3OYKA

Crystal structure of the pfv s217h mutant intasome bound to manganese
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
368
structure length
368
Chain Sequence
b'LDAELDQLLQGHYIKGYPKQYTYFLEDGKVKVSRPEGVKIIPPQSDRQKIVLQAHNLAHTGREATLLKIANLYWWPNMRKDVVKQLGRCQQCLITNASNKASGPILRPDRPQKPFDKFFIDYIGPLPPSQGYLYVLVVVDGMTGFTWLYPTKAPSTSATVKSLNVLTSIAIPKVIHSDQGAAFTSSTFAEWAKERGIHLEFSTPYHPQSHGKVERKNSDIKRLLTKLLVGRPTKWYDLLPVVQLALNNTYSPVLKYTPHQLLFGIDSNTPFANQDTLDLTREEELSLLQEIRTSLYHPSTPPASSRSWSPVVGQLVQERVARPASLRPRWHKPSTVLKVLNPRTVVILDHLGNNRTVSIDNLKPTSHQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PFV integrase
publication title Molecular mechanisms of retroviral integrase inhibition and the evolution of viral resistance.
pubmed doi rcsb
source organism Human spumaretrovirus
molecule tags Recombination,viral protein/dna
total genus 106
structure length 368
sequence length 368
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2010-09-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
A PF17921 Integrase_H2C2 Integrase zinc binding domain
A PF18103 SH3_11 Retroviral integrase C-terminal SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2300 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3oykA04
1.10.340.70 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Endonuclease III; domain 1 3oykA01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3oykA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3oykA03
2NLUA 2FBVA 3OVNA 3OYCA 4ELUA 2RJCA 1LWEA 4M3UA 4DG1A 2OA8A 2E5QA 1BISA 1BIUA 3KJVA 2Y1IA 2HQXA 1C0TA 1TKTA 4B08A 2OZMA 4CEOA 4CHYA 1ZYQA 4Z0UA 4KI4A 4IG0A 4ELVA 4Q0BA 4CFDA 1RT1A 1YTUA 4FL6A 3CM5A 3NF6A 1NOZA 1WSIA 4Z02A 2XHBA 3KKRA 5C25A 1RTDA 4FW2A 4PQUA 2W42A 2QQRA 4HUGA 2I5JA 4I2PA 3VA3A 5KGXA 4KHSA 3PX6A 5D6WA 3LZJA 2JZ2A 1NKEA 4O0JA 4AHRA 5D6XA 4OKEA 1QHTA 1VSDA 1UA1A 4DLEA 4KV8A 3MXIA 1L3SA 4DS5A 1RTIA 3P8DA 4CF1A 3NF8A 3RTVA 4B9TA 1J9AA 2YRVA 4H4MA 4FXDA 1TAUA 1WSGA 2KFZA 4CK2A 4MFBA 1WLJA 4Q5WA 4CHQA 1XC9A 3V1RA 3F9KA 4ID5A 1H3ZA 1F21A 4FJ5A 3SQ2A 1EKEA 3HVTA 2HNZA 4QVZA 5KRSA 4RW4A 1HYZA 4FK2A 1GOBA 4YNQA 2A1SA 4E7HA 2XY6A 4C8MA 2MWOA 2X4YA 2X6NA 4HHTA 2D9TA 3LGFA 4HUEA 3PX4A 2HHSA 1TGOA 1WJQA 4LD0A 3TWHA 5HRPA 3KLFA 1X9MA 1S1XA 4R5PA 3DLRA 2IAJA 3E9FA 1C1AA 2QQSA 3VQCA 4CRIA 2ETJA 5KI6A 2D0AA 1G15A 3U3YA 3OY9A 4E3SA 3HM9A 3IS9A 4J2AA 3NTKA 1EP4A 1XHZA 2P5GA 4EZ6A 3VQ6A 4B8AB 1ASVA 3HJFA 1SUQA 3AVJA 1C0UA 3P8HA 1VSKA 2O4GA 1I39A 2KQ2A 4GMJB 2KZZA 4PLLA 3G0ZA 3MEUA 4W5RA 1CZBA 4IG3A 1TVRA 3FFIA 4CEZA 1VK0A 3QNOA 5IAYA 1L3VA 3BDLA 3ZSXA 3CFRA 4FJMA 2Q3SA 3KLGA 2HVHA 1TK5A 2LSNA 2P5OA 2RI5A 3KLIA 3L2VA 2RPIA 4NCBA 1HQEA 3C6UA 3ZSYA 3FC3A 3OYGA 1S1WA 4DSLA 2G8IA 3NDKA 4BWMA 3VA0A 3NTIA 1KLNA 3ITHA 3K5MA 1XHXA 4CESA 3SV4A 5C0MA 5SZTA 1RT7A 3QIOA 3FLGA 1U04A 1NK0A 1QS4A 3PV8A 1B9DA 2Y1JA 4CJ4A 1WSFA 4OKJA 4AILC 3DOKA 5FRMA 4I9QA 3SUNA 2LTOA 1LWCA 1QE1A 3QEVA 4CGJA 4NCAA 3WNEA 2ZE2A 4ZHRA 1C1CA 4QQGA 1JLCA 1NJZA 1XWLA 1Q8IA 3AO2A 4LH5A 3NNQA 4DTXA 4C8KA 5J2MA 5CZ2A 1WSJA 5KH6A 4DFKA 3DB3A 3NGYA 1S5JA 3SPZA 3TAEA 4DSKA 2YNFA 3V9UA 1IKVA 3V1QA 3NH2A 1KTQA 3K5OA 2RHXA 3AVIA 1JXEA 5I42A 3IG1A 3MO8A 2GBZA 1NK9A 2YNHA 3AVFA 3PNWC 1CLQA 2GFUA 4E1NA 5DMRA 3K59A 4W5QA 1RI0A 3LPUA 1RBRA 4CHNA 2CKKA 3OYEA 3LGLA 3S3OA 3LALA 4O44A 3I0RA 2HNDA 4HCBA 4FJ7A 3MP6A 3DRSA 1VSMA 3ZSQA 3MEGA 1DLOA 3ZT3A 4KPYA 1RDCA 3LANA 3DMJA 1SL1A 1D9DA 4C5GA 4E7LA 1SKWA 4CHOA 4LSLA 3M9QA 1C6VA 3AA4A 4KTZA 3CM6A 4CIFA 1QSLA 2PZSA 3LYIA 1RT4A 4KHQA 3QEIA 4OGEA 4FZZA 3ZT2A 3KUFA 4A4EA 4PWDA 3OYBA 4CJ3A 2RI2A 2LVMA 3VQ8A 4K8XA 5CIUA 4KB0A 1WJRA 4FW1A 4C5HA 3NBPA 3C6TA 1RILA 4A4FA 2EQMA 4Z4GA 2RN2A 3LX7A 1QQCA 1D8YA 4BACA 3WNFA 1S1TA 3ZSZA 3QEPA 3ZCMA 4DMNA 1L3TA 3O3FA 1N6QA 3KIOA 1NKBA 3RRGA 2OZSA 2XY7A 3VQ5A 1XNIA 3QLHA 4L8RB 4CIEA 3F70A 3RMAA 1BL3A 1NK6A 4BDZA 4C5IA 4JS5A 3HL8A 4OGCA 1BIZA 1U48A 3V9XA 1TKXA 1OZ3A 4TSXA 1YTAA 4DU4A 5KRTA 2XY5A 3LAKA 5J26A 5CZ1A 1B92A 3RRHA 3SI6A 4AHSA 3CQ8A 4I9LA 3NHGA 1KLMA 4FU6A 1CXUA 4CECA 4DWIA 1FK9A 3TANA 4MQ3A 2G3RA 5EU7A 3RMCA 2EQKA 3OYIA 1J54A 3UT1A 3FDRA 1G5VA 1REVA 4E7KA 3AVLA 3K57A 3RMDA 3S9HA 4M42A 5E41A 3BGRA 4BE2A 2GUIA 4CJKA 4CJQA 2PYJA 4NYFA 1A5VA 3TAGA 5KE3A 1HNVA 2BE2A 3NGIA 2PYLA 2P0KA 4CF9A 1RT3A 4B9VA 3AA5X 2PY5A 3LP0A 4E7JA 2JLEA 3ZT4A 3L42A 1O1WA 4O5BA 4DTUA 3V6DA 3QERA 4N41A 4KHNA 1J53A 1BQMA 3LLRA 2XDPA 1KVBA 4DTNA 3TAQA 3PMIA 4O55A 4IUTA 3U3GA 4FM1A 4OPJA 3DOLA 5KCHA 3OYDA 4KHWA 1IH7A 4CFCA 2G8FA 3HT3A 3TARA 2YNGA 1RTJA 3MECA 1L3UA 3IRXA 3DB4A 4RW7A 4BWJA 4C5EA 4CEDA 4CJ5A 3OA6A 2FC0A 4H4OA 1RBUA 1Y97A 4IUUA 2DFFA 1NK7A 4DU3A 3VQAA 1NK5A 4CGDA 3TAPA 2VG5A 3PO4A 3I0SA 3SUPA 4CEBA 4YFUA 4OVLA 4QQ6A 4CF8A 3ASKA 4IURA 2ZQBA 1VSFA 1RCHA 2GFAA 1ASUA 1VSJA 1U47A 1OI1A 1BQNA 3V4IA 3C95A 5HBMA 4O4GA 3HP9A 1Z25A 3UIQA 3QETA 3HO1A 1LW0A 2R5AA 3DRRA 1UWBA 4C8LA 4DFPA 2RJDA 3PFSA 2G8UA 1TV6A 1SV5A 4BE1A 3NE6A 4FJJA 3OYFA 2O4XA 2VG7A 3AA2A 1S1UA 4FLZA 2E4LA 1HPZA 4N4HA 4JS4A 3QINA 1RT6A 3OYAA 1X9SA 5FROA 5FDLA 3OS0A 4AHVA 2A1RA 1RNHA 4CEQA 2IG0A 4DTJA 3SUOA 4OLAA 2YHAA 5KTQA 1BI4B 1C0MA 1IKXA 4F4KA 2VYTA 2DY4A 2LCCA 2OPSA 1RT2A 2HQEA 4CK1A 3P1GA 2BUDA 4DU1A 2ITGA 3LPTA 1RDAA 3ZSWA 2BIVA 3OJUA 3JYTA 4O0IA 3OYKA 3AVKA 4IFVA 3ZSVA 4CEEA 2X74A 4X34A 5J2PA 1RBVA 2RHYA 5D6YA 4F3TA 1JLGA 2O4IA 1IO2A 4DQIA 2F8TA 3CYMA 1MU2A 1JXBA 3LP2A 3AVHA 2WOMA 3LAMA 4KHUA 4N76A 4IDKA 3M8PA 4FZYA 3VQ4A 2LRQA 4II1A 3NGZA 2L89A 2RF2A 1BI4A 1VSEA 4M41A 3P83D 5HRSA 3K58A 1J5OA 4FJ9A 3I8DA 3QIIA 2VG6A 4I7FA 4AHCA 4DTRA 1WSEA 1HYSA 4FK0A 1NOYA 3AA3A 2BKDN 4LH4A 3SQ1A 4FJKA 4DFJA 1L5UA 1WSHA 3OQ5A 3KD5E 2X78A 4RG8A 5T7BA 4HTUA 4JRQA 3SQ0A 3S3MA 4Y1CA 3EYZA 1GOAA 4UQGA 1SKRA 3QIPA 1LWFA 4ZTJA 4FLVA 3SPYA 4DQRA 4F3OA 4EP5A 3VQ7A 5J39A 2RO0A 1SL0A 1BHLA 3NF7A 4BDYA 4Z4IA 1OZ2A 3AVBA 2LDMA 1HNIA 3EZ5A 3DM2A 4A4GA 4PY5A 4CJRA 3TAFA 2KZMA 3OYNA 3OMCA 2Z1GA 4DS4A 4CF2A 3SJJA 1JKHA 2K3YA 2E6NA 4JLHA 4EP4A 3O3HA 3QEWA 1SL2A 1KFSA 4EZ9A 1SKSA 3D0PA 2DTUA 3MEDA 3QBYA 4KHYA 3IAYA 3MEAA 3TABA 3AV9A 1N5YA 4M3RA 4AHUA 2G8VA 1R0AA 4DTOA 1BGXT 1K6YA 4HVJA 1VRTA 1TK0A 3H08A 4FJIA 1VSLA 1I3AA 1ZBUA 3VQ9A 3M8RA 4PA1A 3KK2A 4DTMA 3PUFA 2GF7A 2WONA 2RHZA 4RW9A 3LZIA 2KFNA 2FBXA 5J2NA 4B9LA 4CGGA 1S1VA 5JS2A 3DLBA 3ZSOA 2M16A 2HVIA 1JLAA 1NK8A 3VN5A 1ZBLA 4J2BA 4DF4A 2ATQA 2VWJA 2IOCA 2P51A 3MP8A 5KCOA 2YHBA 1FKOA 4N56A 3GOXA 2GV9A 4FLYA 1LV5A 5C6SA 1WAJA 2QXFA 1JLEA 3KTQA 4KTWA 5C24A 4QAGA 2BGGA 1YVUA 1NJXA 2DFEA 4DQPA 4E1MA 2RJFA 1RBTA 2D0BA 2R5MA 2HMIA 1U49A 4FJXA 3MEWA 3H6ZA 1TL1A 4CCHA 3DLEA 1DTTA 2NUBA 1IKYA 3ISNC 2HB5A 4QCLA 4N4GA 2Z1IA 2M0OA 3VQQA 3JSMA 1LAWA 2R57A 3QKJA 5J2QA 3TAMA 2EFIA 2EX3A 4BD3A 1JLFA 4DQSA 4ICLA 4FJ8A 3MEVA 4XIUA 4CF0A 1S6QA 3L8BA 4CJEA 4KFBA 2DAQA 4H8KA 2B8AA 4DSIA 1QSSA 4Q5VA 2B6AA 3AVNA 3SUQA 4B9SA 1FKPA 4B3OA 2RI3A 4DSJA 2X6SA 3WNGA 3OS2A 4A4HA 3QJ6A 5DK5A 4K8ZA 4AH9A 3SV3A 2FBTA 4B9NA 4E89A 1T03A 3L3VA 2B4JA 1LW2A 5KE2A 1W0HA 2KTQA 5CY4A 5M9OA 3CG7A 4FVMA 1KCFA 2EKOA 3CFOA 2XO7A 1YT3A 1T8EA 4KO0A 4FLXA 3B6OA 4HUFA 1Z26A 1A5XA 3ZSRA 4JRPA 3C4SA 4LD6A 3KLEA 3Q1JA 4CJTA 4J2EA 1WN7A 2P1JA 4KREA 4FM0A 1RTHA 3RMBA 2YNIA 2FBYA 3VQDA 4L59A 2E6LA 1EX4A 4HCCA 4N47A 4W5NA 1WAFA 1U4BA 1KVAA 4KI6A 1BCOA 2X4WA 1SSFA 1S9EA 3DLKA 3B6PA 3M8SA 3O3GA 1EXQA 3L2RA 1Q9YA 2YKMA 4OVAA 4IKFA 2G8KA 1IG9A 3PO5A 4GW6A 1GOCA 2MWPA 4M45A 1ITGA 2O4XB 1KSPA 4PLIA 3DLMA 2JTFA 2K3XA 2DFHA 1T05A 4NYNA 4CJPA 4DTSA 4C8NA 5HLFA 3QO9A 3D45A 4CIGA 4HCZA 1RDDA 4IUVA 2G8WA 3OJSA 5K14A 2QK9A 4B8CA 5I3UA 3VQPA 5HRNA 1UAXA 1B9FA 5IN1A 5C42A 2E6MA 3ZT0A 3O8VA 4F8RA 3HSTB 1S9GA 3MAQA 3RR8A 1W9HA 1NJYA 3DI6A 4J2DA 4E0DA 3ZT1A 1NK4A 2HHWA 4E7IA 5HRRA 2EQJA 2OPQA 3NTHA 4FLUA 3O4NA 1HMVA 4IUPA 3NF9A 3RWUA 4CGFA 3FEOA 3ME9A 2IC3A 4Z4HA 3LP3A 4NS5A 1X9WA 3KK1A 3HPHA 3DYAA 3M8QA 4FJLA 2VWKA 4B9XA 4G1QA 3LDSA 1CXQA 4F2RA 3AO4A 3DLGA 2G8HA 1FXXA 3NH0A 4OJRA 1RT5A 2EHGA 1HJRA 4B9UA 4N5SA 4BE0A 2WACA 3LWLA 2X4XA 1VSIA 1WGSA 5HP1A 4LY7A 1CZ9A 3QEXA 4FLWA 2L8DA 3S3NA 3T19A 4OPKA 2KW4A 4M3TA 3E9GA 5HROA 4RW8A 1KVCA 1QTMA 3VQBA 2R7YA 1D9FA 2RJEA 4KAZA 4OLBA 4CJWA 2F5KA 3PY8A 1HRHA 3OYJA 3ALYA 2X35A 2R58A 3V9WA 5JS1A 3HYFA 4QOZB 1JLBA 1QSYA 4M3YA 4F2SA 1KFDA 3AO3A 5J1EA 3QNNA 1ZBIA 3AVAA 1LAVA 3HP6A 4RW6A 3HPGA 3V9ZA 3V9SA 3SCXA 4E19A 4CJSA 3E01A 4M3XA 4N4IA 4W5TA 2D0CA 3T3FA 3VQEA 2QKKA 2HHQA 1UA0A 1X1PA 1RBSA 1JL1A 3BDPA 4Z4FA 4Z4CA 2HHTA 4CFAA 1D5AA 3DRPA 1OYXA 4GVMA 3OMGA 4UC4A 3CFPA 4B9WA 3TI0A 2IS3A 3SNNA 4DSEA 4FK4A 1KHCA 3UWNA 1IKWA 4C8OA 2EQUA 4IUQA 1RDBA 3KK3A 3SZ2A 3V1OA 1WNSA 1ZBFA 4DLGA 1UOCA 1A5WA 4BDPA 3HVRA 2YV0X 1MHNA 2IDOA 3LP1A 4CJVA 3WNHA 3U6FA 3OS1A 2PQWA 4CHZA 5FRNA 1TKZA 3L2UA 1C1BA 4FJGA 1TAQA 4FLTA 3HXMA 3AO5A 2DIGA 1T7PA 3QESA 4DF8A 4ELTA 1U45A 4KRFA 1EETA 1N27A 1XI1A 3SQ4A 3OYMA 4W5OA 4LSNA 3TR8A 1TKDA 1KRPA 2F8SA 5D3GA 3NH1A 2BANA 4CK3A 4CHPA 3KKSA 4CGIA 2IGIA 5CYMA 1VRUA 4IFYA 1TK8A 1DTQA 2XRIA 1ZBHA 1BCMA 4DFMA 5CYQA 1JL2A 4CEFA 3K5LA 2AJQA 4DTPA 1Q9XA 4CJFA 4CGHA 4CFBA 1ASWA 1TL3A 1NKCA 4NZGA 4OKKA 3H8ZA 3NAEA 4PL6A 4KTQA 4AHTA 4GY5A 2RHIA 1VSHA 3AO1A 4FZXC 4IBNA 4QW2A 2Z1HA 2OPPA 3AVGA 3MXJA 3P5JA 4QQDA 4EDUA 2OYQA 4NCGA 3L2QA 4CE9A 2B5JA 3KLHA 3OB9A 2Z1JA 2HHXA 3EAEA 3OYHA 3SD4A 2L3RA 2RHUA 2QKBA 3EY1A 4KB1A 3G10A 3K5NA 4Z4EA 3T1AA 3A2FA 3MEEA 3ULDA 1HQUA 2FHDA 3L3UA 4M3ZA 4WE1A 2XK0A 3THVA 4DQQA 1S6PA 4CERA 4M3WA 3F73A 4FCYA 3HK2A 4DSFA 3ASMA 3RR7A 4ID1A 1JLQA 4I2QA 2HW3A 2HNYA 4RG2A 4KKOA 2OPRA 1HYVA 3CEYA 4FJNA 2JGUA 3MP1A 3NCIA 4FM2A 3PX0A 2ZD1A 3PMTA 5SWMA 3L2WA 2HHUA 3KD1E 3DLHA 4FJHA 3C94A 3S6WA 5KGWA 2DIQA 3ZEHA 1WJSA 4ZTFA 2D5RA 3SYZA 3META 4PUOA 4CEAA 3O4QA 4B9MA 3AVCA 1NJWA 3MXMA 3OYLA 2M1HA 4Y1DA 3HPOA 3AVMA 2F96A 2BDPA 3K2PA 3LH0A 4CJLA 2HHVA 3NFAA 3LWMA 3V81A 4FYDA 4CJUA 2XY8A 2YKNA 2RKIA
chains in the Genus database with same CATH superfamily
2KRSA 2YXYA 4UNFA 8AT1B 3OVNA 4DEXA 3EE8A 2J06A 3SYTA 4GKKK 4H0PA 2RJCA 4DG1A 1EH6A 5D6FA 4WQ4C 2FPDA 2YI1A 3C6HA 1YHQA 2OZMA 3J7AY 2R7WA 1TT0A 4F16A 1ORKA 1NPRA 4IG0A 4ZYDA 2OTJN 1P7IA 4FL6A 2BV6A 4N9HA 1RI7A 2GXAA 5FD5A 3PJRA 5DCFA 3HKSA 1MKMA 3CCQQ 2E10A 1WBDA 2XHBA 3VU3C 2EFOA 4M7AA 2R7QA 2KK4A 1WH5A 4F04B 1JGSA 3GPLA 4DNCA 1BI3A 3A4CA 2NVTJ 5E26A 5F0HA 3WE2A 3J80Z 1JO8A 2JN6A 1NGCA 2WV1A 1VQ8N 4KHSA 3H0GJ 2I7PA 1M3QA 4C2TA 2KIFA 5JVGL 3L0QA 1B9NA 2BTFA 5D6XA 1QHTA 2VPLA 2MA3A 5L3FA 2HQ5A 2X1DA 3HI0A 1IBMK 2K7LA 3MXIA 1VRLA 1RTIA 3BQZA 3NF8A 3QYFA 2MOXA 2WSFE 5J6XA 5EG2A 2QEXN 1TAUA 3OOUA 1WSGA 1B8IA 4B24A 4Y33A 1AU7A 3HBTA 4KGXB 1IGUA 1XC9A 4BUPA 3EUKL 1H3ZA 4ID5A 5A0GA 2FSNA 3DKMA 2FYKA 2AZVA 2QCOA 1BDGA 3H0DA 3U9GA 2BTTA 4HOBA 2RREA 4N4NB 3ZMSA 1J5YA 1ZHIA 2WC2A 5H6QA 2FNPA 4X64K 2DMPA 4HCKA 2X4YA 4HHTA 5M1NA 2HHSA 4MNUA 1OX8A 1MMSA 3GTOJ 1IXCA 5KYUB 2CW8A 2A3LA 3DLRA 1S29A 3H0IA 2LR8A 5EF6A 2ETJA 4J8OA 2ICWG 5KYNA 4E3SA 3IS9A 2DXUA 2ADUA 4BY1J 5GANh 2OU2A 3L2CA 5CYVA 3VQ6A 4KH0B 2EFWA 5M5YJ 4XR6A 5AIQA 2EBIA 3AVJA 2K2MA 3CCUI 1K79A 1M1KC 2I0NA 3ABKH 3SMSA 1KU3A 1RL2A 2ZGZA 2IPQX 2VE8A 1YI2A 4M9SA 1Z9CA 5LGTA 2JRTA 2HMAA 3OA9A 2VJ4A 4H0VB 3CC4N 1VQ9I 3FHZA 1Y96B 4NL3A 3MEUA 1BL0A 4WK8F 4U0YA 2PVDB 4M78A 3E9PA 2CS7A 2F2EA 2V9VA 3FFIA 2KLAA 4CEZA 1F9NA 2VKVA 3CCRN 1VK0A 3QNOA 2YX4A 1L3VA 2PMZA 3KLGA 1SHFA 1TK5A 4WX9A 1MWKA 2LSNA 1MBKA 2P5OA 2K86A 2W00A 4GCVA 3KLIA 4M7AF 2LSOA 4NCBA 1XD7A 2EFNA 3ASNH 4UXNA 5GAN6 3ZSYA 2G8IA 1AKHA 2WTEA 5EJCA 3SFMA 3CCMT 3OH9A 3VA0A 4DR2K 3ITHA 3RYRA 1XHXA 1LJ9A 2RC4A 5SZTA 2A07F 3ZQFA 3JCUC 5HY6A 4C8QG 2IIMA 3CC7A 4JI1K 5AFUA 2F4OB 2ISYA 2Y1JA 2MC4A 3ZX0A 4CJ4A 3CCMQ 1WSFA 3RCOA 4OKJA 3M0TA 2V1XA 2M9UA 4HSBA 3BCAA 2F5CA 1RETA 2Y69H 1JTXA 1LWCA 1V4SA 3QSUA 1OQKA 2CT3A 4M7DG 3OSVA 3J7AO 2KXCA 3CXCA 2EJ9A 4GYIA 2VUBA 3GCMA 4CZJA 1P4WA 4DTXA 1NLPC 5IXFA 2XGEA 3VOEA 3I56T 3H1QA 5CZ2A 1D0YA 3SJMA 3CF2A 3WODF 2ME6A 2HBMA 4UUVA 1I94K 5FFXA 3CCJN 5ICEA 4DFKA 3DB3A 2NAZA 3FZHA 5EYRA 1JTYA 2YRCA 1GLCG 1NG9A 2XDDA 4N0BA 1KTQA 3I56Q 2RHXA 2EWNA 3EETA 4DEYA 1DU0A 1MMGA 2MLKA 1IXRC 3ELKA 1M8VA 1TWGJ 4C92G 2GBZA 3UDCA 1CLQA 2GFUA 2W40A 1S72N 1O75A 2RDPA 5JLWA 4W5QA 1RI0A 2HR3A 2CUDA 2DQRA 1T39A 4CHNA 5FPDA 1UEBA 3LGLA 3HHGA 4Y91A 1FY7A 5LJWA 2E60A 5FLXZ 3BT9A 4C1NI 3LDQA 2VQFK 3ZT3A 1K8AO 5F2RA 2M8EA 4JRIA 1AWXA 3RSEA 1SL1A 2JXBA 3WGIA 4N0AA 2Y0SN 2Q8KA 3M9QA 3CCSN 3AAPA 2OTJT 2JPBA 1FOKA 5LJ5g 2KDOA 2OCEA 2CH5A 1QSLA 2PZSA 3LYIA 1RT4A 4KHQA 4M78F 4GLMA 3EH2A 5CHIA 4AYBA 4DB3A 4KUMA 2PBIA 2M0CA 4CJ3A 3FHNA 3VQ8A 3O9TA 2PJRB 2OTJQ 4K8XA 1WJRA 4FW1A 3FIFA 3NBPA 4LF8K 1ETYA 1RILA 2V52B 4A4FA 2EQMA 1VQ8T 4RB1A 2DRMA 4CO8A 2D0NA 2RN2A 3RMSA 3O9RA 4PZJA 3OHRA 2F5VA 3TO9A 2LNVA 4A3DJ 3A8HB 3QPHA 4W1UA 3ZSZA 2RVCA 2J05A 1N6QA 2X85A 1EWRA 1VQ8Q 3VWBA 3J80K 5DM6F 3EHRA 3CF5F 2XHIA 3QLHA 3IHUA 2QEXT 5HLGA 1BL3A 1OCOH 1UGQB 3F8MA 5LL6Z 4IJAA 5LJ3j 3C12A 3P9KA 3OMYA 4OIOF 2VIXA 3WTZA 3MN7A 3RVCA 4TSXA 4DU4A 2EA2A 4LK1F 4L0ZB 1F36A 2QEXQ 2EV6A 3S1RJ 4C0ZA 4AT1B 1GXQA 1QZEA 2O01E 2L9VA 4I9LA 1KLMA 4FU6A 2RHKA 1ETKA 5KHDA 1KG5A 5DDGA 4JKDA 4BRNA 3A5ZB 2YX7A 4KT0E 2X4HA 1UB9A 3S6IA 3MN2A 2X51A 4MQ3A 3VGLA 3K9KA 3RMCA 2DA7A 3N0UA 2DJIA 1QCFA 2QTVA 4ELYC 1REVA 3K57A 3HZJA 3I0TA 2CH4W 3S9HA 3QXEB 5E41A 4B3RK 2XUBA 2JHJA 3ABUA 4BE2A 3O2PE 1E7OA 3M0RA 3BGRA 4CJKA 2FMLA 2ZFUA 1Q82O 4NYFA 4NBQA 4L5GA 5GAMj 1A5VA 1XCBA 2Z16A 3CCEN 1SAUA 2GQQA 3NGIA 3DF8A 4CF9A 3OS5A 3E66A 2PY5A 3LP0A 5LRRA 2M5WA 3KNTA 2JLEA 3ZT4A 3GWZA 1H9GA 3LAJA 4DTUA 3ZQHA 2PEXA 3S8PA 4HWIA 5LMNK 3GTGJ 2YU3A 4IUTA 3U3GA 1CSKA 5KCHA 3K2AA 1QVFP 4CFCA 3THXB 4XQFA 1FBQA 3HT3A 4ESJA 2W57A 4YOWA 4FL9A 1JJ2P 2OV7A 1RTJA 3CCRT 4I09A 4RGUA 4L0YB 2WAEA 3CCUA 3IRXA 2O8CA 3CC4Q 4NLBA 3IV5A 2W0ZA 4A3CJ 4RW7A 3KEYA 4H0YB 3OH6A 4C5EA 4CJ5A 3OA6A 2NUTA 3CP8A 4FWOA 3CCRQ 2R5YA 1U2WA 3JB9H 3D2FA 1VQ9A 4IUUA 3K4KA 3G7ZA 2K9MA 4EAHD 1VIEA 4DU3A 2P5LC 1U84A 4MDXA 4CGDA 1CF7A 1WVRA 2VG5A 5EVZA 2H1LA 1WYXA 1D8KA 1G6NA 3AG1H 3MHXA 2ED0A 3ASKA 3WTWC 2MSYA 1Q81U 3M1FA 1UG2A 2K5IA 1SPKA 4IO8A 3PSIA 5CPRB 2KP6A 1AHJB 2GFAA 5HK3A 3NAUA 2WTUA 1Y8RB 3HOWJ 4RA2A 3SWNA 2QW9A 4K0KK 2M4GA 2UXNA 3HO1A 4S04A 4XEIA 3CC2I 3V7RA 3VYTB 3FSPA 4XN0A 1OX9A 4DFPA 5JLHA 4H0OA 2MI6A 4A3EJ 1JXSA 2MH2A 1TV6A 3DKWA 5ERIA 1K9MU 1SV5A 2HHHK 2ENMA 4FE7A 4I6MA 4I0AA 4HF2A 2ZXHA 2P9UA 3CCJT 2EH3A 2VQHA 4PFZA 1OCZH 1YQLA 1VAZA 2VQEK 5HDKA 2R7DA 4JS4A 4DR7K 1WI3A 1BC8C 1SKUB 4AHVA 4DZPA 3CCJQ 1V4TA 1G3TA 3M0QA 2QK0A 5GMKe 4Y3OA 4LF9K 4KISA 1Q7YU 2HSTA 2YHWA 9ATCB 2IT0A 4JI4K 1P4AA 1FP2A 3ZMTA 5IP9J 2ZMEC 3GZ5A 1T0HA 1O3QA 3NARA 4BR2A 4ON0A 2OPSA 3A0HC 1X3NA 1X2QA 2HQEA 4CK1A 2XHCA 1S72Q 1QLYA 4FT4A 3VB2A 2VGMA 5HODA 3ZSWA 3G0QA 1XDUA 2BIVA 3OJUA 3TDUC 3OYKA 2OD5A 4IFVA 3ZSVA 2DXBA 3DTIA 1RBVA 2RHYA 4RKUE 3A5MC 4ZDOA 3UKRB 4F3TA 1U8BA 5FLXK 2GGRA 1M9SA 4DQIA 4B4CA 2P9PA 1LFBA 5GAGP 3CYMA 2XKOA 1JXBA 3AVHA 2WOMA 5TJJA 4N76A 2LCSA 2M02A 1U2VA 1ZUKA 1ZREA 2PZ1A 3Q3SA 2L89A 3CCSQ 2LFBA 4Z94A 2D0PA 2A42A 1WJFA 3S2HJ 1XMAA 5E17F 1BI4A 4O8KA 1VSEA 1V5FA 3P83D 3KE2A 4FJ9A 3HSCA 2CQNA 2JUGA 4I7FA 5L3GA 4AHCA 5E20A 3CWUA 4JYKA 3W6JB 3QYHB 2HQHA 1WSEA 1T38A 2XRLA 2K02A 3CPEA 4LD9K 1LFPA 2BKDN 4A5AA 3EYIA 4XOPA 2Q0RA 1VQPI 3CCQA 3M55A 4HW0A 1MSFC 1ZRDA 2X78A 4Y0WA 2DZCA 4I2OA 1WDXA 5IOZA 4RCCA 1I5LA 3S3MA 3GLLA 4Y1CA 1N75A 2XDBA 3EYZA 2EILH 1SKRA 4CUGA 4QSHA 4BI3A 3H9QA 4DJAA 4JUVA 2OQRA 2DTOA 2KY9A 3IH2A 1QVFS 2CZ1B 4PFPA 5LGUA 1YP5A 5LEJA 2L4AA 5J39A 1JJ2S 5GANd 1SL0A 3F22A 1OJLA 1BHLA 4ENKA 3RI4A 2DLPA 2W6KA 3AVBA 3J7AP 5FJ8J 2CT4A 2O8DA 3GZ6A 3CUQB 3TAFA 1R5HA 1KU7A 2X0LA 4MFEA 4UUTA 1H88C 2MYSA 4BG9A 1QGPA 1JEGA 1A6QA 3QEWA 2OTLN 3SDZA 1P4XA 1SKSA 2DTUA 3TSUA 1G2BA 2CUJA 2H6BA 3HKZA 3J81E 3MEAA 4B1RA 2EIMH 1JQQA 3JAMZ 5FPMA 1GL5A 1KG3A 1RAGB 1N5YA 4M3RA 4AHUA 2KGTA 3QJYA 3CCEQ 5D4RA 1JE8A 2UYTA 2ROTA 3S32A 3U9ZA 2CV0A 4HVJA 1VQOI 4JBAA 4W97A 2QYZA 1RLPC 1X6GA 1I3AA 3WEEA 1X27A 2ASPA 4II3A 3L09A 4F55A 5C44J 1WFWA 3PFIA 3KK2A 5GANe 5AZIB 3ZLJA 4D1QA 1DP7P 2FZCB 2GF7A 4A5NA 2P8TA 1ZLMA 4C1NK 1VQ6N 4LFBK 2VUMJ 2DCEA 4CXFA 2DO7A 5LY3A 3ZCOA 2LT4A 4JKCA 3ER0A 4X0GA 1VFCA 2V8KA 2VL8A 2G7HA 1IRFA 4OMZA 1JLAA 4HYEA 2Q31A 1J9IA 1ZBLA 4J2BA 3F3XA 1B72A 2VWJA 1QU3A 1RAFB 4X62K 4BY6C 1KG6A 1M90R 4BRFA 1IRZA 5AQTA 1D1AA 1WA7A 2Y4XA 2XASA 1JUSA 1WAJA 4D5CA 4KTWA 4OB3B 4JI0K 1GUUA 3TPQA 3N4MA 2BGGA 1NJXA 2DFEA 3DQVC 2ESHA 1RBTA 4FYVB 1KA8A 3RQ4A 2RQTA 4X9DA 4MFDA 2LBFA 4A69C 2M4KA 1QBJA 2MFZA 2P81A 4GYGA 1DGRM 1KJWA 3GIBA 1YRNA 2JMCA 2JTMA 4CCHA 1PUEE 3DLEA 1W2BP 2GXBA 2DFIA 1FSEA 5DLQE 4QCLA 3WQUA 4UV9A 4KBMB 3JCMb 3CC2N 3PT9A 1QKXA 3JSMA 3QKJA 2FB7A 1OULA 1W1FA 1KO9A 3RKYA 1J7KA 1IJWC 1XB4A 2BHZA 5EX5A 2BW3A 4FJ8A 4DBHA 2PI0A 4G6TB 4JI6K 4VUBA 2CMPA 4CZCA 4HT8A 1B4AA 4XIUA 1ATNA 2YRDA 2IPOB 3Q9VA 4UOBA 3THYA 4BR5A 1I50J 2O61A 4KN4X 5FWCA 4CD3A 2KMTA 3GOIA 3LL3A 2B8AA 2QA4N 2D1VA 3WTVC 1B7TA 4D9JA 1YITI 4Q4ZF 4B9SA 4B3OA 4DSJA 1BIAA 2YUPA 1I4K1 2VJIA 3A02A 3V4GA 5L3BA 4PGGA 1LPQA 3EPZA 1MBFA 2MH9A 4PJOB 4BNCA 3ZQCA 3B6AA 4NUBA 2P84A 3CBPA 4EV0A 4KGVB 1K78A 5KE2A 4AD9A 1QVGS 4M7AD 3I56A 2QWQA 1K9AA 1HKGA 5TGTA 3M0PA 2YDLA 3S1MJ 5CKHA 1YT3A 1T8EA 2LJ3A 2OX7A 2JN0A 3URGA 3HZ6A 5L3DA 2NUPA 5LJ5j 1DIZA 4BXFA 4PHTX 2CP6A 3T8TA 1Z3YA 1RKTA 1Z26A 2QWMA 4OMPA 2K4JA 2KLOA 2WBMA 2ATCB 2ZNZA 2CZ6B 2EYQA 2O9SA 3C4SA 3ABLH 5HS9A 3KLEA 3M7GA 2FBHA 2QWOA 4J9GA 1RTHA 2K5CA 1UAAA 3VQDA 4RCHA 5IYBJ 4N47A 2NRRA 4W5NA 4B47A 2E3IA 4K11A 1U4BA 2COBA 2OAWA 2JVHA 5DM6L 2X4WA 3CF5L 5CJ9A 3MN5A 3DLKA 2COYA 2L0AA 3K0SA 1LUJB 3CDHA 2MK5A 3Q0VA 3C2HA 1T0FC 3FDYA 3SFIA 3I64A 2STTA 3A1PA 4J9HA 3EYYA 3RERA 1GOCA 3HRUA 2OTJA 5GAOp 4LDXA 4MZPA 2O4XB 3HOSA 1KSPA 2M45A 2R5ZA 1VQPN 3CDIA 5HDGA 5H6RA 2O2OA 1TSFA 2HBJA 3VMFB 4Y13A 3CXCM 4XTYA 4CJPA 3DXJF 3JREA 2CH4A 4OIPF 4C8NA 4IHTA 5HLFA 1TNSA 3VYRB 2ZJQL 2H09A 1M2VA 3H46O 3OJSA 4RTZA 1PU8A 5KQ8A 4HNVA 4CBWA 1KXPA 1R1UA 3O80A 1OPKA 2P4WA 3F8CA 3AG3H 1PNJA 1EBMA 2IA2A 1D3BA 3K2ZA 5EXWA 2JWTA 5C42A 1OKRA 4F8RA 4EMKA 2JS0A 3FZKA 1J6ZA 1BM9A 2OTLT 4LDWA 5DCMA 4FWNA 2RQVA 2QGFB 3GTJJ 4QVDA 3BQYA 5LMUK 1PD0A 4TVRA 2HHWA 2GWKA 2EQJA 2OPQA 2OTLQ 4M78D 3O4NA 4IUPA 3DCFA 2FUG2 2WB1A 1PP7U 3CPWA 2OI3A 2JZYA 2GZWA 3FEOA 4LJZF 5DPKA 5I21A 1ABQA 3PL8A 3KK1A 3JAMK 1M1FA 3E7LA 3M8QA 1Y6IA 3AGRA 4FJLA 4MZTA 1P8ZA 1VIFA 2LX7A 3NMUA 4F2RA 3AO4A 2GTOA 1W2BS 5FU6C 3QMLA 1B34A 2Y75A 2M51A 1VQ6T 4OJRA 3NFCA 4EHUA 1W0TA 2GAUA 1VI0A 1MMDA 4E7SA 2VXZA 1R5GA 2X4XA 5K7ZA 4CC7A 2XF5A 2IJLA 1VQOA 2LDUA 2BOLA 1WHUA 1VQ6Q 2ID3A 3IWZA 3E9GA 4M7AC 3ZQGA 2UV1A 3I71A 3JRFA 2NS0A 1QTMA 1WQ2A 1J2XA 1I5ZA 4HV5A 2CGKA 1XQSC 1IGQA 3MX2A 3HTSB 2PAVA 1OR7A 3VS6A 4CJWA 3PY8A 1KZHA 1HRHA 3P38A 5JS1A 1FZPB 2VWBA 5A2QE 4M4ZA 2O88A 3ATUA 2E19A 4HT9A 1KSWA 4XLFA 4F2SA 4MEXF 3IH7A 2KBTA 3CC4A 5J1EA 4B3MK 3QNNA 4FTHA 1B07A 2F2WA 1ZBIA 3HSBA 3HUGB 2YSQA 4IZ9A 4KFCA 1T3VA 3RJPA 3FRNA 4L5IA 2RF0A 2P6SA 1M1KO 2C06A 5LJ3h 2FBKA 4N4IA 3W0LA 1A0NB 2R7VA 1NG6A 4HNTA 3FK7A 1UA0A 1RBSA 2XKPA 1JL1A 2A41A 2PBDA 3CC2T 1IRXA 3TSQA 1A5JA 2F4IA 2EKHA 1D5AA 3DRPA 4ISFA 2IBDA 1OYXA 1W7PA 3W3CA 2P9LB 5C4JJ 4GV9A 2BUPA 4YOTA 3TI0A 5F08A 3H0HA 3O9SA 3UB5A 4JJDA 4DSEA 2W03A 2JM8A 1KHCA 1SFKA 4G7HF 1QZ5A 3CC2Q 4RB2C 1ZRCA 4C8OA 5BRFA 2F2VA 3WG7H 1LE8A 1KC8R 2IIRA 4AI5A 3SZ2A 1M1EB 2GEMA 4X1VA 4DLGA 1UOCA 2XVCA 3FBIB 2EYWA 1JCFA 2JG6A 5GAMh 1T2KA 2IDOA 1YJ9A 5FW9A 4CJVA 3GXOA 2KDZA 1E6HA 2DL4A 2CG4A 2K3FA 3OV8A 2QA4Q 4CHZA 4BROA 3MKWB 3OTOK 4WCIA 2DTHA 3VYSB 1YYVA 3LSGA 3MMYB 1FJGK 1IDYA 4DF8A 3GNFB 1U45A 1EETA 5GTIC 4MQ9F 1YITA 3R3LA 2CGLA 1WLPB 2N8GA 3KPHA 1LCKA 4MMLA 1LNXA 1VQKA 2IGNA 3KYLA 2EQIA 5AQSA 2WY8Q 4L9TA 2CZ0B 5JVTA 1KRPA 1W36D 4M78C 5D3GA 4MO4A 3NH1A 2PJPA 2DT6A 4CGIA 2AHQA 5CYMA 1S72A 1LMZA 1VRUA 1NM1A 5ELZA 4IOXA 4P1WA 1EH7A 2R93J 1BCMA 2DPNA 5CYQA 5GAHJ 1KYZA 3HGYA 3B6CA 4F7ZA 2OZ6A 4AG2C 3HFNA 4CGHA 1VQNI 3KEOA 5KN9A 4G94A 5E84A 1W70A 1TL3A 4RGXA 1X43A 3CCSA 4NZGA 4XLHA 4OKKA 3TEEA 1E17A 1P6RA 2VBZA 1YIOA 1DPRA 4KTQA 1R7JA 1VSHA 4IQ4A 1JUPA 1VQPT 1WOQA 2HVSA 2Z1HA 2OPPA 4BYYA 4ZZDA 1RUOA 3JS6A 3WT0A 1KG7A 1RFQA 1O7LA 3IKMA 1IG7A 1R71A 3KLHA 3QU3A 3M57A 1VQPQ 4AIHA 2RD1A 3WVDB 4ENNA 1Y64A 1SQKA 1V4RA 1TUDA 3BW1A 2QVOA 1RR8C 5IP7J 3K5NA 4Z4EA 2PMUA 5J8CA 4AG1C 3MEEA 2VODA 4BJ5C 2DLLA 3DP7A 3L3UA 3AG4H 1A36A 2A69F 3MPUB 4IDHA 1KEAA 4C8QA 3GTKJ 1XMXA 3D2EB 1OH6A 3GX4X 4CERA 1IUFA 2M8GX 1WB9A 3HK2A 3GDQA 1V76A 2LP0A 1EJ9A 3ENBA 3RR7A 3H1CA 3E1SA 4M7DA 1I5OB 5AN4A 2X6YA 4NB5A 4EA4A 2CW7A 3NVMA 2XU8A 3K7AJ 4OMFB 4ABZA 1SD4A 4EVVA 1Y07A 3N97A 2MF2A 5GTHC 2ZPIB 4A0YA 3JRBA 2OPRA 3CEYA 4XL9A 1ON2A 2JGUA 3MP1A 3PMTA 2VC0A 2HSPA 1Q86U 4YY3K 4CZHA 4FJHA 3QRFF 4D7MA 3MFKA 5CKBA 1S7EA 4A3MJ 4I98B 2HEOA 4X1EA 2ZMEB 4A61A 5BR9A 2MABA 3I55I 4N0AC 1IHVA 3JCMf 2NVXJ 2YJEA 1ZH5A 4XKVA 1OISA 4NDLA 4C92A 4YDUA 3CCEA 2XF6A 1NJWA 3MXMA 1OOTA 5E3OA 3OYLA 3VTIA 2DXIA 3AVMA 2F96A 4A5BA 1QQJA 3KYCB 1M3HA 2IS4A 3TSPA 1VF9A 5BPIA 4CJLA 4RBOA 1YTYA 1CGPA 3A2KA 4LN2A 1ZGJA 1U78A 1LB2A 4L9VA 1HSQA 3CMAI 3IWFA 4NQWA 3U1KA 3X28B 2EZHA 3O9UA 3G4SA 2XY8A 3MCZA 2NLUA 5J47A 4B3SK 4A63B 2P9KA 2BE7D 3HTRA 1W36C 1K8KB 1LWEA 3GVAA 2Q2RA 5EG0A 1BISA 2VE9A 2Y1IA 4YIRX 1BA0A 1C0TA 4E2FB 4CEOA 4M7YA 3LW5E 3C65A 5CAIA 2DTIA 3VEPA 3BWGA 2J5PA 1UHMA 2O8BA 4B23A 3UNGC 2ZGYA 4CFDA 4DBQA 1RT1A 1WHHA 2M87A 1FYMA 3KTUA 2H8RA 3NF6A 1QKWA 2RK1A 3JB9G 4BJTA 1WSIA 1FBUA 2EZIA 4C0FA 3QDFA 1QRYA 3ZEUA 3THWB 5FWBA 1VQLN 1RTDA 4MHGA 4YPHA 2XAFA 3CCLN 2L7KA 1GLJO 2X6XA 2W42A 2QQRA 4I2PA 1OMIA 4GBQA 5KGXA 3VA3A 3PX6A 4R1HA 3BTCA 3LZJA 4C8QF 2JZ2A 4ZN1A 5IP6A 1HSTA 1NKEA 2KZGA 2IS6A 3I33A 2P9SA 3E5UA 3LSKA 4M75E 3P9CA 2O8EB 2P9IA 4KV8A 1QVGA 4XTUA 5JMVA 2DD5A 1R4MB 1RKWA 5GAOq 1N9RA 4M7DF 3VDXA 2EZLA 5FD6A 1AHDP 2YRVA 5TKWA 4RMNA 4FYWB 2QQ9A 4CK2A 2CH0A 4Q5WA 2D0OA 4CHQA 2FSJA 2QQ8A 1PD1A 3GF5A 4EFHA 1F21A 3GTMJ 2NVUB 4UVCA 4UUSB 3SQ2A 3CMYA 2HNZA 1BC7C 5HNHA 4ISEA 5BPLA 3UKUB 2HDAA 4QVZA 5KRSA 1GOBA 2B7EA 1NK2P 3OL4A 4B9QA 2DOFA 3OIOA 1NEBA 2BE5F 1YLFA 1NGDA 2QTXA 1U3EM 2E41A 1DGKN 3GUDA 2X6NA 3RPQA 2GBQA 4I0BA 4C92F 3PX4A 5KN8A 1WJQA 2JA7J 4LD0A 1X3MA 1DU6A 3IP4B 1X9MA 1D1BA 2IAJA 1C1AA 3QP5A 2QQSA 3VQCA 3HOXJ 4OPAA 2QSHX 1HKTA 2DXTA 5KI6A 1FT9A 2D0AA 2QM3A 2LC2A 1OH5A 2VB6A 2Y4YA 4JLGA 1WJEA 1H89C 1IN4A 4J2AA 3NTKA 3A01A 1XHZA 2UU9K 2DTZA 4B8AB 3AG2H 2C6YA 3P9IA 2DO3A 4DA4A 1SUQA 2HBLA 2DT5A 4EJZA 4BQNA 3G71N 4D8KA 5TKYA 3HHTB 2O7OA 4Q5SF 3I9QA 3BFMA 3JCMh 4OMQA 4LB6B 2LY2A 4MZMA 2NWMA 1NEGA 2KQ2A 2BZXA 4GMJB 3EKUA 1ULYA 2KZZA 3SWNC 4BY6B 4C23A 2EV0A 3IAM2 1MNMC 3D5SC 1IZ1A 5E3NA 5LFAA 1MDMB 5FKNA 5IAYA 4XBFA 3RZOJ 3CFRA 3GFLA 3GTPJ 1MDUB 4OB1B 2HVHA 1XMQK 5J40A 4BVOA 4A54A 4XIDA 2DBBA 2V26A 2ZB9A 2RI5A 4DR1K 2O9VA 1QVPA 2RPIA 2EJGA 4BRQA 3G1JA 2WAFA 2QSFX 1T6CA 1S6LA 1O57A 4L9NA 4YPRA 3KP5A 3OYGA 1S1WA 2E1MC 3NDKA 2PTKA 5EZGA 3Q9SA 1G3SA 4XKBA 3PIPA 1R36A 2LNBA 2YPRA 5IXBA 3K5MA 2FO0A 3SV4A 2HCKA 1NWKA 2WBNA 1TC3C 5J8FA 3QIOA 2HPMA 1U04A 2JPCA 1Y96A 4CJ7A 1QS4A 1Q86C 1B9DA 2F4MB 3OW2P 3DOKA 4BGBA 5FRMA 2W6LA 2QKLB 4DGWB 5F64A 3EG3A 1WPYA 2VXFA 3CCVI 1SVMA 3QEVA 1F43A 4CGJA 4NCAA 4YRVA 5ICFA 4KITB 2V51B 4QKUA 2CREA 2LY1A 1AWWA 4ZHRA 1N6AA 4QQGA 1JLCA 3LA7A 1NJZA 2M34A 1PU7A 1WX6A 1BK2A 2LKPA 4JQFA 3NNQA 3KHYA 4C8KA 5J2MA 4CC2A 3HC7A 5LJ5h 3G2BA 4HLYA 2XKOC 4P9FA 1X1BA 1POGA 2IVMA 4UB8C 3F0ZA 1S5JA 3TAEA 3V9UA 2ZSIB 3NH2A 5LJ3d 3K5OA 3ZFJA 3AVIA 3WXJA 1JXEA 3RZDJ 3EZWA 4OF1A 4NOYA 3MO8A 2JA5J 4E1NA 2HSEB 2CQKA 5LHHA 1EH8A 3DLAA 3LPUA 2B86A 1BO5O 1RBRA 5EEGA 4BEHB 2CKKA 1UE9A 5GJVB 3CMEI 3I0RA 3BDDA 3GNGA 4LIUA 3HJEA 1VQ6A 2QWNA 4C5GA 3LA3A 2ECZA 3CMAA 4CHOA 3SXYA 4QLCU 1YX5A 1UZCA 1N9SA 4JDSA 1I07A 4KTZA 3W2WA 1NKUA 1NYGA 3CJNA 5EDNA 1KQJA 4B1UB 5JLFA 1QZZA 5GAMd 2Z3YA 3HSFA 1KD1U 2L7FP 3AL0C 4M3DA 3VERA 1TWFJ 4J01A 3ZMVA 2DJZA 1M4ZA 2LVMA 3UATA 2Q1ZB 5CIUA 2WA0A 3R60A 3CCLT 1NU0A 3M8FA 4IVNA 1WBBA 4PJJA 4NC8A 3FKJA 4RLQA 4P9UA 4Y17A 1QQNA 3KETA 3F8BA 1LEBA 5KYXB 1TWCJ 4A0XA 1WXTA 4J5YA 1D8YA 2NNNA 1VQLQ 1UMQA 1E6GA 3CCLQ 1S1TA 3PIPF 2HI3A 4DMNA 4JHDB 3NWTA 5FKKA 3KIOA 4M77B 1HNWK 3TBIA 4E9GA 2OZSA 4G6QA 2EQRA 4L8RB 1YJNI 4CIEA 3F70A 1YFHA 5K5OA 2ESNA 3JCMc 4C5IA 3ZX3A 2DETA 4JS5A 3HL8A 1EV7A 4H0XB 4OGCA 4ENMA 3AFHA 1BIZA 1U48A 2COZA 5I2MA 2E5LK 1NJIU 5AQGA 5KRTA 1X58A 1RUNA 2XY5A 3CHWA 4OINF 2LC4A 5J26A 2QTDA 1XNRK 2HNIA 2PJRA 2GQIA 5CR4A 4LF6K 1BW6A 2HDCA 2EYXA 3RRHA 2UXXA 3HTUA 1YIJN 2PN6A 4OMOA 2EV5A 4M9ZA 4M6XA 1PWTA 1PSEA 1M27C 2ZNYA 3ZP5A 1W5SA 4LFAK 2QA4A 1IHWA 1M8MA 4R79A 4KRTA 5EGOB 1OCRH 2LY9A 4HDVA 4B3TK 1V54H 3K9TA 2Q1NA 5KAIC 3U23A 4MDWA 2OJED 3UA6A 1RT3A 1BIBA 3CERA 2LQWA 1ILYA 4B44A 4B9VA 3FF5A 2COWA 1S1NA 5AQNA 3QUIA 5IHNA 4LG3A 3C0BA 4O5BA 1NE8A 3OW2S 3SK3A 4M7AB 3V6DA 2K9GA 1N32K 4KHNA 3KFVA 4H5NA 1BQMA 3LLRA 3O4WA 4M75G 4K25A 2HYFA 4DTNA 3TAQA 3PMIA 4O55A 4FM1A 4U7DA 3SB2A 3DOLA 4L5EA 2I5UA 2K5FA 1GVJA 2X1EA 1IH7A 3G71Q 4ZYAA 3J7ZO 3PIOA 3M8JA 3RBBB 3J7ZI 1IN6A 1JKPC 4NXMK 4JPBW 3H1VX 5DYMA 5AZJB 1V3FA 4XH5A 4IO9L 3J81O 2HDWA 3CJ1A 5FPEA 4FISA 3FIWA 4J9FA 1QQMA 3CVSA 3L4IA 2PG4A 3H0FA 1TWBA 3BDUA 2DFFA 1P7JA 2LJ1A 1NK7A 3HG9A 3V7CA 4U88A 1ENHA 1JJ6C 2CFOA 3TAPA 2D1XA 2A3ZA 3ZL7C 1KG1A 2LF7A 2QSGX 1MMNA 1ZG1A 4OVLA 1ON1A 4QQ6A 4WXCA 5CKFA 4E70A 4XQ3A 2JPSA 2NZTA 3THXA 1K4TA 2KHOA 1VSFA 4LITA 1RCHA 1VSJA 1U47A 1PUFA 4BR9A 3CQTA 5CVVA 3V4IA 5HBMA 3HP9A 1Z25A 3GG4A 3QETA 2ZPFB 3U4LA 2EA4A 2R5AA 2AIRB 3DRRA 1FPQA 5DS9A 4C8LA 3PFSA 1XTAA 4H4KC 4LOCA 1KK7A 5C4XJ 1MGQA 3HFOA 3DBHB 2XGCA 1OYIA 4RTUA 4A3GJ 1Q81R 3K69A 3KX2A 3CCVA 1BN5A 4OO1J 5ICGA 3Q7CA 4KMUX 4N4HA 2WWYA 1DT9A 5FROA 3G1OA 5FDLA 1TWAJ 2VXDA 3TVTA 3T9NA 2Q0OA 1M90C 2FPFA 3TDZC 2UUAK 2AZSA 3FFKB 3SUOA 1B1BA 4M78B 3E0JB 1VQ7N 3GLXA 1K9MR 3FLCO 1M1GA 1QVFM 2KI7A 3OGDA 2DY4A 3G6EN 1F4KA 5DV5A 4QIWN 3AARA 1JJ2M 1FYNA 1HNXK 1RT2A 1D5VA 2L2OA 2ZJPF 3QOEA 2FJ1A 5DUKA 3ZOBA 1Y56A 2BUDA 4OU0A 2KT8A 1O7FA 3LPTA 3PQJA 3VRZA 1W7PD 3AVKA 3TP0A 4CEEA 1KD1C 5J2PA 3A03A 2C0IA 1N8RR 1AKHB 2DA1A 2FE3A 1QA6A 2NOLA 2KEAA 4BQOA 2A7YA 2F8TA 2GM4A 1Q7YR 4EJOA 3I0WA 3O5BA 2DYIA 3LP2A 3OIQA 4KHUA 1V1CA 5D5VB 2LRQA 2BXZA 1XGOA 5BN8A 1GXIE 2KJCA 4BR7A 4EMSA 1Y71A 1Y39A 1XGNA 2HOEA 5KK1A 1ZG3A 4XLPF 3M07A 3I8DA 2YHXA 2VG6A 2O5RA 2XAJA 6PAXA 2Z33A 4EMKC 2E36A 3VYHB 5K5QA 4BRDA 4DFJA 1L5UA 4YIIA 1NJIC 1WSHA 2E1OA 3S1NJ 3UKRA 1KQSP 2BH1A 4XSZF 4RG8A 5E1XA 3JSOA 3T0YA 1G83A 1SANA 3RKQA 1YW7A 1EIFA 1YFNA 3L1AA 5HCKA 2XAUA 1LVAA 4BC4A 4D7NA 5C3EJ 2XV4S 3KCCA 2CUBA 3SQ0A 4PUSA 1ETVA 1BBZA 1Z1DA 5JLXA 3VF4A 2LYCA 1GOAA 4UQGA 4H03B 1TH7A 2CGPA 4ZTJA 2RA2A 1U5TA 3FXOA 1PHTA 1ETOA 4UY8O 1H9TA 3H92A 1YIJT 2EJFA 2ZKZA 1YJNA 1ZQ3P 3NF7A 4Z4IA 3MKZA 3MEXA 1SF9A 2GUPA 4AVZA 3DM2A 4A4GA 4CJRA 4HVWA 4E1JA 3PTAA 3OMCA 1UUEA 4HVUA 1F1BB 1YIJQ 4MLHA 4DS4A 4AIAA 4A53A 1RUWA 2KFDA 2YLCA 4CF2A 4GXOA 1MH3A 4OMYA 1CQTA 2AK5A 2V7ZA 1GVDA 4JLHA 5GAOn 1SL2A 1WWXA 4RTYA 1H641 2DERA 1YJWN 2A40A 4J9CA 3QBYA 4F7UB 1N3CA 2VYPA 2DTRA 3E5QA 3CDLA 2V1QA 3C3WA 3TU5A 4OP0A 4LG0A 2WAQA 3FK6A 2DM1A 1OR7C 3VS5A 3JRHA 4FE4A 2G8VA 1MNEA 2F5EA 3AAQA 1K6YA 2GWRA 1L0OC 4JJNK 1GRIA 3G3ZA 3EGUA 2PFBA 1NMDA 3HOZJ 3R6MA 3LMMA 1ZBUA 4BVPA 4PA1A 3L7WA 4C8QD 2VQLA 1JBMA 1TQPA 1OPCA 2I8DA 2KJBA 2RHZA 3QG1A 3IAS2 2HTSA 2ME0A 4ZGJB 3H3NO 5GPCA 3R6OA 1SC7A 4Q47A 1KYWA 1YI2I 4XM3A 5J2NA 4CGGA 4M7DD 1VQ4N 4XTVA 4M7DE 2W7NA 2M16A 2XPVA 3JRDA 2HVIA 2DKGA 4BQLA 5FLMJ 3DKYA 3EQLF 3DEEA 3KK7A 4CZFA 3JB9I 2CQXA 2IOCA 3ULEB 3P8BB 2YHBA 5E8IA 3K4CA 1RRJA 1QVGM 1LNWA 2KRMA 2QXFA 1JLEA 3EUHA 2HPIA 3KTQA 3IKVA 4EJYA 1W6XA 2HGCA 5AZIA 1IV6A 4QAGA 2AO9A 5LJ5d 4V19S 4LB5A 1YVUA 4AIKA 4LLLA 4DQPA 3HHHA 4M74A 2D0BA 3K1MA 2P0WA 2QI2A 4C92D 2HEQA 4C92E 1IAWA 3H6ZA 4BC5A 4OB2B 2G6FX 2X3XD 4NNJA 3J80O 2E65A 3R4KA 3BR3A 1X3WB 3K70D 1DTTA 3H9NA 3R0JA 2NUBA 3ISNC 3VF2A 1B9MA 4EVIA 3SBTA 4JV5K 5GAN2 4FVUA 4N4GA 3V8JA 4F3QA 3EN9A 1Q95G 2Z1IA 1T0FA 3VQQA 2W85A 4B43A 4E9HA 5A2QO 3TAMA 2CP5A 4DQSA 2E5NA 1ETQA 3O6WA 2Z99A 4ICLA 1P2FA 1UGRB 2HVQA 3E2UA 1ZSGA 2JW4A 3MEVA 4A3JJ 1ZSZB 1X9JA 2FEIA 1ETXA 3L8BA 3C0CA 4A5MA 1QSSA 1WHKA 1HOMA 2B6AA 4Q5VA 2JS2A 3AVNA 3SUQA 3PSFA 1SVLA 5GANf 1SFEA 5LJ5e 1S7AA 3LDNA 3CD6A 3C7NA 3R2XC 2X6SA 1BR1A 3G6ET 1KQSS 4BR0A 2LZ6B 5DK5A 4K8ZA 2O8CB 3SV3A 4FQGA 4B9NA 2J6KA 1GBQA 3L3VA 1LW2A 2NUTB 4E6RA 5GMKh 1VQ7Q 4IHYA 3CMET 3CG7A 2XI9A 3G6EQ 3VYGA 1KCFA 3D2FB 1I0CA 4KO0A 1WUAA 1GCPA 5I11A 3MK6A 5AQXA 2ZJRF 2A3SA 3B6OA 2OC6A 4HSRA 1CF7B 4HUFA 2A68F 1M5Q1 4EJUA 2E2NA 2ZXIA 1JKOC 1VQ5N 3PQKA 4CC4B 1K8AU 2STWA 1EWQA 2H1KA 3MZ8A 4FM0A 2HYJA 2MCNA 2FBYA 4L59A 2E6LA 3M5RA 4MLEA 1MWMA 1IB8A 1APLC 2E2PA 2W25A 3I5RA 3SWNB 1YHQN 5AT1B 1UHSA 3LSJA 4DV2K 4KI6A 2VT2A 1KC8C 3OL3A 1RACB 2A6TA 3IUOA 4YFKF 4PJOA 3A8YA 1T3SA 3EFRA 4C8QC 2G0EA 4C30A 3VS0A 4BC2A 2VLAA 4NB4A 3NWSA 3J81K 1FLIA 2FOWA 3BZ6A 4LC9B 2XB5A 1W2BM 2QYOA 3ULQB 1SD5A 4M7DC 3MN6A 4M45A 1MUDA 4EQQA 2GIZA 4DQ8A 1SFOJ 2K3PA 2VJJA 5JHUA 3DLMA 4LK0F 4F92B 5C12A 3F6OA 5DTDA 4QS7A 2DFHA 1T05A 4MDAA 4A59A 1VQLA 2QM1A 3PVQA 3SAGA 3G73A 4CIGA 1NLOC 1X75C 3QBXA 2YUQA 2V8IA 4DBFA 4IUVA 4ILHA 1GFDA 2G8WA 3HRMA 4DUYK 1USTA 3DTKA 2K9NA 1HXDA 1K61A 4AI4A 4B8CA 1XUPO 5L3EA 1LCUA 4HF1A 5HRNA 1VQMN 3FMSA 5GJWB 1MW7A 3BG9A 3EFOA 5A2QZ 1E0EA 1B9FA 4YOQA 1JHHA 4C92C 4YDUC 4CYCA 1T8IA 1BR4A 2OBPA 4OIRF 2KYBA 2DVJA 2FZKB 4F93B 5GAOl 1XQOA 4FT8A 5C0YA 4H0EA 5DD8A 1YJWT 3UE5A 3RR8A 3ROUA 3DI6A 2E2JJ 3K70C 1SMYF 4M3FA 4G7OF 2DMQA 4IOAF 1GFCA 1SEMA 1KGSA 3U1DA 2DE0X 3ZT1A 2P9PB 1NGAA 3DEUA 4FLUA 3MWPA 1HMVA 3A98A 1YJWQ 4DOZA 3NF9A 1U2VB 5M1KA 4RTWA 1WQWA 3BTLA 4CGFA 2JMWA 3QQAA 4FM4B 4XMYA 2GNCA 3H3UA 5TISC 4Z4HA 4PKGA 3LP3A 2VKHA 3FM3A 1X9WA 3HPHA 1M2OA 1TG0A 2JWLA 1NLVA 4DHYA 2RQUA 2VWKA 3LDSA 3LOCA 1CXQA 3CIPA 1E3MA 5HK0A 4C0DC 3NH0A 1Z7LA 3MKDA 1RT5A 3CBOA 2EHGA 5LLQA 4BE0A 2NOZA 4DV5K 3BJOA 3IC7A 4IIMA 2RNJA 3AAFA 3MCPA 5HP1A 1BG3A 2D45A 2LQKA 4ORZA 5AR0A 1VQ4T 3QEXA 2D8JA 3KYDB 4DR6K 3T19A 1U8RA 2F9WA 1WI7A 3F8NA 5FLXO 4LF5K 2JJ9A 1YI2N 2O8KA 2CWEA 3VQBA 3MN9A 1G3YA 1ATSA 3G71A 2GTDA 4XKCA 4PJOF 1VQ4Q 2F5KA 4B1VA 2C0TA 3D5RC 1K6OA 2R58A 3HYFA 2FF6A 1RRSA 4QOZB 1TXQA 3AL0B 1JLBA 4RTVA 1QSYA 3O8GA 3WXIA 1K4SA 4M3YA 2QLZA 4UVAA 3H5RA 1UG0A 4KA4A 4BRIA 2QQBA 4PSWA 2UUZA 1LAVA 2W84A 3HP6A 3LSPA 4RW6A 3QZ9B 2GOMA 2H94A 1E3OC 5F6FA 4U7BA 1DP3A 4FSSA 4YHHK 3V9ZA 3V9SA 3E97A 4CJSA 4KUDK 3HOTA 4M3XA 2HQAA 2VVKA 2HAXA 5MLCQ 4JKFA 5A0DA 2FZGB 1UELB 1WJAA 1RABB 2YG8A 1A31A 1W7AA 3CC7N 1R8OB 3ZQ7A 3DPLC 1QMCA 3QO3A 5GMKm 4L6V5 5E18F 4B9WA 1TYQB 2GELA 2IS3A 3SNNA 1OKJA 1ZGWA 2ED1A 3EGDB 4JI8K 1T6DA 3HUGA 1KG4A 2A6AA 3F72A 5JICA 3WEEB 3EL2A 3KK3A 5M1FA 3HYIA 4PGHA 1ZX6A 1FP1D 4G9ZA 1A5WA 1TTYA 3JRGA 4RTTA 3LP1A 2FD5A 1BI1A 2WFBA 2ETHA 5LGNA 3I59A 1G8XA 1TKZA 1GLBG 4QVCA 5BQTA 4ETSA 3L6QA 2IS1A 3PIOL 1K8AC 3JCMX 4E6KG 1HW1A 1T7PA 3QESA 1B72B 4KRFA 2VXEA 2DODA 3SQ4A 3OYMA 3EGXA 4W5OA 2ELJA 1KQ1A 3M54A 1VQ5T 1WCMJ 1VUBA 4IF4A 1U9OA 3H3ZA 4FASD 2BANA 3SEQA 2IGIA 3O8HA 3ML6A 1F1ZA 2VT3A 1TK8A 1TUCA 4DCHA 4I99C 4IPAA 2XRIA 4JI5K 5ED4A 1YHQT 1VQ5Q 3C2GA 1ZC6A 3WTTC 4LFUA 4DFMA 4BHPA 4PL7A 4KT5C 3D7SB 4CEFA 1OH7A 2CYYA 1IW7F 2AJQA 2FXAA 1YRNB 3N5NX 1ESVA 3CWTA 2E1NA 4WWCA 1ASWA 3EE9A 1VHXA 1YHQQ 4KN7X 1NKCA 1QO0D 2BXYA 3JXUA 1FW6A 3QP6A 3KLOA 4AHTA 4O5VA 4HF0A 2RHIA 5LHIA 4LD5A 3FXRA 1KIKA 3MXJA 1Y1VJ 2BW3B 5BOXA 3HIFA 2XROA 2HKXA 3JB9F 5ICCA 4P55A 3CCQI 4G9YA 3L2QA 2H3EB 4FOIA 2BYVE 1ZBJA 5HS8A 2GA1A 4GV6A 4A12A 2YR2A 3OYHA 4WXDA 3SD4A 1TUGB 2X4JA 3FKIJ 2HBKA 5EC7A 2P4TA 3KWIA 4H0TB 3PNVA 3G10A 2WSEE 5CQGA 2LMDA 3T1AA 1VQMT 1HQUA 3E6CC 4K2EA 4M3ZA 3VGKA 4WE1A 2XK0A 5CVRA 3BZKA 2M9HA 1Y0UA 1S6PA 3HEFA 4IJNA 4CZIA 4M3WA 4J7FA 2X48A 3JTGA 1OPLA 2DYBA 3F73A 3VW4A 1VQMQ 4RDUA 3CXCP 2I10A 1IXSB 4CCLA 2ITMA 2QZ8A 2V9PA 1WI9A 5A2QK 1YCYA 4BHCA 4IHXA 2UUBK 2HW3A 2CU7A 1IV0A 2HNYA 3FXJA 1Q1VA 1HR0K 1HYVA 3LFKA 2ZXJA 4JJBA 4XLNF 3NCIA 4BR4A 5JVGF 3EH1A 1TQIA 2L7ZA 3L2WA 3HDDA 1FYLA 3KD1E 3C94A 2AS5F 5KGWA 2QWRA 2CRGA 3REAB 3ZEHA 4D8DA 2D5RA 3JCMW 2Y9ZA 2CUEA 4D6WA 3MQ0A 2ROLA 2L3QA 3VFZA 1X1DA 4B9MA 5J4VA 1J75A 3OIPA 3GTQJ 1FN7A 5K1YA 2B0LA 4A3KJ 3HPOA 3RSNA 1MIJA 2BDPA 4DZJA 2R5ZB 2P7VB 2DL7A 3LH0A 2HHVA 2ABKA 1YI2T 3NFAA 3LWMA 3CQXA 1MV3A 1Q86R 4FYDA 3F2KA 3ZETB 1BKBA 1IREB 4L9JA 2OPTA 3LM9A 4CCOA 1OH8A 3T7ZA 1WSUA 1M2VB 4GGGA 3O8MA 1YI2Q 2EGCA 1K7AA 2R7SA 3NRVA 3CCUN 2LTPA 1FOXA 2HU9A 4DKWA 2COMA 4YOUA 1BIUA 2DI3A 3ZQLA 5DY9A 3W2VA 1TKTA 4B08A 4CHYA 1E3PA 5D8KB 3CPFA 1D3BB 4AM7A 1HCRA 4Z0UA 1VQ9N 4KI4A 4BH9A 3QAHA 1ACIA 1AVZC 1YTUA 1ZUYA 3PM1A 3DFGA 1W5TA 3CM5A 1K4US 1XGMA 2NRVA 4IOCL 4I76A 3S2DJ 3LH5A 2KIMA 4Z02A 3CC7T 3KKRA 5C25A 1YQRA 1YO5C 4PQUA 1QHAA 4B3AA 3CP2A 3L9FA 2ZO4A 3SBGA 4HUGA 1X2NA 4YOXA 2YG9A 4O0JA 5GAGJ 4OIQF 4D5FA 4AHRA 2I2LA 4IXAA 2FX0A 3CC7Q 5LD2C 3DPUA 5GAOr 4G7ZF 3CCMI 2RN7A 1L3SA 4DS5A 4FYXB 3FZLA 3JR9A 4CF1A 4EIAA 3RTVA 4JKEA 1B34B 3FX3A 2ZSHB 1J9AA 4HSTA 4B9TA 1XC3A 4H4MA 3H5NA 2V8JA 4FXDA 3GE1A 1RESA 5LEKA 4KUIA 4GKJK 2KFZA 4CCMA 4FWSA 1XSDA 3FXQA 1WLJA 5EEHA 4LE9A 4BHBA 5H20A 4PKHA 3DPTA 3TW6A 3F9KA 1U6GA 4PJ0C 4GLKA 2HBPA 4FJ5A 2CQ7A 4WCEL 3THWA 3VUBA 2QASA 3HVTA 2EBPA 2O8FA 4RM2A 4P96A 1B59A 4RW4A 1HYZA 4FK2A 3ZGKA 3REOA 2CSOA 4YNQA 3U9DA 4XK4A 4C8MA 2FU4A 1ORNA 2O8EA 3RYPA 1JKRC 1N8RU 3I56I 2J5OA 1SHGA 2EWSA 3A8MB 2D9TA 3LGFA 2LMJA 3JAMO 3TWHA 5HRPA 2RV8A 1C0GA 3KLFA 2RN8A 1VQ7A 4R5PA 3E9FA 3FZMA 1TP4A 2IVPA 1G15A 2F6CA 3M5AA 3OY9A 2ZCWA 2XIGA 1PVEA 1T08B 3FXMA 1S22A 3HM9A 5J1UA 4M75A 1EP4A 1Z0XA 4F9OA 2XPUA 4ZH4F 3T8RA 1ASVA 2WY7Q 3UKUA 2TDXA 1M90O 1NPPA 2DZ9A 5LJVA 2EGEA 1R1VA 4HQMA 4PSXA 1R58A 1G2HA 5JI6A 1W7PB 1RGIA 3VEYA 4WQ5A 2VKNA 1VSKA 2O4GA 3F6VA 3D6RA 5GMKi 1K0SA 1I39A 3SZGA 3MDQA 1RDUA 4BY7J 5CCAA 1LE8B 1LEAA 4W5RA 3TQ7P 1CZBA 2OTJI 1J0RA 3AY9A 3HPWA 4WYBA 1KONA 4G12A 1IBLK 3BDLA 3ZSXA 2LNHB 2Q3SA 3DXKA 3MWTA 2KRFA 5LRSA 4R0KA 4E7ZA 1AWJA 3V8KA 3GZNB 3ESWB 3F9MA 2E34A 1HQEA 3C6AA 5AQRA 4IOAL 5HOOA 1VQ8I 4JI2K 4CZLA 1JXOA 1OYYA 4DSLA 4B1ZA 4EJWA 4KH1B 4BWMA 1VYUA 3VV0A 3ZMDA 4HXJA 1KLNA 2DPUA 2YUNA 4CESA 4O5FA 2VQGA 1SD6A 5C0MA 1RT7A 4J9IA 2NOIA 1NK0A 3PV8A 3RQIA 3RUXA 3RR6A 4XN3A 2QEXI 4RTXA 5IYDJ 1XG7A 1MDMA 3OR2C 4QWQA 4I9QA 3SUNA 2LTOA 5L3CA 1CKBA 4HX8A 1ZK8A 2RB6A 3T69A 3U21A 2ZPBB 2HOSA 2X6WA 3WNEA 4U0VA 2BGCA 2RE2A 2OA4A 4J7IA 4HNUA 4KGZB 5LJ3g 3HXLA 5FU7C 1C1CA 2BY2A 4XNFA 5I22A 1Q8IA 3AO2A 3HKZN 4LH5A 2K57A 3VS7A 1I6XA 4I6ZA 1WSJA 2DD4A 3LSIA 1YJWA 3MX5A 2DL8A 1ZR2A 1K83J 3LFUA 1N39A 2DJNA 4XONA 3GYHX 5KNLA 4LDVA 4KHPK 3SPZA 2GTJA 4DSKA 4JK8A 1IKVA 4EM0B 2JM9A 4RLFA 3TL4X 2CDTA 5I42A 5IHKA 3IG1A 1WJCA 1NK9A 2YNHA 1NGNA 3AVFA 4OFEA 3UPUA 1GLNA 2J6OA 5DMRA 1FOYA 1OVQA 4M75F 1UB4A 3ZXSA 3OYEA 3QICA 3CCUT 4OMNA 5GAMg 1K73R 3M59A 2E1YA 2HNDA 4FJ7A 4P5OA 3MP6A 1VSMA 1ZR4A 3MEGA 4PCQA 1DLOA 3HL2A 2F9TA 2GWJA 4Y52J 4QTRA 4C8QB 2JSCA 2M2EA 3QFPA 3MCAB 1VQ9T 2VWFA 2KL4A 2EIJH 3CCUQ 3CC4I 1C6VA 1FJLA 3LCNA 1TZLA 4KDPA 5CVIA 3TP3A 3HSEA 4CIFA 3L00A 3AHUA 2CH6A 1U5TC 3QEIA 5HL7L 4OFHA 2K27A 4PKCC 4FZZA 3DXMA 3ZT2A 4M7DB 1VQ9Q 3QFUA 1YBYA 3KUFA 4X6AJ 4A4EA 2JNGA 1Q81C 4PWDA 3VSLA 1YE9A 3EUAA 2RI2A 5GAEP 1M1KU 1SEUA 2Q2EB 1HSJA 4KB0A 4C5HA 4DV1K 5HNFA 4EATA 4N4OB 3J7YJ 4Z4GA 4BGAA 1GBRA 3GEZA 2HKQB 2K4YA 3OW2M 1PKTA 2RAEA 4C3JJ 1JT0A 2F7TA 1QQCA 1OU9A 4BACA 3BY7A 2CP7A 1UG1A 3WNFA 3M4OJ 3EFSA 3QEPA 1QNTA 1Z67A 3LSRA 1RIOH 1NKBA 2F48A 1K9MC 2HF3A 3LA2A 2XY7A 4PJLA 3WXLA 3RMAA 2CJJA 2R7XA 2JOYA 1KD1R 1FYKA 4C92B 3V9XA 2P9NA 4F52A 3S93A 3ERED 1WEGA 2RKHA 2MD0A 5CZ1A 1UHCA 3WTUC 3CCMA 1X69A 3SI6A 1YJ9I 1YQKA 1N8RC 4AHSA 3CQ8A 1AEYA 4XH1A 5IOYA 2DOEA 4CECA 4NQWB 4DWIA 3WHBA 3CUQC 1Q7YC 4LUDA 5KYXA 4PJOD 3SEZA 1PCXA 4PJOE 3KP4A 4V2FA 2FLOA 3M9AA 2G3RA 4JK7A 5EU7A 3M53A 2EQKA 3FISA 3OYIA 1KU9A 1A35A 3KEQA 1OV3A 1D09B 2IAIA 3UT1A 2MG4A 4M77A 3CCJI 4E7KA 3AVLA 4BI8B 4M42A 3GMEA 1BYMA 1Y57A 4GO1A 1VQKI 3KVGA 1NJIR 2GUIA 3OOPA 4CJQA 5CKTA 1AT1B 4A3BJ 2RH2A 4C0DB 5KE3A 1HNVA 2BE2A 4PK4A 2O8BB 2PYLA 3KP3A 4JZ3A 2YS9A 5EY4A 4LF7K 1S72I 1HYOA 3LM2A 2DN0A 3GF2A 5LL6S 2D5VA 4E7JA 3L42A 1O1WA 1I81A 4ZNXA 1XOVA 1E4GT 3ZEUB 2CSQA 3EUHC 3J7YP 3QERA 4N41A 2K79A 1J53A 2F5FA 1VQ5A 5D5UB 2XAQA 1KVBA 3BTIA 1TOVA 4KH5A 2DQLA 2AXLA 5LJ3f 4KHWA 1AA7A 5F27A 5EGOA 3D0SA 1Z9ZA 3CCSI 2P9SB 3TARA 4CW7B 2P9IB 2V1DA 2JQ7A 1IZ6A 4F14A 3MECA 5F1XA 2DMTA 3VENA 2NOHA 3CCQT 4LDUA 4H5TA 3NMZC 4RAFA 2CW0F 4OPHA 1HD3A 2HMPA 3COAC 4CEDA 2FC0A 1JCEA 2DXCA 3TO6A 1OVYA 5CO7A 1RBUA 5BMZA 1SRMA 2VKDA 3O9QA 1BA1A 2KT0A 4IL6C 3ZN1A 2DDAA 3PE0A 2CP3A 1PU6A 3SAFA 3ZX2A 3REBB 2IVNA 3ZQIA 1FTTA 1I1SA 3T1BA 3IKTA 1KC8O 5J3BA 5BPDA 2RQQA 3SUPA 1QZ6A 2FMYA 4KH6A 2L7MP 2P7CB 4YFUA 1NGIA 4HBLA 1E4FT 2CP2A 5GAMf 2PX9A 2ZQBA 1ASUA 2EIFA 5IPAA 1X6OA 3TKYA 2VONA 5D7UA 4ILGB 3C95A 1WHMA 1VQ8A 2L02A 4O4GA 5AZJA 3UIQA 1LWYA 1HKSA 4EJTA 2IGOA 1LW0A 3TOAA 4AC0A 2PMHA 1VQMA 4C2MJ 4I7HA 1UWBA 4MTDA 2V6EA 3JCMJ 5C15A 2G8UA 3K0LA 4HTLA 1BBYA 4BE1A 4HG2A 3NE6A 2E7WA 3QB0A 3A01B 2QEXA 3ZRGA 5D8LB 4Y28E 2B9SA 4MGRA 2BZYA 4UV8A 2WB1N 3PUBA 1S1UA 1X2KA 4M77F 2OANA 1EQYA 4FLZA 4CH7A 2E4LA 2DNUA 1HPZA 1QQOA 3QINA 5HDNA 3I5SA 2A1RA 5HLTA 4BRMA 5ILUA 3FXLA 3JB9D 1YQMA 2IG0A 4DTJA 2ZWHA 3CCEI 3H5AA 2ZF5O 3WU2C 4PJOC 4G8XA 2QKMB 3KP2A 1RI9A 2VYTA 2L0KA 1WXBA 3ZPLA 3JTHA 2FXUA 2AXTC 2QBYB 4C0GA 4JZ4A 1HJDA 1VQON 1IBKK 4XK8E 1QCOA 3P1GA 2LKXA 5IH2A 3G4SI 2ITGA 5DM7R 3JYTA 1BJAA 4O0IA 4AFQC 2RPNA 1XGSA 4X34A 3D7EO 3QOPA 1ZLJA 5ADXH 4J9DA 1IDZA 1IO2A 5HS7A 2A36A 2MBFA 5FO5A 4XRMA 1G99A 2OCCH 3ECOA 3ZQQA 1STZA 4IDKA 2UXCK 2V75A 5D4SA 3JRIA 1XS9A 3VQ4A 1R6RA 4II1A 3NGZA 1T6SA 3TEDA 2JT4A 5AQLA 5AQZA 3DWLE 4J00A 5IYCJ 2RF2A 1NH3A 1AWCA 1IJJA 5HRSA 4A62A 3K58A 1QZYA 1E3HA 5BREA 3CESA 4QS9A 2E1HA 3JCMP 4E4HA 3ISPA 4MIMA 2A05A 4FK0A 1K1ZA 2CP0A 4FO0A 1NOYA 3CCRA 3K10A 3AA3A 1AOYA 1ODDA 4B21A 4FJKA 2KROA 3OQ5A 3M0SA 1KAXA 1TUUA 4YIFA 1PG5B 4KIFA 4HTUA 3BJ6A 1EF4A 2VBWA 3K4BA 1J5EK 4AQYK 2PUOB 3ERMA 5L8RE 2KE9A 2PNIA 1O3RA 3JCMg 3QIPA 4FSVA 4AFSC 1WH7A 2KVQG 2QF7A 4F3OA 1UGPB 2NRZA 4EP5A 4HX4A 1FIAA 2RO0A 3CJCA 3JRZA 3SLCA 4WFAL 4BXXJ 1N34K 1OZ2A 1YJ9N 4FOEA 1MBEA 3OYNA 1FMVA 2D8HA 4M3EA 1ACMB 4DQ2A 4K43A 1R00A 3CPWP 1PP8F 1JKHA 2XPWA 1GV5A 2E6NA 1GV2A 3V42A 2AKLA 2V79A 1NBWA 3IDHA 1N33K 2LKSA 4BI4A 3LDOA 1VYVA 3A5NC 1Y0NA 1U06A 2ASOA 3MEDA 4RB3C 1YITN 3DU6A 5CQYA 3IAYA 2E2HJ 1VQKN 2IA1A 3IHOA 3VF6A 3AV9A 4YORA 1S3XA 3CCJA 1S8NA 4A0ZA 4IX7A 4DTOA 3WXMB 1BGXT 1UGSB 3DLLA 2IGMA 4KNYA 1U6ZA 1TK0A 2JSPA 2DT7B 1VSLA 4PKIA 5IT9E 1FEXA 1UCRA 4A3FJ 3VQ9A 3M8RA 3BG3A 1QP2A 1UHWA 1YWOA 2H8WA 1X4OA 3PO2J 3M3YJ 3LZIA 3RDIA 2CO5A 2Z0WA 4JKGB 2FBXA 4XAXB 5AQWA 1WGXA 2K5LA 4F7UA 2YT6A 4B9LA 4B8XA 1XQPA 3ZSOA 1DEJA 2QWLA 5AQPA 9ANTA 5CVUA 4CCNA 1KQSM 4BBSJ 3BROA 1J09A 5FB2A 2Y0SA 1QVFA 3VPZA 3J8AA 2P51A 3SEMA 3MP8A 5KCOA 1JJ2A 4PJOG 1NZ9A 3O1WA 4N56A 1IF1A 3GOXA 2GV9A 4FLYA 1LV5A 3THKA 5GP9A 3PFYA 5GMKl 3JCMQ 2A37A 3M6GA 5C24A 4FWQA 4RB0A 2F4VK 2DAOA 1NHAA 2PVOB 4NO7A 4E1MA 2RJFA 1YS7A 3RKXA 4JRKA 1OYWA 2RK2A 5IY5H 2HMIA 2Y30A 2JT1A 1U49A 2DW4A 2W4SA 1VNDA 1R0CB 4CHUA 3RNJA 5KYWA 2XD0A 1IKYA 3BC8A 2HB5A 3W6VA 2KKZA 2Z9OA 2AA4A 3ULEA 4CICA 2R57A 4YEJA 2KR3A 4EJVA 2EFIA 1UJYA 3SZPA 1QQIA 4BD3A 1JLFA 2DL5A 4ZJZA 3MKYB 4RGRA 2NOFA 2YSRA 1H1VA 1S7OA 4CF0A 2OTLI 4MO7A 4DYQA 4CJEA 4KFBA 5M1PA 4H8KA 2ZJQF 4CZEA 2QWWA 2HZTA 4DSIA 2A28A 2RMOA 3S16J 4GNIA 2QQAA 2LVSA 4IEIA 2V7FA 3F0CA 1FKPA 2DA3A 3PNYA 4J83A 4HA8A 2H27A 2XICA 1BOTO 2QUFA 3TSWA 1WHGA 3WNGA 3MZYA 4HQEA 3G1LA 2F1LA 4AH9A 4CVNE 4NLCA 5E1WA 5DM7F 1VQOT 2SEMA 4E89A 1T03A 2VBXA 1MSEC 4ZGEB 5GAOm 3DTEA 1W0HA 1OFCX 3DLLF 1WZ2A 4J8FA 2LRDA 4FVMA 3KWGA 2GQVA 2W82A 3BR6A 4EMGA 5B1AH 3QYBA 3QPLA 3TQNA 4ZDPA 4B09A 3WU0A 3M4GA 4XRSA 4FLXA 1VQOQ 8ATCB 5DD4A 3G4SN 4J9BA 1ZSZA 1A5XA 3ZSRA 1VQ6I 4JRPA 4XKWA 3Q1JA 4CJTA 1JI8A 1WN7A 2P1JA 4KREA 3CC4T 4BRAA 3RMBA 4CZMA 5IT3A 5LBQA 4AU7A 4F7UF 3BG7A 3S41A 3D4VA 2HDDA 3JRAA 4HCCA 1SD7A 1HJOA 5A0LA 5JVHL 2FRWA 1X19A 1PUFB 5AONA 3SHFA 3BF3A 3CPWS 2KNBB 1KVAA 4KIGA 1NNEA 2LREA 1BCOA 3QDRB 4KICA 3CVTA 2IRFG 1S9EA 4EM1A 3DKXA 4MTEA 1C0FA 3VJPA 3B6PA 2VCPA 1Q9YA 3O3GA 2YKMA 2NRAC 5DUIA 4OVAA 3PNTA 3I58A 4IKFA 2G8KA 1IG9A 3PO5A 4FPAA 2XG8D 4GW6A 1MV0B 3WHCA 1K8AR 3CJTB 1Y1WJ 5CHZA 4A6DA 3X24B 4PLIA 5AQKA 2FRYA 3LWHA 4ESRA 1PJRA 2FF4A 3EG1A 1RAHB 1SAXA 2FBIA 2K3XA 3TW7A 5M3MJ 1HF0A 5EEAA 4OMLA 4JD2A 3ONQA 1ZBXA 1L3LA 4X9CA 2EYZA 2V6CA 2FQ4A 3QO9A 3ENOA 3ULRB 1RDDA 3GW2A 1DDNA 4ZYHA 5K14A 4BKXA 4YFXF 5I3UA 3EG9B 3UKGA 3ZBDA 5AFUH 1YJ9T 1GXPA 3VQPA 3UF4A 4M75D 1MBHA 5LJ5f 3MWMA 4KJZA 3O1BA 1LDJA 3QYGB 1BWFO 4EIKA 1PM3A 4RWTA 3ZT0A 2DPDA 3O8VA 5FU7B 1YJ9Q 3GFJA 5AQVA 3HSTB 5KYYB 2VPRA 1NJYA 2ECBA 3QWXX 2H6CA 2AQFA 1YITT 2QA4I 2IA0A 1JCGA 4J2DA 4ZC3A 5TRDA 1OU8A 1VQKT 4I01A 1NK4A 5J3LA 3HRSA 4AIJA 1ZKGA 4IRIA 4ASNA 2ZJ2A 5HRRA 2CS3A 4DR4K 1CZAN 4DV3K 2ZBKA 5I2SA 5AQUA 3RWUA 2FEZA 1YITQ 1S72T 2QXLA 2IC3A 1VQKQ 2KHMA 4FETA 4NS5A 3CI5A 1ONVA 3ZR8X 2PFUA 2VC8A 3UR3C 4AM6A 2FVUA 3HSRA 4Z6YA 2NOGA 2E7XA 2G8HA 1FXXA 1RC9A 1SFXA 4DYRA 2E71A 1YN8A 3NHNA 4B9UA 4PIIA 2TCTA 1VSIA 5F1RA 1WGSA 2FF3B 1ABOA 1DKGD 5I9EB 4JKAA 3CCST 3DAWA 3HOVJ 3QYEA 5AQOA 4FLWA 2L8DA 4M72A 3E1YA 5CE3A 1Q82R 4OPKA 2KW4A 2IW5A 4M3TA 3VEWA 5HROA 1GLEG 3S1QJ 5GADJ 4JK1X 3LAPA 2Y0MA 1U5TB 2E88A 3OYJA 3ALYA 2X35A 3V9WA 1VQNN 3FZVA 1T95A 3N4PA 3WU1B 3BE3A 3VSKA 1GCQA 1KFDA 1MJBA 1DQUA 3NQOA 1XTDA 3AO3A 3FMQA 2KRCA 3AKZA 4WFNL 5KYUA 2HQRA 1ETWA 3HPGA 2ELKA 1T3LA 3KZYA 3E01A 3VEXA 2Q0UA 4W5TA 2D0CA 5F0XA 4GV3A 1HKQA