3OYJA

Crystal structure of the pfv s217q mutant intasome in complex with magnesium and the insti mk2048
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
368
structure length
368
Chain Sequence
b'LDAELDQLLQGHYIKGYPKQYTYFLEDGKVKVSRPEGVKIIPPQSDRQKIVLQAHNLAHTGREATLLKIANLYWWPNMRKDVVKQLGRCQQCLITNASNKASGPILRPDRPQKPFDKFFIDYIGPLPPSQGYLYVLVVVDGMTGFTWLYPTKAPSTSATVKSLNVLTSIAIPKVIHSDQGAAFTSSTFAEWAKERGIHLEFSTPYHPQSQGKVERKNSDIKRLLTKLLVGRPTKWYDLLPVVQLALNNTYSPVLKYTPHQLLFGIDSNTPFANQDTLDLTREEELSLLQEIRTSLYHPSTPPASSRSWSPVVGQLVQERVARPASLRPRWHKPSTVLKVLNPRTVVILDHLGNNRTVSIDNLKPTSHQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PFV integrase
publication title Molecular mechanisms of retroviral integrase inhibition and the evolution of viral resistance.
pubmed doi rcsb
source organism Human spumaretrovirus
molecule tags Recombination,viral protein/dna
total genus 105
structure length 368
sequence length 368
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2010-09-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
A PF17921 Integrase_H2C2 Integrase zinc binding domain
A PF18103 SH3_11 Retroviral integrase C-terminal SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2300 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3oyjA04
1.10.340.70 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Endonuclease III; domain 1 3oyjA01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3oyjA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3oyjA03
4DQQA 1X9MA 4RW8A 2K3XA 1JLFA 4Z4IA 3OA6A 2Q3SA 4E1NA 1T8EA 1DLOA 2RI5A 4O0JA 2YKNA 3QEWA 2P51A 2RKIA 5T7BA 2LSNA 3NH2A 4RW6A 4Z4GA 2EQJA 1IH7A 4KHUA 3HP6A 2D9TA 3HVRA 1REVA 2IGIA 5J39A 4RW4A 4FLVA 4IUQA 4W5RA 4DTNA 4FM1A 4J2AA 3K59A 4Z4EA 4UQGA 4NCGA 3HPGA 1IKXA 3QEPA 4DLGA 1X9SA 3ZSXA 1RDAA 4DS4A 4OKEA 2NUBA 3V9XA 3PMTA 2F96A 2O4IA 2L89A 4CJ3A 5KH6A 1KVBA 1JL1A 3PUFA 4CEBA 1C0MA 1TVRA 2HW3A 1HYVA 1EKEA 3AVIA 3QBYA 1RT6A 2QKKA 3PX0A 3B6PA 3T1AA 4QOZB 1KSPA 5DMRA 5CZ1A 4CJWA 2R5MA 4M3YA 3HO1A 1BIZA 4CECA 1BQMA 3WNEA 3VQ6A 1RTIA 3PO5A 1LWCA 3PV8A 4M3WA 4M3ZA 1ZBFA 2JTFA 4FM0A 2HHTA 3L8BA 4IG0A 2GBZA 3M8QA 2P1JA 4FLZA 5D6XA 4Z0UA 1WAFA 5C6SA 2PYLA 3AVMA 3V81A 4L8RB 1S6QA 4KRFA 4J2BA 3SPYA 1S1VA 2RJFA 4O4GA 3KD1E 3RTVA 3SUOA 4IURA 1VSJA 3SUNA 2PYJA 3OS0A 2G3RA 1A5XA 3SPZA 4KHWA 4CJFA 1DTQA 3ISNC 2JGUA 2DY4A 3FLGA 1IKYA 1LV5A 3KKSA 4HUEA 1KLNA 5KRTA 4BDPA 5KI6A 4CRIA 3OS2A 4ZTJA 4HCZA 4IUVA 2G8HA 2LVMA 5CYMA 3RMBA 3DLGA 1C0UA 4AILC 2RI2A 2OPRA 5K14A 3ZSYA 1RBUA 4AHSA 4DF8A 4BE2A 3CM5A 4E19A 2EFIA 4H8KA 1TKTA 3M8SA 5KE3A 3VQQA 3PY8A 1L5UA 4CIFA 5CIUA 2YNGA 4DFKA 2QKBA 4N56A 2MWPA 4QAGA 4QQGA 2HNDA 1RBRA 1YTUA 1WSGA 3KLFA 3C4SA 4CJRA 4M42A 3LP2A 3NTIA 3WNGA 4IG3A 1BI4A 4LH4A 4E0DA 3K5NA 4R5PA 3ZT4A 2YHAA 2F8TA 3OJUA 1SL0A 4KHNA 3Q1JA 4CF2A 2YNHA 3U3GA 1T7PA 3NTKA 3I8DA 1JLEA 1J53A 5SWMA 3SCXA 4HCBA 3LP3A 3WNFA 3QEXA 4A4GA 3CG7A 5HP1A 2HHQA 3MXJA 4Q0BA 1HQUA 1ITGA 1TAQA 4CHQA 3TAFA 2F8SA 1Q8IA 1LAVA 2QXFA 4IFVA 2X6NA 3AVCA 3L2RA 1UAXA 3DOLA 2FBVA 4PA1A 3DMJA 3AO1A 4DTOA 3MAQA 3CQ8A 3QIPA 3LANA 4PLIA 1TGOA 2X74A 5CZ2A 5M9OA 4Q5VA 3DLEA 4KI4A 3SZ2A 1KVCA 3KUFA 3L3VA 3P1GA 3OYLA 4DS5A 1XWLA 2RJDA 2A1SA 4FLWA 1XC9A 3DB3A 1I3AA 4KI6A 3OYHA 3AVJA 3CYMA 1CXQA 4W5NA 4CEFA 1FK9A 2XK0A 1TKDA 2HQEA 3DLKA 4LY7A 3NF8A 4OPJA 1LWFA 4RW9A 5JS1A 5C42A 4AH9A 1RTHA 2DFHA 1XHZA 4FJIA 1TK8A 2Z1IA 4CF8A 4CJUA 3LZJA 3PX6A 4KHYA 4CEAA 4AHUA 3UWNA 1RNHA 3TAGA 1U04A 4DTUA 1TKXA 4B9VA 1JXBA 3AA3A 3HYFA 2KTQA 2X4XA 3HK2A 3O3HA 4DTPA 2VG7A 4FU6A 4N47A 2RHXA 1MU2A 5J2NA 4DQRA 2R57A 3SI6A 3OYAA 1IKVA 2EX3A 1L3TA 1JL2A 4O44A 4E7IA 3V4IA 3VA0A 1QQCA 4F2SA 4CIGA 1HQEA 3AA4A 1WGSA 1ZBHA 4IDKA 4DQPA 3NBPA 2A1RA 4FW1A 2IS3A 4B8AB 4A4HA 4CFCA 3JYTA 2IC3A 4CHOA 3AVGA 3ZSVA 1VSEA 4C8LA 5CYQA 4OLBA 1VSMA 5D3GA 4HVJA 2Y1IA 3L2UA 4M3TA 1WNSA 2HHVA 3K2PA 3K5MA 1JLQA 4CF9A 2KW4A 2GUIA 5HRNA 1T05A 3I0SA 4GW6A 2E5QA 3OJSA 1NJZA 3DYAA 3KKRA 1JLGA 3O3GA 4MFBA 3DLRA 3IS9A 3ZT0A 3MEAA 3UIQA 2YHBA 4E7KA 3L2WA 4FK2A 1JLBA 1KCFA 1J5OA 1RDDA 2IDOA 2WACA 1TAUA 4FLTA 4CJVA 4CEEA 4Y1CA 3MO8A 3LPUA 3KLIA 3H8ZA 1TK5A 2RHIA 2DIGA 2HNYA 4GY5A 1VSDA 1WLJA 2BE2A 4F3TA 4ID1A 2VYTA 3E9GA 4E7LA 3TANA 4FXDA 4K8ZA 4QCLA 3CFOA 3P8DA 1HMVA 1Q9XA 4N4HA 3ULDA 3KLGA 3MEDA 4HUGA 2PY5A 4CK3A 3KK3A 3NH0A 1BI4B 4F3OA 3T19A 4FJNA 3DI6A 4B9UA 3META 4A4FA 3NGIA 3BDPA 4FJ5A 3ZSOA 3S3OA 1LW0A 1Q9YA 1NJXA 2E6LA 5I42A 4CGFA 4IUPA 1BIUA 3U6FA 3OYFA 5J26A 4A4EA 2XY6A 4DFJA 4CJSA 1WN7A 1VSLA 3SUPA 2EKOA 4CJ4A 4K8XA 2HHUA 4E1MA 3VQCA 4FM2A 3KD5E 2QQRA 3ME9A 3DLBA 4FLXA 1CLQA 3NF6A 4DU1A 1G5VA 1WAJA 1BCOA 2YNIA 3QEIA 2DTUA 3KLHA 1OYXA 4IUUA 3SQ0A 4CJQA 3V1QA 3IAYA 1K6YA 5J1EA 3OQ5A 1RBVA 3QNOA 1TKZA 4CFDA 3ZSQA 2RF2A 1G15A 1EXQA 2QK9A 1B9DA 1NKBA 1CZBA 4IFYA 3KLEA 4CGHA 3V9UA 2KZZA 5KTQA 3ZT2A 4F8RA 4KPYA 2O4GA 4FZYA 1A5WA 1F21A 4CJTA 4W5OA 4N76A 3D0PA 3AVKA 1DTTA 1YVUA 4CEQA 4IUTA 2L8DA 3OYIA 3AVFA 4I2PA 4DQIA 3QEVA 2P5OA 2B5JA 3VQ9A 4NS5A 3KK1A 3H08A 3TAMA 3LGFA 1BHLA 3UT1A 3FDRA 3VQ5A 2D0AA 4XIUA 2RHYA 3MP6A 1LW2A 2F5KA 4F2RA 3NGZA 2DIQA 2RJEA 3FC3A 4OPKA 4WE1A 2O4XA 4FLUA 4C8KA 1W0HA 4OGCA 4JLHA 4EP5A 4DTJA 2OZMA 4CJKA 3NFAA 2GV9A 4CESA 1HYZA 4B8CA 2Z1HA 4OKJA 4II1A 1GOCA 2KFNA 4Y1DA 3ZT1A 4FZXC 4DSIA 3KIOA 4ZTFA 1WJQA 4DU3A 5DK5A 4W5QA 3GOXA 1YT3A 1Z26A 4DU4A 2JZ2A 2AJQA 2KZMA 3CFRA 2WONA 5EU7A 2M0OA 4CGDA 5FRNA 4CERA 2VG5A 3QJ6A 1TL1A 1NOYA 4KAZA 4AHRA 1TL3A 1SV5A 2G8IA 5C0MA 1J54A 4DSKA 4CJEA 2I5JA 1JXEA 1RT3A 4I9LA 1HRHA 3VA3A 2X4WA 2RN2A 4NYNA 3OB9A 1R0AA 1C1AA 3DRSA 3P5JA 1ZBLA 3NDKA 3OYKA 3AO4A 2E6NA 3OYJA 4CEOA 4PL6A 4KO0A 1FKPA 5CY4A 4BD3A 2OPSA 4KB0A 3MP1A 1S6PA 3VQPA 1KTQA 2FBYA 1JLCA 4KHSA 3M8RA 2B6AA 1VK0A 4CEDA 4E7HA 4QQ6A 1S5JA 1BCMA 4C5GA 1UA0A 4BDZA 2XY8A 1O1WA 2NLUA 3U3YA 1NK9A 1NKCA 4JRQA 4DLEA 3RRHA 3ASMA 2ETJA 4JRPA 3K58A 2Z1JA 2E6MA 1S1UA 3V9ZA 1NK0A 3IRXA 3HVTA 3TAPA 3M8PA 2DFEA 4FJ9A 3QO9A 1RI0A 5KGXA 4L59A 3QIOA 3CFPA 1KFSA 1KLMA 2IG0A 4CE9A 4KKOA 3ZEHA 4DG1A 1BGXT 4N4GA 5C25A 2LDMA 1VRUA 4KHQA 2VWKA 4DFPA 4DWIA 1WSHA 5FROA 1SL1A 4UC4A 2B4JA 2BIVA 5HLFA 3QERA 1U49A 1WSJA 3MEUA 1S1XA 3ZSWA 4BDYA 3AO2A 2VWJA 4ZHRA 4N4IA 1IG9A 3PNWC 2YNFA 4B9TA 4M45A 1X1PA 1H3ZA 4PQUA 2RPIA 4IKFA 1NJYA 3ZCMA 3ASKA 2BKDN 3OY9A 1L3UA 4EDUA 1SL2A 2GFAA 4W5TA 4M3UA 4DSLA 4DTSA 4NYFA 3QETA 1EETA 3LP0A 1VSFA 4H4OA 1FKOA 2ITGA 4B3OA 4FK0A 2RO0A 1SKRA 3VQ4A 3LYIA 1D5AA 4FJ7A 4B08A 3ZT3A 4DSEA 2HHWA 3DRPA 4CJ5A 1ASVA 4DQSA 3SQ2A 4O55A 2FHDA 4CGIA 3F9KA 2D0BA 1CXUA 3NE6A 5D6YA 3SYZA 2O4XB 4B9MA 4YNQA 2KQ2A 2X78A 3DOKA 4FL6A 2R7YA 2BUDA 3OYGA 2M16A 1RBTA 1RCHA 4KV8A 3NHGA 4QVZA 3I0RA 2ZQBA 3OYCA 3EAEA 4BE0A 2R5AA 3ZSRA 2HHSA 4F4KA 4FK4A 2XY5A 3RMCA 2YRVA 4DTXA 4NCBA 1ZBUA 2RHUA 1T03A 3BDLA 3MEWA 3TARA 3PX4A 3SQ4A 1SUQA 5J2PA 4OKKA 3MECA 4CJLA 4HCCA 2D0CA 4QW2A 1C0TA 1JLAA 4PLLA 3VQ8A 3K5LA 4KB1A 3WNHA 1BISA 3MEVA 3NH1A 4O5BA 4BWMA 4CHPA 3DRRA 3L2VA 3EZ5A 2EHGA 2EQUA 2B8AA 1J9AA 1ZYQA 4FJKA 1ZBIA 1QHTA 3LZIA 5HRPA 1LAWA 2HMIA 3SV3A 4EZ9A 3BGRA 2BGGA 4KREA 2G8FA 3G10A 3E01A 4LH5A 3V9WA 1GOBA 1D9FA 2PQWA 4C8MA 1NK7A 1Z25A 4E89A 3PFSA 4Q5WA 1S9EA 5KRSA 3L3UA 1EP4A 3VN5A 3AVNA 1BQNA 3VQ7A 4CEZA 1SKWA 3MXMA 2VG6A 3LX7A 3AVBA 3MXIA 1U47A 1NKEA 4JS4A 1NK6A 3KTQA 4CF1A 2HQXA 2BDPA 2HHXA 1RT4A 3B6OA 4ICLA 3P8HA 4PUOA 3EYZA 1HYSA 3ITHA 4C5EA 2FBXA 4CFAA 4ID5A 2X6SA 5HRRA 1QTMA 1N6QA 3T3FA 3LWMA 4FJJA 3SUQA 1TK0A 3C94A 3LP1A 2FC0A 4AHCA 4M41A 2MWOA 4DSFA 3SV4A 4CCHA 4CK1A 3EY1A 2ZD1A 1N27A 2P0KA 3DB4A 4BWJA 4QQDA 1NK8A 5IN1A 4B9LA 2XDPA 1TV6A 3OYEA 1QS4A 3D45A 3O4NA 4ELVA 3FFIA 1D9DA 3S3MA 4AHVA 2OYQA 3DLMA 4LSNA 4PY5A 3V1OA 3TI0A 2HNZA 3LPTA 3TR8A 3OS1A 4M3RA 2LRQA 4FJ8A 1QE1A 4RG2A 3RWUA 4CGGA 3RMDA 2Z1GA 1KRPA 2HVIA 3LH0A 2X35A 1XHXA 4AHTA 4DFMA 1IKWA 1RT5A 4O0IA 4JS5A 1RTJA 3QKJA 2GF7A 1N5YA 1UWBA 2DAQA 4LD6A 4CHNA 4CF0A 4OVAA 3AA2A 2W42A 2FBTA 3F73A 2HVHA 1WSEA 2BANA 1FXXA 4M3XA 3VQDA 1VSHA 3NTHA 3F70A 4I2QA 1Y97A 4GVMA 4NCAA 5KGWA 4OVLA 2KFZA 5IAYA 3TAQA 1S1TA 4Z4HA 4DTRA 1RILA 2ZE2A 3AO5A 3IG1A 4HUFA 3NGYA 3JSMA 4Z02A 1U45A 1C1BA 3QNNA 1S9GA 4CJPA 3OYBA 3LAMA 3MEGA 4J2EA 4I7FA 5FDLA 4FW2A 3HJFA 1RDBA 4HTUA 4G1QA 3QINA 4DF4A 3AV9A 1X9WA 1KVAA 1VRTA 3FEOA 3HPHA 1C6VA 2OA8A 4FJGA 1GOAA 3PO4A 1RT1A 1HPZA 3PMIA 3KJVA 1OZ2A 3LAKA 3L2QA 1LWEA 1HNIA 4N41A 4I9QA 4BE1A 4C8OA 2K3YA 3C6UA 2D5RA 5J2QA 3A2FA 3ALYA 1WJRA 4Z4FA 3QESA 3HT3A 1OI1A 3O3FA 1QSLA 3NNQA 3TAEA 1XNIA 5E41A 3SNNA 3S9HA 3TABA 4MQ3A 4LSLA 3SQ1A 3AVLA 3V9SA 4IBNA 3NAEA 4B9SA 2G8KA 1WSFA 2Y1JA 3O4QA 2XHBA 1D8YA 5JS2A 4ELTA 3CEYA 5J2MA 1UA1A 2XO7A 2PZSA 1JKHA 5HBMA 4FJLA 1ASUA 1WJSA 2EQKA 3C6TA 4CK2A 1UOCA 1L3VA 2HB5A 2RI3A 5SZTA 3CM6A 4EP4A 4RG8A 3K57A 2LCCA 4B9NA 1EX4A 3MEEA 4BACA 1OZ3A 4E3SA 1HNVA 1XI1A 4KTWA 2EQMA 1KFDA 1KHCA 1I39A 1NJWA 4OJRA 2E4LA 3HP9A 3OYNA 3MP8A 3HXMA 1RT2A 4EZ6A 3RR8A 4KTQA 4CFBA 2RHZA 3K5OA 3OYMA 1IO2A 1YTAA 3NF9A 3RMAA 4B9XA 2G8WA 4J2DA 3AO3A 3LDSA 3P83D 3HL8A 1RTDA 4X34A 4Z4CA 3DM2A 4C8NA 3LGLA 4FCYA 3HPOA 3ZSZA 3AA5X 3THVA 4CHYA 2XY7A 2YV0X 3L42A 1BL3A 1MHNA 2LTOA 2M1HA 3SD4A 1RBSA 3LALA 1NOZA 1NK4A 4CIEA 4NZGA 2JLEA 1CZ9A 3AVHA 1WSIA 1RT7A 1VSKA 4GMJB 4FVMA 3NF7A 1NK5A 2R58A 1ASWA 3C95A 1C1CA 5KCOA 4PWDA 3S3NA 2IAJA 3HM9A 2G8UA 3OVNA 3OYDA 1A5VA 2X4YA 4RW7A 4C5IA 3HSTB 5HRSA 4N5SA 5KE2A 2WOMA 3TWHA 3E9FA 2OPQA 4FLYA 3QLHA 3OMGA 4FYDA 4E7JA 4OLAA 3SJJA 2YKMA 2OZSA 1RDCA 4FZZA 1SSFA 2IOCA 3V1RA 4DTMA 4FJMA 3LLRA 4KFBA 5HROA 3QIIA 1W9HA 4ELUA 2OPPA 1SKSA 2CKKA 3G0ZA 2G8VA 1QSYA 5C24A 5D6WA 4YFUA 3AVAA 3RRGA 4OGEA 3DLHA 3OMCA 2L3RA 5FRMA 4DMNA 3RR7A 3NCIA 3S6WA 1HJRA 3VQEA 2GFUA 3KK2A 3M9QA 2ATQA 4FJXA 1QSSA 3VQAA 4FJHA 4CGJA 4B9WA 2P5GA 1VSIA 1S1WA 3O8VA 4HHTA 3LWLA 2QQSA 1U4BA 2RJCA 1U48A 5KCHA 5I3UA 3V6DA 1B9FA 4C5HA 3VQBA 4KTZA 4LD0A 1B92A 1L3SA 2DFFA 4H4MA 4DSJA 4CHZA 3H6ZA 4TSXA 2XRIA
chains in the Genus database with same CATH superfamily
1UJ0A 4RW8A 1VQ4Q 1HOMA 1QKXA 2NVUB 1ITYA 2X9DA 5GINA 3I55N 3J7AY 4Z4IA 3WHCA 4ZGEB 4E1NA 3A1YA 3K69A 2RV8A 2NS7A 1I5ZA 1BU1A 2VB6A 4RGRA 2BZXA 3HKZA 2L2PA 3NH2A 1O9SA 4R55A 4Z4GA 2WY7Q 1IH7A 1BW6A 2ZMEA 1VQ8A 4KHUA 3CC7N 5EY4A 2IGIA 2RPNA 1QQMA 2A08A 4FLVA 1PVSA 3I55Q 2CUEA 5IOZA 2GLOA 4H0TB 3CWSA 2WFBA 4JUVA 5H6QA 4B43A 2OC6A 3HJEA 2ZM6K 1T3SA 4XQ3A 1STZA 4DS4A 2NUBA 2E8AA 5FPEA 2JA2A 4K11A 1NM1A 3CC2T 1UEBA 4CJ3A 1VQLI 5IT9O 3CC7Q 2R93J 3FIWA 2MBFA 2ZGZA 3SWNA 1DP3A 1KJWA 3PIPL 3MZHA 4E1JA 1SD6A 4NDLA 3PX0A 3VYUB 1KSPA 1M9SA 4XOPA 3N4MA 5DMRA 5CZ1A 4CJWA 2CQXA 2MG4A 2R5MA 4M3YA 4A12A 4RCCA 2E5ZA 1BQMA 4NLBA 3PO5A 2VKEA 2R7RA 3OIPA 4M3WA 2BEOA 1W6XA 4M3ZA 2QGFB 3IAM2 1V5EA 1ATSA 1MWMA 3L8BA 4IG0A 3CD6I 4X65K 3M8QA 2VXFA 4FLZA 2NXNB 1VQLT 1H89C 1NM7A 4L8RB 2QUFA 1KAXA 3EG3A 1U6GA 2J06A 1ZELA 1S1VA 1W4MA 3TSPA 4HSTA 4BQQA 1UGRB 4K41A 4C3JJ 1D09B 1LWWA 4RTYA 4JJBA 2PYJA 4MQ9F 2FLOA 4FE4A 1I07A 3K9KA 4CJFA 2A07F 4OB1B 4H5RA 3P9KA 3FLGA 3MKYB 4JPBW 1LV5A 1PU7A 4HX4A 2ME6A 1VQMI 4HUEA 1EWQA 3KLOA 4ESJA 3L6QA 1XGMA 1KG1A 3SMSA 5CLSA 5KI6A 3SFMA 2C0OA 4M3GA 2EILH 5AZIA 3WT0A 1FSEA 3SJMA 4BVPA 2CZ6B 3VERA 5BN9A 1FYNA 2G8HA 4XLNF 1XTDA 3EE9A 3FXRA 3ABUA 2YUOA 2WTEA 5I21A 2XMFA 3DKXA 4C0DB 2VT2A 1G3SA 2HF4A 3BF1A 3D2EB 1SF9A 4BRIA 3VDXA 3RKXA 4EVVA 1WEIA 4J00A 1RBUA 2V26A 3CM5A 2OTJI 4E19A 1QBJA 1WHMA 1YAGA 2K6DA 5M5XJ 1UELB 2EFIA 1T95A 4X1EA 1OCRH 4L5GA 3LFKA 2PQ8A 4IQJA 4Y33A 5KE3A 2OCCH 1SRMA 1UG1A 3CCYA 1XMOK 2K9LA 2VQGA 1VQMT 4H5TA 5CIUA 1MBKA 3CD6N 2ZPHB 4K2EA 2YCHA 1GL5A 1ZBSA 2ACJA 5BPIA 2X4JA 3TP0A 2P0QA 4QQGA 1OH7A 1PUFA 2A36A 4J83A 2DVEA 1RBRA 1YTUA 1G59A 5KQ8A 2LG4A 4CJRA 3KLFA 2WSFE 5D6EA 4BRKA 4M42A 5IXBA 4W1UA 2P9LA 5GAOn 3HTRA 3AL0C 4ZDPA 4IG3A 1B3QA 4LH4A 1IN7A 4R5PA 3FE1A 5K7ZA 2FOWA 3O9SA 3E9OA 4BYYA 5AN4A 2F8TA 1F4KA 2CRGA 1IXRC 1SL0A 2PI0A 3CD6Q 5M5YJ 1YOVB 3E0JB 4KIBA 1RDUA 3ZFJA 3JW4A 4PJMA 2AK5A 3DLAA 1S8NA 1T0FC 1QMCA 2NWMA 5SWMA 1DJ7B 4XH1A 1X3ZB 3R3LA 4EPCA 4N0AA 1Q86U 1VA7A 2XICA 4J19A 2VJJA 5HP1A 2JW4A 2FD5A 4BEHB 1H641 5HNFA 4FL9A 5CAIA 1Q8IA 3CESA 1UFFA 3JAMK 1ARKA 4KMFA 4A3CJ 4FM4B 1BA1A 2OTJN 3HHGA 1HDDC 1I1SA 3CBPA 4DBHA 1OVYA 3DOLA 2FBVA 4FWPA 1KSWA 4DTOA 3RESA 3VEOA 3MAQA 2CMPA 1ETWA 3QIPA 3V42A 4PLIA 1OH8A 3QHSA 2BY2A 2X74A 3LQRA 1NLVA 4XH5A 2P9NA 5M9OA 3BG5A 3U9ZA 4DR7K 5GTHC 4KI4A 3R4KA 1KVCA 3RSEB 2KRNA 3H9JA 4DS5A 3ROUA 2RJDA 2A1SA 4FLWA 1ZUUA 3QAHA 1QWFA 3NWTA 1FOKA 4PIIA 3AVJA 1O3TA 2L0AA 2OTJQ 1AHJB 4BBRJ 1TKDA 3AHUA 1K78A 4OPJA 2ECZA 1ZKGA 2WC2A 5C42A 4OMMA 1C0GA 1XOVA 2L01A 3LSRA 2UV1A 4FJIA 3WXKA 4NNJA 1BR2A 5BPMA 3FZHA 4J8OA 3DPUA 2HOTA 3DXMB 1O57A 3WHBA 1U04A 1U2WA 4EJTA 3O3HA 1Q7YU 1Y6IA 4F14A 5BS6A 4BH9A 4D7MA 2LNBA 1MU2A 3HSRA 4DQRA 3SI6A 2RM4A 2QLZA 1RKWA 2DA2A 2XAQA 3LSMA 1L3TA 5GAOl 1W7PD 2MF2A 4AG2C 2KYBA 4E7IA 1VQ5I 2CU7A 2XPWA 4M72A 1Y64A 4A61A 3VA0A 1D4XA 4J6XA 5AJ3K 3TSQA 2CUFA 4F2SA 4UNOA 4S0HB 4OB2B 1RI7A 3NBPA 2HEQA 2KT0A 2VKHA 4KGVB 5CR4A 3V8LA 2CSQA 4B8AB 4CC3A 3H3VK 4CFCA 2RNAA 5GMKj 3VJPA 1FYMA 2IC3A 2XAFA 2QTDA 5ILUA 3HOXJ 1VSMA 3CJ9A 4HVJA 4ZYEA 1P90A 2AP1A 1XNRK 2M1BA 3TO9A 1JLQA 1NJIO 3ASNH 4WCGA 5L3FA 2ECCA 4OP0A 4MZTA 3DYAA 1V4SA 1K73C 1G4DA 3DU6A 4Y3OA 2V9PA 1WEFA 2QEXN 3IS9A 1HXDA 3KZYA 2KQRA 2NLXA 1J5EK 3BLYA 3ZT0A 1VQ5T 4F93B 3MEAA 2W41A 3UIQA 1QZ5A 4EMSA 4C1NK 4FK2A 4UV8A 1KCFA 4L5IA 3RPUD 1RDDA 5GAMg 1TAUA 5I2MA 1U5TC 3BROA 4CJVA 4I6ZA 1QZEA 3LPUA 3FHNA 4YOWA 4KBOA 3VS2A 1WLJA 2EPDA 1NGAA 2EGEA 2QWOA 1Y1VJ 1R4NB 4LUEA 5EEHA 3FXMA 1XQHA 2QEXQ 4ELYC 1R1TA 4CBXA 1TUCA 4JKCA 4C1NI 2CP7A 3EPZA 7AT1B 2ZF5O 3GZNB 4HUGA 4G8XA 3IP4B 3KK3A 3MZYA 3NH0A 3S93A 1BI4B 4LFCK 4FJNA 3CJ1A 1JHFA 3CMMA 1JJ8C 4BVOA 4B9UA 4A4FA 3NGIA 1Q86R 2V8JA 3B6AA 1K6OA 2OTLI 2DRMA 2Z0WA 1PJRA 5DM6F 1IAWA 4EJYA 3BCBA 1YUWA 2A42A 2UZKA 3A4CA 4O5VA 4LDVA 3ID6A 4B3TK 4PL7A 2MAMA 2RA2A 4IOAL 2NOJB 3CQZJ 1FJGK 3U6FA 4BEHA 3OYFA 1W2BP 1YJWI 1EZZB 4M3BA 1B9NA 3IUOA 5GAOq 4RGSA 2MABA 3ECHA 4JKBA 4CJSA 1F36A 4FT8A 1VSLA 2E5KA 4BL0B 1X2KA 2KNBB 3UATA 3JCMd 2EIKH 4CD1A 4M7DA 1PNJA 4FM2A 3ME9A 1LNWA 1GFCA 3QWYA 5FPDA 3NF6A 4DU1A 1QZYA 1WAJA 2CW0F 3A5LC 3L1AA 1BCOA 4C92E 5FLXE 1RACB 1RL2A 4V2SA 1TYQB 2P5LC 2ASOA 4A3FJ 3OSGA 1QVPA 1TQPA 3ZQIA 1P4XA 2OTLT 2D2WA 2IRFG 3Q9VA 1AD5A 3QNOA 3H36A 4E6KG 4CFDA 2DTZA 2RK1A 3VS6A 2I2LA 3ZMDA 2RF2A 1EXQA 3CTAA 3FK6A 2QK9A 3D6RA 4KT0E 3KLEA 3HHTB 1UHMA 1HJOA 3ZT2A 4NHJA 4L5JA 2E2IJ 5BNGA 1A5WA 1F21A 4EW0A 3D0PA 2KP6A 2HKXA 1X6GA 2IGMA 2P9IB 2IVOA 4C92D 1KG5A 3G25A 5M3MJ 5IYDJ 3HFNA 1Q7YR 4R79A 3MZ8A 5FPNA 4JI4K 1BJZA 3KK1A 3PIOA 3TAMA 1E7OA 5H2FC 1BK2A 1TU0B 3UT1A 4EIAA 2QWMA 1Z77A 2MC3A 2CUDA 2HBWA 2RHYA 3C65A 2XDDA 4DV2K 2O01E 1LW2A 2P0PA 2VQLA 2QTVA 1D3BB 2DX1A 2YSRA 5GPCA 4LFUA 2HKNA 2DIQA 3I5UA 2RJEA 3ZETB 4BHPA 4OPKA 4FLUA 2A28A 4DR4K 4JI8K 4C8KA 3ABLH 4KYWA 1YJWN 1YLFA 4EP5A 2D1VA 1FSHA 3W6JB 2OZMA 2ROLA 1O7LA 4MTEA 4B8CA 1GOCA 1NGJA 4Y1DA 3ZT1A 1EJ9A 1LCUA 2DA7A 3KCCA 4LJZF 1QPIA 1U3EM 3KIOA 1WJQA 1MUNA 1ZREA 1WHJA 4DU3A 3TU4K 3CVTA 4W5QA 2JTVA 3J7YJ 2KL4A 1KHIA 3HBLA 2JZ2A 3GFIA 2CV1A 3IH4A 4L6V5 2KZMA 2WONA 2M0OA 3J7ZO 1IDZA 2K7AA 4CERA 5CR2A 5CKDA 4PJOF 2JZYA 1TL1A 1YJWQ 1B34B 2ITMA 2VE8A 3F72A 2RN8A 2OPTA 3I4MJ 2IPOB 1RT3A 3CCJI 3VTIA 4XK8E 3UNGC 4IHXA 4YY3K 4E6RA 3FHFA 2RN2A 4NYNA 3IQLA 3CMAI 2VGNA 1YITI 1HA8A 4C8QG 2C06A 3E6BA 4LLNA 3GNFB 2HZYA 4PL6A 5A0LA 1ZYRF 1MBFA 5I9EB 3KP2A 4EAHD 2E7XA 2Y2ZA 1JTXA 2QWQA 1J59A 3AT1B 2D1XA 4ZDOA 2VWBA 3ZQCA 1KTQA 4LD5A 2FBYA 3ABTA 4L9JA 4XTVA 4KHSA 4HTLA 2UXBK 4WXCA 3VRYA 2KKOA 1VK0A 1OJLA 3F10A 2CP6A 1TWHJ 3CC4N 4Y52J 3HKSA 3M8EA 2WAEA 1BCMA 2Y75A 2I8DA 2CQKA 4LF4K 3PQKA 5C10A 2YUSA 4M7AE 5M3FJ 2NLUA 2E2PA 1QLYA 4DLEA 4JKAA 3HHHA 2AXTC 2DBKA 2VPLA 3CMAT 1S1UA 5ICGA 1NK0A 3GF2A 3M8PA 4XKBA 1LE8A 1W7PB 3IAS2 1M1FA 2PMZN 2BY3A 4YPHA 5GANj 4RAYA 3CC4Q 4DKWA 3MN9A 2CT4A 1FZPB 2GIVA 4PZJA 1YIJA 3S15J 2DJQA 2KRMA 4A69C 3K4CA 4RLQA 4KKOA 3ZEHA 2E12A 1VQKA 4H5VA 3CCJN 3VENA 2G7HA 4DFPA 3CCUI 2L3PA 3PVLA 1WSHA 1YITN 5FROA 2JN0A 2DYIA 2CW7A 1VQOT 5JVHL 4AUXA 3JAMZ 1DEJA 3CCMI 1TYQA 4CZMA 1RRJA 3GE1A 1ATNA 3ZQQA 4YOYA 3PT9A 4PSWA 4LF8K 2XGCA 3C18A 3PNVA 3J81E 1YI2N 1U49A 1S1XA 4IF4A 2QA4I 4LD9K 1GLJO 3G71N 2YNFA 1UE9A 1FMWA 3CCJQ 3FF5A 1WJFA 1H3ZA 3CMAQ 2R5YB 1YITQ 1IV6A 3ASKA 1K73U 5BR9A 3DTIA 3G1JA 2N8GA 1L3UA 2DL4A 4CYDA 1QZ6A 1YS6A 2LQ8A 4CO8A 3MN2A 4WXHA 1SL2A 2B7EA 3GPLA 3ULEB 1ORKA 1LJ9A 4DSLA 3VYGA 1YIJT 1YI2Q 2EGAA 1JXMA 2ITGA 5AQTA 5LGTA 1VQKT 6PAXA 3QYBA 1VUBA 3DWLE 2F2VA 5EX5A 3I56N 2K5IA 3HZJA 1OCCH 2X0LA 2ZNZA 5AQLA 4Y92A 5FWBA 1ASVA 4DQSA 3CCQT 2QA4T 4HBLA 4O55A 4WX9A 3F9KA 5MLCQ 2D0BA 1CXUA 4OFHA 4BGAA 4ME7A 4MFDA 5FW9A 5LEJA 5IP9J 3DPTA 2DDAA 3VYSB 1BG3A 3FHGA 3RSNA 3CCUN 5E1WA 1JXOA 2M16A 3AG4H 4JAXA 3CPWA 3I56Q 1WB9A 1RCHA 1I6XA 4KV8A 4ITVA 3CCMN 4PJOB 1I0CA 1P6RA 5H20A 4C30A 1GHCA 2EQIA 5F64A 2OI3A 1M8VA 4IO9L 1X27A 4BE0A 3CCLA 4F4KA 3ENHA 2XB0X 4OF1A 4ZYAA 4F52A 4CH7A 2F2EA 1T03A 5LRRA 4LUDA 2QASA 3BDLA 2DK5A 4GRIA 3TARA 3CCUQ 3SQ4A 4XEIA 1SUQA 3C6HA 2VXDA 1VQ6I 2FPDA 2D0CA 3ATVA 3CCMQ 1T44A 1C0TA 2CQ7A 3CDHA 4KB1A 3I35A 3BZKA 3MEVA 3NH1A 3ZX3A 4CHPA 2LJ0A 1JRIA 1TUUA 3EZ5A 1RRQA 2EHGA 2VODA 1M90O 4EMKC 3VWBA 1KD1O 3RUXA 3MN5A 1ZBIA 4ENKA 3KEQA 1SMYF 3SHFA 3WG7H 5JI6A 4FIBA 3KVGA 5AQHA 3CCSI 2BGGA 4AM6A 4P9UA 3GP8A 3UPUA 1YW7A 1T98A 2DTIA 3TEEA 2E6ZA 1S9HA 1JGSA 2WAFA 1K8KB 3V9WA 3S32A 3AFHA 3ZBDA 2P9PB 2PQWA 1LDDA 5I11A 3M0TA 1Z25A 2E2NA 1VQ6T 2V1XA 3S2HJ 1W7PA 5B5EC 5GANe 3H6EA 2ZCWA 3GTKJ 2DFIA 3ZCOA 3ZQFA 2Q97A 4E4HA 4IZ9A 3G6EA 3VN5A 3AVNA 1GXPA 4OB0B 4VUBA 3CMYA 1BQNA 4CEZA 2HYJA 1SKWA 3VPZA 1NPRA 3OOPA 4AYBN 2VG6A 3CBOA 5GAGJ 1PG5B 2HVRA 4FETA 5J1RA 4V2FA 2CUZA 3JRCA 1O3RA 4JS4A 1NK6A 2ADUA 1SFOJ 3A03A 2HHXA 4CA0A 2V52B 1RT4A 2LZ6B 3EYZA 1HYSA 1LPLA 2FBXA 4CFAA 1K9AA 5L3CA 4BRHA 1I27A 2X6SA 4JP0A 3LWMA 1AZEA 4A3JJ 3C94A 2FC0A 4I7HA 4DYQA 1HR0K 2DYSH 4R0KA 4DSFA 3EHRA 4CCHA 1NPPA 4XH4A 2GOMA 2YUPA 1K73R 4OPHA 4II2A 1YJ9N 2P0KA 4CZGA 3LWFA 1X3WB 5KAIC 3O1BA 2NUTA 2LCSA 1MZBA 2V8IA 3G6ET 1HKGA 1VQ7I 3JR9A 3K70C 1IHVA 3JRHA 3O4NA 3CCSN 3MAJA 4HLYA 1R9TJ 3OSSC 5L8RE 2MLKA 2LP5A 3S3MA 4PFOA 2K85A 3DLMA 1U9OA 4CBWA 4L18B 4O3MA 3QICA 1ZQ1A 3OR2C 1I50J 1XSXA 2V75A 4M3EA 5LRSA 4RG2A 2GCXA 1YJ9Q 3BR0A 5GIOA 2RQWA 2Z1GA 3VGLA 3Q5FA 1F5TA 4LN2A 1ACIA 3K6GA 3EYIA 3PSIA 2YS9A 4LMYA 4XONA 3FXQA 4AHTA 3BCAA 2RQRA 4EJUA 1U8RA 3HRGA 1RLPC 4OPAA 1RT5A 4O0IA 3CP2A 5LGNA 1W1WE 4YIIA 1ETOA 2FJ1A 2DAQA 3ZP5A 4F16A 2E65A 3CCSQ 1DU0A 2XGDA 5LFAA 4OVAA 4CF0A 4M78G 3AA2A 3FB9A 2FMYA 1T33A 2LNHB 2W42A 3JCMX 4ZN3A 3F73A 3F8FA 3HGYA 1MNMC 1BW5A 5F1RA 3ISPA 3HKZN 3H0HA 5FGMA 1QHHD 2DBMA 1QQNA 4L9TA 1FYLA 3KE2A 3TU5A 1OX8A 1Y71A 3SYTA 1VQ8N 2GWJA 2O8FB 5ADXA 5IAYA 5M1PA 1QVUA 1EH6A 2A05A 1S1TA 3KXTA 3WUHA 3HSEA 4HKEA 3LWIA 4AWXB 3EKUA 1JBMA 4XRFA 2HU9A 3AO5A 3C7JA 4LK0F 3IG1A 1PU6A 4F04B 2DQLA 2EV6A 1B8IB 3MEGA 2R7TA 4I7FA 5FDLA 3HJFA 2FB7A 2NRXA 1RDBA 3DLLL 3CMEA 2NOZA 3CUQA 1OOTA 1ZH5A 4XAXB 1VQ8Q 1X9WA 1KVAA 3M8JA 4BGBA 3FEOA 3Q0UA 1VQ7N 2XSDC 4FJGA 4OU0A 1ULYA 4B3AA 1KK7A 1UGPB 5GANf 3PIPA 1N8RO 3OOUA 5EZGA 4QLCU 2IP2A 1AWXA 3QUIA 3LAKA 4A5MA 5LJ5h 4C92A 3KK7A 4OMFB 4BE1A 2K4JA 4PKHA 5KN9A 3C6UA 4HAMA 1MH3A 3J7AO 4JHDA 3JSCA 3K4BA 1EIFA 3H3UA 3A2FA 5C4XJ 1HKSA 1VQ7Q 2QQAA 4UOBA 3BFMA 2CSOA 1VOMA 2L3DA 3NNQA 4DR5K 2K9MA 3ERED 5E41A 2ZO4A 2Q8KA 5LJWA 2E60A 2NYXA 1OULA 4WQ5C 2DNUA 3NVMA 2K86A 3K7AJ 4BGDA 4M7YA 3NAEA 3RKQA 4JYAK 2F5CA 2Y1JA 1D8YA 2QKLB 3DCFA 3QZ5B 3PUBA 4CCKA 1UA1A 3FMSA 3GMEA 2SEMA 3QU3A 4XN3A 4R8HA 1JKHA 4D8KA 1OQYA 2VQHA 2VJ4A 1WJSA 2XASA 2DDBA 2EQKA 2A69F 1G2HA 3CVSA 1Y56A 2HB5A 4U87A 3N5NX 4J5YA 3C0CA 5JFRA 4EP4A 1MGQA 3K57A 1YQKA 3P38A 1EX4A 3BF3A 4BACA 2JRTA 5K7HA 5DM7L 1UFMA 5J3BA 2H27A 1HNVA 1XI1A 1XG7A 1ZARA 5EXWA 4EMHA 3E6MA 2JVGA 2DKGA 2E4LA 2LKPA 2CGPA 5LBQA 3MP8A 2MLGA 3OYNA 3HXLA 4F91B 3BR1A 2ZXWH 4M3FA 1HNXK 2KIQA 3RR8A 4DEYA 1NHAA 3BJ6A 4J9CA 1YWOA 4FSVA 4BXUA 5C4JJ 3I33A 5E79C 4HVVA 2QGGA 1Q1VA 9ANTA 2G8WA 4C0GA 3RQ4A 3MN7A 1WQ7A 1JUSA 1QVFS 5AFUH 2IGOA 3HL8A 1D8KA 2JTMA 4W97A 2YJEA 3GBQA 1SZ2A 3ZMZA 2EWSA 2VL8A 2WTUA 3HPOA 2KE9A 2KKZA 2K3BA 3AA5X 3BJOA 3THVA 2YI1A 4QVDA 2UUCK 4H0EA 1Q86O 1ZBXA 1BL3A 3VF6A 2LTOA 5J4VA 2XAGA 3LALA 5GAN6 3BUZB 1FIAA 4CIEA 2F5TX 2JLEA 3AVHA 2VCPA 5BR8K 2VBZA 1VRLA 3CDLA 4M77E 4N0AC 3CQTA 1QHAA 3C95A 2RAEA 3TW6A 4QIWN 2FSNA 3WXIA 1K83J 2BV6A 2IAJA 3EQLF 3FM3A 1NGBA 5DV5A 1QQJA 2QSGX 3OVNA 2A6AA 4M7AA 1DU6A 3S2DJ 4RW7A 4N5SA 2IVWA 2VKDA 3EGUA 2CS3A 5GADP 2IAIA 2E1OA 2F9WA 2J05A 1JHHA 5GAEJ 2WOMA 1WUAA 4BRGA 3FZMA 3QLHA 1B8IA 1P7JA 2C0IA 2HDCA 4NQWB 1BI1A 5IWAK 4GCVA 4M77D 4OLAA 1MBHA 1X2QA 2IOCA 2JS0A 2BUPA 2NRWA 2UXNA 4AVZA 1YNZA 2KJCA 4JEPA 2HBMA 1F1ZA 4CYCB 2W6KA 2K9SA 3QIIA 1L3LA 2I10A 1HD3A 2D0NA 2BOLA 4II3A 1OPKA 3OIQA 2OPPA 4RMOA 1SKSA 4FPBA 1QSYA 2CG4A 3M0QA 3JB9F 1E2XA 5C24A 4JI1K 5AZJA 2KJBA 1R77A 2F48A 4PDKA 1UTIA 1JJ2A 1Q7YO 1MIJA 1WNLA 4H4KC 4LDXA 3GTPJ 4IHSA 2TRTA 3UA7A 1NYGA 4WK8F 3VQAA 4H03B 3IC7A 2P5GA 1IGNA 1ZLMA 4ELZC 1VSIA 3THXB 1S1WA 3VS4A 4IHWA 4GLKA 1Q81C 2NRVA 2EBPA 2WSCE 2EVRA 4NL2A 3I4PA 3OSFA 2JNGA 1AOYA 3IKTA 2X6YA 2EIFA 3QOPA 2A41A 3R6SA 1IHWA 4LD0A 2JUCA 4I98B 2DFFA 3K2ZA 3NRVA 1X9JA 4CHZA 3H6ZA 4BRAA 2XRIA 1UHFA 5IT9Z 1OR7C 1R8OB 1AKHA 5ECAA 2Q3SA 2Y90A 2L7KA 2CUBA 2MW8A 3DWLA 4AMCA 1T8EA 5CHIA 1YHQA 2RI5A 3EFRA 4C0DC 3ABMH 2HI3A 2V79A 2Z5UA 1HPMA 4JKFA 2K5FA 1OYIA 1N3CA 2LSNA 2E2HJ 4RAFA 4RW6A 2XKOA 3BR6A 4EGZA 3HUGB 4N0BA 2K2MA 3HP6A 2RDPA 3HVRA 2YRDA 1D0XA 5K5RA 2KROA 1M1GA 1ZHIA 4OIRF 3ZX0A 2D4WA 4Z4EA 2LY1A 4IHTA 1GXQA 4UQGA 1RR7A 2LKSA 4XSXF 1QKWA 3AGKA 1LPQA 4QPOA 4C0FA 3QEPA 1WKMA 3CJ7A 4JJCA 5ICEA 3QYFA 3NMZC 3HRTA 3ZSXA 2DOFA 4DA4A 1ETYA 4CI6A 4U67L 4AI5A 2K9GA 2JJ7A 3V9XA 3PMTA 5KH6A 2DI3A 3B73A 4XRSA 1MSEC 1WYXA 5J47A 2AZSA 1ZR2A 3GXOA 1TVRA 1HYVA 3TEDA 4BG9A 1OKRA 3VEVA 2HYFA 4OOIA 1IBLK 2QKKA 2PJPA 1YHQT 3M7GA 4JBAA 4QOZB 4C2MJ 1LEAA 1NZ9A 3CJAA 4FX4A 1FBQA 3ZEUB 4CECA 5GMKm 3WNEA 3VQ6A 2GWRA 3EG2A 1RTIA 1E4FT 3PV8A 3EG0A 1AWOA 2HZTA 4UXNA 1FJLA 4CZHA 1XMKA 3BR3A 1SVOA 2PVOB 2E2OA 1JUMA 1OCPA 3E3VA 4M75F 4G7OF 3H35A 1SAZA 4M7XA 3L09A 4LIUA 2EA2A 5E3MA 3J7ZI 1ZX6A 1M1KO 2IA0A 2O6GE 5D6XA 4Z0UA 1WAFA 5C6SA 1CQTA 3ER0A 2PYLA 1S6QA 1R36A 2ZJRL 5GTIC 1X2NA 1FOXA 4IEJA 2RJFA 1U5TB 3RTVA 1KC8O 1VSJA 3IH2A 1W36D 4IXAA 4D8DA 4BB7A 3OS0A 2G3RA 1A5XA 4F3QA 4ENJA 3I0TA 3ISNC 4EMGA 4ANJA 4ZJZA 3OW2A 3ZOBA 1GXIE 1R71A 1KLNA 2JS2A 3SAHA 5J3LA 4IRGA 3ZN1A 5AQFA 2QW9A 3J7AF 4D7NA 1WJCA 4ILJA 3VYHB 1K7AA 4JLIA 2LVMA 5CYMA 3R2XC 3RMBA 1R1UA 2XRLA 3AGRA 4JN4A 1YX5A 1C0UA 4BRLA 1ETKA 1TZLA 1N77A 1LUJB 2V1RA 4PUSA 4ASNA 2CP2A 5B8HA 3A01B 3VPRA 1FNNA 1MPGA 4DV4K 2LRDA 3QP6A 1JE8A 2QYZA 1VQNA 4L9NA 4UVAA 4YOTA 4CCMA 2CZ0B 4HT9A 3IUCA 2DT5A 3IDHA 3OH6A 3KZZA 2Y4XA 1X1BA 2EPFA 4CIFA 2EZIA 5F0CA 2MD5A 2PLYA 5HDKA 1NLPC 5A2QO 3CETA 1WSGA 3C4SA 2YX6A 1OISA 1GLBG 3CCET 1P8ZA 4FOIA 5HOOA 5GAMh 4CCJA 1HK9A 3CF5F 1WRJA 3ZT4A 3CPEA 4F7UG 3V8KA 2GWKA 3H1QA 5FLMJ 2KIFA 3S1QJ 4DIQA 2P9SB 5E1ZB 1OX9A 2YNHA 4V2GA 3FZVA 4FOEA 3T1BA 2PU9B 3SCXA 4CZJA 3WNFA 1X4OA 3QEXA 4A4GA 3HUGA 4M77B 4CVNE 3FR0A 1OLTA 3HOSA 2LT1A 2JMCA 2HHQA 3MXJA 3L2ZA 4Q0BA 2MYSA 1XSVA 3DP7A 4YHHK 1TAQA 4CHQA 1APLC 2ZJPF 1R5GA 1BC7C 4JD2B 1HX1A 2M02A 3W2VA 2OD5A 3F23A 1SFUA 1OU9A 4BRMA 1WIEA 3H0IA 2CV0A 4FWRA 2QXFA 4IFVA 2CH4W 1O13A 1IN6A 3L2RA 2GA1A 3X2QH 4AM7A 3AO1A 5GIPA 4UUSB 3EUKL 2CS7A 3CQ8A 2ASPA 2Z16A 2K57A 1TGOA 2DK3A 5CZ2A 1JEGA 2GTOA 4Q5VA 3DLEA 1VFCA 4FT4A 3KUFA 3G4SA 5AONA 3JSOA 3IKMA 3P1GA 3OYLA 1XWLA 2HSTA 1YS7A 4M6XA 2IVPA 3GFJA 3OYHA 4W5NA 1FK9A 2QSFX 2XK0A 2HQEA 3UKRB 4AIKA 3REBB 5CKEA 1ZQ3P 5JS1A 4M75B 3RVCA 3VTHA 3UB5A 4OMNA 4M7DG 4CF8A 2MK5A 5EG0B 2RN7A 2X6OA 3PX6A 5D7UA 4CEAA 1NBWA 4JLGA 4HX8A 2EW3A 2X4XA 1T0JA 3DV8A 4FU6A 4CCLA 2DPDA 2CQQA 2B0LA 3HYIA 2AIRB 5CVJA 5J2NA 1U5TA 3P8BB 3A8GB 3LDOA 2LMDA 4HF1A 4CZIA 4YRVA 4BY1J 2Q0OA 4FYWB 3M9AA 3VOEA 4I99C 2BZTA 4QVCA 1AU7A 1Y1WJ 1D3YA 1K73O 1HQEA 4IDKA 4DQPA 2V9VA 4NXNK 5KYXA 2A1RA 3AG3H 3GLXA 2KDZA 4M9ZA 4A4HA 2E35A 1D8JA 3PJRA 1GFDA 5CKTA 3HPWA 2L5QA 1SEMA 2HEOA 1V54H 3A0IX 2ID6A 3ZSVA 1F1BB 2A61A 3UR3C 4A3GJ 3JB9I 1VSEA 4C8LA 2LD5A 1WVRA 4M3TA 2HHVA 1TT0A 3QP5A 2DXUA 2G0EA 1T05A 1VQPT 4Y17A 3LSJA 2DA1A 2E5QA 2F2WA 4B1XB 3KKRA 2FPEA 1WH7A 3PGGA 3RR6A 3UKGA 4N4NB 4HPQA 2L9NA 1HF0A 3SDGA 4J9DA 3TREA 5B1BH 4KNYA 3L2WA 1VNDA 3I64A 1JLBA 4YFNF 1J5OA 4CZEA 2XHIA 1SAUA 1KU7A 2LDUA 1SG5A 2Y9ZA 3MO8A 1UGVA 2RHIA 5K7FA 1VSDA 3FM5A 2X3WD 5KYYA 3MK6A 3M1EA 2RHKA 4B9QA 5HDGA 2E1HA 5EGOB 3IRQA 3X24B 1Q9XA 2H56A 3GLLA 3FK7A 3COAC 3KBGA 4RA2A 2EFWA 2EYWA 3DQVC 4F3OA 3A8HB 2DL7A 2NOEA 1Y8QB 3META 2HS5A 4G7HF 3ECOA 4QSHA 2GM4A 2F4OB 3K1NA 2A37A 3EO3A 1W2BS 3WE3A 3S3OA 2VC8A 3JRBA 2E6LA 4M77A 3SBTA 1NG2A 6AT1B 3CCLN 4CGFA 3S2WA 4B21A 3C0BA 3VUZA 3JCMc 4IUPA 3VW4A 2BXYA 1ZA1B 3GBTA 1ZN2A 5J26A 3MFKA 5HODA 1PP8F 4B3SK 2P9KB 1RAEB 5LEKA 3SUPA 2M51A 2R7FA 3QOEA 4XRMA 2KLAA 4NLCA 1HKBA 1B4AA 4LLGF 2QQRA 3CPWP 1OKJA 4FLXA 4UUSA 3LSIA 2DTUA 1OYXA 3M8FA 1O3QA 4CI0C 4MIMA 3CCLQ 3FKJA 4CJQA 3IAYA 2K3PA 1K6YA 2ZPGB 2I5WA 4E9HA 5ICFA 3D4VA 1G15A 1B72B 4IPAA 1RNLA 2STTA 3V9UA 5IT3A 4UV9A 1VQ9I 3BPVA 3IKVA 5LD2C 4BRCA 1Q81R 4U0VA 4W5OA 1SD5A 4HVUA 3TQNA 1DTTA 1YVUA 3OYIA 2BH1A 4I2PA 4XLFA 2P5OA 3F21A 2B5JA 1EFNA 3KYLA 1RRSA 3F22A 3LGFA 4HNVA 1XDSA 4E9FA 2L0KA 3FDRA 3VQ5A 5GANd 3KP6A 2AKKA 3IHUA 5J4YA 4A62A 2R5ZA 1UECA 3CERA 1T8IA 3HDDA 2DK8A 4PK4A 3JCUC 2F5KA 5CKFA 5HS9A 2BY0A 1P7MA 1J9IA 1DP7P 3LSGA 2FNAA 4ISFA 3FC3A 4LOCA 4OMPA 1VF9A 3H1VX 3HG9A 1SHGA 4JLHA 4EM1A 1K0XA 3HBTA 4CGZA 2XIDA 2Z9OA 3JCMV 1VQ9T 2ED0A 1LOJA 2Q31A 1Z0XA 2Z1HA 4RTFD 3PNTA 3M4YA 4MLEA 2K79A 1P2FA 1X1CA 4DSIA 1PU8A 1AVZC 5AR0A 4GY2B 4LC9B 4ZTFA 2FBHA 1T38A 2X6XA 5DK5A 3ZQLA 4O8KA 1S6LA 3D0SA 1WH5A 2Y69H 1BL0A 2VG5A 3QJ6A 3JAME 4I02A 4I76A 3CMEI 1ORPA 4KAZA 4AHRA 4LG3A 2Z33A 1SV5A 5C0MA 1ZGAA 1JGGA 4DSKA 2F5VA 3JRGA 3IH7A 4CJEA 1JXEA 3MKLA 2QXLA 2K2VA 4NOYA 4IXCA 1U06A 5DY9A 1HW5A 2PN6A 4GV9A 4B4CA 3OB9A 4DQ8A 4CZCA 2IS2A 3SBGA 2BBYA 2RF0A 5GAN8 3A8YA 3OYKA 3NDKA 4Y13A 4HOBA 2FZCB 4XKCA 3E6CC 2E6NA 4DOWA 4KO0A 4DZPA 5KYWB 1QVFM 1OQKA 4KB0A 4J9BA 3I9QA 2K3FA 1RGIA 3M1FA 4ESBA 1JLCA 4XICA 2VXEA 2JA5J 2IT0A 2HL5C 2V6EA 4QQ6A 1S5JA 2H8HA 4FWLA 5I22A 4C5GA 4BDZA 4MDXA 2XY8A 3CJNA 4PJOC 1O1WA 1U3OA 3U3YA 4JRQA 5AQPA 4CICA 3ASMA 3NEUA 1QU3A 4JRPA 4FX0A 3TSZA 3K58A 4EA4A 2C0TA 4M6YA 4MMKA 3V9ZA 4O5FA 1ORNA 1GLFO 4ISEA 3IRXA 2XHKA 3VS5A 2QWRA 5LJ3g 2XVCA 3TO6A 2M4GA 4B23A 3EG1A 3BG3A 2FXUA 4E2FB 1I5OB 1GVJA 2HKOA 2A5YB 4YORA 2YU3A 2R7SA 3MDQA 3O8HA 1NH3A 1OH5A 2NZTA 4JI7K 3CMEN 2EJFA 2CYZB 2GAUA 4DG1A 2QYOA 4BY7J 3SZGA 5E18F 1IGQA 1ZGWA 1FY7A 3EGDA 3NMUA 1WJBA 1WQWA 2DTHA 1M2VA 5M1OA 4JI2K 2SRCA 4JNEA 4UC4A 2RNJA 2QG9B 3GZ5A 1KU2A 2EJRA 1W5TA 1ZLKA 3SB2A 5HLFA 2L7MP 1JB0E 5ILSA 4DQ2A 3CMEQ 1KYZA 2E64A 3VOVA 3SDZA 4XBFA 3UDCA 4OFEA 4ZHRA 2HNIA 2W10A 5CQEA 3CWUA 3PNWC 1YCYA 4JK8A 1L0OC 4HZFA 4C2TA 2IVNA 3CBMA 2Y0MA 3U1DA 4JZ3A 4BQOA 1NJYA 1BR4A 3QBXA 3JRDA 1RUNA 1S72I 2BE9B 4FSXA 3C6AA 2ZSIB 3A2KA 2JWLA 3LP0A 4E7SA 5L23A 3CCVI 1A6IA 2P4TA 1VSFA 4H4OA 1YP5A 2OFKA 5JHFA 5KAFC 3IH3A 4YG2F 2RO0A 4JJDA 2EB7A 1ZSZB 1SS6A 5EYRA 2ZPBB 5F04A 5F1JA 1SFXA 1KG2A 2DO3A 2BW3B 1D5AA 4FJ7A 4B08A 3THWB 4A5BA 1CGPA 4FISA 3AKZA 2L54A 5FU7B 3OR1C 4KH6A 3SQ2A 2RD1A 4HG2A 2FHDA 4EMKA 2PVGB 4FO0A 3NE6A 5D6YA 3AG2H 3SYZA 1QA6A 2O4XB 4RGUA 5DM6L 4MDBA 5GAN4 2IGKA 3DOKA 2YHTA 2NAZA 4GNIA 2CWEA 3I55A 1XGOA 3CCRT 2QI2A 1S72T 2KZVA 1RBTA 2ISYA 3O5BA 4C8QF 4LXCA 5HLHA 4LF5K 3NHGA 2DM1A 3J7YP 4LFBK 3CCVT 3I0RA 2ZQBA 3OYCA 1MWKA 1FLIA 3F0ZA 1P7IA 5TGTA 5E20A 2DTRA 2HHSA 4FK4A 2ENMA 1EBMA 5J40A 2M0YA 4DTXA 2KXCA 2RHUA 1VQ4T 1X3NA 3MEWA 3VYTB 3JCMg 2GQIA 2QWNA 5GMKh 4A53A 4CJLA 2RREA 3CC7I 1G99A 2DA4A 3BZCA 3K4NA 4PLLA 5KYWA 4BJ5C 1N75A 1BISA 4M9XA 2VXZA 4O5BA 3K0LA 2WAQA 4B3RK 1QW1A 5ELZA 4JK1X 2AQFA 3D2FB 2JM9A 4A63B 1IXSB 1DPUA 1NJIC 3I55T 5CKBA 4BREA 1T3LA 1HSQA 2O8DA 2HMIA 3VSLA 3C12A 4HVWA 4EM0B 4XIDA 4KA4A 1S72Q 4A59A 4Q4ZF 5E17F 2YR2A 3MKDA 2EWNA 4RCBA 2QQ8A 3Q9SA 1NK7A 3H46O 2DA6A 4XOTA 3CC7T 1JT0A 4Q5WA 1T08B 5KRSA 5HK3A 5C2DA 1IDYA 1IREB 3EH2A 1EP4A 2L3QA 3BW1A 5BRDA 2EIJH 2FO0A 1IRGA 4C92G 2DCEA 2HL3A 3MXMA 4Z2YA 2P6SA 2XAHA 3LX7A 2LNVA 4Y28E 1VI0A 3KTQA 4ENNA 3TOAA 5D5XB 2BDPA 1XG1A 4BY6B 4ICLA 4C5EA 4ATOA 5JVTA 3TQ7P 3ZX2A 2GELA 4XL9A 4LF6K 3KFWX 3NAUA 3IRRA 1N25A 3IHOA 2DODA 5HRRA 3I3LA 1N6QA 4FJJA 3FIFA 3QBWA 2EYYA 1TK0A 1XMQK 3UE5A 2RB6A 4M41A 2MWOA 4KISA 2YHWA 3M07A 3RERA 3MWTA 3B02A 3EY1A 1YRNB 1BU6O 2ZD1A 2M9HA 4B6MA 1XQOA 1N27A 1VQLA 3FLCO 3J8AA 3DB4A 1MW7A 4BWJA 1IZ6A 4Z88A 2LF7A 2XG8D 2FZKB 5LHGA 1I1JA 2E1ZA 4QQDA 3LSPA 1K4US 2H09A 5IN1A 2O5RA 1NK8A 2QKMB 2XDPA 3OYEA 1X2MA 3JCMb 4U0YA 3FFIA 1JTYA 1XGNA 1E3OC 2OYQA 1JJ2P 4LSNA 3T8RA 4PY5A 3CO7C 5TKYA 2QENA 4DNCA 2ZWHA 5LMUK 1YYVA 1KG3A 3ZPLA 1WHKA 4M3RA 4IDHA 1NKUA 5ADXH 4FJ8A 4RDUA 3O9UA 3RMDA 1U6ZA 3TKYA 5GAHJ 3CF2A 1U1TA 2BW3A 2X35A 5KVRA 3ZYYX 3CD6A 4DFMA 2RK2A 1A31A 1D1BA 1PSEA 4JS5A 3QKJA 1R5ID 2RQTA 4P9FA 1UWBA 1R0CB 3CXCA 2CH5A 2XKOC 1AWJA 2HSEB 2LFBA 3C7NB 2FBTA 2EYQA 1WSEA 3H5RA 2ASMA 2BANA 1FXXA 1WX6A 2YX7A 1VSHA 1Y97A 4C8QB 4NCAA 3R9PA 1X1AA 3HOTA 4IL6C 5KGWA 4ZZLA 4E7ZA 2MD0A 2KFZA 1JKPC 3ML6A 3PLAA 1JXSA 2QDYB 1C0FA 4WQ5A 3N97A 4Z4HA 2CUJA 1S3JA 4RGXA 1VQMA 4DTRA 4HUFA 3NGYA 4G9YA 3EETA 4Z02A 3L7WA 1IRXA 3R6OA 1C1BA 5A2QK 2JTEA 3OYBA 2L2OA 1O7FA 1BI3A 4WCIA 1YIOA 5DCMB 3Q3SA 1ZSGA 3W2AA 2XROA 4G1QA 5AQKA 2A68F 1IJWC 4MNUA 1W1FA 3KYCB 2CT3A 2OAZA 1A0NB 3AV9A 2DA9A 2ETHA 3GEZA 1C6VA 1JCFA 2EZKA 3CD6T 5D5VB 1G3TA 4BUPA 3K4MA 1TWAJ 4M3DA 2ECBA 2OTJA 3NWSA 1N39A 5ERIA 1RT1A 3H9NA 2FG0A 2LBFA 4AVPA 1K79A 4YDUA 2D0PA 1GBQA 2JRMA 4G9ZA 2ABKA 4M7AG 3LCNA 4C3IJ 3INZA 1LWYA 4PGHA 4N41A 4I9QA 3SAGA 3OS5A 1VQNI 4J7FA 2NOLA 3FZKA 3ALYA 4Z4FA 2L9SA 3G1MA 1QP3A 1SKUB 3HT3A 1EQYA 2ID3A 2BGCA 1QSLA 3TAEA 4OIPF 1V4RA 1C0WA 1TTYA 1B9MA 1MMGA 3JXUA 5BRHA 4BAYA 3CXCS 4A93J 1S29A 1WHUA 1UGQB 1RLQC 3FZFA 4A3LJ 4B9SA 2OA4A 2G8KA 1WSFA 1OYYA 4OMQA 3O4QA 5JS2A 1WXBA 3TBIA 5LJVA 1D0YA 3OYYA 1N5ZA 3VGKA 4DOZA 4JX5A 2OTJT 5AQQA 3J80O 2PZSA 2VUBA 4FJLA 4GXOA 5GAGP 1QP2A 3O1WA 3EZWA 1L3VA 2RI3A 5SZTA 3FSPA 4MZMA 4KGZB 3MWPA 2PNIA 2O0YA 5CQYA 5LY3A 1I94K 2W24A 1W70A 1GCPA 5K1YA 1BI0A 2BHZA 4BS9A 1M4ZA 2XAUA 3BC8A 2H6CA 4CCNA 4KTWA 1MUDA 2XPVA 1MV3A 2EQMA 1KFDA 1KHCA 3O8MA 1XTAA 1QWEA 3QXEB 5C3EJ 1M30A 1R7JA 2D1KA 4OJRA 4OO1J 1K61A 1YRNA 5EVZA 3HXMA 1ETVA 3B8AX 4EZ6A 3OW2P 1Q82C 4KTQA 4L5EA 1Y96B 4PJJA 1AWCA 1Q1HA 1VQNN 5D4RA 1IO2A 3ZMSA 3RCOA 1YTAA 3NF9A 2CO5A 3GNGA 4J2DA 3AO3A 1NE8A 4DB3A 2M0MA 3LDSA 1GLLO 4M78F 3P83D 1LQ1A 3NARA 1WBDA 1TUYA 3RYPA 3LGLA 3VEYA 1IUYA 2XRNA 4FCYA 2QM1A 5B3SH 1GLAG 3ZSZA 1FTTA 1RABB 1M3HA 4MHGA 1FX7A 2Q2EB 4BI4A 4DV1K 2M1HA 2QEXI 4AI4A 3QJYA 2O88A 4WYBA 1VQNQ 2JA6J 1WHGA 1NK4A 1NJIU 1KXPA 1CZ9A 3W6KB 3PSFA 3LL3A 1WSIA 2RVCA 1WJAA 3K9JA 1VSKA 2NVTJ 2YX4A 1SEUA 4DR3K 2LF8A 2GZWA 1YJNI 1NK5A 2ESHA 2WSEE 3S1NJ 5IT9E 3S3NA 2JUFA 1HLUA 2VONA 1PKSA 3IV5A 2G8UA 1FMVA 5AT1B 4XRSG 1VQ5A 1Y57A 1SC7A 1JI8A 4RWTA 5DTDA 4C5IA 1W2BM 3F8NA 4JOMA 4ON0A 1YF5L 5KE2A 5IH2A 1E3HA 2OPQA 4FWOA 4FLYA 1ZR4A 5IYBJ 2QEXT 5DCMA 2H1KA 2O8XA 4E7JA 2PUKB 3SJJA 5LJ5e 1RDCA 1AHDP 1SSFA 4FZZA 4DTMA 3JRFA 1WGXA 5F08A 4MDWA 3ATUA 1FEXA 3WTSC 4PL8A 2EAYA 1OR7A 3HOYJ 5CQXA 3B6CA 3FBNB 2W85A 1D1AA 2G8VA 3G4SN 5LJ3f 4OINF 4YFUA 3D2EA 1V5FA 1FPQA 1WPYA 1XGSA 1G8XA 3G73A 2L3RA 4DYCA 4DMNA 1NGIA 3RR7A 4G12A 4EATA 3F8MA 3NCIA 2RQQA 1DGRM 1RAGB 2X3XD 3ZN0A 2ATQA 3N5BB 4P5NA 3GTQJ 1CZAN 4CGJA 1B7TA 5GJVB 1U9NA 2V4JC 3L4QA 3FGUA 2H8RA 2RQVA 3G4SQ 2TDXA 2YLCA 3DFGA 1WQ2A 1SPKA 1YJNN 2W84A 2LLKA 4OB3B 2QQSA 3FBIB 1MJ9A 4HCKA 3HM8A 4O8UA 1U48A 1SSHA 4AFUC 2IJLA 4AM3A 2P5VA 4IQ4A 1B9FA 1WI9A 1BIAA 1FC3A 2O8EB 1M90C 1KD1C 2OTLA 2LC2A 4Y15A 5IP7J 4DEXA 4PJOE 1UB9A 4ENMA 4DQQA 1X9MA 2K3XA 2Z2SB 2IIMA 2Y4YA 1JLFA 2DMTA 2NS0A 1YJNQ 3ULQB 3PNYA 3E9PA 3M5AA 1EA3A 4O0JA 2YKNA 3QEWA 4XM3A 1QZZA 1TTHB 2FOKA 2NUZA 2EQJA 3NFCA 1TSFA 2X1EA 3I5SA 1VAZA 5HKCA 3A8OB 2K40A 4GBQA 2AA4A 3LNQA 4PJOD 2F2XA 1IG7A 4JK9A 4RTXA 4M9SA 1OV3A 4FM1A 4DTNA 4J2AA 4UB8C 3K59A 3DXKB 2EJ9A 2DMQA 2E19A 1Y96A 4NCGA 3HPGA 2FMLA 5IHKA 4DLGA 4KIGA 3VUBA 2GXGA 4OAYA 4AFSC 1CF7B 4Z8AA 1YWPA 1RDAA 4M78B 2A40A 1XQSC 5GJWB 2AXLA 3GIBA 2VE9A 1IO6A 1YQAA 4WF9L 3CZ6A 2WA0A 4RAGA 3RSEA 3QRFF 2Y0SN 1KVBA 4AC0A 3PUFA 2QTXA 1C0MA 4BQAA 1WI3A 2HW3A 3ZL7C 1OCOH 1EKEA 3QBYA 4MEXF 1NJIR 3KX2A 2FRWA 2Q2EA 2XF7A 2YU9J 1KEAA 4NC7A 2MC4A 3NGPA 3M54A 3T1AA 1Y0NA 1YJWT 1GDTA 1WFWA 2BY1A 2GIZA 1ESVA 1NMNA 1ZG3A 5C44J 4ILGB 1Y0UA 1R58A 1NTCA 5LJ5f 1LWCA 4ILHA 4M77C 2JTFA 3DXMA 4BY9C 2Z3YA 4HRIA 3F9MA 4FM0A 2KR3A 3BY6A 3LSKA 1J5YA 4ZGJB 4P1WA 1HC8A 5HVQC 4K25A 1FOYA 5KPTA 2GBZA 1I5LA 5K5OA 3LDPA 2OX7A 2P1JA 1BDGA 1I6HJ 3V81A 2NVYJ 3CC4I 4KRFA 4O4GA 3V7SA 3SUOA 2FNPA 2HKQB 3AG1H 4KUMA 3THKA 5GAEP 4XQFA 3R6MA 2BVLA 1S1NA 3SPZA 4KHWA 3H3OB 3QWLA 4GDFA 2K5LA 1FMKA 3GVAA 2NOHA 4XLHA 5J6XA 2JGUA 3QPTA 5B1AH 3GTLJ 3D7SB 1JT6A 2P81A 3KKSA 2XV4S 3HSFA 4OX9K 4BNCA 3M55A 4J9EA 2KPMA 2PAVA 5A2QZ 5CVRA 4BDPA 2CH6A 1DPRA 3OS2A 3VF4A 1QGPA 4HCZA 3MCPA 4IVNA 2B63J 3ZMUA 1W0UA 2KYMA 1M3QA 2YHXA 3SZPA 1IXCA 2KEAA 3DLGA 3CMAA 1USTA 4M75C 1Z21A 2MMPA 2VWFA 3CC4T 2AKLA 4AILC 1J0RA 4CC2A 2OPRA 3ZSYA 4AHSA 5LL6Z 4BE2A 4CCOA 4BKXA 2QDLA 2O9SA 1Q82U 4MO4A 3JREA 4H8KA 2ELHA 1RUWA 1UHSA 1TH7A 1TKTA 3M8SA 2X85A 3VODA 3HZ6A 1YI2I 3VQQA 3QYGB 2GNCA 4A4KA 2HMAA 3ZMVA 1RIOH 1WWXA 2K27A 4RLFA 3R8EA 3MD2A 3IWFA 3MN6A 1M1EB 3G71I 4D6WA 3ONQA 1WHLA 4QKUA 1N8RC 1IN5A 3SFIA 2CV2A 4XNFA 1V3FA 4NC6A 1J3TA 1VQOA 4X62K 2O8BB 4F9OA 2L4MA 3LP2A 4B3MK 3NTIA 3URGA 3Q0WA 4H0VB 1BI4A 5H6RA 4E0DA 1R49A 3CCJT 3K5NA 3RTRA 5CVIA 3ESWB 2YHAA 1YITT 4GKKK 2RQPA 4A3DJ 2XB5A 3QSUA 2CP5A 1Z91A 4KHNA 1XUPO 2RH2A 2A6EF 1I81A 1JKRC 3A8LB 3SEQA 3I56I 2LJ1A 2FSWA 4NC8A 4M63C 2FU4A 5CK9A 1YI2T 1JLEA 3KYDB 3CJRB 4HCBA 3OBYA 5CE3A 5LHIA 2LQWA 4L0YB 1SD4A 3G71T 1Q18A 3CCUA 3NHNA 3R61A 4BC3A 3QB0A 2ZMEB 1HQUA 3GTJJ 4IX7A 1ITGA 2W00A 2D8HA 5FU6C 3KZIC 2YJFA 2F8SA 1IJJA 1V29B 3PO2J 1X69A 3M5RA 4YOVA 3I5RA 1BYMA 1SANA 2E1YA 3DMJA 3LAPA 3W6VA 5J1YA 2JVHA 3CCQA 2HCKA 3KEOA 2E3HA 2QA4A 2GTJA 1U1SA 2HBJA 1BR1A 2QSHX 3DXJF 3I56T 4DUZK 2Q36A 3R60A 4JKGB 5FPMA 4IZZA 4M77G 5KNLA 1XC9A 3SWNB 3DB3A 4KI6A 1CXQA 3DJCA 4CEFA 1TQMA 4S04A 2M45A 3FJ5A 2HBPA 2P9IA 4IO8A 1W36C 1H1VA 2FQ3A 3A8MB 4D5CA 4LY7A 3GYHX 3NF8A 3O08A 1LWFA 4QS9A 2FF3B 4RW9A 2HHHK 2ESNA 3CCUT 1T2KA 2DFHA 2H1LA 3R0AA 2CGKA 2GGRA 1XN7A 5LLQA 4RBOA 4CJUA 3C2BA 4UY8I 3LZJA 2XDVA 3CCMT 1XPXA 1WXUA 3G71Q 3UWNA 3FXLA 2DF6A 2F69A 1D3BA 3AA3A 3HYFA 3HK2A 4DTPA 2VG7A 1HYOA 4AF1A 1UUEA 3PM1A 3ZETA 2HD0A 2COBA 5LHHA 4RAZA 1IKVA 4QT7A 2E4HA 3N05A 1DDNA 3KEYA 1ON1A 3WTUC 2HPIA 1M90U 3P9CA 4O44A 1KD1U 3V4IA 1CSKA 4DZJA 4BHCA 3I9V2 2YWWA 2ELJA 4KJZA 1WGSA 1ZBHA 4AYBA 5C0YA 4XKVA 1RI9A 5EC7A 4FW1A 3VEPA 2E1MB 2IS3A 3JYTA 1P92A 2P4WA 1TBXA 1WZ2A 4B22A 5E8GA 4BC4A 3I59B 1B34A 1Z9ZA 5AZIB 1Q82R 4C0ZA 5CYQA 4OLBA 2STWA 4Z6YA 1WNSA 5IY5H 4BU2A 1VQ6A 4HQEA 3WQUA 2IW5A 2WWYA 1X3UA 2KW4A 5HRNA 2MFZA 3AARA 1FP1D 3I0SA 4GW6A 4EFHA 4U0WA 4KICA 3V7CA 3LDQA 1LFPA 3O3GA 4MFBA 5CO7A 4BJTA 2EFPA 5GAMe 2L9VA 2QZ8A 4E7KA 4CZFA 1FOWA 4XTWA 3WTYC 4F7UF 3NVKA 2P5KA 2ZAEA 1WCMJ 2IDOA 1WBBA 1LFBA 4B47A 4GFBA 1YJ9I 1RESA 4Y1CA 3BQYA 3GTOJ 3H8ZA 1TK5A 5FKMA 3H9QA 1E0EA 3CCSA 4QPQA 2DIGA 4GY5A 2BE2A 4F3TA 5HS8A 4ID1A 1Q7YC 2VYTA 4RB2C 3WTZA 4E7LA 4K8ZA 3TP3A 1TT5B 4QCLA 2O8BA 1UAAA 3V7RA 3CFOA 1PUFB 1TUDA 1E4GT 2DE0X 3ZGKA 4ABZA 1MMSA 5AYFA 3ULDA 1SD7A 3MEDA 2VBWA 2RQUA 2P9LB 2PY5A 2JHNA 3R1XA 4B1WB 3T19A 3ID8A 1HSJA 4JV5K 4BG8A 2CJJA 3BQZA 3G0QA 1F9NA 4FJ5A 3CC2I 5CJ9A 1KU9A 1QNTA 3HEFA 4CSWA 2DL5A 2O31A 4EHTA 4CW7B 4G6TB 3M4OJ 1LW0A 1ZG5A 1Q9YA 2XDBA 3W3DA 1YJ9T 1TUGB 1WZOA 5I42A 2DD5A 4ETSA 2A3SA 1BIUA 3L0QA 1I8FA 3CPWS 3LA7A 2J7IA 2JN6A 1MBJA 2VQEK 4JRIA 4DFJA 2HQ5A 5LJ3h 2D8JA 4PFPA 3GBGA 4N9IA 2A5WA 5AIQA 3CCST 4K8XA 2HHUA 1VQ8I 3M0UA 4E1MA 1GLEG 1RAFB 2EBIA 5IOYA 3VQCA 4BRDA 3KD5E 1D5YA 2WC9A 5BREA 1CLQA 5J1UA 4Y4RA 1G5VA 2LY9A 3U4LA 5JR3A 2E5NA 1YW9A 3QEIA 4JJNK 2ZJQF 3KLHA 1TS9A 1KQ2A 4M7DF 1G3WA 2EFQA 4IOCF 4IUUA 4XTYA 3FXOA 2WAQN 4NB5A 3U21A 5EJCA 5J1EA 4XU2A 3CUOA 3AAFA 3OQ5A 4L3QA 1RC9A 1W7AA 4JKGA 3FMQA 2P9NB 4XU1A 1VQ7A 1NGHA 1TKZA 1N36K 1MBGA 2UUBK 2R7UA 3RPUA 1PSFA 4CBUA 5FD5A 1Z6RA 2E71A 1B9DA 2R5YA 2P8TA 1CZBA 4IFYA 4CGHA 1A5JA 2KZZA 3H5AA 5KTQA 4F8RA 4J01A 2O4GA 4A3MJ 3CP8A 4CJTA 4N76A 4XU3A 2EK5A 3ULEA 3AVKA 2HDWA 4IUTA 1K78B 1AOJA 1VQ8T 5H1SQ 3QZ9B 5CYVA 4EA5A 1F43A 4J9GA 3H08A 2JMAA 1K8AC 2V51B 1BHLA 3W0LA 3QWXX 3CC2N 3JCMJ 4RUGA 2DMPA 1M90R 4XIUA 1KD1R 3MP6A 3E7LA 3LM2A 2A3ZA 3PIOF 2E1NA 1N8RU 3CXCM 4F2RA 1XB4A 2NS8A 3CF5L 4J6YA 1RAIB 4BR5A 3TDZC 1W0HA 4OGCA 2NNWA 4DTJA 2LR8A 4CJKA 3BEXA 1VQ7T 2GV9A 2KQWA 4OKJA 2QK0A 5GAMf 1RAAB 4TVRA 3CC2Q 2KFNA 4CHUA 2G9WA 1HUXA 4FZXC 2L9RA 2XI9A 4PJOA 5F1XA 2JXBA 1S22A 4BR9A 4ZNXA 1JKQC 4B3XA 2HFHA 5DUIA 3GOXA 1FYKA 4IFEA 1TW3A 4DU4A 1M1KC 3I59A 2AJQA 5BQTA 5KCMA 1ETQA 3CFRA 5EU7A 4CGDA 2ZJPL 4EJZA 3G1LA 2P0WA 3C1DA 1VQLN 1NOYA 4WQ4C 1KC8C 1TL3A 2G8IA 1J54A 1D0ZA 3MX2A 5GAOp 5CVUA 2I5JA 3EKSA 2DERA 1T6CA 1HRHA 4CZZA 2HQNA 3J80K 2NOFA 3F0CA 2JMWA 4AU7A 2DPPB 2LJ3A 5A0DA 1C1AA 4F7UB 1ZSZC 3P5JA 3AO4A 2RKHA 2KDSA 5K5QA 3E5XA 2NRTA 3M57A 4CEOA 4IRIA 1LCKA 5FU7C 2OZ6A 3SLCA 1VQLQ 2AS5F 2VASA 1K1ZA 1N6AA 1X6OA 3MP1A 5JVGF 4BI3A 5F2RA 3PTAA 5AQZA 1S6PA 2F5DA 1MNEA 3VQPA 2DO7A 4U7BA 2HPMA 3JCMh 1LMZA 1NGGA 4F7ZA 3M8RA 4OAZA 2BTTA 2LX7A 3G1OA 2B6AA 3ZLJA 1HJDA 1HDPA 3KP5A 2XKPA 2FVUA 4E7HA 4A54A 3CJCA 2P7VB 4CD3A 4A0XA 4EEFG 1K8KA 4TV7A 3FHZA 1UA0A 2Q1NA 3QODA 2KISA 1OH6A 1KO9A 2FX0A 5FKLA 2P9PA 5M1FA 1N34K 2R4GA 1NKCA 3M3ZA 2ETJA 4ZC3A 2Z1JA 3LA3A 2KK4A 4KT5C 2O03A 3U23A 4AIHA 3HVTA 3TAPA 1D1CA 3E1SA 3CHWA 4KMUX 5FLXO 2DFEA 1MA9B 1VQMN 3CWAA 3SAFA 4FASD 2R7ZJ 4FWSA 3CXCP 3QIOA 2FA5A 2MI6A 3IFRA 1KFSA 1HW2A 2UUAK 5EOYA 3KZBA 3DAWA 1KLMA 2WB1A 1GBRA 2IG0A 4CE9A 1BN5A 3P4IA 2XGEA 1ACMB 2W1OA 3ZXSA 2EJGA 1X75C 4YDUC 1U84A 2LDMA 3EEQA 3RQIA 4KHQA 3H41A 1XNQK 1R22A 4XTZA 4KN7X 4DWIA 1HKTA 4M7DB 1VQMQ 3LDNA 2VQCA 1NK3P 1SL1A 1KZHA 1QVGA 3H0FA 3MWMA 2OZUA 2HTSA 4RTZA 4HWIA 4XKWA 2HZDA 3QERA 3JB9D 3EYYA 2DL3A 3I58A 2DXTA 4I2OA 1ZAOA 2AO9A 1WSJA 3ZSWA 1YQRA 4BDYA 1ZTRA 2VWJA 4KH0B 1T0HA 3JB9J 5C12A 1IG9A 4KT6A 4LB5A 2OAUA 4X64K 3AAQA 2FE3A 4HLXA 2PVDB 4PQUA 1KG4A 2DXCA 4YEJA 1Y39A 2RPIA 2JA8J 1BBZA 1TG0A 2BKDN 4HT8A 4CXFA 1YG2A 1Z3XA 4E9EA 4EDUA 2HR3A 2O9LA 3DKWA 2GFAA 5BN8A 4W5TA 4M3UA 1JCEA 2HBKA 1N8RR 4DTSA 4MQVA 4NYFA 1N3AA 1EETA 2CZ1B 1KQ0A 3WTTC 1U78A 1T6SA 3I54A 5LJ3d 4B3OA 2AZVA 4FK0A 1XC3A 3BTCA 2GXBA 2CW8A 2PEXA 3DEWA 1BOBA 4BY6C 2DA3A 3LYIA 3VQ4A 4GV6A 3ZT3A 2HHWA 5HS7A 3DRPA 1SRLA 2VV5A 2JG6A 5FJ8J 2XGXA 2BYVE 1MUZA 2FSKA 2X6WA 3EH1A 2OJ2A 2RNGA 4A3BJ 3OBWA 4B9MA 3Q7BA 1HU0A 5TKWA 3E66A 4MMLA 1GCQA 2O8FA 4F55A 3WXLA 4JZ4A 4FL6A 2O2OA 2BUDA 1M3AA 3IWZA 3OYGA 1EF4A 4JKDA 2E36A 5IXFA 3SEMA 3HRUA 4QVZA 4E9GA 1USSA 1PRLC 2LYCA 2EFOA 2QF7A 3O6BB 3MKZA 3DKYA 1FTZA 4PSXA 1OYWA 3PQJA 2M34A 5D4SA 3NPFA 2XY5A 2DQRA 3RMCA 2E41A 1QVGS 3PE0A 2M8GX 1ZBUA 4HQMA 4QS7A 2W04A 3TW7A 4PJNA 4CUGA 4F7UA 2JPCA 4HXJA 5J2PA 1R6RA 4QW2A 5AQOA 5HLTA 4B1UB 3VQ8A 3K5LA 4N9HA 4M75E 1UJYA 3LA2A 5EG2A 4M6VA 2IVMA 4PGGA 3DEEA 4P96A 3EUAA 2YUQA 2DW4A 3ENOA 2B8AA 2LKXA 1NK2P 5JLWA 1J9AA 1ZYQA 1QHTA 1NEGA 1NG9A 4C8QC 3LZIA 3WGHA 1NWKA 2KZGA 4K0KK 4BXFA 1LAWA 2Y48A 3A0BC 3SV3A 2Q0UA 2P84A 3BGRA 4GVEA 1DUXC 3G10A 2DOAA 4RTTA 2PX9A 4LH5A 1RR8C 4KBMB 2NRHA 4DJAA 5IHNA 5GAOm 1D9FA 4GLMA 2FPFA 4M75D 1UB4A 1VQ5N 3BG9A 4C8MA 3K2AA 3LAJA 4A6EA 4E89A 2UWMA 1K8AU 4DUYK 2M30A 4A5NA 5GMKl 3U9DA 1LE8B 3RZDJ 4U7DA 5GANg 2JSPA 4KIFA 4MTDA 5CVVA 3HGGA 3J81O 1NGNA 1FW6A 2EQRA 3VQ7A 2DMUA 3RDVA 3U8XA 1HLVA 1YO5C 3HSCA 3AVBA 1MBEA 3FWEA 1NKEA 3VKIA 2WADA 5LJ5d 1VQ5Q 1N32K 3H45C 2FZGB 2ZKZA 3B6OA 2MCNA 3P8HA 2HGCA 3ITHA 4UB6C 1W0TA 4ID5A 1NGCA 2OQGA 3VU3C 4BR0A 4YFKF 1QTMA 3KETA 3DBHB 3T3FA 4EHUA 3SUQA 3VS7A 2PJRB 1SFEA 4R56A 1JCGA 3LP1A 4BHBA 2ZSHB 2VJIA 3M0SA 4HX7A 1M1KU 3SV4A 2KBTA 2KY9A 3O9QA 1QCFA 1REPC 4CK1A 4XK4A 2QQBA 2VKNA 1BIBA 1KC8U 1JJ2S 2RMOA 3SJHA 1IRZA 5KHDA 2FL7A 1RETA 4NUBA 2JT1A 1TV6A 2W4SA 2DVJA 1QS4A 5EF6A 1N33K 4OIQF 2X9HA 5LGUA 3QPHA 2F5FA 4AHVA 1GVDA 1IGUA 2LT4A 2YXYA 3ELKA 4CZKA 3T1HK 3TI0A 3G7ZA 3VEZA 2EIMH 3TR8A 3OS1A 4BI8B 2EZLA 2KI7A 1QE1A 2K9NA 2H94A 5BPLA 3RWUA 4JI3K 1E3PA 5DM7R 4HV5A 1KRPA 2OTLN 2M9UA 3T9NA 2HVIA 3LH0A 1U2VB 1XHXA 4CJ7A 4BR7A 2GEMA 1UZCA 2DAOA 5HNHA 1N5YA 1GLNA 1MSFC 2VBXA 3X25B 2OV7A 2M8EA 1KG6A 5KYUB 2HVHA 2LVSA 4M3XA 4IJNA 4I2QA 4JRKA 1HKQA 4GVMA 4HNTA 1BWFO 2GA2A 1TWGJ 3M4GA 1R1VA 2PFUA 2A3LA 4OVLA 5A0GA 2OTLQ 2BVMA 3JSPA 3TAQA 1NG7A 5GMKe 3OL4A 2ELKA 1WSUA 3VF2A 2HTJA 4NQWA 5IYCJ 5E3OA 4A2AA 4BRNA 2FF4A 2ESWA 1U45A 2NOIA 3QNNA 2XD0A 5M5WJ 1S9GA 4CJPA 3LAMA 5L3GA 4DR6K 4RTVA 4QS8A 4CYCA 4AG1C 2DMNA 4X66K 4HTUA 3SDBA 1QPMA 1Z05A 3CCEA 4JI5K 4XORA 4DF4A 1ILYA 4HYEA 1NLOC 2OA8A 3CO6C 2F5EA 2HNHA 4M73A 1GOAA 1Y8RB 4FPAA 3PO4A 4WCEL 3WTWC 3J80Z 1K9MC 1NU0A 1HPZA 4NO7A 3QFUA 5F0XA 3KJVA 5L3EA 3I4NJ 2X1DA 4LK1F 2MH2A 4KFCA 4A3IJ 4XU0A 3CQXA 1FBUA 2K3YA 2WY8Q 3PIPF 4J9IA 2D5RA 3FZLA 3CJBA 5J2QA 1G83A 3REOA 2PBDA 3THXA 4KN4X 3QESA 4C92F 2LX9A 3EUHC 1JO8A 5BPDA 1K8AR 1OI1A 4X0GA 1YFNA 3O3FA 3K9TA 2E1CA 3SNNA 1YN8A 2XF6A 3GZ6A 4MQ3A 4LSLA 5CCAA 4YPRA 1VQOI 2V6CA 2HAXA 2DYBA 3SQ1A 4L9VA