3OYKA

Crystal structure of the pfv s217h mutant intasome bound to manganese
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
368
structure length
368
Chain Sequence
LDAELDQLLQGHYIKGYPKQYTYFLEDGKVKVSRPEGVKIIPPQSDRQKIVLQAHNLAHTGREATLLKIANLYWWPNMRKDVVKQLGRCQQCLITNASNKASGPILRPDRPQKPFDKFFIDYIGPLPPSQGYLYVLVVVDGMTGFTWLYPTKAPSTSATVKSLNVLTSIAIPKVIHSDQGAAFTSSTFAEWAKERGIHLEFSTPYHPQSHGKVERKNSDIKRLLTKLLVGRPTKWYDLLPVVQLALNNTYSPVLKYTPHQLLFGIDSNTPFANQDTLDLTREEELSLLQEIRTSLYHPSTPPASSRSWSPVVGQLVQERVARPASLRPRWHKPSTVLKVLNPRTVVILDHLGNNRTVSIDNLKPTSHQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular mechanisms of retroviral integrase inhibition and the evolution of viral resistance.
pubmed doi rcsb
source organism Human spumaretrovirus
molecule tags Recombination,viral protein/dna
molecule keywords PFV integrase
total genus 106
structure length 368
sequence length 368
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2010-09-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
A PF17921 Integrase_H2C2 Integrase zinc binding domain
A PF18103 SH3_11 Retroviral integrase C-terminal SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2300 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3oykA04
1.10.340.70 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Endonuclease III; domain 1 3oykA01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3oykA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3oykA03
1QE1A 3FEOA 3HO1A 1S1VA 1JXBA 2XHBA 4GMJB 4BE1A 3V1QA 3L2QA 3OYDA 3LGLA 1TK5A 4DTJA 5C6SA 2EQJA 1XWLA 2BDPA 2QKBA 4PL6A 2DFFA 3RWUA 2EX3A 3QKJA 1JLFA 1KTQA 3K5OA 4OPJA 2F96A 5I42A 4O4GA 1MU2A 1S1XA 2RI3A 2FHDA 4CEOA 4M3UA 4ICLA 3KUFA 2DTUA 1OZ3A 4Q0BA 3ZEHA 1UAXA 4J2BA 5D6XA 4AH9A 3KLGA 1T7PA 1JLGA 2RJDA 4F3TA 5KI6A 1FKOA 3E01A 1NKEA 1SL0A 4K8XA 4J2AA 1JLBA 2FBXA 3TARA 1KCFA 1IKWA 4DSFA 3PY8A 2QK9A 1RBRA 4CJTA 3RRHA 3KD1E 1T05A 1TKDA 4Q5WA 4A4FA 2OPRA 4CIGA 3M8RA 4FM2A 5C0MA 4CHYA 3OA6A 1L3TA 1J5OA 3AV9A 3VA3A 1A5WA 3QINA 2VWJA 4KTWA 1IH7A 1IKVA 4OPKA 3F70A 4CEBA 3O3GA 2RI2A 3KK2A 1QSLA 2PY5A 3IAYA 1BHLA 1WSIA 3SYZA 3ZCMA 3SUNA 1UA1A 3PX6A 4E3SA 5FDLA 1WSGA 3VQPA 4PA1A 3LAMA 2DIGA 3ME9A 1G5VA 1RDCA 4UQGA 4IG3A 1ASVA 3VQAA 3VQ4A 4CIFA 4O55A 3LP0A 3M8PA 3ZT3A 4FZYA 2EKOA 3DM2A 1RTHA 3LPTA 1WSHA 3CEYA 4IFVA 3WNEA 4CK2A 4DQPA 3NF8A 2LCCA 4FL6A 3FC3A 3HL8A 1VSJA 1HJRA 1W9HA 2ITGA 3K2PA 4FYDA 3OVNA 2HHQA 3RMCA 4NCGA 4KI6A 3UWNA 4EDUA 3H6ZA 1CXUA 3DRSA 5J2PA 4KHWA 2E4LA 3G0ZA 3SUOA 2B6AA 5D6YA 3JSMA 4C8KA 4Z4EA 4KRFA 4OJRA 3OY9A 4IUVA 1B9FA 4KAZA 3AO2A 2XY7A 5HLFA 4J2EA 3QERA 2B8AA 5K14A 3S9HA 5FROA 4CFAA 5KTQA 4FCYA 3I0SA 1CZBA 4CF1A 3TR8A 4CCHA 3OYIA 1RT7A 2E6NA 2YNHA 1KVCA 3LP3A 4C8MA 3QNOA 4CJ4A 2G8VA 4DSKA 1DTTA 5DK5A 1NK7A 3MP6A 1YTAA 2X6SA 3OYKA 1N27A 2F8SA 3LAKA 3QO9A 4ZTJA 2JTFA 1EKEA 3L3VA 2HHSA 2HB5A 2RPIA 5FRNA 4DTSA 1RTIA 1WN7A 1BGXT 1U49A 2DIQA 2XK0A 4OKEA 1IKXA 3AA2A 5CY4A 1U47A 3O3FA 3SD4A 2XY5A 2R7YA 2RHYA 3PO5A 1YVUA 4UC4A 1JLEA 1NKCA 1RTDA 1TL1A 3DLHA 3QIOA 4KHYA 1BIZA 4IUUA 3EZ5A 4DQSA 2HQXA 3QEWA 2HW3A 4CJKA 3NTHA 2IS3A 3HXMA 2QQSA 1BQMA 1J53A 1DLOA 4DSJA 1B9DA 3BGRA 2G8HA 2HVIA 4LD6A 1ZBUA 1L3SA 1OI1A 3CQ8A 1I3AA 1S1WA 1NJYA 3AA3A 1HYSA 4W5NA 2A1SA 3DYAA 3NNQA 2EQUA 2X4YA 2DY4A 1BQNA 4PWDA 3ZSQA 4X34A 1VSHA 3EYZA 3ISNC 4FLXA 1TV6A 3NE6A 1NJXA 1REVA 4GW6A 2HVHA 3S3MA 2BIVA 4CE9A 4NCBA 3LZIA 3O8VA 3PFSA 1EXQA 5D6WA 4I9QA 4AHRA 1NK4A 3FDRA 3ALYA 1NJZA 1JLQA 1Z26A 1LAWA 4DTPA 3AVHA 4L59A 3WNHA 1J9AA 1IO2A 1HMVA 4PLIA 2LTOA 3F9KA 4NYNA 4CHPA 3GOXA 4DTUA 1C0MA 3LANA 3HPOA 3SI6A 2DFEA 1NK9A 4FJ5A 4GY5A 1BCMA 4FJ9A 5KGWA 4DFKA 2YHBA 5CYMA 4I2QA 2EQKA 5SWMA 2KZZA 2L89A 4CF8A 2GUIA 4JRPA 4PUOA 4RW7A 3MXMA 4I9LA 4IKFA 1QTMA 4B9MA 3MEAA 3I0RA 2YNFA 2B5JA 4C5GA 2HHXA 4AHSA 3LX7A 2EFIA 2PQWA 1RBUA 3AVBA 3M9QA 1S9GA 1CXQA 1HQUA 1WJRA 4N4HA 2JLEA 2X74A 4ZTFA 4FVMA 3ZT1A 1RT3A 3LALA 4AHCA 4CJUA 4JRQA 1U48A 2G8WA 3MEWA 4HCBA 2VWKA 3HT3A 4ID1A 5KCOA 2G8IA 4AHTA 3LP1A 2P5GA 2XRIA 4O44A 4BWJA 4M41A 1QS4A 4KHQA 1RT5A 3ZSZA 2IOCA 5KE2A 3DRPA 2Z1GA 3O4NA 4QVZA 3SV4A 4FZZA 3PNWC 1F21A 1TKZA 3ZT0A 4B9VA 4PLLA 3ASKA 4F2SA 4CHNA 1X1PA 4HTUA 1RT4A 5J26A 2GFAA 3ZSOA 3VA0A 4B9TA 1GOBA 1C6VA 4Y1DA 1TKXA 2GBZA 2ZE2A 4DU1A 3SJJA 3IRXA 4FJGA 4N41A 3EY1A 1TAUA 4A4HA 2RHUA 4B9SA 3AVNA 3IG1A 2K3YA 5D3GA 3HVRA 1C1AA 1B92A 4EZ6A 4ID5A 2VG7A 5CIUA 4CJVA 1YTUA 3SCXA 3VQ6A 3Q1JA 1HPZA 1TL3A 4BE2A 4CEEA 1T8EA 2O4GA 4F8RA 3OYEA 3JYTA 4TSXA 2L3RA 3SPYA 2RO0A 4B9NA 4BDZA 3NGIA 3ASMA 4RW8A 3OMGA 3TAPA 2M1HA 4H4OA 2IAJA 1RDBA 4CJPA 2KZMA 1VRTA 2OPSA 2ZQBA 3NH0A 3SV3A 3SQ4A 1T03A 1ZBHA 4EZ9A 2X4WA 1XNIA 3P8DA 1IKYA 1WNSA 2BANA 1MHNA 1BI4B 1C0UA 4IUPA 1RT6A 2Z1JA 3QLHA 3V1OA 4CGHA 2OPPA 4BE0A 1KFSA 3AA4A 4DSIA 4N47A 1WSJA 4IFYA 3VQBA 3L2UA 4RW6A 2I5JA 3VQ5A 1LWEA 3VQQA 3OS2A 2HQEA 2YKMA 1KFDA 3UIQA 4ELTA 3QIPA 5HRSA 3T3FA 4FM0A 2M0OA 3U3GA 1S6PA 5KRTA 3AVFA 3DMJA 1NK6A 3LLRA 2YHAA 5CYQA 3V1RA 4N5SA 2HNYA 4CGDA 4FLZA 4AILC 2G8UA 4E0DA 4N4IA 1RT1A 3D0PA 2GFUA 4DLGA 1YT3A 3MEUA 5HRRA 1RCHA 3KLFA 1KRPA 4BDPA 4C8LA 2R57A 2OYQA 1ZBFA 2OA8A 3SQ0A 2DAQA 3ZT2A 3OYCA 4IBNA 4C8NA 2GV9A 2X4XA 3AVLA 2VG5A 4AHVA 4QOZB 1HRHA 1N6QA 3CFOA 2RKIA 4FK0A 2G8FA 1GOAA 4CJ5A 4KB1A 4IURA 3AVCA 1RBTA 4M45A 1NOZA 3C6UA 3C95A 3VQEA 4B9LA 1ZBIA 2JZ2A 3E9FA 2RJFA 5M9OA 4FK4A 3CFRA 3K59A 3RMBA 2PYJA 3OYNA 3HSTB 5J2NA 1NKBA 3S3OA 1WLJA 1LWFA 4F4KA 1CLQA 1G15A 5JS1A 3OYAA 1Q9YA 2LDMA 1LW2A 4W5QA 3VQDA 5E41A 2PYLA 1BISA 1TK8A 3OJSA 3PX0A 3OS0A 1HNVA 1KVAA 4W5OA 1NJWA 3KK1A 2BKDN 3KTQA 2Q3SA 1UA0A 4CIEA 4DQQA 2RI5A 4OVLA 3CM5A 2G8KA 4QCLA 3QEPA 4KHNA 4DMNA 1N5YA 3OMCA 1FXXA 3NF6A 2ZD1A 3OYGA 4FJ7A 4CJFA 4NCAA 3B6OA 3RMAA 3OYHA 4FJMA 2FBVA 2DFHA 2ATQA 4E1MA 4ELUA 4FJNA 3WNGA 4A4EA 3KLEA 4DU4A 3NF9A 1NK8A 5J39A 5HRNA 1L3VA 2R58A 3S6WA 4Z4CA 4OLAA 1H3ZA 4CGIA 3NCIA 1C1CA 2OPQA 5J2QA 3K57A 1RT2A 1U4BA 4OLBA 1VSIA 3OS1A 3IS9A 1XHZA 4CF9A 3K5MA 3OYFA 2WONA 4CGGA 2F8TA 1JLCA 3S3NA 5EU7A 3SNNA 4Z4GA 2HHWA 4YFUA 4OKKA 5C25A 4DF4A 4DF8A 1SUQA 5KRSA 4N76A 5HBMA 3CFPA 1WGSA 3EAEA 3C4SA 4CJSA 4IDKA 4QQ6A 3ZSYA 4QAGA 2HHUA 1KHCA 2BUDA 1WSFA 1BI4A 3CG7A 3L8BA 4DTRA 3SUPA 1Z25A 4DLEA 3PV8A 2O4IA 4JS5A 1GOCA 4DTXA 2E6LA 4M3TA 3WNFA 1WSEA 4FW1A 1VSFA 4N56A 4M3RA 2KTQA 2YNGA 3P1GA 4CF2A 3ZSXA 4FLYA 4DTMA 4FXDA 4LY7A 3KJVA 4DFMA 3DLMA 2Z1HA 1HYVA 4MFBA 3NF7A 3LP2A 3SPZA 4DSEA 5FRMA 3V9ZA 4B8AB 3LGFA 4DQRA 4DU3A 3H8ZA 4FK2A 2BGGA 1RDAA 3DLEA 4Q5VA 3L2RA 2E6MA 3KLIA 2D9TA 1KLMA 1VK0A 5C42A 2X78A 4R5PA 1X9MA 2P5OA 4BDYA 1RILA 2WOMA 3HK2A 4FLUA 3TAGA 1UOCA 4DG1A 3AO1A 4W5TA 1EP4A 4CEFA 3RTVA 4LH4A 3SQ2A 2FC0A 1JXEA 3KKSA 3AVMA 2E5QA 4O0IA 3M8SA 2FBTA 4DTOA 2D0BA 3MO8A 1Q8IA 3TABA 4DQIA 1L5UA 2NLUA 1IG9A 4B08A 4Z4IA 1JL2A 4EP5A 2X6NA 3AVIA 3DB3A 2RHXA 1HNIA 3L42A 2YNIA 2IGIA 4LH5A 4HVJA 1HYZA 4ZHRA 1VSLA 4CJRA 3TWHA 4FLVA 4CF0A 2HNDA 2P51A 3LWMA 4FLWA 1D9FA 2PZSA 3PUFA 3VN5A 3NH2A 1A5VA 3LH0A 3HP9A 3HM9A 5HROA 5CZ1A 2OZMA 1ZBLA 1ZYQA 1XC9A 1SKSA 2RHIA 2OZSA 4B3OA 3NTIA 2O4XB 1O1WA 1WAJA 4KI4A 1LAVA 1S1TA 1W0HA 3C6TA 1EX4A 4F3OA 4G1QA 2GF7A 3V4IA 4CK1A 3NAEA 4CJWA 4NS5A 4CFBA 3LPUA 4AHUA 3LWLA 2XY6A 3MEVA 3L2WA 2HHVA 1RBVA 2YKNA 1S9EA 2Z1IA 3PX4A 4LD0A 3DOKA 3QIIA 2R5AA 3MP8A 1OZ2A 2MWPA 1JL1A 5SZTA 3AVGA 1TK0A 3NHGA 3FLGA 3P83D 5KGXA 2ETJA 4CJLA 4E7HA 2IC3A 1ASUA 4H8KA 4B8CA 1X9WA 4YNQA 3DLKA 5C24A 3VQ7A 3PMTA 4N4GA 4E1NA 4K8ZA 1ITGA 3B6PA 3OYLA 3G10A 3MEDA 3NH1A 4DTNA 2HMIA 3BDPA 4HUFA 3ZSVA 4W5RA 3MEEA 4QQGA 1VSDA 3AO5A 4CJQA 4II1A 4QW2A 3QJ6A 1VSEA 3TANA 3ITHA 3UT1A 3BDLA 3LYIA 4M42A 4RG2A 3P8HA 5I3UA 1WJQA 2X35A 4FM1A 3K58A 4B9UA 3QNNA 4E7JA 1LV5A 3QEIA 3OQ5A 3NGYA 4FJHA 1TVRA 4FJLA 3LDSA 1S1UA 4CECA 3PO4A 2QKKA 5KH6A 2KQ2A 3RR7A 4HUGA 1WJSA 3K5LA 4CEZA 1A5XA 4JLHA 4M3XA 4QQDA 3HVTA 1NOYA 2AJQA 4KTQA 2VYTA 4OGEA 3QBYA 3LZJA 4DFJA 3VQ8A 3ZSRA 1Q9XA 2RHZA 1RDDA 2RN2A 3MXJA 4DFPA 4ELVA 2YRVA 4B9WA 1K6YA 3M8QA 3OYBA 1C1BA 3ULDA 4MQ3A 4E89A 3V9WA 4L8RB 3ZSWA 4FU6A 3L3UA 2VG6A 4CRIA 4BD3A 1SL2A 1SKRA 3DRRA 2M16A 2HHTA 4IG0A 3K5NA 2F5KA 1BL3A 4FJ8A 3O4QA 3SZ2A 4FJJA 2LRQA 1C0TA 3OYJA 3PMIA 1KVBA 5IAYA 4GVMA 4OVAA 5J1EA 4NYFA 1S6QA 4IUTA 2MWOA 4C5EA 5KE3A 1RTJA 4HUEA 4HHTA 3META 4CEQA 1D8YA 4M3WA 1SSFA 3C94A 1VSKA 2D5RA 4OKJA 5IN1A 4Y1CA 3D45A 3OYMA 4KV8A 5CZ2A 3NGZA 2W42A 5KCHA 2XY8A 1TAQA 3AA5X 1HQEA 2HNZA 3TAMA 4CHZA 4DS4A 2RF2A 3DB4A 3NDKA 3RMDA 1D9DA 2R5MA 1VSMA 4PQUA 2P0KA 2O4XA 3QESA 2QXFA 3AO3A 4C8OA 1XI1A 4KREA 4H4MA 1R0AA 4O5BA 2NUBA 3TAFA 1XHXA 5JS2A 4CEDA 4CHOA 1L3UA 2L8DA 4C5IA 2RJEA 2XO7A 3NFAA 4EP4A 4KHUA 4KKOA 3ZT4A 3P5JA 1QSYA 1RNHA 3V9SA 3TAEA 4KTZA 2IG0A 4LSNA 4OGCA 2QQRA 1SKWA 1QSSA 4KB0A 4C5HA 3HP6A 1EETA 4FJKA 1JKHA 4CK3A 3HJFA 4DS5A 2B4JA 4PY5A 1SV5A 4I2PA 2G3RA 1WAFA 2YV0X 4CJEA 1U04A 1ASWA 3AVJA 3AVAA 3KK3A 3THVA 3V9UA 4J2DA 4BWMA 4DSLA 3MXIA 4BACA 1D5AA 4Z4FA 1CZ9A 2LVMA 3HPHA 3T19A 4KPYA 1FKPA 4FW2A 3QEXA 4DWIA 5T7BA 4RG8A 1RBSA 4FLTA 3RRGA 3SQ1A 4FJXA 3QEVA 1NK5A 4I7FA 3VQ9A 3I8DA 1J54A 2KW4A 3DLRA 2Y1IA 4CJ3A 4Z4HA 3V9XA 5DMRA 1JLAA 3KKRA 3QETA 2KFNA 3A2FA 3U3YA 2A1RA 3T1AA 1BCOA 2D0CA 1TGOA 2FBYA 3DOLA 1U45A 3V6DA 5J2MA 3MP1A 3NTKA 4M3ZA 4A4GA 1LWCA 3KLHA 1UWBA 4KFBA 4CGFA 2D0AA 2CKKA 2K3XA 5HRPA 3L2VA 4CESA 2XDPA 3H08A 3MAQA 1RI0A 2BE2A 3CYMA 3KD5E 3AVKA 4CGJA 3U6FA 4JS4A 1Y97A 3DI6A 4RW9A 3OJUA 2Y1JA 2WACA 4WE1A 3TI0A 4KHSA 3AO4A 2RJCA 3SUQA 1X9SA 3MECA 1SL1A 1KSPA 3RR8A 3VQCA 3F73A 3HPGA 1I39A 3DLGA 4CFCA 3E9GA 1DTQA 4KO0A 4E7KA 4FJIA 4E19A 4CFDA 1NK0A 4LSLA 1OYXA 3TAQA 1KLNA 1S5JA 4IUQA 3OB9A 4HCCA 4XIUA 2JGUA 2EQMA 5HP1A 1QHTA 3HYFA 3KIOA 4E7LA 4NZGA 4Z02A 1BIUA 1VRUA 4Z0UA 3DLBA 1LW0A 1TKTA 2LSNA 4RW4A 4M3YA 3O3HA 2IDOA 3CM6A 3V81A 4FZXC 3FFIA 4CEAA 1QQCA 2EHGA 4F2RA 3MEGA 4E7IA 4B9XA 4CERA 3NBPA 4HCZA 1FK9A 2KFZA 4CHQA 4O0JA 2P1JA
chains in the Genus database with same CATH superfamily
2XHBA 5CVJA 4HBLA 1XWLA 4IEIA 4A59A 3LH5A 3D2EA 1JLGA 3DU6A 4BR5A 1SHFA 2JS2A 3CJQB 3OIOA 1W6XA 1E3HA 3J81O 1L3TA 1OQKA 3N4PA 4C0DC 4E4HA 2L3QA 1IRGA 4IPAA 2B9SA 3VQAA 4YRVA 3PIOF 2RMOA 1J6ZA 1R0CB 1JO8A 1KU3A 1YX3A 1B4AA 1K61A 4XRFA 3KP4A 4LFBK 2GWRA 1VQON 3GBQA 2YXYA 1IN5A 5K14A 2KRNA 1LVKA 1OX8A 1X43A 2DDAA 2KSSA 2KIFA 3PJRA 3HRGA 3G71A 2BW3B 3HOWJ 2LJ1A 2HMPA 1PYVA 2KLOA 2D0OA 4DTSA 3X25B 1RTIA 4E9HA 3QXEB 1YJNA 3FBNB 3AA2A 2QA4A 3CCLN 3AG2H 4CZIA 1YVUA 4UC4A 1NKCA 3ZGKA 3PIPA 3FXMA 1B9DA 2D8HA 4ESRA 2I5WA 1KYZA 3P38A 3CXCP 4AF1A 1C0FA 4CUGA 1VSHA 1PD0A 3VGLA 2JUCA 4A3IJ 3SJHA 2GWJA 1QVFP 4BQZA 2DK3A 3LDPA 4DFJA 2LTOA 1C0MA 3SI6A 1UCRA 2RNAA 4IHWA 1ZBSA 4DFKA 3KYDB 2E1MC 3KP6A 2EQKA 4XKBA 1H9TA 4RUGA 2UXBK 3BY7A 1QTMA 1VQLA 3I71A 2ZM6K 1RBUA 2BH1A 1N3CA 4UVAA 2ZJ2A 1IN4A 2XU8A 4ILGB 4EPCA 4QVZA 1LE8B 1HPMA 4PKHA 3D4VA 4AFSC 1H9GA 4CYCB 4ENNA 1X1PA 1A04A 4J7IA 1K8KA 3C7JA 1W70A 3A1PA 3VSLA 5DYMA 4KGZB 4A54A 1PM3A 4C92G 3J80O 5CIUA 3G1OA 2KP6A 4E9EA 5GAHJ 3H9QA 2O4GA 2PAVA 1O13A 3F23A 3QDKA 3OBYA 4HNUA 5EVZA 1XNIA 4RB3C 4L5IA 1MHNA 1R6RA 2K2VA 4I76A 3JAMK 2OPPA 1QVGP 4RW6A 3H9NA 4IEEA 2HQEA 1FEXA 2QWWA 1SD4A 5FFZA 2IAIA 5M1OA 3THKA 1XGOA 3PIOA 2FEIA 2R57A 1USSA 3M0RA 2DXIA 1V1CA 5FPMA 5DCMB 1KHIA 3MMVA 2JN6A 3C7NA 5FKOA 1IUYA 4FK4A 2R5ZA 2A5YB 3K9JA 1XB4A 3HSTB 3HRTA 4H5RA 2Q3SA 1XSDA 4B3AA 2OAUA 1FYNA 1QVUA 4KHNA 5IY5H 3OMCA 4F7UA 3V42A 1XCVA 4NQWA 4O3MA 4AI4A 4R1HA 3K57A 1UHMA 2XPWA 3OYFA 1D4XA 5KRSA 3DV8A 4IXAA 2WWYA 2FSWA 2ZJQL 3CG7A 1WSFA 4Q47A 3ZL7C 4JS5A 1W7PD 2QUFA 5TJJA 1Z7UA 4HV6A 1SZ2A 1FPQA 1VQ6A 1YUWA 4DQRA 3S1RJ 4JPBW 4FISA 3DXMB 4BJTA 4JKDA 3I55I 3DXJF 2YX7A 2D0BA 4BC2A 1FBQA 3A0IX 3HHGA 2LNHB 1D9FA 4CF0A 2KFDA 1SKSA 2OZSA 4B3OA 1ETKA 3CP8A 1W0HA 2GXBA 1NM1A 5IT9Z 4CJWA 2VL8A 4DZPA 3LWLA 3WGGA 3TQ7P 4PHTX 2A5WA 4BH9A 3IKTA 3DXKB 4JN4A 2QK0A 2ETJA 1IF1A 1TUDA 3V8KA 2NAZA 5AIPA 2DEUA 4LK0F 1OCPA 1VSEA 4DV2K 2J06A 4C30A 1MBFA 3QZ5B 3BF1A 3AG3H 4E7JA 2TRTA 4UOBA 2DYRH 3EN9A 1NLOC 4FJLA 3H5RA 3HSEA 4KBMB 2EBIA 5AQTA 5K5QA 3RKWA 4CZZA 4XLPF 2YJFA 3THYB 2CV2A 1M4ZA 4ELVA 3M0UA 1R4MB 4UY8O 4HA8A 4JKEA 3CCLT 3I53A 2KEAA 4AM6A 4LF4K 1KVBA 2E36A 2MLGA 4BRMA 5KE3A 1RRQA 4KV8A 3ZYYX 3MN2A 1ENHA 3TAMA 2I10A 3NDKA 1R23A 2DE0X 4KH0B 2XO7A 1BL0A 3ZX3A 5IOZA 2FX0A 4FPBA 4B1ZA 4DS5A 4JKGB 4WQ4A 3CC2I 2JXBA 3WTVC 1ASWA 3HHTB 4JKCA 4OFAA 2PUKB 2PMZN 4FW2A 2NXNB 1W36C 3BTCA 3JSOA 2CSIA 2QA4I 1DGWY 1WRJA 1TGOA 2FBYA 2STWA 3MP1A 1SHGA 1RR8C 5HLHA 1YP5A 2HFHA 1NGCA 3H08A 3EG3A 2KDZA 3F0ZA 3AO4A 1VQOI 4BU2A 1KU9A 4E6RA 3UDCA 4FWPA 4WX9A 5D4RA 4IHVA 3FRNA 3I56I 2JGUA 2VPLA 1VRUA 2AP1A 3L0QA 3E9LA 1K4SA 3JCMW 3FFIA 3IAS2 4KISA 1QE1A 3FEOA 5FKNA 3CCLI 1TK5A 1MZBA 5CR4A 3PL8A 1UUEA 2QEXQ 4DV1K 3RWUA 2EX3A 2NVYJ 1MU2A 4UNFA 1V5FA 1ZRDA 3X20B 2R0QC 4LITA 4J2AA 2NUPB 3O9SA 1IBKK 5C0MA 2HKXA 2VWJA 1IHVA 3D0SA 4IO9F 4EATA 2K4JA 3O3GA 1YWOA 3WU0A 2QW9A 2A36A 4CH7A 1YJWA 2PN6A 4CIFA 1YIJT 1K78B 2M0YA 5HNHA 5C3EJ 3RDVA 4C23A 2E4HA 4FWLA 4D0PA 2W1OA 4DA4A 1QQIA 3SUOA 4Z4EA 2XASA 4E70A 1UGPB 2M4KA 3AO2A 5D5WB 5GAOp 1TW3A 1BG3A 4GVEA 2KDSA 4FCYA 3I0XA 4L0ZB 3LP3A 1KG6A 4CJ4A 4EMKA 2QKMB 1DTTA 2I0NA 4X6AJ 3CQZJ 1JBMA 5CKDA 1YHQQ 1YJ9Q 4EW4A 4C92B 2Y31A 5EDNA 1O75A 5AJ3K 1NLPC 4M7AB 1RTDA 4M7AE 4RS8A 2QSFX 1VYTA 1WOQA 1PVSA 5BPDA 2ZXHA 1L3SA 2Q2EA 1C6VX 3D5RC 1PUFB 3NNQA 2ZJRF 4RKUE 5KYWA 3VEYA 1REVA 1FZPB 4E7SA 3TDUC 3O8VA 4IOCL 1O3RA 2BE5F 5AQVA 1OCTC 4V19S 3AVHA 3CFRA 1HMVA 4Y0WA 3M54A 1AWXA 5LL6Z 2L89A 4BQNA 3FZLA 3CCVQ 3K59A 1WHLA 3S15J 2IS2A 4DOZA 2ZJRL 1Y8RB 3MEWA 5L8RE 1VA7A 3I55Q 2OCCH 4KN4X 2Z9OA 3CW7A 1RT4A 5J26A 2ZE2A 1GDTA 2VUMJ 1TAUA 3LSMA 3JCUC 2RHUA 1R5GA 3W3CA 5M1KA 1Q82U 2FEZA 1LJ9A 3CCRQ 3AL0C 3ZCOA 3EKSA 3NWTA 1VQ9N 4WQ4C 4JKHA 5LGNA 4A3CJ 4X65K 2X4WA 1QVFS 4M3EA 3CC7T 1WSJA 5J1UA 2O8FA 2LDUA 3H0HA 1MMAA 5HRSA 3GTMJ 4ASNA 3T3FA 1NK6A 4RTTA 4B6MA 4LDUA 2G8UA 3REBB 5AZJA 1RT1A 2ZMEA 1ITYA 4OB3B 2VV5A 5CYVA 3TP3A 4Y91A 1X1CA 1QZ5A 5CO7A 2P9IB 3KHYA 5GAN8 1MJ9A 3CBMA 4KB1A 1YXQA 1RBTA 1HKBA 1SFUA 2JMCA 1S72A 4F4KA 4W5QA 1EH8A 1I94K 1JXSA 1UA0A 4DQQA 4XTWA 4DMNA 1SAUA 5GMKi 4BBSJ 2VJ4A 4HT9A 2ZD1A 4FJ7A 4NCAA 3DFGA 3BZKA 3CCYA 4E1MA 5J39A 5HRNA 4B09A 4C3JJ 5EXWA 3JCMg 3WHCA 3RVCA 2X0LA 3G71N 1OKRA 2W6LA 4Z4GA 3HSCA 2IIRA 3CMET 1NBEB 1WGSA 4FASD 4CC2A 3EYYA 2M7AA 5KVRA 1APLC 3L8BA 2WSFE 2O4IA 5CHZA 3W2AA 2DXCA 3TSQA 1TWBA 1VQMQ 2E2OA 2JA7J 4FXDA 2O9SA 4OB0B 1UAAA 3JB9D 4FOIA 1YRNB 1YQLA 3OJSA 2CGHA 1WJFA 2P5OA 2UUAK 1IRXA 3ER0A 1EP4A 1NGDA 1HA8A 5LGUA 2QA4Q 2CP5A 1JL2A 5FB2A 1WH7A 5IHNA 1MJBA 2V75A 1XTAA 1Z6RA 3HKSA 5EF6A 3RQ4A 1XC9A 3A8GB 3G1MA 2XF6A 4GKKK 2O8XA 1G4DA 4BKXA 1XGNA 3QZ9B 1R36A 4HRIA 1YFHA 3DTKA 3M8EA 1Q95G 2Z1IA 3DOKA 2R5AA 4HX7A 3OBWA 1TK0A 2CGKA 3J81K 3A5ZB 3CMAT 2IS6A 2PJRA 1L3LA 2HD0A 3TO6A 4QPOA 2LMJA 1S22A 4B3TK 4K8ZA 4M75F 1N36K 4CJQA 2RQQA 3QJ6A 1ABOA 1EF4A 3OSGA 4M42A 2X35A 1A31A 3EG9A 2QKKA 3QDFA 4K0KK 4M3XA 4YOVA 2R5YB 2JMWA 1MPGA 2PBDA 3T1YK 1KONA 3H35A 3CCVT 2RQTA 1RDDA 1K6YA 3RNJA 1R00A 2L7KA 5J1YA 4FU6A 4NUBA 1YJ9N 2F5KA 4FJ8A 5J1EA 1Z7LA 1HDPA 2V26A 5K7FA 4MLEA 4OKJA 3I56N 3DQVC 4NC8A 2JHNA 1VQKQ 3BPVA 1LWVA 4LFCK 4BNCA 1X2KA 1U78A 1MDUB 3BR1A 2RN8A 4E2FB 3FXLA 2M7BA 3VRYA 4RLFA 1QSYA 3T0YA 5BR8K 4OGCA 2AXTC 3RDIA 4FJKA 4PY5A 1M3QA 1KSWA 1WHUA 1O9SA 2NNNA 3ZMTA 1NBWA 2WADA 2CW8A 4PJOG 1PJRA 1T0JA 2HS5A 3GZ5A 1DDNA 2VQGA 3VS3A 1YVNA 2AIRB 4NL3A 3L2CA 1SD6A 4U7DA 3J7YP 4Z4HA 2ID3A 4OINF 3CCJT 3DOLA 4BRNA 5DY9A 1LWCA 3W6KB 4N4OB 2CKKA 1PDNC 4HF0A 4EA5A 4DV5K 3EUHC 2LY2A 4JAXA 3KXTA 1N34K 3VMFB 2ELKA 4LF7K 1UJ0A 3CCSN 1S5JA 4CO8A 5H6QA 4YPHA 2LT4A 3VS4A 3DLBA 5KK1A 3NPFA 2IDOA 1MBGA 3FMRA 2QQAA 3RTRA 1XD7A 3JRBA 2DM1A 4FYVB 2VVKA 2YLCA 1HJDA 1GBQA 4M3UA 3IMXA 1U8RA 2P4WA 1HQCA 3JB9G 1T7PA 3E5QA 1XMOK 1NKEA 3AGKA 3CQYA 3PY8A 5ICEA 3J7AO 4Y4RA 3A03A 4BUGA 4O6JA 2OPRA 1BKBA 4CYDA 1A5WA 4KTWA 3IAYA 1LNWA 1SRLA 4H0EA 1K6OA 3RPUA 2XC7A 4U0VA 5GJVB 1G5VA 2ZNYA 1CKBA 1IXDA 2IEKA 3LSHA 3NMZC 3LPTA 4XH4A 3NF8A 2LCCA 4QIWN 4EGYA 4FL6A 5B1BH 4QS9A 3JRHA 4V2FA 2Z1DA 2DXTA 5GPAA 4RAFA 2XY7A 2NNWA 2FBKA 3I0SA 2YNHA 1PU6A 3EFOB 1FW6A 3VTHA 3OYKA 3EGUA 1XMKA 4M78E 2AHQA 1ZC6A 1BC8C 3SD4A 2NS8A 2EFNA 2ZGYA 3BR0A 4GBQA 4XRSA 5D5VB 1TL1A 3EZ5A 4DQSA 3G25A 5F0FA 1BQMA 1DLOA 2M8GX 4LD6A 3VS2A 2FZCB 1NJYA 4K43A 1D1AA 1T33A 3JV3A 2DY4A 2VOOA 1JKQC 1KQSM 3IL2A 1W7PB 1CF7A 5M5YJ 5CR2A 4M7DB 3CCQT 3LZIA 2HVQA 3IH2A 4DTPA 4PQUA 1J9AA 3CUQA 3ID8A 1HR0K 1HJOA 3CBPA 2B86A 5JVHL 1H8AC 3QFUA 5LY3A 1RUOA 4IKFA 3T7ZA 2PMZA 4BQAA 4OMYA 1OQYA 4DU4A 4AHCA 3LALA 4ZYAA 4CJUA 1ZH5A 4L3QA 1HW5A 2FMLA 3OW2S 2BTFA 2DMNA 2QYZA 4CZHA 4FZZA 2L2OA 1TKZA 1NNEA 1WXBA 3FXJA 5F0HA 1C6VA 4DOVA 4N41A 3ENOA 4FJGA 1O3QA 4MO7A 3QYFA 4C92A 3IG1A 4ID5A 2L3DA 3WGHA 1TL3A 5ED4A 1NGFA 4MMKA 5KCMA 3O8GA 4V2SA 1R58A 3CC7A 3N5NX 4Z94A 3FHNA 4ZGDB 2ZQBA 2O8BA 1ETOA 1BYMA 1KLNA 1ZHIA 3F6OA 2IPOB 2O8FB 3V1OA 3AA4A 4BR0A 3MVPA 3W2VA 2QQ9A 1X19A 4D5CA 1MGQA 2XROA 2NNYA 2FPEA 4YOUA 1V54H 3GX4X 2JG6A 5L3CA 3I4NJ 1S6PA 4XM3A 4M73A 4LB6B 5DV5A 3CPFA 1LB2A 1K0SA 3LMMA 4C8LA 1KQ0A 2VKVA 4CDGA 1FYLA 1RCHA 4LF6K 2DRMA 2OYQA 4GV9A 1B3QA 5E79C 1R9TJ 3OR2C 5GANg 2E35A 4CJ5A 4ETSA 3B8AX 4M78G 3AVCA 3PO2J 3E9FA 5M9OA 2GUPA 4M3GA 1VQ6I 1RAAB 1WLJA 2OD5A 4H4KC 5E26A 4M7AG 1LW2A 2Q8KA 4XIDA 1TK8A 2M30A 3OS0A 1KVAA 4QS8A 1N5YA 2CZ1B 3FZVA 3NHNA 3LDLA 1H3ZA 4KMFA 4YOWA 3MN7A 1KG5A 3UA6A 4J6WA 4JZ4A 3JRGA 4K41A 2MH9A 5IOYA 2PUOB 2EWSA 2AO9A 3C4SA 2NOGA 2L02A 2X85A 1MA9B 2OTLI 2E6LA 2VGMA 3WE2A 2VBZA 3CP2A 3RR8A 4IZZA 3DLMA 2YX4A 2CU7A 4DSEA 2F1LA 3V9ZA 3H8ZA 2BGGA 3DLEA 2Q36A 1YG2A 1MSEC 1TG0A 4MNUA 1XDUA 2EGAA 5TISC 2MW8A 2VJ5A 3SQ2A 3QDRB 1YJ9I 1MUDA 3G0QA 2NOIA 3S32A 4Z4IA 3SB2A 3GBTA 2UXCK 4BRQA 1FLIA 3FIWA 2OZMA 1ZYQA 4PUSA 1R5HA 2VKDA 1FYKA 4DQ8A 1KQ9A 2W84A 4OMQA 1FSEA 4JX6A 2NRXA 1NGJA 1QW1A 1RBVA 4FWOA 3VERA 2A68F 4RMOA 1RKWA 1JL1A 4H5TA 5AQMA 2AK5A 3CCSA 4XICA 2HDAA 5KPTA 3MDQA 3OWTA 3CCVN 4FYWB 1LVAA 2LREA 4WXHA 1XUPO 3FM5A 2A6TA 1RIOH 2HDDA 3UT1A 3BDLA 5BRHA 2RC4A 3CCVA 2LRDA 4YOTA 4FWQA 1LV5A 4NB5A 3LDSA 3GNFB 4PJOF 3CUQC 4FL9A 1FP2A 2DA4A 2E70A 2C6YA 3LZJA 4M7AF 3CC2A 4RCBA 2RN2A 3MXJA 4DFPA 3G4SQ 3HHHA 4WXDA 3M8QA 3OYBA 4RTXA 5J4VA 4XQFA 4OFHA 2XF5A 3D6RA 2MK5A 1I1JA 1QZEA 4IOCF 3U1DA 2BY3A 4JI8K 2DMUA 3RQIA 3U9ZA 2PI0A 2J6OA 4R56A 1UGRB 3P4IA 4H4MA 5F27A 3NARA 1VQ7I 2VYPA 4BY6B 4GNIA 2LQNA 2CT4A 3ZT4A 3Q7BA 3ZOBA 1NYGA 4RGRA 2QQRA 5GAMe 2VLAA 2HL5C 2KT0A 2L4AA 1JUPA 4S04A 3I56A 3AVJA 3ZMDA 5GAHP 2M0CA 2R7DA 4XSXF 5LJ3e 1D5AA 1ETYA 1FKPA 4MFDA 4L9NA 2F69A 4IOAF 1ZYRF 4XK8E 3CCLA 1BI1A 2Y1IA 3CCMQ 1K9MO 1J0RA 5AQRA 4IEJA 5J2MA 1KAYA 2F7TA 4KFBA 2KRMA 1RI0A 2COBA 3U6FA 3T1BA 5CCAA 2RJCA 4AFQC 5C2DA 3SUQA 2Y4XA 3I64A 3F73A 5JLXA 1I39A 2NS0A 2WAEA 1A5JA 4OIOF 2F4MB 3DU5A 2YX6A 3SJMA 2KMTA 4KHPK 5AR0A 1QHTA 4NZGA 3G6EN 2KY9A 3H3VK 4F2RA 3FB9A 4UVCA 3O5ZA 3ZSXA 4BXXJ 3OYYA 3KZIC 5DUKA 3HGYA 2D5VA 2DFFA 3I55T 1PG5B 4A3EJ 1R5ID 1NU0A 1S1XA 2RI3A 1BA1A 4ICLA 1Y57A 1XPXA 1UAXA 5HOOA 3K0SA 1PRMC 3TARA 1M3AA 2KYMA 4CGZA 3AV9A 1O7LA 2DJIA 2HXIA 3SYZA 2BZTA 2DA2A 5CVRA 3JB9H 2QGFB 3LP0A 1ZA2B 2DXBA 4EJTA 1P92A 3HL8A 2LLKA 3MX2A 4LUEA 3VF4A 5D6YA 3JSMA 1A6IA 4OJRA 3OY9A 1FSHA 3QERA 4M4ZA 3CQTA 3QQAA 3QNOA 4WCIA 5BPMA 4Y92A 5GADP 1JCFA 3CF5F 1IAWA 3GL1A 4FQGA 2CGLA 4BUPA 4UB6C 3VSKA 2BE9B 3CC4A 1R1TA 3VODA 2QKLB 2KJBA 3DP7A 4KHYA 1KQ8A 1FBSA 1Z9ZA 4KICA 3CQ8A 3E5UA 2UXNA 2ZXWH 1W1WE 4M7DA 2X4YA 1V76A 4MO4A 1S3JA 2BY1A 3ZQFA 1VQ5Q 5I22A 1Z26A 1OH8A 3HSFA 3FJPA 4XMYA 1WJBA 4L9JA 3PQJA 2VODA 2EAYA 2NRHA 1OV3A 2P9SA 1PHTA 1W36D 2IGOA 4RAZA 4CI6A 1GFCA 3Q3SA 4II3A 4FVMA 1F1ZA 2NVQJ 1AWOA 2Z2SB 1FMKA 2IVOA 2FF6A 2E5LK 1QVFM 2ICWG 1QP3A 4AHTA 3LP1A 5GANj 3CDLA 4KHQA 4BWJA 2OTLA 4XU0A 4RCHA 5HY6A 1BW6A 2KYBA 1HSTA 1LDJA 4IIMA 1N78A 4M3DA 4BG8A 2JZYA 2QA4T 4IHXA 1GOBA 1TKXA 1UGQB 1EJ9A 4B9SA 1GHCA 4AG2C 5AN4A 2MD0A 2SRCA 1YTUA 3SCXA 3VQ6A 4UY8I 2M51A 1GLBG 5HS7A 3VYTB 3WU2C 3SPYA 2BXYA 3NGIA 1QZZA 2L01A 3ULEA 4IO9L 3BF3A 3P8DA 2HYFA 5KYYA 3FMSA 2JWLA 2H3GX 1AKHB 2E8AA 3OS5A 4BC4A 2OUMA 2A0FB 3DMJA 2CUFA 3D0PA 2BXZA 2EB7A 2CH6A 4HPQA 1WHHA 2RKHA 2G0EA 1G59A 5CQXA 2GV9A 3CCSI 3EG2A 4M7AD 1T44A 1YHQT 4FK0A 1REPC 1A35A 3MWMA 4WFBL 3HEFA 2DL8A 2P0QA 4YY3K 2Q0RA 1NKBA 3K4CA 2ENMA 2K85A 1HNVA 4CIEA 4OVLA 3SYTA 2R7SA 2Q31A 2FBVA 2R7QA 3U1KA 2FNAA 2R58A 4R0KA 4UUSB 1VQKT 1USTA 2R3SA 3PO3J 2D0QB 3R0JA 3FISA 3TGNA 1JLCA 5EU7A 5DM7R 5KPRA 1VZ0A 5HBMA 1J7KA 1M3BA 4IDKA 4OWRB 2VXFA 4OB2B 2PBIA 3BOQA 3E7LA 3OOPA 2M1BA 1K8AU 4C0FA 2DK5A 3IRRA 1U1TA 4DU3A 2O8DA 2D9TA 1JRIA 5B66C 2EW3A 4AD9A 2GAUA 3M8SA 4M7DD 2FBTA 3BT9A 3MCPA 3MO8A 3VEZA 3DB3A 3K1MA 2EA4A 4MLHA 4IHSA 5E18F 3LH0A 2YLBA 2P9PA 4I6MB 2ZWHA 2XHKA 3J80Z 2YRDA 2LT1A 2LP5A 2VQCA 1Y39A 5E3NA 4NS5A 3F22A 2A6HF 2XY6A 4Y33A 3L2WA 4BI8B 1N25A 5J6XA 3PX4A 1NGNA 3WXJA 3S2HJ 3ZEUA 5SZTA 1ODDA 5GAN6 3T69A 1WLPB 4RDUA 2VKNA 2CDTA 4M7DC 4DTNA 5GAMg 3CJNA 1BB9A 3K4NA 3LFUA 3JCMX 2KE9A 2EYYA 4IRHA 4FJHA 1UGVA 2PFBA 1N75A 1SVLA 5LEKA 4EIKA 3WTUC 3SZPA 3V9WA 1D0YA 2WV1A 2R7UA 3A5LC 5EOYA 3CCEN 1IGQA 1BL3A 3ZETB 1Y0MA 3RMCA 1YS7A 2MWOA 2OJED 5HROA 5IP7J 2J4RA 2X9DA 1LEBA 4M7AA 5E1ZB 4L9TA 2QXFA 4C8OA 3E1YA 1BI2A 2V1XA 2VT3A 4CZMA 1E3OC 1R0AA 4DJAA 1XHXA 4H0OA 1MNMC 4ILJA 5IPAA 1WI9A 3UB5A 4YTLA 4EIAA 3TAEA 1SKWA 1I3QJ 1VQ5N 3T5XA 2QM3A 2V79A 4CZCA 1D3YA 4AWXB 1G3WA 3THVA 5DCFA 3C2GA 3HOSA 4Z4FA 3URGA 4M9XA 2D1XA 4RG8A 1F5TA 1U3OA 2VBXA 3EGXB 3AG1H 4EMGA 2CT3A 5JR3A 2CZ0B 4MTDA 2K86A 4F7UE 5FPDA 2RE2A 2RV8A 1UWBA 1YOVB 3CCQQ 2LBFA 2BE2A 2EV0A 1NJIO 4RW9A 5LJ3d 4WE1A 1D1BA 4ZGJB 3DLGA 1OYXA 2ADUA 1KYWA 4IUQA 4LC9B 4XIUA 4BXUA 5HP1A 3I33A 4M63C 5AZJB 4MDWA 1QVGA 1UEBA 5H1SQ 4M77F 3MEGA 4O0JA 2ESWA 3VF6A 1OEBA 3L2QA 4RB2C 3SAHA 2CWEA 2XPUA 2FHDA 3W0LA 4AIJA 3H1CA 4ENMA 2QBYB 4FSVA 4A0XA 4L0YB 2O9LA 3M4YA 3M8RA 5A0GA 1WJDA 4KGXB 4JI5K 4N9HA 3F70A 1NM7A 1I4K1 4CC7A 1YJNQ 1WSGA 3VQPA 3E0JB 4XU3A 4O5FA 4UQGA 2UUCK 1S72Q 1RDCA 2WUSA 1P2FA 4FZYA 5IH2A 1WSHA 2KRFA 3GDQA 1CXUA 1VQOQ 2EV5A 3K4JA 2DA5A 2IVWA 2E2QA 3ZX2A 5ADXA 1D1CA 4F7UB 1Q82O 4FE7A 1TS9A 4C8MA 2MA3A 3I59A 4DSKA 1KU2A 1GXPA 2CUEA 3H1QA 1V55H 3ZPLA 2X6SA 2EKHA 2FPDA 2DA9A 3QO9A 1EKEA 1S6LA 1FJLA 1OJLA 2DIQA 3HIFA 2HDWA 4MGRA 1RUWA 4XOPA 5EY4A 5HCKA 1VQLQ 3HJEA 4CD3A 2FUG2 1VTNC 2HW3A 5GANh 2IS3A 2P9NA 2K6DA 1QVPA 1OI1A 2QCOA 1FC3A 1NTCA 2HBJA 2K5LA 3ZSQA 3G4SI 2BIVA 4NL2A 1SQKA 3FXQA 1R7JA 4K25A 3FJ5A 2DETA 2LVSA 3IHUA 3E66A 4BRGA 4FJ9A 4K2EA 4GY5A 1SAXA 2QEXT 1YITA 3JCMV 1E17A 2QF7A 4C92E 2B5JA 1LWYA 5ILVA 3KTUA 3KWIA 1GVDA 2NRWA 2XD0A 2G8WA 4M41A 1RT5A 4KGVB 3JRFA 1BOTO 3SV4A 1GVJA 4HV5A 4M7AC 4LD5A 4F2SA 4EEFG 5BREA 2GFAA 1SS6A 2VN2A 3HVRA 1Z91A 3M58A 2HVRA 1AZEA 4A0YA 1IGUA 2M1HA 5ECAA 2IAJA 2KLAA 3BW1A 3Q0WA 4JI0K 1Z67A 2H27A 2NUTB 3VQQA 4L6V5 2X6WA 1ZBJA 1YJ9T 3ZMSA 1X6OA 4BVOA 3REOA 4EM2A 4QVDA 1MD0A 3FXKA 4FSXA 2DERA 4XNFA 5F08A 4A4KA 4ITVA 3ZT2A 1GOAA 4ENJA 2DMTA 1BJAA 4LIVA 5J3BA 2GM4A 3S3OA 3ECOA 4ZDOA 5LJ3g 3JB9J 1BISA 3M8FA 1ZSZC 6AT1B 1XOVA 3KEQA 4KIGA 1FXXA 1OOTA 3CPWP 4GLMA 4FJNA 4ELUA 3K1PA 1ATNA 4WF2A 1ZKGA 4LUDA 3TSWA 1LOTB 1K78A 2XV4S 3IH3A 1MKMA 5FLXK 2WONA 3SFZA 3DPUA 4JD2A 4DF8A 2XF7A 4RGXA 4ISGA 1ZSZB 2RD1A 3ZSYA 1K9MU 3PV8A 1GOCA 1QU3A 2IXSA 4DTMA 4OPHA 4FLYA 4Y15A 3CWTA 3LGFA 3M9AA 3VEXA 1WWXA 4I99C 2QDLA 2K40A 1YIJQ 2GX9A 3DF8A 1NPRA 3VPZA 3ESWB 5GTHC 4AIHA 3F2KA 2X6NA 4HCBA 3L42A 4LH5A 2Q97A 2HCKA 3JXUA 4FLVA 2I7NA 3P9KA 3X28B 4EMKC 4XK4A 2A3LA 4UUTA 2COWA 3T8TA 2O4XB 2F48A 1S1TA 4CXFA 4HXJA 1ZELA 1KK7A 3GF2A 3AFHA 4CCNA 2R7OA 3M56A 1VQ6Q 2YKNA 3VRZA 1W7AA 2VCPA 4LD0A 3UKRA 1VQ5I 2MWPA 2QVOA 3I0WA 3O1BA 5KGXA 2CYZB 1S72N 3EFOA 1ASUA 2RQRA 2DJZA 4YNQA 5GINA 3J7ZI 3CC4T 3VQ7A 4LG0A 2K9LA 3LSGA 5A0LA 4F7ZA 4DYCA 5JVGF 1K1ZA 3LYIA 4M7YA 2E5KA 5GAOl 1FMVA 3JRDA 2VC1A 1FP1D 4HUGA 2OTJA 1BI0A 3CESA 3QBYA 4B9WA 1SKRA 1Y0NA 4BJ5C 3SZ2A 3KLOA 5GAMd 3A01B 1Z1DA 1KXPA 3PVQA 3CCJI 4X66K 1E3PA 2HNZA 1NJIU 2WY8Q 2W24A 2P9PB 3EE9A 2QENA 2V1QA 4PKGA 2RA2A 2Q2EB 4PJOB 4CEDA 1R4NB 3VEOA 2L8DA 4KHUA 2LZ6B 2A69F 2WAFA 2CV1A 2XHIA 2B63J 2O2OA 1R8OB 2E71A 1JKHA 3ZBDA 5GMKe 1WAFA 1NMDA 1WYXA 3I35A 3AVAA 4IIOA 3S14J 4DSLA 5C15A 2YCHA 3ZQQA 3CWUA 3NQOA 4FT2A 1RBSA 2HOTA 3VYSB 5IWAK 4K11A 1Y0UA 3S1QJ 3DLLF 3U3YA 3T8RA 5AZIB 2KIUA 1YQMA 2UUBK 3SZTA 2O8BB 1HSJA 4V2GA 3RSEB 2BW3A 1OVQA 2O8CB 3MHXA 1KSPA 4KNYA 1S8NA 4E19A 2HSTA 2Y69H 4LSLA 3OW2A 3MWTA 2GWKA 4ZYEA 4Z02A 3S16J 2NOFA 4RW4A 2EZLA 3CM6A 1EV7A 5LHGA 4XH5A 3A8LB 2V8KA 4D8KA 1NGHA 1LCUA 2GA1A 1YITI 5CKFA 2HVIA 2FU4A 1ONVA 2P9LA 4XRSG 3E6BA 1TTHB 3ZQ7A 1FKOA 3V8JA 3HSBA 1KCFA 2QK9A 5FKMA 1NGBA 3KD1E 2QSHX 3S6IA 5K5OA 1B8IA 1N5ZA 1U2WA 3T1HK 2WC9A 4BYYA 5E3MA 3PX6A 1VHXA 5EYRA 5JFRA 1ORPA 3OSSC 3I4MJ 3FC3A 2ITGA 1QMCA 2LD5A 1XC5A 1R1UA 4BI3A 5E1XA 1XNRK 2KT8A 1B9FA 2MD5A 3I9QA 3WODF 1WKMA 4CFAA 4PIIA 5GTIC 2QWQA 3VEPA 1WFWA 3H6EA 3MP6A 1RGIA 3K10A 1PKTA 2JTFA 1PD1A 1V4TA 5GMKj 1OPKA 1ZAOA 1ACIA 3CCST 5CY4A 2F5EA 4FX4A 1VQ7T 1NJIC 3VF2A 2A3SA 1OH6A 1MH3A 1FYMA 3HXMA 5B1AH 1J53A 4C2UA 2HQAA 1K8AC 2A1SA 2EYZA 3CPWS 1WXUA 1MUYA 2P9KB 2W48A 3MN5A 3NE6A 1OPCA 3HC7A 3MKLA 1YITT 2CGJA 4NLCA 1NK4A 1H8KA 2FRYA 5K7HA 3WNHA 3C7NB 3HPOA 1NK9A 4BRIA 2RDPA 1WDXA 1X3UA 5CYMA 2HNHA 1M90O 1N8RR 1I1GA 3M3YJ 2HHXA 2ZPHB 2WV0A 1RC9A 1R22A 3QU3A 2ITMA 2D45A 3I54A 4A2UA 3A2KA 1Y71A 1QS4A 2IOCA 2Z1GA 3GTPJ 1PSEA 1M1EB 4PLLA 2IJLA 5HS8A 1C0GA 1TTYA 2DJNA 3O2PE 8ATCB 1F36A 3I56T 1X4PA 2RVCA 5BPLA 2YUOA 4DBQA 3VUBA 4EZ6A 3E5XA 2QM1A 2JVHA 1T6DA 4F8RA 3JYTA 5HLIA 2CGPA 2E5NA 4HKEA 3PIOL 3ASMA 2OZUA 3HDDA 2JQ7A 4CJ7A 1RDBA 3IWFA 3NH0A 3SV3A 2WAQA 1C0UA 1BI4B 4RTFD 4HT8A 1GLEG 4IFYA 4HVUA 3PM1A 1VIFA 2KBTA 4JJCA 2P9KA 3E19A 2Z16A 3CMEN 2IA1A 3V1RA 2Y90A 4TVRA 5FD5A 4AILC 1QCFA 3NRVA 2L54A 5E20A 1ABQA 5E8GA 2DAQA 4HG2A 1WFXA 3T9NA 3CFOA 2RKIA 1FY7A 1QPIA 1IDZA 4EVVA 4FETA 2DNUA 1NGAA 2F5CA 4KN7X 3FGUA 1R71A 5KYNA 3WQUA 3ABLH 1T3LA 2IGNA 2E3IA 2RQUA 3WVDB 4D9JA 4A93J 3KTQA 5D4SA 2G8KA 4WTOB 3CBOA 4A3DJ 3B6AA 2K5CA 2O03A 3PE0A 3F6VA 1YJNI 3E6DA 4NQWB 1I1SA 2MSYA 1P90A 2YU3A 3L7WA 2VQFK 4P55A 1S7EA 2M45A 4CJSA 1FT9A 1XQSC 3MAJA 3DBLB 4JUVA 2AZVA 4J9BA 2YNGA 5GAN3 4DFMA 4KRTA 2BOLA 2VE8A 1IREB 5CKHA 5AQIA 5F1XA 3KLIA 4M77D 2JM9A 2K3PA 3DXMA 5K7ZA 4J5YA 3OL4A 1ARKA 1DGRM 4B3RK 1GV5A 2BTTA 2VI6A 2JS0A 4MLOA 4B22A 4HVJA 1VQLI 4JJBA 2RHIA 1I5OB 2XVCA 1W7PA 3F10A 4OO1J 1FN7A 1I07A 4IOXA 1P4WA 3MP8A 5K1YA 2VXDA 4RM2A 5F04A 1OYIA 3G4SN 2PVGB 4B8CA 5C24A 3BG5A 1YITQ 4IJNA 3F8FA 3CC2Q 3HOYJ 4KJZA 3ZSVA 2GQVA 3RMSA 2COYA 1BI3A 2PQ8A 3K69A 2LKXA 2HTSA 4F3QA 3LSKA 1UDLA 1WJQA 2JK3A 4PJMA 1RKTA 3K58A 4B9UA 4B43A 4J9GA 1YW9A 3FX3A 1S1UA 1N33K 1DU6A 1WPKA 2IVMA 3CMMA 5J47A 3H0IA 3CC4Q 4YOXA 5ADXH 2EZHA 2CUJA 4JP0A 5H20A 2IS4A 1KG2A 4LN2A 4M75G 1BIBA 4C5EA 1D8YA 3O6WA 3ZN0A 2W42A 4JZ3A 3TEEA 3IV5A 1TAQA 5BNGA 4CBWA 2O4XA 5IT9K 2V8JA 1D3BA 2P9UB 5FLMJ 1VQPA 4C92C 4NHJA 4KB0A 3HXLA 3HJFA 3IFRA 4KYWA 3ATUA 2RREA 3BJAA 1PC0A 1RABB 4AQYK 1K76A 3EZWA 3QEXA 2V9PA 4V19K 3QEVA 1ZUKA 3V7RA 3M5AA 1TQMA 4BY1J 3SAGA 3R60A 2LF8A 3JRZA 5I21A 4CESA 3CCUQ 3GTJJ 1Y96B 4BRCA 1X9SA 4H5WA 1AKHA 2E2IJ 2PVOB 1MH4A 3GZ6A 4CZJA 5JMVA 5DDGA 3WU1B 4FZXC 2P4TA 2UZKA 4C8QE 4O5VA 4BHBA 4GMJB 2G9WA 1XQPA 4DTJA 1Z9QA 5EG0B 1NLVA 3QKJA 3K5OA 3VJPA 2E64A 3KLGA 1XG7A 2DD5A 2NVUB 1OU8A 1YW7A 5EEHA 1KQJA 4H0XB 4C8QF 3BTIA 3TDZC 5AQZA 3GTQJ 1QP2A 4JKFA 2DYBA 4M9ZA 3SUNA 3RESA 1UA1A 5FDLA 2X3WD 2DIGA 3ME9A 5J40A 2XRLA 4O55A 3R61A 1PWTA 5ELZA 1G83A 3ZT3A 2Z99A 2BUPA 2D1VA 1TWFJ 4ILHA 4HWIA 3L9FA 2E4LA 3CCRN 4X0GA 4KAZA 3RCOA 2DLLA 1VQ7N 1X27A 2ID6A 1LQ1A 4BJ6C 3HUGA 1YTAA 3ISPA 5DEQA 3BQZA 1YI2Q 5BPNA 2A08A 3M0SA 1HC8A 2O8EA 1A6QA 5FRNA 1RRSA 2H94A 1AOYA 4IFEA 3O3FA 2GXGA 4MMLA 5LGTA 1TWHJ 5GPCA 1M1KU 4YPRA 4CJKA 3PIPF 2CZ7B 1ZBUA 4OIPF 1I3AA 2P84A 1OR7A 4HSTA 3ZQIA 1PUFA 1TNTA 1TT5B 5LJ3h 4QLCU 2V51B 1HD3A 1IO2A 4NYNA 4DTUA 4B9LA 2QSGX 2DFEA 2O61A 2IGKA 4CI0C 2HSEB 3S8PA 1H0MA 1CSKA 2KQRA 4JRPA 2HVSA 3AAFA 5HK3A 3CMEQ 4IX7A 4ZTFA 4XTUA 3HT3A 4ID1A 2XRIA 5GADJ 2JRMA 2YSRA 2DBMA 1MBJA 1M5Q1 4JYKA 3LNQA 2YUQA 3WTZA 3K4BA 4DU1A 4WFAL 3SDZA 1M30A 2W0ZA 1OYWA 2KVQG 2RNJA 4IRGA 2L3RA 2RO0A 2JNGA 4PJNA 1IG7A 3SHWA 4H4OA 1DKGD 3ZMZA 5FLVA 5JVTA 4IFVA 1K0XA 3TSUA 1ZGAA 2BGCA 2CUZA 3VQBA 2FG0A 2I5JA 3BR2A 3CC4N 2YKMA 3ZQHA 3UIQA 3R2XC 4UXNA 3EE8A 4E47A 2YHAA 2HNYA 1KG4A 4N4IA 4I02A 3KLFA 4FWSA 3Q9SA 4QPQA 4IBNA 4C8NA 3CMAQ 3V7CA 3CC7Q 3VQEA 5A2QZ 3QP6A 2XAQA 3QPSA 5KYXB 2ZJPF 3RMBA 4RGUA 1JQQA 1DJ7B 2NOJB 2H56A 1WHKA 2LDMA 4HNTA 1BM9A 3QEPA 3S2WA 3OYHA 1JE8A 2XAHA 4JHDA 4ZNXA 1L3VA 4EJZA 3J8AA 4HQEA 4JRKA 2JTVA 3IS9A 4CF9A 1JKRC 3G73A 2F8TA 3RZDJ 3QWYA 1JTYA 2YHXA 2P8TA 3EGXA 2ZF5O 1Q7YO 1SUQA 1Q86C 1KHCA 4DTRA 3CPEA 1BI4A 1Z25A 5CQGA 5AQYA 1VSFA 2RQPA 2DN0A 4N56A 3ERMA 3P7NA 2KTQA 4KH5A 1K73C 1TQIA 2E6MA 5HODA 4BDYA 4DG1A 1N8RU 1OH7A 4F17A 1JJ2A 2FC0A 4O0IA 2R7FA 4M75B 3VETA 5HLGA 1QNTA 3H5AA 1UTIA 4E1JA 2XPVA 4OIRF 4BS9A 2RHXA 4CJRA 3MN9A 2EZKA 2HNDA 2HQ5A 4B21A 1XQHA 1ZR4A 3CJBA 2GF7A 3VFZA 2GEMA 2FOWA 3UATA 2QLZA 3ZLJA 3TQNA 2X4JA 4XU1A 4JHDB 2KRHA 1IJWC 4H8KA 1F43A 4L18B 2R7RA 4N4GA 3IUCA 4W5RA 3BE3A 5ERIA 3HM8A 2ROLA 1QHGA 2L9VA 2QDYB 2M5WA 4FM1A 1U8BA 1KD1R 4WQ5C 3P31A 1LOJA 1BK2A 4KTQA 4BHPA 3VQ8A 3O08A 2XUBA 2YRVA 2R5YA 3G1JA 1C1BA 2LKPA 3RKQA 3A4CA 4IG0A 3SZGA 5EJCA 5F6FA 2LQ8A 5GAOq 2V6EA 4FVUA 4Y1CA 5KCHA 1HQEA 2P9UA 1VQNT 5LJ5f 3AO3A 2RF0A 1VQ8N 1XI1A 1RAFB 3LL7A 2BEOA 4OFEA 2P0WA 4C5IA 2RJEA 1G3YA 5IHKA 4P9UA 3M59A 4RAYA 4A62A 3JTHA 3O5BA 2EIMH 3CCQA 4G6QA 5T7BA 4FJXA 3EFRA 4G7OF 3QETA 5FU6B 2KKZA 3A2FA 2A1RA 1UJ8A 4M7DF 2XHCA 4B1VA 2OTLT 1GLAG 1GXQA 3P9CA 1YBYA 1X3WB 5E3OA 2JM8A 1X3MA 1JT0A 4C8QD 1VAZA 3VYRB 3EG9B 3CCRI 4ZYGA 5TKYA 3R4KA 2E2PA 4GY2B 2K9GA 4A63B 3RR6A 4FJIA 3HTSB 4CFDA 2ZPGB 2L9SA 3DJCA 1MBHA 2X1EA 4KHWA 5FO5A 2W10A 3VS5A 2DTRA 2IRFG 3TSPA 5GAMf 1ATSA 5IT9O 4E7IA 2XDDA 2K02A 3HO1A 4NDLA 3LGLA 2QKBA 1K79A 4RMNA 1HKTA 3CCUT 3LSPA 2IW5A 2FZKB 1BUPA 4J2BA 2QWMA 1IRFA 2Y2ZA 4C8QC 4JKAA 4DSFA 4A4FA 1VQ9T 5M5WJ 1H641 2RI2A 5I11A 1UHWA 2EBPA 3CXCM 1RTHA 4D7NA 1B34A 4C92D 4F93B 1W2BM 4DQPA 3CLOA 4E6KG 4ORZA 1W9HA 3H6ZA 1M90U 4KUMA 1X2QA 1VYUA 2B6AA 3QYBA 4IUVA 2V1DA 2M2EA 1SMYF 3I0TA 3COAC 2P5LC 3C0CA 3TBIA 1WI7A 1X01A 2OFKA 1Y56A 5C10A 1N27A 3WVEB 2VJIA 3GBGA 1PNJA 4FIBA 1W0TA 4OKEA 3DPLC 2Y4YA 4KH6A 2H1KA 1YQRA 2B7EA 4IUUA 2V9KA 5AIQA 3NTHA 2C06A 5E1WA 4AMCA 1HW2A 2E1MB 5TGTA 3H3NO 3RI4A 1JHHA 3P9IA 1O57A 5GMKm 2Y75A 1ZLKA 1Y1VJ 4CE9A 4A61A 3E6CC 1CF7B 5FKKA 2DPPB 3ALYA 5GAN7 2EV6A 3L09A 3FKIJ 4B47A 3KYLA 2YHBA 4BQLA 4I2QA 2EQRA 2EIFA 2IVPA 1QWFA 1QQOA 4XKCA 3I0RA 3NVKA 3KCCA 1LNXA 3MPUB 2P7VB 4WXCA 5F64A 3CTAA 1U47A 4N4HA 2X74A 5KCOA 4HOBA 2F5DA 3DRPA 2VWBA 3KETA 2KK4A 4X62K 3PNWC 3EGDA 3TVTA 1HW1A 3M1EA 4BY7J 1DU0A 3SJJA 5AQNA 2VG7A 2E7WA 3VB2A 2QWOA 1P4AA 4DEXA 1SFOJ 3SMPA 2OTJQ 1VQOT 1EH6A 2AQEA 2ZSHB 1ZBXA 1Q86U 2KZMA 1IDYA 3BDUA 2Z1JA 3LL3A 2XKOA 2ZSIB 2JVGA 3CC2N 2M87A 2OTLQ 3K4MA 2M0OA 4QS7A 5TKWA 5CYQA 1MGTA 4B3XA 4II2A 4A3MJ 2FBHA 5LJWA 5LJVA 1LCKA 3OYCA 3SBTA 1N6QA 4IURA 3BCAA 4LLGF 1SEUA 4J83A 4UNOA 3DLLA 1AD5A 3F3XA 1JB0E 1G15A 3LSRA 3BCBA 1NJIR 2PEXA 2BKDN 3KK1A 2YWWA 1B6AA 5LJ3j 1KQSA 1RI9A 2YG9A 1U0JA 4EM0B 1KC8R 2RK2A 1Z77A 2JA2A 1C1CA 2WTEA 2KHOA 3TOBA 3O9TA 1D0ZA 3K5MA 3CVSA 3S2DJ 3S3NA 1Y7XA 1RUNA 4C8QA 5AONA 4UV9A 4VUBA 1W5TA 1X3NA 2LR8A 3TKYA 5C44J 3GMEA 3O6BB 3SPZA 4DV6K 4CZKA 4B44A 3THXA 2XSJC 1E7OA 4IQ4A 2K5FA 5M3MJ 1GV2A 2JOYA 3QJYA 1K73R 2E5QA 2HBMA 2DT7B 2K9QA 2DLPA 2FLOA 2Q0OA 2QWLA 3EFSA 4ZHRA 3NH2A 4AM3A 5LLQA 5DS9A 4ELZC 1JKPC 2H3JA 1VQNI 4JLIA 3V4IA 4NC6A 4BB7A 3TCJA 2BZYA 5LRSA 4CBUA 2KL4A 5LHIA 3NHGA 2NOEA 3EQLF 3OH9A 1U06A 1XJWB 1DPRA 4XTXA 1WEGA 3C0BA 2HF3A 3B6PA 3NH1A 2Y0SN 1VI0A 3MEEA 4QQGA 1VSDA 3AO5A 5BMZA 3SXYA 3P8HA 1HKQA 2CQ7A 3QNNA 4BR7A 3HZJA 4Z88A 3RR7A 4Q4ZF 1ZTRA 1HCRA 3CCEQ 3TP0A 1B07A 1KZHA 4FT8A 4KIFA 4J9IA 2VG6A 4BD3A 1R49A 3DRRA 1YHQN 3GWZA 1ZK8A 4GVMA 2XAGA 5IYDJ 3LM2A 4NYFA 2FNPA 2GXAA 2AS5F 4CCKA 2D5RA 3FXRA 3D45A 3NGZA 2XY8A 2W6KA 3OH6A 4KULA 2ZJQF 1LWWA 1D9DA 1VSMA 4KREA 3AAQA 5AQOA 2NUBA 1E2XA 4KH4A 1WVRA 2HR3A 1L3UA 4HQMA 1YW8A 3J7AY 4M77A 4K42A 3EH2A 1T38A 3I5UA 3F21A 4IJAA 1SV5A 3GCMA 4I2PA 3H3UA 1U04A 3KK3A 3CMAN 1QO0D 3VV0A 3VS0A 1Z9CA 1TH7A 3RRGA 1VQ9I 3CMAA 3PFIA 1NK5A 5LJ5h 5D5UB 4M6VA 1MIJA 1JLAA 4XR6A 4KA4A 4C9YA 2VIXA 1ZXOA 1Y07A 5GANe 1BCOA 3ABUA 3H5NA 3I8BA 3BR3A 4CGFA 5BS6A 2KGTA 2DL7A 1TWCJ 2BBYA 3L1AA 4ENKA 1QQNA 3W3DA 1TWAJ 2ZPIB 2V1UA 4P96A 5M1PA 1NK0A 2EIJH 3A0HC 1RRJA 2QTDA 1TKTA 4U88A 1S72I 1KEAA 1ZSZA 1IBLK 1DQUA 4JK1X 2K79A 2CH0A 4B9XA 4HCZA 2RQWA 5LHHA 1YAGA 2JVVA 1XCBA 2EQJA 2FSJA 1V4SA 1I8FA 1NG7A 2F96A 2RB6A 1KC8C 3SEQA 3HZ6A 3KUFA 3BG6A 5DTDA 1ATRA 2P7CB 2FBXA 1RBRA 4A3KJ 3M3ZA 1MBEA 3JSCA 4J9EA 1YN8A 4CIGA 3MX5A 2O01E 2JJ9A 5CPRB 1IKVA 4CEBA 4I6ZA 1E3MA 2GNCA 1ASVA 3M4OJ 2NUZA 2FSNA 3DM2A 2F9WA 5BPIA 3CCJN 4BR2A 1VSJA 3K2PA 1TL8A 2ZPBB 2F4OB 4EDUA 4A6DA 2G6FX 4C8KA 2XI9A 1TWGJ 2B8AA 3S9HA 4M7DE 2D1KA 5KTQA 4G9ZA 3BFMA 3GOIA 3O8MA 1MMDA 4GRIA 4QWQA 1RT7A 4AUXA 5DK5A 4GV3A 4W97A 3OMYA 3CCUI 5BRFA 4ZDPA 4MQVA 3RKXA 2A28A 3L3VA 3FZKA 2HHSA 3DTEA 1ZGWA 2QYOA 2RNGA 1BGXT 4LXCA 4CW7B 2ZCWA 1U5TC 5K5RA 3KLNA 4ZN1A 5JVGL 4DV3K 5EZGA 3JCMb 1T95A 2JPCA 2QGGA 5CVIA 2X3XD 5EEGA 2WB1N 2LJ3A 1ETQA 1ZGJA 2FO0A 5D6WA 1ORKA 2HDCA 2A42A 4DR7K 3RERA 4PJOD 4FYXB 1R77A 3MJXA 4FYYB 5FLXO 1T0HA 4RW7A 4I9LA 4BL0B 2YNFA 3ZMUA 3ZT1A 2IA0A 1U48A 2K9NA 4BEHA 2PLYA 1TUYA 1KG3A 3CCLQ 3RUXA 2AT1B 3EGDB 4WCGA 3TMOA 2DL5A 1BA0A 3GEZA 2VUBA 2J5OA 2GBZA 4FWMA 4NLBA 4A4HA 1E4FT 3AVNA 2XIDA 2K3YA 3QO3A 4M77C 2V6CA 4JX4A 4BE2A 3J80E 3ELKA 4TSXA 4S0HB 2NRVA 2AXLA 1IW7F 1J3TA 2E1ZA 3QBXA 2KXDA 5HDNA 1WNSA 4LOCA 4IUPA 1KFSA 3L2UA 4AI5A 4DR3K 3QIPA 3JAMZ 3BG3A 2M0MA 3ZQGA 4C0ZA 1BO5O 4DHYA 1B1BA 3LLRA 1OX9A 4E0DA 2SEMA 4LDXA 4PSXA 3MEUA 5AFUH 2ZO4A 2NYXA 1G8XA 1ZBFA 1VQPQ 3OGDA 2L0AA 2VXEA 3CMYA 3SLCA 3H9GA 2K7LA 2CQQA 1V4RA 3C95A 3E6MA 2J6KA 2KMUA 5C4JJ 2HXOA 1D8JA 3RBBB 3OYAA 1Q9YA 5F2RA 4I7HA 1YX5A 1WH5A 2RI5A 3WQTA 2DTOA 3KLEA 4DBHA 3VKIA 2DTIA 4BXFA 5J2QA 3VS1A 2G7HA 1U4BA 3DBHB 2AQFA 1CQTA 3D7SB 2L5QA 4CGGA 4IVNA 4DF4A 2VBYA 4M75D 3OW2M 1WHMA 2KKOA 1WX6A 3Q0VA 1EO1A 2KPMA 4DTXA 2ETHA 2K3FA 2E1HA 1QVGS 2QAZA 1TUCA 2Z1HA 1HYVA 1I5LA 1ERDA 1JJ2M 3ZETA 2IA2A 5C42A 1KLMA 1BOBA 4DQ2A 3HK2A 2ABKA 3SWNB 2OX7A 4CZEA 3KKSA 4C3HJ 2K27A 3JCMP 4B1XB 4DQIA 1Q81C 4MIMA 1IG9A 3MD2A 4KFCA 3WXKA 1RR7A 2ZFWA 2HYGD 3TWHA 1RLQC 3HP9A 4F91B 2VB6A 3WEEA 4KI4A 2P0PA 2EJRA 2ZAEA 2OA4A 4G1QA 2VONA 3ZP5A 4G8XA 2Q2RA 1L0OC 1CZAN 1HLUA 2ZMEB 4B24A 5AQLA 4XOTA 1OZ2A 1QQJA 4E7HA 1P9QC 5L3BA 4J6YA 3BDPA 2AZSA 1U3EM 4RGSA 5J8FA 2K3BA 4UV8A 4NO7A 4LMYA 4OGEA 2NRRA 1LEAA 2EWNA 1QA6A 4DBFA 4H0TB 2O3FA 1EIFA 3IP4B 3CCQI 1I27A 2V1NA 1D09B 1SL2A 4E9GA 1AWWA 3QOEA 4OVAA 1F1BB 1S5LC 1S6QA 3META 4A6EA 3KFWX 4AIAA 3X26B 2KXCA 4CD1A 2K9MA 5FD6A 3HPWA 4M75E 3ROUA 2DODA 4Q48A 5HVQC 3WEEB 5C4XJ 2RQVA 3SEZA 2MC4A 1HKSA 4PFPA 1NG9A 1RNHA 1NK2P 4DW6A 4LSNA 3WUHA 4CK3A 4KBOA 2FRWA 4OPAA 2G3RA 2V52B 3R6OA 1MUNA 3CMEA 3QB0A 2VQEK 3TU4K 1X6BA 4I7FA 1SVMA 2F2XA 2XRNA 4ANJA 3HOXJ 4BREA 1TT0A 1RDWX 3T1AA 4DV0K 2WSCE 4DUZK 1K4TA 1MDMA 2ED1A 3K4KA 4MTEA 2CZ6B 3BZ6A 1U6ZA 3DI6A 1RL2A 5FLXZ 2PJRB 1DUXC 4J7FA 2E1CA 2IBDA 2CH4A 3LA7A 1S3XA 1M2OA 1TOVA 3VEVA 1MNEA 1BIUA 2EFWA 2MI6A 3O3HA 4WWCA 2EHGA 2FF3B 1HBXG 2KFZA 2MMPA 3D5SC 3A98A 4JDSA 3V1QA 4DR4K 2QTXA 1FOXA 3BJOA 2IPQX 2QZ8A 4YDUC 4E9FA 2CUBA 2BZXA 3KWGA 3ZXSA 2FB7A 3IUOA 4CCJA 1GLCG 5FLXE 1G6NA 2EZIA 2DTUA 1VQPN 2VT2A 4DV4K 2OTJT 1V3FA 2YHTA 2PY5A 1BHLA 2ASOA 2GZWA 2EK5A 4IG3A 1S29A 2D8JA 2MH2A 2OTLN 1YJWN 4BGAA 2HHQA 2QG9B 4NCGA 4GV6A 1WJEA 1VQNQ 1N3AA 5HLFA 2HEQA 3VOEA 1VQ4Q 1VNDA 2R7VA 3F8CA 3CCUN 1NK7A 5EX5A 4I01A 4ZYDA 3CETA 5F1JA 2UV1A 4M9SA 5L3FA 1IKXA 5E84A 1TXQA 2RHYA 5BQTA 5JI6A 1IV6A 3VENA 3DLHA 3SK3A 2DO7A 5HS9A 3C6HA 1BIZA 3QEWA 3TO9A 1PUEE 2DPUA 4BRLA 5IXFA 1JHFA 2ECCA 4XTZA 1UELB 2UU9K 1Z21A 2W41A 4HSBA 2DDBA 1ZR2A 1SEMA 3PFSA 4JJDA 4I9QA 3CCVI 3GLXA 5JHFA 2G7UA 3H3ZA 1AWCA 5KGWA 3UNGC 3ENHA 5SWMA 4PUOA 1JGSA 3HTRA 3MXMA 4B9MA 1UHFA 4M3FA 7AT1B 1P7MA 3ECHA 2GTJA 1CXQA 4PJOE 4IDHA 1SRMA 2HAXA 1YI2I 5KE2A 4G6TB 2E12A 4HTUA 3ZSOA 3VA0A 1G3TA 2GTDA 3IRXA 3K6GA 3OV8A 3EHRA 3HTUA 1E0EA 2IIMA 5AQUA 1B92A 4ZJZA 4CJVA 3R6SA 2F4VK 4PJ0C 4B9NA 3TAPA 5I2MA 2ZB9A 1HKGA 1KAXA 3RJPA 4EZ9A 2OC6A 4A3GJ 1BW5A 4NOYA 4CZGA 2F5VA 4J01A 4IHYA 3WTTC 2KRSA 1W0UA 5IXBA 1LWEA 1BN5A 4KUIA 1KFDA 3LAJA 1UB4A 3G6EA 4NC7A 3EL2A 4CGDA 1AVZC 2DQLA 3LCNA 5CAIA 1P7IA 1VQMN 2CFOA 5EG0A 2IS1A 2DD4A 3L2ZA 3BY5A 4XKWA 2RJFA 5CKBA 4EHUA 3QHSA 5JICA 2CQNA 3H3OB 3A8OB 3HBTA 1AZGB 3FKJA 4A53A 3PX0A 1NJWA 2DMPA 4EJVA 1BR2A 4L5GA 3MKWB 2B0LA 4N0AC 1ETXA 3RMAA 2PZ1A 3C2HA 4PKIA 4Z4CA 4CGIA 1ZA1B 2FD5A 2EIKH 4BRAA 1YYVA 3HFNA 1UGSB 2LNVA 4OKKA 1QPMA 5A2QE 2KZVA 4QQ6A 4QAGA 4PK4A 1WNLA 2BUDA 5ICFA 4M3TA 2CSQA 3KJVA 5LJ5d 4MFBA 2MABA 3L2RA 2X78A 1YQAA 4DNCA 3THYA 4PFOA 1RILA 2NUTA 5JLHA 2Y0MA 3WXIA 4JI6K 4LLLA 2CH5A 3F5TA 1JJ6C 1L5UA 3A1YA 2COMA 5D6FA 2JA6J 4F7UF 4BQOA 3F72A 1W5SA 2IGIA 2E6ZA 4J8OA 3TREA 5CZ1A 1ZBLA 3NTIA 1NG6A 3BJ6A 4RTWA 2H1LA 2O0YA 4RTYA 1BOAA 2IGMA 2DL4A 1G3SA 2F5TX 2W00A 1DGKN 1VQKN 3CC4I 3QIIA 3IAM2 5L3GA 1WB9A 3MQ0A 2GOXB 1JUMA 1OR7C 1SANA 2CV0A 4LLNA 3MEDA 5KYUB 3CC7N 3BC8A 1T39A 5AQWA 4UHTA 4LG0B 2M8EA 5LRRA 3FBIB 3B73A 1MNDA 2DILA 2A05A 2W04A 3TPQA 2L3PA 1Z0XA 5B5EC 4G7ZF 1MV0B 2VYTA 3IDHA 3C18A 4BRHA 3DWLE 2O8DB 3FIFA 3ZSWA 3L3UA 1S72T 2HKQB 1C0TA 3ATVA 1RTJA 2KJCA 3CHWA 1VSKA 2CUDA 2MPXC 3PGGA 2NOZA 2QASA 2RF2A 1M2VB 2R5MA 3QYEA 2V7YA 4EGZA 2W85A 2HHHK 4EP4A 2LJ0A 4KKOA 1B8IB 4AVPA 2YPRA 2B4JA 3GW2A 5JHUA 3WTYC 3CJ1A 2DJQA 2YI1A 2HI3A 2KZGA 3MXIA 4OB1B 2ZCFB 2DT5A 1CZ9A 4KPYA 3NFCA 3AG4H 1XN7A 3KZZA 1H88C 3JCMe 1LFBA 3D2FA 1ZG1A 1J54A 5KYXA 4OMFB 4GGGA 4M77G 2D0CA 1TQPA 2M34A 2DL3A 2D0AA 3CJCA 1H89C 3U4LA 2FQ3A 4EV0A 1Y97A 3OJUA 1CGPA 2JT4A 3GTKJ 1M1FA 3MECA 3I58A 3QRFF 1W2BP 3RSEA 1AWJA 2KROA 2EINH 4MZMA 4JBAA 4A2AA 5L3DA 4C8QG 2A5XA 2JA5J 4AU7A 4Z0UA 1LW0A 3S41A 1I0CA 4NB4A 2H8RA 1KQ2A 4CHQA 3CO7C 2OZ6A 4GDFA 1M1KR 2EFPA 1XMAA 2X51A 2ZXJA 1D5YA 3KZYA 4HX8A 2X9HA 2RJDA 3JCMc 1Q81O 3RRHA 3CCUA 1MBKA 3K70D 5FU6C 1WHGA 1YI2A 2NZTA 4CHYA 4B23A 1PVEA 2HWVA 3HYIA 3LAMA 3VOVA 1GLLO 2LQWA 2GOMA 1SFEA 2YT6A 2PMUA 4HAMA 2DCEA 2A6EF 3CEYA 2R5ZB 3BZCA 3LSIA 2PVDB 4EJUA 2BHYA 4KRFA 2QI2A 1KD1O 4J2EA 1EA3A 5FROA 1M1GA 1EFNA 3JAMO 2EQIA 5M1NA 3OYIA 2HKOA 2YS9A 3MZHA 1VQPT 2ATCB 3G6EI 2F8SA 2R7WA 3N05A 2MCNA 1BU6O 1NG2A 4QKUA 4L5JA 5LL6S 1X69A 5GJWB 3GLLA 1KO9A 4A57A 1PSFA 2I2LA 2HBPA 1Z05A 3K2ZA 4DSJA 2QQSA 2W82A 3AA3A 1HOMA 5LD2C 4PKCC 2DBBA 3OR1C 2HVHA 2STTA 5AFUA 4EA4A 4DR2K 4Z89A 1JLQA 3KP2A 2FBIA 4WQ5A 1AT1B 4PLIA 1E6HA 3GOXA 1NGIA 2I7PA 3LANA 3LWHA 1M8VA 1J5YA 3W6JB 1VQMI 5GP9A 4CF8A 4IRIA 4ATOA 4CICA 2PX9A 1SG5A 1S9GA 2KI7A 2GLOA 1PCXA 2LKSA 2P6TA 3AARA 4JNEA 4M7DG 1GLNA 2A7YA 2EPDA 2A40A 3J7AF 1EBMA 1A36A 4XLNF 1F21A 5GIPA 3ASKA 1K8AO 3G7ZA 1FJGK 1WGXA 1ETWA 4BG9A 3ASNH 4BROA 1TP4A 1X75C 3N4MA 3TTFA 2ZPEB 3PNTA 1YJNT 4ABZA 3ULQB 1LPQA 3J81E 3J7YJ 4M74A 2OPSA 1DT9A 4ON0A 5GAMh 4F92B 5J8CA 3ID6A 1U2VA 2H6BA 3EYIA 3D5LA 1VQ6T 4OP0A 4N47A 2XGXA 4LE9A 4F16A 3UF4A 1SC7A 3BDDA 1BU1A 4Y52J 3A8MB 2CG4A 4KUDK 3CO6C 4FLZA 4BHCA 3CF5L 3M5RA 4A0ZA 3SFMA 2O88A 4AHVA 3AVLA 1ZLMA 1DP7P 2KNBB 3AHUA 1RZ4A 4HDVA 2X48A 3BPXA 2PYLA 3VQDA 3QODA 4W5OA 3GNGA 3ULRB 5D8KB 4FPAA 5CKEA 3VS6A 1JJ2S 3B6OA 5M3FJ 4RM3A 1NK8A 3BR6A 4NXNK 3JCMQ 4OLAA 5FU7B 2MF2A 1RADB 3VYGA 1YJWQ 1B34B 2MC3A 4HLXA 4IL6C 3CJAA 3DLLL 4YIRX 3F8BA 5C25A 3RYPA 2EFOA 2DX1A 4RBOA 4CC4B 4DLEA 1FX7A 3WNFA 1YJWI 4H5VA 3L4QA 2OI3A 2NOHA 1HSQA 1ZQ3P 1X9MA 4M77B 1KC8O 4RLQA 4R5PA 1V29B 2HQRA 1YO5C 1TC3C 1ZREA 5DLOA 4DTOA 1WJCA 1Q8IA 3TABA 5AYFA 1GXIE 4B08A 4XAXB 5H6RA 2EYXA 3E2UA 2P9SB 2PZSA 2P51A 2COZA 3PUFA 1A5VA 2UUZA 5GAMj 4YELA 4A2BA 2J6FA 4DUYK 9ANTA 2A6AA 4OMMA 4KH1B 5MLCQ 3MEVA 4AC0A 3LAPA 1OMIA 2MGQA 3KPHA 1LMZA 3KZBA 3P83D 2X1CA 2IC3A 3CCET 2VKEA 3H0GJ 4F7UG 1QZ6A 1MJAA 4DV7K 3H0DA 5GAN5 2YUNA 3N0UA 3H92A 1OCOH 4JYAK 1DP3A 3ITHA 1X4OA 1NKUA 2CH4W 2W7NA 3QPTA 4DR6K 3HL2A 2DVEA 1POGA 5GAGP 3A8HB 4JEPA 4CECA 4C0DB 3K5LA 4QT7A 4RWTA 4QQDA 2FL7A 1QWEA 4EMKB 3KEOA 5JLFA 1Q9XA 2HEOA 4MQ3A 4ZZDA 1QCOA 4EMHA 4B3SK 3OSVA 4DBRA 3UKUA 3AGRA 3M1FA 4FJJA 3RIRA 4FM4B 2DXUA 2LYCA 1SSFA 3PVLA 1PU8A 2ZGZA 1M2VA 2F2VA 1JT6A 4XLAA 2DF6A 3QWLA 2XAJA 2JTEA 2VXZA 4PCQA 2HTJA 2P6SA 3RSNA 2MFZA 2L9RA 4A69C 1JCGA 5EC7A 3NFAA 3V9SA 2FXAA 1R0BG 1YFNA 4BEHB 1VYVA 4LDWA 2NVTJ 1T3VA 1P6RA 1VQ7Q 2ROTA 4AFUC 2XKOC 3SQ1A 2ZBKA 2KW4A 2EGEA 1OCZH 3M7GA 1D0XA 2KQWA 3KKRA 3K70C 1U45A 1UHSA 1TYQB 2DEQA 3CD6Q 4EVIA 1ILYA 5F0XA 1ACMB 4D8DA 2NWMA 4L5EA 1TBXA 4CGJA 2ECZA 2BZ8A 3CWSA 1SL1A 1ZN2A 3I4PA 3HPGA 4LJZF 2E34A 1G99A 3E9GA 1DTQA 4J9HA 1RAEB 2EQMA 3KIOA 2FZGB 4Y13A 1XQOA 2LSNA 3A01A 3DTIA 1Q82R 1VFCA 2CRGA 2KIMA 2P1JA 1AHDP 2XMFA 3MKZA 4I6MA 5C6SA 2BDPA 2O7OA 1VQMA 1UJYA 4PL6A 4WK8F 1JLFA 1KTQA 3UA7A 4HVVA 4CEOA 1HNWK 4PGHA 4AH9A 3A0BC 2VC0A 1RAIB 1TKDA 3DCFA 4O8KA 3OA6A 3CXCA 2L2PA 1IH7A 4OPKA 3KK2A 2Q0UA 4N0BA 1WSIA 1J9IA 3ZCMA 4OOIA 2GBYA 3GFMA 3IRQA 3VQ4A 4PGGA 1H1VA 1QVTA 2Y0SA 2EKOA 5LFAA 2CREA 3R6NA 1SFKA 1HF0A 1HJRA 2JHJA 3OVNA 2YHYA 4KI6A 2EJ9A 2VQLA 5H2FC 3QPHA 1TYQA 3UE5A 3WE3A 2WBMA 1LFUP 1W2BA 2EPFA 5EG2A 2E5ZA 1N6AA 1KVCA 1SFXA 1KC8U 3F9MA 5M1FA 3LAKA 4ZTJA 1WEFA 2ESHA 3MN6A 2RN7A 1WN7A 2XK0A 1Y1WJ