOLA 2K7AA 3G6EN 4CZFA 3V9WA 3KP2A 2PFUA 4CJUA 5JVTA 2MA3A 1X9SA 1Z91A 3CJQB 3G71Q 2B7EA 4OB3B 3RNJA 2QAZA 1AWXA 2Q97A 5ILVA 2QEXN 2GUPA 3IQLA 3E9GA 5JS2A 3HEFA 2DFHA 2P5VA 1OH7A 1KLNA 3K57A 5BPMA 4CCLA 1RAIB 2OQGA 2V7ZA 4F14A 4N0AA 3V7RA 5AZJB 4F7UB 4PJNA 1OPKA 1I1SA 4IWVA 5ICCA 1TWHJ 1EWRA 4CHUA 2BVLA 2R5MA 4KI6A 4YDUA 3RMCA 1IBLK 1BUPA 3MEWA 2DDBA 2K2MA 1GOCA 3O8VA 5F1XA 1NJYA 1Q8IA 4AG1C 3IRRA 4J9HA 1IG8A 2B63J 4EP4A 2E1ZA 4B09A 4IHYA 5L3GA 2OV7A 3D4VA 3WGGA 5IT9O 1WVRA 4RAFA 1Y1VJ 1QLYA 3AG3H 5CKBA 4LF9K 2F8SA 2O61A 4E7KA 4F3OA 3SZTA 3JCMP 1W6XA 4LFCK 1GV5A 1SD4A 5FU6C 4A0YA 4M73A 4DQPA 4DA4A 3VS2A 3CMAA 2PVDB 3WTSC 2CH5A 2O7OA 1ZQ1A 5HK3A 4ZZLA 4M63C 2E1HA 4E9HA 4BE0A 2NVYJ 4NDLA 4M7AE 1TK0A 3RQ4A 4CEAA 2X9DA 3SAGA 1KC8O 3I0XA 1IUFA 1Q1VA 1QP3A 1JT6A 1MDMB 4KT0E 1LE8B 2G9WA 1X3MA 3VQPA 4BQOA 4M77A 3AKZA 1T38A 1C6VX 1C1CA 1WSJA 3DOLA 1YJ9T 5GANf 1OCZH 3UA7A 3GTLJ 5C6SA 2XAFA 1YS7A 2UXBK 4FM2A 4ISGA 3DB4A 3OH9A 1T3LA 2A5YB 3A5NC 2STWA 2IAIA 1I81A 3W2AA 4M75F 3RTRA 5GAN4 4CEEA 1V5EA 3BPVA 2DA3A 4YFNF 4V19K 2P5GA 4CEOA 3P9IA 3CTAA 1J5EK 5D3GA 1YIJI 3GW2A 1BGXT 4FOIA 2W1OA 3E2UA 2DMUA 1NGDA 2DTIA 1E3MA 3O4QA 3HFOA 3TANA 3AO5A 2D2WA 3FIFA 3VDXA 1MGQA 1VQOI 1HR0K 3A8MB 2RM4A 3MP8A 1RKTA 2QA4N 1UMQA 3ZEUB 3QHSA 2XRNA 3CD6N 3CC4N 1OX8A 2F5DA 4A4HA 3M9QA 4X64K 3DYAA 1ZUKA 2KRMA 3EGDA 3RR8A 4AFUC 1K9MR 1GL5A 3GX4X 5LHGA 1LKXA 3JRGA 3CC2T 1O7LA 2DA4A 3KCCA 1EIFA 1PD1A 1M3AA 1X58A 3N5NX 1YN8A 1OH6A 2RD1A 2DU9A 1OU9A 2P9PA 5LHHA 4D6WA 4B47A 2ZFUA 1R5GA 3SI6A 2L54A 1Y57A 2OUMA 3QFUA 3TAMA 5AQUA 1NK5A 2F4VK 4LB6B 3MN2A 2V7YA 5CYQA 4BH9A 3A01A 4RGXA 1U84A 3CC4T 1IG9A 4DV5K 3QYGB 3DQVC 2L3SA 5FPDA 2WY8Q 1P7IA 1J6ZA 1LDKB 4MEYF 1HX1A 5KYNA 4HSTA 1T8IA 1ESVA 2VKVA 3VYTB 3IH7A 2DI3A 4CGFA 1HYSA 3IKVA 3VS7A 3B73A 4IKFA 4LN2A 1WJRA 1FWZA 1NTCA 3CCYA 2CP2A 5GAMg 1VQ7T 4JNEA 4O3MA 2HDAA 2VUMJ 1CKAA 5BRDA 5FU7B 3QJYA 1QPIA 4M77G 3W2VA 4G6TB 4OX9K 4P1WA 4F17A 1LJOA 3FHNA 2CGLA 3PNTA 3LYIA 3C3WA 1LWFA 3O9QA 3CCEI 4N0AC 3SFIA 2PBIA 2FPDA 4WCIA 4CFBA 3JCMg 4NC8A 1VQ6N 4ZDPA 1WHMA 5B66C 3K9TA 1AKHB 3DWLA 2RO0A 2DM1A 3VYHB 3OH6A 2OAWA 2LQKA 1WI7A 1X1BA 1ZA2B 3IMXA 3VQ9A 4R5PA 4DS4A 2V9KA 4WE1A 3DTEA 1QVGA 1RKWA 3G71A 1N8RO 1M90R 1NKUA 3LSGA 2LZ6B 1LCUA 5HRNA 1WJDA 1N9SA 4RAZA 3SNNA 1HYVA 3M8JA 5KGXA 1WN7A 4UC4A 4NO7A 3S3NA 4HX4A 4JK7A 4KFBA 1TW3A 4ELYC 5B8HA 4C0GA 2B9SA 4LG3A 5D5WB 2K27A 3JCMb 2LK2A 1OV3A 5DV5A 1VSDA 5JVHL 5AQMA 4N41A 1BIUA 3VA3A 4BRHA 5A2QK 4OPHA 4FJXA 1RI0A 2DNUA 4J8FA 3ID6A 3BE3A 4B3OA 3TR8A 5EOYA 4B9SA 4B1ZA 5D6YA 1Z6RA 3SBTA 5IT3A 1W0UA 4PKCC 3MEGA 2ZJPL 2EZKA 4FWLA 3HHTB 1CGPA 1PVEA 3I35A 2MI6A 4IUTA 4ENJA 2OPRA 4YOTA 3FXMA 1N77A 2Y4XA 3HVRA 3GOXA 3PIOF 3BR6A 1Y0UA 2ZJPF 2K5LA 1I6HJ 1TKTA 3F0ZA 1VQNA 2C0OA 3JB9H 4E4HA 4I2PA 2HTSA 2CS7A 2ZCFB 1QQOA 1X3NA 3GLXA 2X6WA 3SAFA 1N36K 2LKSA 3A01B 2VKNA 4F3TA 3R0JA 3I5RA 1ZLKA 3CP2A 4QOZB 4FLYA 1RRJA 1WAJA 4YNQA 1Q86C 1QWEA 4XSXF 1M30A 1XNRK 4X1EA 5EZHA 4J7IA 3KYCB 1PD0A 1WJSA 2R7OA 1QVGM 1T0FA 3RKXA 3VGMA 1Y7XA 2BUPA 2EZLA 1JKQC 3B6AA 2E88A 3QYHB 3L9FA 4FK0A 2IC3A 2NLXA 3CZ6A 4U7DA 3EYIA 1JUMA 4GO1A 1YFHA 3DB3A 1JRIA 1C1BA 3OHRA 3CMEN 4C92C 2EX3A 4HVUA 2X0LA 2MPXC 2VGNA 1QPMA 1YRNB 3KJVA 4EAHD 1JJ2A 2NUBA 3EPZA 4EJVA 1FMKA 1TBXA 2WSFE 2RDPA 1D3BA 1X2MA 4A3BJ 2R0QC 2R5ZA 2CFXA 1UB4A 4GY5A 2KTQA 2K9GA 4CUGA 2MC4A 1VQ7A 2JT4A 2HKXA 5AQZA 3VJPA 3U9DA 1NGEA 2GV9A 4H5RA 3CMET 5M1FA 5C2DA 2E70A 3ZSOA 2DMPA 1TK5A 2KYMA 1MH4A 5HDNA 1WFWA 3RPUA 1WSHA 3LSHA 1RBTA 5J8CA 3L2QA 3U3GA 4MMLA 4CBWA 3FJPA 3NNQA 1G59A 2IIMA 1V76A 4DU4A 3CUOA 3GUDA 1W5SA 4CYCA 4BDZA 1QVPA 1F1BB 2EGEA 2AP1A 1ZGAA 4XSZF 4A12A 2R7VA 3C2BA 2COZA 3L2VA 1HKGA 1A35A 1SC7A 2DRKA 1SG5A 3H36A 1QCNA 2OTLI 1QCFA 2A69F 4ZDLA 2V26A 3BJAA 3HO1A 3TU5A 3G1MA 3DEUA 4PUSA 2I10A 1OH8A 4N4GA 1WEIA 2YKNA 3NH2A 4Y0WA 1RC9A 1WNLA 4LDXA 2RK2A 4EMKB 3U8XA 2ZQBA 3ISNC 1Z77A 3VV0A 1NBEB 3CCET 1FC3A 2A7YA 1I6XA 1NKBA 2VG7A 2NUPA 1XG7A 3TSUA 5GAHP 4J2BA 5GAOr 4XLCA 4FPBA 3SD4A 5A0LA 3GTKJ 1FTZA 2F69A 3PX0A 2R5AA 5M1KA 2IDOA 1OR7A 4B8XA 4DTJA 2DRMA 2KIMA 4DF4A 3CUQA 8ATCB 1MBHA 5E1XA 4QQGA 4YORA 1GVJA 1HU0A 5CQXA 5BN9A 1TL3A 3AAQA 4PNOA 5E20A 4I01A 1Q7YR 2MABA 4FWQA 3H5AA 1GLJO 1FOWA 4GYIA 5LRSA 3GBTA 3ULDA 3DLHA 1O75A 2FHDA 3K5NA 5DCMB 2MGQA 2NNNA 1JCEA 4XK4A 4IEIA 2O8FB 3RKYA 2P6TA 2WONA 3SFZA 4ZYEA 3JCMQ 3QNNA 4BR4A 1PU8A 4P5OA 2RQTA 1IKVA 4C8QG 4R1HA 1QGPA 3H9QA 4AIHA 5MLCQ 4HUGA 3PO3J 1R00A 1CXQA 2P4TA 1GRIA 2J5OA 4Y33A 1CKBA 3C65A 2FXUA 3G6EA 1FT9A 2XY8A 1QCOA 4CZMA 4BY7J 2L5QA 1U0JA 3K10A 2P9SB 1FBQA 1FEXA 3DAWA 1QSLA 4D0PA 4CE9A 5AZIB 4LFBK 3C6UA 4BROA 4QQ6A 2NUTB 1TAQA 3CCQQ 4AYBN 4M3WA 3P1GA 2X4XA 1U47A 2BH1A 1SPKA 5FO5A 5DD8A 4BXFA 3O8GA 2ABLA 3WNGA 5J3LA 1Y71A 2IP2A 2YJFA 2QEXT 2V6CA 1LFPA 3L42A 2O9LA 3J7YJ 2RNAA 2I2LA 4MDXA 3AG1H 5GAGP 2YDLA 2RC4A 4V19S 1SFEA 2BW3B 4QS7A 2QXLA 1PHTA 3BY5A 1GBQA 3BJOA 5JLFA 4M7DF 3K70D 3HOWJ 3RBBB 3D6RA 2ADUA 5FLXZ 2ZJRL 3RDVA 2HHXA 1FMVA 2KFNA 2C06A 3CCQN 4II1A 3SJHA 3MEDA 3FXLA 3KWIA 5IP7J 1WHJA 1SZ2A 4BQQA 3IH4A 4CYCB 3G7ZA 2P0WA 1KC8C 3UKUA 3HI0A 3DU6A 4XTWA 2VBYA 1DT9A 1DPUA 3T8RA 2DXIA 4EJWA 3PTAA 4HLYA 4LJZF 2KI7A 4PJOC 3DF8A 1BKBA 1ZGJA 4M3UA 3VOEA 1XC9A 4ENKA 3VQBA 4AM7A 4WQ4C 4C5EA 3HM9A 2O8KA 3CCRN 1GLCG 4M3BA 1DGRM 4U0VA 4PJOA 1WZOA 5KYYA 1XGNA 4FLZA 3KFWX 4BL0B 4X0GA 1RT6A 4IJAA 2QGGA 4YFKF 3A8GB 2DA2A 4ELZC 4LH5A 2ZSHB 1ETYA 3ZXSA 2F4IA 2Q0RA 1VQOQ 4J19A 2EQKA 3CXCS 1XQHA 3K4JA 1UHCA 5I3UA 5F1RA 2LJ3A 2DT7B 4JP0A 4KHSA 3MEUA 1YS6A 3B6CA 3EUKL 2EYQA 3I0SA 3CCLA 5KHDA 2ZXWH 1SF9A 3K6GA 2R93J 3OYLA 2OTLT 4DOZA 3CI5A 2A6EF 5KK1A 3TW6A 4CJ3A 3KBGA 1VQ4N 2E4LA 1JB0E 1VI0A 3HTUA 3PVLA 5GPAA 2C0TA 1S72A 5CR4A 1VQNQ 3ZQLA 2M9UA 4FE4A 3OW2M 5J8FA 2GFAA 3O1WA 1W7PD 3D2EA 4W5NA 2XY5A 2R3SA 3AY9A 2WC9A 4BHPA 3A8HB 3VQ5A 3E5UA 4D8KA 4IHWA 4KHNA 3DPLC 1GCPA 5J26A 4NYNA 4X1VA 4XTYA 3CMAT 2RA2A 2DYIA 3K5OA 2AHQA 3HXLA 1NEGA 4IDHA 3M0QA 3F8BA 5D6FA 2EJGA 1XGOA 3G4ST 4AFSC 3CD6T 5L23A 3TQ7P 4M7DB 1KSPA 1ATNA 4BQAA 4H0XB 4Z8AA 3VOVA 2XKPA 2KBTA 5H1SQ 2A6HF 1FYLA 3GO5A 4XIUA 3CCMQ 3VQ4A 4OVLA 3ZT0A 3CCVA 3VA0A 5BS6A 2CUBA 3ZL7C 4HSRA 5M1NA 1RDAA 2DZCA 3SXYA 3J80Z 3KYLA 3DOKA 4EM0B 2C6YA 2MC3A 2FNAA 3KZYA 2GWRA 5F0CA 3AA5X 4JI4K 2OANA 4G7ZF 4PJOE 2HF4A 2CWEA 4P96A 2EGAA 3SHWA 4M41A 1NZ9A 2QI2A 4E7JA 1YHQQ 4C5GA 1B8IB 3LP0A 3J7ZI 1LEAA 3DBHB 4ZHRA 4LD9K 2BE9B 1DTQA 3DPTA 3KX2A 2D0NA 3HPHA 1YP5A 3OYNA 3DXMA 2E1NA 3R61A 4UQGA 1R1TA 5KN8A 4B3TK 1QZYA 1QRYA 2HBMA 4K0KK 2E35A 4A0ZA 3PMTA 3OL3A 3EG3A 1KD1U 1AEYA 3WTVC 3QNOA 2YUSA 4NL2A 4OMLA 1AU7A 3M55A 4MDBA 4LXCA 2OAZA 4DR2K 1YI2I 4LDWA 3KUFA 1JJ2S 1XMXA 2DJNA 1VQLA 5M5YJ 2DL4A 3ATUA 2R7TA 3O4NA 3SPZA 3WNEA 3NWSA 1WJBA 1FZPB 3KP6A 3SUQA 3CG7A 4H4KC 4IHXA 3A0IX 4BNCA 5AQGA 4C2TA 1Z9ZA 4EW4A 1Y96A 2RHUA 1OVYA 3WGIA 2NOZA 5LD2C 5GJWB 3I56I 2NUPB 8AT1B 2EIJH 2XGCA 4FSSA 3F8FA 4CYDA 4G12A 5K14A 1HNWK 2F5KA 5EGOB 2VC0A 1N6AA 3QQAA 3GEZA 1MSEC 1OLTA 3ZSQA 3BC8A 2VIXA 3D5LA 4GCVA 1Z9CA 3VENA 4CZGA 1F9NA 1ASUA 3OR2C 2HNDA 4X65K 3K58A 3CDHA 2FBVA 2E1OA 5LJ3d 2X6XA 2XB5A 4E9GA 4DEYA 1D9DA 1S1VA 1PP7U 1N39A 2ATQA 4J8OA 4CZLA 5DS9A 1NMNA 5DK5A 3I4NJ 4M78G 2PAVA 5CE3A 2LP5A 5DM7L 2XD0A 3LFKA 4PJJA 5AQKA 3VGLA 5HNHA 3AVIA 4DBRA 1QHHD 2Z3YA 1MA9B 2KFZA 5AZIA 3V42A 2BW3A 4M6XA 2WAQN 3DBRB 2DBKA 1YHQT 3DXJF 3PJRA 3NVKA 1RGIA 1YJNQ 1RCHA 3LDPA 3QBWA 1SD6A 4Z4CA 3CEYA 3A4CA 5E26A 4LFUA 4RM3A 4M77C 2OCEA 3FXJA 2K4BA 2M2EA 3D2FB 1P2FA 4FVMA 2QA4A 1NOZA 2QZ8A 5KI6A 3A5OC 2VE9A 1M27C 2RMOA 1UFFA 4HTUA 1FPQA 3QMLA 2GFUA 3AG4H 2CP5A 2P9SA 1U45A 3ZSYA 3GZ5A 1W5CC 1CZBA 1YQAA 2M3AA 4EA4A 2QTDA 5KH6A 3IHOA 1ACMB 2HCKA 4BRLA 2J4RA 1G6NA 4DYCA 2FEZA 2KQRA 2HF3A 5F27A 2BGGA 5TISC 2RQUA 1YBYA 2EV0A 3CJTB 3IUCA 4BHCA 3W2WA 1H3HA 3CCUA 5AQWA 5AONA 4UUSA 3DKWA 3L00A 2F2EA 4ZDOA 3ENOA 1YX5A 5BRHA 4XLPF 1BC8C 1W7AA 3E9LA 3KWGA 1SRMA 2BDPA 1XCVA 2LBFA 1XI1A 2D0BA 2E41A 2LJ1A 4LITA 2BHZA 1GUUA 2CO5A 3QG1A 4BUGA 4JHDB 3KKSA 1VQ6Q 3M1EA 3O9SA 1P59A 4ID5A 1BM9A 3HRTA 5HOOA 4JI3K 2E1YA 3OYGA 2QA4T 4AD9A 3ENBA 2ZPHB 4CGZA 1ZTRA 3LP2A 5C12A 5JVGL 5TKWA 3DTKA 2NRWA 3OYKA 3CVSA 3FLCO 2L7KA 1TL1A 3HJFA 4RS8A 2LREA 2KW4A 2UUZA 2KYBA 2V51B 1D5AA 1Q81R 4BRNA 2RK1A 3BZCA 4JYAK 5IHNA 3SYZA 2QWQA 5C0YA 3OW2A 3HHHA 4GYGA 3HFNA 2ME6A 2YRVA 3GFJA 2HMPA 1XMQK 3BG5A 2YR2A 4UB6C 3M53A 3MFKA 3R2XC 5I9EB 2O8DA 1VQMQ 5A2QE 1VQ5I 1KXPA 5HODA 4BVOA 1ZR2A 4DYQA 1FOYA 2N8GA 4M4ZA 2QWOA 3M4OJ 3SPYA 3HBLA 3MKYB 4OIQF 4BJ5C 4OKEA 4JJNK 4HUEA 1I3QJ 3M8FA 3HSCA 4CJQA 2IS1A 5E3NA 5CLSA 2E6ZA 1IXRC 4BVPA 4B3AA 4ZH4F 2IG0A 4CBUA 3LSRA 3CMAQ 3KETA 5JFRA 2HHUA 1SKUB 2ESHA 2QDYB 3HOVJ 1ABOA 1B6AA 2L0AA 2KLOA 3I0TA 1WGXA 2KQ2A 4I02A 1X2QA 1O3SA 4DR3K 4F7UF 1I07A 2EKOA 4BG8A 2VV5A 3RPUD 3OWTA 3QYBA 5IYBJ 4MTDA 3AA4A 2Y1JA 1YVUA 4XONA 4HVJA 3CWSA 1TWAJ 4FASD 3ZBDA 2W10A 4C3IJ 1ENHA 4A3DJ 1VQ6T 4PZJA 3TSWA 2DAOA 3HG9A 3QPTA 3CCRI 2M5WA 2FOKA 4E70A 4Y13A 1NG9A 3CD6A 1KAYA 4A3CJ 2YHYA 4PJ0C 2UUAK 1OULA 1VQ8I 1HSQA 3QZ5B 1V4SA 4EP5A 5FLXE 4NQWA 4YHHK 5A0DA 1WAFA 2DFUA 5JICA 3JB9G 1RAGB 3CCUQ 3NAEA 1T3SA 2P5LC 3L2UA 4BRQA 1Z7LA 2CZ0B 4LG0A 3QICA 1VTNC 1JXMA 4BD3A 3WTTC 4U7BA 1XS9A 1Z6TA 3A8OB 5AQNA 3M5RA 4YOYA 1Y96B 1UEBA 3JSCA 3QP5A 1NPPA 2Q0OA 4WX9A 3MWTA 4XOTA 1ZSZB 4HVWA 4J7FA 3META 3T19A 2P9UA 4FYYB 3CXCM 4JRIA 2VKEA 1BOAA 3RYPA 4LUEA 5GMKm 4OOIA 3U23A 3TO9A 1ZLJA 3OYCA 4LDVA 3F10A 1KSWA 2K02A 1IC8A 1UFMA 2W6LA 1VQ5Q 2CT4A 5LL6S 5EEHA 3ID8A 3K1NA 1S22A 2RAEA 4H0TB 2O2OA 5LJ3h 4TV7A 2E6LA 2G7UA 2RHXA 1HSJA 4B24A 1BCMA 5KQ8A 1WUAA 3RSNA 4ZC3A 2EQUA 3OYJA 4CD1A 1MWKA 5F64A 1X1DA 2CG4A 5GAN6 3RKQA 4U88A 3VYRB 1VIEA 2R7SA 3U1KA 2X78A 1X3UA 4OMMA 5KYYB 4HWIA 2CH6A 3K5MA 1OYWA 2HTJA 3DRSA 2FL7A 1FBUA 1DPRA 3P8DA 1FYNA 1QVUA 3BQZA 2WB1A 1NBWA 2GTJA 2NZTA 3K4KA 2OAUA 4KAZA 3M59A 1MZBA 1JCGA 4BQLA 4BRKA 3OIQA 2A3ZA 3K4LA 1X9JA 2B5JA 1C0WA 1TSFA 4DOVA 1R7JA 1B8IA 2JUFA 3HM8A 3D5RC 1T39A 3SQ0A 1Q7YU 4A3EJ 2V7FA 4B44A 1NM7A 1FYMA 4HBLA 4MNUA 1RZ4A 2KMUA 1QO0D 2YLCA 5IN1A 2JHJA 1KJWA 4RMOA 2L02A 3J8AA 1EWQA 4D5FA 3ABKH 3BDDA 4BRAA 4D8DA 3JSOA 2DLPA 4EM1A 2G0EA 4A3FJ 1KQ1A 4L6V5 2BZYA 3LAMA 3UKRB 2E7XA 1P9QC 1EZZB 4RCHA 3GTGJ 3JCMX 2O03A 4ISEA 1EQYA 1KU9A 3G4SN 2NXNB 4C30A 4I76A 5FFZA 4FCYA 2JPCA 4LLNA 3ZX0A 1W1FA 2DEQA 3K70C 2CS3A 3A1PA 4I6MA 1RIOH 4EFHA 3MP1A 5GAMj 2BXZA 1GVDA 2DF6A 5TKYA 2YNFA 3PIOL 1KCFA 5CPRB 1M9SA 2L4MA 2PYLA 1YCYA 5L3BA 5CY4A 3ZQFA 2GM4A 4BC3A 2VQHA 3RJPA 3OW2S 3GYHX 1MPGA 4HHTA 1ZR4A 5KVRA 2HBPA 1A0NB 1KG6A 4E6RA 2DILA 1UOCA 3IV5A 4E19A 2JTVA 1VOMA 3VRYA 4DSFA 1WHGA 2G7HA 2H94A 2Y9YA 1HF0A 2HQAA 2ITGA 4A3JJ 4CCHA 1XX5A 1X6OA 3C6TA 2Q2EA 3MEAA 3I71A 2LOOA 2VWBA 4XU2A 1R49A 3MP6A 2B4JA 4C23A 3KEQA 1KD1O 5EG0B 4KH5A 1TKZA 2JQ7A 4B22A 3DRRA 2DZ9A 4J01A 2ZF5O 1H9GA 2DA9A 2PQWA 3VFZA 2D5VA 3VB2A 1PC0A 4NLBA 2XROA 1VQPI 1VSMA 4A2UA 2KAFA 3GE1A 4RAYA 3I0WA 3LWMA 2MG4A 3HSTB 3K59A 4WQ5A 1YTAA 3TMOA 1OCOH 2KMTA 2L4AA 3ZETA 2IS6A 4II3A 3MCPA 3ZQHA 2GWJA 3I54A 2VBZA 2YHAA 3K0SA 2BZXA 3QRFF 4CEZA 4CD3A 4PJOF 2NRHA 1MMNA 1OU8A 2NNYA 5DLQE 1UDLA 3CC2Q 4ENMA 4ELUA 4RW9A 3FR0A 1SD7A 4JS4A 3RERA 3KZZA 3ZT1A 3CMMA 4A5NA 4G1QA 2O4XA 4BGDA 5GMKj 1ZSGA 2P9KB 3FE1A 2ME0A 1FXXA 1YQLA 2YLBA 3SV3A 5JHUA 1WJQA 4CJ7A 2YU3A 1JGSA 4L18B 5L3DA 2P7CB 2KSSA 1HKBA 3J7AY 1NOYA 4XM3A 2P1JA 1MKMA 3JAMK 3PIOA 1M1KU 4I99C 4LSNA 5HL7L 2MWOA 4CFAA 1JTYA 1M90U 4CICA 1MHNA 3VYGA 1J75A 2GWKA 1SEMA 4EGZA 5D5VB 1HDDC 4B9MA 3ASMA 4C8QD 2UV1A 5ERIA 3DTIA 5DEQA 2A61A 1ZK8A 2JTFA 2NWMA 4HZFA 2X51A 3DCFA 3E66A 4L9VA 3DEEA 4B48A 4IEJA 4XRSA 4IQJA 2HGCA 5HROA 1V4RA 3PMIA 5CZ2A 3NARA 4CEBA 2X9HA 1HD3A 4CZEA 3SJMA 1ATSA 1RNLA 1R6RA 2J6OA 2MBFA 2R57A 5AQTA 3RTVA 2A28A 4JD2A 5J4VA 3DLLA 1NJIO 2HKNA 5LHIA 2DK8A 2BE2A 4DSIA 5AZJA 4RW6A 4B9QA 4IUQA 4A5MA 4DU3A 1L0OC 1MUYA 3D7SB 4VUBA 4L9NA 3GP8A 1NGHA 3R6MA 5AQOA 3ER0A 3R1XA 1B34A 3NFAA 5KYUA 3LAJA 4RTYA 1RT5A 3BT9A 5FB2A 2RPIA 3S2DJ 2FVUA 3ZT3A 1HYOA 4KH0B 1K73R 1BISA 2R4GA 1BR2A 4YEJA 3BFMA 1BU6O 3HSFA 3CWTA 2GX9A 3E5XA 4WFAL 3S15J 1D1CA 2ECBA 4BRIA 2QQAA 4GV9A 3OSFA 2FQ4A 3G25A 3CMEA 2HFHA 5HDKA 5DM7R 2ZAEA 1M1KR 3M07A 3N05A 3HP9A 1A6IA 1N8RR 1Q7YC 4B9XA 4CCOA 3DXMB 2W00A 4MQ3A 2A37A 3S41A 1KONA 1LNWA 3L8BA 1K9AA 3V6DA 3BWGA 1Y0NA 1YQRA 3HP6A 4JI0K 2O5RA 4BYYA 4ILGB 1R0BG 1JXEA 1WPYA 5AQIA 4CCNA 3THVA 1B9DA 1WKMA 5DY9A 4HVVA 1YTYA 2I7PA 1RDCA 4PJMA 1UUEA 2VXDA 1H641 2KKZA 1U5TA 5IPAA 4UUSB 4Z89A 5GTHC 1WHUA 3FFKB 2KJBA 4QS8A 2PI0A 2RF2A 2NNWA 4QTRA 5FROA 1PWTA 3CC2N 5LGNA 1C1AA 3FRNA 3CYMA 3O5ZA 1PRLC 1G15A 3S14J 3R8EA 4M45A 2ZJ2A 4CJRA 1U49A 4AFZC 3EHQA 5E3OA 1IW7F 3V9ZA 3X20B 3LNQA 2BY2A 1R58A 3QDKA 4W5RA 1VRUA 3OA6A 2W41A 2YX6A 3H46O 5KQDA 3MMVA 3QWLA 3WTXC 1NK6A 3EYZA 1WSIA 2BY1A 3K69A 1RLQC 1LWEA 5LGTA 3K0LA 2COWA 4LF4K 3L3UA 2F9WA 3AVNA 3QEVA 2JVVA 1DQUA 4H0OA 4OKKA 2DXCA 2FF6A 1SSFA 2HBLA 1WSFA 2XK0A 4M9XA 4RGSA 3OOUA 3W3CA 2DXUA 4FZYA 5DDGA 1FSEA 4E7IA 4H4OA 3BTCA 4RM2A 4B23A 2FD5A 3ZN1A 1QS4A 4HQMA 1YOVB 1WHLA 2HQXA 1ZG3A 2K5IA 3QYFA 1W36C 2WV1A 2CH4A 2IBDA 1K4US 3LOCA 2O8EA 4GXOA 5F08A 1KGSA 3A5ZB 2HVQA 5IOYA 2VCPA 1OCTC 4JLGA 3F8NA 3VS1A 3B6PA 3SQNA 3RWUA 4NLCA 3BROA 3HL2A 4Q47A 1PYVA 4W1UA 3ERED 1QTMA 4CRIA 3FBIB 4JI7K 2Z9OA 4J6XA 3JAME 2HYJA 1RBUA 2EAYA 4KH1B 2E5QA 5FWBA 3SAHA 2XPUA 1WZ2A 3S93A 2DPDA 1OJLA 1K1ZA 2WOMA 4Q4ZF 3KYDB 5CKHA 3FK6A 2KPMA 1YJWA 4B43A 2AXTC 5I11A 1KG5A 2Y69H 1RRSA 4C8NA 2ZNYA 3QXEB 1ARKA 1K8KA 1QZZA 2JA7J 1BA1A 5C4JJ 2CDTA 3F22A 2AJQA 3VYUB 4OMOA 4QVZA 4J2AA 4OMFB 2VKDA 2G8VA 1Q86U 4KT6A 4FZXC 2Z1DA 3L6QA 1O13A 1HW1A 5EY4A 3QFPA 1H0MA 2OPTA 3KKRA 2EPFA 4TVRA 4M9ZA 2Z1HA 4M3TA 3H92A 4IG0A 4PJLA 3EHRA 3M8SA 3OYFA 3ZEUA 4R8HA 3RESA 4JEPA 4BI8B 4FZZA 4M75E 4BE1A 4EMHA 1BR1A 4C8QB 2CQ7A 3VODA 1N75A 1KU3A 1Q7YO 2XHKA 5CQYA 1MNMC 1ZRDA 4HA8A 2DE0X 2PJPA 2IT0A 1K61A 4Z94A 3EG2A 4LY7A 2AS5F 2QVOA 3GZNB 3H41A 5E3LA 4OKJA 1GLDG 4J2DA 4XRSG 2I5JA 2E2IJ 1KEAA 3KIOA 1UG1A 2NRVA 3EH1A 3GNFB 3V7CA 3VYSB 2DODA 1LFUP 3AHUA 3DLKA 3KD1E 5DMRA 4WF2A 1Z9QA 5GAN5 4ZNXA 2ISYA 2BBYA 2LTPA 3QWXX 3LSPA 2ASOA 2HXOA 1IKXA 3SDZA 3PX6A 3KK7A 1TNTA 1KFSA 3V8LA 1BO5O 1RBRA 1WH5A 1LW2A 3DFGA 4K8XA 2CQQA 4M6VA 4ZGDB 2K2VA 4NS5A 2IGKA 1JLAA 2K4YA 5K7HA 4K11A 3J7AP 2V75A 1IDYA 3HTSB 1J7KA 2NVTJ 5C42A 3L2ZA 4CFDA 4FYDA 2SEMA 3DM2A 1XHXA 1MJBA 2GA2A 2VT2A 1QWFA 4I0AA 2DMQA 3OIPA 3L2CA 2F2WA 1IF1A 4CEFA 2FBTA 2F1LA 5DYMA 4A6EA 3OB9A 2ZJQL 4CGHA 1WJ5A 1A04A 2EV5A 1M5Q1 3P38A 5F6FA 3ZPLA 5EX5A 2FU4A 3P31A 1M3QA 1GOAA 1PKTA 4JHDA 3FBNB 5GANj 2HHQA 4KBOA 1RT2A 1P4XA 1RPWA 5FWCA 3VERA 3U1DA 1VQ8T 3PIPL 2H09A 3EUAA 4KGZB 3LSMA 3T5XA 1QKWA 1Y56A 1X43A 3LM9A 4DIQA 2R7ZJ 1UHMA 2Y90A 3SQ2A 3HSBA 3TAGA 1R59O 2FBYA 1VSKA 3C12A 3BCAA 2WUSA 2JS0A 3CCSN 2HXIA 1SVMA 2LC2A 1KQ2A 5FW9A 3MKDA 1TUCA 1MBEA 4I9QA 3O9RA 3IRXA 3P9KA 4YDUC 3OS1A 1Q82R 2YPRA 3H3ZA 1TYQA 1WFXA 2NYSA 2DL5A 3CMYA 1CZ9A 3LAPA 2Y0SN 1WXUA 5GAOp 3TTDA 2Y4YA 1SL2A 1LNXA 3V4IA 1S3JA 5KE3A 4KJZA 1Y39A 5J1YA 5I2SA 5ECAA 3OYIA 4RLQA 2DXBA 1KVAA 2ETHA 1MMGA 5LGUA 2DK5A 2JK3A 3U6FA 4M75A 1DJ7B 1Z67A 1U5TB 1DP7P 4WF9L 3BY7A 2XHBA 2ZC2A 1BL0A 2IA2A 2X48A 5K5RA 1IZ1A 4DSEA 1WA7A 4A4FA 4CESA 1YITA 1B3QA 3C2HA 2K3BA 1YCSB 1BI4B 2ZB9A 1JLBA 4F55A 2WBNA 4MQ9F 4O6JA 1NGGA 1RT7A 2UYTA 1JU5C 1RTJA 3COAC 2VONA 1IRFA 3NWTA 1YITI 1ZHIA 4BWMA 4BC5A 3AVAA 5EZGA 2LMDA 1WEFA 3I55Q 2FRHA 1WHKA 3NGPA 4O5VA 1YNZA 3R3LA 3LP3A 4Y52J 3BLYA 4HF0A 4BXXJ 2KT8A 4B6MA 3UNGC 1M3CA 2EK5A 3WT0A 2PX9A 5JHFA 5FRNA 1AWOA 2LJ0A 3CF5L 5FLXK 2E2HJ 4KGXB 3TAFA 2EA4A 3BG6A 3I9V2 5CAIA 4Z4EA 2X3WD 1ZBSA 1G3WA 3ATVA 4FQGA 4OB1B