3OYKA

Crystal structure of the pfv s217h mutant intasome bound to manganese
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
368
structure length
368
Chain Sequence
LDAELDQLLQGHYIKGYPKQYTYFLEDGKVKVSRPEGVKIIPPQSDRQKIVLQAHNLAHTGREATLLKIANLYWWPNMRKDVVKQLGRCQQCLITNASNKASGPILRPDRPQKPFDKFFIDYIGPLPPSQGYLYVLVVVDGMTGFTWLYPTKAPSTSATVKSLNVLTSIAIPKVIHSDQGAAFTSSTFAEWAKERGIHLEFSTPYHPQSHGKVERKNSDIKRLLTKLLVGRPTKWYDLLPVVQLALNNTYSPVLKYTPHQLLFGIDSNTPFANQDTLDLTREEELSLLQEIRTSLYHPSTPPASSRSWSPVVGQLVQERVARPASLRPRWHKPSTVLKVLNPRTVVILDHLGNNRTVSIDNLKPTSHQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PFV integrase
publication title Molecular mechanisms of retroviral integrase inhibition and the evolution of viral resistance.
pubmed doi rcsb
source organism Human spumaretrovirus
molecule tags Recombination,viral protein/dna
total genus 106
structure length 368
sequence length 368
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2010-09-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
A PF17921 Integrase_H2C2 Integrase zinc binding domain
A PF18103 SH3_11 Retroviral integrase C-terminal SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2300 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3oykA04
1.10.340.70 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Endonuclease III; domain 1 3oykA01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3oykA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3oykA03
4E7JA 1KSPA 4FVMA 3AVCA 2IOCA 4CGHA 4CGDA 3LP3A 2R7YA 1WSEA 2KQ2A 1TV6A 4CJPA 3SD4A 2W42A 4IDKA 1RT2A 1TAUA 2B6AA 5J26A 5J2PA 4CGFA 4DTSA 4BDZA 3V9UA 5FDLA 3HPGA 3L3UA 1KVAA 4ICLA 1QSYA 1L3TA 1S6QA 3TAFA 2G8VA 4OPJA 2RHXA 4DF8A 4KI4A 1VK0A 4CJEA 4CHNA 1JLCA 1YT3A 4J2AA 5HROA 4KREA 2VG6A 2GBZA 4AHTA 1WJRA 3UT1A 1TK8A 4CJ3A 1XC9A 2QQRA 4CGJA 4DFPA 1ZBUA 5KCHA 5T7BA 4Z4EA 1IKWA 1Z26A 2BANA 2Z1HA 3NF9A 3NBPA 2WACA 3MEDA 3V6DA 4DSFA 3B6OA 3QNNA 1WSFA 1FKOA 4IG3A 1TKTA 5D3GA 3PNWC 2HHSA 3MEWA 4FLUA 1NJXA 2X4YA 4KKOA 2HHUA 1JL2A 1NK9A 4CF0A 4A4EA 1RCHA 3WNHA 1X1PA 4CERA 2OPPA 4PY5A 3F9KA 4QVZA 4IBNA 2VG5A 1BQMA 1DLOA 1RI0A 2X6SA 3SQ1A 4W5NA 4OLBA 3TAPA 4B9XA 3KLEA 1JLGA 2XHBA 1NJWA 4DF4A 3EY1A 4CEQA 4EP4A 4CJ5A 3ZT0A 1EX4A 5HBMA 5IN1A 1HYSA 3VQBA 3V9WA 1SKSA 3LPUA 3RTVA 4YNQA 4WE1A 1WSIA 4E7HA 1C0TA 1IKXA 3AVIA 3LAMA 4I9QA 4Z4CA 2O4XB 1N27A 1ASVA 4RW8A 5DMRA 3S3OA 2RHIA 4CIGA 5J2QA 2HB5A 3I8DA 4PQUA 4LY7A 3QIOA 1ASWA 3QBYA 3LYIA 3V1OA 1LW0A 5I3UA 4DTJA 4FJNA 4KHUA 2K3XA 2RN2A 3PX6A 4Z4GA 3OYGA 3SNNA 4F8RA 4E7KA 4II1A 1BL3A 3RRGA 4FJJA 1IG9A 3LP0A 2CKKA 3V1RA 3DRPA 4L8RB 5KE3A 1CLQA 2M0OA 2G8KA 4KB1A 3LGFA 3VQAA 4CHQA 4CJWA 4KPYA 3CFPA 3JSMA 4RG2A 4BDYA 1CZ9A 1UA0A 2PYLA 1IH7A 3NGIA 4JLHA 4NZGA 1T8EA 3QIPA 5J39A 2X78A 3EYZA 4PLLA 4CIEA 1RT4A 3I0SA 1X9SA 4OGCA 4CJRA 2BIVA 5CYQA 1RNHA 4RW9A 4NYFA 4AH9A 3L2RA 3VQ8A 4FZZA 3ZSOA 4CEZA 2P5GA 1XHZA 4E1MA 2XY5A 3AVAA 1JXEA 1NK0A 2HQXA 2WONA 3NHGA 3SUQA 3QIIA 4DFMA 3KLGA 1VSMA 1HRHA 2LVMA 3KK3A 2DFFA 5CY4A 1U04A 1RT1A 3ALYA 3LGLA 3HO1A 1RILA 3CQ8A 1O1WA 4IURA 1L5UA 1WAJA 4CF1A 3KUFA 1NKCA 4C5GA 3NGYA 3V81A 1G5VA 2DIQA 3L2VA 1J5OA 3NF7A 3OMCA 3U6FA 2Y1IA 1WNSA 4I2QA 3ZSQA 4FK2A 2E6MA 4AHSA 3MP1A 4BACA 1MHNA 4Q5WA 2RJCA 2QKKA 3DRSA 4NCGA 1A5XA 1ITGA 3QEIA 2RPIA 1D9DA 3C95A 4CCHA 3F70A 1W0HA 2EFIA 2XY8A 1ZBIA 4ELVA 4N47A 2D0CA 3TABA 4OPKA 5KI6A 3AVGA 4KB0A 1ASUA 4E89A 3G10A 1JLBA 3HL8A 2XRIA 1HQUA 1RTIA 4DQSA 3GOXA 3F73A 3QO9A 3LP1A 4JS4A 5HLFA 1CXUA 4FJLA 4CHOA 2G8FA 3IS9A 3OYCA 4KAZA 1WSHA 4E19A 3QKJA 2D0BA 2IGIA 5J1EA 3M8PA 3HP6A 4JS5A 4A4HA 4GMJB 3PMTA 4Z4HA 4CE9A 4CEFA 2XY6A 4EZ9A 4H4OA 2XO7A 4QCLA 4N41A 4C8LA 3ZSRA 3FEOA 2EX3A 3HPOA 1TL3A 4O55A 1JLEA 3O8VA 1OI1A 3K2PA 3O3FA 2P0KA 4HTUA 1N5YA 4B9LA 3KLFA 4CK2A 3OQ5A 3ZT1A 2MWOA 3M8SA 2DTUA 3ZT2A 3FLGA 4DSEA 4KHWA 1KLNA 3ZCMA 3NTHA 3DM2A 4KHSA 2G8IA 1XNIA 3O4QA 2P5OA 2DFHA 1VRTA 3TARA 4R5PA 2ETJA 3MP8A 4QQDA 3AO3A 1KRPA 1Y97A 3ZT3A 1U49A 2O4XA 2QQSA 5C42A 5EU7A 3T1AA 5C24A 2EQKA 2L89A 2VWJA 5IAYA 3DI6A 1QE1A 2AJQA 3S9HA 2KZMA 1X9MA 3MECA 2NUBA 4HCBA 3QINA 1RBTA 4Q5VA 2M1HA 3NTIA 4CESA 4B3OA 1T7PA 1TAQA 1RT6A 3QNOA 1OYXA 4LH5A 3WNFA 4CECA 4PL6A 3HJFA 3HSTB 3MO8A 1LW2A 3AA3A 2HHTA 2R5AA 3OS1A 4IUPA 2Z1GA 2GFAA 4FU6A 1L3SA 4KHYA 3V1QA 3TANA 2PYJA 3RWUA 3RR7A 1RBRA 5KGWA 2XDPA 4F2SA 2ZQBA 4OVAA 1G15A 3VQCA 3K58A 2GFUA 2B4JA 2R58A 4HCZA 3AVHA 1OZ2A 2X4WA 5J2MA 4DSIA 4DQPA 4CGIA 3K5LA 4CF2A 4CEEA 3JYTA 1SUQA 4CEOA 3O3GA 2FBXA 3LZIA 4B9VA 4FLWA 3MXIA 3C94A 4FLTA 4OKKA 2VWKA 4IFYA 3IRXA 3M8RA 4DLEA 3SUPA 3QEXA 4NS5A 4KTWA 1TKDA 4FJ9A 4F3TA 4E1NA 1XI1A 3LLRA 3FDRA 1Z25A 3P8DA 1NJYA 3M9QA 2WOMA 1DTTA 5JS2A 1QS4A 2DFEA 4B08A 3VA0A 4E7LA 4CJVA 3SZ2A 1J9AA 2P51A 4E0DA 3L8BA 2K3YA 3NE6A 2EHGA 4AHVA 3OJSA 2XY7A 4M3ZA 2OPRA 1WGSA 4C8NA 2YNFA 4OJRA 3NF8A 1VSEA 5KRSA 1HJRA 2L8DA 2YNIA 3ISNC 1A5VA 1R0AA 2YKNA 4Y1DA 4QW2A 1RDAA 3CM5A 4KV8A 4DMNA 4Q0BA 4O44A 4CHPA 3SQ2A 2VG7A 3VN5A 1VSJA 4FLVA 4N4IA 5KCOA 1JLFA 1RBSA 2YNHA 2BGGA 3P1GA 4I9LA 3KTQA 2Q3SA 3NH0A 3DB3A 3EAEA 2O4GA 2B8AA 1KFSA 2HNYA 1NK8A 3DLMA 4N56A 1BGXT 3TAGA 3K5MA 4CJLA 2RJDA 4B9UA 4DTNA 1J54A 2FBVA 3S6WA 4HCCA 4F2RA 1RBVA 3RRHA 4DTUA 3AO4A 4DSLA 3MEVA 1C1BA 1WAFA 4EZ6A 3E9GA 1D9FA 3QESA 3ZSZA 2HHVA 3HYFA 3CFRA 3WNGA 3PV8A 3SPYA 5JS1A 4CFAA 1D8YA 3NAEA 1XHXA 4H8KA 1BIZA 4MQ3A 3OYKA 2BKDN 3O4NA 4O5BA 1QSSA 1SL1A 1EXQA 2BUDA 2JTFA 4LH4A 2LSNA 3MXMA 5KTQA 1LWEA 4C8OA 2JZ2A 5CZ1A 3LDSA 4IUQA 1KVBA 3OS2A 3DLHA 3V9SA 3OB9A 4IFVA 4DU1A 1KVCA 4FW1A 3LWLA 4TSXA 3LZJA 2OZMA 3MEEA 5D6WA 5FROA 2RHZA 4H4MA 3NF6A 3S3NA 3T3FA 5SZTA 2PQWA 3QEWA 3DOKA 1LV5A 3KK1A 3THVA 4CJTA 4FK0A 3DMJA 4C5HA 1U4BA 4Z4FA 5D6YA 4FJKA 4M45A 4W5RA 3O3HA 2RO0A 4DSJA 4OVLA 4LD0A 3AA4A 1NOZA 3IAYA 3DLKA 2DAQA 1RT7A 3VQ5A 1QTMA 4KHNA 2L3RA 4CJ4A 4CFDA 3OYIA 1RTDA 3LH0A 4KO0A 4DTXA 2HW3A 4FM0A 2HMIA 2E4LA 2Z1JA 4PA1A 4FZYA 4Z0UA 4DTOA 3V9ZA 5FRNA 3QETA 3PO4A 3C6TA 2HHXA 1TK0A 4CHYA 2PY5A 1ZYQA 2OPQA 2X4XA 1NK7A 1IKYA 3OYLA 4IKFA 1GOBA 4IUTA 3AVBA 2EQJA 3PUFA 1TL1A 4BDPA 4F3OA 3DLRA 4B9SA 2YKMA 4F4KA 3C4SA 3PX0A 4QOZB 2D0AA 2X6NA 1SKRA 4N4GA 1BI4B 1KCFA 1S1XA 4CK1A 2HQEA 3LAKA 3VQEA 4M41A 4DQRA 4ZTJA 4MFBA 3OYAA 3KKRA 1TGOA 1NJZA 3QEPA 1VSKA 1J53A 5E41A 2KZZA 4LSLA 4OLAA 1NKEA 3ME9A 3DLEA 2QKBA 3QLHA 1SKWA 4FJGA 2M16A 3OYJA 4OKEA 3T19A 3LANA 3K57A 4CEDA 1ZBFA 5HRRA 4HUFA 4B9TA 3PFSA 2R5MA 4AHCA 4RW4A 2FHDA 2YNGA 4B8CA 4DTPA 4K8ZA 3HP9A 2RI2A 4CHZA 2FBYA 4FJ8A 1VSDA 3OYNA 1JKHA 1BIUA 3MP6A 3SQ0A 1WJSA 3Q1JA 2YHBA 4JRPA 3KLIA 3H6ZA 4UQGA 1A5WA 4BE0A 2IG0A 4KI6A 1REVA 4O0IA 1WN7A 1SSFA 1NK6A 3KK2A 1KFDA 4BWMA 2B5JA 3CM6A 1SV5A 4CFCA 5M9OA 1DTQA 4C8KA 1OZ3A 3ASKA 4K8XA 4DWIA 2HNDA 1HMVA 3AVLA 1XWLA 5CZ2A 4N76A 3HVTA 3KD1E 1I3AA 4FM2A 2ZE2A 3B6PA 4W5OA 2BDPA 4LSNA 3PO5A 3KKSA 3VQQA 3ZSWA 3H8ZA 4M3YA 3P83D 4BE2A 1BHLA 4EDUA 1C1AA 1L3VA 3ZSVA 3LP2A 1RTHA 3CFOA 1UAXA 2KFZA 5KRTA 4CFBA 2I5JA 3P8HA 4FJMA 4RG8A 1WSJA 1YTUA 3A2FA 1S6PA 3TAMA 2IDOA 2GUIA 2YRVA 2EQUA 1LWCA 2JLEA 1JLAA 2G8UA 1TKXA 3BDPA 3NH1A 4IUUA 4J2DA 2E6LA 1B9FA 4CEAA 4RW7A 3QEVA 3G0ZA 3HK2A 3VQ9A 3SV3A 5CIUA 3AO1A 4QAGA 3FFIA 3WNEA 3NH2A 3SUOA 3ZEHA 5C0MA 1RT5A 2X35A 4DTRA 1T05A 3K5NA 1KTQA 4B9WA 4Y1CA 2HNZA 3NCIA 2IAJA 3AO2A 4BE1A 1EP4A 3ITHA 3DLBA 3BGRA 4AILC 2GF7A 4CF8A 2ITGA 1UOCA 3L42A 4FLYA 1TK5A 1QQCA 2RHYA 4E3SA 4FJHA 2QK9A 4A4FA 4G1QA 4ID1A 4ELUA 4DU3A 4HVJA 4GVMA 1TVRA 2YV0X 3LALA 1KHCA 2EKOA 2A1RA 2IS3A 1N6QA 1WSGA 4DFKA 5K14A 3QERA 1S1VA 2QXFA 2LDMA 4KRFA 3UIQA 3DYAA 3UWNA 1HNVA 2P1JA 3L2QA 2RI3A 3OA6A 2LTOA 4UC4A 3NGZA 3OYFA 4CK3A 1X9WA 2RHUA 4IG0A 4N4HA 3VA3A 4FJXA 3E01A 2X74A 3V9XA 1NKBA 1U47A 4XIUA 4C5EA 3MEGA 4O4GA 3DLGA 1RBUA 3OYHA 4CJFA 2FBTA 1ZBLA 4DSKA 2D9TA 3H08A 5HP1A 3OJUA 1VSHA 3OS0A 1S1UA 3CYMA 3NDKA 1H3ZA 3SQ4A 2Y1JA 1BQNA 1BI4A 4Z4IA 3TI0A 3RMBA 1NK5A 1C0UA 3QJ6A 3VQ4A 2O4IA 4CJUA 1GOCA 4I7FA 4M3RA 3OY9A 3ZSXA 4HHTA 2HHQA 5HRNA 1NK4A 1BISA 1FXXA 4DLGA 3META 2OPSA 1IO2A 3AA5X 1CXQA 2G8WA 1B9DA 3OYEA 4FK4A 4PWDA 3FC3A 3NNQA 1VSFA 2BE2A 3NTKA 4NYNA 4FJIA 3C6UA 3OYMA 3TWHA 4BD3A 4ZHRA 3MAQA 1U48A 1LAWA 3E9FA 3I0RA 3MEAA 1B92A 1FKPA 2RJFA 1SL0A 3ZT4A 4IUVA 3OYDA 2F5KA 3RMCA 3HT3A 1HPZA 3IG1A 1S9GA 1S9EA 3HM9A 2LCCA 3L2WA 2KFNA 2A1SA 1KLMA 4GW6A 4DQIA 4CJSA 4M3UA 2DY4A 2HHWA 4DS5A 4RW6A 3V4IA 2EQMA 5HRSA 1Q8IA 4AHRA 1VSLA 2E5QA 1S1WA 3RMAA 2PZSA 1HNIA 4C8MA 1WLJA 3OMGA 1HYZA 4CJQA 4M3WA 4FJ7A 4EP5A 3RR8A 1L3UA 4M3XA 5KH6A 3OYBA 1SL2A 1VRUA 4X34A 3AA2A 3U3GA 3HVRA 3KIOA 2RKIA 3HXMA 4FM1A 4DG1A 3L2UA 3LPTA 3AVFA 1RDCA 1F21A 4NCAA 4O0JA 1UWBA 3KD5E 2JGUA 2OYQA 2F8SA 3KJVA 1JLQA 3DB4A 2KW4A 4OGEA 3ASMA 5D6XA 2ATQA 3D45A 1MU2A 3NFAA 2GV9A 4QQ6A 4AHUA 2F8TA 3SI6A 5HRPA 1Q9XA 3SV4A 2IC3A 5KE2A 4ID5A 3RMDA 4FL6A 4B9NA 1S1TA 3VQ7A 4CEBA 1VSIA 2OZSA 3MXJA 3L3VA 1RT3A 1GOAA 1ZBHA 2XK0A 4DS4A 3AV9A 3PY8A 1JXBA 4I2PA 2HVIA 3U3YA 3TAQA 4DTMA 4NCBA 3VQ6A 1LAVA 3PX4A 4J2BA 1Q9YA 2YHAA 1WJQA 3KLHA 5C6SA 2MWPA 4OKJA 4ELTA 5C25A 1RDDA 4KHQA 3PMIA 4FXDA 4GY5A 1CZBA 3ZSYA 5FRMA 2D5RA 3CEYA 4KTZA 1EKEA 3AVMA 2R57A 4M42A 3P5JA 1C0MA 2DIGA 1EETA 2E6NA 1UA1A 3SPZA 4PLIA 4CJKA 4CRIA 1RTJA 4W5QA 2RI5A 4FW2A 5CYMA 3AO5A 1BCOA 1IKVA 2G8HA 1QHTA 4KTQA 2LRQA 2NLUA 4DQQA 3LX7A 4CF9A 1TKZA 3SUNA 3D0PA 1W9HA 3EZ5A 4FCYA 1YVUA 5KGXA 4JRQA 3TAEA 3K59A 4HUEA 4N5SA 5SWMA 4CGGA 1T03A 4CIFA 3HPHA 4FJ5A 1D5AA 4FZXC 4B8AB 2G3RA 3CG7A 2HVHA 3AVJA 4BWJA 4C5IA 4KFBA 3S3MA 3K5OA 4FLZA 3DRRA 3AVKA 1QSLA 2F96A 3M8QA 3SCXA 3LWMA 1RDBA 4A4GA 2VYTA 4E7IA 1U45A 1K6YA 1HYVA 4W5TA 4Z02A 3AVNA 2FC0A 4LD6A 5DK5A 1C6VA 3ULDA 5J2NA 4PUOA 5I42A 1HQEA 4J2EA 3OVNA 2RJEA 3MEUA 1C1CA 1LWFA 4FYDA 4M3TA 2Z1IA 1FK9A 4DFJA 1I39A 3TR8A 3SYZA 4DU4A 1NOYA 4FLXA 4L59A 2OA8A 4B9MA 3VQPA 2RF2A 1BCMA 3BDLA 3VQDA 3DOLA 2ZD1A 1JL1A 2KTQA 1S5JA 1YTAA 3SJJA 4YFUA 4QQGA 4ZTFA 4HUGA
chains in the Genus database with same CATH superfamily
4FYYB 4E7JA 5L3CA 2EV0A 3N4MA 2EV6A 4MNUA 2EA2A 2ASPA 4IOAF 1B7TA 3H3UA 1JKRC 4CGDA 4V19S 1YW8A 3I35A 2DL3A 1X19A 4CZGA 5GAOn 3CJTB 4B1YB 1Y71A 1TV6A 2L7MP 5H6QA 2W42A 1K0SA 4WTOB 1SHGA 3M0SA 2VKHA 3KLOA 4JKBA 3V9UA 2F7TA 3CC2T 4O6JA 3U9GA 1KVAA 1W4MA 2EFQA 5BR9A 1QSYA 4LFAK 1QHHD 2ZSIB 3SJHA 2G8VA 4PKHA 2YLBA 4FT4A 2WY7Q 3QG1A 2FF3B 4OU0A 1VK0A 1E3OC 4CJEA 4IO9L 1E6GA 1M1GA 1G99A 1ESVA 5HROA 3REBB 4RUGA 4EA5A 2EFOA 1W7PB 2FEZA 2P5KA 5EYRA 5BRHA 1X6BA 4XLFA 4CJ3A 4DZPA 2QQRA 1YITT 2HZDA 4CGJA 5CVIA 2UZKA 3O9SA 2H94A 2Z1HA 3CMYA 2YSRA 3NBPA 2WACA 3J7YP 3QZ5B 4MZPA 3V6DA 4DSFA 5EEHA 3QNNA 1RKTA 3JB9G 4HSRA 4XNFA 2RNGA 5H20A 3KYLA 4KIGA 5FLXO 1B34A 2P9IB 4EPCA 3K1NA 4RB3C 5DEQA 4BC2A 2BGCA 3VUBA 2HHUA 3E5XA 5L8RE 1JL2A 2E2PA 1NK9A 5LBQA 1RRQA 3NMZC 4A4EA 1RCHA 1M3HA 1YQKA 3WXMB 3CC7A 2D0NA 3WG9A 4MO7A 1BQMA 4W5NA 1BJAA 4OLBA 2NYXA 4ILGB 2W0ZA 2Y30A 1EF4A 1JEGA 2OFIA 3CCMN 2ZGYA 1U2VA 1NJWA 2GOXB 2IVWA 3R6OA 2LD5A 4JV5K 1QGPA 3DJCA 2X48A 3IH2A 2JSPA 4F93B 2EFWA 2QKLB 4DEXA 1OCRH 5IN1A 3SDZA 4C1NI 1HYSA 1VQ9A 2SEMA 4YNQA 4YG2F 5LJ3d 1C0TA 1IN4A 4WQ5C 3CCUT 4KHPK 2XAFA 4BC4A 1Q81U 1Z9ZA 2KMUA 1K73U 4HDVA 2OQGA 4CZHA 1SKUB 3EE8A 5TISC 4Z4CA 4IDHA 4HX8A 5CHZA 4M3EA 3CWTA 4BR2A 4BC5A 5DMRA 3E7LA 3U21A 4IEIA 2JHJA 5F1JA 4LY7A 3QIOA 1CF7B 3QBYA 3LYIA 1P4XA 1LW0A 5I3UA 2H56A 2PJRB 2VUBA 4KHUA 2E64A 1YJWT 1QU3A 1PU8A 1NGIA 4HAMA 4BH9A 4II1A 3HSFA 1Q86U 5AIQA 2EYQA 2EPFA 3ESWB 4FJJA 2TRTA 2AA4A 4I6MA 3V1RA 3L4QA 3GBQA 5KYUA 4F14A 3LGFA 5GAMg 2DILA 4CJWA 2UU9K 1E17A 3KP2A 3CFPA 3KHYA 3JSMA 2B86A 5E3LA 4M78B 3FGUA 4B47A 5AONA 2KZGA 1IH7A 3NWSA 5BN9A 2DT6A 4JLHA 4M75F 1GFDA 1QRYA 5IHIA 1ATNA 2NNWA 1RT4A 4OGCA 4XLNF 2BIVA 1VQ7I 3LOCA 1RGIA 3WXLA 3DF8A 1IZ1A 3MHXA 4AIJA 1JBMA 4NYFA 2ZJPL 4CBXA 3CCQT 4YOQA 2NUZA 1G3TA 2VT3A 1FYNA 3GFJA 5J40A 1XHZA 3WXJA 1IXSB 1YFHA 4LF7K 1OKRA 2M8EA 1RPWA 3SUQA 3MX2A 3MKLA 3WTUC 3S17J 3C7NA 2HBKA 2P9NB 2J5PA 1XN7A 2LVMA 2HF3A 1VF9A 5FD6A 1AWWA 3I56A 3U1DA 2A5XA 2D8JA 4X0GA 5AQUA 3G6EI 1O1WA 3SDBA 2GZWA 4F17A 3I55Q 2F2VA 8AT1B 4P96A 3VOEA 1TTYA 2OTJA 1NKCA 5BPLA 4C5GA 1QVFP 4BBRJ 4ILHA 1UG2A 1Q7YU 2EJRA 3NGYA 4Z94A 4M78E 3V81A 2W4SA 2COWA 1J5OA 4MTDA 3SAGA 4M6XA 3NF7A 2QGGA 1WHGA 2M51A 3ZSQA 2XRLA 3W0LA 1M3QA 5DUKA 3MP1A 2BY1A 2COMA 4LF8K 2IPQX 5JVHL 4MLOA 4CZMA 2F9WA 1HSTA 1YJ9Q 4QLCU 3ZQ7A 2A61A 2EK5A 3PT9A 3E9LA 3K4JA 1YWOA 3PGGA 3M8JA 3FM5A 1S5LC 1W0HA 2EFIA 4YPHA 2NVYJ 2Y4XA 1I5OB 1U5TB 3CWAA 5KI6A 2X4JA 1BDGA 3U8XA 2M4GA 3FXLA 4XLAA 5IYCJ 1W7PA 4E89A 4KT0E 1W7PD 2UXDK 1JLBA 1U06A 4DK9A 2XRIA 3HRTA 4KFCA 3G71T 1RDWX 2A05A 3ZQCA 1RTIA 2VKDA 1TYQA 4X9CA 2HVSA 4IEJA 2P4WA 3TSZA 4JS4A 5HLFA 1NBEB 1CXUA 2ZPBB 2H3EB 1JU5C 1WFXA 4DBRA 3JSPA 1TNSA 4OPAA 3OYCA 4A3LJ 3TEDA 4A6EA 3IFRA 3E6MA 4PJOF 2LX9A 3HHHA 1WSHA 2HNHA 4E19A 1O3RA 3TW6A 3QKJA 3LA3A 2K3FA 1NBWA 1FZPB 4IWVA 2P9IA 2HKOA 2O8FB 2CGHA 4JS5A 1GLCG 2NOHA 3SMPA 3PMTA 3QDFA 3KXTA 2CZ7B 5BPIA 3T9NA 3BR5A 2CRGA 2DU9A 4H4OA 1TT5B 3RSNA 3ZX0A 3TU5A 3LSTA 1MNEA 1TL3A 1Y8QB 4A5AA 4EW0A 1T3VA 4KH5A 4HTUA 5E8GA 2VQEK 4B9LA 3F0ZA 4M77G 3BZCA 2MG4A 4CK2A 3ECHA 3GMEA 2MWOA 5CQYA 4A3IJ 5ED4A 4LDWA 1N8RC 4KHWA 3ZCMA 3DM2A 4HVVA 2HF4A 2HAXA 1QQNA 5M1FA 1ETKA 4KH4A 1V55H 1HF0A 2CGJA 5HKCA 3R61A 1XDUA 4R5PA 3ZMTA 1LKXA 3DPUA 3MP8A 2ZCFB 2HKNA 3AO3A 1MMDA 1Y97A 5KYYB 5AQYA 2IGKA 5CKDA 3K10A 3H3ZA 2F5TX 2RMOA 3VSKA 2QQSA 3BF3A 1LFPA 1XSXA 1X4PA 2NRTA 3T1AA 3MX5A 1Z9QA 5C24A 5J8FA 2L89A 3OIOA 2IW5A 5EZHA 1UGVA 3VTIA 3GZ5A 2JK3A 1WI3A 2DKGA 2BZXA 1ZXOA 1PD1A 2PJRA 2XROA 3VS4A 1X9MA 4II3A 2EBIA 3QINA 1V5EA 1ERDA 2KT1A 2OU2A 2M1HA 1HQCA 3HFNA 3L4IA 1NHAA 3CC2Q 2WC9A 1GDTA 1T38A 3K69A 4A3DJ 1NYFA 5GAN4 1X1CA 3H5AA 2HTJA 4MEYF 1K8KB 1OFCX 4JBAA 5TRDA 1RI9A 4PL6A 3AARA 3HJFA 4ZZLA 4C8QD 2OA4A 3VEWA 3L9FA 2HGCA 5KPTA 3AA3A 5CKHA 2DPDA 1PC0A 1YF5L 3OS1A 3S41A 1VZ0A 1UZCA 2YLCA 5D5WB 4OP0A 4H4KC 3OW2A 2H6BA 4IUPA 5A0LA 3OW2M 3RBBB 1YITQ 2Z1GA 2GFAA 2PJPA 2ZAEA 3V1QA 4A59A 1SEMA 3RR7A 5DLOA 1RBRA 2RDPA 1M1FA 3EE9A 5D8LB 2PMUA 3C12A 5LGTA 1K0XA 2E5ZA 2P4RA 2GFUA 5GAOp 1SS6A 2GWJA 2PVOB 2LKXA 2R7XA 2BZYA 2DJNA 3QOPA 2KNBB 1QQMA 2RQVA 2CH4A 3ZMDA 2BVLA 2KZVA 4CGIA 3J7AY 4DBQA 3BY7A 4CF2A 3VPRA 4CEEA 3CC4N 1MJBA 3JYTA 3DLLL 2P9NA 2M34A 4CZIA 5JLHA 1X6OA 2K7AA 3AAPA 1LOJA 1HSJA 5AT1B 5LEJA 5DLQE 2DMTA 4MZMA 1ODDA 3F6OA 1O13A 1GLEG 1BO5O 5AQPA 1Y96A 4H0YB 5BREA 4F3TA 5C4JJ 3CD6A 2IS1A 2X3XD 1AD5A 1H3HA 5CLSA 4FM4B 1ON2A 3KTUA 3P8DA 3GOIA 1L3LA 3VESA 4GFBA 1J75A 4HDUA 2R7OA 1YQRA 5JS2A 3E9OA 1WZ2A 2XKPA 2K2MA 3MCAB 4XU0A 1M3CA 1VQ4T 4CJVA 2LREA 2HDDA 2DDAA 4RS8A 4XEIA 1S9HA 3OGDA 1Q82R 2Y0SN 1P7IA 3L8BA 3CCUQ 2E10A 2J06A 3NE6A 2EHGA 1TW2A 2XY7A 4UXNA 4DEYA 3OMYA 3H5NA 3J8AA 2DE0X 4C8QG 4OAYA 4OJRA 3UKUB 1VSEA 3CP2A 2AP1A 4F55A 2DO7A 4LDXA 1R4NB 1J9IA 5EEAA 3HYIA 3TGNA 2YNIA 5BRDA 1IBLK 2WB1A 4AWXB 3P9CA 1A5VA 5IOYA 4CCJA 4Y1DA 2JRMA 1RDAA 3PO3J 3U2RA 4ZGDB 4JI4K 3I55I 5CAIA 2GM4A 5LJVA 4CDGA 4JLGA 3VN5A 3KVGA 2HKXA 1N6AA 2KDOA 2P8TA 1RBSA 2BGGA 1K9MU 2JWLA 3H36A 1KC8R 4OB3B 4M78C 4CBUA 3LDQA 1XUPO 3NH0A 4R56A 4LF4K 2EBPA 2UUCK 2O4GA 1KFSA 2HNYA 3BOQA 5KPZA 4B24A 3QPHA 2V26A 2A3LA 1IW7F 2X85A 3S1QJ 2L2PA 3A0IX 3K5MA 2RJDA 5GAOl 2O8FA 4RA2A 2FBVA 3A03A 4HCCA 2VXZA 1RBVA 1IGNA 3RRHA 1YJ9I 1EZZB 3OW2P 2VBZA 1M1KC 2KDSA 2FSWA 1SG5A 2SRCA 1WAFA 1YI2A 4EZ6A 1Q82O 4KUIA 5AQOA 3TSQA 5KYXB 3OSGA 1RRSA 2CYZB 3ZSZA 1N9RA 3FMRA 1TW3A 3CDIA 2QQAA 2WC2A 2XHCA 1UG1A 2F69A 3SPYA 2BTTA 1B4AA 3CCQQ 3NAEA 5GAGJ 5IHKA 5JMVA 3OYKA 3WU2C 1KG7A 3O4NA 2ECCA 1X69A 3JTGA 1SD5A 4H5RA 5M1NA 5KYWB 3S32A 5BRFA 3E19A 3RQ4A 1H89C 2JT4A 4I02A 3LSMA 1SAUA 2NWMA 4D8KA 1JTYA 4AD9A 2MH9A 1B3QA 5GJWB 3TOAA 1JKPC 2FL7A 1ZREA 5LJ3g 5AQRA 1Y39A 1WOQA 5IP9J 5CZ1A 2FA5A 3OIQA 1KC8O 1WJAA 3MKWB 5KYYA 1KVBA 3E3VA 1KVCA 2Y31A 4L9VA 3ABMH 4TSXA 2PAVA 1W0UA 3MEEA 2OCCH 4CSWA 3QHSA 2HBMA 4FWKA 1JUSA 5KAFC 2PLYA 2CSQA 3T3FA 3L2ZA 5SZTA 4ORZA 4DYRA 1LV5A 5KCMA 3BR3A 1XG7A 1U4BA 2IP2A 2OAWA 4M45A 1U5TC 1T2KA 2EPDA 2KBTA 1M90C 2A6EF 3K4KA 2F4MB 1F36A 2JA8J 5ILSA 2ENMA 4OVLA 2ZO4A 2JXBA 1D1AA 3A5NC 3AA4A 4A0ZA 4ANJA 1UCRA 3MKYB 4EJZA 3CCMT 3C18A 1OQYA 1LVAA 2VV5A 1NMNA 1BA5A 4EV0A 3WU1B 4LLLA 1K8KA 3LAJA 3OYIA 2ZMEA 2DTRA 2ED0A 4C2UA 4DV2K 5CE3A 1PU6A 2EVRA 1BC8C 4KO0A 1WBDA 1LPLA 1NH3A 2XPVA 2HW3A 1E3HA 4I2OA 4E6KG 1MBGA 1GVJA 1ORPA 4Z0UA 1Q1HA 5AQKA 3G71Q 2QWNA 3QETA 3T8TA 2CUEA 2HHXA 1A6IA 2P9UB 3D1NI 2OPQA 5GAN8 1HKGA 1R77A 2EKHA 5GINA 2NOGA 3BG5A 3CCLT 4YTLA 2FPEA 1USSA 1DUXC 2O8CB 4L5GA 1TL1A 4F3OA 3DLRA 2HOTA 2G6FX 2VPLA 2H1LA 4U7BA 2KSSA 3VS2A 4F4KA 3HI0A 1SQKA 4QOZB 1ZSGA 4JKGB 2IVPA 3A1PA 4B3TK 2V9KA 2X6NA 3H0HA 3T1HK 3GF2A 1BI4B 3CC2I 5J3LA 4CK1A 2D45A 3LAKA 3QSUA 4JYKA 4MDXA 4NC6A 1NJIU 1WI7A 4DQRA 5DM6F 4ZTJA 4AM7A 2RQPA 4XRSG 1YIJA 4JI3K 2MABA 5M1OA 5BN8A 3ZXSA 2L7ZA 2V9PA 3WTSC 2AKKA 2AHJB 4KISA 5E41A 4OAZA 1G3WA 1NKEA 2HOAA 1NE8A 4NC7A 3TP3A 2M16A 1B07A 3OYJA 4CJ7A 3T19A 1YITI 4CEDA 1RAIB 3E1SA 1A36A 1NGHA 1N39A 1BBYA 2R5MA 2XSDC 1GT0C 2LQNA 2FHDA 2VXDA 3LQRA 1QVFS 1V54H 1JJ2A 3HP9A 1JJ2M 2YHWA 2RI2A 4CHZA 2QWPA 3J81Z 2EGCA 1VSDA 3DAWA 2HL3A 4H5WA 5E79C 1MH4A 3MP6A 3I64A 3Q1JA 2Q2EB 1S1NA 2YHBA 4UQGA 4ESRA 3UKUA 2FYKA 3JCMP 1XGOA 1K8AU 2CW0F 2WSFE 1FP2A 4P9UA 4XMYA 3CJNA 4KA4A 2RH2A 4BWMA 2KRNA 5LJWA 3H1VX 4IO8A 3VS3A 1WEIA 1XSVA 3UDCA 4CFCA 1S72A 4DR3K 4C8KA 2IJLA 1MDMB 2JHNA 3OV8A 4M7AC 4RTXA 1SAXA 1OCPA 1ZG3A 4DWIA 4A63B 1HMVA 3O4WA 3FZVA 1NGGA 1F9NA 3CCSI 3B8AX 3CCJN 4G7HF 4DOWA 2EA4A 3KD1E 3PM1A 4BQNA 3EL2A 3AKZA 1R71A 1M2OA 3K70C 4LSNA 1OPCA 2BY0A 3CCUI 2QQBA 2O9SA 3NGPA 2KISA 5CR2A 4BE2A 4K25A 1BHLA 1BJZA 2QDLA 4HLXA 1L3VA 1WBBA 2FLOA 3IH3A 4A5BA 1RTHA 1M9SA 3S6IA 4M77B 3CFOA 4NHJA 2YHTA 4CFBA 3FZMA 3T1BA 5KYXA 4DCHA 4HKEA 4JQFA 4ZDOA 1WSJA 3TAMA 1Z21A 2DM1A 2IDOA 1VQPN 4L5JA 3OR1C 4UVCA 1NEBA 2EQUA 3NAUA 3PUBA 1LWCA 5D5UB 2DMUA 1TU0B 2JLEA 2ICWG 3LMMA 1TKXA 3CCRA 3VMFB 5KYWA 4CEAA 4L9JA 4TVRA 1H9GA 3GIBA 4NLBA 2XMFA 1NM7A 1G8XA 4D0PA 1VQLI 2EFPA 3QMLA 3VQ9A 4M3FA 2VPRA 3FMSA 4OMZA 1VIFA 4KJZA 3AO1A 4O5FA 5IT3A 5EEGA 3FFIA 5HLGA 3WNEA 5HDNA 1WJDA 4ESJA 1BI1A 4HVWA 5C0MA 4DTRA 4XM3A 2LVSA 2JSCA 5KVRA 4J8FA 3C6HA 2CQKA 4A3JJ 2LYCA 2HNZA 1B72B 3NCIA 2HQNA 5K7ZA 3AO2A 2OTLN 3ITHA 5FPMA 3CI5A 4FSSA 3EG9A 2V1DA 3EG3A 2C0TA 1VQ4Q 2QM1A 5AQJA 3ZCOA 2GF7A 3LM9A 4CF8A 1FT9A 4AILC 2ITGA 1JJ2P 2ZFWA 1QQCA 3VYHB 4E3SA 4EA4A 3FZHA 5HDGA 3M1CA 2HBLA 2YUSA 2JQ7A 3EN9A 2QK9A 4A4FA 4ZC3A 4GVMA 3UKGA 1ZTRA 2DLPA 3LALA 2EKOA 2KVQG 4E47A 3TQ7P 4B3MK 2IS3A 4DFKA 1ETOA 1J59A 1VQNN 5HODA 2MBFA 4KRFA 3UIQA 2P1JA 5KQDA 3L2QA 2RI3A 3OA6A 2JG6A 2QEXA 3R4KA 3NGZA 3ZQQA 4JKAA 3AY9A 2RHUA 4M7DB 4MDBA 1PUEE 1JT0A 4NOYA 3VA3A 2VASA 2P9UA 4B48A 1JQQA 2L02A 3V9XA 1XPXA 2YR2A 2RPNA 2ASMA 3DBHB 4H5TA 3ABUA 2JRTA 4C5EA 2O8CA 3OYHA 4CJFA 3G1LA 2FBTA 3TW7A 2D9TA 4O8UA 4HT9A 3EKSA 3I0XA 4JKGA 3LDLA 5FWCA 3ZQGA 3I53A 3NDKA 1VI0A 2CGKA 3SQ4A 4LE9A 1BI4A 2L3DA 4Z4IA 3TI0A 2YG9A 1HKQA 2G7HA 1FEXA 3ENHA 5HLTA 1CGPA 1Z6RA 2W7NA 2O4IA 2VXEA 3AGKA 1GOCA 1NYGA 3H9JA 2GXBA 4JPBW 4DLGA 4FT8A 1K73C 1Q81C 3P9IA 1SRMA 3K4LA 2G8WA 1B9DA 4PWDA 4IX7A 1F43A 3HM8A 4O3MA 2LP5A 4E6RA 4AFZC 2XAJA 3NTKA 3CPFA 5CVUA 5FFXA 3NVMA 1VQ6A 2VQHA 3G71I 4NYNA 3E2UA 1LCUA 1EH6A 3J80Z 4FJIA 3ONQA 4Y52J 1M27C 3C6UA 4M7DE 3FXKA 1JXMA 3MAQA 1IG8A 3E9FA 4LFUA 1FC3A 3HSCA 3MEAA 3K0SA 1FKPA 2RJFA 1SL0A 1JUPA 3VRYA 2F48A 3HT3A 5L3DA 3T5XA 1HPZA 4JDSA 3HPWA 1S9GA 4D9JA 1S9EA 4H03B 3CWUA 1EO1A 1WHKA 2VQLA 3L2WA 2Q2EA 4DOZA 5C12A 4XLPF 2DY4A 2QWRA 2HHWA 2NZTA 5AIPA 3V8KA 2EIJH 2KJBA 1QMCA 5GPCA 2EQMA 3AG2H 2VJJA 4KYWA 4UVBA 1F4KA 2MAMA 1MDMA 3RVCA 4FYWB 4CJQA 4M3WA 3THXB 3OH6A 1WJFA 5KH6A 1VQMA 1VHXA 3GTGJ 3G1OA 2BEOA 4X34A 3HOUJ 1TUYA 3CCMQ 2RKIA 3HXMA 3ASOH 2LC2A 3I4PA 2QF7A 3LPTA 3BY6A 4Z6YA 3HG9A 1FY7A 1ZC6A 3G0QA 2DMPA 4XRFA 3RMSA 1XG1A 3PSIA 1R59O 2H8RA 3V7RA 1OX8A 2OYQA 2F8SA 3KJVA 1JLQA 2IPOB 3DB4A 2Y0MA 1FOYA 3EH2A 4A3GJ 4XTWA 2XD0A 5HDKA 3ASMA 2COBA 4KUDK 4XH4A 3NFAA 2GV9A 3CCLQ 2Z0WA 2NVUB 3TDZC 1LFBA 4EVIA 4F3QA 3SV4A 4RB2C 4J9BA 9ANTA 3RPQA 4ID5A 3RMDA 4FL6A 4B9NA 4CEBA 5JVTA 1IXDA 2FSKA 4JK1X 2OZSA 5CCAA 3L3VA 3GG4A 3CUOA 2XK0A 3PY8A 3GZ6A 2I0NA 3CMAT 2HVIA 3TAQA 4DTMA 2F4OB 2EW3A 3VQ6A 5E1XA 3O8GA 3PX4A 4FWQA 2YHAA 1WJQA 3W2AA 5J1YA 1YHQN 3RPUD 3KP6A 2ZXIA 3KLHA 2MWPA 4D1QA 1MSEC 5HS7A 2UWMA 1ZLMA 2P7VB 1FIAA 2NVTJ 3V7SA 5E17F 4LNPA 5ICGA 3CEYA 1NGCA 1B72A 2YU9J 3THWA 3EKUA 2X4HA 4M42A 2QGFB 1O57A 3QUIA 4AI5A 2HDAA 1EETA 4FWOA 1QNTA 1UA1A 2K57A 1YP5A 2VN2A 4DR4K 2MC3A 4NXMK 3PIOL 1VYTA 2A3ZA 2K9MA 3G4SA 3DXJF 3FXOA 4LK1F 2QWOA 5I21A 3IKTA 3I4NJ 1KAXA 4YY3K 3MCZA 5FKNA 5C15A 2Q0UA 2W41A 2W1OA 4PL8A 1QHTA 2G8HA 2TDXA 2LRQA 3QYGB 3LWHA 2DA4A 4DQQA 3DV8A 4J7FA 4CF9A 2PZ1A 1TKZA 3D0PA 4MLEA 4FCYA 5CQEA 5LMUK 3K59A 5IT9E 4HRIA 3IQLA 1FWZA 2K4YA 3DPLC 4HXJA 4HUEA 2P7CB 2V6CA 3OSFA 1T03A 2IVMA 2P9KB 3I5UA 2R93J 3PJRA 4M7DA 4YDUA 5CK9A 5J8CA 3OYYA 2X0LA 4KFBA 1VYVA 4KH0B 2FE3A 1EWQA 3K5OA 4M77C 3GWZA 3AVKA 2WY8Q 1VQ4I 3SCXA 4CZFA 1NG9A 1ORNA 1RDBA 1F1ZA 2E1OA 4A4GA 4IZ9A 2QQ8A 5DM7F 2VYTA 2HMAA 3U1KA 4RCCA 1I50J 3EPZA 4W5TA 1FOXA 4DIQA 4LD6A 3M57A 2HSEB 3CC7T 4JI0K 2L7KA 1W0TA 4CICA 4QVCA 4AMCA 3H41A 4DR6K 2XDBA 2CZ1B 3J81O 5I42A 1IXRC 3RYPA 3OVNA 3HRUA 2RJEA 2R5YA 3ZMVA 4UUTA 2LBFB 5J47A 4FYDA 1OMIA 2Z1IA 2QXLA 4BRAA 2FRHA 1R58A 1WEFA 3SLCA 1I39A 3M59A 1FLIA 3SYZA 4WXHA 5E1WA 5BPMA 1N8RR 5AQNA 2ID6A 1X1DA 5ELZA 1WX6A 4L59A 2OA8A 1VQ9T 4YIIA 1BCMA 3BDLA 1ITYA 2R7FA 2YUNA 1JL1A 4E9HA 2KTQA 1YTAA 2XKOC 3KETA 3SJJA 3M0TA 4PHTX 1MBEA 2G0EA 4XQFA 4ZTFA 4HUGA 1IUFA 4CZEA 3ZL7C 2E34A 2FZGB 2IOCA 1XMKA 1WSEA 2RA2A 2KGTA 3HOVJ 1X2QA 1N3AA 4HNUA 1PRMC 4CJPA 1V4RA 4DV1K 5FLMJ 1RT2A 4IDKA 1FW6A 5JVGF 5ILUA 2BBYA 5LGUA 3UKRB 1TAUA 5J26A 4W97A 5J2PA 5LD2C 4BDZA 5FDLA 1K4TA 3BTCA 1U0JA 4NNJA 3LSRA 4WCGA 1AKHB 3L3UA 3X26B 2DFUA 2VIXA 3H5RA 3CLQA 2M5WA 4M3GA 3TAFA 1LUJB 1HXDA 2RHXA 2D1HA 2HDWA 1YT3A 4J2AA 3VRZA 4KREA 2L4AA 3HTRA 4JHDB 1LWYA 3URGA 4FQGA 3THXA 2FMYA 2CG4A 4M7DC 4AHTA 3UT1A 3M4GA 3E6CC 1GRIA 1VQ7A 2K02A 4X64K 5K7FA 1B9MA 4BY6B 1ZBUA 5KCHA 4Z4EA 3HTVA 2BANA 2KRMA 3NF9A 4JKEA 3CQTA 1TH7A 3G73A 1WH7A 1WSFA 3O6BB 4B3AA 3A1YA 2I5WA 5FFZA 4FE7A 3P8BB 1NKUA 4AIAA 2AIRB 4I99C 4AYBN 2X4YA 3MN2A 2Z5UA 3F8BA 3G6EA 2AHQA 4DW6A 3WNHA 2PI0A 1IJWC 2OPPA 4PY5A 2JTMA 2VG5A 3W3CA 4EFHA 1RI0A 2JPSA 3SQ1A 1NGDA 1RR8C 3KLEA 2CGLA 4ZYHA 1AHJB 2E2JJ 5E18F 3EYYA 2WUSA 3CCMI 4CXFA 2O2OA 2N8GA 3EY1A 4EP4A 2EIFA 2O8KA 4C92G 4KICA 2OTJT 3GFLA 5B8HA 4EM2A 4OIQF 2GAUA 3LPUA 2ELHA 3VKIA 3RTVA 3TVTA 2L3QA 3DKYA 4WE1A 3JAMZ 1WSIA 2ACJA 2PNIA 5DS9A 2RNJA 3UE5A 2O4XB 1KD1R 1ASVA 3BR2A 4RW8A 2PN6A 1X2KA 2RHIA 4CIGA 5J2QA 4F7UG 3D5SC 1R0CB 3I8DA 1UB4A 3JAME 1ASWA 3V1OA 2JJ9A 1JJ2S 4M63C 2K3XA 3SZGA 1IHWA 1VQPT 2RN2A 3OYGA 4XK8E 1YJ9N 1PSEA 3I8BA 1X6GA 2ZBKA 3RRGA 1NEGA 3DP7A 1IG9A 4HWIA 3AT1B 4JRKA 3LP0A 2IVOA 3MEXA 4A0XA 3P39A 3SEZA 3Q7CA 3E97A 3SBTA 2Y9ZA 4JRIA 5GAN6 4XN3A 4FSXA 5I9EB 4IOCF 1VQON 2M0OA 2P9KA 2G8KA 4KB1A 2LT4A 2ITMA 3R3LA 2RNAA 3I71A 3KP3A 4CHQA 2K9GA 3J81K 1VQKA 5AQIA 4Y3OA 2LX7A 3LSHA 1N75A 1L0OC 4RG2A 1YCSB 4BDYA 1CZAN 5BR8K 4A2UA 3BJOA 4NZGA 2CH0A 1T8EA 3QIPA 3EYZA 2OTLT 4BNCA 4CIEA 1WHJA 2FVUA 2IS6A 1X9SA 1WRJA 1MMNA 3J80O 5GMKh 1UHSA 4IZZA 3K9TA 3R1XA 4NB4A 2VQGA 5CYQA 1RNHA 1VRLA 4CI6A 3QWXX 3EG0A 4AH9A 1FYMA 2IA0A 2ROLA 2MYSA 4CEZA 3ATUA 1KD1O 2DA7A 2P5GA 2UXXA 4F91B 2R4GA 1T56A 3CJ9A 3JRHA 1XGSA 3AVAA 1X43A 2I10A 3KLGA 1VSMA 2KIMA 2DD4A 3OL4A 1VYUA 4B3SK 3ULQB 1DGKN 4PKGA 5D7UA 4B1WB 3SHFA 4QVDA 4EMKB 2KXDA 1E3PA 2X6XA 2DK3A 2DXUA 4GY2B 4X62K 4P9FA 1MJAA 3B6AA 5F0FA 3EFSA 2F5EA 1VQNT 3MMYB 1I6HJ 4IURA 3CMAQ 4K42A 2Y4YA 4KIBA 3FIFA 2Y90A 2EV5A 3JCMb 1YX5A 3S93A 4GGGA 2E6ZA 1LWWA 1G2BA 5CVVA 1G5VA 3A01A 2O61A 2R3SA 1ZA2B 3OMCA 3U6FA 4DYQA 2CV2A 4MQVA 2GGRA 3SB2A 3JRCA 3CETA 1VAZA 4EM1A 1MHNA 1AVZC 4XKBA 4LFCK 2KKZA 4BI3A 1VQ8N 2HNIA 3QEIA 2RPIA 2MPXC 1AKHA 5TGTA 1D9DA 1M90R 3AL0B 2I8DA 1ATSA 2K3PA 1PP8F 3F70A 4MFEA 3OA9A 2XY8A 2EGAA 3JCUC 4DQ8A 4ELVA 5ICFA 3A8YA 1K9AA 4A54A 5A2QZ 1WA7A 1BU6O 3AVGA 4JHDA 3O9UA 4JLIA 1NLOC 2ZM6K 3F6VA 3MMVA 2L9RA 4DQSA 1HW1A 3CC2N 1U1TA 3LL7A 3F73A 3OSSC 5C44J 2P84A 2OV7A 1Y7XA 2W82A 3LP1A 5KN9A 4KGVB 3AAQA 1UEBA 3M4YA 4C30A 4QIWN 2F5DA 4M9XA 4FOEA 1FSHA 1LE8A 3KNTA 2DTHA 2XPUA 2QENA 4DR5K 1YLFA 5TKWA 1HBXG 1N25A 1WQ7A 4JZ4A 1B8IB 4AC0A 5ERIA 4ETSA 3VEZA 5J1EA 2NAZA 3HP6A 4RMNA 4A4HA 2QWQA 1R7JA 4GMJB 4G6QA 4CE9A 3EG1A 5BNGA 2XY6A 4GKJK 2ZXJA 4EZ9A 2WSEE 3D7EO 2XO7A 4L5EA 4C8LA 2L01A 1W70A 4XH1A 3M1EA 3HPOA 4B4CA 4FPBA 1ZRDA 2O9VA 4IVNA 1PKSA 3GTKJ 3O8VA 2HKQB 2H8WA 3O3FA 1N5YA 1QCOA 2W6KA 1DT9A 3EH1A 2NRRA 2A37A 3KLFA 3OQ5A 2KAFA 3G7ZA 4HPQA 3M8SA 4QS9A 2CT4A 3H9QA 2DTUA 3ZT2A 1KLNA 2CO5A 1Z91A 1W2BA 1W2BM 2DXTA 3VDXA 3CJ1A 2O03A 3TARA 1ZBJA 5AQGA 3CO6C 1FBQA 1TUGB 2DQRA 4R79A 1KRPA 3OH9A 1TQMA 4CGZA 1VQ9Q 3WTVC 5DM7R 3GFMA 1OYWA 2O4XA 2LC4A 3ZPLA 2TCTA 2DA6A 1OPKA 5EU7A 3I55A 4G7OF 2EQKA 1NK3P 3DI6A 3LW5E 1GL5A 3QODA 3S9HA 2KZMA 3IWZA 2H8HA 3BWGA 1FJLA 4XTUA 4HCBA 1RBTA 2QQ9A 1NPPA 4IHSA 3RCOA 2ZJQL 4B3OA 1YBYA 1H9TA 1Z3XA 3LSKA 2ESHA 1I94K 1T7PA 1XMXA 2L9SA 2V8IA 1JCEA 4BY6C 1VUBA 4MDWA 2JVHA 1FTTA 4N4NB 3WT0A 4FO0A 4Y13A 3AAFA 2NS8A 1W36C 2P5LC 1XQSC 2VBYA 3KEQA 3S16J 1YHQT 1LW2A 1MGQA 2JPCA 2LF8A 1YJWN 2CJJA 2D0OA 5DM6L 1NG6A 1SEUA 1WJCA 3MZHA 2CSIA 3ZP5A 4FU6A 4LG3A 1TQIA 2A6AA 1Q82U 4HLYA 3WXIA 3WVDB 2XDPA 3QB0A 2V9VA 2DMQA 4OVAA 1G15A 1YI2T 3IC7A 2B4JA 4HCZA 4RGXA 3AVHA 3GVAA 3HZ6A 1R36A 1RUWA 3KP7A 1O7LA 3RNJA 4C0ZA 6PAXA 5AQTA 4DQPA 4RB0A 4EEFG 1LQ1A 1BR1A 3SZPA 4CEOA 4BS9A 4X65K 1KG3A 3BUZB 1WIEA 3CC4I 3PSFA 4FLWA 3MXIA 2VWKA 3ABLH 4QSHA 4RB1A 5FLXE 3VS7A 3Q0VA 4IFYA 3M8RA 3SUPA 4F16A 3QEXA 4NS5A 5LL6Z 2RVCA 3CCQN 1W5TA 2LQKA 3LLRA 1JJ8C 2RK2A 4PSXA 1SD6A 3T0YA 4H5VA 1Z25A 3VODA 4LD9K 4K43A 1NJYA 4GV6A 4JX5A 5JLXA 2I7PA 3BQZA 4DNCA 4M7DF 4RTUA 1P90A 3ABTA 4BHPA 2NUPB 3ZMSA 3RR6A 3HKZA 2OTJQ 2VWFA 4GLMA 1SFOJ 1Z05A 4B1VA 2P51A 1D3BA 1W2BP 1D5VA 2ZZDA 1ETYA 4AHVA 4GVEA 4LJZF 4YIRX 1OCTC 2KRHA 2F5FA 4N0BA 4CD1A 1ZGAA 3ZN1A 1GBQA 2LT1A 2AO9A 4BUPA 2KMTA 5LL6S 2GLOA 1RLPC 1ZGJA 3VF2A 4L18B 4OIRF 4Y92A 3ISNC 2DI3A 5LJ5d 3AG4H 5IOZA 3JB9I 1X2NA 4V2GA 2UXBK 3KE2A 3CCVN 3J7ZO 3JB9J 3CF2A 4M71A 4CHPA 2HBPA 3MQ0A 1VQPQ 5GPAA 1VSJA 2HDCA 4QTRA 2DL4A 3TKYA 2EZLA 2V1NA 4ZN3A 3P1GA 1UELB 4I9LA 3KTQA 4F7ZA 3DB3A 1TOVA 1MZBA 3EAEA 4FYVB 2B8AA 5GAMj 2VLAA 1XMQK 3H1QA 1OCCH 4N56A 1BGXT 2DA2A 3VSLA 5F6FA 1B8IA 2KP6A 4M75G 1D1BA 4B9UA 5IT9K 2GXGA 5LJ5j 1J54A 2KE9A 3S6WA 2FZKB 4EJOA 2GTOA 3Q3SA 5IYBJ 4C23A 2DBKA 4DTUA 2IXSA 3HM5A 3VYTB 5GAGP 3M07A 1P6RA 1JUMA 2W57A 1IV0A 1XGMA 4OB1B 1XDSA 2OTLQ 4CCLA 3E9GA 1HC8A 1D9FA 2IBDA 1D8JA 1K78B 1YITA 5F2RA 4C92B 2HHVA 4EMKC 4DV7K 1PNJA 3FXQA 4FX0A 2JN6A 3PV8A 5LHGA 2HHHK 1S3JA 4XICA 3E6BA 1QBJA 2BKDN 4ON0A 3U9DA 1Q81R 5D8KB 4II2A 1HNWK 3DLLA 3GZNB 3K4NA 1EXQA 3WE2A 2L5QA 2LG4A 3CW7A 3HOWJ 2JTFA 3TTCA 4BRHA 1Z67A 3F10A 2VL8A 1JXOA 5GMKm 4OFEA 4RLFA 1LB2A 3C0BA 1LWEA 1VQNQ 2JZ2A 5GP9A 2KL4A 3VYSB 2F2EA 3RERA 5GMKl 3VEVA 3V9SA 4EQQA 4IFVA 2CUBA 3M8EA 4DU1A 5IP7J 3GNFB 3ZQIA 3HOSA 3LZJA 2OZMA 2R7QA 5J1RA 3F8NA 2K5LA 5FROA 2F6CA 4AFSC 1Q86R 5ADXH 4M3DA 3QEWA 4J9GA 1PG5B 3THVA 4CA0A 5K1YA 3ENOA 4FK0A 2HYGD 4Z4FA 3CCSA 1M8VA 4C92E 1BN5A 3KP4A 1RADB 3DTKA 1FJGK 4W5RA 1SZ2A 3C1DA 1F1BB 2ZC2A 3O3HA 2CQQA 4KBMB 2RO0A 4DSJA 1N36K 2ZGWA 4FSVA 1WUAA 1RDUA 3BTLA 3FMQA 3GDQA 4LD0A 1S72T 2HXOA 2RN7A 2WBNA 1NOZA 2BHYA 3CCUA 2KLOA 2HS5A 1CSKA 1RT7A 4J6WA 4KHNA 2L3RA 4TV7A 2VYPA 5F08A 4CJ4A 4CFDA 1SVMA 4RM3A 3L1AA 3PIPF 2KT0A 4AF1A 1OKJA 2PBIA 4FM0A 2A68F 2E4LA 1D1CA 4B1ZA 1BOAA 5FRNA 4JK7A 4PJOG 2R7RA 3C6TA 3R2XC 5EDNA 1ZYQA 4FETA 1FN7A 1I3QJ 1IKYA 1GOBA 3VYGA 1FX7A 2FB7A 4BAYA 3AVBA 2EQJA 3PUFA 3R0JA 2FMLA 3INZA 3PFYA 2YX7A 3ROUA 1Y64A 2DVEA 4BDPA 3CQZJ 4B9SA 1PHTA 5E26A 2E2NA 3A8LB 1ARKA 2E1MB 4QT7A 5AQSA 4Y4RA 4OB0B 1VQLA 3J7AP 3UPUA 3VTHA 2FNPA 3K1PA 3CERA 3T8RA 4N4GA 3PO2J 2A6HF 1DQUA 1DEJA 2DYRH 1Q7YR 4B23A 2WBMA 2FSJA 3CCRT 1SHFA 3OYAA 1QW1A 5C4XJ 5AQHA 3QEPA 1VSKA 1H92A 1BR2A 2KZZA 1JTXA 4F9OA 4OLAA 3QLHA 4WWCA 1T33A 3LANA 2E2OA 3K57A 1VQOT 2JT1A 4HUFA 4DR1K 2K27A 4AHCA 4PK4A 3M0RA 5A2QO 2CU7A 3FE1A 4B8CA 1HJOA 4DOVA 1SFKA 4CVNE 2J4RA 3OYNA 4Q48A 1EBMA 5K5OA 3F23A 1O9SA 3VJPA 2VJ4A 3NWTA 1UJ0A 5AQXA 4NBQA 3JRFA 1QQIA 2P81A 3A5LC 4J6YA 3H6ZA 2WAQA 2RQTA 2W6LA 2IG0A 2GX9A 3IMXA 2GWKA 2AKLA 4X6AJ 3JCMW 1XS9A 4Z89A 3B73A 1NK6A 4ZYGA 1MUNA 3KK2A 2DBBA 1OU8A 2BUPA 1X1BA 3JRBA 2B5JA 2V7YA 3QZ9B 3W6JB 5AQMA 4HV6A 4AI4A 4UNFA 4ENMA 4LIVA 1YO5C 5CKFA 1GVDA 2KK4A 3JAMK 2A36A 3RSEB 3HVTA 4RTVA 3JRIA 2VUMJ 4K41A 3CCJI 1KEAA 5BPDA 2V1QA 1HKBA 4N0AC 2VB6A 3KKSA 2QA4N 1RAEB 1YHQQ 3H8ZA 3AHUA 2NRZA 4KIFA 4EDUA 2YT6A 1KONA 1M1EB 3S1NJ 1C1AA 3D5RC 2IGNA 2PVGB 1JGGA 3HOYJ 1WQ2A 1TBXA 1UAXA 2V1UA 1B59A 1WVRA 4BL0B 2DJZA 4EJWA 4WCEL 1ETXA 2I5JA 2LJ0A 1D5YA 3G71A 3PL8A 4FJMA 1VQ8T 4HF1A 1K78A 2QGUA 4C92A 3A2FA 4HF0A 4A3CJ 1YI2Q 5HNFA 2CMPA 1TC3C 2YRVA 3VENA 2DERA 2QTVA 1DGWY 1EWRA 2J6OA 4WQ5A 1VQPI 3Q5FA 2E5LK 3BDPA 5EGOB 4IUUA 2FNAA 3K7AJ 4J2DA 2DAOA 2QWLA 4C2TA 2P9PB 1LJOA 1X01A 1XSDA 3BROA 2NVXJ 2D1XA 2WAEA 2K85A 1YJNN 1J5YA 4QAGA 1ZRCA 1EH8A 3A4CA 1S7EA 3E0JB 2V7FA 3CO7C 1BL0A 3K1MA 3SUOA 3ZEHA 1RT5A 1T05A 2HQHA 3V8LA 2DPNA 3BFMA 1KTQA 4B9WA 2EZIA 2E71A 1FMVA 2ASOA 4BE1A 3F5TA 4J9EA 1I27A 4X1EA 5FB2A 1EP4A 3DLBA 3BG3A 1ACMB 2OTLI 2FQ4A 3BGRA 3JCMQ 1DP7P 1UOCA 1OH8A 4KMFA 2QVOA 4BRNA 1MV3A 3A8OB 1FOWA 2GCXA 4ELZC 1HSQA 4UV9A 4ID1A 3GX4X 2FX0A 2E1NA 4W1UA 2UXNA 3DEEA 1U8RA 1TVRA 4C3IJ 2YV0X 4X66K 2HBWA 4YOTA 5DM7L 4A6DA 2R7SA 1IUYA 4LOCA 2FQ3A 3QERA 2ZJRF 3QU6A 1A0NB 2OJ2A 3K9KA 4AVPA 4G9ZA 1FOKA 4PJMA 1MUDA 1VQNI 3DTEA 5CQGA 3R6NA 3UF4A 3QDKA 3DBRB 2LTOA 3MJXA 1RZ4A 4UC4A 3CQYA 4CK3A 2V7ZA 1RAHB 2O8BA 2R0QC 4IG0A 2BV6A 5BMZA 2RGVA 1ZQ1A 3CCEN 4N4HA 2D0PA 2ATCB 2X74A 1VQ5N 3RI4A 1BW5A 1XTAA 1OU9A 1AT1B 1U47A 4XIUA 3ULRB 1VFCA 3F8CA 3DLGA 2NOZA 4MDAA 4FWSA 1RBUA 1ZBLA 2J05A 3H08A 2GQIA 4C92C 2YHYA 3OS0A 3D6RA 4LMYA 3RDVA 2NS7A 3BZ6A 3BTIA 1H3ZA 1HNXK 1I1JA 2JMCA 4E9GA 4M7XA 4PKCC 1ONVA 5AZIB 2JPBA 2M7BA 2DA1A 2KKOA 2W00A 3EO3A 3CCLN 2GBQA 2YSQA 3I9V2 3MZYA 4O8KA 3VQ4A 4CJUA 3HTSB 2A69F 3OY9A 4HHTA 5HRNA 1ZLJA 1BA0A 3AA5X 3TSPA 2AXLA 1CXQA 2MA3A 4JZ3A 4OFHA 5M5WJ 2A07F 1PUFB 3FC3A 5JVGL 2YRCA 2NNNA 1LMZA 2L7FP 1R1VA 4HX7A 2ZPHB 1MSFC 3CHWA 1XC5A 3OYMA 3R8EA 3QYBA 4IRHA 4DKWA 1MW7A 3TWHA 3I54A 2VE9A 4BD3A 1OH7A 4ZHRA 5M1KA 5GMKe 5LJ3j 2DJQA 5GADJ 1HLUA 1B92A 4A62A 4IJAA 3ZETA 4IUVA 2L4MA 5LY3A 3RMCA 4AIHA 3JRGA 3HM9A 4XQ3A 1YWPA 2DRMA 4YFXF 2QCOA 1OULA 3KP5A 2V1RA 5JFRA 2EJFA 2O8DB 1MA9B 2KFNA 2ZB9A 3RZOJ 1JT6A 3JCMc 3GTOJ 1KLMA 4DQIA 1X3NA 2CP5A 4PFZA 4M3UA 2E5KA 3G4ST 3LFKA 3WGHA 3BTJA 4RW6A 2VGNA 1D4XA 1EQYA 2VC8A 3HHGA 3O8HA 2NS0A 2PFBA 1MGTA 2RD1A 1K9MR 1Q8IA 3M1FA 3BR1A 5LJ5g 4MO5A 3BJAA 2M9HA 4AHRA 1VSLA 1GCQC 2KRSA 3RMAA 3T7ZA 4C8MA 1HD3A 4P55A 1YRNA 1HYZA 3FZLA 1STZA 2IA2A 4BY9C 2M8GX 4ZH4F 4KNYA 2DT5A 1VQ4A 5GJVB 4FJ7A 3RR8A 4M75B 1T0JA 1S72Q 2QM3A 3RSEA 3CQXA 4KN7X 5KQ8A 1UFFA 1ZHFA 4Y7NJ 4IHWA 5GANh 4BJ6C 4Q5SF 1F21A 4BXUA 4RGUA 3B6CA 3C65A 3GPLA 4O0JA 2O6GE 2YUQA 4HW0A 3M5AA 2E1MC 1M3AA 1UWBA 2NXNB 1Z1DA 2JGUA 3HGYA 2KFDA 3TREA 2VCPA 1K83J 4XIDA 3ABKH 5ICEA 1TXQA 1WKMA 2KW4A 8ATCB 5L23A 1R4MB 4H5NA 5D6XA 4BY7J 1A5JA 2F8TA 3L0QA 2CZ6B 4LB5A 5HRPA 1MIJA 2VBWA 4CC4B 4BQOA 5KE2A 5FJ8J 2DW4A 5EF6A 4Y17A 3SFIA 4YRVA 1S1TA 1YQMA 1ZELA 2FF6A 3MXJA 1DJ7B 1GOAA 1HU0A 4Z2YA 3CCVT 4NCBA 4E70A 1NNEA 4OFAA 3GEZA 1QVGA 4M75E 2P9PA 1QVGM 1LAVA 3SQNA 4ENKA 3M9AA 3WUHA 1BOBA 3CCRQ 2QAZA 1YHQI 4UUVA 3I0TA 3QAHA 4KHQA 4Y91A 4FXDA 3PVQA 5FLXK 1LOTB 2D5RA 4BRFA 1EKEA 3J7AF 3AVMA 1VQOQ 3MWPA 2XGXA 1R49A 2Y69H 5EZGA 1NG2A 1S3XA 2LY9A 2L54A 2K9NA 4D5CA 2HZYA 3SPZA 5IP6A 4LD5A 1KQSA 1KQSM 4PLIA 1Q18A 4CRIA 4W5QA 2E70A 2VJ5A 3U4LA 4NL3A 4FW2A 4L6V5 1IV6A 4A12A 4OMQA 2JM8A 2E35A 4IJNA 1TNTA 1IGQA 5GAN5 1IKVA 3IL2A 3Q0UA 2RC4A 2C0IA 3RKXA 1W7AA 3F21A 2NLUA 3N4QA 1TWHJ 5FPNA 2JWKA 5IH2A 3SUNA 4PJOB 1W9HA 1RKWA 3GFIA 3SHWA 1YVUA 3DLLF 2FRYA 5KGXA 4JRQA 2YCHA 3MK6A 1EFNA 4KT5C 1YS7A 4I6ZA 3VEYA 2IGMA 3CPWA 3CPWM 4N5SA 2R7UA 2ZGZA 2FJ1A 3IV5A 3H0IA 3GP8A 4CGGA 4CIFA 3HPHA 1D5AA 1MNDA 2G3RA 2RK1A 2HVHA 2JM9A 4BWJA 4PFPA 5M5XJ 1R5ID 2LMDA 3ASNH 5D6EA 3DRRA 1KQ2A 4NL2A 1R00A 4XOPA 1QSLA 2F96A 2R7DA 3M8QA 1WEGA 3PFIA 2VWBA 2JUFA 5GIOA 3DKWA 2NOJB 3IUCA 1NJIR 1ZR4A 1U45A 3D5LA 1GFCA 3G6ET 3CCMA 4Z02A 2FC0A 2JA5J 5DK5A 2DT7B 1IRFA 4BHBA 2RQRA 4LLNA 5AZIA 1SRLA 5LHIA 5F64A 3TO7A 3LWFA 4PUOA 2O9LA 4RTYA 1HQEA 4XTXA 1MWKA 1NPRA 3HB9A 4JJNK 3H9GA 2CZ0B 5DYMA 4PJOE 1B9NA 2PU9B 1VQ8Q 1TUDA 3LWIA 1PP7U 3EGDB 1QZYA 3H46O 1GLAG 3TR8A 3FDYA 2ZPIB 2XF5A 3QYHB 2H3JA 1OLTA 4FLXA 1E2XA 1CF7A 1YIOA 3CBOA 3G1JA 4FISA 4B9MA 3QWLA 3ER0A 4IIOA 1NLVA 2CYYA 3NPFA 3VQDA 5D5VB 2NOIA 3DOLA 3EEQA 1QVGP 1S5JA 1G3SA 4CC7A 2XGDA 1K8AR 5CR4A 2F9TA 2VONA 1KSPA 4FVMA 2YPRA 3HRGA 1X27A 4JAXA 2ZPFB 4CGHA 2E7XA 2KQ2A 3BDDA 3DTIA 3SD4A 1M30A 2FUG2 4M7AB 3V4GA 1IF1A 3ZMZA 4CC2A 1PYVA 1QQJA 4BJ5C 2K9LA 4DTSA 2X1DA 4M78A 3HPGA 3I0WA 4M78D 1U84A 4ICLA 1T98A 3G2BA 4KGZB 3PIOA 1KQSP 1L3TA 4DHYA 3G3ZA 2A40A 1QHGA 4OPJA 1SPKA 4DF8A 3J7ZI 5B1AH 4J00A 4EM0B 4Z8AA 3DKMA 4OMLA 3SZTA 5E3NA 2VG6A 1JXSA 3L00A 4DBFA 1Q82C 4WQ4A 1WJRA 3GCMA 1TK8A 1SD4A 3RZDJ 5IXFA 4RM2A 3M54A 1X2MA 4KULA 1VQKT 1Q95G 1QWEA 4J9IA 3ZOBA 4LFBK 2P9LB 3LFUA 3MEDA 3ZEUB 3CF5F 4PJNA 4FT2A 3B6OA 4XONA 5D6FA 3CPWP 1FKOA 4ZGEB 4BQLA 1TKTA 2HHSA 4AIDA 3CMEN 3U23A 3MEWA 3HFOA 5GMKj 4AVZA 4PSWA 4QS7A 1ZUUA 1Q1VA 5EG2A 5FKMA 4AG2C 3DPTA 4YOWA 4M7AE 3JB9H 4H0TB 5ICCA 1ZSZB 4CZJA 1X1PA 5LFAA 4CERA 5D5XB 4OWRB 1IN7A 1QP2A 4C3HJ 1MJ9A 3F9KA 4QVZA 4M6VA 1KC8C 4UB8C 2PMZN 1WHLA 2M0MA 1DLOA 3JRAA 3VF6A 4BQAA 3VEOA 1SFUA 4B9XA 2CSOA 4ISGA 3MDQA 3SWNB 2JMAA 1JLGA 1IAWA 2XHBA 2OQRA 1Y6IA 1OH6A 2QSHX 1GBRA 2CFXA 4DF4A 5HOOA 4U0YA 4CEQA 1QCNA 4CJ5A 3ZT0A 1GXQA 1EX4A 5HBMA 1PJRA 1UHWA 3HSBA 3L6QA 2DA9A 3VQBA 1YVNA 1SKSA 1AZGB 1QKXA 2DOAA 3RKYA 2ME0A 1HNZK 4JYAK 2OFKA 1G6NA 4A69C 3S2DJ 1U5TA 2LH9A 1DP3A 3CMAN 3FKJA 1YN8A 2E1YA 2QA4T 2C6YA 4EIKA 4I9QA 2AZSA 2MW8A 5DDGA 2NYSA 2EGEA 1YJWQ 2LMJA 1IC8A 4BU2A 2VQFK 1KU7A 3SMSA 3O3KA 5AJ3K 1FPQA 5H1SQ 5A0GA 5B66C 3CPEA 4PQUA 5GANf 2D4WA 4DTJA 2FPFA 4FJNA 1NGJA 3HRMA 1KG4A 4BREA 3G4SQ 3PX6A 1UUEA 4WXDA 4M75C 3SNNA 1E6HA 3QJYA 4WQ4C 2NRAC 2ABLA 4PJOA 3IHUA 3G25A 1BK2A 2IT0A 2CW7A 2DYBA 5IY5H 2LDUA 1YW7A 5K5QA 3SEQA 2MOXA 4A3EJ 3DRPA 4L8RB 2F4VK 2JTEA 5DCMB 4B09A 2HOEA 1CLQA 2HQ5A 1ABOA 3MPUB 3MKDA 1YJNT 4BGAA 4DZJA 3VERA 4PJJA 3ERED 1DDNA 3H92A 5HLIA 3VQAA 1VQOI 3ZRGA 4KPYA 2PQ8A 4XRMA 1Z9CA 5K5RA 4K0KK 2PYLA 3SFMA 4RWTA 4XBFA 2M30A 4IHTA 4OX9K 3A02A 2BXYA 1N34K 4CJRA 1NGNA 2NRXA 3MAJA 3JRDA 3UR3C 5LRSA 1MMGA 3BF1A 3L2RA 4HSTA 4J83A 3VQ8A 3BR6A 2PUKB 1JGSA 5KHDA 3CMMA 1JKOC 3N5BB 2EILH 5CYVA 1NK0A 1JXEA 2HQXA 2WONA 3M3ZA 1SC7A 3CBPA 2Z33A 4DFMA 1T3LA 2XIDA 2R7TA 3LQQA 3WQTA 1R1UA 1HRHA 2DO3A 4RTFD 3EGDA 2WTUA 1KZHA 1U8BA 2DFFA 5CY4A 1IJJA 2XV4S 3W6KB 2XDVA 4KH1B 2K4BA 5E3MA 1XQHA 3HO1A 4V19K 3CC7N 4D5FA 3D2FB 1UDLA 1RILA 3CQ8A 4BGBA 2O0YA 1L5UA 1WAJA 4CF1A 4PJ0C 4R1HA 5HK3A 4YOUA 4AQYK 3CCVQ 4LUDA 3E1YA 4GBQA 4M9SA 1Y0NA 4XLHA 3F8MA 1A35A 2P0PA 2MI6A 2XPWA 4FYXB 3TEEA 1U9OA 2O3FA 2VC0A 3CCET 3QBWA 3ECOA 3L2VA 2MCNA 1T0FC 4G6DA 1VQ5T 1RUNA 2Y1IA 1WNSA 2ELKA 1HPMA 3HZJA 3OOUA 1IV8A 1KG5A 4FK2A 1YAGA 3BR0A 4UHTA 1VQ9N 2HCKA 4BB7A 2KIUA 3EDPA 2QKKA 3JCMh 4M7AA 3DRSA 1G83A 2YWWA 1K7AA 4WF2A 4JKFA 4M7AD 3M6GA 4NCGA 1A5XA 4EW4A 4BYYA 1OISA 4WYBA 1BI0A 1KG6A 2HBJA 2O7OA 1VQ8I 4PJOC 3K0LA 2EYZA 4CCHA 3L1PA 2AQFA 2VT2A 3O1BA 1FYKA 3SAHA 1ZBIA 2FBIA 4N47A 4OPKA 3K70D 2Y9YA 1ZN2A 1OJLA 1ZUYA 3C6AA 4KB0A 4H0PA 1GLNA 1W5CC 3KPHA 4FX4A 4JEPA 3C2BA 3WGIA 1HQUA 4XKCA 3FXUA 4BRGA 4G7ZF 3N5NX 3NVKA 3GOXA 4LK0F 3QO9A 1V5GA 2KT8A 2EIKH 1KQ0A 1I1GA 4ZYAA 2P9LA 5CKBA 4FJLA 3ZEUA 1T0HA 3IS9A 1OVYA 3GTMJ 2GUPA 4D7NA 2CS3A 3JV3A 2D0BA 2AQEA 1P7MA 2KEAA 3CP8A 3CC4A 2IGIA 2KR3A 3M8PA 2DDBA 2HVQA 3SYTA 2E7WA 4Z4HA 4LF5K 2BE9B 2EQRA 4CEFA 4DGWB 3F2KA 1ZSZA 4WFBL 3K2AA 4GXOA 2PVDB 4QCLA 1UFMA 3FEOA 5KYUB 1WYXA 4UOBA 2QZ8A 1LEBA 3G6EQ 2Y75A 1PD0A 1BU1A 3MCPA 4JK9A 1JLEA 3BY5A 2QWMA 1Y1VJ 1OI1A 3SWNA 2P0KA 3CBMA 2A28A 3O9RA 5AR0A 1YNZA 2KYBA 3ZT1A 3WG7H 5IPAA 1HW2A 4D6WA 4KMUX 4B6MA 4UV8A 5AQFA 3FLGA 4DSEA 2LY2A 4CD3A 3NTHA 2Y0SA 4JUVA 4KHSA 4JI7K 3O4QA 2B9SA 2DBMA 2P5OA 4EHUA 1VRTA 1UECA 2MLGA 1RFQA 4QQDA 3J81E 1BW6A 4BXXJ 3I56N 2MF2A 1U49A 2HFHA 4JNEA 4I0BA 3C7NB 3Q0WA 3JB9D 2V52B 5C42A 3QICA 5BPNA 4JI1K 2OTJN 2P6SA 3PIPL 2HI3A 4B1UB 4KBOA 2VWJA 1H8KA 5FD5A 1M2VB 4IQ4A 2XRNA 1RLQC 2A5YB 2CP6A 2KHOA 2KIQA 3HEFA 4B43A 1RUOA 4PGGA 2LNHB 2XDDA 2KROA 3GO5A 5DCFA 4CO8A 1FYLA 5EVZA 2J5OA 4CESA 3UA7A 1OVQA 2M02A 3M56A 3FXRA 2M2EA 5HS8A 3BC8A 4IPAA 3WNFA 4CECA 5DCMA 3BPXA 4RDUA 1I1SA 3VU3C 3HSTB 3MO8A 4NDLA 2XAQA 4CBWA 2HHTA 2OCEA 2E4HA 4RGSA 3QP6A 5HK0A 4A57A 1YJWI 3IRRA 2XAUA 5L3GA 2CT3A 1L3SA 1NZ9A 1GLJO 4F04B 2NVQJ 1VQKQ 3RWUA 5DTDA 1ZSZC 3TSWA 3JCMV 2DNUA 5KGWA 4WFNL 1YG2A 2LNBA 5AQVA 2R7WA 2ZQBA 1X3MA 3VQCA 1SMTA 3K58A 2QWWA 4BC3A 3MN5A 4CH7A 1P8ZA 2KPMA 1OZ2A 3G4SI 3MN9A 1MWMA 3SWNC 5J2MA 1KHIA 3K5LA 1TYQB 3EFOB 4PZJA 1KYWA 2GBYA 1CQTA 2FBXA 1MBJA 4FASD 5JR3A 1I0CA 3FISA 4E9FA 4M77E 1J3TA 3IRXA 4DLEA 2KDZA 1TKDA 2VE8A 3D2FA 4FJ9A 1J2XA 1HDDC 1BUPA 3CCQI 1O7FA 2EQIA 1U6GA 3M9QA 1I5ZA 3ZR8X 2RV8A 2K2VA 1DTTA 2QYOA 2DFEA 3PE0A 2OJED 4XL9A 1ZGWA 1N32K 2NOFA 4E7LA 1QVGS 3SZ2A 1J9AA 4E0DA 4XKWA 3HHTB 2E60A 1ZA1B 1Y57A 4PJLA 3KWGA 2K3YA 2IS4A 1QVFA 2GIVA 1QVFM 3OJSA 2QA4Q 4UY8O 2HPMA 2OPRA 4J8OA 2X6YA 4EJYA 3CCST 2NRHA 1O3SA 2K9SA 3NF8A 5C2DA 2MSYA 3P7NA 5KRSA 2MK5A 5I2MA 4BVOA 5JHUA 4IXAA 4KH6A 3EGUA 1KK7A 2H27A 1ZX6A 2YKNA 4DR7K 2WADA 3CESA 3FXJA 4IRIA 2H1KA 4Q0BA 4O44A 1KQSS 1U6ZA 4CCNA 4XR6A 3CCVI 3SQ2A 2CP2A 2VG7A 3E9PA 1ZLKA 1JO8A 1HW5A 2ETHA 4C0GA 4L0ZB 3QPSA 4XTVA 4IHVA 4EGZA 7AT1B 4J9DA 2Z1DA 3W2VA 3GLLA 1KAYA 1NK8A 4IOAL 3AFHA 2X9DA 5F0HA 4RBOA 3DLMA 3P4IA 4MMLA 1N3CA 1YJNQ 3EYIA 2ZJ2A 3H0GJ 3N05A 2O88A 5E20A 3JCMX 1OYIA 2NOLA 3G1MA 1XMAA 2KIFA 1FTZA 5LRRA 3CPWS 5BS6A 3X25B 4MGRA 1RAFB 3AO4A 2VKNA 4DSLA 3MEVA 1C1BA 3M8FA 1VQLT 4RAZA 4HV5A 1E7OA 2VGMA 4GCVA 3QESA 4M78F 4C8QB 1QVUA 3MZ8A 3PIOF 3CFRA 3WNGA 2OPTA 4IFEA 2DJIA 4AUXA 4JJCA 4J01A 1XHXA 3C7JA 4H8KA 4MQ3A 5F1XA 2NOEA 1WXBA 4IL6C 4F92B 1IHVA 3BPVA 5GANe 4BI4A 4NC8A 3IKMA 1AEYA 1QSSA 5I22A 1SSHA 1BG3A 1J0RA 3JCMf 3J80E 2PBDA 3MFKA 2M45A 2XB5A 2WTEA 3O5BA 4FVUA 1IB8A 1QO0D 2LSNA 2L0KA 3MXMA 5KTQA 1A6QA 2DRKA 4R0KA 4CYCB 4A3KJ 3QYFA 1MBFA 4LIUA 2JTVA 3JW4A 3U9ZA 1HUXA 3LDSA 4EIAA 1NTCA 4IUQA 1WXTA 5F27A 2A7YA 4OMPA 1J5EK 1JE8A 3CD6N 3A5ZB 2NRWA 2FF4A 1JHFA 3LWLA 2ZJRL 1WJ5A 3CMET 3TTDA 2EWNA 2FBHA 3DKXA 1IN6A 3K9JA 3CCEQ 1P92A 1N77A 3DLAA 3OBWA 1I4K1 4H4MA 4HBLA 1VQ5Q 2YG8A 1Z7UA 2HPIA 1M2VA 4AT1B 1M5Q1 3M4OJ 1Y96B 3KK1A 3LNQA 3DMJA 4C5HA 4C8QE 5D6YA 2MD5A 3RESA 1V4TA 2WA0A 3EZWA 4KN4X 2K3BA 1QQOA 3T69A 4GYIA 3CCJA 4MFDA 2XB0X 2KJCA 2DN0A 4JN4A 3GTQJ 5E3OA 4NXNK 1WHMA 1T08B 3DLKA 4M77A 2JVVA 2PX9A 4M77D 1PDNC 2DAQA 4RTZA 3R9PA 4BXFA 2ZPGB 4JJDA 2E36A 3OW2S 2NUTB 1RTDA 3CZ6A 1AZEA 1IBMK 2AS5F 2WB1N 3E6DA 1MUYA 3HXLA 2HMIA 2Z1JA 1HJDA 3OS5A 3HGGA 2BW3B 5CKTA 3V9ZA 3F9MA 3REOA 3NQOA 1SFEA 2X4XA 1NK7A 5FKOA 2HQAA 3OYLA 1VQPA 4IUTA 1KQ9A 2O5RA 2LLKA 6AT1B 1BWFO 4IXCA 4DV0K 2FO0A 3RMQA 4CCMA 4M4ZA 1YUWA 2YKMA 2HVRA 2E8AA 3PX0A 3H3NO 2ED1A 2YRDA 4HG2A 1B1BA 1SKRA 3EFOA 1MNMC 1Y0MA 1KCFA 1S1XA 3DEUA 2DTIA 1JHHA 5J4YA 3VQEA 2XKOA 3FZKA 3T1YK 3MD2A 3VYRB 5HY6A 4MFBA 4CZCA 3KLNA 3WXKA 1X75C 1YI2N 2CS7A 4H0VB 1J53A 4J6XA 1C6VX 1KFZA 4LSLA 3UNGC 2MMPA 3ME9A 2OTLA 4MTEA 3DLEA 4QKUA 4Q4ZF 4FJGA 2Z9OA 3TU4K 4OKEA 5EC7A 1ENHA 4NUBA 3M0QA 3TCJA 5B3SH 1ZBFA 2CQ7A 4JI6K 2BYVE 4DQ2A 3PFSA 1IZ6A 1VQKI 4RW4A 2L0AA 2CUJA 2YNGA 1SF9A 4DTPA 2K4JA 5LEKA 3KCCA 4ZNXA 4ISEA 2V75A 1FMKA 2K5IA 2FBYA 1M4ZA 1JKHA 1BIUA 4HQEA 3VETA 3WHCA 3SQ0A 1WJSA 2NNYA 4NO7A 4M7DD 5CVRA 5IYDJ 1VQNA 1A5WA 4HVUA 5C0YA 4MEXF 1HLVA 1WN7A 1SSFA 4IHYA 2E1HA 4OPHA 4LC9B 4HZFA 2BHZA 5TJJA 4U0VA 2CUZA 2RREA 4RKUE 3CM6A 3HL2A 1HKSA 4HT8A 4HEA2 4D7MA 1DTQA 2E19A 3GBTA 2DK5A 1OZ3A 2DA3A 3KFVA 3ASKA 2FXAA 3EUAA 2J6FA 5HNHA 5EXWA 4YFNF 1H0MA 1V29B 1Z3YA 5GAN3 4DA4A 3LSIA 4FM2A 3X2QH 2CQNA 2AXTC 2EYXA 2ZE2A 3B6PA 4W5OA 5H6RA 2BDPA 2Q8KA 4A0YA 4LUEA 3VQQA 4M3YA 2QA4I 2OI3A 1AA7A 1JJ6C 3LP2A 3GTJJ 5AFUH 4Z88A 4M7AF 4ELYC 2DCEA 3N97A 5KRTA 3I4MJ 1GXIE 1KGSA 4BJTA 2ZMEB 4C8QA 4RG8A 1XGNA 4JK8A 5AZJB 1W6XA 1G4DA 1ZQ3P 1S6PA 4ENJA 3FKIJ 3CJBA 2GUIA 1WXUA 3P31A 3E5UA 1QKWA 1W97L 2MFZA 1YFNA 1PM3A 1JLAA 2G8UA 1S29A 2E6LA 1U3OA 1IN5A 1AWJA 4RW7A 2XHIA 4BKXA 3V42A 1HOMA 1UGSB 2GELA 2XHKA 3SV3A 4B1RA 5BQTA 2HMPA 1KSWA 2B63J 2EZKA 4J5YA 5JLFA 2MGQA 1ATRA 1KAZA 1XCBA 1ZRFA 4M7DG 4CYCA 4Q47A 2WV0A 3NH2A 1YJNI 4P5OA 3FB9A 3ZN0A 2KI7A 1YIJN 2X35A 4M9ZA 1OOTA 1TSFA 2MLKA 2FPDA 4CZKA 2V8KA 1RAGB 4Y1CA 1YOVB 2RAEA 3CJ7A 3FHGA 2IAJA 4HNTA 1NG7A 2B7EA 2HSPA 4WCIA 3FFKB 5GANd 1A04A 3L42A 3SK3A 1G59A 3ULEB 4WK8F 2IRFG 2RHYA 1N8RO 5M3MJ 5GAOr 4FJHA 4G1QA 3TO9A 1WPYA 4ELUA 4I0AA 3LSPA 3CCSQ 3KBGA 3QBXA 5LLQA 2CH5A 4YOVA 2VOPA 2A1RA 1WSGA 4GRIA 5K14A 3ZLJA 2UYTA 1W1WE 2Q1NA 2CWEA 2QXFA 2HOSA 2LDMA 2NUTA 1KD1C 1XQOA 1KYZA 2BZTA 5GANj 3BW1A 1LPQA 4NLCA 2BW3A 1X9WA 3WODF 4X1VA 1S72N 3VGMA 3E01A 3CCEI 3I56T 1ZG5A 3JB9F 3VB2A 1TTHB 1VQ5I 2JMWA 2D1VA 3MEGA 4O4GA 3FXMA 3DBLB 4G6TB 3EHRA 1QWFA 4C8QC 1R0BG 1VSHA 3IP4B 1S1UA 2DL8A 3CYMA 4PL7A 4RTTA 4XTYA