3OYKA

Crystal structure of the pfv s217h mutant intasome bound to manganese
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
368
structure length
368
Chain Sequence
LDAELDQLLQGHYIKGYPKQYTYFLEDGKVKVSRPEGVKIIPPQSDRQKIVLQAHNLAHTGREATLLKIANLYWWPNMRKDVVKQLGRCQQCLITNASNKASGPILRPDRPQKPFDKFFIDYIGPLPPSQGYLYVLVVVDGMTGFTWLYPTKAPSTSATVKSLNVLTSIAIPKVIHSDQGAAFTSSTFAEWAKERGIHLEFSTPYHPQSHGKVERKNSDIKRLLTKLLVGRPTKWYDLLPVVQLALNNTYSPVLKYTPHQLLFGIDSNTPFANQDTLDLTREEELSLLQEIRTSLYHPSTPPASSRSWSPVVGQLVQERVARPASLRPRWHKPSTVLKVLNPRTVVILDHLGNNRTVSIDNLKPTSHQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular mechanisms of retroviral integrase inhibition and the evolution of viral resistance.
pubmed doi rcsb
source organism Human spumaretrovirus
molecule tags Recombination,viral protein/dna
molecule keywords PFV integrase
total genus 106
structure length 368
sequence length 368
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2010-09-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
A PF17921 Integrase_H2C2 Integrase zinc binding domain
A PF18103 SH3_11 Retroviral integrase C-terminal SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2300 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3oykA04
1.10.340.70 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Endonuclease III; domain 1 3oykA01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3oykA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3oykA03
3VQCA 1VSHA 4CHNA 2VYTA 5KRSA 4GW6A 4H4OA 1S1TA 1XHZA 2DFHA 3LPUA 4CF2A 1BCOA 1QSLA 2FC0A 2BANA 3DOKA 3MEEA 1D8YA 4OPKA 2Y1JA 3OYLA 5I42A 1Q8IA 5EU7A 2FBTA 3DLRA 4DLGA 3SCXA 1VSMA 1R0AA 4AHUA 3DB4A 1T03A 3LGFA 3DYAA 1WSEA 4M3TA 3AA5X 1OYXA 3OYGA 4N47A 4M3YA 5KI6A 2QQSA 2OPSA 4DSIA 4KRFA 4N4HA 3RMDA 1CZ9A 3H08A 4IUVA 3T1AA 1S6QA 4PQUA 3V9UA 1BGXT 1MHNA 1KHCA 2HNYA 1BQMA 1C0UA 3RMCA 2KW4A 4O44A 1TKZA 4B9TA 4KREA 2HB5A 4CFCA 2A1RA 2OYQA 2Z1GA 1GOBA 2IOCA 1WSGA 3ZSZA 3OYFA 1FKOA 4E7KA 3WNFA 5CZ1A 3LAMA 4WE1A 3ZSXA 3RRHA 3HJFA 3AVIA 1LW2A 4UC4A 1JXEA 3AVGA 3G0ZA 4IG3A 2D9TA 4CJTA 4DU1A 1VSJA 3SQ0A 5IN1A 1SKSA 1SKRA 4IBNA 2VG7A 5DMRA 1VSFA 4CF8A 4CJSA 1EKEA 2O4IA 2HHXA 2OA8A 4O0JA 4GMJB 4CEZA 3F73A 3O8VA 1YVUA 3DRRA 5C6SA 2HQXA 4CJEA 3HPGA 1RTDA 4DSKA 4JS5A 4CGHA 4M3XA 3S9HA 3SZ2A 4F2RA 1X9MA 3SPZA 4HCCA 3OYKA 1EP4A 1C1AA 4FLZA 3ASKA 3B6OA 1XWLA 3V9ZA 3UT1A 4E89A 3TAQA 2G8IA 1WSJA 4XIUA 1YT3A 4HVJA 3OYMA 3META 1T05A 2NLUA 4DF8A 4L59A 4E7HA 1VK0A 1CZBA 2Z1JA 3MECA 4KO0A 3QEPA 4FZYA 4FJHA 3OYJA 3IS9A 4R5PA 2IDOA 4QVZA 1JLCA 4DTUA 2M0OA 3PX4A 4B9SA 3SPYA 3UIQA 3BDLA 4KHQA 2LCCA 3ZT0A 3DLHA 1TKXA 5T7BA 3OMCA 3VQPA 2RN2A 4EDUA 2RHIA 4CESA 3CFRA 1HYSA 3VQ8A 3L2RA 3AVFA 4CHPA 1VSEA 1N5YA 2PYJA 4FJKA 3ZEHA 1WSIA 4J2DA 3VQ6A 4B8AB 4QQ6A 4NZGA 2D5RA 4AHVA 5KE2A 4N56A 4FL6A 5M9OA 4ID5A 1L3SA 3AVKA 3SUNA 2RI2A 3H6ZA 4I2QA 4M41A 2LVMA 4CJRA 3NGIA 4CECA 4RW7A 3F9KA 3OYBA 4HCBA 3FDRA 5C0MA 2B8AA 2JGUA 4ID1A 4OPJA 4BDZA 3SI6A 1T8EA 4DWIA 3KK3A 2I5JA 4CGJA 1JL1A 5D6XA 3KD1E 3LYIA 4Z4IA 2KFNA 1DTQA 3NH1A 4FJ9A 4CE9A 4B9LA 1RI0A 4MFBA 4BACA 3OA6A 4JRQA 1BIUA 3SNNA 4J2BA 2HHTA 4AHSA 3U6FA 2BKDN 1EETA 4IFYA 4DMNA 4E19A 3TAFA 1NKCA 2F5KA 4NS5A 1NKEA 1YTAA 3DLEA 4B08A 3H8ZA 1W9HA 4IUUA 3ALYA 4CJLA 5KCHA 2YNFA 3LP1A 3VN5A 3RMBA 2VG5A 2RF2A 4CEEA 4J2AA 3RR7A 2E6MA 4BD3A 2D0CA 3HYFA 3VQ5A 3NAEA 4Y1DA 3VQDA 2GUIA 1RBSA 3SQ2A 4C8OA 4F4KA 2R5MA 3L42A 2K3YA 2IAJA 5J39A 1EXQA 4LH5A 3VA3A 4RW8A 3THVA 3PNWC 3O3GA 5J2MA 3DRPA 3LANA 4CF1A 4ZHRA 3U3YA 3P83D 1U45A 2HVHA 4JRPA 3V6DA 2KQ2A 2DIGA 1KRPA 5D6YA 4M42A 1ASWA 2P51A 3OMGA 5SZTA 4JS4A 3WNEA 3DLMA 3IAYA 3SD4A 1TGOA 3AA3A 1LAWA 4IKFA 5KCOA 1CXQA 4ELUA 4DTMA 2HVIA 1JLFA 4FLVA 1OZ2A 1BISA 1RTHA 4KAZA 2R57A 3MP1A 5JS2A 4FM0A 4CGIA 5HP1A 4ZTFA 1C1BA 2B4JA 4FZXC 1TAUA 3IRXA 3OVNA 4BDPA 1HQUA 1O1WA 1WAJA 2X74A 3AO1A 2YKNA 3S3OA 3AA4A 3QO9A 4Z4FA 3C95A 1C1CA 2HHQA 3HVRA 3OYAA 4C5IA 1S1UA 3L2VA 3FLGA 2XY8A 1X9SA 1SL1A 3HXMA 1D9DA 3DLBA 3NBPA 3O4NA 4OKEA 1I3AA 3AVMA 4CFBA 2JZ2A 3SQ1A 1NK8A 1RT1A 4O55A 2JLEA 4DU4A 2FBYA 4FK4A 4CJPA 1ZBFA 5C42A 3K57A 1U48A 1I39A 2YKMA 2XK0A 4FJLA 4A4HA 2DFEA 1WGSA 4FJXA 3VA0A 1HMVA 3PO5A 4CCHA 3KJVA 2XY5A 2QKBA 3K5OA 3O3FA 1NJXA 4IG0A 4FLTA 4Q5WA 4GVMA 2FBVA 2O4GA 2X4XA 3C94A 4RW9A 2IS3A 3E9GA 3CFPA 1WNSA 4CF0A 3LH0A 3VQEA 4BWJA 2EX3A 3TABA 2B5JA 2PQWA 3NF6A 3ZT1A 1JLEA 4H8KA 3KLHA 2DFFA 1S5JA 1REVA 1RDCA 3HL8A 3OYIA 4F3TA 3AVBA 3WNGA 2CKKA 2RJDA 3OS0A 1TAQA 1L3TA 4C8LA 3QINA 4EZ9A 2EQJA 2HQEA 3DLGA 3TAEA 3NTIA 4FK2A 3QNOA 3V81A 1NJYA 3ISNC 3LZIA 1H3ZA 1ASVA 4CGDA 3QKJA 4CEBA 4FM1A 3HP9A 3CFOA 3KLIA 2RI5A 4DFMA 1UA0A 4I9QA 4KB1A 3PMTA 3S3NA 1TVRA 5SWMA 4CHYA 2GF7A 3A2FA 4Z4HA 1BI4A 1U04A 2O4XB 5HRNA 3LX7A 3L2QA 3JYTA 1QSYA 1HYZA 3QNNA 2G8WA 4RW6A 4DSFA 5J1EA 1LW0A 2PY5A 4W5TA 2PYLA 2E4LA 2RI3A 4M3ZA 4DF4A 2E6LA 2GFUA 3MAQA 3MEWA 1KLMA 2X4YA 2G8UA 4A4FA 1RDDA 4FW1A 4OKKA 3E01A 4F8RA 3MXMA 2NUBA 3I0SA 1JLAA 5DK5A 1XC9A 3SUPA 4PL6A 3OJSA 1SKWA 2RJFA 3MEVA 4LD0A 4K8XA 4DTOA 1Z26A 1LWEA 5CY4A 3P1GA 4UQGA 4DFKA 4CJKA 2G8VA 2X78A 2WONA 1JXBA 1TK0A 3KKSA 5HROA 3MO8A 4C5GA 1UWBA 5C24A 4HUFA 1A5VA 1RCHA 4C8NA 2G8HA 4RW4A 1HPZA 3M8QA 4CJFA 4FJMA 3I0RA 2KFZA 4BE0A 3RWUA 3BGRA 3QIPA 3NF8A 3HT3A 2XY7A 1QTMA 2L3RA 1RBUA 3ZSRA 3OYHA 1NJWA 4M45A 1LAVA 3HPOA 3VQAA 3ZT2A 1J53A 4AHRA 5FRNA 4O5BA 1OZ3A 1RT5A 3V1QA 4OLAA 3VQBA 4DSEA 1TL1A 3EZ5A 1FXXA 4JLHA 2R5AA 3PX6A 1DTTA 2HMIA 2AJQA 3DLKA 2FBXA 1IG9A 4KTZA 5J2QA 2Q3SA 3HP6A 4RG2A 1NOZA 3ASMA 1XNIA 4NYFA 1TK5A 4B9WA 4DS4A 2ZD1A 3VQ7A 4DQPA 3OS1A 3CEYA 2EQUA 2IC3A 2YHBA 3ZSWA 5HLFA 4CEDA 3CG7A 3LLRA 3UWNA 2LDMA 4Z4CA 3QEXA 2MWPA 3HO1A 2HW3A 3OQ5A 2X35A 5CYMA 3LP2A 1RT2A 2QXFA 3M8SA 4OVLA 2R7YA 3V1OA 4DFPA 1D9FA 2DTUA 4RG8A 1RT4A 2ZE2A 4LSLA 1EX4A 5CZ2A 2VG6A 5J2PA 3K5LA 1RDAA 3AVJA 4BE1A 2DAQA 5KE3A 1LWCA 2WOMA 2X6NA 4QAGA 3LP0A 3ZSOA 1VSKA 4OLBA 5D3GA 4YFUA 3HVTA 1SUQA 5KGWA 4DTRA 1F21A 3FFIA 5K14A 1WLJA 3SJJA 1SL2A 1NK7A 3L2UA 1QHTA 3V9SA 4X34A 3M8PA 2F8SA 1LV5A 2K3XA 4H4MA 2RJCA 3GOXA 1CXUA 1BL3A 2ATQA 4I2PA 4FVMA 2EHGA 4CK3A 3QEWA 2R58A 4KKOA 1GOAA 3SQ4A 3NDKA 1NK0A 2KTQA 5HRRA 4CJ3A 4M3WA 1SL0A 1QE1A 1RBVA 1WSHA 3K5NA 3QIOA 1Y97A 3I8DA 3AVNA 3D0PA 3P8DA 1X9WA 4E7LA 3QJ6A 5CYQA 4CIGA 4F3OA 4NCBA 4KTQA 1FK9A 4KFBA 3OYDA 2F96A 3EY1A 4E1NA 3KLGA 4PY5A 2QKKA 4O0IA 1T7PA 2OZSA 4M3UA 2RHUA 1RT6A 1TKTA 2HNDA 3LP3A 5KGXA 1ASUA 3NF7A 3K5MA 3TANA 3HM9A 1C6VA 3NTKA 1KFSA 4E1MA 1L3VA 1FKPA 3KLEA 3QIIA 1IKXA 1RILA 2DY4A 1HNIA 4OGCA 3MEGA 3PO4A 3HK2A 3RMAA 2LRQA 1DLOA 3F70A 3DI6A 3KKRA 1BQNA 3L3VA 3SV4A 4LSNA 1SSFA 3C4SA 3LPTA 3PUFA 3ULDA 1S9EA 2ITGA 1UAXA 3VQQA 4EZ6A 4HTUA 4PA1A 4CIFA 4ZTJA 4PLIA 4AH9A 5HBMA 2P1JA 4W5OA 1OI1A 3ZSQA 1U4BA 4ELTA 3ITHA 4KTWA 3AO3A 3VQ4A 4CGFA 4GY5A 3TI0A 4NCAA 2EQKA 4DLEA 4FJNA 2D0BA 4CERA 2EQMA 4ICLA 4L8RB 4B9NA 4IFVA 4IUQA 1J54A 1ZYQA 5JS1A 4N41A 3ZT3A 1L3UA 3LWLA 4N5SA 4DSJA 1BI4B 3LGLA 2YRVA 5KTQA 3TWHA 4C5EA 1C0TA 1TV6A 2RPIA 1VRTA 4CHZA 1NK4A 4QOZB 4E0DA 4CGGA 3KIOA 2M16A 2L8DA 3FC3A 3MXJA 3V1RA 4EP4A 3KLFA 4FLXA 3S3MA 4DTNA 4DU3A 2YHAA 2P5OA 4DTSA 3S6WA 4HCZA 1Q9YA 1CLQA 5HRSA 4KHWA 3TR8A 3O3HA 1VSDA 3EAEA 2X6SA 2Z1IA 1KTQA 1RDBA 3OYCA 4W5RA 1G15A 3QEIA 5KRTA 4HUEA 1NK5A 2BDPA 2GFAA 2OPRA 3SUOA 4DTJA 3NF9A 3NFAA 3KUFA 4CJQA 4MQ3A 4FJ5A 2RHZA 4DS5A 4CIEA 2X4WA 2EKOA 2G8KA 4DSLA 2OPQA 2BUDA 1X1PA 1KFDA 4CEQA 4FM2A 2G8FA 3ZCMA 4B9UA 3JSMA 1XHXA 1A5XA 3T3FA 4B9XA 4E7JA 4KPYA 2HHVA 5KH6A 2L89A 3QEVA 2PZSA 1YTUA 4IUPA 5FDLA 5J26A 1RT3A 2QK9A 1Z25A 2RJEA 2BE2A 4Z4EA 3NNQA 1WJRA 2A1SA 4EP5A 1U49A 2FHDA 3AV9A 3LDSA 4FLUA 1RBTA 4N76A 1B92A 4LH4A 4CEOA 1TKDA 1J9AA 1JLQA 3AO5A 4QCLA 3CYMA 3B6PA 3U3GA 4CHOA 4FJ8A 2HHSA 5D6WA 3C6UA 4Q0BA 4OJRA 4KI4A 3MEUA 1W0HA 3SUQA 1BHLA 4A4EA 1HRHA 2IGIA 3V9WA 1D5AA 3V4IA 3BDPA 4DQIA 2HHUA 3MP6A 4FU6A 2KZMA 3HPHA 2P5GA 4W5NA 3AO2A 4DQSA 1IKWA 3Q1JA 1NKBA 4E7IA 1ZBIA 2E5QA 4KHNA 3OY9A 1S1VA 2LSNA 4FJJA 4FJ7A 1S9GA 2BGGA 3P5JA 1IKVA 4FXDA 2HHWA 2YNGA 4KHYA 1VSLA 4Z02A 1C0MA 1WSFA 4NCGA 3NH0A 2XY6A 1NK6A 3L8BA 3FEOA 5IAYA 3ZT4A 1JL2A 3LZJA 1L5UA 4DQRA 3DOLA 3RTVA 1WN7A 3KTQA 1G5VA 4LY7A 4CF9A 1LWFA 4FK0A 1QQCA 1S6PA 3QERA 3MEAA 5C25A 4FJIA 4LD6A 4IURA 4FZZA 4II1A 3KD5E 1A5WA 1QS4A 4F2SA 3OB9A 3MP8A 3OYNA 3SV3A 1RBRA 2HNZA 4CFAA 3RR8A 4K8ZA 2LTOA 4N4IA 4NYNA 4BE2A 3TAGA 3QESA 1WAFA 2G3RA 3QBYA 4OGEA 1VSIA 2E6NA 1BIZA 2YNIA 4CJUA 2VWKA 2ETJA 1ZBLA 4Z4GA 1B9FA 1BCMA 3QLHA 4OKJA 4HHTA 2YV0X 2RO0A 4FW2A 2XHBA 2OPPA 1GOCA 1WJSA 4O4GA 1HNVA 4AHTA 1QSSA 4OVAA 2JTFA 1IKYA 2RHXA 3NGZA 1K6YA 3LAKA 3OS2A 2M1HA 1IO2A 1JLGA 4A4GA 4FCYA 4CK2A 1J5OA 3QETA 4BDYA 3SYZA 4DTXA 4KHUA 2F8TA 1Q9XA 1UOCA 4IDKA 3ME9A 3PFSA 3AVHA 1KCFA 3L2WA 3HSTB 3NH2A 2GBZA 4B9VA 4W5QA 1KLNA 4B8CA 4C8KA 5E41A 3AVAA 3EYZA 4DQQA 4FLYA 4CRIA 4Q5VA 1TL3A 2XRIA 3CQ8A 1U47A 4FYDA 3D45A 4AILC 2WACA 3P8HA 1S1WA 5HRPA 1RNHA 1NJZA 3NCIA 3ZSVA 3DMJA 1N27A 3DRSA 3G10A 4CEAA 4DG1A 3KK2A 1IH7A 3MXIA 1NOYA 1HYVA 4ELVA 4BWMA 4C8MA 4KB0A 2O4XA 3NE6A 4QQDA 3E9FA 1RTIA 2MWOA 1RT7A 4HUGA 3T19A 1XI1A 2P0KA 4CHQA 2RKIA 3KK1A 3L3UA 3AVLA 4YNQA 4B9MA 4PUOA 4CJ4A 3CM5A 2EFIA 3PX0A 4Z0UA 1ZBUA 3V9XA 1KSPA 3ZSYA 1ZBHA 3CM6A 4CK1A 3NHGA 1KVAA 4KI6A 4M3RA 5CIUA 3LALA 3PV8A 3M8RA 4N4GA 5I3UA 3DM2A 3VQ9A 3K58A 1MU2A 3IG1A 5FRMA 4CEFA 3K2PA 5FROA 1TK8A 4CJVA 4J2EA 2RHYA 4DTPA 1ITGA 3O4QA 2ZQBA 3PY8A 1S1XA 1JKHA 3AA2A 4CJWA 2VWJA 4KV8A 3NGYA 1HJRA 2B6AA 3LWMA 3AO4A 4CFDA 3K59A 4Y1CA 2Y1IA 1UA1A 3C6TA 1N6QA 1B9DA 1HQEA 4QW2A 2D0AA 2YNHA 4CJ5A 4DFJA 2KZZA 4I7FA 1KVBA 3M9QA 2QQRA 4AHCA 3PMIA 2IG0A 3TAPA 2OZMA 4B3OA 2GV9A 2XO7A 1RTJA 5J2NA 1NK9A 4E3SA 2DIQA 4IUTA 4C5HA 4FJGA 3MEDA 1SV5A 1VRUA 1WJQA 4FLWA 3OJUA 4KHSA 2XDPA 2W42A 3WNHA 1KVCA 2Z1HA 3OYEA 4PWDA 3AVCA 2BIVA 3NTHA 3TARA 4I9LA 3TAMA 3DB3A 1JLBA 4G1QA 4TSXA 3RRGA 4QQGA 4PLLA
chains in the Genus database with same CATH superfamily
3HOWJ 5TGTA 5LJ5g 2QBYA 1N36K 5BN8A 3AGKA 1SC7A 3AA5X 2QLZA 4N4HA 3S41A 2Y30A 5IT9K 1F5TA 2HB5A 1OCCH 3CD6T 1ZELA 3HHGA 1WSGA 5A2QK 3ZSXA 3KZZA 3JV3A 4M75B 3GFMA 3CPEA 4FWSA 1B07A 3GTJJ 4PFZA 3JSOA 1YVUA 2IXSA 2RNAA 1ZSGA 2LKPA 3ZFJA 4A2AA 4LN2A 4FLZA 4C3JJ 2M7BA 2FO0A 2HSTA 4KO0A 3CMAI 3MECA 4FZYA 4RLFA 4IOAF 4IOAL 3GLLA 1TKXA 3VQPA 2DXBA 5ERIA 3M0SA 3ECHA 2Y90A 3ZEHA 1WSIA 3VQ6A 2MSYA 3LNQA 2DVEA 2B0LA 3NGIA 3QYEA 5CQGA 1BR4A 4CI0C 3FXLA 2KBTA 3BEXA 1Z91A 4RAFA 3W2VA 3TW7A 2LNBA 2GUPA 4M75A 1HA8A 3CC7Q 2KFNA 3UKRB 4MFBA 5H6QA 1X6GA 5BREA 3SNNA 3OBYA 3EYIA 2Q8KA 2E6MA 5LGTA 3SDZA 3HYFA 1RBSA 3VA3A 4N0BA 5LEKA 3INZA 8AT1B 4LIUA 4DOWA 2QGUA 3AA3A 5KCOA 3F6OA 2FXUA 4EM2A 2DN0A 1SFXA 4DV4K 1GLEG 2KLAA 1TAUA 1RRQA 4C0ZA 1VYVA 3SDBA 1F4KA 4DYQA 4BRQA 2COMA 3Q9SA 4RB1A 1SMTA 2LY9A 3HGYA 4CFBA 2Z0WA 3FM3A 2RKHA 3VF2A 2NAZA 2QQ9A 3BY5A 3VA0A 5D5VB 4C8QF 1C0GA 4C8QB 4MLOA 2NOZA 4F92B 3DTEA 3RYRA 1Z9ZA 4M7AD 4CC2A 2FF4A 3N5BB 4H4KC 2CP2A 3BTLA 1H641 2DFFA 2VN2A 2K7LA 4WCGA 2PZ1A 3I56N 4KDPA 4CEBA 3HP9A 4DFMA 3S3NA 3A0BC 4KUDK 3U2RA 2RI3A 3IAS2 4L6V5 3GXOA 5LD2C 4JX4A 3CCYA 5JLXA 3I5SA 4M3EA 1Y96A 2VYPA 4MFEA 5KN9A 2XROA 5AR0A 3TTDA 4M7AF 2YJEA 1DGRM 1NGAA 3MQ0A 2EJRA 4A4KA 3WXLA 3CWTA 2DLPA 4C8QD 2P9UA 3LA7A 4DSEA 3P7NA 2XI9A 1TUDA 3GMEA 1ULYA 1S72Q 2O8CA 4MDXA 2XG8D 4IO8A 3EGDB 3ASMA 3FMSA 3CG7A 3CCLN 2MWPA 3GTLJ 2X35A 2YJFA 4PSXA 4IHWA 4LSLA 1NGJA 2DAQA 2X6NA 5E17F 3HUGA 1M2VA 3WT0A 5D3GA 4XLCA 4YFNF 3J81O 1K1ZA 2QM1A 1LOTB 3VYHB 4H4MA 4M9ZA 4FSXA 1SVOA 4U0WA 2FF3B 4A69C 5FU7C 2MOXA 4AYBN 1VQ4T 2O9VA 3FZLA 4MZMA 4BEHB 4FM4B 4E9FA 3QIIA 1RILA 4BGBA 1VQ6N 1W7PA 4KISA 3F10A 5FD6A 2VXZA 2CDTA 4LSNA 2CGPA 4C92B 2DPNA 2ZC2A 2VKVA 4HV6A 5DUKA 3GOIA 4OB3B 2EQMA 3VUZA 4L8RB 4HTLA 3BW1A 3REAB 4I2OA 1C0TA 2ABLA 1Q82O 1QVUA 2L8DA 1VQPN 4BJ5C 1E6GA 2JS0A 2E2IJ 3I64A 3SAHA 2BDPA 2LC2A 3FHZA 1PVSA 5IWAK 4KPYA 3HTRA 3EZWA 1YTUA 5I21A 2BZTA 3N5NX 1WJRA 4BQNA 1J75A 4LH4A 1W0TA 3C65A 4MO7A 3DLLF 1BDGA 2JT1A 3C6UA 3DLLL 1PC0A 2ASMA 5A0LA 2E1HA 2HCKA 4FWPA 4JI3K 5EOYA 3URGA 3DKYA 2OBPA 4AQYK 2XY6A 4DZJA 3DKXA 4DQRA 3DOLA 1YO5C 4CF9A 4LY7A 4FK0A 1QQCA 1Q95G 4HLYA 3DWLE 5LHIA 1IN6A 3CCVA 2D8JA 4E2FB 4A5MA 1R7JA 3HOUJ 1WAFA 3TOBA 5DCFA 1B9FA 2HKNA 1WUAA 2CUBA 2XHBA 3VS0A 1ATRA 4UNOA 4OMOA 4DR3K 3K9JA 2UU9K 4JJBA 2LJ0A 2F2VA 4F93B 1S1NA 4HQMA 1OH7A 1R5GA 2H3GX 2BEOA 1QVFA 1V55H 4QVDA 1CKBA 4ELVA 5LRRA 2P4WA 2RKIA 4B9MA 2LRDA 4OMZA 3L6QA 1CGPA 3A5LC 5AQMA 1Y0NA 3CCUQ 2ED0A 2KE9A 1REPC 2CUJA 1VQNA 1ITGA 4EIKA 2UUZA 2DJQA 1YI2A 3K59A 4JI6K 3C6TA 2KZZA 2YI1A 3E19A 1LVKA 5ICGA 2HNIA 4AHCA 5AFUA 4B3OA 4GRIA 4IEJA 4PFPA 4EV0A 1Y64A 2L7FP 1DDNA 4JI4K 1KYZA 2XKPA 1RDWX 2O8DB 4DA4A 4J9IA 2CFOA 4QQGA 3VQCA 2K4BA 4H4OA 4XLHA 2A3LA 3LW5E 1AD5A 1PM3A 2XAGA 3LOCA 3MKLA 2DA4A 1GXIE 1WDXA 1QQNA 4E47A 2LQ8A 4N47A 1W2BS 5M1PA 3CJNA 3BR6A 2PU9B 1QVGM 1ABQA 2FBKA 2CSQA 1BGXT 4PFOA 3RMCA 4O44A 4HVUA 3WNFA 4EJWA 3RRHA 4M6VA 2DJZA 4IBNA 2X48A 2CU7A 4NUBA 4A53A 4I0BA 3PFIA 4F2RA 3OYKA 4X65K 1GL5A 2GNCA 2MD0A 1UFFA 2VOOA 1WEIA 2JA2A 4E9EA 4XU0A 1X3NA 2M2EA 4LD9K 5T7BA 5GAGJ 5LJWA 3VQ8A 1SKUB 1GV2A 4J2DA 1T0HA 1IBLK 3M4GA 4M7DG 1YJWQ 3H6ZA 4FO0A 1M3AA 1KG5A 2XV4S 3RKWA 4IWVA 3G7ZA 3CCSN 2I5JA 2VV5A 1KGSA 1FIAA 3DBHB 4B9LA 3CC7I 3RSNA 1BIUA 2ZGWA 2YT6A 4DMNA 2RNJA 1W9HA 1GLAG 5FLXZ 3H92A 4JI0K 2DK5A 4B9UA 2VQLA 5FPEA 4LUDA 4CF1A 4M78G 1Y1VJ 4D1QA 1IJJA 1UHSA 4M77F 4C2MJ 4ESFA 4FYVB 2R7RA 1RTHA 2H94A 4OO1J 4FM0A 3IRXA 2IBDA 3QO9A 4BGDA 3S3OA 2VKEA 2LR8A 1YTYA 2E5ZA 4WK8F 1BBYA 2KNBB 4J9DA 2UUAK 2Z5UA 3FLGA 1X9SA 1FEXA 1BOTO 1KONA 1RKWA 1ZSZC 1NK8A 2FBYA 1YX5A 4CJPA 1W70A 3ZQHA 3GPLA 1ZA2B 1XNQK 2E3IA 1XPXA 2V9PA 2P6TA 2WAFA 3PE0A 3BWGA 4U7BA 1JLEA 4HAMA 3WNGA 4KH1B 3HKZA 2ACJA 2VBWA 3NTIA 3T1YK 1F1BB 3JCMV 4XL9A 2JM9A 1HJDA 4B3RK 3TDZC 1H3ZA 2GAUA 3BCBA 2PVOB 2LTPA 1J3TA 3L2QA 3TREA 5IT9O 2G8WA 3CI5A 4ZYAA 1Y07A 4KH4A 2FSWA 4DF4A 2IVPA 1PUFA 4MZTA 4OX9K 2DLLA 2HQNA 2WONA 1YJNQ 2IA0A 2DXIA 1A5VA 4XICA 1JKRC 3NVKA 2K2MA 2DKGA 3I56A 4JK9A 3HPOA 1ZX6A 2EFPA 2HOAA 2FF6A 1HX1A 3JCMh 4BR7A 5CJ9A 2K7AA 2CFXA 1VQ9Q 2CH0A 3M0UA 4A3EJ 3KCCA 3M3ZA 3LCNA 3BF3A 2XF5A 2EBPA 1V5FA 3AT1B 1NE8A 1M2OA 4RAZA 5E20A 5TISC 2FLOA 4J6XA 2HBKA 4MFDA 1M1FA 2K3FA 2WV0A 4FSVA 3C18A 3ZMVA 2X85A 4IZ9A 3VTHA 5I11A 4X0GA 1I94K 1QWEA 3ZETB 1RT6A 4NB4A 2R7TA 1VI0A 3TANA 1KO9A 2J6KA 3UR3C 4CYCA 1IKXA 2ICWG 3MEGA 3DI6A 2EAYA 3LSIA 5K5OA 2RQRA 3ULDA 1LUJB 2BW3A 4UUTA 3NMZC 4M75D 4FOIA 4ZZDA 4ISEA 4ZDLA 5HLGA 1M2VB 1MSEC 3ZMSA 1PUEE 3CCLT 3ZMDA 5HLTA 1QVGA 3K6GA 4ILGB 4P1WA 3F5TA 1KYWA 5ED4A 4AT1B 4QOZB 3Q5FA 2NUZA 2E7WA 4DU3A 1ITYA 4HCZA 2KQRA 1Q9YA 1OFCX 1QP3A 2MW8A 5J40A 2ZSIB 5B1AH 1O3QA 1K78B 4W1UA 3NFAA 1I5ZA 4AIAA 2CP3A 2JWLA 3I9V2 2KHMA 4E6RA 1ODDA 2HXIA 3GZ5A 4N0AC 2DYIA 4H5TA 1VQOT 5C12A 3ZQGA 4H0EA 2LOOA 4M6XA 3MEUA 3EPZA 1FJGK 2HHUA 2QWWA 4CZEA 1FP1D 4A6DA 5AQJA 3N05A 3QAHA 4QPQA 2A0FB 4RM2A 3LZJA 4R56A 2M3AA 4OOIA 2H27A 4ZYEA 1ATSA 1HDPA 1Y39A 2QKLB 1P8ZA 1GLNA 2NNYA 1WXTA 5GMKe 5M5YJ 4CJUA 1NGEA 2LT4A 2VOPA 1ZUUA 4AHTA 1IZ6A 3CUOA 1KD1R 3KLNA 1MBFA 3HOSA 3LAKA 1AWJA 4A4GA 4HNUA 4BDYA 2NRZA 1QRYA 1FTZA 4YFXF 4FLYA 2MI6A 4GNIA 3GWZA 4HPQA 2RE2A 2WACA 3DEEA 4QQDA 5D4RA 3HJFA 1FYKA 3CJRB 3T19A 2MFZA 3N0UA 2F48A 2CG4A 3D5RC 2I0NA 5E8IA 3V9XA 2R0QC 2UXNA 1WEFA 2ROLA 1Z77A 1Q1HA 3DM2A 2HOTA 5J6XA 4MMKA 3D5LA 2CUZA 2ZB9A 2CP0A 3PY8A 4AYBA 4B1VA 3FXJA 2CZ0B 3PIPA 2B63J 3MMYB 5KYUA 2C0TA 3A98A 1QU3A 3BE3A 1TYQB 3HL2A 4M7DF 2QGFB 4KYWA 1EZZB 2LVSA 1KU3A 2BIVA 4G1QA 3I59A 2E12A 4FVMA 2EV0A 2L7ZA 3Q0UA 4KA4A 5BN9A 2KHOA 4LFCK 3GBQA 3FFKB 5EU7A 4C1NK 2FBHA 4WWCA 4D5CA 1OH6A 1WSEA 3DKMA 2D2WA 2QSFX 5IOYA 1CZ9A 3ZX2A 1M5Q1 2LP5A 4EA4A 2KDZA 3QZ5B 2KW4A 1JI8A 3UF4A 3WUHA 1GOBA 4P9UA 3FDYA 4M75G 2XF6A 4EVIA 1YXQA 1X3UA 2O4IA 4Y7NJ 3G6EI 3OL3A 3CC2Q 4CGHA 2JSCA 3THYA 1B9MA 3FZVA 1YT3A 3O9SA 4H5RA 1ARKA 4BJTA 4RB2C 3GTGJ 5GINA 2QEXI 2LCCA 2ZGYA 1I3QJ 2I2LA 4EDUA 3WTWC 3MWTA 4FJKA 1X3WB 3GZNB 2R3SA 4CCOA 4RW7A 5FJ8J 4RA2A 4K25A 4IJAA 1HCRA 2L3DA 4JX5A 1VFCA 3VEYA 1ABOA 3O2PE 1NMNA 3C1DA 5M1QA 2FVUA 3SLCA 3U6FA 4ZGEB 3R0AA 1RAFB 2R7XA 2DL8A 3K69A 3BF1A 4B44A 3P83D 1XD7A 1KQ8A 2I10A 2HVHA 2KQ2A 3RQIA 1YI2Q 4JJCA 1ZK8A 1TT5B 3C7NB 2OUMA 1BISA 2GLOA 2R57A 3LH5A 4Y4RA 3CW7A 3WEEB 2LMDA 3A1YA 3C95A 2HHQA 1NKUA 2FZGB 1TQMA 5CQYA 3ZN1A 2K57A 1MDMA 2JLEA 3R6NA 1U48A 3O8GA 5K7FA 2DFEA 1QBJA 4C8QC 3C94A 3CDLA 3HZJA 4HZFA 3VQEA 4BWJA 2FA5A 1UTIA 1AOJA 2GX9A 3FXKA 4FE7A 4C8LA 3RERA 3BLYA 3EGXA 1TUUA 4RB3C 1ON2A 1R6RA 2XKOC 1ZUKA 3FX3A 2UXXA 4A3FJ 4NDLA 4FWRA 2W03A 2X4YA 2HMAA 4IJNA 4OKKA 3BDUA 1GLDG 2JHNA 4EQQA 2XU8A 3LWHA 4LD0A 3LSMA 5LJ3h 2JN6A 2DW4A 1MUDA 4C5GA 2DO3A 2ESWA 4N0AA 1Y56A 1K73C 4FJMA 2ENMA 1HU0A 2K27A 5FRNA 4O5BA 3FK7A 1GDTA 1PP8F 2KMUA 1DTTA 4FWKA 3JCMc 2DMOA 3HKSA 4MLEA 3RMSA 4DS4A 3CEYA 5HLFA 3X20B 3HSCA 3OW2P 1IN7A 2TDXA 3LP2A 1HD3A 2XHIA 1A31A 1RC9A 4BRIA 2EJFA 3EH1A 5KE3A 2QSGX 2O88A 5E3OA 1O9SA 5BR9A 3Q7CA 3O4WA 4WQ4C 1CXUA 1ZGWA 4I2PA 4XKCA 1VQKT 1BUPA 1PKSA 3H46O 2YHWA 3TOAA 1UFMA 3RI4A 4LDWA 5AT1B 5CR2A 4F3OA 2E65A 4KFBA 4XN0A 4E1NA 4KJZA 3CC4I 2QKKA 1V54H 4O0IA 3F22A 1APLC 3NF7A 4EM1A 3R9PA 4J9GA 2X1CA 1R4NB 2P5LC 3VUBA 1HYOA 1XQHA 2DDAA 4OGCA 5AQTA 2DY4A 4KT0E 4EA5A 4H0YB 3PUFA 2VGMA 2PN6A 2V1QA 3E97A 4PA1A 4J19A 2YS9A 2JXBA 4CHUA 1ZBXA 1Q7YU 3CCLQ 4CGFA 4D0PA 1JQQA 4BC4A 1E3OC 2D0BA 2O8FB 3E2UA 2JRMA 4B9NA 2CT3A 3AAFA 1EWRA 3E9LA 3HXLA 5DLQE 4G9ZA 3LWLA 3NVMA 4L3QA 1J09A 1EO1A 4CHZA 1W4MA 1WGXA 1M90C 2DCEA 4DTNA 3MXJA 1EBMA 3U4LA 1CLQA 3CD6Q 5ILSA 3H5NA 2K40A 4DTJA 3NF9A 3SDGA 1ZGJA 1IN5A 1X1PA 4BRCA 4X9DA 3T3FA 2Q31A 1VQ9N 1B9NA 5M3MJ 1Z3YA 2FHDA 3LDSA 2XGDA 2KR3A 2NRHA 4CEOA 4PJMA 4F7UE 2PUKB 3H0HA 3U3GA 1O7LA 3CQYA 4OMLA 3SUQA 4M78A 3BDPA 1KIKA 4BHBA 4RAYA 5ICFA 4IHSA 3I55T 2HHHK 1S1VA 2UYTA 3F72A 4RTFD 2EPFA 2YUPA 3KTQA 3DP7A 3NRVA 2A3ZA 3CUQA 2DL5A 1VQ7N 4M3FA 2VXFA 2E5KA 2Y9YA 3EQLF 1NHAA 4AIKA 2E6NA 1VQPA 4O4GA 4MMLA 1HLUA 4OVAA 3HOTA 2EIJH 4RGXA 4CC4B 2FOWA 1IGQA 1O75A 4PJOA 1I8FA 3ZL7C 5E41A 3A8OB 4C23A 4A3CJ 3EYZA 1SD7A 2B7EA 1K8AU 4AILC 2VQHA 5HRPA 4WX9A 1WA7A 4CZGA 1E6HA 1IH7A 1JTXA 1YFHA 1MZBA 1QVTA 1N6AA 2MWOA 2BXZA 1VA7A 2DNUA 1Q86O 3CM6A 4AM6A 3TEDA 4KI6A 1EWQA 2NVTJ 3THYB 3I4PA 2I7PA 4QT7A 2CH5A 3VENA 1N6QA 3IMXA 4B1RA 5B5EC 2HXOA 5GTHC 1X6OA 3BG6A 4FJGA 1E2XA 1FMWA 1NGBA 3S6IA 2CT4A 5AFUH 1POGA 2GBYA 1H3HA 1VQNQ 5HCKA 2VYTA 4LF4K 5CK9A 2O8XA 1XQOA 1NJIR 4V2SA 2NRXA 4LMYA 4B09A 3BQYA 1NBWA 1OYXA 4LUEA 2WY7Q 4KRFA 5GAOl 2K79A 4AI4A 1JCEA 1C0UA 5K5RA 2I7NA 1TKZA 3VETA 3P39A 3CCEA 1R9TJ 4II2A 3OH9A 1R22A 2HAXA 2HF3A 4G12A 1I6HJ 1KC8R 1TYQA 2V8KA 2YG8A 2VQFK 3I56I 3BTCA 2LNHB 1MMDA 4E70A 4M77B 2WB1N 2E7XA 3SPYA 2EFQA 3BDLA 3DLHA 2HL5C 4DR6K 4HG2A 1Q82U 5M9OA 4CCKA 1YITQ 1T6CA 3O9TA 1T3VA 2O61A 2DYRH 1J0RA 1YW9A 3DU6A 3F9KA 2RN8A 3G1OA 1NEGA 3DPTA 4LLLA 1SRLA 4CGJA 2DFIA 3LYIA 3AY9A 3M56A 1LNWA 4F52A 5C10A 3OR1C 4M9XA 2F5KA 3MJXA 1UZCA 4BRFA 1U8RA 5GAMd 2VG5A 4J2AA 3LSJA 5DM6F 5DM6L 3GTPJ 3I8BA 1XS9A 3O3GA 3DRPA 2ISYA 2C0IA 2DXUA 4M78B 5F0XA 1KG4A 3J80O 2E1CA 2P51A 1XNRK 2DTZA 2YX4A 1YW7A 4CGIA 5HP1A 5DS9A 2QWRA 3PLAA 1ILYA 2VQGA 4HKEA 1VQLA 4F7ZA 3CMET 3CCUN 1ZSZB 1Q86C 3S2HJ 1YIJT 3QPTA 1ZHFA 2YKMA 2MLKA 3ZETA 2A6EF 1GBQA 3HTSB 2DMNA 2UXBK 3ZGKA 5M1FA 2QWOA 3RIRA 2FEIA 1JB0E 1RKTA 2P6SA 5IP9J 4IRIA 3DLGA 3GO5A 1N5ZA 2NZTA 1JE8A 4GV6A 3W6JB 2M9UA 1JCGA 3KLIA 4ESRA 4CHYA 4Z4HA 1LV5A 2KT0A 4M78F 1FT9A 3CHWA 4OMMA 2NUBA 4JNEA 2AXLA 4BXUA 3WTVC 4YOVA 5IY5H 3SJHA 3MO8A 1UWBA 5IXBA 1EQYA 1FSHA 4RW4A 4PKCC 4JV5K 2F5CA 2JM8A 3IL2A 2E2HJ 2E10A 1J5EK 4TV7A 3T1HK 2LQWA 1T0FA 3HTVA 5DPKA 2OZ6A 3VQBA 4LIVA 3KLOA 2ZCWA 1FYLA 1O3RA 3AFHA 1XNIA 1KC8U 2W6KA 1XG1A 3CCMI 1J6ZA 3V1OA 4UUSB 5GANf 1YJ9I 1VQKN 2KISA 4FVUA 4V19K 2Y31A 1HW5A 2QBYB 3FJPA 1F21A 4BL0B 1K9MO 1S22A 3IUCA 2JTVA 3I71A 2F2WA 2A28A 3W6VA 2FL7A 2HU9A 3BJOA 3PL8A 3U1DA 4UUSA 3QDFA 4BR9A 3QIOA 1Y97A 2FPDA 3QBXA 5BR8K 1R23A 4O8UA 1RNLA 3QYHB 3CCUA 3FXRA 1QVFM 3BTJA 2V75A 4DYCA 5GAHP 1XQPA 1PYVA 4CCMA 1VQNT 2VKDA 3UKRA 4XU3A 1AZGB 2YX7A 1WJ5A 2P1JA 1OI1A 1UHCA 3VEWA 1W5CC 1VAZA 4RCHA 4GY5A 2FU4A 4D8DA 4CERA 4DR2K 1LJ9A 4YDUA 5HK0A 2XIGA 1WJBA 4E1JA 1U1SA 1UJYA 3KIOA 3S3MA 3FHFA 2YHAA 2O2OA 2FB7A 4U87A 3JCMW 2ZKZA 3FHGA 3TR8A 2X6SA 4C8QE 3W6KB 5KRTA 1IG8A 3W2WA 2Z99A 4CJQA 3CDIA 3K4JA 4CCJA 3ZCMA 1WCMJ 5KVRA 4C30A 2QK9A 2YSQA 5FDLA 3R8EA 1RT3A 2L4AA 2DAOA 3BR0A 4Z4EA 3NNQA 2NOIA 4BEHA 3LMMA 1JLQA 3IWFA 4ABZA 2QA4I 1GUUA 4BRGA 2PFUA 1Q82C 1S72N 3BJ6A 5LJ5d 4BKXA 2AK5A 4FU6A 2ZPHB 3CCJQ 5E18F 3ZT4A 3WGIA 3ERMA 1PWTA 1S6LA 4LLGF 4LB6B 2O9LA 4M7DD 3BZ6A 5EGOB 2VVKA 4J83A 3PVQA 2XPUA 4XBFA 2YNIA 2FQ3A 1D8JA 4A62A 1BC7C 2R7OA 1QSSA 3K70C 3CVTA 1W36D 1B7TA 4NQWB 3WTYC 4AFSC 4FT8A 1Q9XA 1NGHA 2CP6A 2K9LA 4B9VA 3Q7BA 1WHMA 3KXTA 2O8KA 1PHTA 4RCBA 2ROTA 5B1BH 5DM7F 5DM7L 3DPUA 5E8GA 3ESWB 2Q0OA 1Y57A 3RMQA 4HUGA 4ZYHA 1OPCA 1M27C 2IT0A 2IS1A 2HBWA 1HKGA 1WQ7A 3CJBA 3ZSYA 1VQ6A 4ESBA 3BZKA 2XHKA 1YLFA 1VQKQ 5JI6A 3BDDA 3LSKA 3CO7C 2VC1A 2EV5A 4R79A 2VWJA 4KV8A 2TCTA 3TO9A 3C0BA 1UGQB 2LCSA 1VRUA 1CQTA 1P59A 4KMUX 3WNHA 3AVCA 3VGMA 3RSEB 2X9HA 3R4KA 2LJ3A 4CF2A 2FC0A 2K4JA 2Y1JA 3HZ6A 1VF9A 3SZGA 2FBTA 1FN7A 3VF4A 1OQYA 4C2TA 9ANTA 1VQOI 3MCAB 1QLYA 3E6CC 4UUVA 5CVJA 2XVCA 3C6AA 1S6QA 4C0FA 1FNNA 1YHQN 1KHCA 3J81E 3K70D 4PGHA 3DBRB 2W1OA 3G73A 1TH7A 2N8GA 3OYFA 3CJCA 1K8KB 2A41A 5M5WJ 1SL2A 2D9TA 3H0DA 1VSJA 3D6RA 1SKSA 3WGGA 4G7ZF 4O0JA 3F73A 1QHHD 4J9CA 4QIWN 1U3OA 5FLXO 4DSKA 2NOEA 3B6OA 2G8IA 3GLXA 1K4TA 3VU3C 1B8IA 2MK5A 4AMCA 4RS8A 2DBBA 4B9SA 3LDOA 1DU0A 5GAHJ 4L18B 3OMCA 2FBIA 5GIPA 2BZXA 1YITT 2BZ8A 3EG9B 1YITI 4DQ8A 3WXJA 1E3MA 1TWHJ 4EHUA 4BH9A 2Z2SB 4DWIA 2JMWA 1YQLA 1IDZA 4FWQA 3G25A 1LQ1A 2PMUA 3AKZA 3OA6A 2NS8A 1NMDA 2DBKA 1XTDA 2LBFA 3CCRI 1JJ8C 2KPMA 5J1RA 3BY7A 2YUOA 2YNFA 5AJ3K 3CUQC 3VKIA 4QS9A 4H03B 2EIFA 3KEQA 2VJIA 2P9SA 1RI7A 3L42A 3EFSA 3DLBA 3DXMA 1RESA 4RW8A 4K8ZA 3H3NO 2BTTA 5E3MA 5GP9A 3T5XA 1IXCA 1IRZA 2D4WA 2CUFA 2DILA 2M5WA 2DOFA 1VQLI 1PCXA 3ERED 2KRSA 4MDAA 2B4JA 1PJRA 5C4JJ 2DL7A 1VIEA 3PJRA 2YKNA 5HNFA 1DKGD 3CJTB 1S1UA 4C5IA 2X6WA 4WF2A 5EZGA 2FSJA 3DLAA 2XY8A 1D9DA 3SQ1A 4AUXA 4OMPA 1OPLA 4BJ6C 3WTSC 1UMQA 3BQZA 4FJXA 5D7UA 4C8QG 2LDUA 2E1YA 4AM3A 4G6QA 4FISA 3CCQN 2F4OB 1N75A 1TQPA 4JDSA 2EX3A 1WIEA 4PJ0C 2X6XA 1OQKA 1X43A 4V19S 3OYIA 1VQMA 3ENHA 1VQ8Q 1ORNA 2KIMA 3NPFA 2R5ZB 3LZIA 1RAGB 5EYRA 3FZHA 2F9WA 1OH8A 1QSYA 2OTLA 3MN9A 1U06A 4W5TA 3B6CA 1U5SA 3MKZA 1WXBA 4EPCA 1VQMI 3IDHA 2QDLA 2EINH 1DGWY 4EMKC 3R61A 1GLBG 1JXBA 4K41A 4B1XB 2VC8A 4C0DC 3CCJN 2FMYA 2QENA 4J6YA 4KITB 1D09B 3I4MJ 1LAVA 3CCJA 2DT5A 5H20A 5FPMA 4E7ZA 3QFPA 1RUOA 1ZHIA 5CYMA 1Z6TA 3I0XA 3HOXJ 3NHNA 3P38A 4Y15A 2WUSA 5CZ2A 1BJAA 2SRCA 3D2EB 2KDSA 2WOMA 1QMCA 3CPWP 4HX8A 1F9NA 1G2BA 5I2SA 3C12A 3GEZA 1MMNA 2F8SA 2PQ8A 2FX0A 2A3SA 2NYXA 2NOHA 2HVRA 2EHGA 1Q81R 3SQ4A 3D2FA 2RQPA 2RVCA 5B8HA 2ZO4A 1I81A 4KH0B 3PNVA 2R7QA 5KGXA 4HCKA 1KFSA 2OTJI 2CV0A 2COWA 4P55A 3L3VA 1DLOA 3CC2I 3SV4A 4AFUC 2ITGA 1GCPA 1BI1A 4CIFA 4OMYA 1FC3A 3NWSA 4NCAA 3S2WA 1K8KA 3X2QH 3WVEB 1KU7A 4E0DA 2QWNA 3MX5A 1KHIA 2QQ8A 2BXYA 2QCOA 3EAEA 3QUIA 4IIOA 4DEYA 1G15A 1YS6A 1KAZA 2OPQA 4ZYGA 1DIZA 3CMEI 2L89A 3R6OA 2DTOA 5DDGA 3DPLC 2OZUA 4N76A 2PTKA 5J4YA 1VYUA 1A6IA 2HHSA 3O9UA 4KI4A 2QUFA 4MLHA 4DBFA 2ZCFB 4A4EA 5CVVA 2F6CA 8ATCB 4I99C 2E5QA 1VQ5Q 3JCUC 1IKVA 3HOYJ 4Z02A 2H1LA 3G1MA 3L8BA 3FEOA 3GBGA 2AZSA 5IAYA 1JL2A 2V79A 3RTVA 4E7SA 3GBTA 3F9MA 4Q47A 3J7YP 4FJIA 3UKUB 3H9NA 3IQLA 4OIPF 4C3HJ 2HQAA 1UDLA 4JAXA 3JCMJ 3ML6A 3KHYA 2JPBA 3FXMA 3QLHA 1WFWA 3CWUA 2HF4A 4UVBA 3F8FA 1HOMA 1LDDA 4CK2A 2GXAA 1V1CA 1LFPA 3L2WA 3AVAA 3QZ9B 3CQ8A 2KKZA 3DMJA 1HYVA 2FSKA 3E9FA 3JXUA 4OWRB 1KQSA 4A0ZA 3JAMO 1XCBA 3WU2C 5B3SH 1XSDA 1YIJQ 2X6OA 1BW6A 4N9HA 1YQMA 2RHYA 1F1ZA 4Y92A 2CZ7B 1JKHA 4PUSA 1VQLQ 1ETWA 1OR7C 3FXUA 4KFCA 2LMJA 4B21A 2ECBA 2OZMA 5J2NA 3L0QA 3KX2A 3WVDB 4E9GA 3W2AA 2LX9A 2QYZA 1M1KU 3CBOA 3JR9A 4KHQA 3I55A 1D0ZA 4EEFG 1PNJA 2AZVA 2BANA 4DOVA 3H41A 1ESVA 2FNAA 2GIZA 4M3TA 2OPSA 1IG7A 3CC4T 3RMDA 3T1AA 5LJ5j 1YJNT 2COBA 4XTWA 4H0XB 1MHNA 3O6WA 1BQMA 4I0AA 1YWPA 2OYQA 2HS5A 4R0KA 5EG2A 3HKZN 1S7OA 1BOBA 3K1MA 3WG9A 5GAMg 2OA8A 1FX7A 2M34A 3KZBA 3CJQB 2HQXA 1VQ9A 1ZREA 5AQNA 3S9HA 1YE9A 4EMKA 1BR2A 1QKXA 5LHGA 1FOWA 1AKHA 3BJAA 5A2QO 2RHIA 2GGRA 2IVNA 1HYSA 1VSEA 4HNTA 3KZIC 4ZYDA 3MMVA 4KN4X 1ZGAA 1IGNA 2NVYJ 3DCFA 3J80E 4ID5A 2E1OA 1W2BM 1NTCA 5AZIB 2A05A 5KAFC 1XSVA 4MTDA 1Y0UA 1JL1A 4DV6K 3KD1E 1MDMB 4AF1A 4FSSA 4EMGA 2QDYB 4IFYA 2JHJA 1BB9A 5BRHA 1IHVA 3I56T 4BD3A 4J00A 4C8OA 3BT9A 4LH5A 3LAJA 5D5WB 4A2BA 4M78C 1R00A 2JMAA 2XB5A 3OMGA 2P0QA 2EA4A 1BM9A 2HDAA 4C92E 1VZ0A 5M1OA 3DEUA 1RRSA 5F1JA 1OH5A 4ZJZA 1NYFA 2C0OA 3NFCA 3VS7A 2FNPA 1WHUA 5EF6A 3HXMA 3CCET 1DEJA 2FXAA 3BROA 1I39A 4JD2B 2M0MA 3QP6A 4E6KG 3J7YJ 2VPRA 4Q5WA 4HV5A 4ENMA 4DR7K 1P7MA 2KJBA 2ADUA 4GY2B 1M1EB 1E3PA 1RR8C 3OSFA 3QKJA 4LC9B 4FM1A 1YHQA 1TNTA 4M78E 5K7ZA 5LJ3g 3TU5A 2L3PA 1B8IB 3QNNA 4J7IA 3GG4A 3R0JA 4CC3A 3K9KA 3NMUA 1Y71A 3J7ZI 5EC7A 3IH7A 4UVCA 2F5TX 2QEXA 4MIMA 2V7YA 3LSPA 3TL4X 4IEEA 2EZIA 2K85A 1LWEA 5J1YA 2MBFA 3FBIB 1T56A 3H9JA 4AD9A 1MNDA 2RQUA 4M4ZA 3PIOF 3PIOL 2XY7A 4LDUA 3VQAA 2RV8A 4PJLA 3MPUB 2VGNA 2IIMA 4EATA 3UDCA 1U5TC 2YUNA 1TK5A 2M87A 3OS1A 1HKCA 2LP0A 4CEDA 4CA0A 1IW7F 3WTXC 2QXFA 1WI7A 5DUIA 1OV3A 2ECZA 3JB9D 1OCPA 1H1VA 2BY3A 4YFUA 3ATUA 4XIDA 1BG3A 2PMZN 3OW2A 4EJOA 1X1BA 3B73A 2K3XA 3VF6A 1T2KA 3QEWA 4H5VA 1VQ4A 2CWEA 3K5NA 2WADA 5C15A 3OYDA 3ER0A 1KD1C 4YIFA 1I1GA 3HG9A 4PJOG 5KQ8A 2F4VK 2V9KA 4U88A 3RMAA 3F70A 1FJLA 2JWKA 3LPTA 1BOAA 1I1JA 1ON1A 2NUPB 2YX6A 2WSEE 4PLIA 4KUIA 1M90R 2PJRA 1VQ6I 2WC9A 1U6ZA 1R58A 4C0GA 2VIXA 4IFVA 5F0CA 4D6WA 1WZOA 1HKSA 5FLVA 5LJVA 1WBDA 3O3HA 5M5XJ 2LQKA 4FJ5A 2BUDA 1KFDA 5EY4A 1O57A 4F9OA 4IUPA 2M45A 1LJOA 2BE2A 3CD6I 2PI0A 3FR0A 2GQIA 4QCLA 2MYSA 2OPTA 4J9HA 3Q0WA 2P5GA 4FASD 2WB1A 5GADJ 4E7IA 1TP4A 5DM7R 4XQFA 2P9PB 3EL2A 1C0MA 4FE4A 3LDQA 1U6GA 3DLLA 3FZFA 1RETA 3MEAA 2VPLA 3PO3J 4DK9A 3A4CA 2VKNA 3SEQA 2FSNA 3M1FA 3RR8A 4HRIA 2DA2A 3HBTA 4NYNA 3K1NA 4OGEA 2DETA 1VSIA 5KK1A 3S1RJ 2VONA 2JTFA 2RHXA 3NGZA 1MA9B 2F4MB 2M1HA 1R5ID 3OA9A 4KH5A 4LFUA 4M3BA 4IDKA 5HS9A 3DWLA 2J06A 4AIDA 2QZ8A 1X27A 4RBOA 2IS2A 3D45A 4A12A 1RNHA 4CICA 1N27A 3LQQA 3CLOA 3MXIA 4YEJA 2W40A 3QXEB 4DSLA 1RT7A 4ZGJB 4CHQA 2EFIA 3H5AA 3O9RA 1TS9A 5CKTA 1TW3A 3F6VA 2NVQJ 3IG1A 1ZR2A 4AFQC 1OCTC 3OW2M 4J2EA 1Z67A 5F04A 2Q2EA 4OIQF 1WH7A 5GANd 3NGYA 2OTJA 1HQEA 4QW2A 1JBMA 1VQLT 2GV9A 2DL4A 3PQJA 3SFMA 5HDNA 5LJ3d 1YIJA 1K9MU 4KHSA 2W42A 3M58A 3M0RA 3N4PA 3LSGA 3K9TA 3RRGA 4BRKA 1F36A 1PKTA 4M77D 3S1QJ 4XLAA 1S8NA 2AT1B 4YIIA 1MH3A 4EJZA 1YJNN 1D8YA 2KROA 3CCVN 5JHFA 4M7DA 2JG6A 1U9NA 1N33K 2K9GA 4QWQA 1VSMA 3ABUA 1KC8O 2CGHA 4CZZA 1W2BP 2KEAA 3K4BA 1IAWA 4PQUA 2F7TA 4XH1A 4ENKA 1G99A 3CCMA 4B9TA 4KREA 4DV7K 5CZ1A 2I8DA 3H45C 3WXKA 4UC4A 1BJZA 1VNDA 1K9MR 3CERA 4UY8O 4ISFA 3ZEUA 3L00A 4A3LJ 4JS5A 3A5NC 1NG7A 2KRFA 4EJVA 1MUNA 4ZNXA 1XWLA 3BP8A 4Z6YA 2ESHA 4QSHA 2H8RA 4ELYC 4C2UA 4XSXF 4HNVA 1Y7XA 2GELA 2O0YA 1DU6A 2PYJA 4I01A 3JSPA 4KRTA 4B3MK 5KHDA 3OYBA 2ZAEA 4ID1A 2RQQA 3D7EO 3JCMd 3HRSA 1TLHB 3BZCA 1NKCA 3MZHA 2NS7A 2YR2A 3DXMB 3CWSA 1VRLA 4KBOA 2XD0A 3DTIA 4QVCA 2EZHA 3HSRA 4CGZA 4I09A 3A01A 4JRPA 3V6DA 1VQKI 4MQ9F 3JAMZ 1U2VB 2HWVA 4LK1F 5SZTA 3P9IA 1YCSB 3WNEA 4M63C 3CQTA 1JLFA 4BRNA 1SRMA 4O5FA 1ACIA 3FRNA 1UJ0A 5JS2A 2ZMEA 3PFYA 1YJWN 4U7DA 1RLPC 1I3AA 5AQQA 3ZEUB 1RT1A 4O55A 4L0YB 4F14A 2OTLQ 2KYMA 1BU6O 2R7DA 7AT1B 3KFVA 1XDSA 2WAQN 2YWWA 1B72A 3H6EA 2P9PA 1I6XA 4GO1A 1L3TA 1U2VA 2M1BA 1KQ0A 1ZUYA 4CGDA 5TKWA 4WF9L 1YITA 2GF7A 2EYWA 3SHWA 1G4DA 1JKPC 1WI3A 4JI2K 4M7AC 3MEWA 3E1SA 3LFUA 1JKQC 4A3KJ 2ZPGB 3E01A 1PVEA 1CZAN 3O3KA 1JXOA 5GAOn 2E1MC 3GF5A 2HSPA 2IW5A 4KIGA 3ZCOA 3LWIA 3HRUA 3BGRA 4CH7A 1AVZC 5LJ3j 4KNYA 3I5UA 1GVDA 1KFZA 3UE5A 3RJPA 2HMIA 5DLOA 3RCOA 2FBXA 1S72I 5F0FA 4LFAK 4ELTA 4B9WA 2ZD1A 3B02A 3FHNA 1YG2A 1PG5B 4NB5A 3LLRA 3J80K 2ZE2A 1EX4A 2L2PA 4DB3A 1WFXA 2ZGZA 2KFDA 2DA5A 4XLEA 3ID8A 1NG9A 4AM7A 1WRJA 3WG7H 4M7AE 3M5AA 3GFJA 3THKA 3GW2A 3QBWA 3A1PA 3I59B 3I8DA 5CYVA 5HS8A 1S29A 1GVJA 3Q0VA 1YIJI 1JO8A 4LF9K 2JVHA 4HQEA 2V26A 3EY1A 4GDFA 2W6LA 2ZNZA 4HWIA 3RBBB 4DR1K 3KP4A 1FP2A 3L2CA 3A5ZB 3HOVJ 1Q86U 1KAYA 2AP1A 1L3VA 2ZMEB 4AG1C 4XQ3A 2P9LB 2QAZA 1NLVA 1S9EA 4C92C 5C4XJ 4AH9A 1W6XA 3TSQA 2XPWA 2EYZA 2OAWA 2LF7A 4IUQA 1Y96B 2VCPA 4CI6A 1NGCA 2YRVA 2A42A 3ZP5A 2DXCA 3KP6A 2LKXA 1MPGA 3CMEQ 3H3OB 3WQTA 2BUPA 6PAXA 1OOTA 4NOYA 3THWA 1EF4A 1PP7U 2M7AA 1OMIA 3T8TA 3KZYA 2G8FA 4E7JA 5J26A 3TTFA 2A6HF 1Z25A 3TPQA 3ATVA 4EP5A 4OB1B 4KHPK 2HBMA 3CYMA 1VQOA 5D6WA 2BE5F 4DUYK 1TWAJ 3KP5A 4J5YA 3H1QA 5JFRA 1VQON 2BGGA 2YNGA 4KHYA 2JS2A 3NH0A 1L5UA 2P84A 3A5MC 4X64K 4Y3OA 4A3DJ 1W5TA 3ISPA 1UB4A 3BUZB 2OFIA 2OTLN 1NPPA 3I0TA 3EG0A 3SEMA 1BCMA 4HHTA 2YV0X 2UWMA 2P7CB 3KP7A 2E20A 3O80A 2IA1A 1AU7A 3H0GJ 5BOXA 2V1RA 1KG3A 2LY2A 3MDQA 3HFOA 1AZEA 1G3TA 1RAIB 1Q7YO 1NJZA 3RDVA 3ZRGA 4ISGA 2X51A 3DRSA 3G10A 2K9QA 3JRFA 4CBWA 4FYWB 5GIOA 4DBHA 4CJ4A 3TO7A 4RGSA 4Z0UA 4C92G 1K8AC 3MK6A 2BZYA 5J3LA 2ZQBA 2FJ1A 2Y4XA 4H0PA 3TMOA 1IDYA 4JK7A 2P7VB 2D0AA 2O31A 5HKCA 1YFNA 2VLAA 3E1YA 5LMUK 1SV5A 5LJ5h 3P9KA 5BMZA 3OJUA 3C0CA 3TAMA 3DB3A 2E2PA 2MC4A 3T1BA 2XDVA 4FOEA 3A03A 1BCOA 4PJJA 1Q8IA 3SCXA 1R0AA 4RLQA 2OI3A 3VEZA 5BQTA 2E19A 5GPAA 2QQSA 1K0SA 3EN9A 4RAGA 4IUVA 1JT0A 1V4SA 5D5UB 5KCMA 1S3XA 1YQRA 4RM3A 3DBLB 3CMEA 1TW2A 1YNZA 2A1RA 4BVOA 2IOCA 3ZSZA 1X3MA 3FZMA 4A61A 3MN2A 4Q5SF 4UV8A 3F23A 5LMNK 3I4NJ 3RKYA 2JTEA 5ILVA 5E26A 4M3XA 3SZ2A 2DYBA 5H2FC 2DD4A 3UT1A 1X75C 3TQNA 4XU1A 2KLOA 4HF2A 2Z1JA 4FJHA 3OYJA 2QG9B 2G7UA 1JLCA 3J7AF 4KGVB 1B34B 2RN2A 3L2RA 4DV1K 2EZLA 3HSEA 3JS6A 4MZPA 3SWNC 2KY9A 2D5RA 2VXDA 1K73R 3AVKA 2W7NA 2F5FA 1G3WA 3F8NA 3CVSA 3N4QA 3CP8A 1P2FA 3TDUC 3VODA 2ZJ2A 1LFUP 4I7HA 2WWYA 4HF1A 4CE9A 2VL8A 1H92A 1WJEA 3EUHC 3J81K 3S16J 2YRDA 5AONA 1TWGJ 3SBTA 4CJLA 1C0FA 1YVNA 5FW9A 3VQ5A 3NAEA 3VQDA 1DQUA 1X19A 5LJ3f 2IAJA 2WA0A 2LZ6B 3K7AJ 3GZ6A 1Z05A 4BBSJ 3L9FA 2M8EA 3B8AX 3WXIA 2HVIA 4S05A 4FLVA 3H35A 2JVVA 2KL4A 2A08A 4FZXC 3REOA 4DR4K 1O1WA 5CKDA 3QFUA 3UB5A 3AL0C 4FWMA 1J59A 3GTQJ 4OKEA 3AVMA 5FPDA 2CQ7A 5HL7L 2OTJN 2R92J 3S32A 4IG0A 2LK2A 4RDUA 4BQOA 1ETKA 1ZLJA 2B5JA 1Z1DA 3NF6A 4H8KA 5BPIA 3SXYA 1JCFA 4F3TA 1ZG5A 3GVAA 3M1EA 4X1EA 2YUQA 1QZEA 4MTEA 3QYBA 3ISNC 1N8RO 1HSTA 3LSRA 3VS2A 1D3BA 1J9IA 2UV1A 2PMHA 4BY1J 3ASOH 2LT1A 2E4LA 4M3ZA 3VESA 1IV6A 1KLMA 1HSJA 5E1ZB 2EGAA 2MIOA 1W0UA 5L8RE 2IS6A 4U67L 3LM2A 3PO2J 2CUEA 3LDLA 4UQGA 4M77G 1X58A 3OW2S 1ETXA 4CJFA 5LL6S 2VE8A 5DCMB 2XUBA 1LDJA 3FKJA 1DGKN 4OLAA 3O8HA 1LWVA 4O5VA 1UG2A 3CQZJ 4G7HF 1IXDA 4N41A 2ME6A 1E7OA 2Y9ZA 3VQ7A 1O3TA 2UXCK 3HHTB 3M07A 3UWNA 2LDMA 5FKKA 4Z4CA 5IYDJ 2D0QB 4GKKK 4YIRX 1BI0A 4OU0A 1QNTA 1YRNB 3MN7A 4QAGA 4YOTA 3ZSOA 4BY9C 1VSKA 3H3UA 4OLBA 2ELKA 3L4QA 3C7NA 4CYDA 1U5TA 2X3XD 1X01A 5K14A 3EH2A 1VQKA 2XRNA 3V9SA 1IXSB 5C2FA 3PM1A 1AHJB 3QICA 1ZH5A 2QWPA 4L9NA 2ZWHA 3QJ6A 4NCBA 1WNLA 4MQVA 1K9MC 4BRMA 3A2KA 3WU0A 2HNDA 1IV0A 1VQ5N 1XTAA 4V2GA 2XDBA 4EW4A 5JVHL 3QPHA 1VQ7A 4N9IA 5K5QA 3GFIA 1AKHB 4F16A 3VS5A 5GMKj 1BI3A 4FIBA 1Z3XA 3LA2A 2DOAA 1VRTA 3TKYA 5L23A 5KNLA 1UHMA 4KHWA 2V52B 4W5RA 2JA6J 2KP6A 3P4IA 4BG9A 1X1CA 1N3CA 3K4KA 1NGFA 1T39A 3GTKJ 2QA4T 4CC7A 3U9ZA 5ADXH 2EIMH 5AZJA 2E1NA 5C2DA 2XASA 3CJ1A 3G0QA 1KSWA 2A40A 4EM0B 2G0EA 4OB0B 1B92A 2K4YA 4YORA 1WHHA 4HEA2 1W0HA 4BG8A 2A6AA 4XAXB 1HRHA 2EBIA 3QDRB 1UHFA 4B3SK 4CZLA 3OY9A 4FJ7A 1YJWT 3LAPA 5GAOr 2K5LA 4IURA 1QGPA 5KYYA 1KC8C 1QS4A 4XLFA 1M90O 3CP2A 4CFAA 1VQPT 1ZBLA 2C6YA 2ETJA 2L0KA 1ZA1B 2ZFWA 1GOCA 3WTUC 4M73A 3RPUD 5I9EB 1J5OA 3L1AA 3FM5A 4KHUA 2F8TA 3ME9A 2AXTC 3NH2A 1QZ6A 4JKBA 1WPYA 2HD0A 3RNJA 3P8HA 2L7MP 2A5WA 4NXNK 1HW2A 2P0WA 1QVGS 1RAEB 3VOVA 2YU3A 4PUOA 3EE8A 2EJ9A 2MD5A 3PX0A 2EIKH 3LQRA 5HLIA 1QKWA 3K58A 5CHIA 2ID6A 3QOEA 1SPKA 4WCIA 4CZFA 1TK8A 1RUNA 4PSWA 3UPUA 1OR7A 2JUCA 3O5ZA 3MN6A 4WXHA 1BW5A 1YUWA 3CMYA 1MBKA 1Z7UA 2PX9A 2K9MA 3R2XC 2YNHA 5AQPA 4NQWA 4BRAA 1IHWA 1O7FA 1XOVA 3OWTA 3QPLA 1VQ8T 3NTHA 1AT1B 5AIPA 1VQ8N 5AQLA 1SD6A 3AG4H 4B1UB 1FSEA 5GAN8 4RCCA 1PU7A 3OIPA 2G6FX 4A5AA 5KPTA 1NG2A 1NGNA 5CO7A 1K73O 3LGFA 4BRHA 3SMPA 4DQ2A 3M6GA 4JHDB 1TTHB 2FE3A 3F21A 3S17J 1ACMB 3M59A 1LOJA 3G4ST 4YELA 3TSWA 2V1XA 2BY0A 1TC3C 1XG7A 3G4SN 3JAMK 2AKKA 2DRKA 1NPRA 3X25B 2JA7J 1VQ8A 2DF6A 3IWZA 3OMYA 3EG3A 1Q81O 1FKOA 3ZQLA 1S3JA 3SQ0A 2L54A 2MMPA 3H0FA 1SKRA 5IN1A 2VG7A 1G3YA 1A04A 1TUCA 3HPGA 1X9MA 2EFOA 5FWCA 4LG3A 3EDPA 3TAQA 4XTZA 1VQNN 2P4RA 4HVJA 1I4K1 1SF9A 4CDGA 2JOYA 3I9QA 1QQIA 3OV8A 3V8JA 4RTYA 2M0OA 4CESA 4FWNA 2DVJA 2YUSA 3KNTA 2NOGA 4FL6A 4IHYA 2FPFA 4XH4A 4CJRA 1YQAA 2B8AA 4PZJA 2P9SB 3OH6A 3SI6A 1UE9A 1WX6A 1K0XA 3OBWA 4YFKF 3VYUB 1JJ2M 5D8LB 2CJJA 1NM7A 3HOZJ 2KIUA 5CVUA 2BKDN 4YPRA 2E4HA 3ZX0A 1YTAA 3DLEA 2XSDC 3LP1A 2FEZA 1YS7A 4Y1DA 2DODA 1HDDC 2GUIA 4C1NI 1EXQA 4K8XA 5J2MA 3JRZA 2XAJA 4YRVA 1HNWK 1KQSS 4ELUA 4ZN1A 5AQIA 1ZBSA 2O5RA 1YJ9T 2CSOA 2NUTB 3FKIJ 2VUMJ 3QG1A 3HVRA 1XGSA 2O7OA 2UXDK 3HGGA 3NBPA 4IQ4A 1NM1A 4QS8A 4J01A 5AN4A 1W2BA 4AIJA 2HPIA 1M3BA 1HMVA 2NXNB 2HVQA 2DBMA 2Z1DA 3CCST 4ZN3A 1UUEA 3KETA 3FJ5A 3E9GA 1WNSA 2NVXJ 1PSFA 3ZT1A 3KLHA 1N34K 3QP5A 4DIQA 3HL8A 1Z9CA 2DPUA 4AI5A 2K86A 2RJDA 3C2BA 2EQJA 4J9EA 3TAEA 2Q1ZB 2X4JA 3HBLA 1XCVA 3ONQA 5IH2A 3A2FA 2KDOA 1IREB 2K3PA 2K9NA 3CF5F 1NZ9A 3CF5L 2L2OA 1UEBA 1RDDA 4F8RA 2XGEA 2HL3A 2WAEA 2VXEA 3SUPA 4Y0WA 3I55N 1TK0A 4HUFA 3KP2A 2G8HA 1IUYA 1DPRA 2ZXHA 3M8QA 3G6EQ 3AG3H 2KFZA 2QYOA 1OEBA 3H1VX 2JRTA 1P4XA 3G6EA 4AHRA 4IOCF 2R7VA 2KIQA 4IOCL 3PX6A 2DQLA 2B9SA 4FTHA 3RPUA 4NXMK 3ZQIA 2ZPEB 4KIBA 3OQ5A 4HA8A 3D2FB 4GLKA 5AQFA 3HC7A 4B47A 1AWOA 1B3QA 3LP0A 1HK9A 2MLGA 1WJCA 5FKMA 1NK7A 2P81A 4WFAL 3OHRA 4CK3A 2VB6A 4XLPF 3RUXA 3AG2H 5FU6B 4OFEA 3AVNA 3D0PA 3P8DA 2PVDB 1U84A 5BPMA 1T7PA 2CSIA 5GAMj 4A3MJ 3LP3A 3I33A 1C6VA 4XRSA 2J5OA 4E1MA 4RTTA 4A5NA 1YI2I 2VT2A 2ZMEC 3ZBDA 1FIPA 4GBQA 1QHAA 4BQZA 2F2EA 1VUBA 1MBEA 2VBYA 2HKXA 5I2MA 2ASOA 3ITHA 5FLXE 1GLCG 3VB2A 5J1UA 4IPAA 4EGZA 3CJAA 1VIFA 3ZT3A 1L3UA 4N5SA 5KTQA 3LGLA 2RPIA 2P5OA 4DTSA 4XTVA 3NARA 1ETOA 3BPXA 1OYYA 2VASA 1NJIU 2K5IA 2RQTA 3CIPA 3CQXA 2IGKA 3FF5A 1IBMK 4EW0A 4GGGA 3Q3SA 3V8LA 1LB2A 2QA4Q 5IT9E 2GOXB 4Q48A 4UB8C 3QQAA 1H9GA 4PJNA 4OAZA 1UJ8A 3RPQA 1RDUA 2D0PA 3VPZA 1VYTA 3MCZA 5CVRA 1KD1U 2GWKA 1KZHA 5H6RA 4JEPA 2X6YA 2ELJA 2DZ9A 4ELZC 2NRTA 1YJNI 3ZN0A 1SG5A 3CCVI 2RGVA 3E6MA 4WFBL 3V4IA 2KZMA 2D1VA 3MP6A 2E5NA 4M78D 1K76A 3AO2A 1E4GT 1MV0B 3EFRA 2R7FA 2HHWA 1VSLA 3K0SA 4RB0A 1OCRH 3JRHA 3JRGA 2EA2A 3FIWA 4LD6A 1A5WA 4JKGB 1T33A 3OYNA 2DDBA 3H36A 3ZMZA 4ATOA 1O4XA 2G3RA 3QBYA 4M77A 4Y17A 2VWKA 1IRFA 4U0VA 1UHWA 1WJSA 1B6AA 5AQVA 1KG7A 1TSFA 1K6YA 3OS2A 1JLGA 1HNZK 5E3NA 1VQ9T 4DQQA 1UELB 4C92D 2CW8A 3RDIA 4DG1A 4WXDA 3KK2A 3JCMP 4C8MA 5DD8A 3NE6A 4OMNA 4DBQA 5JMVA 4CZMA 2DPDA 5IP6A 2Q0RA 1YP5A 2JSPA 4XTUA 4M3RA 3LALA 1MU2A 2YHYA 3CC4N 5GAEJ 4CJVA 4RWTA 1QQMA 1S1XA 4UOBA 1WEGA 2OU2A 3PNYA 1UA1A 1D0YA 1VQ4Q 1BWFO 1WHLA 4XK4A 1WVRA 4I7FA 5L3GA 1QPMA 3HUGB 1RAAB 2IP2A 4JI5K 1X1AA 3U1KA 4AFZC 3U9GA 2MCNA 3GIBA 1QO0D 1N8RR 4A0YA 3LPUA 1SQKA 3GUDA 4PCQA 2MPXC 3VWBA 3MEEA 1YJWI 3IAM2 3NAUA 5C3EJ 4OPKA 5I42A 2O8CB 1T03A 5HVQC 4AHUA 3DB4A 4BNCA 2OJED 4M3YA 4BAYA 3QYGB 1M3QA 3EO3A 3CJ7A 2E60A 2HKOA 2PFBA 3W0LA 4JKFA 4BVPA 4M75F 3N4MA 4IFEA 1G59A 4KMFA 4FPAA 2E6ZA 1ZYQA 1S72A 4NLBA 1JXEA 5F08A 2QTDA 2FYKA 1VSFA 2YHXA 4YOQA 3CC2T 4CJEA 4D8KA 1ONVA 1GLLO 3IHOA 3KYDB 4P9FA 3SJMA 4X62K 1WSJA 1T05A 5LGNA 4IXAA 3ABKH 3B6AA 5JLHA 1L3LA 3UATA 4M3DA 2CP5A 4RTUA 2KK4A 4BYYA 2ABKA 4Y28E 4RTVA 3A0HC 2QI2A 1WWXA 1VQ7I 1VQ5A 2LQNA 1YF5L 1OVQA 3D4VA 3TBIA 1UAAA 1L3SA 2KT1A 4V2FA 3TSPA 4CECA 3C3WA 1R0CB 2FZCB 3CC2A 2IJLA 5C0MA 2E34A 4XLNF 1B4AA 4LE9A 1K61A 3LDNA 1SHFA 4Z4IA 2YCHA 1NH3A 1LDKB 2MC3A 1M1KR 1X69A 4E19A 3HSFA 3ALYA 2JNGA 4A3GJ 2D0CA 2XAUA 5JVGF 5JVGL 1IN8A 3LWFA 2DT7B 1T95A 4A3JJ 2NRAC 3CCRN 2DIGA 1XGOA 4GYIA 5FO5A 3SD4A 3JB9G 3T69A 2HNHA 4DTMA 1VQ4N 1OZ2A 4KAZA 2NOJB 3QPSA 2A68F 2BVLA 1FWZA 3G1JA 3JB9I 5GAN4 2H6BA 1FOXA 4KULA 1KQJA 3AL0B 1YIJN 5LHHA 4BR4A 5C42A 1MNMC 4FJLA 3G71T 2DTIA 4CCHA 2OFKA 4GVMA 2X4XA 4RW9A 1E3HA 2R5YB 2CS3A 3K0LA 2W04A 4JLIA 3TVTA 3QRFF 4ZC3A 2PMZA 1QWFA 4YOXA 1H89C 1TAQA 2GXBA 5ILUA 3JCMf 3WTZA 3M5RA 4BRPA 4PIIA 2H3JA 3MCPA 1QVFP 3KK7A 2O4XB 4MEYF 3BCAA 2ZF5O 1AWXA 1SMYF 4L9JA 2GFUA 2E64A 1KQSM 2D1XA 4LOCA 4YG2F 1XC9A 4PL6A 1EH6A 3F2KA 3K4LA 4PKIA 2EZKA 1UGVA 3G6EN 3ULQB 1ZLMA 1RCHA 4G7OF 1HPZA 1I0CA 4BE0A 3QIPA 1QTMA 3CCEN 2OD5A 3IH4A 2P5VA 1RT5A 2DM1A 3EZ5A 4CCNA 5GAEP 3HB9A 3CXCS 4KTZA 3CXCM 1NOZA 4C9YA 4DCHA 4JJNK 3SYTA 1I27A 1K73U 2BY1A 3M4YA 3QEXA 1OLTA 2DOEA 5ICEA 1V3FA 3TP0A 1MH4A 2CREA 4B43A 2KRMA 2F2XA 5J2PA 3K5LA 2IA2A 3R1XA 2DU9A 3MX2A 4BY7J 1SUQA 3K2AA 3VYGA 4ETSA 3ECOA 1XB4A 2KIFA 1HJOA 2X4HA 4I6ZA 1UGRB 2KTQA 5HRRA 5HNHA 2MAMA 1WSHA 3EKSA 3MKWB 1LEAA 3F3XA 2XAQA 2F96A 1PDNC 4D5FA 4BQQA 1TUGB 4IF4A 3CCRT 4HBLA 1PSEA 2GTJA 1JUMA 1C0WA 3NGPA 3REBB 1ZYRF 3H3VK 1HNIA 2ME0A 1XGMA 3HK2A 2V6CA 3KKRA 1W5SA 2MA3A 3IH2A 4BY6C 4N4NB 1IO6A 1YI2T 4ON0A 1U9OA 2JZYA 4KTWA 3AO3A 1W4SA 4DLEA 4BGAA 3VPRA 1J54A 4DSJA 3G71N 2JWTA 3SFIA 2J05A 1GLJO 2HYFA 3K2ZA 4CGGA 2M16A 3FC3A 4FLXA 2OAZA 1FPQA 1N9RA 2H8WA 2M02A 4FYYB 3JCMe 2Z1IA 1KTQA 2NRRA 4HUEA 1BI2A 4XONA 3EUHA 3KUFA 5GMKl 3U23A 3O9QA 1DP3A 2Z33A 2X4WA 1P9QC 2W48A 3NWTA 2KSSA 3KVGA 2BYVE 5DY9A 1A5XA 3OIOA 4RGUA 3TGNA 4PHTX 5J8FA 2RJEA 3TQ7P 2A1SA 2PUOB 5TRDA 4FLUA 1FW6A 2K5CA 2ZFUA 1FBUA 5BRFA 2RK2A 2IIRA 3V9WA 4Z88A 3D2EA 4DQIA 1QCNA 4C92F 4IEIA 2DA6A 3G3ZA 4KHNA 1XQSC 3GP8A 3CMAN 4DHYA 4PL7A 1NK6A 1QVFS 4MDWA 3F8BA 2W10A 3BG9A 1WN7A 1N32K 2ZNYA 5ICCA 2E70A 2K2VA 1MBHA 2V8JA 1ZRFA 2LTOA 1S7AA 2EGEA 2XGXA 2VUBA 4GYGA 1EV7A 3PQKA 4E4HA 3VEOA 3CCMN 2G7HA 1Y1WJ 1IKYA 1ZTRA 4EMHA 1E17A 2RPNA 2HEOA 3J7AP 3JRDA 3ELKA 3SYZA 5TJJA 2LF8A 3PFSA 3WODF 1T08B 2FPEA 3I54A 2KGTA 2P9KB 1H8AC 4EJYA 4CJ7A 3AVLA 3COAC 2HZDA 2HBPA 1KVAA 2DEQA 4LK0F 5FROA 1HSQA 4JYKA 4LNPA 1T38A 3I53A 4CZIA 2Y1IA 1HJRA 5J4VA 5IYBJ 2KVQG 1TZLA 2D1KA 1RL2A 3TAPA 2HDDA 2NOBA 4IUTA 2CH6A 4KICA 1IV8A 3UA7A 3SFZA 1TU0B 4TSXA 4PLLA 5KRSA 3PUBA 1QP2A 3W3CA 2EFNA 3DOKA 4EJUA 1ZQ3P 1J7KA 4MHGA 2BE7D 3HI0A 1YJNA 2D5VA 2XRLA 1OU9A 2V1UA 2GEMA 5FGMA 3Q9VA 3H08A 1M3CA 2Y0MA 2HNYA 2HSEB 4XM3A 3CBPA 3FE1A 3BFMA 3LAMA 4M75C 3UA6A 5GAN2 2ZJQF 4BREA 1LW2A 2ZJQL 4IG3A 2HEQA 4CF8A 1EKEA 5GMKm 2W82A 4F7UB 1U78A 3FIFA 3N97A 3CCQA 1KG1A 1C1AA 2VWBA 1WZ2A 3ENBA 3LFKA 1VK0A 1LWYA 3VEPA 1CZBA 1N8RU 3CCLI 3CO6C 1N5YA 5D6EA 5CKFA 2W4SA 3OTOK 4BHCA 4M41A 2LVMA 1SANA 1P4WA 1RR7A 4G94A 4OPJA 4BDZA 1T8EA 2Z9OA 2KRNA 3A01B 3AG1H 3SAFA 1XSXA 1OX8A 4BRLA 3CPFA 1NKEA 3JREA 3E9OA 1SVLA 2LC4A 4LXCA 1U0JA 3HIFA 3QU3A 3FBNB 1SHGA 3JCMX 4FT2A 4JKAA 1MUYA 5CVIA 4IIMA 4CSWA 1CXQA 4F3QA 4ZTFA 1MGQA 3KWIA 3AO1A 3OVNA 4BDPA 4JN4A 4LGWA 1C1CA 3L2VA 3VS4A 2L9VA 4FL9A 1VQ7T 1SL1A 2AS5F 1W7PB 4BROA 4F7UA 3WTTC 5AQOA 1Z7LA 1MGTA 2QKBA 4JK8A 4FLTA 2O4GA 2DEUA 4L5GA 2EWSA 3V7RA 4NLCA 3F8MA 1BA1A 3OS0A 3JRCA 1BA0A 5GAMh 3O8MA 4EZ9A 3AGRA 1NJYA 3QWYA 4O3MA 4FT4A 1ASVA 1J5YA 2AHJB 4KB1A 5AQZA 1TVRA 4QLCU 1BI4A 2CZ1B 1UCRA 3VV0A 1LW0A 2PY5A 1YHQT 4JKDA 3M53A 3MAQA 3MEXA 1JRIA 3RKQA 2HYGD 2F9TA 1HXDA 3MEVA 1YQKA 5FLXK 3CMAQ 5CY4A 4M71A 4A54A 5GAOm 4DFKA 2QEXT 1X3ZB 2YLCA 4XU2A 1RIOH 3OYYA 2K6DA 1GFDA 3E5QA 3E0JB 3SEZA 5GAMf 2HOSA 1IXRC 1D1BA 4CZCA 2ZBKA 5GAOq 1XJWB 3J81Z 4B8XA 1SZ2A 2IC3A 2D45A 2QWLA 2O8BB 4IO9F 4IO9L 2DTUA 4RTXA 1KXPA 1XX5A 4BR0A 4OINF 1MV3A 2G9WA 3I5RA 1FY7A 1A35A 2RJCA 2ASPA 1A36A 2R58A 4XRMA 1GOAA 2CW7A 5FU6C 2L9NA 1QE1A 4JI7K 2XC7A 4R1HA 4CIGA 5FU7B 4W97A 3KLGA 4UNFA 3VRYA 3JSCA 1TBXA 5A0DA 1R77A 1EA3A 1W97L 3I56Q 1WHGA 5BS6A 5HOOA 1N9SA 4WQ5C 4A6EA 2A61A 2DRMA 5AQGA 5HBMA 2M9HA 1GXPA 4HVWA 2LNVA 3FMRA 2EQKA 2VJ4A 1ETVA 4ICLA 3JTGA 3NEUA 1RI9A 5JS1A 1R5HA 1G83A 4CBXA 3CMAA 4IQJA 4C5EA 4HYEA 4EP4A 2O01E 1WHKA 2EB7A 3PIPF 3PIPL 5AQKA 5LEJA 2VWFA 1U8BA 2CV1A 4RKUE 4LF7K 2O8DA 3SUOA 4DUZK 1AA7A 4DV0K 5J3BA 4FPBA 3K4MA 1VQ8I 5ECAA 2GWRA 1SAXA 1TKDA 2JVGA 2CH4A 5CQXA 3B6PA 3M9AA 4CHOA 5EDNA 1D5AA 4GCVA 1TTYA 1ZXOA 3CD6N 2HZYA 3J80Z 1NKBA 4L9TA 1V5GA 2CV2A 4FJJA 3GL1A 4FXDA 5IT9Z 4H5NA 2RNGA 1D5YA 1P7JA 1SEMA 1QCOA 5C25A 4B23A 5IHKA 1RUWA 3L4IA 2RD1A 3MP8A 3WHBA 2RK1A 3TAGA 3HM8A 2RREA 5F0HA 3VS6A 2MH9A 2K5FA 4FW2A 1D1CA 2BBYA 1K79A 1TQIA 1VQNI 3JCMQ 1OVYA 5ADXA 1IO2A 5IYCJ 2IGMA 4FCYA 2IPOB 3BR2A 4DTXA 2DA1A 1IRGA 1UOCA 1SAZA 3C2HA 3O1WA 4B1ZA 1NG6A 2FRWA 2LX7A 4OMQA 1NOYA 4Y13A 4BWMA 3DTKA 1P92A 5A0GA 1FLIA 3L3UA 3CM5A 4NBQA 3CCUT 1KSPA 1Z6RA 3PV8A 3M8RA 3WE2A 1R1UA 3K10A 2HDWA 3RYPA 1T3SA 3M0TA 2H09A 4XMYA 4AVZA 1V4RA 2OTJT 5KYUB 4DTPA 5J47A 2QASA 3AA2A 5EEHA 2K9SA 1CF7A 4IRGA 4ITVA 3M9QA 2QQRA 2CQNA 2IG0A 2W24A 3DF8A 4LF5K 3K4NA 1WQ2A 5AQUA 4WFNL 2Z1HA 3OYEA 3RKXA 2XY5A 2NNNA 4ZZLA 3M0QA 4CHNA 2YDLA 1ZQ1A 3QODA 2LSOA 3T9NA 1Y0MA 4GVEA 5LLQA 1KA8A 1RGIA 2HMPA 5I22A 4JK1X 3A8YA 3DLRA 1DUXC 1T6DA 2VKHA 2DE0X 1M30A 2KRCA 1Q86R 4B3XA 3DXJF 1K83J 3CD6A 1SAUA 4LG0A 2DYSH 4C8QA 2FZKB 4BUPA 3M1CA 4DNCA 2EK5A 2KZVA 3JSMA 1KQ1A 4E7KA 2ECCA 4WE1A 2WV1A 4BHPA 3PIOA 2V8IA 5LJ5f 3VYRB 4MGRA 5IXFA 4CJSA 3F8CA 2Q97A 1KD1O 4GMJB 3RR6A 4FWLA 5KYYB 1GCQC 2HR3A 2XKOA 3OSVA 2OF7A 1TNSA 4J8FA 5AQRA 4U0YA 2L0AA 2NLUA 4DF8A 4L59A 4ME7A 2CGKA 2PEXA 2EYYA 4UV9A 1JHHA 3PX4A 3HSBA 2FD5A 2CQXA 2O6GE