3OYJA

Crystal structure of the pfv s217q mutant intasome in complex with magnesium and the insti mk2048
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
368
structure length
368
Chain Sequence
LDAELDQLLQGHYIKGYPKQYTYFLEDGKVKVSRPEGVKIIPPQSDRQKIVLQAHNLAHTGREATLLKIANLYWWPNMRKDVVKQLGRCQQCLITNASNKASGPILRPDRPQKPFDKFFIDYIGPLPPSQGYLYVLVVVDGMTGFTWLYPTKAPSTSATVKSLNVLTSIAIPKVIHSDQGAAFTSSTFAEWAKERGIHLEFSTPYHPQSQGKVERKNSDIKRLLTKLLVGRPTKWYDLLPVVQLALNNTYSPVLKYTPHQLLFGIDSNTPFANQDTLDLTREEELSLLQEIRTSLYHPSTPPASSRSWSPVVGQLVQERVARPASLRPRWHKPSTVLKVLNPRTVVILDHLGNNRTVSIDNLKPTSHQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular mechanisms of retroviral integrase inhibition and the evolution of viral resistance.
pubmed doi rcsb
source organism Human spumaretrovirus
molecule tags Recombination,viral protein/dna
molecule keywords PFV integrase
total genus 105
structure length 368
sequence length 368
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2010-09-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
A PF17921 Integrase_H2C2 Integrase zinc binding domain
A PF18103 SH3_11 Retroviral integrase C-terminal SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2300 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3oyjA04
1.10.340.70 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Endonuclease III; domain 1 3oyjA01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3oyjA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3oyjA03
1NJZA 3VQPA 5HRPA 3O8VA 1TKDA 1VK0A 1TKTA 4DTXA 3AO2A 4PUOA 1EXQA 4LY7A 1C1CA 1UA1A 1WJRA 3AO3A 1DTTA 3S3NA 1X1PA 1KVCA 2X4YA 1JLFA 2QQRA 1VSEA 2YV0X 3VA0A 4ZHRA 1U45A 4PWDA 3AO5A 3D45A 1J54A 3OYAA 3SI6A 4L8RB 1JL1A 1XHZA 3FFIA 3SD4A 4GW6A 3KJVA 3BDLA 4LD6A 2YKMA 4I9QA 1JLGA 3I8DA 3SUPA 4CF2A 2MWOA 3V4IA 4IKFA 1T05A 4LSLA 3U6FA 2P5GA 4M3TA 1RBSA 4CJFA 1KSPA 2EQMA 2YKNA 2HMIA 3NTIA 3V9WA 1UOCA 4CJVA 2G8UA 1LAVA 4N47A 3T19A 3NH1A 3ITHA 3LWMA 3HXMA 2K3YA 1ASWA 1G5VA 4FLUA 4W5TA 4Z4IA 3S9HA 1S5JA 4KKOA 5KE3A 2DIQA 2G8HA 4KAZA 4FJ7A 2GFAA 1TAUA 4E7KA 1S1TA 2OPPA 1J53A 4FW2A 4BE1A 3O3HA 4BDPA 5FROA 3G0ZA 2HHQA 1EX4A 2IC3A 2G8WA 1VSIA 2Z1GA 2O4GA 1TK8A 2VWKA 3AVAA 5CZ1A 4F2RA 1VRTA 1NJXA 3DOKA 2F5KA 4KB0A 4NCBA 3TAFA 1IO2A 3NF8A 3OYJA 4CJKA 1Z26A 3VQAA 2X35A 3L42A 4J2AA 1TV6A 2LDMA 3IRXA 3PMIA 5D6WA 1TVRA 4RW4A 4CJLA 3VQ5A 4DS5A 2QKBA 2GF7A 1NOZA 3MEDA 4DSIA 4JS5A 1Q9XA 4EP4A 4KTWA 4CJRA 2G8IA 1SV5A 4KHYA 3HO1A 2KFNA 1ZBFA 3P8DA 2M0OA 3LANA 4E1NA 3NDKA 3META 4FM2A 3SQ0A 4IFYA 1QSYA 5HP1A 2XO7A 3E01A 4DTUA 1T8EA 3TANA 4FJ9A 3AVFA 4C5EA 2YNGA 3NH0A 4CHNA 1TK5A 1NKEA 2E6MA 1OZ3A 3HT3A 3PO4A 2QK9A 4FLTA 4GY5A 4DS4A 3K5LA 3LZJA 1IKVA 3K5NA 4OLAA 1D8YA 3LGFA 4R5PA 5CY4A 4EP5A 2OPSA 3OYDA 4I9LA 3M8SA 3QEWA 1WLJA 1HPZA 3JYTA 4AHTA 1O1WA 2B4JA 4CJEA 3AVKA 3RMCA 3PV8A 5K14A 4B9TA 2GUIA 3OQ5A 1VRUA 4DTJA 1BQNA 4A4GA 5M9OA 3OYBA 1RDAA 2FC0A 3KLGA 4FJIA 3MECA 4CJ5A 1JXBA 1SUQA 1RILA 2BIVA 1S9GA 3P8HA 2EQKA 1JLEA 1WNSA 3I0RA 3WNGA 3OJUA 4DTPA 3RMDA 1MU2A 4ELTA 2GV9A 4CHYA 3KK3A 4CJUA 1QHTA 1B9DA 3LWLA 3L8BA 2PQWA 1VSDA 5KGWA 4KI6A 2HHSA 1CLQA 2W42A 2IAJA 3O3GA 5CIUA 3ZT4A 1IKYA 1JXEA 5KRTA 3KK2A 2VG5A 5D3GA 3SCXA 2DY4A 2P0KA 4O4GA 4CESA 3QNOA 5HROA 2A1RA 3OYLA 3QO9A 2IG0A 4I2PA 1RTHA 1LV5A 4J2BA 5KE2A 4W5RA 1U4BA 4Z4GA 4YNQA 3V81A 2EX3A 4FJJA 2G8VA 4BD3A 3LZIA 3KLHA 4DSEA 4DU3A 3SV3A 2OZSA 4E0DA 1WSHA 4DTRA 2HHUA 1S9EA 4CEFA 3ZSXA 1TKXA 1NK6A 4A4EA 5C0MA 4CK2A 5DMRA 1JLAA 4BDZA 3MP6A 4CFAA 4DFKA 3SPYA 3DRSA 1WAFA 1WGSA 2VWJA 4DFJA 4KHUA 5J2PA 3OS2A 1JLQA 3SPZA 3LYIA 5D6YA 3SQ1A 3RR7A 3QEPA 4EDUA 1BCMA 4QCLA 2X78A 3OYFA 4NZGA 5IN1A 3K2PA 3TR8A 5KRSA 3SQ2A 4B8AB 2D9TA 4BE0A 1EKEA 3U3YA 2PY5A 1RDDA 1NOYA 5J26A 3ZSWA 1RT6A 4CEBA 4CFBA 2HNZA 2R58A 2XY7A 2F8TA 3RMBA 4GVMA 4IUUA 3AA4A 3BGRA 1TAQA 3V1OA 1I3AA 4CF9A 4RW6A 2HHVA 2RI2A 1RBVA 3V6DA 3QINA 3KD5E 4C8NA 5KTQA 3VQQA 1BISA 1CXQA 5KH6A 4M41A 4AHCA 1TK0A 2K3XA 4IURA 1CXUA 1KCFA 3Q1JA 2GBZA 3IG1A 3NF7A 4CFCA 3OJSA 3V9SA 2HNDA 1TL1A 3O4QA 2BKDN 4DSKA 3UWNA 4FJ8A 1BI4B 3ALYA 4OLBA 4DU1A 4IG0A 3QEIA 1RDCA 3S3MA 4K8ZA 2FBTA 1A5WA 2Y1IA 3ASKA 1SL0A 1J5OA 3K58A 4HHTA 3FDRA 5KCHA 2JGUA 3QLHA 3QERA 4FJGA 3NH2A 4ID1A 5KI6A 4N76A 3KUFA 4AHRA 2DFHA 3U3GA 2R5MA 1ITGA 3ZCMA 4N56A 1XHXA 4CEDA 4JS4A 2HVHA 1HYZA 3OS1A 3OYNA 3AVGA 4M3XA 4II1A 2P5OA 1SL2A 1YT3A 4DSLA 4M3RA 1WJQA 3V9XA 3K5OA 3NE6A 1H3ZA 3JSMA 2XY5A 4CECA 3EY1A 4CK1A 1SKSA 2DTUA 1L3TA 4E7LA 4CGHA 3OA6A 4KV8A 1S1WA 1S6PA 3DB4A 4M45A 3SYZA 5KGXA 4CEAA 2X4WA 3THVA 1TGOA 3WNHA 5CZ2A 4KHNA 3DRPA 3TAMA 4Z02A 4OKKA 3TAQA 3L3UA 1U49A 4FJNA 3PX0A 2IDOA 4JRQA 3UIQA 2B8AA 2YHBA 3TI0A 2E6NA 3QESA 4FZYA 2OPQA 2HHTA 1B9FA 4CHOA 2BUDA 2O4XB 2QQSA 5I42A 1IG9A 4KTZA 3F9KA 4KPYA 3LAMA 1C0UA 4CIEA 3OYEA 3MP8A 1RT4A 1Z25A 4CJ4A 3F73A 4DF4A 3C4SA 4Y1DA 1SKWA 1BIZA 4BDYA 5HBMA 1RT1A 2Y1JA 1JL2A 4C8KA 4CCHA 1VSHA 2HQXA 4QQGA 4O55A 4HUFA 4DWIA 5C42A 2E4LA 3KIOA 3ZSQA 2BGGA 3VQ9A 2KZMA 1BQMA 1LW0A 4LD0A 2B6AA 3M8QA 1VSJA 4RG8A 4RW8A 4E3SA 3OYIA 4B9MA 2RJEA 2Z1HA 1BIUA 3DI6A 4OPJA 4B9WA 3A2FA 4UQGA 3ZSOA 3NNQA 1REVA 1LAWA 3NGZA 4CGDA 4N4IA 1S6QA 4DF8A 3OB9A 3S6WA 1RT5A 2HB5A 4Q5VA 4FZZA 3LX7A 3HM9A 4CGGA 3M8PA 4A4HA 3DLEA 3NF9A 3OVNA 3L2UA 3S3OA 3LLRA 4DTOA 1S1UA 3L2WA 1X9MA 1RTIA 1C1AA 5J1EA 1JLCA 1C0MA 1KLMA 1F21A 2IS3A 3QIOA 4O44A 4QAGA 4BWJA 3ZSRA 2BANA 3DM2A 4FVMA 4M3ZA 5T7BA 2XDPA 1N27A 3RTVA 3K57A 4Z4FA 4OPKA 3MP1A 4AHUA 4DLEA 2YNHA 4DQQA 4XIUA 4IG3A 2XY8A 4KREA 3UT1A 5HRRA 3RRHA 1LWEA 4K8XA 4OKJA 4CJTA 3CG7A 2XY6A 3VQ7A 4W5NA 3PUFA 4B8CA 3SJJA 3KLIA 1YTUA 3AA3A 3QBYA 3ULDA 4CF0A 4RW9A 2RKIA 4Z4HA 5SZTA 3DOLA 3ZT3A 4CHZA 4C5HA 2XHBA 3D0PA 4FJKA 4E1MA 3MEVA 2RHIA 2M1HA 2RJFA 4FU6A 1D5AA 3WNFA 4CIFA 2PYJA 1HNVA 1BL3A 1JLBA 4CEQA 2FBYA 1EP4A 3LP1A 2DFFA 3O4NA 2M16A 1WAJA 4PA1A 1NK7A 1NK0A 3PY8A 4DQPA 4M3WA 3IAYA 3TAGA 1ASVA 2HNYA 1HMVA 4FLYA 4CK3A 4KO0A 1ASUA 4C8OA 4F3OA 4CIGA 3NHGA 1D9FA 3MO8A 4B9LA 2OZMA 1D9DA 3HJFA 2KW4A 1FK9A 4FCYA 4JRPA 3QIIA 3MXIA 4FZXC 4CJWA 3PMTA 2RHZA 5DK5A 1J9AA 4PQUA 4N4GA 4HUGA 2KQ2A 1RCHA 3HPGA 4DMNA 3AVCA 3CFOA 4HCZA 3VQDA 3LDSA 3OYMA 1N6QA 4DQIA 4M42A 1EETA 4N5SA 2O4IA 3SUOA 5C25A 4PL6A 5SWMA 5J2QA 2E5QA 4OVAA 3CYMA 1VSFA 3AA5X 4GMJB 2A1SA 3SUQA 3DYAA 4NCGA 3NCIA 1Q9YA 4CHPA 3FEOA 3M9QA 1G15A 4FM0A 2RJCA 2XK0A 4OVLA 3KLFA 4CJSA 2JZ2A 3C6TA 3DMJA 1NJWA 4QQDA 4DTNA 2RHUA 1I39A 4FJLA 1HJRA 3CM6A 3LAKA 3DLMA 4ELUA 2X6NA 1RBRA 1WSGA 4IDKA 3CFPA 2RI5A 4AILC 4B9NA 2HHWA 3DB3A 4DTMA 3T1AA 4IUTA 3NTKA 5J2NA 1YTAA 1KTQA 3LP3A 3M8RA 2RJDA 3HYFA 4B3OA 3KKSA 5C6SA 2F8SA 2L89A 3HP9A 3TABA 3B6OA 1RI0A 1GOBA 4E89A 4L59A 3P1GA 1XC9A 4BWMA 4N41A 3OMCA 1NKBA 4RW7A 3HPOA 4Q5WA 1QQCA 2RHYA 1RNHA 4PLLA 4B08A 1KFDA 1NK4A 2FBXA 2ZQBA 1QTMA 1HQEA 2LRQA 3LGLA 3MEAA 1MHNA 2B5JA 2I5JA 2Q3SA 3KKRA 4LH4A 3KLEA 4FLWA 2F96A 2RI3A 1BHLA 3V1QA 4DFPA 3F70A 5HRNA 4BE2A 4FLVA 4CGFA 4M3YA 5CYQA 1T03A 2HW3A 1BGXT 4H4OA 3AVIA 4WE1A 5KCOA 4DQSA 1NK5A 4B9UA 4OJRA 3K59A 2E6LA 2CKKA 1RTJA 1L3VA 4HTUA 3RR8A 3DLBA 2NLUA 3LPUA 4CJ3A 4J2DA 3AVLA 2HVIA 1RT2A 2HQEA 3NAEA 4FJ5A 3L2VA 3HSTB 1XWLA 3IS9A 4KHWA 4OGCA 3NTHA 3DRRA 5HRSA 5HLFA 3DLHA 4IUPA 4HCCA 4KB1A 2EHGA 1QE1A 4ELVA 3GOXA 4FK0A 4B9SA 3G10A 2OYQA 1VSKA 2KTQA 2YNIA 4FM1A 3PO5A 1GOCA 2WOMA 1DTQA 2FHDA 1T7PA 2ZD1A 4JLHA 1ZBLA 2RHXA 2BDPA 3CM5A 1FKOA 3SZ2A 1NK8A 2YNFA 3KD1E 2L3RA 1HYVA 3ZT1A 4W5QA 5FDLA 4F4KA 3VQ4A 1XI1A 1U47A 1Q8IA 3QEVA 4KTQA 3SV4A 2P51A 2EQUA 3RRGA 2FBVA 4J2EA 3AO4A 3MXMA 2Z1IA 4I2QA 3KTQA 1R0AA 1S1XA 3LPTA 5CYMA 3OMGA 1VSLA 4ZTJA 3I0SA 3P83D 4KHQA 2LSNA 4IFVA 2VG7A 4KFBA 3MEEA 1KRPA 1RBUA 1ZYQA 4A4FA 3ASMA 3QJ6A 3CFRA 1K6YA 4C8MA 3H6ZA 4G1QA 1S1VA 3VQEA 4CJQA 3SQ4A 1RT7A 4F8RA 2EFIA 2YHAA 1B92A 1X9WA 4CGJA 1NK9A 3ZEHA 4NCAA 1OYXA 4NYFA 3ZT2A 2PYLA 4M3UA 4CF1A 1U04A 4FL6A 3EAEA 1VSMA 2ITGA 4IUQA 4RG2A 3MXJA 3QNNA 1NJYA 3HK2A 1U48A 2HHXA 3CQ8A 1KVBA 3TAPA 4CJPA 3HVRA 3PX4A 3NFAA 2QKKA 2EQJA 4OKEA 1YVUA 3TARA 2PZSA 2AJQA 1FXXA 3MAQA 3L2RA 1LW2A 5E41A 3TWHA 3VQBA 4DSFA 2EKOA 4MFBA 1CZBA 1BCOA 3VQ8A 5FRMA 3QETA 1IKXA 1L5UA 2WONA 1IKWA 4O0JA 2RO0A 2IOCA 2R57A 4AHVA 4UC4A 2IGIA 3OYHA 3AVBA 1RTDA 3H8ZA 1QS4A 3LP2A 2D0BA 4F3TA 3NF6A 5D6XA 4O5BA 3PX6A 3PFSA 3PNWC 2D0CA 1OZ2A 3ZSVA 1L3UA 4EZ9A 4MQ3A 3AVJA 1HNIA 1Y97A 2G3RA 2OA8A 4FJXA 1ZBIA 4NYNA 1C0TA 1UAXA 3AVMA 1JKHA 1RT3A 3AVNA 3WNEA 1W9HA 3MEGA 4E7HA 3HP6A 1TKZA 4PLIA 3HPHA 4TSXA 3BDPA 4EZ6A 3VN5A 4DU4A 2G8FA 4FJMA 2GFUA 3AV9A 3KK1A 4Q0BA 3QIPA 5C24A 2D0AA 1LWFA 1C1BA 2JLEA 4IBNA 3MEWA 2QXFA 3EZ5A 2O4XA 4HUEA 3OYGA 3LALA 3O3FA 3RWUA 4FLZA 1HRHA 4FJHA 2KFZA 1WN7A 4W5OA 3OYCA 1QSLA 4CRIA 3FC3A 1SL1A 4I7FA 4CE9A 2JTFA 3OY9A 2LTOA 3T3FA 2Z1JA 3DLRA 2RN2A 3C95A 1FKPA 4OGEA 1X9SA 1TL3A 3SNNA 1A5XA 3VA3A 5J2MA 4B9VA 3LH0A 4KI4A 2P1JA 1UWBA 3NBPA 3SUNA 3MEUA 4H8KA 4FW1A 1HQUA 1WSFA 2NUBA 4HVJA 4E7JA 1RDBA 4QQ6A 2R7YA 1LWCA 1W0HA 3AA2A 4FK2A 4IUVA 4AHSA 1GOAA 3V1RA 4CEOA 2X4XA 3AVHA 3VQ6A 4H4MA 4FXDA 3NGIA 2RPIA 4YFUA 3V9UA 3FLGA 3VQCA 5I3UA 2VG6A 4C5IA 4FK4A 4Z0UA 4C8LA 2WACA 1N5YA 4DFMA 1L3SA 4KRFA 4DSJA 4E7IA 1KLNA 1OI1A 4HCBA 2X6SA 3LP0A 4CEEA 1BI4A 4Z4CA 3ZSZA 2XRIA 4PY5A 1WJSA 1WSIA 1KVAA 3NGYA 1ZBUA 2X74A 1IH7A 3ME9A 4NS5A 3ISNC 4ICLA 3ZSYA 3ZT0A 4CEZA 1KHCA 1SKRA 4DG1A 1ZBHA 4QOZB 1WSJA 5EU7A 5J39A 3OYKA 4QVZA 4C5GA 3TAEA 2DAQA 2LVMA 3HVTA 4N4HA 4X34A 1SSFA 1A5VA 3H08A 3QEXA 3E9GA 2LCCA 3B6PA 4LH5A 5IAYA 4B9XA 2ETJA 5JS2A 4DLGA 4CHQA 2YRVA 4FYDA 1HYSA 1XNIA 4Z4EA 4CGIA 4ID5A 4CFDA 3OS0A 1RBTA 4KHSA 3AO1A 2DFEA 3L3VA 3QKJA 4LSNA 4O0IA 4ZTFA 3E9FA 2D5RA 2OPRA 2L8DA 3DLGA 3L2QA 4E19A 3EYZA 3RMAA 1NKCA 2ATQA 4CERA 3C94A 5JS1A 4FLXA 4QW2A 4Y1CA 4CF8A 3K5MA 3V9ZA 2ZE2A 2DIGA 3HL8A 2G8KA 4F2SA 2BE2A 3DLKA 1DLOA 2RF2A 3C6UA 3P5JA 4AH9A 4DQRA 4DTSA 1QSSA 1KFSA 3CEYA 1CZ9A 1WSEA 4BACA 2R5AA 2VYTA 1UA0A 2KZZA 5FRNA 1C6VA 2MWPA
chains in the Genus database with same CATH superfamily
3UATA 5HRPA 3TP3A 2AQFA 5GAN7 1M9SA 1T05A 4CF2A 5GTHC 4LSLA 4XQFA 2HL3A 2GQVA 4HYEA 1VQNI 1IN8A 1NZ9A 1Z21A 1D1AA 4MHGA 2HDWA 3R3LA 5D5UB 2YJFA 2VWKA 1ZRCA 4JJCA 4M7AA 3VQAA 4YPHA 1TVRA 4CJLA 5A0LA 2GF7A 2DQLA 3BG9A 3ECOA 4JS5A 5LGNA 4BRNA 4WFBL 4CZLA 2QZ8A 2XPUA 1SHFA 4L5GA 3CCRA 5HP1A 1N3CA 3NH0A 1TK5A 3KFWX 4EMKB 2KXCA 5DPKA 4ENKA 2H1LA 2COZA 1CSKA 2KRMA 4AHTA 4CJEA 1MUYA 2OZUA 1VRUA 1J7KA 4KGXB 1RDAA 3GFIA 2VE8A 4GO1A 3FB9A 1T56A 4AVPA 2DLLA 3BY6A 4J7FA 2RQTA 4ITVA 1QHTA 1LFUP 5JVGF 1UJYA 2AHQA 1JXEA 3CJBA 2DY4A 3DLAA 1OKRA 1UFFA 1U4BA 3RKWA 2XICA 1KJWA 3SV3A 1WHJA 2VODA 2X1CA 2KZVA 1DQUA 2K3FA 3EETA 3GFLA 3TW7A 1KD1R 4J8OA 3TP0A 3V8KA 1JLQA 2Y30A 3CJTB 2E1OA 2M7BA 1RACB 1X19A 1RR7A 3QYBA 1H88C 5GJWB 2E1HA 5FFXA 2Y69H 4M7DC 1TUYA 3LDOA 2ZGWA 3NF7A 4MDXA 4DSKA 3FZMA 3M55A 2LJ1A 3QEIA 3S3MA 2K7AA 5DM6F 4RTYA 2ZO4A 1X2NA 4JS4A 1T8EA 1ZBSA 2FPFA 3QB0A 2CH4W 4BRMA 4BR2A 3ERMA 1YQAA 1Y64A 3ENHA 3HOTA 3BEXA 3CWTA 2B8AA 2M51A 1BOTO 2RNJA 5AZJB 1SKWA 3NMUA 2YUPA 1BIZA 1SVLA 4HEA2 4GXOA 5HBMA 3AL0B 5IWAK 3F6OA 4DWIA 4O55A 3JCMd 4BR5A 1OU8A 3IV5A 4JKEA 2PFBA 3GO5A 4UXNA 1G3SA 3NGZA 2R7ZJ 2EYQA 5HNFA 4MNUA 4JKDA 3WTVC 2LMJA 1HSQA 2P9PA 1B8IA 2RGVA 3VS2A 2AA4A 4O6JA 3DQVC 4HV6A 3MCZA 1OVQA 3MP1A 2ZPEB 4DLEA 4LNPA 3CMAA 4LDYA 4DR6K 4OMNA 3MKYB 1D5AA 3PVLA 3SAHA 1JLBA 3NWTA 5FFZA 4FLYA 1VQ8T 4TV7A 2EVRA 4BGDA 1QVFP 2N8GA 4M9SA 2M34A 4ZZLA 1ZKGA 1XS9A 2VYPA 4XK4A 3SUOA 5C25A 2WSEE 2P9UA 4UV8A 2GOXB 2XAJA 2HTJA 4C3IJ 3JB9H 4HX4A 3QZ9B 4RTUA 2BY3A 4OWRB 5IPAA 3MEXA 3DB3A 3M8RA 2YLBA 1NGDA 3GTQJ 3B6OA 3JCMh 1QVTA 3G6EA 3A8YA 3THYA 2R5YA 1BIBA 3R6SA 1H9GA 1KD1C 2LRQA 4DEXA 2E7XA 4BE2A 2P7VB 4MDBA 4JJDA 1NK5A 1RTJA 1LOTB 2E7WA 4FX0A 2QYZA 3RI4A 2GWRA 5GTIC 2ENMA 4B9SA 2BVMA 3I9V2 1VQ7T 5J4VA 4DUZK 2DFUA 4BQZA 2V7ZA 4II3A 4J5YA 3CBPA 2XI9A 4CZKA 2CV1A 2WV0A 4KNYA 3ZX2A 2HVSA 3K7AJ 3BOQA 4HXJA 2Y4XA 3FIWA 2HSEB 4JHDA 3VGKA 5EGOA 4KULA 3P83D 4KHQA 4M75A 2LSNA 3T5XA 1Q95G 4A4FA 3CFRA 2L7KA 2JMCA 2D2WA 1R6RA 4YIFA 3ZT2A 4CF1A 2AS5F 3MXJA 2P6SA 2DA4A 3QYHB 4Q5SF 2WADA 2G7HA 5JR3A 4WF9L 1ZHIA 1EIFA 2PZSA 2AJQA 1FXXA 5E41A 2IP2A 4CJ7A 1ERDA 1YHQQ 1BCOA 2CS7A 1MGQA 5FRMA 3VQ8A 1LDDA 4AFZC 2UUAK 3N5NX 1VQ5Q 4V19K 2L9RA 3C6HA 4FWNA 4JI6K 4HQEA 4YOTA 1KC8O 3DXKA 1B9NA 2VJ5A 2LREA 3CMMA 1SD5A 2KK4A 5GAHJ 4JNEA 3CCVT 4BC5A 4Y33A 3VRZA 2QWLA 1W5CC 3E66A 2DJZA 4FJHA 4RAZA 3RYRA 4C30A 4DR3K 5F27A 1ETOA 5EX5A 1ZUKA 1X9SA 1IDYA 5K5RA 1VQ7Q 3TO6A 4IHWA 1O7LA 1WHHA 1XX5A 2XUBA 1B34B 3AA2A 2ZXIA 3RTRA 1SF9A 2V9KA 1R1VA 4E1JA 1YHQN 3VQCA 4OP0A 4Z0UA 1X2QA 5I2MA 2X6SA 2QVOA 1E4GT 4ICLA 5LHHA 3I9QA 4XTUA 2IVMA 3IUOA 1RAFB 4JEPA 2DBMA 2ZAEA 2CH6A 3E9FA 1QVUA 5CPRB 1WRJA 1P4WA 2K02A 4Y1CA 1M90O 2BE2A 1QSSA 3P5JA 4A2AA 4BRPA 4BACA 3JSCA 4H5TA 2VVKA 4FYXB 1Q82C 4M7DA 4AM3A 1Q81U 1POGA 1WYXA 3VA0A 2GEMA 1T2KA 3GF5A 3I55Q 3H41A 3OYAA 4ZYHA 3CC7T 3DTIA 4I9QA 2IGNA 3H9QA 1X1AA 2HSPA 5EG2A 4N47A 4ZYGA 3LWMA 2BGCA 2O03A 3OOPA 1MSFC 1KG7A 2DIQA 2OPPA 2X3WD 1FJLA 4WCEL 1IBLK 3O3HA 2F69A 4BJ5C 2YJEA 3NPFA 2DI3A 3CWUA 4BRIA 1ZLMA 1Q81R 4BI4A 3I55A 1Y1VJ 4KTWA 3CCEA 4LE9A 4CBXA 4PUSA 3MKWB 3AVFA 2AKLA 1S5LC 3OMYA 2QK0A 5E3MA 1MUZA 4BI8B 1XTAA 1YWOA 3L1PA 4IZ9A 5C2DA 4QKUA 4PJNA 4ISFA 4IIMA 4K0KK 1JLEA 4CJUA 2HBMA 2EV0A 2JN0A 1BR1A 3TBIA 2Z2SB 3ZQHA 5FKNA 1C0FA 1NHAA 1B72A 2ME6A 4DZJA 3I55T 3D5LA 2Q0UA 4CEFA 1YS6A 1W0TA 3H3NO 2LSOA 2COYA 4HX8A 3SPYA 1IF1A 1YW9A 5DM7F 4BHPA 2QLZA 4IPAA 3RZDJ 2EJFA 3A8MB 1KQ0A 4JP0A 4E6RA 3F9MA 2F5FA 2ESHA 1I1SA 3AA4A 4O8KA 1WB9A 2COBA 2D1KA 4HOBA 2OTLA 5A2QO 2XKOA 5A2QK 4M41A 3QU6A 4JHDB 1OISA 2E64A 4OLBA 4EW4A 4KIBA 3IH3A 2FBTA 3CCJN 1DU0A 2EGAA 4XQ3A 4N76A 1U3OA 3HL2A 4A59A 3QPSA 4BUGA 1GCPA 4X64K 3W6KB 3TPQA 4KHNA 1MPGA 4JZ3A 4JRQA 3K4JA 2QA4I 2QQSA 1HSTA 3HOYJ 3I58A 4KPYA 1QA6A 4G7ZF 4CIEA 4Y1DA 1QHHD 4XOPA 1VSHA 1MDMA 3G3ZA 4B9MA 1LQ1A 1GFDA 2Z1HA 4M78G 4B9WA 3WHBA 2KLOA 1S6QA 4PSWA 3OB9A 5JI6A 2HHHK 1XB4A 1C1AA 4CHUA 3KYLA 4YDUA 5EC7A 2OI3A 2CDTA 1HR0K 4JKCA 3L2ZA 4YEJA 4FSSA 4KREA 2IS4A 2GWJA 1U06A 4CF0A 3EG0A 4CHZA 3SAGA 3D0PA 4PSXA 3ID8A 2M1HA 2NOBA 1VQ5A 3PIPA 3ZGKA 2EFQA 4P1WA 2KMTA 3N05A 3PY8A 1M3BA 2W0ZA 1LFBA 3MO8A 2RC4A 1T0FA 3CCMI 2ETHA 2OU2A 5C12A 3C7NB 2D6FA 1DT9A 1VUBA 2QQ8A 3BTLA 3TTDA 5SWMA 4PGGA 2RQWA 3ML6A 5HOOA 4CGZA 2Q2EB 1GVJA 1QU3A 5L3FA 4LF5K 1NYFA 2DTRA 1HJRA 3ZQFA 2JG6A 1VQKN 1K78B 1KQ8A 1VQOT 3HZ6A 3D2FB 1PKSA 3KEOA 3ERED 2HMPA 5LJ3h 2B7EA 2FD5A 2ZFWA 4GGGA 1RZ4A 2DA6A 1NKUA 3PQJA 1R7JA 2B5JA 1ZHFA 2D1HA 2VOPA 1W5SA 2K57A 2F6CA 4FLVA 3TDUC 1FYNA 1EBMA 1LUJB 5DM7L 4I6ZA 1X3WB 3CCQA 3EGDA 4LDWA 2HYJA 3CM5A 2NOZA 2L3RA 2JA6J 4JN4A 1MH3A 5CKHA 5AZJA 4DV4K 4JOMA 4J2EA 1WWXA 3O9SA 1AKHA 3LPTA 3OR1C 2KNBB 1SG5A 2XPVA 1REPC 1D5YA 2ROTA 5HS8A 2OTLI 2W41A 1LCUA 3ZEHA 2RREA 4F7UE 4J7IA 3GP8A 5MLCQ 3CJ9A 4K43A 1WJEA 3E1YA 3VQBA 3QRFF 2K85A 3BPXA 2DTHA 2FA5A 1ABOA 3A8GB 3CCEI 4GFBA 3S93A 3MN7A 3CCMT 4M78E 3PX6A 1BW6A 5FW9A 3HBTA 1LFPA 4A2UA 1Y97A 1HNIA 2G3RA 2DMUA 4DQ2A 5FD6A 3IRRA 4RLQA 1WH5A 4QS7A 1OMIA 4OFHA 1W9HA 3MEGA 2P9NB 4RGSA 1U1SA 4TSXA 1YN8A 2ZWHA 1UGSB 1FOWA 1HKGA 3TCJA 5C44J 2JLEA 3LALA 5AQHA 3M07A 2Z1JA 4JKBA 3PLAA 1FKPA 2VBYA 2Q0OA 3T9NA 1OFCX 2E41A 2W4SA 2EPFA 4MZTA 1RR8C 1KU3A 5KN8A 1XQHA 1W0HA 5LBQA 1CKBA 2CP0A 1O3RA 2G0EA 2WTUA 1MZBA 5KGWA 1KVAA 2L9VA 4XBFA 3ULEB 3E9OA 1WSJA 2E4HA 4X34A 3KNTA 4XLFA 4CCOA 4ID5A 2M30A 1WSUA 2GXAA 4G9YA 3CD6T 1B7TA 2HEOA 3SZGA 3J81O 2G8KA 2RF2A 4M7DF 1R49A 2F5EA 1ZG3A 4RM3A 3O6WA 5DDGA 3VQPA 4YPRA 1VQ5N 4DR1K 5LGUA 3H92A 3JCMJ 3HFOA 2DOEA 1R58A 3M1CA 1KSPA 1UOCA 2VLAA 1G5VA 1TWAJ 1GHCA 2CWEA 4JYKA 1LNWA 4HZFA 3CDIA 4FW2A 4BE1A 5FROA 4I6MA 2GTDA 3AG1H 5LHGA 4DYRA 4AC0A 2KT1A 4CXFA 5GAN5 2DT6A 2XHCA 1P90A 5J3LA 2KKZA 5JLWA 3SFMA 1HW2A 4OMOA 2K9MA 1Q9XA 1QQJA 3JS6A 3NDKA 4XKVA 4M78A 1XSDA 2XO7A 3HRMA 5GIOA 1OLTA 3LGFA 4HTLA 1VQ6N 1PRLC 4JRIA 4HX7A 1YRNA 1JRIA 4PJLA 1USTA 2V7FA 2Y9YA 2X51A 3OQ5A 3H1CA 5GAOm 4FWPA 1X2KA 4PKIA 1SUQA 1D8KA 2BIVA 3EG3A 2Z33A 2CGPA 5AQPA 3BG5A 2IW5A 3K1MA 5D5WB 5BN8A 1NM7A 3REBB 2L9SA 4B3TK 2BE9B 3CCMA 2E35A 4BD3A 4DSEA 1YE9A 1X6OA 4DCHA 1V54H 4B9QA 3QYFA 2ZPFB 4M7AD 4BRAA 1VQ9N 3MAJA 5C4XJ 2QYOA 2FE3A 1S72A 1H641 5J2PA 3U9DA 3H5NA 5FLXE 2DOFA 3A0IX 2PY5A 3ZSWA 2XF6A 2F8TA 1D4XA 2Z1DA 4U67L 1I3AA 3CCUN 2YX4A 2E1YA 3LDLA 4A3IJ 4G7HF 1W7PA 4IURA 1CXUA 1ZQ3P 1BIAA 1JQQA 3CC7I 3GW2A 4PJMA 2UUBK 4A62A 1R59O 1DDNA 5KCHA 1EJ9A 4M73A 2LD5A 3QPHA 1CF7B 3JSMA 2W85A 3ZL7C 3EY1A 3VS4A 1TH7A 1DEJA 3CCQI 3R0JA 3TAMA 3CC2I 4GV3A 2HHTA 1B9FA 4A3MJ 2O4XB 1QZ6A 1V1CA 3LAMA 1QPMA 1VQLN 2OFKA 3ZMDA 2YSRA 1R23A 5AZIB 4C0FA 3IH7A 4XKBA 3BTCA 2BGGA 3MD2A 1GLCG 5HK0A 2W10A 2VKHA 4G94A 1LAWA 2HDAA 2HOEA 4HF1A 3RDVA 3R9PA 2BZXA 4RB2C 3L2UA 2DEQA 3S14J 1BDGA 1RTIA 2IS3A 1M3QA 3CC7N 5TRDA 1S72T 1OOTA 1X43A 2ZNZA 5EJCA 1IXRC 1ETYA 4D0PA 4JRKA 4LITA 1HC8A 3PSIA 4M6YA 4M6XA 4CEQA 3LP1A 4M3WA 3OV8A 3BROA 3VENA 4F3OA 4UY8O 2QEXQ 2VBZA 3K6GA 2W1OA 3FK6A 1C0GA 2AK5A 3HIFA 1VQ9I 4HUGA 3HPGA 2UXDK 3LDSA 5FKMA 1JGSA 2E5QA 4OVAA 3JCMW 4CBUA 4MO5A 3MCAB 4YOVA 3C6TA 3RSEB 3S2HJ 4ELUA 1VF9A 3BJ6A 3TU4K 2X6NA 3PQKA 3JRFA 3WU0A 3DU5A 1HX1A 2GGRA 4J6WA 4J01A 3G4SI 5B5EC 5BN9A 1NKBA 1TQPA 1Q82R 4Q48A 3U4LA 4LH4A 4FLWA 2ZBKA 3MX2A 3U9ZA 1G59A 1XC5A 3E7LA 2BXYA 4BG9A 4KDPA 2JJ9A 2LC4A 4DV7K 3IRQA 2FRYA 5M1NA 1YWPA 4BR4A 5GAN4 3KD1E 4QS8A 4M7AG 1HYVA 3M4OJ 1ZC6A 2JTEA 4PJOC 1R4NB 2QWWA 1OU9A 1R0AA 5DCFA 2OFIA 4B3XA 3I0SA 4IFVA 3MCPA 4WCIA 1TNSA 3VQEA 1EF4A 2V1XA 3MKZA 4NCAA 4BRQA 1U04A 3ASOH 1XG1A 2HHXA 3GFMA 2LT1A 1KXPA 3MAQA 4YIRX 4LFBK 2M87A 2R7VA 4LMYA 2EKOA 4MFBA 3CO6C 4YFXF 2KDOA 1KQ2A 3P9KA 2AIRB 4U88A 3LP2A 4YG2F 2PAVA 4F3TA 3UA6A 4JAXA 1K78A 2O8CA 2F5CA 1VOMA 2A6HF 4CZCA 2W57A 3CMAT 4J83A 1RLQC 3PGGA 4Q0BA 1WKMA 2MC3A 1YJWT 1WN7A 5D8LB 4CE9A 4HBLA 1DJ7B 5ECAA 1WNLA 3V7RA 2M02A 3VPZA 4R8HA 3O80A 1WSFA 1RDBA 3N4PA 2X4XA 4MQ9F 1FBUA 1GLEG 1CF7A 2V79A 1HKCA 2QEXN 1AOJA 2I8DA 2X4JA 4H0VB 1FTTA 1YJNQ 1S72I 2JPCA 3I64A 2YU3A 1B9MA 3O1WA 1GBRA 5M3MJ 2R5ZA 3AGKA 4WQ4C 1W7PB 2EZHA 2RKHA 5M5XJ 1UUEA 4J8FA 2L8DA 4CZFA 2EJGA 2W48A 4KH4A 4CERA 1Q86U 3U1DA 2XROA 5KPTA 1WPYA 3VS0A 1DKGD 3DPTA 3PIOA 4IDHA 1KAXA 1DTTA 3HC7A 2QQRA 1YVNA 5BMZA 1O3SA 1NPRA 3ZBDA 2LX7A 3MKDA 4ENNA 3C0BA 5AQTA 4F3QA 2CV2A 1Z1DA 4DR4K 3FXJA 3F10A 3FZVA 4FSXA 3ZEUA 4A3KJ 2ID6A 4IHYA 2DX1A 1ORNA 1M1EB 2XKOC 1QVPA 5LHIA 3ZMUA 2HI3A 2DBKA 3EYIA 3F8BA 5K1YA 1W36D 2GTOA 3LL7A 2J6FA 2DXIA 2H56A 1S22A 2GNCA 1SV5A 3HO1A 3CCRI 4E1NA 5CKDA 4C5EA 3CUQA 3CMEQ 1XGMA 4OLAA 3M8SA 1WHGA 1U8BA 3TSWA 1QP3A 3CC2Q 4FOIA 3JYTA 2Q97A 1R8OB 1UEBA 2RK1A 5F04A 1N77A 5AQMA 1JXBA 4UUSB 1IRGA 2VC8A 4WFNL 1Z9QA 2VV5A 1K6OA 2C06A 1D3BA 3I4NJ 4CESA 3IL2A 1XMXA 4AIJA 2PJRB 2FL7A 2O01E 1DPUA 4J9IA 1S9EA 3J7AO 1VQ9A 4DR2K 1NK6A 2VXEA 1WAFA 1NH3A 1FOXA 4QCLA 4EDUA 1AHDP 1KU2A 1YF5L 4BXXJ 3EUKL 1BJAA 3A03A 3KETA 1VQ7I 2ZXHA 3WG7H 4Y15A 4IUUA 5D8KB 3F6VA 3PFIA 2B86A 1H9TA 2ESNA 1BISA 1VQOQ 1Z67A 4FJLA 4MLHA 1VA7A 3UKGA 2YUNA 4WXHA 2P4RA 4QVCA 5BRHA 5DUIA 3RKXA 5KI6A 3MXMA 3U3GA 4BQNA 4CEDA 3QG1A 4M3XA 2F5VA 4UNFA 3E3VA 5LJ3f 3H1VX 4PFOA 5M1FA 5HLTA 1SKSA 4G6QA 3TO9A 4J9GA 5ICGA 1BA5A 1ODDA 2HBKA 2RB6A 2W6KA 1PVEA 3SBGA 5FPDA 3TAQA 1U49A 3N4MA 1X27A 3QESA 1JJ2S 4FWMA 1ULYA 1Z25A 1STZA 3FHFA 5E3LA 3VYHB 1B6AA 1JT0A 5AQQA 4AFQC 1RPWA 3ZSQA 2ZFUA 4M7XA 4DK9A 2ZC2A 4J19A 1G2HA 1RDWX 3S6WA 5I11A 5HLHA 2R7WA 3M8PA 1Y8RB 3DLEA 3I59A 3CCJI 5I42A 1Y56A 5IOZA 4AHUA 3PE0A 2JPSA 3EO3A 1YIJN 1NG9A 2XHBA 2MIOA 4UVAA 4G6DA 4DNCA 3JCMc 1HNVA 1Y96B 4FM4B 3T1HK 1UG0A 2E19A 1ASVA 1HMVA 3CJQB 2GA2A 4CIGA 4M77E 3HJFA 4LF7K 1T44A 2IRFG 4PQUA 3M1FA 1I5OB 2NOHA 2D0PA 2EGCA 4BY6C 4CJSA 3CC4N 1LOJA 2FNAA 2ECBA 3SYTA 4BVOA 4FISA 1WHKA 4E4HA 2QDYB 3CCET 4FHTA 1CGPA 1YTAA 2EZLA 5GAOn 3H0DA 2QA4Q 2IVNA 2MABA 4B3OA 3CZ6A 1HW5A 3V8JA 4EFHA 5FPMA 2KL4A 1NK4A 5IXBA 4OFAA 2E2OA 2XRLA 2WAQA 2GM4A 3O5BA 2KMUA 2EWNA 2PNIA 1JCFA 3AVLA 5HODA 4XNFA 3J7YP 4AQYK 4OGCA 1NGIA 1Q81C 1WLPB 4MQVA 2DYSH 3CPWS 1V5FA 3I56I 1QLYA 1IV8A 9ANTA 3FGUA 2MG4A 2RHXA 4ILHA 1U47A 3DLLF 2LP0A 1OH8A 3C7NA 2EZIA 4RTTA 1B1BA 3RRGA 1JUMA 3HHHA 4A3BJ 2LQ8A 2MSYA 5AQIA 2XGEA 2NRAC 1FN7A 5E17F 3COAC 2MGQA 2FSNA 3EL2A 4CJQA 4G1QA 4R55A 2HSTA 2YHAA 1NK9A 1A6IA 3CXCS 1D1BA 5JVGL 1ON2A 1HA8A 5CQXA 2CUBA 3CMAQ 2JK3A 1X6BA 2I5UA 1W7PD 2NNWA 4A6DA 3RJPA 4JX6A 4E2FB 3ZLJA 3IMXA 1E3OC 4PJOG 1G83A 1WHMA 4M7AC 3PFSA 4WQ5C 1ESVA 3X24B 2QSHX 2A68F 1ABQA 4RCHA 1O4XA 4B23A 1LCKA 1TWBA 4DV5K 3HTRA 4EZ6A 1VZ0A 2EJRA 3HYIA 3CPWP 4W97A 3MEWA 3RWUA 3AY9A 2XD0A 1P59A 4ZDOA 2FBHA 2L0KA 4HNUA 3LSMA 4B9VA 2P1JA 2MH9A 3MN9A 2CQ7A 3LSGA 1FP1D 2DM1A 3F22A 3CDLA 4XONA 2YX6A 5I3UA 3CCMQ 2YR2A 5IHIA 4C92F 4RBOA 2NRHA 3ZT0A 3MMYB 1K0SA 3JRHA 5FKLA 3JXUA 5GJVB 4BC3A 3QSUA 3B6PA 4LFUA 3A01A 4PJOE 4YOXA 3HOVJ 3BR2A 5AN4A 3RMAA 4EJVA 2DK3A 1R1UA 2RDPA 2CUDA 2I0NA 4QW2A 4XTZA 1PUFA 4M78D 3GZ5A 2CQKA 1KFSA 1GT0C 1T0FC 1I81A 3CCMN 3FBIB 2VYTA 5FRNA 2EAYA 1C6VA 2IVWA 3AO2A 3VYRB 4CUGA 5CR4A 2PG4A 4PWDA 4OO1J 1ZR4A 4ZDLA 4WYBA 2CREA 3QFUA 3BDLA 4LD6A 4D5CA 3I8DA 2A42A 2O8FB 3SEQA 4FLUA 4D9JA 1IJWC 3V42A 3HUGA 1FBSA 4RB0A 4KAZA 3THXB 4AG2C 2EIJH 1LJOA 3FSPA 2Q2EA 2F5KA 5DEQA 1VAZA 4XICA 1YIJQ 1XNQK 1XCVA 4HF2A 4H5NA 3LW5E 2LNBA 4PDKA 1MJ9A 3META 3ABMH 4N9IA 1PP7U 2E6MA 3A1YA 3HT3A 3MWTA 1HXDA 4KUMA 2VWBA 3CCJA 5GAHP 2C0TA 2B4JA 3VEOA 1QRYA 2OAZA 2KT0A 5GAGP 4DBFA 5M9OA 1F1ZA 3UB5A 3SZTA 4DV6K 5J8CA 3I55I 1QNTA 1KQSA 5KAFC 4YFNF 2PVGB 2ABKA 3TEEA 2IA2A 3KTUA 5LFAA 2C6YA 4DEYA 4CZMA 2VG5A 1K76A 4LD5A 4CYCA 3HXLA 5HROA 1LV5A 1JT6A 2EX3A 2G8VA 2OTJQ 4DTRA 2A08A 2KDSA 3A5LC 2DK8A 4C8QF 3OGDA 4A3EJ 4OB3B 3DRSA 1RKTA 2NUPA 4DFJA 3M0QA 1M2VB 1KHIA 4J9DA 2HXIA 3BJAA 1BCMA 4RDUA 4I7HA 4L0YB 2FZCB 2J06A 4E70A 4B8AB 1BR4A 3I56T 1NOYA 5J26A 4PCQA 4RTXA 2R58A 1VQPI 4GVMA 3BGRA 1DUXC 2FQ3A 3VTHA 1KONA 2RI2A 2ZSHB 2ZPBB 2HBWA 3QDRB 3IG1A 4I0BA 1QPIA 4PHTX 1J5OA 5C15A 3OS1A 1KC8R 3Q7BA 2CGKA 5CK9A 3NE6A 3RBBB 1YTYA 1T6CA 1G99A 3EPZA 1ZA1B 5IP7J 1N8RR 4ISEA 2DO7A 3CMEI 4BGBA 2KP6A 4HQMA 4AF1A 2VOOA 1F9NA 3I56A 5GMKi 5LY3A 2JZYA 1QQIA 4ZYEA 1FMKA 4X9DA 5AQJA 1ZLJA 4BY7J 1EH6A 3LSKA 2OZ6A 3J8AA 1BQMA 1SAUA 4IRHA 1OX9A 1B8IB 4JJBA 4B1WB 1N36K 1N8RC 4CGDA 4I99C 1Z9CA 3DP7A 1FSHA 1RADB 4RA2A 3H9NA 5GAEJ 1TYQB 1R5GA 1FBQA 2DA7A 1CZAN 4UUVA 2Q1ZB 1F21A 2BANA 3I56Q 1HQCA 1ONVA 1K4US 1U0JA 1QZZA 2RN7A 3K2ZA 3AA3A 3CCJT 1QVFM 1JUPA 2RHIA 4AMCA 5D4SA 3O4NA 2ZXJA 2QXLA 4M77G 2WWYA 1YAGA 2KW4A 3MXIA 4LB6B 4ZGEB 2PBDA 1P8ZA 2YUOA 1RL2A 3JTGA 2P9SB 4CHPA 2BBYA 5CKEA 2EIMH 4CZEA 3IKTA 5AFUA 1R9TJ 1NJWA 5IP6A 4A69C 2LKXA 3ZQ7A 3VMFB 2DJNA 1Z9ZA 4C8QB 4DTMA 4DOWA 1G3TA 1U5TA 2X4HA 5C6SA 2L89A 4AIDA 4L59A 4N41A 4U0WA 1RNHA 2OQRA 4M4ZA 2XSDC 1MHNA 2K27A 1P2FA 4NOYA 2RI3A 3JAME 2QWMA 3VTIA 4FT4A 3X25B 2DVJA 2E6LA 1L3VA 5IT9O 1D0ZA 1EH7A 4C8QD 1KSWA 1Y57A 2QEXA 4KB1A 3LSPA 3G10A 4FO0A 1GOCA 3KE2A 2WOMA 3FZHA 4EM2A 2J4RA 1HOMA 2XRNA 3G1LA 3JAMZ 5E20A 5ERIA 3LDQA 3QEVA 5E79C 1PJRA 3SV4A 1MSEC 4ELZC 5CHIA 3AO4A 5J1UA 1YIOA 4WQ4A 5AQYA 1S1XA 5CYMA 3OMGA 4ZTJA 2EA4A 2X1DA 5EZGA 1RBUA 2EB7A 5J6XA 4V2GA 2IIMA 4BXUA 4FT2A 4EJZA 5DUKA 1Z6TA 3DKWA 3FISA 2EILH 3GTOJ 3G25A 2L02A 2E2NA 2ECZA 1BI0A 4E7SA 4HSBA 1L5UA 1WFWA 2WSCE 2LQKA 2WAQN 4QIWN 4MLOA 4S05A 5D6XA 3OW2M 1ZBIA 2WV1A 3AVMA 3G4SQ 2PTKA 2I10A 3HP6A 1Q82U 4C0DB 2LKSA 1IG7A 3PSFA 1KZHA 1K73O 1M3CA 2Q8KA 1K8AR 3FZLA 2KFZA 3F8FA 1XSVA 1JKPC 1K1ZA 3U23A 2BW3B 1WBBA 3KFVA 1TL3A 4D8DA 1HQUA 2ZJQF 5AYFA 2JUGA 2KBTA 4IUVA 1GOAA 3AVHA 3HI0A 2IGKA 1QGPA 3ABLH 2Z0WA 3LA3A 2NOEA 3EQLF 3ZSZA 4S04A 4HWIA 2P81A 3LWFA 1JTXA 3G71I 4NO7A 5E26A 3VS3A 1TOVA 1YJ9N 3WGGA 2QQ9A 3VEZA 2H27A 4N4HA 2RM4A 3CJRB 1KG1A 2H1KA 4CHQA 4RS8A 1M8VA 3MZ8A 2P0PA 2YRDA 3Q0WA 4PFPA 2JHJA 4P9UA 2VXDA 2HPIA 1D3BB 3U21A 2EYZA 4Y91A 1I6HJ 3NAUA 3V9ZA 2QKMB 5KYUA 1NMDA 2VQLA 2IIRA 3CMEA 1VQMN 1Z05A 1OR7C 2R5AA 1YW8A 4R56A 3EUAA 1ZBXA 4LY7A 3HKZN 2X4YA 3LOCA 2BHZA 4BJTA 2PBIA 3D45A 5DYMA 4HVWA 2YKMA 4AFSC 5LEJA 4M3TA 5I22A 2L4AA 2G8UA 1LAVA 3NH1A 2VIXA 3VYTB 4HVUA 4KH6A 4JI0K 3RPUD 2BVLA 4OB0B 2MYSA 2HHQA 3KVGA 3FK7A 1TK8A 2KRNA 5EY4A 1BOAA 3PIOF 5CZ1A 1Q7YR 3CXCM 2X35A 2V51B 1OQKA 1NOZA 1LDJA 3MEDA 4H5RA 2JUCA 3VOVA 2AZSA 4JKGB 2HYFA 2G8IA 2HZDA 1QSYA 1BI1A 2KRSA 3VPRA 3E01A 4CI6A 3ZRGA 2PLYA 1LWYA 1M2OA 2KJBA 5ICEA 3AVKA 1ZSGA 3BF1A 3PV8A 5KYXA 4BJ6C 3I4PA 3NFCA 3WVEB 3AARA 1GVDA 3SDGA 5CJ9A 2DU9A 2LMDA 3D2FA 2ECCA 4E9FA 4MTEA 2HHSA 3DXMB 1LE8A 3FZKA 4W5RA 2OZSA 4A0YA 3G4SN 3K1NA 3SDBA 3QP5A 3P9IA 4AYBN 4CCMA 4B3SK 3ONQA 3HOUJ 1IJJA 2JRMA 1XD7A 5I2SA 1XGSA 2X1EA 3DBLB 3OYFA 3K2PA 1FOKA 1E6HA 3C6AA 4NB5A 4RW6A 5CVJA 3PFYA 2DA3A 4BR0A 2K3XA 1ETXA 3O4QA 2LJ0A 4Y13A 4DU1A 4JYAK 2VT3A 3WE2A 1OYIA 1A5WA 4B48A 2JJ7A 3LM2A 1YJNA 4G12A 1OH7A 2M8GX 4CZZA 1G4DA 4XLAA 4BY9C 5F0FA 1VQ8N 3CCRQ 4IEJA 4QVDA 2DTUA 3LWHA 2P84A 3BQYA 5KGXA 1NBWA 3DTKA 3CC7A 2W25A 5DV5A 3ULRB 2CS3A 3K70C 3TI0A 4FZYA 1I50J 2Y0MA 4A3GJ 2DL7A 5C0YA 4DF4A 1RT4A 1IUFA 1U6GA 3G73A 1QHGA 1ZGAA 4IRGA 4M78C 2ASMA 2X9HA 4QQGA 3WVDB 2HOTA 3ZCOA 2RNAA 2WA0A 1JUSA 5FO5A 4OMMA 4EMSA 4YOQA 3IP4B 4YDUC 1AWOA 3C0CA 2A36A 2VXFA 1H0MA 2L3PA 3CCUT 4FVMA 4I01A 4FWLA 2HVRA 4ZN1A 3NEUA 4ZC3A 3CCUA 2HBPA 4XRSG 2E2HJ 4FJKA 2Q36A 2RJFA 1HNWK 1KO9A 1LVAA 1ZSZA 1QKXA 3IAYA 3SZPA 1WQ2A 4BEHA 5TISC 3CERA 3K4CA 3KZBA 3JB9F 3M7GA 1BYMA 1XQSC 2EBIA 5BPIA 1RCHA 1N6QA 1QVGM 3KYCB 1K9MR 3CCVA 3SJMA 3WTTC 1QZYA 3SWNC 1B4AA 1WZ2A 1BOBA 2RHUA 3VESA 3LAKA 2QQBA 1LWVA 1OQYA 4WWCA 3W3CA 1I5ZA 2IAIA 2QA4A 3CUOA 1T3SA 2NVQJ 2L3SA 4H0OA 3E6MA 1Z77A 5FWBA 2NNNA 4C0GA 2VN2A 3WTZA 4Q5WA 3DAWA 1NLOC 4M7AB 4B08A 2DK5A 2ESWA 2DERA 4AG1C 3GTLJ 2F9TA 3MK6A 2O8EB 4EPCA 3TOBA 3QHSA 4BG8A 1BA0A 5CYQA 3CMET 4IOXA 2R4GA 4K41A 4F7UB 4JD2A 1FIPA 1AZGB 2GTJA 4XN3A 1T7PA 3URGA 2JT1A 4FYWB 1T0HA 4FWKA 4O5FA 2P9NA 2NZTA 3E6CC 4AT1B 5FU7B 3SLCA 3VU3C 4HNTA 2COWA 2DZCA 1M1KO 4C8MA 3M8EA 1NJIC 1LMZA 4F7UG 4DUYK 3HRUA 2JHNA 2KGTA 1YP5A 3QDKA 4FL6A 3EAEA 3RDIA 4IUQA 3HK2A 3RKQA 3CQ8A 1KVBA 3T8RA 3DPUA 4FE7A 4NUBA 4F55A 2HVQA 3TWHA 4GCVA 3KP3A 4KT0E 3WODF 2P4WA 4M72A 3CQYA 2DTOA 2FBKA 2OCEA 4EM0B 3PNWC 1OH6A 1K8KB 3NQOA 2K4BA 2WFBA 3LSTA 3JCMb 1SKUB 1NMNA 3VV0A 4R0KA 3VN5A 3RERA 4M3GA 1Y07A 3GBGA 2D0QB 3P4IA 1C1BA 2BYVE 1T6DA 4IBNA 4OB1B 5AIPA 1GUUA 5FU6B 4CRIA 1SL1A 4CBWA 3OY9A 2V8KA 2RN2A 2DXUA 1NGBA 1O75A 1NLPC 4N9HA 5I9EB 4JKHA 1N5ZA 3I59B 3E5QA 2AXTC 4YFUA 1LWWA 1IZ6A 2DMPA 2O8EA 3IWZA 1WGXA 4ESBA 1S6LA 2R7FA 3ME9A 4XKCA 2ZMEB 3DBRB 4EVIA 3HVTA 3HRSA 2ETJA 4EMKA 1W2BA 4ESJA 4CFDA 4CZJA 4L18B 3TTCA 1S1NA 3J7ZI 4E19A 2ATQA 3L2CA 1GCQC 3A0BC 2ZE2A 3HL8A 5M5YJ 4AH9A 1DLOA 3EEQA 4DQRA 1M90R 4BVPA 3CEYA 1CZ9A 5AZIA 2R7TA 1WI9A 2IPOB 1NJZA 1VK0A 2RE2A 2EFOA 1C1CA 1UA1A 2BTFA 5LJ3g 2YV0X 1P7IA 3FXKA 2Z99A 4MFEA 2LX9A 4LK1F 1JLGA 3O8MA 2P5GA 3U6FA 3UR3C 2V1QA 3Q7CA 5AQNA 4LDXA 2P4TA 3FXRA 2J6KA 3JCMP 5HS7A 1QMCA 4B1XB 3M4GA 5AQOA 4AIHA 4FJ7A 2H94A 4LB5A 4UUTA 1VSIA 3I56N 1MDUB 4F2RA 1JTYA 4I02A 3TDZC 3P31A 1SRMA 2A6AA 3THWB 5EF6A 2GIVA 4EP4A 2ZM6K 4GRIA 1BR2A 3M57A 4DTUA 3GZ6A 2H3EB 2JT4A 3RQIA 3K5LA 4IO9L 4GV6A 2FBIA 3SMSA 3MHXA 3D7EO 1KD1O 2W6LA 1PD0A 1GFCA 1O1WA 3T69A 4B9TA 3ZQIA 3ZETA 1E3HA 2FC0A 3MECA 3ZX0A 3PT9A 1W5TA 1S9GA 3P8HA 3I0RA 3OJUA 3A8LB 3KZYA 4YIIA 4CHYA 4KI6A 1WEIA 4BRKA 5GPCA 3O3GA 3CBMA 4MDWA 1QP2A 3CLQA 4Z4GA 1AA7A 2VB6A 4YNQA 2O9LA 4HCKA 3KP5A 2R7UA 4MDAA 1YITQ 4BDZA 2K3BA 1Z6RA 4BYYA 5E8IA 1VIEA 4RKUE 2O5RA 1ZLKA 3P9CA 2BTTA 4A3FJ 4CEBA 3CCRT 2K9LA 3DEWA 5BPDA 4BRFA 5GAOl 3DV8A 1WDXA 4EA5A 2NNYA 3BR5A 4CFCA 3K4MA 3OJSA 1PWTA 1Y6IA 1BI4B 3K1PA 4EHTA 3ASKA 2LFBA 3SEMA 2HQ5A 5ICCA 1RAAB 1JXMA 2KI7A 3KUFA 3ZCMA 4Z8AA 3ZQLA 3ENOA 3WEEB 3R60A 1HK9A 2P5OA 5ILVA 1VQ7A 4DSLA 1X2MA 3BR1A 3V9XA 4FE4A 1WJQA 3TSPA 2P0QA 1OVYA 2VCPA 1G3WA 2OJED 1SMYF 3PNYA 2MFZA 3K69A 2ZPHB 1U2VA 2OTJI 1W4MA 1U2WA 2A05A 2Y0SA 4KTZA 3KYDB 4FVUA 3LFUA 2XDBA 4HUFA 2R7SA 2J05A 3VF6A 5M5WJ 1F4KA 3DI6A 3E6DA 1DGWY 3PL8A 4R1HA 1PVSA 3ZMSA 2YUSA 3HM9A 4CGGA 2BHYA 3OW2S 1K9MU 2CH0A 2KIUA 5J1EA 3ZQQA 1C0MA 4OPHA 4BQOA 4D6WA 4QSHA 1K8AC 4HSRA 3OR2C 3A02A 3LMMA 2Q0RA 1K4SA 1ARKA 1Q1VA 2OPTA 3D6RA 3J7AF 1NK0A 4PA1A 2O8FA 1Q86R 2HL5C 3D4VA 4XU2A 2HNYA 2Y48A 1AWJA 2OZMA 2TCTA 1D9DA 2JUFA 1P7MA 1VHXA 5DK5A 1OYWA 1YCYA 4HCZA 3OOUA 4HRIA 5CVRA 3O4WA 1VSFA 2CZ6B 3I5RA 2EW3A 5F2RA 3GBQA 2EPDA 4LDUA 4AILC 1ACIA 2KLAA 1C0WA 4IUTA 2OTLQ 2DMQA 5L3DA 2JRTA 2LCLA 2EFPA 3RUXA 4M9ZA 3A4CA 1K7AA 2ELKA 2M4GA 5CVUA 1TT5B 2NOLA 1T03A 1F1BB 1TUUA 2DJQA 5KCOA 4HTUA 4CJ3A 2F2XA 4ZN3A 2HQEA 4KHWA 5HRSA 2HCKA 4HCCA 2H6CA 1QE1A 2E88A 2YNIA 2DCEA 2FHDA 1U9OA 4MEXF 1GCQA 2O6GE 2E36A 3EH1A 4OAZA 5FDLA 3PTAA 5CYVA 1A36A 3GVAA 2X6YA 3NARA 3FHZA 5GAN2 3BWGA 1QQOA 2ZNYA 2JWKA 2V8IA 3MEEA 2D4WA 1IHVA 5H1SQ 1KRPA 2VBWA 3O9QA 4OFEA 3DU6A 1SEMA 3H6ZA 4B1UB 1FT9A 2WSFE 4LF6K 3QODA 2MLKA 1VSMA 3OH6A 3EGXB 1ITYA 4FWRA 1ENHA 3CCEN 4CJPA 2Y31A 3AAFA 1YVUA 1XDSA 1ZN2A 2FZGB 3G4ST 4DSFA 2CGJA 4F14A 1CZBA 2FRWA 5LRSA 1YI2Q 4L5JA 1VQ8A 2CP6A 3FE1A 1TTYA 3H8ZA 3HGGA 2QKLB 3NF6A 4LGWA 2CZ0B 3ZSVA 4QS9A 3BTJA 2ED1A 1M8MA 1V3FA 3BJOA 1JKHA 4UY8I 1D0YA 4I76A 2O8KA 4IHXA 5B8HA 5JLHA 4CC3A 5K7ZA 4HUEA 3O3FA 4PGHA 3EG1A 4AU7A 2RAEA 4M3EA 4I7FA 1E2XA 2M5WA 3PNVA 4PKCC 2V9VA 4OMYA 1XN7A 4FW1A 4XTWA 4Y52J 5AQLA 3AKZA 3FKJA 2JS0A 1G3YA 3VQ6A 3CQZJ 4FXDA 1RRJA 5K7FA 3LNQA 1WA7A 1K9AA 1UAAA 3LCNA 2Q2RA 3CPWM 1BI4A 2GOMA 1UE9A 4ENJA 2M2EA 3X2QH 4QOZB 1GDTA 4HPQA 2IGMA 4C23A 4Z4EA 3RPQA 1NGFA 3S41A 4CGIA 3WTWC 3AFHA 3QKJA 3PIOL 3VEVA 4YORA 5ED4A 3ZYYX 1YX5A 2EV5A 3ZX3A 2BH1A 1LEBA 1U6ZA 1IN4A 4DTSA 4U0VA 5C3EJ 3RZOJ 4S0HB 3VKIA 4C92E 4KH5A 3O08A 2ITMA 3MKLA 3SDZA 2HOAA 2P9IA 1EXQA 4EJUA 2CGLA 3WUHA 3S3NA 1FW6A 5LLQA 1KYWA 1RESA 2HFHA 4HNVA 1O3QA 3EE9A 1PD1A 4ZDPA 1XSXA 4EJWA 3LSJA 4LG0A 4Y7NJ 3CCQT 3SUPA 4L9JA 5H20A 1RBSA 4CJFA 2EQMA 2HMIA 3V9WA 4CJVA 4IXAA 2GXBA 5M1KA 4JI1K 1KC8U 1N33K 3EFOB 2G8HA 1VRLA 3WXIA 1JHHA 3GIBA 4ZGJB 5DS9A 4BC2A 4XSZF 5HDGA 2Y90A 2OCCH 4J2AA 4WQ5A 3WXKA 3JCMQ 4RW4A 3VQ5A 2OBPA 3VOEA 5HLGA 2ABLA 2KVQG 1ZBFA 3SQ0A 4JLIA 4DW6A 3H36A 3WU2C 2JTMA 3TANA 5GANg 1NPPA 4ESFA 3MVPA 2VQCA 1O3TA 5K14A 3AGRA 4C92A 3H0IA 3CCVQ 4H0EA 2GUIA 2VASA 2LK2A 3CMAI 3UNGC 4ORZA 3L4QA 5D6EA 5GAOp 3H45C 4RM2A 4JI2K 2RQQA 3KK3A 3CCLA 3LWLA 4Q4ZF 3HBLA 4BQAA 4LIVA 2ZKZA 2H8HA 3TQ7P 4Z6YA 1W36C 2P0KA 4O4GA 2VPRA 4YTLA 3ZR8X 1IBKK 3QO9A 1RTHA 3TKYA 4AIKA 1M90U 4IO9F 1JU5C 3KLHA 2DDBA 4A4EA 3UF4A 1Y71A 2V1DA 5F1RA 1PG5B 1G6NA 1WGSA 1EQYA 5IHNA 3SQ1A 3RR7A 1U2VB 1X3ZB 2M1BA 4G9ZA 1HCRA 2D9TA 4BY6B 1I5LA 1GXPA 1TAQA 3CI5A 3KK7A 3T7ZA 3D0SA 1QBJA 3DF8A 2GBZA 3Q1JA 3OH9A 3UWNA 4RB1A 1W4SA 2F4IA 2PN6A 1PDNC 4FJGA 4NXNK 1SD7A 2V4JC 2W24A 2X6WA 4N56A 2E65A 1XHXA 2HVHA 1PU6A 3AVGA 1BI3A 1FMVA 3VGLA 2HF3A 3PO2J 4PNOA 2XY5A 1L3TA 4E7LA 1ZQ1A 1BBZA 1S6PA 2JVGA 3RQ4A 1KQSS 1N39A 2OAWA 5CZ2A 3VEYA 4Z02A 4FJNA 3L3UA 3FLCO 4X62K 3K10A 4A0XA 3DXMA 1YFHA 2AP1A 5JLFA 3Q9SA 2BUDA 3LQQA 3HM8A 4C92G 3ZETB 5E18F 1IV0A 3JRGA 3CCUI 4KH1B 3QOEA 3CCVI 3SFZA 2RQRA 4Z88A 3ULEA 1YI2N 3CD6I 2HKNA 1D09B 1LW0A 4E3SA 2QWPA 5AR0A 5IT9K 4OMFB 4F16A 5EXWA 1WBDA 5KHDA 2F2VA 4C92C 3M0TA 5M3FJ 1I4K1 1JKOC 4RTZA 5HDNA 1S1UA 1A04A 3TL4X 3ZSRA 5GANd 1JJ2P 2QGUA 3EH2A 2WAEA 1QVFS 1V4RA 3IHOA 2LF7A 4XIUA 2QCOA 4LD9K 3UT1A 3UKRB 1K9MC 4IEEA 1IN6A 2PX9A 2YG9A 4OMZA 2X85A 2UU9K 3R6NA 5SZTA 3VERA 2DYRH 2PYJA 3O5ZA 2E2IJ 1YJ9T 2M16A 1VQOI 1QCFA 3TAGA 1W1FA 1DGRM 2RHZA 3PO3J 2KQ2A 4EMHA 1EETA 1TNTA 2LRDA 4ZNXA 4D8KA 3TSZA 2CQNA 2KY9A 3R6MA 1K4TA 3VUZA 2IA0A 3A8HB 2JZ2A 2LQWA 1SAXA 2IPQX 3HTSB 2NUTB 4GKKK 4IX7A 2CQQA 4CCLA 3VGMA 2L2OA 2DL4A 2CW0F 3HYFA 5KQDA 2CMPA 1YJWQ 1RC9A 3HP9A 3SBTA 3E5XA 1BU1A 2BUPA 5HNHA 2Q3SA 4ENMA 3CC2T 1VQ8Q 4A5NA 5KQ8A 5LMUK 4PUOA 3HGYA 3RR8A 3O2PE 2WAFA 3DEEA 4FJ5A 1XWLA 5HLFA 1ZARA 2DL8A 1ZREA 3WE3A 1IGNA 5GAN3 2M4KA 2LG4A 2JVVA 3D5SC 1KQ9A 2A37A 4W5QA 4HA8A 4QWQA 4C3HJ 2YCHA 2DMOA 3FJPA 3VDXA 3CDHA 2XB0X 4LXCA 4ESRA 1VSLA 4P9FA 2FB7A 1A31A 3DLLA 2VUMJ 4OMPA 2ZMEC 1PC0A 4F8RA 4CGJA 4RG2A 3V4GA 5K5OA 2XAUA 3CXCA 3CJCA 2EQJA 1XMAA 4IOAF 1LW2A 1OYYA 1RETA 5LL6S 2O8DA 2RO0A 1RABB 4UC4A 1AVZC 4EJTA 4GBQA 5F0XA 1KIKA 4X66K 2CRGA 1NJIR 4CZHA 4HAMA 4RAFA 2M9HA 2DPPB 3HPHA 2ZJRL 5LJVA 4DU4A 2BZTA 4WXCA 1ATSA 4F9OA 1NGCA 1ZGWA 3BZ6A 3U2RA 1EFNA 1QVFA 3C95A 2P7CB 4GLKA 1H89C 3Q3SA 1V4SA 2H6BA 5AQXA 3M56A 4QQ6A 2R7YA 1LWCA 1S72N 2VJIA 1VQMA 3FJ5A 1I3QJ 1UGPB 1UB9A 4L9TA 2FSJA 1ZUUA 4LG0B 2K86A 4RGRA 3LP0A 2O2OA 2X74A 3ZSYA 3D2EA 1IXCA 1OCRH 4PK4A 2NRTA 2P9IB 2D45A 3OYKA 1IN5A 3BR3A 5L23A 2XSJC 5DTDA 2HQHA 3CLOA 1XNIA 1RGIA 3AO1A 5HVQC 2OV7A 2GX9A 3QMLA 3ZMZA 5AQKA 3C94A 4XU3A 2H3GX 3WXMB 3F8MA 1D8JA 5EG0A 4A5MA 3EUHC 4F91B 1ZA2B 1WPKA 5IOYA 3AO5A 3LWIA 1OKJA 1TG0A 3GLLA 3JRCA 4C8QG 1MW7A 2V1NA 4XTYA 3T19A 3VB2A 1UHFA 1M3AA 4KKOA 2CP2A 4RLFA 3QPTA 1V4TA 2E1MB 5E1XA 3G0ZA 1KQJA 1WXUA 3NF8A 1RRQA 4BQLA 4ZYAA 3MN5A 1ORKA 2UUCK 4UHTA 5ELZA 1Q1HA 2F2WA 1PKTA 2DAOA 3LANA 2K9QA 3TQNA 1UELB 1P4AA 3R8EA 4BRGA 2IS6A 1HYOA 3J7AP 3GNFB 2MCNA 1BI2A 4BS9A 4EP5A 3MZYA 1WLJA 4QTRA 1VYUA 3VFZA 1YJWA 1QWEA 4DBRA 2VT2A 4DTJA 1E4FT 2QDLA 2FF6A 3IQLA 1WNSA 2L3QA 1RUWA 1TQIA 1VQKI 2DA5A 5CIUA 3KK2A 4W1UA 4TVRA 2LY9A 4IOAL 1DP7P 3HFNA 5TGTA 2A1RA 5KYWA 1OH5A 2LDUA 4C9YA 3H0HA 2A5YB 4A3CJ 4E0DA 1NU0A 3ZSXA 1TKXA 2VC0A 1W2BS 5L3CA 3EG9A 4YELA 4KHUA 3OS2A 3BZCA 2NUPB 3QEPA 4K11A 5LJ3j 2W03A 2XVCA 1JB0E 2HNZA 4BAYA 3RMBA 2E2JJ 4EA4A 1QW1A 3JV3A 2XV4S 3KD5E 2EA2A 1HF0A 2HDCA 1SS6A 4C8QC 5GANj 4OIQF 2CUZA 3W2VA 2NWMA 3I33A 4XRSA 3FDRA 4B1RA 4AD9A 2OA4A 2WC9A 5GAGJ 3QOPA 1QKWA 1R0CB 1YT3A 3CBOA 2OAUA 1UDLA 2WUSA 3FHNA 2K79A 4CGHA 3I0WA 3SYZA 3NRVA 3S32A 2K5IA 2HWVA 1A6QA 3CTAA 3VSLA 2IDOA 1MJBA 1EV7A 3SHWA 2HTSA 4P96A 1KD1U 5FLXO 1IG9A 3F9KA 1MV0B 2DPDA 3ROUA 4Y0WA 5AQFA 2NS8A 4YOYA 4GY2B 2NVUB 3BTIA 5M1QA 3FWEA 4FPAA 1JE8A 2Y4YA 3HPWA 4EMKC 5LJ3e 1QVGS 2EZKA 3E1SA 3ZPLA 4HF0A 2HB5A 4Q5VA 2ASPA 4I2OA 3FZFA 1D1CA 3L2WA 1JLCA 5FLVA 1R36A 3QAHA 4PJOF 1FP2A 2ZMEA 3KXTA 2ZJQL 3MZHA 4RCBA 1KFZA 2EH3A 1N27A 1E6GA 3KLOA 3QZ5B 3RRHA 1I0CA 5HCKA 3CG7A 4B8CA 5FLMJ 3UPUA 3DOLA 1ETWA 2JPBA 2YUQA 1YJ9A 3K70D 3UKUB 4CK3A 2GXGA 1VQ4A 2J5OA 1VQMI 3MWPA 5J3BA 4FZXC 2XU8A 4PKGA 1H8AC 4N4GA 3VQDA 3CFOA 4M42A 3CCYA 5EOYA 5LRRA 3H46O 1XC3A 4NCGA 2P0WA 1M90C 3JW4A 5AJ3K 2IEKA 2RJCA 3G0QA 4XMYA 2X6XA 2RV8A 1J6ZA 2A69F 2DF6A 2L2PA 1UJ8A 3GCMA 1WVRA 3T1AA 3NMZC 1M1FA 2SEMA 3J81K 4H4KC 2RQUA 4ZJZA 1WHUA 3CUQC 3TW6A 2YU9J 2NUZA 1MBJA 1WJFA 2FBXA 1U5TB 2YS9A 3MEAA 2HBLA 1W6XA 3V1QA 5AONA 1GLFO 3QBWA 3AVIA 2FEIA 1IRFA 1K8KA 2HVIA 4IHVA 2JWLA 3QWLA 4A6EA 4M3FA 1HJOA 2VKDA 1OCOH 1DTQA 1R4MB 1YO5C 2B0LA 1BUPA 2BY1A 2EQUA 5ICFA 4N4OB 3LFKA 2FSKA 3GZNB 3JCMg 2KKOA 3AG2H 4J6YA 1X9WA 3TSQA 2QEXI 1BBYA 3L00A 1NJYA 4IOCL 4AI4A 5L3BA 2CP5A 3CQTA 2AQEA 5IP9J 3EGDB 4XTVA 4BROA 1RTDA 3F0ZA 4J9FA 2V6EA 4QPQA 1AKHB 1O57A 2OA8A 2VQGA 1FWZA 1YITI 3WEEA 3QFPA 2GAUA 3D2EB 1YLFA 5C24A 4FX4A 1MJAA 2OANA 1PRMC 4FLZA 1HRHA 3M5AA 3OIOA 1WI3A 3LA2A 1YOVB 2Z5UA 3GLXA 4BY1J 3BCBA 1KGSA 1NM1A 3GG4A 1LDKB 1R00A 2NVXJ 2M8EA 2FXAA 2E71A 2YHWA 4M77F 2K4JA 2E34A 4HCBA 2ATCB 1FYMA 1YITN 1HKQA 1K73R 2YXYA 1IZ1A 3JAMK 5JS2A 2YRVA 2K5LA 4Z89A 5J1YA 2OTJT 2W04A 4XL9A 1VQKQ 4ZTFA 1V55H 1U1TA 2D5RA 3CW7A 3ASNH 1TZLA 1NKCA 5M1OA 1YJ9I 5K7HA 3K5MA 1KU9A 2QWQA 3H9JA 2UWMA 2FMLA 2KZZA 3PX4A 2XHIA 3O8VA 4EMGA 3BG7A 4DTXA 2F7TA 4RGUA 3LAPA 1TSFA 2K2VA 4XOTA 5ADXA 3VS5A 1FIAA 4FYDA 2KIFA 4UV9A 1RI7A 4PKHA 2YKNA 5BRFA 1I94K 1T33A 4CYDA 4RTVA 1NK2P 1Q18A 3FXOA 3MN2A 4HG2A 1S5JA 5KPZA 3U1KA 1WHLA 2R7DA 1FLIA 3MPUB 1Z3YA 3CMYA 2IC3A 2G8WA 3ABTA 4CZGA 4FWQA 2M0CA 3TAFA 1IO2A 2MD5A 4WF2A 4E7ZA 2W40A 1ILYA 2W84A 3JCMf 3S16J 4C2UA 4M78B 1W70A 3Q0UA 5GAN8 5EDNA 4FM2A 2KYMA 4LC9B 4XTXA 1AEYA 2YNGA 1MNDA 3QICA 1OCTC 3PO4A 2QK9A 3VYGA 2UYTA 2JNGA 3K5NA 4R5PA 2JQ7A 3K2AA 2LBFA 4BBSJ 4CO8A 4LUEA 4LLNA 2BZ8A 9ATCB 1BQNA 4FOEA 3H9GA 3OYBA 3ER0A 1KG3A 2FZKB 3UKUA 1MU2A 1OCZH 5TJJA 2DD4A 2PI0A 4I2PA 4J2BA 2D8HA 1WSHA 2HHUA 3CCJQ 4J9HA 3EN9A 5GAMd 2NLXA 4BBRJ 1ZGJA 4A3LJ 3ESWB 3O1BA 4LFCK 2QBYB 2KJCA 4D7NA 5C2FA 4B3MK 2KROA 4BE0A 2UUZA 2ZSIB 2L7ZA 4CF9A 2RMOA 3DBHB 3MDQA 4A54A 4I09A 1CXQA 4JX4A 1XUPO 5B66C 4DIQA 3L7WA 2HNDA 1TL1A 2BKDN 1V5EA 1JJ2A 1L0OC 1MMNA 3OIQA 2QI2A 1GLJO 3ENBA 4EQQA 3CP8A 3FRNA 1LNXA 3H0GJ 1O7FA 1MUDA 2FUG2 1T3VA 1UHSA 3GTGJ 4KV8A 4RCCA 2UXNA 4CEAA 4OKKA 4EEFG 2HZYA 3ATVA 2YHBA 2E6NA 5FD5A 4XU1A 3PVQA 1QVGA 8ATCB 2FOWA 1Y39A 2EYYA 1C0UA 1CKAA 4X65K 5H6QA 2GBQA 5F1XA 2HQXA 2FRHA 1VSJA 3E0JB 4CVNE 4OPJA 3A2FA 3RMQA 4WFAL 5CCAA 1QZ5A 5E84A 2J6OA 1KAYA 3LX7A 2QENA 4A61A 1W1WE 4DTNA 1KLMA 3CPEA 4O44A 1A0NB 1WI7A 4QAGA 1IGUA 4F7ZA 1RFQA 1SSHA 4AM7A 1WXBA 3FMRA 1U78A 4YOUA 2XY6A 4KUDK 3R0AA 2VBXA 2WY7Q 4FASD 2RKIA 4Z4HA 2NOGA 4OPAA 1M1KU 1SRLA 1APLC 2ROLA 4JI4K 3FHGA 1GV5A 4IHSA 2QUFA 1I1GA 4CW7B 1TWHJ 3TMOA 5BS6A 2E5KA 1ZG5A 3HTUA 1XNRK 4KH0B 4HW0A 4DR7K 1H8KA 2XG8D 2C0IA 3BT9A 2KISA 3AHUA 3REAB 3FEOA 2P9UB 2NRRA 4OVLA 3Q5FA 5LD2C 2HYGD 4MO7A 3CCEQ 3OSFA 4CC7A 1ZXOA 1MMGA 4IWVA 2XF5A 4AFUC 3TABA 1XMKA 1UECA 1GOBA 4CCJA 2HS5A 5BPMA 1VI0A 2DOAA 2ACJA 3JTHA 1Y8QB 5TKWA 3LGLA 3KLEA 3KKRA 2F96A 2E10A 1OV3A 2JXBA 4DHYA 2R3SA 5EEAA 2EYWA 3UE5A 4C3JJ 1UGRB 3X26B 3O9TA 4B9UA 1EZZB 2K9SA 3SMPA 3LPUA 4IEIA 1X3NA 2YI1A 2DW4A 3DLHA 2FSWA 3JRZA 2CZ7B 4Z94A 2CU7A 2VKEA 5CE3A 3G1OA 1T95A 4CC4B 1BL0A 1XI1A 2E12A 3JREA 5GAMe 2FYKA 4A53A 2FBVA 5CKFA 2JMAA 2A61A 1SFXA 1W0UA 2FLOA 2CV0A 1N78A 1KG4A 5KYYB 4KFBA 3VS6A 1RT7A 3JRDA 3CCLT 3RYPA 4EAHD 3CF5F 3U9GA 3QNNA 3LM9A 3EUHA 1HDPA 1YUWA 2XIDA 2H8WA 3JCMe 1TBXA 1K83J 2IOCA 5DCMB 1X3MA 1QS4A 2DO3A 3JAMO 2MPXC 5FWCA 2JA7J 5F6FA 1NNEA 4E9GA 3RIRA 4E7HA 1WX6A 4XEIA 3JB9G 4KN4X 2DN0A 1LWFA 2KHOA 2QXFA 2HKOA 1J59A 1GLDG 1T8IA 3JCMV 4H5WA 2NS7A 3C2HA 1YCSB 3ATUA 3HOXJ 3VA3A 1HSJA 1MGTA 3VS7A 3CC4A 1LJ9A 2NUBA 4V2FA 3J80K 3F21A 4E7JA 1ZAOA 4H4MA 5CKBA 3J81E 4EIAA 2WACA 5FPEA 2KQRA 1A5JA 4MMKA 2XRIA 2JA2A 1JHFA 1MNMC 3ISNC 4DOZA 3THYB 1SKRA 5J39A 4PJJA 5IY5H 2LVMA 2PVDB 2MOXA 1A5VA 1IC8A 1TW2A 4E47A 3PIPL 4LSNA 3N97A 3G2BA 2FVUA 5B1BH 4ATOA 4GKJK 2P6TA 1I07A 2CH5A 3BUZB 1YJWI 4M77C 4F92B 3MJXA 5GANf 1J5EK 4A5BA 1YHQI 4M7DD 1W97L 3VYUB 1VSEA 3CO7C 4JK1X 1J54A 2VGNA 1RRSA 3HM5A 3FFIA 1NJIU 2BY2A 3GXOA 2KDZA 1N34K 4BRLA 4EJOA 1AHJB 2NUTA 4K42A 2W82A 3VF2A 4M75G 1TAUA 1U5TC 2E8AA 1BC8C 3CJAA 2Z1GA 1R22A 2NOFA 4DJAA 3L42A 3W6VA 3J81Z 2E5NA 1K8AO 4BU2A 4C92D 4DSIA 5FGMA 2ZB9A 1UGVA 1M4ZA 4CCNA 3C2GA 3FXUA 4FJ9A 1K0XA 4GYIA 2L9NA 4GY5A 4J9EA 4DS4A 2O31A 3V8LA 1NYGA 4I9LA 1HPZA 4NXMK 4KA4A 3FBNB 2DL3A 5GAOr 1S7EA 3BPVA 1H1VA 4BRDA 2R92J 4OOIA 3WNGA 4BR7A 1O9SA 2W7NA 2PQWA 1CLQA 1NGJA 2RN8A 5D3GA 1R1TA 2F4MB 3BDDA 3OW2P 5IT3A 4JPBW 4OIOF 2DXBA 1TUCA 1KC8C 3LAJA 2A28A 1S9HA 1DPRA 4DFKA 1UGQB 3S15J 1JI8A 1WXTA 5D6YA 2WY8Q 3ZQCA 3CVTA 2E1MC 1RDDA 5AQRA 1V5GA 4M77A 1X3UA 4EV0A 2KXDA 3L1AA 1RBVA 3I0XA 2G7UA 3JRIA 1S8NA 2QA4N 1KCFA 3QETA 4K2EA 3M0SA 2O8DB 3G71A 4I0AA 1RDCA 1TWCJ 1IHWA 4NDLA 1SL0A 4HHTA 3QPLA 2VE9A 2PUKB 3CPWA 4ID1A 3DXJF 2RQPA 2PQ8A 3WTSC 2A3LA 3M3ZA 1MA9B 2DXTA 3SWNA 3K5OA 3QU3A 3CD6A 3ZFJA 3SXYA 1JJ8C 1S1WA 1UG1A 1TW3A 1WEGA 2X4WA 3ZXSA 2RVCA 1NGAA 3DRPA 4EJYA 4JKAA 5CKTA 4NQWB 4C0ZA 2KHMA 4YRVA 2ZJPL 3H3ZA 3C4SA 4XLNF 5J4YA 2M7AA 1FJGK 5LJ5j 2K3PA 1M1KR 4KMFA 2HPMA 2HNIA 3KIOA 2L01A 3ZN0A 4HT8A 2EJ9A 3OL3A 1TU0B 1WQWA 2B6AA 3BCAA 3OYIA 3AG3H 1BIUA 1BG3A 4UQGA 2LLKA 1REVA 1JKRC 2RF0A 2YHXA 2EV6A 3FFKB 3LDPA 5GMKm 3OVNA 3CQXA 3WQUA 1ZK8A 2RQVA 4DS5A 2ZJRF 3C18A 3DM2A 5KK1A 4M3ZA 4U87A 4RTFD 3KX2A 2XDPA 1NEBA 1EWRA 4O5VA 4DQQA 1MUNA 5H6RA 1WCMJ 5L3EA 4ON0A 3GF2A 4OKJA 4M6VA 4KITB 1YITT 1VQLA 4FU6A 1EP4A 1G8XA 2DFFA 3H3UA 1FZPB 1NGEA 4MZMA 4WCGA 4B9LA 1RDUA 1NLVA 5BPLA 4KIFA 5BNGA 1FK9A 4B43A 3IDHA 1HBXG 1T0JA 2A3SA 1I8FA 1ZSZC 3NGPA 3ZQGA 4PL6A 3CYMA 5CAIA 3B73A 3ZN1A 3FMSA 3M59A 1ZH5A 5BREA 2M3AA 3W2WA 4XN0A 2JM9A 4B44A 4PJ0C 2RNGA 1DP3A 5AQZA 2DDAA 2XGCA 4WTOB 1Q86C 5CQEA 3JSOA 5KYWB 2F5DA 2EWSA 3ID6A 1XGNA 4ASNA 5GAN6 5L8RE 2RJDA 4JKGA 3VEXA 1SC7A 1XC9A 3S1NJ 1N8RO 3NVKA 4KHPK 2DBBA 2R7OA 5KYXB 3EG2A 4N0AC 3ABUA 4M3YA 2HEQA 4NNJA 2NLUA 3VWBA 4OIPF 3NAEA 4F7UF 3IS9A 1VQ4Q 1PUEE 1E17A 1U84A 4ELVA 1NBEB 1IO6A 1IBMK 1VSKA 2LKPA 1AD5A 3CCSN 1FOYA 4JLHA 2BDPA 3L4IA 2YNFA 2R5YB 1GRIA 2UXBK 1Q8IA 2JTVA 1RLPC 4OU0A 3P7NA 3M3YJ 2Z1IA 1G2BA 2NYSA 2VG7A 1ZYQA 5KYYA 1K6YA 3SQ4A 1S1VA 4KMUX 3CC4T 3OWTA 2KYBA 3CCSQ 4II2A 4NYFA 1Z91A 1EH8A 2VI6A 3W6JB 1U48A 3KLNA 3NFAA 2CH4A 1UTIA 1ZX6A 8AT1B 2IXSA 1VQ4T 2WONA 4O0JA 3AVBA 1E0EA 3JCUC 4HVVA 3VEWA 1SD4A 1VQMT 4O5BA 3GPLA 1L3UA 5EGOB 5BOXA 3R2XC 4IJNA 1SMTA 1SD6A 1VQ5T 1C0TA 4LUDA 2A5XA 3FR0A 2E6ZA 3D5RC 2ZPIB 4ILGB 3ABKH 2XC7A 4EM1A 2RHKA 4FJMA 4CH7A 4JJNK 2CT4A 2YT6A 2O61A 3HB9A 3IKMA 2XDDA 1J75A 1X6GA 3EGXA 3SUNA 4H8KA 1KU7A 4ELYC 3VF4A 4AHSA 3V1RA 3G6EN 2XDVA 5LGTA 2VG6A 1P7JA 4C5IA 1M3HA 2D1XA 4E7IA 2HNHA 1OI1A 4BR9A 4FWSA 1WSIA 3K57A 3BY5A 3GOIA 4DG1A 4UVCA 1IXDA 1BM9A 4QVZA 4C5GA 4BREA 2Y9ZA 3QUIA 3H3VK 4LH5A 4RAYA 2V6CA 1PUFB 4KHSA 1RBTA 1VQPA 2RK2A 1MD0A 5KAIC 4DKWA 2HXOA 2XHKA 5EEHA 5FB2A 3EYZA 3DLGA 2CSIA 3M0RA 1ACMB 2CFOA 4F2SA 2DIGA 2STTA 3C6UA 1OCCH 2AO9A 2MWPA 4G8XA 2UZKA 5LJ5f 3CETA 1YI2I 1JLFA 2YHTA 3VS1A 4GW6A 3LQRA 3V4IA 3EFOA 2P5VA 5KNLA 4BNCA 1ASWA 2E3HA 1R0BG 4MO4A 1J2XA 3S9HA 1IGQA 4MTDA 2GFAA 1Q82O 2STWA 5HS9A 2XGDA 1KG6A 1MKMA 4DV0K 4M7DB 3AT1B 5E1WA 1F5TA 2LDMA 2QGGA 1MBFA 3LDNA 4CJRA 2D0OA 3KZIC 5D5VB 2D5VA 1H92A 1VQLI 3CCLQ 2MC4A 1WQ7A 5JMVA 3LZJA 1KQSP 3OYDA 3GTMJ 3RMCA 2KT8A