3OYKA

Crystal structure of the pfv s217h mutant intasome bound to manganese
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
368
structure length
368
Chain Sequence
LDAELDQLLQGHYIKGYPKQYTYFLEDGKVKVSRPEGVKIIPPQSDRQKIVLQAHNLAHTGREATLLKIANLYWWPNMRKDVVKQLGRCQQCLITNASNKASGPILRPDRPQKPFDKFFIDYIGPLPPSQGYLYVLVVVDGMTGFTWLYPTKAPSTSATVKSLNVLTSIAIPKVIHSDQGAAFTSSTFAEWAKERGIHLEFSTPYHPQSHGKVERKNSDIKRLLTKLLVGRPTKWYDLLPVVQLALNNTYSPVLKYTPHQLLFGIDSNTPFANQDTLDLTREEELSLLQEIRTSLYHPSTPPASSRSWSPVVGQLVQERVARPASLRPRWHKPSTVLKVLNPRTVVILDHLGNNRTVSIDNLKPTSHQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PFV integrase
publication title Molecular mechanisms of retroviral integrase inhibition and the evolution of viral resistance.
pubmed doi rcsb
source organism Human spumaretrovirus
molecule tags Recombination,viral protein/dna
total genus 106
structure length 368
sequence length 368
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2010-09-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
A PF17921 Integrase_H2C2 Integrase zinc binding domain
A PF18103 SH3_11 Retroviral integrase C-terminal SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2300 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3oykA04
1.10.340.70 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Endonuclease III; domain 1 3oykA01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3oykA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3oykA03
3C4SA 4DU4A 3AVLA 1Y97A 1NK0A 2O4XB 4OPJA 2IDOA 2L8DA 1BI4A 2OPQA 3QEWA 5KI6A 3SUPA 1L5UA 4BDZA 4HCBA 2YNGA 3AVGA 1QS4A 3WNHA 5KCOA 4QOZB 3RWUA 3QLHA 3NTKA 4CJEA 2BE2A 2FHDA 3SQ1A 3G10A 3NTHA 1RTHA 4WE1A 3HM9A 3TARA 2HHXA 4TSXA 2E6LA 3MP8A 1LWEA 3PX6A 1C1CA 4E7IA 1NOZA 4DWIA 3HVRA 3LP2A 3CM6A 1C1AA 2BDPA 2QQSA 1RI0A 1GOCA 2A1RA 3MEVA 4ID5A 3DOLA 1WSEA 1NJZA 4KTWA 4HTUA 4BDYA 4O0JA 4F4KA 2HMIA 4FLVA 3TWHA 1HQEA 1S6PA 4DTPA 4PLLA 4OGEA 3BDPA 3CM5A 4BWJA 2VWKA 3MAQA 4E7HA 3NHGA 4Y1DA 4DTXA 3RMBA 1LV5A 1VRTA 4KB0A 3CYMA 1VSLA 1IKWA 3AA2A 2HVHA 1RT2A 5C24A 1RT4A 2HNZA 2YV0X 2R58A 1SKRA 2RJFA 1TGOA 4B9LA 3OYKA 1VSIA 3O4QA 4C8OA 2NUBA 3PO5A 3PMIA 5KE2A 3DLRA 4CCHA 4N4GA 4A4HA 1UA1A 2YKMA 4CECA 4B8CA 4CHNA 3HPOA 3TAMA 3K5MA 2Y1JA 1CZ9A 2KZMA 5IN1A 3BGRA 1WNSA 5SZTA 1KRPA 4Q5WA 1UOCA 3DLGA 3U6FA 3OS0A 4Z4HA 1SL0A 4YNQA 4CGIA 3L2RA 4UC4A 1L3UA 2IAJA 1T8EA 3SUQA 1ZBUA 2RI2A 1NKEA 1VSFA 4AHCA 1U48A 1VK0A 3PV8A 3NH0A 2CKKA 4LH4A 5J2QA 2YHBA 4DS5A 4B9NA 4EZ6A 1I3AA 2EFIA 1XHXA 2RO0A 1ZBHA 3P8HA 1FK9A 4NS5A 3LANA 3I0RA 3NGYA 3TANA 4CJSA 3CFPA 3NDKA 4IUPA 3NGZA 1G5VA 2ITGA 3ASMA 3VQ9A 4FJHA 1RT7A 4M45A 3HVTA 1YTAA 4W5QA 3O4NA 3SV3A 1S6QA 5J2NA 2HVIA 4IBNA 5J2PA 1I39A 4IUQA 3U3YA 1B9FA 1WAFA 3HL8A 5HRRA 1RTJA 2X6NA 3L42A 5JS1A 1R0AA 1NOYA 3VA0A 3E9GA 4CE9A 4CGJA 1WLJA 3VN5A 4O44A 4NCAA 1WSHA 4OKKA 2K3XA 2GFUA 4DQSA 2WONA 3VA3A 4CJFA 4CEEA 3AVCA 2R5MA 1QE1A 1A5VA 3IAYA 1S1TA 2EQMA 2Y1IA 4C5IA 1S1VA 3OVNA 1IKXA 1BL3A 1VSDA 2KW4A 4CRIA 4FM2A 3LWMA 1CXUA 3DYAA 5KTQA 4Y1CA 4QAGA 1J9AA 4I7FA 1WSFA 4FJIA 1A5XA 1YTUA 4EZ9A 3OB9A 2DFEA 4OLBA 3OMGA 3QNOA 4DG1A 3ISNC 4PQUA 3AA3A 3V4IA 4KI6A 2XY7A 4N4IA 5CZ1A 3LP1A 2D0CA 3O8VA 4FK4A 4FLTA 3ZT4A 3MECA 1S1XA 2XY5A 4J2BA 2B5JA 4CESA 4F8RA 1KLMA 1JLBA 2IS3A 2G8KA 1RBVA 3SD4A 3DRSA 3K58A 3ZT2A 4DTMA 3OYMA 2IOCA 4RW4A 1U04A 2RHUA 3MP1A 2ATQA 5C6SA 4PUOA 1C0MA 2BANA 4PL6A 4CK3A 3B6PA 4IUVA 4CFDA 5CY4A 3VQ8A 1BIUA 4W5OA 1KFDA 3VQ4A 2XRIA 1NK9A 3QNNA 4KPYA 4CIFA 1MHNA 3AVAA 1O1WA 5CYMA 1JXBA 4CJRA 3ASKA 3DLEA 4CGFA 3V9XA 3S6WA 1CZBA 3S3NA 1S1WA 3HK2A 3A2FA 1TKTA 4B3OA 4CEDA 3LP3A 4E7JA 1BIZA 4R5PA 1XC9A 1JXEA 4DU3A 3AVFA 3DM2A 3WNFA 4AHUA 3OJUA 1U4BA 1BCMA 4CFCA 2HNYA 3OMCA 1TL1A 3PX0A 4GMJB 1J5OA 4BWMA 2LVMA 3KKRA 1XI1A 2RPIA 2RHYA 2WACA 5HROA 1C0UA 4FLZA 4F2SA 1N6QA 4DMNA 3UT1A 4HUEA 3BDLA 3QINA 3L2VA 3HP9A 2XK0A 2VG5A 4PY5A 2RF2A 4Z0UA 3QBYA 4O0IA 4KFBA 3L3UA 1QSYA 3LP0A 1FXXA 4G1QA 2A1SA 4CGDA 3NTIA 3DLBA 4BD3A 5KGWA 1ZBIA 1IO2A 4CEFA 1WJQA 4F3TA 1CXQA 2E4LA 3OYNA 3F73A 4J2DA 4JS4A 1KVBA 5KH6A 5D6XA 3CG7A 3K2PA 1HMVA 4QW2A 3T1AA 4FJ8A 1KCFA 3OYCA 3K59A 3C6UA 1Q9XA 3AVKA 3OS1A 4CF2A 1NJXA 2ZE2A 5I3UA 3AO5A 4C8NA 4HCZA 4JRQA 3LZIA 1YVUA 4LSLA 4JLHA 3KLEA 3HXMA 1HRHA 3FDRA 1HYSA 4DSJA 4GVMA 3P83D 4QCLA 4AILC 3OYJA 4RG8A 4B9SA 1HJRA 3QEIA 3V9UA 1REVA 2K3YA 3ZSVA 1W9HA 4E3SA 3G0ZA 1Q8IA 2VWJA 3SPYA 5HRSA 2L3RA 4FJ5A 3TR8A 1WJRA 1WN7A 3HJFA 2RJEA 4FJ9A 3ZSQA 3M8RA 4OGCA 1S1UA 3JSMA 3RTVA 3QEPA 1X9SA 2BIVA 3QIIA 3KK2A 4KHNA 2QK9A 1IKYA 3DRRA 3OYFA 2G8VA 3CEYA 4FLUA 2F96A 3UIQA 1DTQA 3DB4A 2FBTA 4O5BA 4IG0A 1SKWA 4F2RA 1XHZA 3EZ5A 5CZ2A 1C6VA 1RDCA 4DSEA 4CEAA 2PZSA 3AVMA 1N27A 2ETJA 4IDKA 4E89A 1RBRA 2FBVA 2GBZA 1RBSA 5KRTA 4GY5A 2VG7A 4KTQA 4Z4EA 2GF7A 4LY7A 3VQBA 3ZEHA 1JKHA 4CJLA 3CQ8A 1ASWA 4MFBA 3VQ7A 2BGGA 3S9HA 4BE1A 1TKXA 5C0MA 4AHTA 5M9OA 3MO8A 2YRVA 1G15A 4FW1A 4IFVA 1W0HA 3MEAA 1BCOA 3SQ4A 5HP1A 2XY6A 1Z26A 1RCHA 4IURA 4FJXA 4KV8A 1KLNA 3OQ5A 1TKDA 1OI1A 4QQGA 3KD1E 4A4EA 4B9MA 2RKIA 3OYLA 4K8XA 3FEOA 4KTZA 1T05A 4DTJA 1C1BA 4OVLA 1EX4A 3T19A 1KVAA 3MEGA 2R7YA 4FYDA 1SL1A 4FJKA 1WJSA 4CEOA 4NCBA 2PYLA 1QTMA 1OZ2A 2X35A 1GOAA 4LSNA 4ELVA 1WGSA 3HT3A 2HHWA 4KO0A 4NZGA 3SJJA 2XY8A 3M8SA 4JRPA 3K5LA 3OYHA 1NKCA 4DLGA 2G8FA 4JS5A 4RW7A 1NK5A 2B4JA 2KTQA 4CJTA 4CJUA 3T3FA 4FJGA 4FL6A 2KFNA 2DFFA 5DK5A 1F21A 3CFRA 1BISA 1U47A 1D9DA 5D6YA 4CEBA 3DB3A 2XDPA 4DFMA 3AVHA 2VG6A 2EQKA 2HHTA 3KUFA 3L2WA 4DSIA 4PA1A 2D0BA 4M3YA 1FKPA 5KRSA 3MXMA 1CLQA 1T7PA 1QSSA 2YNHA 3AA4A 4E7LA 4DFPA 3NE6A 4CF1A 4FU6A 4DTOA 3V9WA 2G8IA 3TAGA 3PFSA 4CIEA 1RNHA 2L89A 1RTDA 1SKSA 3ZSXA 3MEUA 3IG1A 4N76A 1VSEA 2KQ2A 3EAEA 1VRUA 4CK2A 3FLGA 4ELUA 3ZSRA 4CHZA 4FLYA 1S9EA 2KZZA 2IGIA 4DU1A 3VQAA 4M3ZA 2X74A 1EXQA 1D9FA 4RW6A 4Z4CA 4M3RA 4CJVA 2X4XA 3JYTA 2YHAA 4FJLA 1C0TA 2RHZA 1OZ3A 2XO7A 1IG9A 1UA0A 2HHUA 5C42A 2XHBA 4EP5A 1SV5A 2B6AA 2QKKA 3AO3A 3S3MA 4DQIA 4GW6A 3K5OA 4J2EA 3M8PA 4NYFA 1RILA 3C95A 2RI5A 3KLFA 2RI3A 3ZT1A 2Z1JA 1TK8A 3DLMA 4O4GA 3SQ2A 1X9WA 4KHUA 4CHYA 4KI4A 4ID1A 4DF8A 1JL2A 4CEZA 4DFJA 4C5GA 1NJYA 2JGUA 3TAPA 4I2PA 1TV6A 3SYZA 4NCGA 3H6ZA 3KLHA 2EQUA 1N5YA 1B92A 1RT1A 4CHOA 2JTFA 4H8KA 3LX7A 2OPPA 5C25A 5FRMA 4F3OA 3TAEA 3DOKA 3RR7A 3WNGA 3NAEA 4QQ6A 3V6DA 2G8WA 4FK0A 1J54A 4PWDA 1ASUA 4DTRA 1HNVA 4FM0A 3P5JA 4LD6A 2OYQA 3HYFA 2DAQA 1RTIA 3AVJA 3DRPA 4FJMA 1BQMA 3QIPA 1JLAA 3VQ5A 5SWMA 4QVZA 4E7KA 1VSKA 4CIGA 3NH2A 3LPUA 3ALYA 2W42A 3D45A 1BHLA 4DTSA 1RBUA 4KB1A 3TI0A 3HP6A 3AA5X 2D9TA 4FLXA 5HLFA 5I42A 3AV9A 2P0KA 4B9WA 4CGGA 3TAFA 4W5NA 4DTUA 1OYXA 3L2UA 5D6WA 3NBPA 3IS9A 2LCCA 1NJWA 2PY5A 3KD5E 3F9KA 1EP4A 1NK7A 2LDMA 1RT5A 1QQCA 3L3VA 4I9LA 3NNQA 2M1HA 5J1EA 3OS2A 4M42A 3NFAA 4HVJA 2JZ2A 2EKOA 4I2QA 2HQXA 4CJ5A 5FRNA 3NGIA 3QO9A 2P1JA 2OA8A 5EU7A 3QEXA 2DFHA 3V1OA 1Z25A 3D0PA 1EKEA 4QQDA 5DMRA 4FLWA 1TKZA 4C8LA 2B8AA 1TK0A 5T7BA 1L3VA 2P51A 3V1RA 4N56A 3PNWC 3PMTA 2EHGA 4B08A 3LGFA 3VQPA 5KE3A 4N4HA 4E1NA 1WAJA 1FKOA 4CF9A 5CYQA 3ULDA 4B9TA 4C8KA 3ZT3A 2I5JA 3QETA 4OKJA 4M3WA 3I8DA 4CERA 1RDDA 2LRQA 4ZHRA 4YFUA 3DLKA 5D3GA 3ZSOA 1MU2A 1S5JA 3E9FA 4N41A 3C6TA 3MXJA 4DSFA 2DY4A 1JLCA 3M9QA 5KCHA 5HRNA 3DMJA 4M41A 4OJRA 3HPHA 4FJJA 4KHWA 2HHSA 1D8YA 1NK4A 3EYZA 1UWBA 2FBYA 4XIUA 1B9DA 4BE0A 2NLUA 3PX4A 2X4WA 3VQCA 3U3GA 3ITHA 3SI6A 4K8ZA 3NCIA 3K57A 4CK1A 4L59A 2G3RA 1K6YA 1LAWA 3OY9A 2LSNA 3LAKA 1HYVA 4CFBA 2P5GA 1D5AA 2Z1IA 3ZSWA 4IKFA 3SPZA 1RT3A 2D5RA 4CHQA 3MEDA 2HHVA 3SCXA 4E1MA 4HUGA 4Z4FA 3KLGA 4W5RA 4E0DA 1RDBA 3PY8A 4MQ3A 4BDPA 1LWCA 2FC0A 2P5OA 1L3TA 3O3FA 3QEVA 2Q3SA 2BKDN 2ZD1A 1KHCA 1U49A 3UWNA 4PLIA 3QERA 3RMDA 3LYIA 2GV9A 5JS2A 4N47A 3LGLA 1IH7A 1DTTA 2RJDA 4CJ4A 3VQDA 1NK6A 3LALA 3RR8A 1KTQA 4Z4IA 4C5EA 4BACA 2F8TA 3E01A 3AVNA 3SNNA 1LW0A 1ZYQA 1NK8A 1BGXT 1DLOA 3VQQA 4IUTA 3OYAA 4KREA 3LLRA 3DI6A 3OJSA 4DTNA 4L8RB 3L2QA 3V9SA 1KFSA 3ZSZA 4HHTA 3THVA 3PUFA 4CJWA 3KLIA 3SUOA 2Z1GA 2F8SA 2D0AA 2PYJA 3FC3A 1S9GA 2YKNA 5J2MA 2Z1HA 3H8ZA 4CJKA 3TABA 3KIOA 1TVRA 3S3OA 3DLHA 3VQEA 1RBTA 2OPSA 2RJCA 4IG3A 1VSMA 4C8MA 2F5KA 2QQRA 4AHVA 3LAMA 3VQ6A 3RMAA 3KK3A 2E6NA 1L3SA 1HQUA 4II1A 2YNFA 4Q5VA 3RMCA 4B9VA 3H08A 1Q9YA 2KFZA 1JL1A 4FCYA 4X34A 4Z02A 1JLEA 2RHXA 4H4MA 4B9UA 3NF6A 1ZBFA 3O3HA 4RW8A 1LW2A 4ZTFA 4IFYA 3LPTA 3KK1A 1BI4B 3L8BA 2QXFA 3P1GA 3OYDA 1A5WA 3B6OA 4OVAA 1HNIA 3AO2A 2R57A 2EX3A 3V9ZA 4CFAA 4KHYA 5E41A 1RT6A 2DTUA 2MWPA 2M16A 1H3ZA 4FJ7A 3Q1JA 4J2AA 4DLEA 1KSPA 1SUQA 4OLAA 4FJNA 5HBMA 1ITGA 1TAQA 2E5QA 4B8AB 3HO1A 1U45A 2LTOA 2BUDA 2OPRA 4O55A 3ME9A 4CJ3A 3MEWA 5CIUA 2X6SA 2JLEA 3V1QA 4KKOA 3SV4A 4FZYA 2HB5A 4EDUA 4OKEA 3KTQA 2IC3A 4ELTA 4FW2A 1J53A 4CEQA 4A4GA 4FM1A 1JLQA 5KGXA 3META 3LZJA 5K14A 2YNIA 4CF8A 3OYIA 3TAQA 5J39A 4DS4A 3OYBA 4KHSA 2RHIA 4AHRA 3NF7A 1EETA 4ICLA 2GFAA 4KHQA 4FZXC 4LD0A 3OYGA 1WSJA 2IG0A 4W5TA 3NF9A 2O4XA 3HSTB 4DF4A 4HCCA 4CJQA 1ZBLA 1LAVA 1YT3A 5FDLA 4B9XA 5FROA 4DSLA 4KRFA 2HHQA 3MEEA 1SSFA 1BQNA 4OPKA 4AH9A 4RG2A 3ZSYA 1HPZA 4CHPA 4M3TA 2RN2A 3GOXA 4BE2A 3ZCMA 3SQ0A 4CGHA 3WNEA 1QSLA 3MXIA 3LWLA 2R5AA 2ZQBA 1VSJA 4CF0A 4FXDA 2HQEA 3AO4A 2HNDA 4N5SA 4DQQA 5HRPA 1JLFA 2VYTA 3SUNA 1KVCA 2FBXA 3C94A 4A4FA 4C5HA 3RRGA 1XNIA 4ZTJA 3ZT0A 1QHTA 3QJ6A 3OYEA 2EQJA 3SZ2A 2X78A 4EP4A 4DFKA 4H4OA 1WSGA 1X9MA 4LH5A 1TK5A 3AO1A 3AVIA 3RRHA 4Z4GA 1SL2A 1IKVA 2PQWA 1JLGA 2OZSA 2AJQA 2HW3A 2MWOA 3PO4A 1TL3A 2GUIA 4M3XA 2O4IA 4DQPA 3EY1A 2M0OA 3QIOA 3NH1A 1X1PA 3V81A 3LDSA 2G8UA 2WOMA 1XWLA 4FK2A 3QKJA 4FZZA 2OZMA 1NKBA 1WSIA 2G8HA 2O4GA 4Q0BA 3F70A 4KAZA 4HUFA 5IAYA 4E19A 3HPGA 3LH0A 3M8QA 4AHSA 4I9QA 3OA6A 1HYZA 3KKSA 4FVMA 2DIQA 3CFOA 5J26A 3NF8A 3MP6A 3KJVA 4IUUA 3K5NA 4CJPA 1ASVA 1GOBA 1T03A 3I0SA 2X4YA 4NYNA 1VSHA 1UAXA 3AVBA 4M3UA 4UQGA 4RW9A 2E6MA 1TAUA 2QKBA 3P8DA 1LWFA 3FFIA 3IRXA 2DIGA 4DQRA 3QESA 1RDAA 4DSKA 3O3GA
chains in the Genus database with same CATH superfamily
2WAEA 4DU4A 1Y97A 5AQNA 3DEEA 5K1YA 3EGXA 1N5ZA 3O9UA 2OAZA 2JPBA 3O08A 4EGYA 2KRSA 1P92A 2M7BA 3S2HJ 1FMVA 3KPHA 4OPJA 2PG4A 2L8DA 3H92A 4Z89A 3HRGA 4LDVA 2OPQA 2MAMA 5C10A 1P7MA 4BDZA 4HCBA 4B22A 2YNGA 3AGKA 3DXKA 1QS4A 2JN0A 4DV4K 2Q0OA 1UJ0A 2DILA 2JTMA 1WB9A 2IBDA 4HX7A 4F17A 3K6GA 1J09A 2EYZA 1IV6A 3VSKA 3WU2C 2EQIA 1C6VX 1QHAA 2RREA 2YXYA 2ZXJA 4V19S 3BCAA 2BE2A 2JN6A 5EG0B 2JMCA 4OB3B 1K78A 2GAUA 4JJNK 5GAMj 3CESA 1WNLA 3TARA 2CFXA 3F0ZA 4BKXA 1Q86C 1X9JA 3A01A 1TS9A 2J6FA 3MP8A 1LWEA 5DY9A 3BCBA 5HLGA 3TSWA 1ZREA 4HTLA 4LOCA 1LFBA 4LK0F 4RGSA 1W36D 2W03A 1OYYA 2BDPA 5LJ5h 1N8RU 1WUAA 2RE2A 1EFNA 1KC8C 2GXAA 4OMYA 1NJZA 1QHHD 4F4KA 2HMIA 1UJYA 3CO6C 3BY5A 5JR3A 4OGEA 1IHWA 3CM5A 2X0LA 1GVJA 2FD5A 2BEOA 3A5LC 4QS9A 2E2IJ 5LHGA 5IYDJ 4WQ5C 4EAHD 4Y1DA 4UNOA 4FWRA 5AQQA 1LV5A 1VRTA 2HQRA 1RT2A 3DWLA 2WBNA 2HL5C 4CSWA 2V9PA 2R58A 2YV0X 2ECCA 2RJFA 1JQQA 2K4JA 3QZ5B 4B9LA 3VMFB 4UV8A 2H3EB 2VT2A 1VSIA 3TKYA 1J59A 3O4QA 4KIBA 3M4YA 3MWTA 2NUBA 3GZ6A 4XN3A 5JHFA 4RB2C 4L0YB 3OBWA 3F10A 4N4GA 4CECA 3HPOA 1TQPA 3VEOA 1CZ9A 3MN6A 4JPBW 1Q7YO 5SZTA 2QA4A 4H0YB 5GAN8 5HK3A 4JI7K 3BR0A 5LJWA 3GFLA 1S72A 4M6YA 3EFOA 5C3EJ 3OS0A 3M58A 4Z4HA 1SL0A 3R3LA 3HHTB 4CGIA 2R7VA 1L3UA 2IAJA 4OAZA 2KRMA 4IHSA 1Y0MA 2LY9A 2FUG2 5GIPA 4M75D 1V5GA 2KYMA 3NH0A 4B9NA 2CP5A 5GAOn 1K8AC 3E66A 1I3AA 1M27C 2RO0A 2DD4A 1W2BA 2ZGZA 4GLKA 2D8HA 5GMKe 4EGZA 5EF6A 3I0RA 5DM7L 3C2BA 2GEMA 1MV3A 3R60A 2NVQJ 1EIFA 4WF9L 4E9HA 3K9JA 5JFRA 3QJYA 4AWXB 4CJSA 2R5YB 3WXMB 4ANJA 3RSNA 2BE5F 4DYQA 4L18B 3WODF 3NDKA 3JB9G 3C65A 3NGZA 1M5Q1 3RTRA 4NOYA 4D7MA 4O5VA 3A98A 4FJHA 3UDCA 4EW0A 2V52B 2WA0A 5EZHA 3O4NA 2PMZN 4KN7X 1PUEE 4ESRA 4S05A 4KICA 3L2CA 3GBGA 2HVIA 2ETHA 5J2PA 2PUOB 5LJ3d 3BC8A 4LLGF 5DLOA 4OPHA 5LJ3f 4UB6C 2QUFA 1WAFA 3HSCA 3IDHA 2X6NA 3BJAA 1H3HA 2R3SA 3VA0A 2WAQN 2OANA 4CE9A 2F5VA 1Z9QA 4O44A 1JJ2S 4XU2A 1KSWA 1NJIO 4BVOA 3IKTA 2GFUA 1O3RA 1U1SA 3TREA 1M1GA 3NRVA 3RZDJ 4CCOA 4Z6YA 2QBYA 4M7DC 5A2QK 5C4XJ 5JICA 2R5MA 1QE1A 2NAZA 1YYVA 2JJ7A 5D8LB 1P8ZA 2ICWG 4EMKA 4BUGA 1YRNA 4A5NA 2KW4A 4CRIA 3A5ZB 2XAGA 4GLMA 4FO0A 2QGGA 1YAGA 1TP4A 3M9AA 4XU3A 2VKDA 4P5NA 5E17F 2ESHA 2CH0A 2LLKA 1BW6A 4DG1A 1B7TA 3AA3A 4KI6A 5HDGA 2QCOA 2H3GX 3LP1A 4EJVA 1YQAA 4KRTA 2DOEA 2K3BA 5EX5A 4OO1J 4FLTA 3I55A 4JAXA 3MECA 1DGKN 2GIVA 3G7ZA 1S1XA 4HOBA 2CS3A 4BQZA 3N5BB 5CQYA 2J7IA 1UFFA 2CH4A 3K4NA 2B5JA 3O2PE 3CMAA 1X58A 4F8RA 1Y0NA 3E5UA 1JLBA 3I5UA 3BJOA 1VQMN 1KG6A 2LTPA 2IS3A 4D8KA 2G8KA 3PUBA 4MNUA 2E7WA 2E3HA 3SD4A 3QHSA 5EG0A 1DIZA 2FEZA 5ADXA 2IOCA 4HF1A 3K70D 1OCRH 1X2KA 3BJ6A 1U04A 2W48A 2RHUA 3A8GB 3A5NC 5C6SA 4RDUA 3FFKB 1C0MA 3I3LA 2BANA 2ZGYA 3B6PA 2YX6A 4M78G 1N33K 1ZQ3P 1BL0A 1HDPA 5F27A 2HMAA 3GNGA 4DOWA 4W5OA 3G25A 1NYGA 2JRMA 1ENHA 1ZH5A 4I6MB 2A7YA 1MHNA 4JLGA 4M6VA 3QWYA 1JXBA 4EM0B 5FLXZ 1NHAA 3J7ZI 2ZCFB 3CC4A 3LSPA 2EYQA 3HK2A 1SVLA 3A2FA 1T3LA 1TKTA 1MH3A 4AVPA 3CCMA 2AS5F 3RQ4A 3A03A 1BIZA 4XKWA 3N05A 1A31A 2K27A 1LDDA 2WWYA 3P4IA 4M63C 3OJUA 2VC1A 3ZX0A 5A0GA 3VS4A 2Y30A 1BUPA 4C0ZA 3I5SA 5ICEA 2H1LA 1W4MA 4F14A 4X64K 1A0NB 3FKIJ 3PX0A 1VQKQ 2XAQA 3OWTA 2HFHA 2KIFA 1RUWA 3E1YA 3DBRB 5DV5A 1YJ9I 1KAYA 3S15J 3GPLA 4DBRA 2A68F 3JB9H 4R79A 2RPIA 2O0YA 3LCNA 5LJ5g 1C0UA 3FXRA 1MIJA 4F2SA 5ILUA 3BF3A 3UT1A 1MH4A 2YT6A 2K5FA 3VJPA 3QINA 1SRMA 1R1UA 2H1KA 3HP9A 2VG5A 3BFMA 4P5OA 1GDTA 1HSQA 3WU0A 1M3QA 3QOEA 1OEBA 4Z0UA 4O0IA 4FSXA 1XC3A 1TW3A 4EM1A 1WBBA 2BZTA 5KGWA 1IO2A 3EG3A 5GAEP 2NS7A 1WJQA 4F3TA 4JNEA 3C18A 3ZN1A 4B9QA 4J2DA 4MTDA 4BQOA 1TL8A 1VQ8A 3KHYA 4LFUA 1J9IA 3M4OJ 4DYRA 3G6EQ 4AD9A 1KCFA 4U67L 5CKFA 5BREA 3PGGA 3AVKA 1VQ9T 3N4PA 1ZBSA 4E9EA 4HCZA 1YVUA 2KKOA 2W4SA 4FSSA 4JLHA 1Z0XA 3NFCA 2XB0X 3CCLA 1HYSA 3GTPJ 4GVMA 4QCLA 1H8AC 1YIOA 4PFPA 3MEXA 1VUBA 4YHHK 3FDYA 2IJLA 4C2UA 4G6DA 1VQ9N 4TV7A 1YQKA 2WSEE 3I53A 2FF4A 2EINH 5KYWB 3HM8A 4L9JA 1ZN2A 1G2BA 5KN9A 2FU4A 4IZZA 4JP0A 4UOBA 4HNUA 3X25B 3ZSQA 2WY7Q 2XV4S 3QEPA 4BR0A 2BIVA 1NGEA 4HVWA 1OCZH 3QIIA 2KQRA 3DBLB 4GY2B 5F2RA 5LJ5j 1IKYA 3DRRA 3UNGC 2KK4A 4LIUA 4PNOA 4IO8A 1JJ6C 2BUPA 5E3MA 1ZARA 4OMMA 2ZFUA 2UXCK 2CUFA 3JRIA 2STWA 5I9EB 1I5ZA 1TWFJ 2KRHA 1GFCA 3JREA 1NZ9A 2Q31A 2J05A 1M8MA 2A08A 9ANTA 1DTQA 1P4XA 3HPWA 3N0UA 4O5BA 4IG0A 3AAPA 2GLOA 5DPKA 4F2RA 2B0LA 2GBQA 4UUVA 4ZZLA 2P9NA 3CWSA 2KP6A 5LEKA 5M5WJ 4OINF 3LDOA 1FTTA 4CEAA 5FLXE 4EJUA 4AFZC 1R77A 2HOEA 4A3CJ 2ETJA 4IDKA 2KLOA 4IPAA 2HEQA 1RBSA 3GDQA 2RK2A 1W36C 2KZGA 1MMAA 3CCQI 5F04A 4CJLA 4D1QA 1SQKA 3CQ8A 2WV1A 1F43A 2DA9A 3S9HA 1YHQI 4AHTA 2MIOA 3FB9A 3M8FA 1G15A 4FW1A 2W6KA 4F9OA 1BCOA 4HQMA 3MCPA 2XY6A 1IAWA 3KE2A 2EZLA 1GT0C 2L7ZA 4PFZA 4HVUA 1EWRA 2E34A 3OQ5A 1OI1A 4QQGA 3M0PA 5FGMA 4A4EA 2RKIA 4KNYA 3PFIA 3OYLA 5EC7A 2ZNZA 3IRRA 3M1EA 1DEJA 5IY5H 4KTZA 3HG9A 5EEHA 1ATSA 4DTJA 2KHMA 1P2FA 1FBUA 3OW2P 1VQNQ 1KVAA 2IS1A 1JRIA 2M45A 3H9NA 1USTA 5AQSA 5J1RA 1QTMA 4MFEA 3G4SA 1Q82C 4ELVA 1WGSA 3G2BA 2KT0A 5GAOp 5IXBA 4I6MA 2G7UA 1KFZA 4EJWA 2LT1A 4JS5A 3WT0A 2B4JA 4BRMA 1K73O 4FYXB 2CH6A 4CJTA 3T3FA 1E3HA 3QSUA 5CAIA 4WCEL 3QO3A 1XQSC 5DK5A 1U47A 1X2MA 5D6YA 3V42A 3CW7A 1RI7A 3AVHA 4M73A 3RKWA 2VG6A 2QSFX 3ULEB 4IO9F 1P4AA 3AT1B 2RH2A 1XSVA 3HEFA 2D0BA 1JUPA 1T0FC 2V26A 4M3YA 3MMVA 5LLQA 2XG8D 5A2QO 3MXMA 4MQ9F 3BR2A 1QVFA 3LH5A 4M75C 2YNHA 3H5AA 4E7LA 1SKUB 1ORNA 1MUZA 4MO7A 4JI2K 1ZUKA 1KU9A 5IT9K 5E1XA 4QS8A 1PU6A 1O4XA 2UYTA 3CBMA 5FKNA 3PFSA 2YUNA 3JCMW 1Y07A 2L7KA 3CWUA 2XGXA 3M4GA 3S16J 3J8AA 5JLFA 3GTKJ 3MEUA 1RKWA 3CJ7A 1I94K 1VSEA 2KQ2A 3EAEA 1VRUA 4RLQA 3DEWA 4M77B 1TQIA 4EMSA 2KZZA 3VQAA 1DDNA 4FE4A 1M90O 2X74A 1SD7A 1D9FA 1W5CC 4JD2B 1T3VA 4Z4CA 2DLPA 5E26A 2OTLQ 4UVBA 2FRHA 2YHAA 3NGPA 1VQ5A 1MMDA 1R71A 2A5XA 3ZQHA 1XNRK 3P8BB 1YW9A 1PDNC 1PU7A 4AG1C 1VQPT 1UA0A 3K1MA 2ITMA 3TU4K 4EP5A 2UUCK 4YOWA 3JB9F 1I0CA 3S3MA 4DQIA 2H3JA 4GW6A 2LKXA 3IAM2 2P8TA 3D4VA 4J2EA 5LBQA 4B6MA 3AAQA 3T8TA 5CE3A 4I09A 5FPEA 2LC4A 2YS9A 5E3NA 1LWYA 1GLBG 4MMLA 2DN0A 2Z1JA 4O4GA 4KHUA 3I0WA 1VQPN 1V1CA 4DF8A 3EFSA 2HQ5A 3LL7A 1MWMA 4F7UE 3TAPA 3O3KA 4U88A 2NUTB 1HA8A 4LFCK 2F9WA 1LMZA 3ABKH 1U84A 3QPTA 3AG1H 2JVVA 5LJ3g 4C8QC 1B92A 3QYHB 2O7OA 2LYCA 3JAMZ 1ESVA 2OPPA 3C0BA 2R7TA 1YWOA 3TAEA 5AYFA 4OIPF 2LQKA 4O8UA 4BB7A 3CXCA 3WNGA 3RR7A 2V6EA 3NAEA 4QQ6A 4FK0A 2Q97A 1NM7A 1QMCA 1K0XA 5KYWA 2LCLA 2BXZA 4D0PA 2EZHA 2R92J 1HNVA 4PUSA 3P5JA 3OA9A 5H20A 2LP5A 3CCRQ 4YOYA 3DRPA 2VBYA 3IQLA 1XGNA 1JLAA 3VQ5A 5KAFC 3ALYA 5J4VA 4DHYA 3UR3C 2JXBA 2A3ZA 2ZPGB 4DTSA 3F8BA 2CQKA 2F5CA 2F2EA 5GMKh 4YG2F 3RVCA 5D6EA 2VXDA 1UE9A 4FE7A 1J75A 4CGGA 2YUOA 3CJ1A 3CCJA 3OH9A 1I6XA 1LOJA 3S1NJ 1APLC 3U9DA 3K70C 2AHJB 3HB9A 3J80Z 1BR4A 1WHLA 4ENMA 3NBPA 1Q86O 2XHCA 1TUUA 1RGIA 4J9FA 3WGHA 3F9KA 4KITB 2JWKA 2LQ8A 4RLFA 1EP4A 1NK7A 5JLHA 1KQSP 4KGXB 3M07A 2P6SA 3NNQA 3OH6A 2LR8A 3SDGA 3UF4A 3NFAA 4HVJA 5C15A 3MN5A 4ZGJB 1QPMA 3E7LA 3COAC 3JAMK 2OA8A 3G4SI 2DBMA 5EU7A 2DFHA 3V1OA 2HSPA 1Z25A 2FA5A 3CF5F 4BC2A 2M3AA 4RB0A 1F36A 3GO5A 2IA2A 2A05A 4F92B 1KG4A 5B1AH 4BR2A 2DVJA 1IN8A 4ESFA 3CJ9A 4D7NA 2NNYA 3D5LA 1KONA 2EGAA 1WQ2A 4E6KG 3PMTA 2XKPA 2CV0A 5HOOA 1VQPQ 3E6DA 5KE3A 3KFWX 5DTDA 4N4HA 2HOTA 3GG4A 4CF9A 3ZT3A 2I5JA 3K9TA 1KQ2A 2OTJA 5HNFA 1ZHIA 5GMKi 1FZPB 5AQIA 2DT7B 2XIGA 1JE8A 2PUKB 4J00A 2GA2A 3DQVC 5FKOA 3EG9B 1N3AA 1T2KA 1WI9A 2EVRA 3MXJA 4L6V5 2DY4A 1JLCA 3M9QA 3WGIA 3CD6N 3NWTA 1R0BG 4M41A 3AY9A 3GFJA 1Z91A 2JA2A 2FBYA 4XIUA 4PZJA 4BE0A 3TCJA 2CV1A 5A0DA 4BRNA 4C1NI 3ULEA 5AONA 3TP0A 4CK1A 3CCUQ 5GIOA 3LAKA 2MC3A 1R6RA 3CDHA 4JEPA 4U7DA 1HYVA 2ZJRF 2P5GA 3M56A 1HW5A 1D5AA 4JQFA 3W2AA 2Z1IA 3ZSWA 2NVUB 5JMVA 5FU6C 3H0GJ 2NOIA 5L3GA 3M59A 1VQLT 2EBPA 1U5TB 5AZIB 4A3MJ 1YITA 1UB9A 2L01A 4Z4FA 1SRLA 4K43A 3JAME 1G99A 1ZXOA 1SD6A 3D2FB 3FM5A 3O3FA 2BKDN 4BR7A 5LRSA 2E2QA 1DT9A 4B1XB 2ZJ2A 3ELKA 2ABLA 3V8JA 1B72B 2QENA 4MO4A 3WXIA 1RC9A 5HS7A 3HOYJ 3QERA 4IOXA 3QFPA 4M77A 2VPLA 3RMDA 3CC2Q 4XKCA 1VQLN 1SD4A 1WH5A 1IREB 3F8MA 4JD2A 3GTMJ 1JXOA 1FOWA 1WKMA 1QWFA 1OULA 1Y96B 4HXJA 3VQDA 1NK6A 4KMUX 5M1FA 1NU0A 1HKGA 1KD1O 2FZGB 1LJOA 1YQLA 3AVNA 3CPWS 3MN2A 1MSEC 1YG2A 3I56Q 3KZBA 1EJ9A 3GFIA 3VQQA 2HAXA 3OYAA 3ZXSA 4DBFA 3J80E 5HS8A 2XAHA 3IC7A 2R7QA 2DVEA 1B07A 1S1NA 1D0ZA 3WTYC 3HOWJ 2KT1A 1TQMA 3DI6A 4HNVA 2R7XA 1AU7A 1YJNI 4DTNA 5FD6A 2VVKA 3O8HA 4A6EA 5GANj 4BI8B 3MKWB 3SZTA 4M77D 2HQNA 2E12A 3THVA 1XGSA 1Q18A 2NUTA 1FSEA 1H9TA 3A8MB 4JK1X 1WXTA 2Z1GA 1OVQA 4IOCL 3EQLF 4XTUA 3FC3A 1HU0A 5LL6Z 3BPVA 1SAZA 3H8ZA 2MFZA 3TABA 3KIOA 2KZVA 5L3FA 3CCJI 2J5PA 2DTHA 3M0TA 5GAHJ 4Y28E 1RR7A 5GAHP 2YG9A 1JTYA 1UGVA 4JI6K 1IW7F 1ZA2B 1VQ4T 5EXWA 3DLHA 3ISPA 1SS6A 4DV6K 1UAAA 1NJIR 2NWMA 5GINA 3W3CA 2CUJA 1QQJA 5J1UA 5TKWA 4BNCA 1UMQA 4H5VA 5AQJA 1VSMA 4C8MA 3DEUA 1QVGA 3BDDA 2KKZA 1M1FA 3H3OB 2EV0A 1AZEA 2KJCA 5F6FA 3VPRA 1RDWX 3I54A 4A61A 5JVGF 2ECBA 4JX4A 1FLIA 1VI0A 5KYUB 1U3OA 1AOJA 1OR7C 5IP9J 2YNFA 2O8EB 5J47A 3DKWA 1E6GA 4N4NB 1J6ZA 2ZWHA 1VQ4N 1Q9YA 3O8GA 3CCEI 4J9HA 5IHKA 5L3EA 2FZKB 4LF7K 4H4MA 5IT9O 4WXCA 2FXUA 2Z99A 3KTUA 2BGCA 4RW8A 3RI4A 4DUYK 3ZQLA 2DE0X 2W41A 4IFYA 1W4SA 1MNMC 2VBWA 1BOAA 4D5CA 2ASPA 5IWAK 3WE2A 1CZAN 4NDLA 5ICCA 4BBRJ 4RGRA 4N0BA 1YIJN 3FJ5A 2V8KA 1XQPA 4Q4ZF 1SMYF 4MLOA 2VXFA 4QVDA 4Z2YA 2MGQA 3Q1JA 4J2AA 4RB3C 2VYPA 2STTA 1WJBA 3JRBA 1LUJB 1ZX6A 3CMMA 1TAQA 2Q1ZB 1LFPA 4ESBA 3VDXA 1U45A 3VOEA 3ESWB 4Z94A 2JLEA 2AKKA 5EG2A 1VQOI 1Y57A 3CUQC 2WFBA 1K83J 4L5GA 5GAN6 2DO3A 3EG9A 3NAUA 5TISC 1UB4A 1QP2A 4FM1A 4E7SA 1QHGA 5AIQA 1OPCA 3P7NA 3N97A 4E6RA 1M3HA 1PJRA 3OYIA 3X20B 4QSHA 5J39A 5IOYA 1BBZA 4YOXA 2K9NA 2WV0A 3K69A 2RHIA 5BRDA 2GFAA 2HKNA 4MIMA 5FKMA 4LD0A 2DL4A 1WSJA 2E7XA 1DUXC 2O4XA 3FZFA 3EEQA 3HHGA 4DF4A 2A3SA 5KAIC 5K5OA 4KBMB 4JI1K 1FBSA 3E6CC 1JB0E 4B9XA 5FROA 1E4FT 4YOQA 2E36A 3VPZA 2G6FX 2IIMA 4AM3A 3CP8A 3EUAA 1BQNA 1AKHB 4OPKA 1U5TA 5AZIA 3VF6A 4ZC3A 2FRWA 2M5WA 1Y71A 4MDAA 1LCKA 1KIKA 3OBYA 3VTIA 3ZCMA 4XH1A 2Q0RA 2VC0A 3D2FA 4CGHA 1QSLA 2R5AA 1N32K 2YU3A 1IXSB 5IH2A 2HQEA 2LNBA 2DOFA 2V75A 2K9LA 3E3VA 4N5SA 4DQQA 1NE8A 4R8HA 1GBQA 2HF3A 1AHDP 1USSA 2FBXA 3C94A 1NEGA 4OIRF 3TSQA 2IGMA 2LREA 1XMXA 4ZTJA 3BZCA 1OQKA 5GMKj 1Y96A 2E1ZA 1IUFA 3JAMO 2XIDA 2P4WA 1VAZA 5LL6S 2Z3YA 2EQJA 1NLPC 4PJOC 1O7FA 2C6YA 1LE8B 2DL8A 3UATA 3SZ2A 5EEGA 4EP4A 2AIRB 1WSGA 5B3SH 2PJRB 3AO1A 3J7AP 1D1AA 2OZSA 3WVDB 2AJQA 4KDPA 2HW3A 2RVCA 1PD0A 3NMUA 1XG1A 2MWOA 1OH5A 2QA4T 4GYGA 5KYXB 1S6LA 3SBTA 1CGPA 4EIKA 2I5WA 3QIOA 4M7AE 1S72T 3LDSA 2ZBKA 4CBXA 4LG0B 4M3EA 5D5XB 1YFNA 4IXCA 4FK2A 3QKJA 1ACIA 1K9MC 2PEXA 5F64A 2EBIA 2G8HA 3C3WA 1HNWK 2O4GA 3HUGB 5ELZA 2BHYA 2PMZA 2GELA 1VYTA 4KAZA 3Q3SA 3M8QA 1X3WB 4HZFA 2K9QA 2W1OA 2ID6A 1PU8A 4H0XB 2OCCH 2QA4N 1HYZA 5BPDA 3KKSA 3KZIC 1Y6IA 3MJXA 5J26A 1S72N 1M8VA 3NF8A 1Q81O 4IUUA 2Q36A 2D0OA 2Q2EB 1TW2A 1ASVA 2X4YA 2J5OA 4H5WA 1DU0A 1QKXA 5CJ9A 3AVBA 1KU3A 2TDXA 2DBBA 1VYVA 4LGWA 4NQWA 1LWFA 2FZCB 2WC9A 2DIGA 5KYUA 1DP7P 1V29B 1BU1A 4BY1J 4CI6A 2DL3A 3QESA 2FNPA 2VC8A 4DSKA 3FJPA 2KHOA 1LWVA 3CUOA 4DOVA 4U0VA 3C4SA 2NS0A 4RWTA 5KK1A 1MUNA 1YJWT 3AVLA 1NGBA 1YS7A 1W7PB 3GW2A 3HTRA 1K61A 2DA2A 1IXCA 3TEEA 2L3DA 2VL8A 3JB9D 1JGSA 6PAXA 1KQ1A 4Y3OA 4FT2A 1KG5A 1Z6RA 3RESA 1WVRA 1JKPC 1BO5O 2D45A 1WPYA 2KEAA 1E3PA 2K3FA 1E7OA 5K7HA 1AZGB 3WNHA 3W6VA 4J6WA 2HYGD 3OR2C 4QOZB 2ZJPF 3QLHA 4HLYA 1YJWN 2MBFA 4GV3A 1E2XA 2FMYA 1BW5A 4II3A 4OMQA 2M0YA 4CC3A 3DLAA 2UU9K 4FWSA 3NTHA 2VODA 1YXQA 4LDUA 5AQFA 1FYKA 3DPUA 1RTHA 4WE1A 3MZHA 3RR6A 1VQMA 5DEQA 1O75A 4NC7A 1AEYA 5CKEA 3ONQA 4TSXA 1NGNA 4LF6K 3TGNA 1R8OB 4UV9A 3PX6A 5LD2C 1C1CA 2CW0F 1GHCA 3F2KA 1YP5A 2DL5A 4F16A 4JYKA 3HVRA 1VQ6A 4WXDA 4MZPA 4BRIA 4YDUA 3OR1C 1K4US 1C1AA 4G7OF 3E5XA 5C12A 2QQSA 1RI0A 2YJEA 4J9BA 2A1RA 4F7UF 3I55T 4ID5A 4NL2A 1WEIA 4KTWA 4KUDK 4K2EA 3I33A 2L9VA 2ABKA 5BRHA 4L5EA 3CMAT 4DR6K 1RABB 4L3QA 4BXFA 2QA4Q 2E70A 1K73R 2P0PA 4BWJA 2VWKA 3MAQA 1BKBA 2FL7A 2VKNA 2GX9A 3X26B 3SLCA 4YORA 2P5VA 2Y9ZA 1YVNA 3CYMA 1IKWA 1JJ2A 2XGEA 5C24A 5CK9A 4D5FA 4J83A 1YJ9Q 2B86A 4GDFA 3EH1A 4RTFD 1SKRA 1LNXA 1TGOA 3Q7BA 3CMAN 3FXOA 1M1KC 1FNNA 4JKBA 4ME7A 1ZTRA 3FZKA 1C0WA 3AG4H 2DPUA 3ZQQA 3IKMA 2AO9A 3G71A 1GVDA 3PO5A 4EMHA 3H36A 4RTYA 5KE2A 3BLYA 4CCHA 1AKHA 2DA5A 2P5KA 2YKMA 1YI2A 3CJNA 2W00A 1XOVA 4ZH4F 3F0CA 4CHNA 4J5YA 3TAMA 3K5MA 4DR2K 4L5IA 5IN1A 3CC4T 2EPDA 4GFBA 2RMOA 4JJBA 1I50J 1ZYRF 3DV8A 3CCMT 3HOUJ 4Q5WA 5C2FA 1UOCA 4EJZA 3M0SA 3U6FA 4RTXA 4OMOA 4PGGA 1V3FA 3A1PA 3O5BA 3NHNA 3LWIA 1UHWA 5E18F 3MKYB 1RPWA 3SUQA 4A3GJ 1NKEA 4BGDA 1XX5A 1U48A 2ZJQF 1VK0A 3LDQA 4MZTA 4KULA 1V4SA 1G6NA 2CKKA 2LX7A 1EA3A 2YHBA 4LH4A 1YO5C 1LE8A 3EPZA 3CCMN 1OQYA 3JB9I 1ZBHA 2MD0A 4NS5A 1Z77A 3VFZA 3MCAB 3FXUA 2PJRA 3TANA 3ZL7C 2CUBA 1STZA 2CP6A 2Y4YA 4HCKA 2NUZA 1IBLK 5D4RA 2L5QA 4R1HA 1KU7A 1S5LC 1G5VA 2ITGA 2VLAA 4KBOA 2F4VK 1FP2A 3VQ9A 4AIDA 5KYXA 1RT7A 4NC6A 2F2XA 3LSRA 1YTAA 1NJIU 4A57A 1HCRA 4LG0A 5J2NA 2KIQA 3WU1B 2EZKA 4J9EA 4X9DA 3WQUA 2J06A 1T6SA 4KISA 3HUGA 1R0AA 3I55Q 3E9GA 2AZVA 4CGJA 1TNTA 3ATUA 1WLJA 5HDKA 4NL3A 1JHFA 3X28B 1GLLO 1VQ8T 5FPDA 4NCAA 2P4TA 4OKKA 2E5NA 4IQ4A 1RAIB 3U21A 4WQ4A 1TT0A 3CMAQ 2O3FA 3Q0UA 2RN7A 4M7DE 4DGWB 2Q2EA 4AG2C 3E0JB 2O61A 3AVCA 2R0QC 3UKUA 2ZB9A 2RDPA 2VIXA 2K5CA 1H9GA 1MD0A 1KK7A 2Z16A 3CZ6A 1TSFA 3CCLT 2W7NA 2MG4A 3S8PA 1VQ8N 2QVOA 4QAGA 2LG4A 3J81O 4CHUA 1QQMA 3OB9A 1Q86R 1YS6A 2H27A 1YHQQ 4OLBA 1SFEA 1W7PA 4ENKA 3OW2S 3FR0A 4ILGB 3V4IA 3D5SC 2XY7A 4N4IA 3IAS2 2D0CA 3O8VA 2IRFG 4EJOA 4O8KA 2Y0SN 3JCMd 1Q7YC 3F8FA 1KC8R 3CCLN 3JCMf 2OAUA 3I64A 1QZEA 4X1EA 4XK4A 2KR3A 4J2BA 4FYWB 3F5TA 3CC4Q 2FSWA 2P7CB 2PVDB 2MK5A 1KLMA 4E7ZA 3R6SA 4FPBA 1YF5L 1A36A 2MH2A 5AQPA 1K1ZA 4O5FA 2DI3A 5GAMd 2IW5A 1V4TA 3GTJJ 5C44J 5GAMf 3UPUA 1FTZA 3OYMA 1WSUA 2BZ8A 3HTUA 3PNTA 2ATQA 1W7PD 2EYYA 4IHYA 3RQIA 4JZ4A 4G7ZF 3QFUA 5CY4A 3G1LA 2FOWA 3CMET 3ZLJA 3VQ8A 1JXSA 2HEOA 3CIPA 4BQAA 1I5OB 3HGYA 2VQEK 2DA6A 2ISYA 5B8HA 1O1WA 4CJRA 1FJLA 3ASKA 1RDUA 1ON2A 3A8YA 1R4MB 4EEFG 3DLEA 1M3AA 3V9XA 1Y7XA 3TDZC 4BXXJ 2O03A 4YEJA 4BI4A 1CZBA 1WHUA 4BRQA 4B3OA 3CMEN 4F52A 4EHUA 3LP3A 1HW2A 3EHQA 3JRGA 4LN2A 2HBJA 4LLNA 3M5RA 4RTVA 4AHUA 4F7UB 1E3MA 5ICGA 2DK3A 1U4BA 1VQ8Q 4DNCA 2WSFE 1BCMA 1NM1A 4CFCA 1TL1A 1X3MA 2IPOB 3OSVA 1NGJA 2HVQA 2LFBA 5BPMA 1J5OA 5C2DA 2WC2A 5EYRA 2CJJA 4BJ6C 5F1RA 2HBLA 3KKRA 2H6BA 4OB0B 2DLLA 4A69C 2RHYA 4H0VB 2OD5A 2M0CA 1N6QA 1NPPA 1YW8A 3FHNA 1OH7A 3L2VA 3EFRA 4OPAA 1KU2A 4PY5A 3OIOA 1A04A 4RAFA 2RPNA 4FOEA 3H9JA 1YN8A 4J7FA 4BY7J 4TVRA 1QSYA 4Q5SF 2DXCA 1FXXA 2UWMA 4G1QA 2EFQA 4CGDA 3ZFJA 3I0TA 3GCMA 4BD3A 3HOSA 1KQSM 1Z21A 2BY0A 4CEFA 2BE9B 1KD1R 2ZMEB 4JS4A 1KVBA 4ESJA 4CXFA 3FXKA 1U9NA 1PM3A 3CXCS 2ZPFB 2BHZA 2DXUA 4QW2A 3T1AA 4FJ8A 3T0YA 1YE9A 2ED1A 2VV5A 1LB2A 3C6UA 4XK8E 3OS1A 4FOIA 2ZE2A 3MPUB 5I3UA 1VQ9I 2E20A 4BAYA 4C8NA 2CZ1B 2E88A 3LZIA 3HHHA 3GE1A 2XU8A 4Y7NJ 2DEUA 4RM3A 5GPAA 2JWLA 2CSIA 3L6QA 4DSJA 1SC7A 4JZ3A 2R7SA 3JCMh 3ZX3A 3RIRA 3OYJA 4XOTA 3UKGA 4B9SA 5IOZA 3MZYA 1VQ5T 1IXRC 4BQLA 3V9UA 3C2HA 2DZCA 5GAOq 2K3YA 1W9HA 4E3SA 2QEXA 3VETA 2ECZA 1Q8IA 1ZC6A 1XPXA 2VWJA 2JSPA 2QYZA 1VIFA 1ERDA 4WX9A 3ABLH 3RKQA 3PJRA 2EAYA 2L3RA 4H5RA 3G3ZA 1S3JA 4CZHA 5GAMh 3EHRA 1U5SA 3VGLA 2IVNA 2X4JA 4FL9A 3M8RA 4OGCA 2VKVA 2JZYA 3VEPA 1X9SA 2QK9A 3KK2A 1O7LA 1L3LA 1WYXA 4R55A 2HYFA 4W1UA 1VQ5N 2ME6A 3LM2A 3OYFA 2K02A 3HYIA 3SK3A 5BR9A 1WHHA 4FLUA 4EW4A 1N9RA 1IGUA 3Q9VA 5AQKA 2CGJA 2Y2ZA 2JMAA 5L3BA 5KYYB 2KL4A 1N8RO 5IT3A 4AMCA 2KIUA 2HKQB 5CZ2A 2OZ6A 1C6VA 3OTOK 1SVOA 5CVIA 3O9QA 1ZBXA 4E89A 2FBVA 2A37A 1VQ7T 3G4SQ 3JR9A 4Z4EA 4ZDOA 2GF7A 4BQQA 3REBB 2F6CA 2WTUA 1JKHA 1P59A 3TVTA 1ASWA 1HF0A 4ITVA 2BGGA 3NWSA 1Z3YA 3RPUA 4AQYK 2CW7A 3KNTA 4A6DA 2G0EA 2YRVA 3PT9A 1Z7LA 5GAN7 5DCMB 1Y64A 1OCTC 3SQ4A 2COBA 1S7AA 6AT1B 3BDUA 4WXHA 2PX9A 3E97A 1VQ7N 1IN6A 5GJVB 2ZJRL 4FJXA 4BS9A 1KLNA 1TKDA 1FOXA 4IF4A 3KD1E 3C6HA 2EFNA 4HRIA 3Q0VA 4HX4A 3ID8A 2XAUA 1F1BB 4XM3A 5AQHA 4K8XA 3CQZJ 2HOSA 1W70A 2CZ0B 2QASA 1T05A 4PJLA 4C0DB 4M71A 1QVPA 2COYA 4OVLA 1EX4A 3CMYA 3MEGA 4FYDA 1WJSA 4ZN1A 1ETWA 2EQRA 2W25A 1SAUA 2VASA 1RI9A 4M7AF 5TRDA 2X35A 1XGMA 3U4LA 1OH6A 4EIAA 3OV8A 3RPUD 3IHOA 2K3PA 2CS7A 2EILH 4PK4A 3OGDA 4NZGA 3OOPA 3P38A 4A4KA 1CKBA 3L4IA 4M78C 2MCNA 1X2NA 4FPAA 2QQBA 2KTQA 2E41A 5D6FA 2IVPA 4CJUA 2JVHA 2H56A 2DFFA 1JU5C 1BISA 1IN5A 3CD6A 4CEBA 1VQ5Q 1FYNA 1XTAA 2XDPA 5CQEA 3C6AA 5HDNA 2EQKA 5CKDA 2QF7A 3BWGA 2JJ9A 4PA1A 2GQVA 2RNAA 8AT1B 1I8FA 4F7UA 5KRSA 2OTJT 1RUOA 1T7PA 4M7XA 3KX2A 2ED0A 4J9IA 4CI0C 2ROLA 3NE6A 3ZN0A 4CF1A 3P9KA 3CC7T 2CUEA 4FU6A 1TZLA 2D1HA 1X3NA 4A12A 3A5MC 1B1BA 2K5LA 4EATA 4UB8C 2CZ6B 2ELKA 1OKRA 4X1VA 3H3NO 2L89A 3SFIA 1AA7A 2R93J 2XB5A 3VF2A 2RAEA 2LJ0A 1UG0A 4XRSG 4XKBA 3OSFA 2HWVA 3LSIA 1ZG3A 4N76A 2UXBK 2CO5A 3FLGA 4CHZA 1IJJA 5GMKm 3SEZA 3DPTA 2HKXA 4ZN3A 5CLSA 3H46O 1PYVA 4M3ZA 2BTFA 3EETA 3CC7N 2JTVA 3JCMJ 3X24B 1OV3A 3W6JB 3LDLA 1LEAA 2LNHB 4CJVA 3KZZA 5BPIA 3JYTA 4AIHA 1W2BM 1JJ8C 1C0TA 2O01E 1OZ3A 4MO5A 1NEBA 2V7ZA 2DD5A 1O3TA 4J7IA 1R58A 1HKTA 3PFYA 2KYBA 2HHUA 5KVRA 2KROA 1VQPI 1S7OA 2JS2A 2QKLB 1SV5A 3SYTA 2QKKA 2QDLA 4IL6C 1HX1A 3AO3A 4G9ZA 2ZMEA 5JI6A 4ZJZA 2X6WA 1Z9CA 5JVGL 3HL2A 4JK7A 1ACMB 1ZLMA 2HVRA 4NYFA 1YITT 5I21A 5BN8A 1G2HA 5L3CA 4JKFA 2AQFA 1X9WA 2MD5A 3RJPA 2LSOA 2DXIA 3OS5A 3CDIA 4KI4A 3HI0A 3FM3A 3CCJQ 4LF5K 4C5GA 4DV7K 2HQAA 3A0BC 4AFQC 2FG0A 1KG7A 3ZQIA 2GNCA 4C8QE 1GLJO 3KLHA 1YITN 1R00A 2NRWA 3TO9A 2EQUA 1SFOJ 1XQHA 2DMPA 2JTFA 1GV5A 4H8KA 4JK9A 5F0CA 5FRMA 4M77G 4C3HJ 4OIQF 1UFMA 3DOKA 3EDPA 1NG2A 3CJRB 2EFPA 1YW7A 2YRDA 2RNJA 1F9NA 4R56A 2DEQA 1K73C 2OBPA 3FXQA 4ELYC 4LD6A 1JI8A 4WQ4C 2DAQA 3TOAA 3WTXC 3FXMA 1Q81R 3PIPL 1RTIA 3AVJA 3LL3A 2A69F 3EKUA 2XRNA 3M6GA 5BNGA 5SWMA 4BRFA 1Q86U 4IIMA 4B43A 1I4K1 4IHVA 4RMOA 1MBHA 1BHLA 2G9WA 1LVKA 2F2VA 1RBUA 3HP6A 3AA5X 2EIMH 2D9TA 3I59B 5I42A 2P0KA 5KYYA 1BI2A 1KC8U 4H0TB 4HNTA 5D6WA 2A6HF 4LG3A 2X48A 4Y91A 3SQNA 2OTJQ 1O57A 1WXBA 1VQ4A 4BHCA 3FXLA 4BR5A 5EDNA 3GTGJ 3L3VA 1OPKA 2AHQA 2JWTA 1QVUA 3HZJA 4YIIA 3JCMg 4DCHA 1WJ5A 5BS6A 3OS2A 3PO2J 1X2QA 4ETSA 4K0KK 2JZ2A 1XCBA 2EKOA 4I2QA 2GTJA 2NRRA 4YOUA 3WEEB 2GBYA 2PBIA 1Q82R 2DW4A 2CU7A 1WDXA 1M90C 1DGRM 5DCMA 3CQXA 1G3SA 3JCUC 4QQDA 1YIJA 5DMRA 5GAMg 1EH6A 1TKZA 4IVNA 3JB9J 3EG0A 2FSNA 3V8KA 1LDKB 2CQNA 2P84A 3M1FA 4HSBA 4UXNA 4N56A 3RYRA 2EHGA 3AHUA 2JA6J 3WG9A 2W0ZA 3ZMVA 2HCKA 4BRGA 3FMQA 2BOLA 2PVOB 5CYQA 1X4PA 3ASNH 1BIBA 2FSJA 1IN7A 3ML6A 3QETA 2DA3A 4OKJA 3I8DA 1RDDA 1WHKA 1RAEB 4EA4A 3GX4X 3M8JA 2V1QA 4YFUA 1WFWA 1OU9A 4JRIA 2PVGB 3E9LA 1QLYA 4LNPA 4LF8K 3VSLA 3DLLA 4ON0A 1ETOA 2M1BA 4HX8A 3D7SB 1Q95G 4YPHA 1QZ5A 3T8RA 1XGOA 1H88C 3NPFA 4OJRA 4FJJA 4KHWA 1VQKA 3MKLA 3ULRB 3EYYA 1WFXA 1NK4A 4LE9A 4YPRA 2CUDA 1NBEB 5AQXA 2JVGA 1RNLA 2EJGA 2NLUA 1B9DA 5D4SA 4M7DF 3SI6A 3FKJA 5BN9A 1K8AU 3WE3A 3PQJA 3NCIA 1K6YA 1LAWA 3OY9A 1EWQA 1ZSZB 4M7AB 2VWFA 4HLXA 2CP7A 1EO1A 3THWA 4IKFA 5C4JJ 2L3QA 2D5RA 5AQGA 1VQLI 3K1NA 2DYBA 3SCXA 2K9SA 4RM2A 4C0GA 4DQ8A 3UA7A 2K79A 5GPCA 4CVNE 2E64A 2QG9B 3KLGA 4W5RA 3SXYA 1RDBA 2VJIA 4MQ3A 4BDPA 2FC0A 4KH5A 1D5VA 1L3TA 1HNZK 4WFBL 1V5FA 2NOBA 3TW7A 4LIVA 3UWNA 4PLIA 4CCMA 3G6EA 3VGKA 4HW0A 2PN6A 4PSXA 2DBKA 3EGDA 3MKZA 4M6XA 3LYIA 1YTYA 4N47A 4HBLA 1PSEA 5ED4A 3LGLA 4A0XA 2RJDA 4FETA 5KNLA 2EGEA 4B3RK 4XLHA 2O8DB 1NG6A 4H5NA 1JBMA 5DM7F 4IHWA 3DTKA 2C0IA 3RR8A 2QSHX 3VERA 1KTQA 4Z4IA 4C5EA 3LWHA 4BACA 4XMYA 2R5ZB 2MW8A 4C2TA 2DKGA 3H6EA 3CI5A 1LW0A 2EV5A 3SNNA 1ZYQA 2KFDA 4EFHA 1NK8A 4OAYA 3WVEB 3LA7A 1XQOA 4P1WA 4PJ0C 3SFMA 1RRSA 3SHWA 1BA1A 2O88A 1E17A 3IWFA 3DP7A 3OJSA 3SWNC 4L8RB 3TBIA 3F9MA 1NBWA 3QB0A 1J3TA 3ZSZA 2JHJA 1OYIA 5EEAA 4L5JA 2SEMA 2CH5A 2OF7A 1LKXA 3K7AJ 3PUFA 4DW6A 4K41A 2MYSA 2DJIA 3SUOA 1Q1HA 2NZTA 2XDVA 2F8SA 2XI9A 3CCQN 2YKNA 5I22A 2Z1HA 2W57A 2ZJPL 2IS2A 3QDFA 2HL3A 2NUPA 4CBWA 3KXTA 1PRLC 1W0TA 4BUPA 3L00A 5IXFA 3M0RA 3H5NA 1D09B 1VQ4I 1B34B 1WHJA 2OPSA 1HQCA 5CVVA 2K9GA 3SB2A 4NNJA 5ECAA 5FO5A 1T08B 2HZTA 3RERA 2DJNA 5FWCA 2QQRA 3LAMA 1R23A 3QYFA 3KK3A 4X65K 4MMKA 2LQWA 4A62A 3AFHA 3KP4A 3KEYA 4MGRA 3FK7A 1IN4A 3RMCA 1SSHA 2VUBA 3DPLC 3I59A 3ZMTA 2X6OA 2KPMA 3IH2A 4FCYA 1YCYA 4BG8A 4LB5A 3FF5A 1MZBA 1PP8F 4GKJK 5LMUK 2C06A 3NF6A 3FMSA 2HU9A 2KRNA 4BY6C 5ICFA 4ZZDA 3JCMQ 5HKCA 4ZTFA 5E84A 2TRTA 3LPTA 4Y4RA 2KIMA 3KK1A 1BI4B 4AM6A 1QU3A 1K79A 5M1NA 2COMA 4OB2B 3RSEB 3THXB 1HKSA 4X9CA 4XTWA 2R57A 2EX3A 4FT8A 3V9ZA 1FMWA 4CFAA 4KHYA 5E41A 2OJ2A 5CKHA 1BOBA 3F6VA 2FMLA 4OF1A 1HKCA 1Z3XA 2M16A 3GEZA 3WTVC 5GAOm 2Y9YA 4DLEA 1YJWA 2CQ7A 5L3DA 3T1HK 1CKAA 2KRFA 2LT4A 1KD1C 2IVOA 5HBMA 4Y17A 2VXZA 1JEGA 2Y0MA 1KAZA 1UEBA 2P9PB 3HO1A 2LTOA 2BUDA 1MSFC 2EYWA 3SMPA 3EE9A 3G0QA 3DBHB 3ME9A 2CQQA 2PJPA 3PIOA 1ORKA 1K76A 2X6SA 2VJJA 4BJ5C 4KT5C 5DYMA 2RNGA 3K4LA 3T69A 1OPLA 4RKUE 1UECA 1IC8A 4KN4X 2L9SA 3Q7CA 3K0SA 2NYXA 1J53A 4CEQA 2HF4A 1GXPA 2EYXA 3PVQA 2HPIA 5KGXA 1WJDA 4QPOA 3META 3D2EB 4BRAA 2DTZA 4CF8A 4XAXB 1FPQA 5BQTA 3QDRB 1I1JA 3HJEA 2M7AA 1XTDA 2CGLA 4AHRA 4A5AA 3WHCA 4ICLA 2HKOA 3TU5A 1QVFM 3A0IX 4FZXC 3VB2A 3OYGA 4AVZA 2DQLA 1VQMT 2ZJQL 4W5TA 3NF9A 2DA7A 4CJQA 3W0LA 2QTXA 5KPZA 2JA5J 1HC8A 1YT3A 1VQ6T 1ZSZA 3D6RA 4M7AA 2DT5A 5AQMA 2ENMA 3MEEA 3QUIA 2H8WA 2OTLA 2FPFA 1A6IA 4AH9A 2K40A 5AQVA 1R5HA 3ZSYA 2DNUA 1GLCG 3RPQA 4HF0A 4CHPA 3ECHA 2Z9OA 3DKMA 2PAVA 1KQ9A 5AJ3K 4M3TA 3TO6A 2QTVA 3C7NB 2MC4A 4BE2A 2OPTA 3WNEA 3KYLA 5IHNA 1VQ6N 5MLCQ 3M55A 3GL1A 1XDUA 3WXJA 4XLNF 4M7DB 2M30A 3VS1A 3JTGA 2A5WA 2HQHA 1Z9ZA 2XKOA 4CYCB 3CETA 3TDUC 3T1BA 3GZNB 3ZRGA 4B3XA 4NHJA 4XLFA 4NXMK 1X3UA 5LEJA 4BH9A 4B3AA 2WUSA 4C5HA 4HSTA 2E5ZA 2O8DA 3ZT0A 3S2DJ 4M7AD 4PJOE 1Q1VA 2I2LA 4BVPA 3M57A 1GLAG 3RZOJ 3OYEA 3EG2A 2R5ZA 2HGCA 3G71T 4DFKA 2XRLA 1MGQA 4LH5A 1YI2T 1Y8RB 5DM6F 2D1VA 3HOTA 4BL0B 2Z0WA 4BC4A 3RRHA 4Z4GA 4HEA2 3KYDB 5GANd 1JLGA 1TT5B 1JKRC 5HLIA 2JA8J 5GANf 4DBHA 4A59A 1TU0B 3PO4A 4M77F 5CPRB 2O4IA 2QA4I 4IEIA 2EA2A 4OP0A 3CCRA 2FPEA 4E4HA 2FOKA 4HAMA 1X01A 2M51A 2G8UA 3PQKA 3G71N 1S72I 1LOTB 1MJ9A 1W1WE 3HKZN 1VIEA 4V2SA 1YI2N 1NKBA 4I02A 4DZJA 1K4SA 3C12A 3F70A 3V7CA 4HUFA 1QWEA 1TXQA 2WY8Q 1HK9A 4G9YA 3EG1A 3K4CA 4AHSA 2HDDA 4DR1K 3R4KA 2E1MC 1B34A 2O8XA 3MP6A 1X75C 1PD1A 1UGPB 1HPMA 1MV0B 1G8XA 2XUBA 3C7JA 4UQGA 5GAN3 1V76A 1NTCA 3FFIA 1ITYA 2F1LA 3IRXA 4F04B 1VQMQ 2FRYA 2ADUA 2Z5UA 3B02A 3EUHA 3O9TA 2OA4A 1MMNA 5FLXK 1RDAA 2P9LB 2XICA 1DKGD 1KJWA 4O6JA 1R1TA 4WQ5A 2O8FB 2HPMA 2M8EA 1OMIA 1Q82U 1WJFA 2DYSH 5AQLA 4N0AC 4N9IA 1NK0A 2F5FA 3BROA 4KGVB 3CQYA 1H1VA 1X1DA 2UXDK 4EV0A 2IDOA 2RB6A 2LZ6B 3FRNA 1BI4A 1TUYA 4LITA 5LHIA 1WI3A 3BOQA 3M1CA 4OB1B 3RSEA 2DMNA 4MLEA 2CSOA 3AVGA 4H03B 3THXA 3REOA 1MA9B 5KCOA 4PDKA 3CCVA 2R5YA 3RWUA 2Y0SA 2FF6A 3AL0C 3AKZA 4ZGEB 3BTCA 2X6XA 1ZLKA 5HL7L 2HSTA 2FHDA 1OCPA 3F6OA 4JV5K 4GBQA 4B1WB 1NMDA 3TL4X 3ZCOA 4DA4A 1YX3A 1NMNA 2VE8A 3HM9A 1SEMA 4U0YA 2JHNA 2HHXA 2JPSA 2E6LA 1R1VA 3QQAA 3M0QA 2VPRA 3GOIA 3T1YK 2P9PA 1B8IB 2KRCA 2EZIA 4DWIA 3BTJA 1UUEA 2LBFB 3LP2A 2E35A 1ZAOA 2L4AA 3CM6A 2DO7A 4PFOA 4IIOA 4HT8A 2E2NA 2NVYJ 1GOCA 4IXAA 1M30A 4C30A 3HC7A 1K9AA 1HD3A 2F7TA 1X69A 1YI2Q 3JTHA 3I55I 2GWJA 4C8QF 3CCUA 4GRIA 1XDSA 3TWHA 1HQEA 1S6PA 4GNIA 2TCTA 4DTPA 4A3IJ 4Z88A 3CMAI 4PLLA 3TTDA 3D2EA 2PFBA 1ZRCA 4E7HA 2JT1A 1YJNT 3F72A 1ZRDA 2E3IA 3RMBA 1HBXG 4DJAA 3O4WA 2HVHA 2X1DA 3AG3H 5IP7J 4CZKA 1U0JA 1RT4A 2A6AA 2E1HA 4DV5K 3CMEA 1Q81C 1KZHA 4L9NA 4XRMA 5CHIA 3JRDA 3OYKA 3FBNB 1NGGA 2OFKA 5GANh 2A40A 4G8XA 4C8OA 3TSZA 4HA8A 2DTIA 1G3WA 1SFUA 2CREA 2QWOA 1YJNN 1B9NA 3CJQB 2O8BB 4WCIA 4KA4A 4LD9K 3MN9A 3PTAA 1UA1A 3RKYA 3B6CA 3HSFA 3J7YJ 3C7NA 1FN7A 4AUXA 2Y1JA 2Q0UA 2L2OA 2KZMA 3MZ8A 1BM9A 3I56A 4HDUA 3CC4I 3OW2A 4C92E 1TBXA 1N25A 1KRPA 2EIKH 1GCPA 2D0NA 4S0HB 4M7DA 1YFHA 2F4MB 3CCMI 1IZ1A 4KH4A 3DLGA 3H1QA 2DYIA 5J3LA 1KXPA 4YTLA 5KQDA 5HLHA 4PCQA 4IQJA 4YNQA 1RL2A 4R0KA 1K9MR 2QXLA 4UVCA 2X6YA 4BGBA 1VQ9Q 3DF8A 1H8KA 1BYMA 4AFSC 1NGHA 3PV8A 3LA3A 5J2QA 4EMGA 2ZCWA 2DL7A 1ZR4A 2GGRA 4KHPK 2E65A 1FK9A 2RQQA 3LANA 1ZGWA 1OOTA 3NGYA 2W04A 3L4QA 4GXOA 3GP8A 3ZQCA 2FPDA 2YU9J 1GFDA 2J6OA 3MK6A 4M7DD 3CCST 3ASMA 3HVTA 5FLVA 4W5QA 2KDOA 3HOVJ 2BV6A 3SV3A 4FVUA 3VYUB 2P81A 5ERIA 1RUNA 1BA5A 4XL9A 3LAPA 1JTXA 1QVGM 1N34K 1RTJA 1ZKGA 1NNEA 5JS1A 4M3BA 1JCFA 1NOYA 2R7FA 3J7AF 1QO0D 1HLUA 1TLHB 1JKQC 1J2XA 3H5RA 3CCSN 1FMKA 1FOKA 1WSHA 1VQ8I 3TEDA 5J40A 2I7NA 1VTNC 1BR2A 2ZXWH 2WONA 5M1QA 2VJ4A 2DA4A 4CEEA 5LJ3e 2UUAK 4YELA 4JN4A 2KE9A 4A3JJ 1MBGA 2IT0A 1A5VA 2XHIA 3QRFF 3FLCO 1LPLA 5CVUA 3IAYA 2M9HA 3KP7A 3K4JA 1S1TA 2Y1IA 1NK2P 1MBEA 3GF5A 1BL3A 2E1OA 4FM2A 3LWMA 1CXUA 3CCLI 3DYAA 5KTQA 2XASA 4Y1CA 1J9AA 4CW7B 4I7FA 4HG2A 3HRSA 2A36A 2P9LA 4A2BA 3THYB 2E2HJ 4EZ9A 2O8FA 1VQON 1FOYA 5KCMA 2B63J 3OMGA 3QNOA 3CLOA 4DOZA 4DV0K 1X1BA 2BH1A 1XN7A 2QEXT 3O6BB 2L3SA 5LGUA 5E79C 5CZ1A 4QIWN 3R2XC 1YQMA 4FK4A 4HT9A 2VKEA 1BR1A 2K7AA 4B1YB 4G6QA 2P0QA 3HFOA 4M75B 2XY5A 1WHGA 4GV6A 4CESA 3QWXX 2E5LK 3JCMV 3CCYA 4C92G 2RGVA 2PLYA 5FU7C 4GVEA 4FX0A 2QEXN 2NNWA 1RBVA 2R7ZJ 4J01A 4LB6B 3PO3J 3L2ZA 4KH1B 3K1PA 5GAN2 3P39A 1VQ7A 1AWXA 5KPRA 1HNXK 1OLTA 1FJGK 4PL6A 3KFVA 3BG5A 4CK3A 2LBFA 4IOAL 4YFKF 2JG6A 4CFDA 2YUSA 1M1KR 3EUKL 3CMEI 1BIUA 3GBTA 4XN0A 1KFDA 2KNBB 3HSBA 3KWGA 5CQXA 1BWFO 3SJHA 2ATCB 4XU1A 3TTCA 2VOPA 4KPYA 1A6QA 3PNYA 4CIFA 4FWOA 3AVAA 1S9HA 5CYMA 4EMKC 4O3MA 4BRHA 5KHDA 2JA7J 1IF1A 2MF2A 4CGFA 1E0EA 1U2WA 3S6WA 5TKYA 2RHKA 2RC4A 1J0RA 1KQSA 1ZQ1A 5DUIA 3W6KB 3CJBA 1V55H 3KP6A 3BW1A 5ILSA 1WWXA 4E7JA 4R5PA 2AXTC 5F1XA 4S04A 2DQRA 1WBDA 2LY2A 1XC9A 1JXEA 4HWIA 3A1YA 4DU3A 3NARA 3WNFA 1GRIA 3DTIA 1D8KA 2ELJA 2CP0A 4C8QB 2HNYA 1EZZB 3OMCA 1OX8A 4DR3K 2L0KA 1RRQA 3OL4A 2R7DA 4BQNA 1SAXA 2NVTJ 2O8BA 3ZR8X 2ZC2A 5FLXO 1I27A 2ZPEB 5AT1B 5IYCJ 1HJOA 1S22A 4EM2A 3TMOA 3DU5A 2Q2RA 3E2UA 1TWCJ 1RAAB 3CPWP 2KMUA 1UJ8A 5HROA 1G3TA 4FLZA 1BI1A 3U9ZA 2VOOA 4HUEA 2VBZA 2NOGA 1EBMA 3CD6T 1IXDA 3JSPA 2RF2A 4D9JA 5BMZA 2NOEA 1S8NA 4KH6A 4XH4A 3QBYA 4KFBA 3L3UA 2HZYA 1FEXA 2KJBA 2A1SA 1AWOA 3NTIA 3DLBA 4XRSA 2E5KA 3QDKA 3CC7A 1CXQA 3KETA 1ABOA 2E4LA 3SHFA 3J80K 2GZWA 2K57A 3ZQFA 5KH6A 3CG7A 2CP3A 2D6FA 2CYZB 3V4GA 4F55A 4A3DJ 1U1TA 4F7UG 3K0LA 4CF2A 1NJXA 4IOCF 2OU2A 4ENNA 5GANg 3AO5A 2XPVA 3O5ZA 2OV7A 3ERED 4LSLA 3KLEA 4UNFA 2XPWA 3HXMA 4ZYDA 3FDRA 2R7OA 3BR6A 2EGCA 1IHVA 2EJ9A 4P55A 4B47A 3P83D 1C0FA 1XMAA 3JV3A 4RG8A 3QPSA 4I0BA 4B1VA 2FXAA 1FYLA 2VJ5A 1VQ5I 2FJ1A 3ZSVA 1XS9A 1YWPA 1SANA 2V1RA 3BEXA 4A63B 4Y0WA 1OYWA 2P9UB 4JKAA 3SPYA 5HRSA 4FJ5A 1VRLA 2O9VA 2A6TA 1WJRA 1W0UA 3HJFA 1SPKA 3LA2A 4FJ9A 2E4HA 3JSMA 1Q7YR 5FFZA 1N39A 4CD3A 2E1CA 3RKXA 1EH7A 2DXBA 5FFXA 2LF8A 2XDBA 3CEYA 2G8VA 3S2WA 2F96A 5JVTA 3KBGA 3UIQA 4CCLA 3DB4A 2FBTA 3QWLA 3EUHC 1NYFA 1SKWA 1TWBA 2DDBA 1KAXA 3EZ5A 2KT8A 3S6IA 1CQTA 5LY3A 1U6ZA 5AIPA 3TO7A 9ATCB 3THYA 4JKDA 1RDCA 1SF9A 1LPQA 1EH8A 2PZSA 2NRHA 1N27A 2GQQA 5AQTA 4KYWA 1Y0UA 2GBZA 4DB3A 1KGSA 4GY5A 2YWWA 2VG7A 3AAFA 1VQ7I 2PQ8A 4LY7A 3F23A 1O3SA 3ZEHA 4OFHA 1T0FA 3FHZA 3TPQA 2OZUA 1XD7A 3KZYA 3OYYA 3T7ZA 4BE1A 4M75A 3KP3A 1YBYA 5C0MA 5FU6B 3MO8A 4ZDPA 4WCGA 4IFVA 2CP2A 2EWSA 2ID3A 4KUIA 4PJOF 4AYBA 3E19A 3CD6Q 2EJRA 1RCHA 2Q1NA 1P7JA 4J6YA 4BC3A 2UUBK 3DFGA 1FIAA 3CLQA 4B9MA 1RZ4A 3A4CA 1Y1WJ 1WXUA 1JCEA 1C1BA 3T19A 3BR3A 1JT6A 3ATVA 4AI5A 4CEOA 2DK5A 3WXLA 2PYLA 3KVGA 4DV1K 3S1QJ 5A2QZ 3F8CA 1OZ2A 2DPDA 1KG3A 1CSKA 4LSNA 5AQRA 2MABA 1NLOC 1VOMA 1NGIA 1YJ9A 2CGKA 2JOYA 1T6DA 4KO0A 3SJJA 2XY8A 3M8SA 4YIFA 3F21A 4M78E 3PNVA 1NKCA 2IVWA 4B3MK 1IDZA 1JJ2M 2G8FA 1ZG5A 3LSGA 4RW7A 4HSRA 2ESWA 4XH5A 3E6BA 3IHUA 1YIJT 3I4NJ 1LEBA 3U8XA 2QWNA 3QZ9B 4FJGA 1PKTA 4FL6A 2BY1A 4Q47A 1F21A 3CFRA 3RMQA 5FKLA 2KDZA 3ZEUB 1D9DA 2HS5A 4RAZA 1W2BP 1MMGA 3VWBA 3DKXA 3RMSA 1QGPA 1VQLQ 1T0JA 3KUFA 4DBQA 4DSIA 3FHFA 4BY9C 2O8CB 2D4WA 4JK8A 3MX2A 4YFXF 3M8EA 5CVRA 3ZYYX 1CLQA 1QSSA 1MDUB 2OTJI 1AOYA 3AA4A 4C8QA 4I01A 4DFPA 1T3SA 4F91B 5BRFA 4DR4K 4KJZA 3CC7I 3URGA 4FYVB 3V9WA 2G8IA 1KG1A 4OMNA 3TAGA 3SEMA 3FX3A 1N8RC 4CIEA 3TSPA 4IJNA 4FM4B 4CBUA 1K9MU 1VQKT 3VGMA 1IV8A 3ZSXA 2V1NA 3ZETB 4BYYA 1MBJA 4EPCA 2ZF5O 2M8GX 5HY6A 2IGIA 3D7EO 4EJTA 3BQZA 3JW4A 5KN8A 1NGAA 1EXQA 4RW6A 3IH7A 4NC8A 4M3RA 1PUFB 4XTYA 1H641 3HRMA 3I9V2 4FJLA 2NRAC 4IWVA 3RDVA 2XO7A 1ILYA 2P9NB 4B09A 2XHBA 1X1AA 3MWMA 1VQKN 4C8QD 5KQ8A 4BHPA 2L02A 4Q48A 3ZBDA 5HK0A 3K5OA 3I5RA 1R22A 2FQ4A 2DERA 1RILA 2P4RA 5K5RA 1YITI 2RI5A 2ZFWA 2RI3A 3ZT1A 2RM4A 1GLNA 1N3CA 4UY8O 3H3UA 4ZYHA 2XPUA 1TK8A 4QS7A 1V54H 4LMYA 3DLMA 1W97L 2JK3A 2A5YB 3BQYA 2DMOA 2M2EA 4LJZF 4DFJA 4FYYB 3G6ET 1RACB 1WEFA 1W7AA 4CZGA 3JSCA 2ROTA 5M5YJ 1ZUYA 2MOXA 2LKPA 3FZVA 4AIAA 4G6TB 1TV6A 1YUWA 3SYZA 2WBMA 1VQ4Q 4NCGA 1JGGA 3PVLA 3B73A 5CKBA 3ZMZA 3C1DA 4CC7A 3ZMSA 4BRLA 3LX7A 3GTOJ 5C25A 1HXDA 3CO7C 1QCFA 3NVKA 3FZLA 5KPTA 3V6DA 2G8WA 2P9UA 4NXNK 3CCQA 2KY9A 1TUDA 1J54A 3G6EN 3VYGA 1ASUA 2DZ9A 3S1RJ 3D0SA 4DTRA 3G1JA 2OYQA 1YHQA 1IRZA 5JLXA 4OMZA 1V4RA 4PKCC 4XOPA 1BQMA 2P9IB 3MN7A 1R49A 3QIPA 3CUQB 4QVZA 4XTVA 2KSSA 1B72A 4CIGA 1ZGJA 2OUMA 3LPUA 1YIJQ 4YRVA 3GLLA 3JRHA 1DPRA 1N77A 4KB1A 5A2QE 1B59A 4FLXA 2BVMA 5HLFA 1ZELA 4MTEA 1W1FA 3TAFA 4B9WA 3MD2A 5E8GA 1GUUA 4DTUA 2AT1B 3KYCB 3CJAA 1X4OA 1MUYA 4B3TK 2GM4A 4KH0B 3IMXA 1OFCX 1E3OC 1NJWA 2PY5A 2YI1A 3LM9A 3IWZA 1QVTA 5J4YA 2LDMA 4C92F 2J6KA 3QYEA 4I9LA 4JJCA 3MCZA 1T6CA 2M1HA 2COWA 2PTKA 4M42A 4AFUC 4P96A 2RQPA 4LUEA 4RTUA 4CJ5A 5FRNA 2QK0A 4MZMA 4PL8A 1XCVA 1N6AA 2Z33A 1QCOA 3WGGA 5D8KB 3I4PA 2LC2A 4M3FA 2E1NA 1EKEA 2ZKZA 2HBKA 2ZM6K 4FLWA 4C8LA 1M1KU 2FO0A 5LJ3h 3J80O 4Y15A 2X1EA 3V1RA 5AQWA 1R7JA 3PNWC 1FW6A 3LGFA 3VQPA 2YJFA 2DPPB 3HBLA 3CTAA 2X9DA 1FKOA 1RKTA 2QWPA 4C8KA 4GYIA 2Q8KA 2DTRA 1EQYA 2K9MA 1DU6A 1X3ZB 5D5WB 3M54A 4M3WA 2LRQA 4CO8A 3VYSB 5GAEJ 3RBBB 2F9TA 3LDPA 3DLKA 2CUZA 3CWAA 3GFMA 2QQ8A 4PJOB 3FISA 2JUFA 1VYUA 4WYBA 2CFOA 1OKJA 1VQNT 3C6TA 7AT1B 4NUBA 2WAFA 4DSFA 2O8EA 2PU9B 2A07F 1ZUUA 1D8YA 1IGNA 2BZXA 3EYZA 2YUPA 3N4QA 1OISA 2QW9A 3R0AA 3W2WA 1UWBA 1HLVA 1TUGB 4XORA 5EZGA 4DEXA 3ZEUA 3PX4A 4PL7A 2X4WA 3VQCA 5CO7A 1IDYA 3ITHA 2GCXA 4CZFA 4J19A 4I2OA 3K57A 2O8CA 3R8EA 1VQNN 2X85A 2A41A 5DM6L 3O1WA 3TP3A 4ISGA 2EH3A 4HYEA 3IKVA 2DODA 3L1PA 2RF0A 1HSTA 2AP1A 1RT3A 4LD5A 4CHQA 3MEDA 1LVAA 2XSDC 1T44A 2HHVA 4BRDA 1AWCA 4WFNL 2D5VA 3SAHA 3KCCA 2NNNA 3PY8A 5FJ8J 3HZ6A 1GLEG 2BYVE 2JSCA 3QEVA 1EV7A 2CYYA 2GUPA 1U49A 1ZR2A 4ISEA 2NOJB 3ZETA 1QKWA 2QM3A 4CCNA 1UHMA 2V1DA 2VKHA 5JS2A 5IHIA 4B1UB 1IH7A 1YCSB 3D1NI 2YCHA 4E47A 1OR7A 4A3BJ 3EO3A 1PUFA 2LVSA 4LDWA 4OFEA 1UHSA 3LALA 1IBMK 4EA5A 2SRCA 3L7WA 2QWLA 2ZSIB 3TQ7P 3M7GA 4U87A 3CPFA 2K2MA 1JXMA 1N75A 2MLKA 3V7SA 2OTLT 1DLOA 5AFUA 1JUSA 4IUTA 3DXJF 4KREA 2O9LA 2P9SB 3E9OA 1OU8A 4J8OA 4FWNA 1O3QA 3LLRA 1S72Q 4M7AG 4L0ZB 4JYAK 2GXGA 4OMFB 2W85A 3L2QA 2VQGA 3VS6A 5LGNA 3V9SA 1M2OA 3JXUA 4G7HF 2NOLA 1RETA 2NXNB 4QKUA 3VYRB 3QICA 1TUCA 2IAIA 2RQWA 3WTSC 2OTLN 3SDZA 1QPIA 3KLIA 2MSYA 4B4CA 5AZJB 2PYJA 1Q7YU 3NEUA 2CRGA 2QWQA 3PL8A 5J3BA 3DU6A 4XLAA 3HOZJ 3GTQJ 4RGXA 4CJKA 5M1KA 5B5EC 5IT9Z 1KYWA 4XLEA 2E60A 3HKZA 4JX6A 4CGZA 2LQNA 3QAHA 3VQEA 1RBTA 4BEHB 2RK1A 2W10A 4XIDA 2BW3B 2RJCA 4IG3A 5GP9A 2E6ZA 2F5KA 4AHVA 2IS6A 2CGHA 2P9IA 5HS9A 3CUQA 3VQ6A 3JCMc 2P7VB 4XSXF 4M77C 1O9SA 1M2VB 1YJWQ 3NQOA 1PWTA 1MKMA 1UGSB 1M90R 4ASNA 2DA1A 1XC5A 2E6NA 4CCJA 4I0AA 1XNQK 1TWGJ 1HQUA 1IZ6A 2OC6A 2EB7A 2VWBA 4JKEA 3CCRT 1AD5A 4Q5VA 3S17J 3H08A 3LQRA 1JL1A 4D6WA 2PZ1A 1T56A 1JLEA 2KDSA 2YDLA 1Z1DA 2DTOA 3T5XA 4XSZF 1QA6A 4B9UA 1KO9A 4FHTA 5M5XJ 4FWMA 3O3HA 4OX9K 2ESNA 1G83A 3GMEA 1VHXA 3S41A 5FPNA 3ZQ7A 1IRXA 2A28A 4RTZA 1B4AA 2H6CA 2HR3A 1PVEA 2XMFA 2QXFA 3F8NA 2MMPA 3OYDA