3OYYA

Structure of pseudomonas aeruginosa elongation factor p
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
189
structure length
187
Chain Sequence
MASMKTAQEFRAGQVANINGAPWVIQKAEFNKSGRNAAVVKMKLKNLLTGAGTETVFKADDKLEPIILDRKEVTYSYFADPLYVFMDSEFNQYEIEKDDLEGVLTFIEDGMTDICEAVFYNDKVISVELPTTIVRQIAYTEPAVRGDTSVMKTARLNNGAELQVSAFCEIGDSIEIDTRTGEYKSRV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Elongation factor P
publication title Crystal structure of elongation factor P from Pseudomonas aeruginosa at 1.75 A resolution
doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Translation
total genus 32
structure length 187
sequence length 189
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-09-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01132 EFP Elongation factor P (EF-P) OB domain
A PF08207 EFP_N Elongation factor P (EF-P) KOW-like domain
A PF09285 Elong-fact-P_C Elongation factor P, C-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.30 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3oyyA01
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3oyyA02
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3oyyA03
3HOVG 4GN3B 1VQMT 2OQKA 3KJPA 1PH8A 5JEAJ 3STBD 4K0KL 4LFAQ 1E1TA 1UE6A 1YBYA 1YHBA 1UEBA 1M1KC 2K5NA 3EIVA 4JI8L 3CC7A 5IYCH 4AQYL 2UUCQ 3S17H 2JA9A 4O0AA 4DV2L 1XMOL 1QUQA 4GKJQ 4YWLA 4FDBA 3A0JA 4OWTB 4GNXA 4JBWA 1JJGA 3CC2A 2ZM6Q 2KHJA 4LF6Q 3S14H 2VW9A 2AWNA 4JI1L 1VQ8A 3E9HA 1YJ9A 4GNXB 2E5LQ 1OXXK 2AKWB 4QGUA 2C35B 1DGSA 3J80E 4APVA 1KRSA 2VZAA 3RZDH 3M3YH 2JUFA 4YCVA 1MJEA 4LWCA 4DV3Q 1L0WA 1VQPA 4YY3L 2N49A 3CF5A 3S1RH 2Q2UA 3OTOQ 2YU9H 4LF4Q 2A19A 5M3FH 3PO3H 4ALPA 2F4VL 1SROA 1ASZA 2QA4T 4DK3C 1Y1VG 4HIOA 3G6ET 2K52A 3PIPA 1YZ6A 2ALYB 5C3EH 3T1YL 5FJ8H 1Y1WG 3HFZB 2E2IH 1XNRQ 3F2BA 3I55T 1L1OA 4HJ9A 2UXCQ 3EN2A 5HY6A 1HNWL 3CCET 4A3CG 1VQGA 1KXLA 1L1OB 1VQ7A 1EIYB 5H1SE 5FLXc 4X34A 1LM0A 1XMQQ 4OWXB 1I94Q 3AFQA 5AJ3Q 1VQ6T 2UUBQ 1EQRA 4EQ5A 1FJGL 2A8VA 3TS0A 4DR4Q 2R92G 4LFBL 4QQBX 2K5HA 3UDIA 1VQ4A 4DUZQ 1R9TH 1K83H 1GM5A 2BH8A 2HQLA 4LUVA 3MEFA 4QY7A 3M85A 1N33L 4X66L 4GOPC 4JBMA 1VQAA 3ULPA 4R1JA 1U5KA 4JI0Q 4JBJA 2JA8H 2GVAA 3AEVA 1NMFA 4A3FH 3PF4A 1MJCA 4JC0A 4B3TQ 3ER0A 1L2FA 2ZTEA 2R93H 2N78A 4YCWA 3LGJA 3NELA 4LF9L 3CPFA 1HNZL 1N36L 1YI2A 4RG2A 1VQNT 4IPDA 3CMAT 4R4IA 3G4ST 2MFIA 2UXDQ 3NENA 1Q12A 4DV0Q 3CCRT 3J7ZC 4DR1Q 4IOAA 1X9NA 4JI7L 4WJ3M 5LMUQ 2ZJPA 4DR7L 1OXUA 1Q7YC 2MI6A 4H02A 4OONA 5M3MG 4JI8Q 4C3JH 5GROA 1K73U 4A3IH 1NZ9A 1IBMQ 3JAME 4POFA 5M3FG 3G71A 3PO3G 3CCLT 3OW2A 2F52A 3TQYA 3I4MG 3M7NA 3A5UA 4B3RQ 4R4QA 5BR8Q 4GLVB 3H3VI 1WOCA 5FJ8G 3U4ZA 1IYJB 2IHFA 2JVVA 3CCQT 1TWHH 5C0XJ 1YHQT 1KIXA 1PFSA 5IWAQ 1K8GA 3RLFA 1YIJA 1Q1BA 1VQJA 5IT9c 3S16H 2LQ8A 1VQOT 2HIVA 2VQEL 5A2QE 1CKOA 1IXRA 1YVCA 3CCVA 4Y7NH 3HOWH 4AIMA 1N34Q 3ICEA 1B70B 3NEMA 1VQLT 1X55A 3S1QH 4JV5L 2YTYA 1E1OA 4DV7Q 5FLMH 1XTDA 2YTXA 4A3KH 4A3BH 1D8LA 1M90C 2EXDA 3WWVA 1C0AA 1A0IA 3CXCA 4A76A 1TWAH 2K4KA 2UXBQ 1IBLL 1IBKQ 1HR0Q 1G6PA 5J26A 2RHQB 4LF8Q 1PV4A 1JJ2S 4GS3A 1G51A 5C4JH 2ZTCA 1PH5A 3FP9A 1Q81C 3H0GH 4PG3A 4LF5Q 3S1NH 4UP7A 4DAMA 2VS1A 2ZJQA 2MO1A 3I2ZA 4BY1H 4RMFA 4YHHQ 3TS2A 2R93G 4DR6Q 1VQFA 1O7IA 4JI2Q 4WJ4A 1I50H 2WP8J 3RLNA 1VQ5T 2G3RA 4IOCA 3PUZA 4LFCL 1S72A 1FL0A 4LW1A 1SN8A 1QVGA 2JJQA 4QL5A 1PYBA 1J5EQ 1X54A 3RNUA 5C4XH 4A3LH 4PZ7A 3J80i 3U58A 2JEAI 2MWPA 1YNXA 2IT1A 3CC7T 2QEXA 3CMEA 1MIUA 3E0EA 3I4OA 3STBC 1HNZQ 1QVFS 4A3IG 4B3SL 2Y0SE 2A1AA 2K75A 2PQAB 1KRTA 1RIPA 3HOXG 3I56A 1XPRA 3I4NH 3CCMT 2AMCB 1T9HA 3PIOA 2AHOB 2LXJA 1HNXQ 3I4NG 4B3ML 1VQ8T 2CFMA 4DNIA 4JYAQ 1XPUA 3RLOA 2VQFQ 3HOZG 2OQ0A 1AE2A 1QUQB 1KAWA 3AYHB 3K7UC 3UDFA 5C44H 2BH2A 1VQPT 4P74A 2E8GA 3A74A 3CCUA 3HOWG 1N32Q 4JI3Q 4GN4B 5FLMG 3D31A 4DR5L 4A3BG 3M4QA 3CD6A 1UE1A 3HOYH 4NXNL 2KHIA 3H15A 1NMGA 2JK8A 3UE0A 3GTOH 1PH2A 3S2HH 2EQSA 3DM3A 1VQMA 3J81c 4DV6Q 4TVAB 4HJAA 4A4IA 2UUAQ 2DO3A 1I6HH 1A62A 2AWOA 1KQSA 2Z6KC 1YEZA 1Q7YU 3E9IA 4X65L 2JA5H 3L2PA 4JI6L 4BBSH 1K3RA 1YITA 3H0GG 4JI4Q 2CQOA 1VQ7T 2YV5A 4X64Q 4NXML 2F3IA 3CPWS 4KHPQ 4BY1G 4AYBE 3K80C 4R4OA 1Q8KA 2WFWA 1JB7A 1LTLA 2L15A 3KJOA 3FHWA 2HHHL 3UDGA 2JA6G 1X6OA 2VY3A 3BU2A 4POGA 1MKHA 3GTLH 4X6AH 2JQOA 3PO2H 3DLLA 1TWCH 4JI5L 1LUZA 1YJNT 2R7FA 4RG1A 2IG0A 4BBRH 4DV5Q 1EQQA 1TXYA 2E6ZA 2I5HA 1JMCA 1B7YB 2PMZE 1QZHA 2VUMH 4JOIA 1QZGA 1EYGA 4IFDJ 4OX9Q 4DV4Q 4A3DG 4X62L 4A3GG 4AH6A 1HJPA 4A3LG 5C4XG 1VQCA 4OO1G 2OTLA 1CKMA 1VS0A 4DUYL 4LF7Q 1YJWA 3JAMi 4B3MQ 3ULLA 3G6EA 4DV1L 5DLQE 2RCNA 2RHSB 3S15H 1M90U 1V43A 4UP8A 2YTVA 2JOYA 2IX0A 3ERSX 5HGQA 3I55A 1WJJA 2KCTA 1QVCA 5IYCG 5IP9H 2UU9L 5IAYA 4GLAC 4DR3Q 4J15A 3CCEA 4R4TA 5JJLA 1GD7A 5DM7R 4GKKQ 3LGFA 4DR2L 4TQUS 1HZBA 3CCJA 2LVMA 1CUKA 1Q81U 1SRUA 1H95A 2YYZA 4TVRA 5C44G 4B3SQ 4A93H 5GAEC 4IPGA 3SGIA 1BBUA 3G71T 1UE7A 1RL2A 3L7ZC 4P72A 4PZ8A 3CCSA 4AQYQ 2ASBA 5GAHC 3J81E 2CWPA 4LUZA 2Y0SG 4DV2Q 1XMOQ 2NVTH 3HOYG 2N3SA 4HIKA 3BZKA 2E2HH 1L1OC 3HOUH 5IYBH 2B63H 4HIMA 4P71A 4JI1Q 1XNIA 3KBGA 2D0PA 1WYDA 1YIJT 3K0XA 4KLKA 2I5LX 5EAYA 5C3EG 2JA5G 4LFAL 1HZ9A 2UUCL 1EFWA 5FLXE 2DUDA 4L5QA 1WCMH 2B3GA 1Q82C 4GKJL 1GVPA 3IRBA 4YY3Q 2GN5A 1C9OA 3G4SA 1W3SA 2NN6G 1NPRA 2D0OA 3KYHC 4UY8C 4HIDA 1XNQL 2ZM6L 2F4VQ 4LF6L 3U50C 1JT8A 2MNAA 3PO2G 3K81C 1XJVA 4BBRG 3T1YQ 2Q2TA 2MQHA 2E5LL 1NTGA 1E7ZA 3BJUA 2VUMG 1CKNA 3M4PA 4HJ5A 5LMNL 2CKZB 4IPCA 2JA7H 1HNWQ 3B6YA 4LNQA 4A93G 4DV3L 2VNUD 4L5RC 4LF4L 3W1GA 1XPOA 3CCLA 2JA8G 4YWKA 1CKNB 3HKSA 1HH2P 2IHEA 4A3FG 1W2BA 5JEAG 2XTIA 1FJGQ 2K5VA 1HZAA 4LFBQ 1E24A 3CCQA 1VQ9A 5K36G 1S72T 1YHQA 5IP9G 2UXCL 3KFUA 3GO5A 1N33Q 3JC66 4MZ9A 4X66Q 4EX5A 4ZN3A 2BA0A 5M5XH 2I0QA 1N8RC 3W5OA 3RR5A 1VQIA 1VQLA 3KF8B 3PUWA 2QEXT 3CMET 4O2DA 1Y1VH 2K50A 4C3IH 1XMQL 5AJ3L 1I94L 2UUBL 4DR4L 3KDFA 4OO1I 1Y1WH 3GTPH 4BY7H 4P73A 1NJIC 1OXVA 2PNHA 4DUZL 4LF9Q 1N36Q 2WB1E 1X3EA 3HOUG 3KDFB 1X65A 4A3CH 2D62A 2JE6I 4LUOA 1EIFA 3LGLA 4C3HH 3CC2T 3HKZE 1Q86C 2GVBA 4NB3A 1SMXA 3PGZA 3UE1A 4JI0L 2ATWA 2OTJA 4JI7Q 3CP0A 3GTKH 1A63A 5IY0A 1K9MC 4DAYB 4DR7Q 5IT9E 5E7NA 4B3TL 1YJ9T 3UDXA 3CCUT 4IO9A 2NZHA 4YCUA 2K14A 1VQDA 4BXXH 4QJFA 2QGQA 1P16A 3CD6T 4OXPA 1WI5A 1VQKA 2OWOA 1PH1A 2UXDL 4DV0L 3A5ZB 5LMNW 3J7AF 3L0OA 5LL6S 4QQDA 1KC8C 1V1QA 3AFPA 3G48A 4P75A 5IP7H 5ELNA 3ULJA 5LMUL 4HJ8A 4GOPA 4A3KG 2R92H 4GN5A 5IE8A 4UP9A 3CC4A 3MXNB 4BA1I 1M1GA 1YITT 4IFDG 2XGTA 3F2CA 4MTNA 2JA7G 1G291 4R4CA 3OW2S 4L5SA 4GNXC 1Y14B 3T1HL 3PF5A 4GOPB 2VL6A 2VQEQ 2CCZA 3CW2C 1IBML 4JG2A 1S40A 1GO3E 1XNQQ 4JV5Q 4B3RL 3CCMA 1FVIA 1C7YA 1PH6A 3P8BB 1VCIA 3KF6A 3LH0A 5BR8L 5GAGC 3S1MH 2OCEA 2NN6I 2IY5B 1I3QH 2NVYH 4DK6C 1Q46A 2IX1A 4UPAA 1S3OA 4GKKL 4XIGS 5M3MH 1VQ4T 2MO0A 4IPHA 3KF6B 5IWAL 1KD1C 5LMNQ 1K8AC 2EIFA 1IBLQ 2I5MX 3GTQH 3M4OH 3K8AA 4IJHA 1SLJA 1N9WA 2OTLT 1PH7A 1N34L 3I4MH 3S24A 3CAMA 1YJWT 1EOVA 4DV7L 1YHAA 1U0LA 4YTLA 1Q82U 1JJ2A 4HJ7A 5JJKA 3CXCS 3D0FA 3JAMc 1OXTA 5GQOA 3RZOH 4BY7G 3NBHB 2KCMA 4A75A 2RF4A 3J81i 4JBKA 3F2DA 1CSPA 2HT1A 2QA4A 3F1ZA 3S2DH 3PCOB 2UXBL 1YI2T 1IBKL 1HR0L 3RN2A 1PH4A 1W2BS 4LF8L 3W1BA 4C2MH 4A3JH 3CCJT 1ASYA 4LF5L 4LFCQ 3TEHB 3I7FA 4QIWE 1OTCA 1SFOH 3GDEA 1EUJA 2MWOA 4YHHL 2WAQE 5C0XG 4DR6L 4ME3A 5IYDH 4JI2L 4BXXG 3CCST 3J81j 1HZCA 4K0KQ 2E70A 2FXQA 2V1CC 3PUVA 1VQ6A 1QVGS 1YJNA 4A3MH 1VQHA 2CKKA 2XHCA 5M5WH 2R7ZH 1TWFH 5GADC 1QVFA 1SE8A 2WB1G 5IP7G 2NZOA 1UWVA 5J3BA 2Q2IA 2JNGA 3Q8DA 4KHZA 2KENA 1J5EL 1X3FA 2PI2E 2LSSA 1IL2A 3HKZG 1N8RU 4GLXA 1JJCB 2DGYA 1KL9A 2HIXA 1Q1EA 3VDYA 3GTMH 2KVQG 4BBSG 1NE3A 3FKIH 3CCVT 1WFQA 4XTCS 1LYLA 1NJIU 3ZJYC 4A3EH 1PH9A 4PZ6A 1GKHA 1V9PA 2ZTDA 1VQNA 4KI0A 4DR5Q 1HNXL 5JJIA 3OYYA 5ELOA 3CMAA 2JEBI 4NXNQ 4JYAL 1D7QA 3CCRA 4ZN1A 1Q86U 3EBEA 3HOVH 1Z9FA 4JOIC 1TWGH 3PSIA 2VQFL 2PI2A 1K9MU 3T1HQ 1NPPA 4X65Q 1N32L 2B29A 1VQBA 3M9BA 4JI6Q 4JI3L 1E3PA 3HOXH 4IFDI 5M5YH 4NXMQ 2ES2A 4JCVE 1HR0W 1X3GA 4PMWA 1PH3A 1PYSB 2KBNA 3OTOL 2HHHQ 3H3VH 1AH9A 4NPSA 1VQ9T 3CPWA 1KQSS 1BBWA 1OXSC 4CRIA 1CSQA 2Z0SA 2N8NA 1KC8U 4AYBG 2H5XA 4DV6L 2UUAL 2LCLA 1I5FA 3PV0A 4JI5Q 2CWAA 3HOZH 3BZCA 3KOJA 3PUYA 4A3JG 1PHJA 3DB3A 1B8AA 1XNRL 1NBWA 4DPGA 4JI4L 1M1KU 2ID0A 4MNOA 4X64L 3F8TA 3AQQA 4KHPL 4X62Q 1VQOA 2R7DA 5IYDG 3U4VA 4DKAC 1BKBA 3TRZA 3DB4A 1PA6A 4Y52H 1PVOA 3J80c 3GD7A 1IZ6A 4DUYQ 1SSFA 4YWMA 1SR3A 1KHIA 4DV1Q 4A3MG 4BA2I 1VQEA 4DV5L 2R7ZG 2KDSA 3J7A5 4IJLA 2UU9Q 3I56T 2LXKA 2NVXH 1E22A 3GTJH 2OTJT 1KD1U 4OX9L 1K8AU 1JE5A 4DV4L 1UE5A 2Z6KA 1FGUA 2Q2HA 1P8LA 2E2JH 4DR2Q 3TREA 5IYBG 2B63G 1J6QA 2JA6H 3PUXA 4LF7L 3GTGH 1EWIA 4OWWB 2L3RA 1X56A 1NY4A 2ZJRA 1K73C 1A8VA 2WAQG 1BVSA 3FKIG 1AE3A 1Z47A 4L5TA 5C0XI 1VQKT 4A3EG 4DR1L 4DR3L 1WCMG 2NVQH 4A3DH 2BA1A 3KLWA 3CQZH 3K7AH 1K0RA 1VQ5A 3CC4T 2PQAA 3RN5A 4A3GH 2R6GA
chains in the Genus database with same CATH superfamily
5COYA 4GN3B 3IAYA 1VQMT 3FDRA 1FMWA 1VQ5Q 4A3GB 1ET9A 2QF7A 4R56A 2XSCA 2HQXA 4HMIA 3BE3A 2EYLA 5I2XA 1E1TA 1YHBA 2LJ0A 2RF0A 4FSXA 3RUXA 1M1KC 3K5LA 3OYNA 5GAMe 4P5NA 3NTKA 1E0BA 4OWTB 1WTOA 3CC2A 2D9UA 4FVMA 3E3XA 4LF6Q 4K2LA 1PCXA 1DM0B 4JI1L 1VQ8A 5IODA 1GUGA 2HAXA 4RKLA 2DBMA 3NMZC 2L9HA 2E4HA 1RKNA 2AKWB 3KXTA 4QGUA 4APVA 1EIHA 3VV0A 3RZDH 5I21A 1MJEA 4E7IA 4LWCA 1I3QB 4RGNA 1L0WA 1VQPA 3D6CA 5IGCA 4DV3Q 4FXKC 2J4XA 5M3FH 4I7ZC 3M3YB 4CJ1B 4LAAA 1I4QA 3FJ5A 3JCMW 3EG3A 1Y1VG 1R0CB 2E76C 4FF1A 2XG8D 4HIOA 3UT1A 3G6ET 2EYFA 2K52A 1Y1WG 1JQYD 3MEWA 3I4MB 4ZUJA 2HDAA 2RVLA 2UXCQ 3EN2A 1STAA 2E2IB 1NSNS 5EKIA 1KABA 2ZPBB 1JICA 1Q86R 3OSOA 1RABB 2DL8A 3NP8A 5CR3A 3A56A 1VQ7A 2O2OA 3LWEA 1EY7A 3ERQA 4C5HA 1G6ZA 5LJ5j 2C06A 2EJFA 1FJGL 4C92D 1ESRA 1GFCA 2LNVA 4ZRZA 3VRZA 4M75G 3V2TA 1I5OB 1FX7A 1TUGB 2EAYA 2LRQA 3F70A 3M9QA 2LC4A 3BYTB 4QQBX 1R9TH 2DMOA 1GM5A 3NE5B 2HQLA 2CP2A 4L8JA 2F0LA 2FMCA 3HZXA 2M2LA 5CQXA 3FRPB 2VUBA 4KRTA 1U5KA 3OHXC 1RHPA 2GVAA 5GMKm 1QCBD 2DLPA 2EQIA 1L2FA 1WQWA 2JA8B 3E1SA 1UAPA 3A98A 3LGJA 4LF9L 3CPFA 3EG1A 1NAPA 1N36L 4RG2A 5GAN3 1DONA 2R93B 2F0MA 2XICA 2HCCA 4RTZA 3DXJC 2N88A 3CCRT 2XDBA 1B4OA 5KGUA 3WVEB 4DR7L 3CCJQ 4XU3A 1UNSA 1Q7YC 4H02A 3SHWA 1B44D 1U4PA 4C3JH 4WF2A 2G6FX 1K8AR 3GQBA 2K05A 1K73U 2RA2A 4DF7A 4A3IH 1AZPA 4A63B 2DEUA 5M3FG 5C6SA 4LD6A 1UB4A 3TZDA 1O75A 3CXCP 1O7YA 4FYDA 3JB9J 2JVVA 3CCQT 1J8IA 4FF4A 3AMUA 2NUPB 2F03A 4ANJA 1X3QA 1NG2A 2YWWA 1VQJA 2PZTA 4WTOB 2LQ8A 1VQOT 2HIVA 5A2QE 1VMCA 2NTTA 1GBRA 2CHBD 1VQLT 3OSSC 4K2KA 4O42A 3HOZB 1E1OA 2ZZDA 1X3PA 2PNRC 1STEA 2YTXA 3HOWB 8ATCB 3MA2B 3L2VA 5FRMA 4R9WA 2KXDA 4BY6C 4A54A 2QQ9A 4C92E 1TWAH 1IBKQ 2RJDA 5J26A 4PLIA 2RHQB 3A8JE 4LF8Q 4GS3A 2ROTA 4AFUC 2ZTCA 1PH5A 5GAOl 2H8HA 4DAMA 2ED1A 5CIUA 2ZJQA 3HRTA 4BY1H 3H8ZA 4M7AE 4RMFA 1EEFD 3K5NA 4PJOD 1VQFA 5IXFA 1SPKA 4K6DA 2XDPA 3L1AA 3QB3A 1FD7D 1Y71A 1DJRD 3WOFA 5CKHA 4RUGA 2HBPA 3BDUA 3DM1A 4C0FA 4N8FA 2KI7A 1DXMA 2QQBA 4LW1A 5G3LF 3UI2A 2LQKA 1PYBA 2MJ8A 2PU9B 1S72Q 1EQTA 5HGTA 4KY6A 1T0HA 2F1LA 3VYUA 3RNUA 2DD4A 1GHJA 4WJWA 3J80i 5CKEA 3Q23A 2DTOA 2EBPA 5GMKh 2JEAI 4OO1H 2MWPA 1U4MA 2WIIB 2QG9B 1BXTA 1X32A 5TSSA 3RKYA 4PK4A 2RM4A 4A3IG 2Y0SE 1KRTA 1RIPA 2QEXQ 3HOXG 4HN7A 1U4LA 5D6WA 4QUCA 1XPRA 1BF4A 1T9HA 3I4NH 3OBWA 2R58A 2NWMA 1T3SA 2CFMA 3K5MA 5NUCA 4VUBA 4CDDC 4E6IA 5J39A 3VYHB 2AK5A 4RH6A 5C0XH 2B2WA 5KE3A 2OQ0A 1B3AA 1QUQB 2BH2A 2ZPHB 3OYMA 2OX7A 3E0JA 5JVH3 1AZQA 1LCKA 3HTRA 4JW0A 5C44B 5T1IA 4GN4B 1LTTD 3RMQA 3CCUQ 1LT6D 1TT2A 4NXNL 2NUCA 2Z8LA 1NMGA 4EIKA 2RN8A 3HFNA 4OMNA 3H15A 2JP1A 4XXEA 2EQUA 2EQSA 3J81c 2JSOA 2SEMA 5L37A 4HJAA 1NM7A 4FW1A 1A62A 3WDNA 2YU9B 1QLYA 4PJJA 1Q7YU 2IWHA 2DZ9A 5KCOA 2F3WA 4CBVA 1PSEA 2AIRB 1LT3D 2JA5B 1I6HB 1PKTA 4BY1G 1JB7A 1VYUA 4M75C 2L15A 2NN6H 2JA6G 3DEPA 1G8ZD 3BU2A 4JJCA 4OMPA 2IW3A 2JQOA 2DL4A 3DLLA 4PJOE 1TWCH 1IKMA 2IG0A 1SNMA 4QMGA 1JMCA 1B7YB 1SG5A 2PMZE 4V190 1F1BB 4C92G 4FP5D 1FNWA 3PO2B 4C5EA 1X2QA 3MEUA 1PRTB 4BBRB 2Q8TA 1H9RA 3X26B 4OO1G 3X24B 1F2LA 3FVQA 2F0NA 2L3PA 3EG2A 4LDUA 4LF7Q 1H9SB 3JAMi 5KYXA 3HRUA 2OTLQ 4LK1C 5JEAH 4B3MQ 2RCNA 4ZQ3A 2QA4Q 4GNXC 3I4NG 5HGQA 1EFNA 1ILPA 1QVCA 4A3FB 1OX8A 5IAYA 4DR3Q 1EZ8A 4IN3A 4FU6A 3CCEA 2A68D 3NPFA 1GD7A 1C1AA 4B9XA 3LGFA 1M9SA 1CUKA 4RAUC 5LJ5f 5GAEC 1E7OA 2B8FA 1X01A 3PMTA 3MHXA 3G71T 1RL2A 4AQYQ 2RK1A 3J81E 4L6V5 4LUZA 4DV2Q 2Y0SG 1XMOQ 4A93B 2N3SA 3E9FA 4IQZA 3G7LA 1C48A 2VB2X 1XTCD 1D1BA 3HOUH 1AWWA 1OO9B 5IYBH 2B63H 4IUQA 4P71A 1B34A 1XNIA 5EQ0A 1YIJT 2K2VA 1KQ2A 4DAVA 1OPLA 1EYAA 2H4OA 4OB2B 5LHY1 4LFAL 2UUCL 2FHTA 2DUDA 1AZGB 2X51A 2DIGA 3TBIB 5KYWA 4K5VA 2VC8A 2ECZA 3MEAA 1W3SA 1NPRA 2NN6G 4UY8C 2PVDB 3HRZC 2F4VQ 3U50C 4FXGC 1U8RA 1HTLD 1EIGA 1FWZA 4BI8B 3EG9B 1TS5A 3QSUA 2F0JA 1NR2A 1CKNA 4N4HA 3S3OA 2CKZB 1CA5A 4S3SA 1BI3A 2BTTA 2EYQA 4LNQA 4KUDK 2VNUD 3DWPA 3QHSA 1KDAA 2ZXPA 4JS4A 2IHEA 1HH2P 4C1NI 5C4ZA 2KR3A 4FNFA 2JA7B 5JEAG 1IXDA 1CZWA 1RI0A 2K5VA 4LFBQ 1E24A 2HQHA 3S1NB 3ULRB 1YHQA 2M9UA 4E7HA 4F04B 1B9NA 4C0DC 1JB0E 9ATCB 1KFZA 4PJOG 1CK1A 3K59A 1YNJC 4MZ9A 1N33Q 2EY2A 1MHWC 4FXDA 2DXCA 2X9HA 3W5OA 3LWHA 1VQIA 4XTVA 3RR5A 3KF8B 2A6HD 2PW5A 1XMQL 3GP7A 2YT6A 1RDPD 3KDFA 2RBMA 2GNCA 1XYIA 1OXVA 2KEAA 3EJIA 4JS5A 3TP8A 4AFSC 4DAYA 1X3EA 3VYGA 1TKWB 3LGLA 3F2UA 3HKZE 1Q86C 3HOUG 3DWQA 3PGZA 4NB3A 3S2DB 1BI1A 2EQJA 3A8GB 3MXGA 5IT9E 1LACA 2D5DA 4B3TL 1BOSA 5CBEE 4JPBW 4QVZA 1O7LA 1R4PB 1K0XA 4NP5A 3VR5A 5D3IB 1MUZA 4QJFA 2EFIA 3CD6T 1JRIA 4EMGA 1WI5A 3EVQA 1VQKA 4PNYA 2EQKA 2RI3A 3MXNA 3GBQA 3A8OB 3A5ZB 2PQEA 2VXEA 2WACA 1Y96B 2J6KA 4M7DD 3G48A 2A7YA 3I9QA 1B1ZA 4RMOA 1QQJA 3R6NA 4M78B 1ZHIA 1YITT 2WB1B 2VGMA 4KY5A 2XGTA 3F2CA 3QOLA 2RHZA 2FZGB 1G291 2COWA 1VA7A 5CMDA 2VQEQ 1JORA 5E4WC 1F9QA 1TS3A 3S2HB 1I4XA 1EY5A 3SK5A 4B3RL 4CC7A 1FVIA 4J6YA 2V8IA 2C0OA 5LJ3g 4BWGB 7AT1B 1HPCA 5GAGC 2OCEA 4XQQA 1NLPC 1I3QH 2NVYH 3VR2A 4UPAA 2K79A 4C92C 4IPHA 3KF6B 5IWAL 2JW4A 4ODGA 1K8AC 1IBLQ 3S1MB 1ZA2B 1KIKA 1EQVA 4G7OC 1SRLA 3ZEHA 1N34L 2OI3A 3I4MH 3GV6A 1V1PA 1YJWT 4DV7L 1YHAA 2RO0A 4YTLA 4M7AC 4HJ7A 2RCFA 5JJKA 3JAMc 2J6OA 1DOLA 2KHSA 4J8QA 5GQOA 3NBHB 4MZPA 2SOBA 1TQOA 2HT1A 3R2TA 1WHLA 2GFUA 4Q5WA 5IGFA 2JMAA 5CV7A 2F0TA 1W2BS 3LYIA 4BI4A 1NR4A 4LFCQ 3CCJT 1JWSD 1WHMA 3OMGA 1JR0D 4AYBB 4M7DF 2B8GA 2EY6A 1OTCA 2KUMA 2NUZA 4LUEA 3GDEA 2MWOA 2DRMA 2WAQE 1G3TA 3NQTA 4C2MB 4JI2L 3CCST 3J81j 2DD5A 1HZCA 5EG2A 2E70A 4JJBA 2M00A 2V1CC 4OL7A 1YJNA 1U9RA 4A3MH 4RCNA 2R7ZH 2B2VC 4AG1C 4GLMA 4K6LA 1ZQ1A 3URGA 1K8OA 1E6HA 1QVFA 1SE8A 2NTSA 4FYWB 2WV6D 1UWVA 1D5MC 1X75C 2CDTA 5C5LA 2K3BA 1J5EL 4DNTB 5M5WB 1F2MA 3HKZG 3EGDB 1JJCB 1II3A 2DGYA 1UGSB 2HIXA 3VDYA 2NVTB 5E1FA 4ME5A 1VF7A 4HVUA 1NE3A 4A53A 3BDCA 3FEWX 1ZLMA 2Z1CA 1LTGD 4LE9A 2K1BA 2DPPB 4F7XA 1VQNA 3EFSA 4XU1A 3OYYA 4X9CA 3CMAA 3OYEA 3BY7A 2BZ8A 2JEBI 2OXPA 1DYQA 1QB5D 1WIEA 3M58A 1Q86U 4XTZA 1KAAA 2KE9A 1WCMB 2VQFL 1VYTA 2DYBA 1JEGA 1TU0B 3OYGA 2O4XA 2LQNA 3CCRQ 2B29A 3QYGB 4ELZC 3I90A 3HOVB 2GQVA 4RTYA 3OYDA 4QUFA 1VIEA 3EGXB 1LTBD 2AQ1B 3JCMb 2FRWA 5GANe 1PYSB 2AT1B 3S6WA 2FMMA 3RERA 3OTOL 2I07B 2F0HA 4ID6A 4MMLA 3CPWA 4C0ZA 1VQ9T 1BBWA 2A69C 2Z0SA 4L63B 2D8HA 4DV6L 4N4GA 4PJOC 3HPWA 2LCLA 1V29B 1SHGA 3HGBA 3HOZH 3VS4A 4JRIA 4C8QB 3I3CA 1EL0A 1NEBA 1XNRL 2HNIA 1NBWA 3JCMX 2EYXA 4X64L 3L2WA 4N9PA 2NYSA 1ML0D 3SVMA 1HSQA 2L0CA 4X62Q 2F0OA 3U4VA 3MKDA 4C5GA 4ZGDB 5M9OA 2YHTA 2JYOA 1SSFA 5FU7C 3J7YW 5KYUA 4DV1Q 4A3MG 1VQEA 2R7ZG 2KDSA 3J7A5 3OS0A 2QYZA 1E22A 2DERA 5FROA 2OTJT 5IGBA 1K8AU 2D0NA 4DV4L 1UEAB 4HA8A 4OMLA 3X3NA 5FWBA 1P8LA 3I35A 3I8ZA 3NWSA 4PJMA 3GTJB 3TREA 4KJNA 4ESRA 3RR6A 1YP5A 1X56A 1NY4A 1IHZA 2WAQG 4L5TA 4M75A 2ZT9C 1HA6A 3MP8A 1PM3A 4PNOA 4P2CB 3A8LB 5ELCA 2NVQH 5D6YA 2LQWA 3FPUB 3L2ZA 4LUDA 4A3DH 1G3WA 2X69A 4B08A 2CH4A 3RN5A 3CC4T 4KK7A 3SWNC 5GAN2 3MXUA 2B2UC 3K7AB 2KYBA 3H3VC 4DGZA 5GAN8 1H3ZA 2X4JA 4M7DG 1SBBB 1OZ3A 1YBYA 1UEBA 1XX8A 3EIVA 4UAIA 3ITPA 3CC7A 3PFSA 2JA9A 4O0AA 4QVDA 4GKJQ 4YWLA 4FDBA 3A0JA 1QWEA 4GNXA 1AEXA 1JJGA 3S17B 3JRZA 2KHJA 3FB9A 2AWNA 2B2YC 2VW9A 5GJVB 4FYVB 1VYVA 5IHNA 3LW5E 2F5TX 3E9HA 2KY9A 2E5LQ 5ECAA 1OXXK 3D3RA 3S14B 3BVZA 4II1A 1ARKA 1YJ9Q 2O5JC 2K7VA 4YCVA 2ZPFB 5IN1A 2F3VA 4WORA 4YY3L 2N49A 3CF5A 1BIAA 3OTOQ 2YU9H 3PO3H 1SNPA 3L2QA 2HQEA 1G3SA 1VIFA 2QA4T 4DK3C 1AP0A 3PIPA 5CKFA 1LT4D 5ISRA 3HFZB 1XNRQ 4HJ9A 2KK4A 2EYOA 2CP3A 2D8JA 1IRXA 5HY6A 2JXBA 1HNWL 1IGUA 4A3CG 4XAXB 1FNUA 2PVOB 1BI2A 2RQWA 5LJ3h 2FZKB 1UJYA 5H1SE 1EZ6A 5CV4A 4G7HC 3AFQA 1JXOA 3OSVA 1VQ6T 4G4KA 2KQ3A 1I4PA 4EQ5A 3MVVA 5FLXL 2J7ZA 4DUZQ 1K83H 2D9TA 1KXLA 3MEFA 1IB8A 1M2OA 3BZDB 4X66L 3C94A 1VQ4Q 1VQAA 4GOPC 4OEMB 1ZUYA 1GUNA 3MTSA 3GIBA 4JBJA 1X69A 4KJOA 2DNUA 4A3FH 4KBMB 4DBQA 4JUVA 1MJCA 1UUEA 4HKEA 2QGFB 2ZTEA 2E6NA 2N78A 4YCWA 3QJ6A 4EMKB 1HNZL 4Z8AA 4E47A 4R4IA 3L2RA 2MFIA 1UGVA 3M53A 1YI2Q 1Q12A 3NENA 4DV0Q 1PRMC 1HYOA 3K0YA 4GZYC 4WJ3M 1ABQA 3E6ZX 3BVGA 5LMUQ 2KEEA 1ONLA 4DXGA 2ZJPA 5GAMf 3NGPA 1NLOC 3KUFA 2RSOA 5M3MG 4JI8Q 1CTMA 3H41A 3FRNA 3QYHB 1BO0A 3RIRA 5GROA 1NZ9A 1IBMQ 4X1VA 4OIJA 2VYTA 1QWYA 3PO3G 3OW2A 5GAMd 4M75F 3T13A 4R4QA 5BR8Q 1RAGB 4DOVA 3AB9A 4GLVB 1WTXA 3G71Q 1VDZA 3P1HA 5EJWA 5C3XA 4XTXA 3L2UA 4RHRA 3U4ZA 1N5ZA 1TWHH 5CV9A 1JXMA 1I07A 3V8KA 5KYIA 2VXWA 4A4FA 2GTOA 5KYLA 4HXJA 1QWFA 1CQVA 3S16H 2FRYA 2NUTB 2QXFA 1SYEA 5ELEA 1YVCA 3CCVA 1YCSB 4JV5L 1YIJQ 1B70B 3UA6A 4E7JA 1X55A 2X6GA 4R8IA 2YTYA 1EY6A 5FLMH 1NBEB 2F0QA 5CYUA 4A3KH 1D8LA 1D1KA 3M0PA 4FYYB 3CBMA 4RCCA 2GGRA 2EXDA 3S1QB 3TP6A 3WWVA 3URYA 2RHUA 4MN3A 4DAPA 4A3BB 1HR0Q 1EX4A 4A4KA 2L3SA 2RPNA 1OX9A 3VS6A 5C5MA 2LCSA 3H0GH 5CV5A 5JVG3 4Y28E 2PCFB 1I4HA 4L6TB 3S1NH 3H9NA 2YUQA 4FYXB 4XQ3A 4QF4A 3MFYA 4DR6Q 5DAUA 2NVXB 2QEJC 2CUBA 2QQSA 4JLGA 1EYDA 3X3MA 2K57A 4DA2A 4WJ4A 4NS5A 1I50H 3RLNA 3HHTB 1F2YA 4IOCA 4C92A 4K8JA 2EWNA 1Y8OB 1SN8A 2E65A 1QVGA 4C0GA 2FPDA 2ZPGB 3SD4A 1WX6A 1RI9A 1UHCA 3N5BB 4A3LH 4RGTA 3HRSA 3N52A 4K0KL 1HNZQ 3E0EA 3S2DH 4M7AA 2AQ3B 3I4OA 1LLRD 1QVFS 5C4XB 4RWSC 2B8AA 4LN2A 4M77B 2NYZD 1MBYA 2AHOB 2LXJA 1HNXQ 1X2KA 4CKCA 1VQ8T 3I56Q 5E3FA 3C3LA 3JB9H 3REAB 2F5KA 1UGRB 4NKLA 4R0KA 1PHTA 1WD1A 2BKDN 5FRNA 1M3BA 1N32Q 5A0LA 1VQPT 2E64A 3TCJA 1RD9D 5FLMG 4DR5L 5GAN6 1JWMD 1UE1A 2JXMB 5KH6A 3M4QA 4ZKBB 3HOYH 3A8KE 2BZXA 1SYCA 2B2VA 2JK8A 1QVPA 4E7LA 1V1OA 3O8VA 3CD6Q 3LX0A 3DM3A 1VQMA 3GTOH 3S2HH 1FNVA 4TVAB 3S1RB 3M7GA 2UUAQ 4FL6A 2XDDA 2F4IA 1KQSA 4X65L 3TEEA 3KLSX 1BBXC 2CYZB 2QAZA 2RSNA 3BDOA 1SSHA 2EY1A 3NFCA 2ZAEA 1K3RA 3EFXD 3H0GG 4BBSH 4J9HA 1VQ7T 1JOQA 3A8IE 4CC3A 3CPWS 4KHPQ 4KGZB 4AYBE 5C3EB 1YITQ 1Q8KA 4R4OA 3RKWA 2HHHL 2NZ1D 2ED0A 2RQVA 2DJFC 2YRDA 3KUPA 1SSOA 3GTLH 2XRQD 4DV5Q 2R7FA 1EQQA 2I5HA 3OS2A 2EJGC 1SMYC 1Z6HA 3MEVA 1EYGA 4IFDJ 1TH7A 4A3LG 1Y8PB 1K3BC 4OMFB 2RHXA 4M7AD 1VQCA 2EPBA 2VUMB 1LTSD 1STGA 3OBYA 2FL7A 4DUYL 5AJ3Q 1CSKA 2EYWA 2E12A 1ZXTA 4OHJA 2CW0C 2FO0A 3G6EA 2XU8A 1V43A 1YJWQ 2JOYA 2YTVA 3C46A 2UU9L 1U06A 4F7UB 2K2MA 4J8OA 4NL2A 1TS9A 5KYXB 4PJOA 2GA4B 2N55A 4J15A 4R4TA 3I55Q 4LNPA 4MZTA 2KGTA 5DM7R 3JB9G 2QCPX 5DNFA 4GKKQ 5JJLA 4FO2A 4DR2L 2DF6A 2LVMA 2ZGWA 2RA4A 3HS0C 3ZFJA 1CFMA 2DZCA 1U5SA 3HL8A 2RQTA 3M0QA 1S5CD 1UE7A 4OGEA 3L7ZC 4DNRB 5FO9B 2KSSA 1TR5A 4P72A 3T9NA 5GAHC 3HOYG 1KQ1A 4DEYA 2NVTH 1D09B 3CCSQ 3PIP3 4AMCA 2YUPA 2G9DA 1L1OC 2EXZA 5I2MA 3H91A 4JI1Q 4C92F 1WYDA 2I2LA 1ABOA 1PD0A 4OMOA 3OIQA 3QPHA 4C8QE 2HCIA 2X3WD 1B34B 1UG1A 2F0PA 1G83A 1WCMH 2B3GA 1W6KA 1GVPA 1C9OA 4M7AF 5GANh 3KYHC 2BDOA 4HIDA 2F0EA 2ZM6L 5IXBA 5EPKA 1JT8A 4JDSA 3ASKA 1QP2A 3G4SQ 5CK9A 3MP1A 3K81C 5KYWB 2MNAA 1DZ1A 1B50A 3JCMg 1KK7A 2Q2TA 1JBMA 2MQHA 3SWNA 2F69A 2F0SA 2W10A 4O1NA 4HJ5A 5FU6B 5LMNL 4IPCA 3OWFA 2B2UA 3VS7A 1S1NA 4LF4L 1N6AA 2K5FA 4M1UB 4EVOA 4YWKA 5GAOn 1CKNB 1UE9A 1W2BA 4EMHA 3REBB 2A69D 1FJGQ 3CCLQ 1XQHA 3TU4K 1B2TA 5C4JB 3RD4A 4CGYB 1UFFA 4WFN3 3CCQA 3M54A 1W6JA 1F2ZA 2DM1A 1I6VC 1ZYRD 1SJHD 1AN8A 3JC66 1VQ9Q 1PZKD 4EX5A 1B07A 4ZN3A 3OYLA 1D6EC 2XMFA 4DBHA 2BA0A 4DU9A 2I0QA 3CQTA 4KUIA 3META 3RMSA 1VQLA 2CSIA 4ABNA 5FOBB 1ENAA 1D1IA 1SEMA 3CBOA 1PTOD 1I94L 5I9OA 3NHNA 2PW7A 2UUBL 4DR4L 4OO1I 2P4TA 4C3JG 1N9RA 4DXFA 4LF9Q 4C3IB 2V1QA 2DETA 4KKSA 1N36Q 2KA7A 4KTAA 1M1FA 1CHQD 3GTPB 4BY7B 3KDFB 1X65A 1EWCA 2D62A 1EU3A 2YRCA 1HUMA 3OS5A 3T4AC 4JI0L 3CP0A 1D2BA 5IY0A 3OIPA 1FR3A 4DAYB 2P0QA 4DR7Q 5E7NA 4C3HB 1RACB 1YJ9T 2OTJQ 2ZPEB 1W1FA 3FMCA 1PRLC 4JZ3A 1MMAA 1VQDA 1TS4A 2A74C 1NNXA 1P16A 4PFOA 1Y07A 2DK3A 3OA6A 4OXPA 5F2DA 3QOJA 1PH1A 2UXDL 1WHGA 2HKNA 4JJNK 4HCZA 1RTOA 1YWPA 4DR1L 3AFPA 5IP7H 2BE5C 4HJ8A 1GHKA 1EZZB 1M90R 4GOPA 4KGVB 3OYKA 4PJOF 5IE8A 3MXNB 2Y90A 1YWOA 5T1GA 2COZA 2TMPA 1DCZA 3TQ7P 3CC4Q 3OW2S 4L5SA 1UTIA 2R92B 2EPDA 2EYJA 1Q81R 1QNUA 2MPMA 4OIKA 1C7YA 1AWJA 1UGQB 3I91A 3CCMQ 2NN6I 2IX1A 2SDFA 1VQ4T 4RKUE 5LMNQ 2KOLA 4PKCC 4CJ0B 2I5MX 3R8BA 2C9OA 5GMKj 4DA4A 4IJHA 1SLJA 2QI2A 2W0ZA 3GTQB 3S24A 3SHLA 3TDQA 3Q22A 2DY7A 4KD3A 3VRYA 5LJ3e 1Q90A 2XRSD 5C3WA 1QVFP 1V1PB 2QW7A 3F1ZA 2UXBL 1YI2T 4M7AG 2J6FA 2BE9B 1PH4A 4J6WA 3GTLB 1HUNA 3W1BA 4A3JH 1ASYA 4LF5L 4PL6A 3RBBB 5ELFA 1EUJA 4YHHL 5IOCA 5C0XG 5A2QL 4IIOA 1DOKA 4RGOS 1SFOB 4J6HA 4B3RQ 3MHBA 2F0KA 2JA6H 1QVGS 2Z0WA 2DFUA 3BDLA 3V7RA 2F0IA 1PTOH 2JS0A 1VQ6Q 5IP7G 3FC3A 1JB3A 5J3BA 2P84A 1TY0A 2EGAA 2Q2IA 3Q8DA 4KHZA 1X3FA 2MMPA 2PI2E 3Q24A 1JE4A 1TWFB 4HCCA 3Q6SA 4GLXA 3P8DA 1KL9A 1Q1EA 4HR7B 4OMMA 3EFOA 1ZSGA 2LT1A 2PNIA 1SDFA 1WDXA 4OP0A 2MF2A 3FKIH 3PVQA 3VYTA 3PE0A 5A0DA 1WFQA 3NBIA 2E2HB 1LYLA 4QIWB 2Z4HA 3U23A 3CPWP 3GTMB 1GKHA 3TSZA 4KI0A 3QWYA 4JYAL 4NXNQ 4HCEA 4A3EB 2QDLA 4ZN1A 2RD1A 5EBDA 4K11A 1QJOA 1XXGA 1NPPA 1ZSZC 1K4US 1GUTA 4KGXB 2MCNA 3NTHA 4M7DA 1GUOA 4RA8A 4JI3L 1TWGB 2MYSA 4IUTA 5KE2A 2KRMA 4JCVE 1HR0W 1X3GA 2O4XB 3MCAB 1K0SA 2CP5A 2OAUA 1WTPA 1T3LA 3H3VH 3NWTA 1HHVA 5M5YB 4IUVA 1B9MA 4JRKA 1KQSS 1OXSC 4CRIA 2N8NA 2K3YA 3KLSA 2F2WA 4CKEA 3BZCA 3SR1A 4MMKA 3PUYA 4A3JG 2DBKA 5AT1B 1B8AA 1FYCA 4DPGA 5FO8B 4JI4L 2HMAA 1BB9A 3F8TA 2F0FA 2X35A 4AFQC 1CHPD 1BKBA 5KNBA 3DB4A 4D8DA 2BDNA 4Y52H 3J80c 1SHFA 3PVLA 3X25B 2EDGA 2RHIA 2LZ6B 3M0SA 4BA2I 2EW3A 1EY8A 3GOXA 4IJLA 1M2VB 3I56T 3A7LA 2NVXH 1Z9ZA 3QXEB 3VS1A 1SXTA 1Y1VB 4M77E 4DFAA 4OX9L 4D8KA 2L11A 5KYUB 2E2DC 2SRCA 2Q8RE 4WRDA 1Y1WB 3EGUA 2RDHA 4RKBA 2KT1A 5IYBG 2FB7A 2B63G 3S3NA 3C2PA 2GBQA 4OWWB 1PMRA 1BVSA 2NBFA 3FKIG 1Z47A 5C4HA 3GTKB 1VQKT 3GTGB 1HQMC 2QTVA 1KDBA 2Z6BA 1Q82R 1PKSA 5HK0A 2R57A 4M75B 1PFBA 4A3GH 2IPOB 1VQ5A 1K0RA 3C4SA 2EJGA 1A3VA 1D5XC 2KMTA 2L4NA 1OYXA 5JEAJ 1FMKA 2R61A 5I6YA 5IIFA 2EYHA 4LFAQ 4C8QC 4HCBA 2PUOB 4J7IA 2UUCQ 2K5NA 3TSSA 5IYCH 5LJ5e 1AVZC 2M0YA 1QUQA 3O13A 5D6XA 2Z4IA 1JO8A 2CZ6B 4JBWA 1KNAA 4F88A 2LS01 1W6XA 1EY0A 1WXTA 1ZUKA 3VR6A 1CA6A 3ND9A 2M0OA 3CC2Q 3OWEB 3TVTA 4GNXB 1QNKA 4RTWA 2C0TA 5GANf 1HXDA 1WI7A 1VQ8Q 1H92A 2BCOA 1DGSA 3L9AX 3J80E 3M3YH 1KRSA 3OB9A 4I7AA 2JUFA 5KIXA 2XIDA 2Y4YA 3H6MA 1N8RR 2FJ2A 3S1RH 1PDQA 2A08A 2Q2UA 1HJDA 4ALPA 4QB4A 1PD1A 3VYSA 5GANd 1VQPQ 5D3DA 4LDYA 1WHJA 2L8DA 3J81L 3T1YL 1YZ6A 2ALYB 5C3EH 5M3FB 5FJ8H 2E2IH 4EPCA 3SXHA 5GAOr 3I55T 4AT1B 4X9DA 1L1OA 2EOTA 4K5XA 1HXYD 2PZWA 3ICEA 4F7UE 3QKJA 1D1AA 5CKBA 3VA7A 1X6BA 2ABLA 4N9TA 1EIYB 1FMVA 2JS2A 1NE8A 3KLRA 1LM0A 3TMEA 5FLXc 4J9BA 5GAMj 1XMQQ 2HDLA 4OWXB 2A8VA 3WOEA 1VQ7Q 1EQRA 4E2FB 4F17A 3FJPA 1SF9A 2VXFA 2EE1A 2A73B 2K5HA 3UDIA 2CS7A 2BH8A 2DNEA 1AD5A 4MDWA 3SEMA 1SMYD 3LNNA 3ZYYX 1O78A 4JBMA 1S5ED 2SNSA 4LJZC 1WTWA 1R9TB 1KC8R 2JA8H 3D4RA 4QKUA 4ZGJB 1E6GA 1NMFA 1KJWA 2K5WA 3Q0AA 5D14A 4JC0A 2CQAA 4B3TQ 1IHVA 4Z89A 2K5DA 3TN2A 5JAVA 1I1JA 2CW0D 2R93H 3OW2P 1D3BA 4A4EA 1VQNT 2DVEA 4EQNA 4IPDA 1I5LA 3CMAT 3G4ST 1MSGA 1OQKA 3V05A 3EA6A 4CJ2C 1NUCA 4IOAA 4JI7L 2HBWA 1OXUA 5CAIA 1WTVA 2VV5A 2KRSA 2MIOA 1KD1R 5BN5A 4PQXA 2H3EB 5GAOm 1WHHA 3JAME 4POFA 2ZCFB 4C3JB 3CBPA 3CCLT 2F52A 2OEOA 5CO7A 3TQYA 3A5UA 4KMUC 3I4MG 3M7NA 2B39A 2CT4A 4JK1C 1LABA 4Z88A 1NEGA 4A3IB 2EKHA 5FJ8G 1RLQC 1IYJB 1ET6A 2IHFA 3K58A 1KIXA 3HOXB 4F87A 1PFSA 5IWAQ 1K8GA 3QR8A 2QASA 2CGHA 2DILA 3P7JA 1ZYRC 3EG9A 3HOWH 1M8MA 2F2VA 2HZYA 1IXRA 2LTOA 1GFDA 3L3OC 4MHEA 5IT9L 4AIMA 1LO5D 1PRTD 1N9SA 3NEMA 1N34Q 3M59A 1D1CA 3SFMA 4DV7Q 1XTDA 2R3ZA 1KSWA 4H44C 2K3XA 1M90C 4IALA 1PTOC 4EMKC 4ILWA 5GAOq 5KEEA 4A76A 1QVGP 3HP9A 3IFTA 6AT1B 4KN4C 1YN8A 1PV4A 5C4JH 1G51A 2VKNA 4HAEA 1BYMA 3FP9A 4FCYA 3ME9A 4J5YA 1Q81C 1M8AA 1SNQA 3SE0A 1A3UA 3VJPA 4C5IA 5HK3A 3MEHA 3NHHA 3TS2A 1YNZA 2R93G 3OYBA 2E3HA 1QP3A 1O7IA 4JI2Q 1TSFA 1E2ZA 1EOTA 3KF8A 1GOZA 4BY1B 2ATCB 2E2JB 1PFNA 2JA6B 5LJ5g 1S72A 2K5IA 1D5ZC 3LLRA 1RJTA 1G2SA 2Q8IB 4DN4M 1OV3A 1MHNA 3H0HA 1J5EQ 3HG9A 2X6LA 1HTPA 3U58A 5FW9A 4C92B 1MSHA 3LWUA 2L0AA 1RAEB 3OY9A 3A7AB 2IT1A 1RUWA 2FZCB 2GFAA 2QEXA 3CMEA 3CC7T 1MIUA 3CQZB 3STBC 2A1AA 2PQAB 2XKOC 1PLFA 3CCMT 2AMCB 3VS2A 5DEHA 3OYJA 4DNIA 1T5XD 4H0LC 1KQSP 4ZK9B 3I4NB 2YXYA 1U1SA 2DEQA 3RLOA 5IGGA 2C5CA 2QK0A 2BIVA 1MNDA 2VQFQ 3KK7A 2K6AA 4KN7C 3HOZG 1Y96A 2B86A 1AE2A 3K7UC 3SK6A 2MAMA 3UDFA 2CZ0B 5C44H 3HOWG 2E8GA 1FYNA 3CCUA 1AWOA 1BCPC 1L0YB 3A74A 1AZEA 1ZEQX 1SKUB 4MZMA 4EQPA 3D8GA 2LFNA 1Y7XA 3D31A 2J0TD 2BE5D 3JCMP 3FLGA 2Y0SB 4XQJA 4DV6Q 4A4IA 2DO3A 4HVWA 2AWOA 1BR9A 2JA5H 1I6HH 1GXIE 3L2PA 4PJNA 4JI6L 2KEDA 5JOBA 1WTRA 1PSFA 4X64Q 5HKCA 4NXML 2F3IA 4OF1A 3UPUA 4ELYC 3T56B 3K80C 3RUZA 1Q95G 5IH2A 4EQOA 4J7FA 3KJOA 3FHWA 2IL8A 3UDGA 3QJYA 2R5AA 3BG3A 1X6OA 2VY3A 4KY7A 2RDFA 3I73A 4J6XA 1H641 4X6AH 3QO2A 2DL5A 1WJQA 2K4YA 3PO2H 4JI5L 2MUYA 4RG1A 4BBRH 3NBHA 1A2TA 3QDRB 4M77C 4J9CA 4DV4Q 4A3DG 1ZSZA 1SE4A 4AH6A 3C0CA 2YSQA 2OTLA 2V26A 1OULA 4DBRA 1VS0A 4C56C 3MJXA 2PTKA 1U1TA 3I4LA 1QG7A 3EROA 5FKAC 1OU8A 1M90U 4PV1C 2IX0A 3ERSX 1WJJA 5K36H 3JB9D 5IP9H 3ND8A 4GLAC 5IGDA 2DYIA 3OYIA 4V2SA 4X3UA 3GPLA 1GRIA 1LTAD 3ZL7C 1HZBA 2A5HA 2MGSA 1Q81U 3CCEQ 2YYZA 4TVRA 4PJOB 5C44G 4M78D 1TOVA 4L5GA 1HD3A 4A93H 1QW1A 1X43A 4IPGA 2PO4A 1HRJA 2CZ1B 2X3XD 3FIFA 2CWPA 3QDFA 4JLIA 2DXTA 2JTEA 1MMDA 2E2HH 3UDCA 1F9PA 5FU7B 4HIMA 4BE0A 1XJVA 2D0PA 2X4WA 2NWGA 2JA5G 5EAYA 2I5LX 4NW2A 3G7ZA 3HOUB 2KNBB 2B63B 2KCCA 4L5QA 1W2BP 1ICFB 2LMJA 3GNGA 1Q82C 4HT8A 2K33A 3IRBA 4YY3Q 4B9WA 2JM8A 4UC4A 2D0OA 1XNQL 3OW7A 2X4YA 2CSQA 4LF6L 1ZX6A 3PO2G 1P92A 4Y7NB 4BBRG 3PTAA 4ME7A 2P4RA 1NTGA 3JB9F 1PZJD 3M4PA 4IFDH 4Z02A 4TRDA 2JA7H 1HNWQ 2D0QB 3B6YA 4DV3L 4XU0A 1MGQA 1XPOA 2ZXRA 2YUOA 3HKSA 3D4WA 4A3FG 1SNDA 1DJ7B 1WQ7A 1EU4A 4ULLA 5K36G 3JCMe 2UXCL 2YLCA 2RQUA 4RTTA 3VS0A 5IP9G 3GO5A 3KFUA 4ZCKA 3UA7A 1PC0A 4X3TA 4X66Q 2CT3A 1YHQQ 1KLUD 1N8RC 3CU7A 2AZSA 2PYKA 4QVCA 3PUWA 4RGMA 3BS1A 4O2DA 2EGCA 2QQAA 4M7DC 1ICWA 1M4VA 1Y1VH 2K5QA 4A93G 1KHCA 2EJMA 1Y1WH 1RAFB 4P73A 4M78E 2WB1E 2J05A 3U9OA 2RKSA 2JE6I 3CC2T 2KAFA 3UE1A 1SMXA 3GTKH 1UECA 2EQMA 3QZ9B 2E3IA 4CDCC 2DJZA 3JB9I 3TZUA 1TY2A 3T53B 4IO9A 1WHKA 2JJ9A 2NZHA 2KYMA 2WSEE 1IW7D 1RODA 3P75A 2QGQA 5FU6C 5LJ5h 2OWOA 2KXCA 2K32A 1JWUD 1TS2A 3VU3C 5LL6S 1KC8C 1V1QA 4P75A 1VQKQ 4IIMA 3VR3A 3ULJA 4A3KG 1MV0B 4UP9A 1I4K1 3C95A 1M1GA 3W3AA 1GCQC 2F0WA 4MTNA 4BD3A 4C8QD 2JA7G 3NTIA 4R4CA 4IFDG 2XD0A 5BN3A 3T1HL 1MV3A 3RESA 4GOPB 3PF5A 2VL6A 3HKZB 1UUPA 3CW2C 4JG2A 2M16A 1XNQQ 4JV5Q 1A3TA 2IVWA 3IKJA 1H9KA 2ZPIB 1O7ZA 3VA5A 3S1MH 3AU7A 1JQQA 3BFMA 4YIJA 4DK6C 2IY5B 1HK9A 2MO0A 2IX3A 5EC7A 2LP5A 1KD1C 2EIFA 2HD0A 1RADB 3H0IA 4RTXA 3TSWA 2NVYB 1VOMA 3K8AA 1LTID 1N9WA 3PMFA 5A35A 2QDBA 1PH7A 1SNOA 1U0LA 1Q82U 1JJ2A 1CKBA 3D0FA 4MTKA 2FPFA 2P0KA 2V8JA 2GF7A 4FSSA 4O6JA 2KCMA 1NYFA 2LJ3A 3GLXA 2RF4A 4KD4A 3J81i 1CSPA 4ZTFA 3F2DA 4GLKA 1EWHA 1UDLA 3MPUB 1IBKL 1JOOA 5CVIA 4KKTA 1QCNA 3JV3A 5D65A 4H7BA 4LF8L 4C2MH 5I11A 1O9SA 4FM4B 1DOMA 1YNND 3TEHB 2DTIA 4HVVA 1AWXA 4XTUA 3S15B 2E75C 4LDWA 1MGSA 4BDYA 5IYDH 2VB6A 2I46A 4C8QF 4K0KQ 3X28B 1K1ZA 2FXQA 3PUVA 8AT1B 1VQHA 2CKKA 2KRNA 2XHCA 5M5WH 4M78G 4EMKA 2V4DA 5GADC 2WSFE 4XU2A 3RDVA 1SJED 3QIIA 1YJNQ 2EYYA 1EY9A 2WB1G 5IGEA 1C8CA 2JNGA 3G6JB 4A3MB 2AQ2B 5CC4A 2R7ZB 2LSSA 1N8RU 1K76A 3GNFB 4RCOA 4QQGA 1GCPA 3SK8A 1RCVD 3L42A 2Z9HA 4IURA 3NUCA 2K9GA 4BBSG 2CP7A 5EKKA 2A3LA 2OF1A 2AHJB 4XTCS 4OGQC 1W4SA 2JZ2A 2BOSA 3EFOB 1XOVA 1V9PA 4DR5Q 2O9SA 2WAQB 5ELOA 1NYGA 1TU2B 1PRTC 3PMIA 3T51B 4BACA 5EKLA 2EYZA 4O5VA 3LH5A 1VQNQ 3CCRA 3MFGA 3CMAQ 3HOVH 3E5SA 4JOIC 2DTHA 1BQQT 3J7AV 2PI2A 4Z9CB 3T1HQ 4X65Q 3QG1A 1IKLA 3HSBA 5GAN7 4R55A 3M9BA 4XTYA 3HOXH 1C0MA 2ES2A 2O01E 5G3LD 2K7AA 5I2YA 1ZA1B 1PH3A 2NUTA 2KBNA 2HHHQ 1AH9A 4M7DB 4JJDA 4NPSA 1I81A 2J06A 2K03A 5DY9A 1CSQA 1KC8U 4AYBG 2H5XA 3QUIA 1TIID 3PV0A 4XYQA 1STHA 2QKIC 4OGCA 2FFKB 1PHJA 5LJ3f 1WTHA 3TP7A 1M1KU 1BCMA 5KYYA 2B2YA 4MNOA 5JPMC 5J22A 2O5IC 3AQQA 4ZGEB 3OYFA 1VQOA 2FHDA 3P8HA 1GUSA 2A6EC 3M0UA 4DKAC 5IYDG 1GJXA 2MPXC 3TRZA 1TUCA 5EPJA 3SK4A 4DUYQ 3GD7A 1IZ6A 1WXUA 1HA5A 4FIBA 1U4RA 5IHIA 5LJ3d 5FO7B 4YWMA 4K14A 1AFPA 1SR3A 1KHIA 4J9FA 2LMCB 3V96A 5M5XB 2F0DA 3V7CA 2UU9Q 3JCMc 4GY5A 3PNWC 3GTJH 1GBQA 2LT4A 1B3QA 3D7SB 3EAEA 1TXQA 3WVDB 4BI3A 1KD1U 1JE5A 1D0XA 2A28A 4JRQA 1FGUA 2Q2HA 2E2JH 1U3OA 4CC2A 4JVZA 4DR2Q 1MD2D 1ZKOA 1J6QA 5I4DA 1Y0MA 4PFPA 4LF7L 3UWNA 3M4YA 3N6RA 4LDVA 2L3RA 4EGVA 4M4ZA 2ZJRA 5GANj 1QCOA 4DK1A 4B3ML 2RI2A 2F1MA 5C0XI 3EHQA 3E19A 2A36A 1PG5B 5LL6X 5GAMg 4XT1B 4DR3L 1WCMG 1DD2A 2ENBA 1PFMA 1VMPA 4OVAA 2PQWA 3PGGA 3KLWA 3CQZH 3K7AH 2A0FB 1WZOA 5KNCA 4M77A 3HOVG 2NVQB 3KJPA 2YDLA 2OQKA 4RFBA 4A3DB 1PH8A 1KTKA 3STBD 3MAQA 3O5ZA 1BBZA 2O88A 3CMEQ 1R4QB 1UE6A 4MDXA 5I6WA 4AQYL 3S17H 2KT8A 1LV9A 1BNZA 4DV2L 1E2VA 1XMOL 1WVLA 1ACMB 1Q8IA 2F2XA 2RQRA 3CC7Q 4ZNXA 4C8QG 5DM73 4EDUA 2ZM6Q 2PVGB 3VS5A 3ZBDA 2R5MA 3S14H 1PTOF 2COYA 3A54A 1S5FD 4MIUA 4CDEC 1YJ9A 1WNLA 3S9WA 1KG1A 2C35B 2DY8A 2XNAC 1BCPD 1LNXA 2VZAA 3V8JA 4LF4Q 5M3MB 1D0ZA 4OB0B 3X20B 4BB7A 2A19A 2F4VL 4K8IA 1SROA 1ASZA 3M4OB 5ELBA 2CUDA 1O80A 1SYBA 3PO3B 1NJIR 1YCYA 2DA9A 4F8MA 3F2BA 1PYWD 2FG0A 4LXCA 3CCET 5AFWA 3RZOB 2P5ZX 3FEOA 1LOJA 4RG8A 1VQGA 2HUGA 1L1OB 4G7ZC 4N0AC 4FW2A 4X34A 1K9MR 2BE7D 3MC0B 5KCHA 4TKOB 1I94Q 5CQYA 2UUBQ 4DR4Q 4LFBL 5AYFA 3TS0A 3M4GA 2MP1A 3QZ5B 4M78C 5E4XA 5HURA 1VQ4A 3BW1A 3M85A 4LUVA 1ZUUA 4QY7A 2JT4A 1N33L 4M77D 1G91A 1MMNA 3OMCA 3ULPA 4R1JA 3I70A 5C6AA 4JI0Q 1K83B 4J9IA 4JRPA 4F7UA 2EYPA 1MNEA 4FF2A 3AEVA 1JC7A 3PF4A 2DJGC 4C1NK 3ER0A 3GF5A 4HMJA 4BE2A 2OJ2A 3NSWA 2M1HA 4BY6B 1BCPF 3NELA 2RDGA 5EBCA 5HCKA 2JM9A 4FT4A 1YI2A 1HCZA 4KULA 1F77A 4XT3B 2BZYA 2UXDQ 4B6MA 3OOCA 3J7ZC 4DR1Q 1D3BB 4AFZC 3V8LA 5C0MA 4OB3B 5IHKA 1BK2A 1LJOA 2E10A 2DAQA 2K5LA 2MI6A 4ORZA 2MK5A 1ENCA 2HEQA 4OONA 2LX7A 2DE0X 1OOTA 2ENMA 1PZID 4HCSA 1VF5C 2V1RA 2KROA 3G71A 5LJ5d 4NOYA 2NUPA 3T16A 4IUUA 1G2TA 1V76A 1KDCA 2O2LD 3H3VI 5CR2A 4J9EA 1WOCA 4Q5VA 5C0XJ 1XJWB 1YHQT 2M9VA 2DIQA 3RLFA 4M77F 2RH2A 3OYCA 2LDMA 1YIJA 4LDXA 1Q1BA 5IT9c 2VQEL 1M30A 1TWHB 1CKOA 4Y7NH 1CI3M 2FEIA 4ZTJA 1HFNA 3S1QH 3GV3A 3SEBA 4ZKCB 3VR4A 2FVUA 3S16B 3CCVQ 4A3BH 3RKXA 1Y57A 3INZA 4CC4B 2HKQB 3V7SA 4D6WA 1C0AA 2K01A 1RAHB 1UJ0A 3JCMh 3CXCA 1A0IA 1Z9QA 2K4KA 5JPNC 4A3KB 1IBLL 2UXBQ 1G6PA 4RCBA 2ROLA 2BUDA 1OPKA 5EGTA 1JJ2S 2E1HA 2SNMA 4ZAIA 1WD0A 4LF5Q 1GCQA 4PG3A 4DK0A 4UP7A 4XQNA 4CI0C 1SRMA 3SB2A 2VS1A 2MO1A 3I2ZA 1G3YA 4YHHQ 2IPKD 2L1BA 2EVRA 3H0GB 2OT2A 1AOJA 2WP8J 2GTJA 3IQLA 2G3RA 1VQ5T 3OYAA 3OYHA 1IW7C 3JCMJ 1S5BD 1FL0A 2ICEC 3PUZA 4LFCL 3QIAA 2L3QA 2JN0A 3EG0A 1E2WA 2JJQA 4QL5A 1I50B 3VYRA 2Y4XA 1X54A 2XWJB 5C4XH 2L12A 4PZ7A 1STYA 2E41A 1YNXA 1GUWA 2M51A 4B3SL 2RJCA 3HFOA 3H09A 1CQFA 3K6OA 3CRLC 2NB0A 2K75A 3FDTA 1H8KA 2CP6A 3ONAB 3I56A 3VUBA 1EFID 1LT5D 3PIOA 1SE2A 3I5SA 4E7KA 1QE6A 3I72A 2B2TC 2VB3X 4JYAQ 4A4GA 1Y69U 2D2CC 3R93A 1XPUA 2KECA 4Y91A 2MHVA 3M55A 3R6OA 3AYHB 1KAWA 2XIWA 4F7UF 1EYCA 5GAMh 3H6ZA 4P74A 4GBQA 3QWXX 4ATOA 4UDUC 3OQ5A 4HSVA 4JI3Q 4AG2C 1IGQA 3M57A 1SYDA 3UF4A 4A3BG 1F9SA 3CD6A 3RNJA 2LCCA 3M0RA 3QWNA 4UHVA 2KHIA 1XWEA 3UE0A 2D6FA 5CKDA 1CT1D 2EYMA 3BYYB 1PH2A 3RZDB 2F0VA 3HOYB 1T5EA 2PUKB 1ENFA 2Z6KC 3E9IA 1YEZA 1VQMQ 3GTOB 4N8X1 4QW2A 1YITA 5L23A 4JI4Q 2CQOA 2YV5A 2EY5A 5L8RE 1QCFA 4A75A 2DN8A 3U9SA 2WFWA 3DMUA 3EQLC 1LTLA 1YNNC 3NQIA 1JU5C 4K5WA 4BBSB 4L59A 2DXBA 1N27A 1QOHA 3FPPA 2KJXA 4POGA 1I4RA 1BDOA 1MKHA 1K73R 1IREB 3EHRA 3EFRA 1H95A 1K9AA 1JOKA 1YJNT 1LUZA 4FF3A 2ASBA 1TXYA 2E6ZA 1QZHA 4IZ8A 4E7SA 2VUMH 1C6VX 4JOIA 3A8MB 1RAIB 3JSCA 1HQRD 2QILA 1H9SA 1QZGA 3JCMQ 4OX9Q 1FGBD 4X62L 1WLPB 4A3GG 1HJPA 2F0GA 4R8NA 5C4XG 1IL8A 5D7UA 1CKMA 1K8MA 2TSSA 1T0JA 4M77G 1M3AA 4KH1B 1YJWA 1ZSZB 3S3MA 3DEOA 2K28A 1H9JA 3ULLA 4DV1L 5DLQE 2RHSB 3CHBD 3BVMA 5DM63 4UP8A 1BUVT 1LTRD 3S15H 1R77A 1M1KR 2YLBA 3I55A 1A0NB 5CCAA 2KCTA 5CGKA 3OS1A 3G6EQ 5I9PA 5IYCG 1TUDA 4H13C 4LMQD 1M5Q1 2HSEB 4TQUS 3W2DA 3VUZA 3CCJA 1SRUA 2PZUA 2EKOA 2RB6A 2IJ0A 1ILQA 4B3SQ 3EH1A 1Q3LA 5FK9C 5I2SA 5GJWB 3SGIA 1BBUA 1IYVA 1TVXA 4J83A 4C0DB 4NL3A 3CCSA 1J3TA 1RTNA 4PZ8A 2QDYB 4HCKA 2J7IA 2WKCA 4HIKA 4PFZA 3BZKA 2QQRA 4KT0E 4M7DE 1S4ZA 3KBGA 3JCMV 2RI5A 4KLKA 3K0XA 5C3EG 2AUJD 2RQXA 3LWIA 4BE1A 5GMKl 2WINB 2EVBA 1HZ9A 2F0UA 1EFWA 5FLXE 4N4IA 2ESWA 2EJFC 2DL3A 1H9MA 2FINB 3HP3A 4GKJL 1I8FA 3DKMA 3G4SA 2GN5A 4IUNA 3IFDA 2RMOA 3E2UA 3AHUA 2KBTA 1UHFA 4XTWA 1A2UA 3T1YQ 2C0IA 1TWBA 2HL3A 4M8AA 2E5LL 3HEJA 1E7ZA 3BJUA 2VUMG 2E74C 1X6GA 3K5OA 1EEID 2AUKA 2I0NA 3EH2A 1AEYA 3QBYA 4L5RC 2RHYA 3W1GA 1WFWA 3CCLA 2JA8G 1YFNA 4PLLA 1TWAB 2ZXOA 5K5PA 2EJ9A 2G9HD 1X27A 4F7UG 3LX7A 2KQWA 2XTIA 4BUGA 2KCNA 1HZAA 2HSPA 2DJQA 2DRKA 2E5QA 1VQ9A 1S72T 4KV6A 1Z7TA 1W70A 1EY4A 3K57A 3CCQQ 4PMBA 2LY7A 2WKDA 3DLMA 1BU1A 5M5XH 1FXXA 1OZ2A 4XDXA 3KFVA 1M2VA 2A6ED 2L5TA 1G5VA 1VQOQ 2X4XA 2JTMA 2QEXT 3CMET 1RF2D 1Y8NB 1Q7YR 2K50A 1K28A 4U68A 4C3IH 5AJ3L 3J80L 1VQLQ 1M8VA 1H3HA 3GTPH 1BI0A 4BY7H 2VWFA 1NJIC 2LJ1A 2PNHA 4DUZL 2CH4W 3NXWA 4JZ4A 3OPOA 4Q0FA 4OELB 4LUOA 1CZGA 4A3CH 1BIBA 1EIFA 1TG0A 4QT7A 1PRTF 2GVBA 1VUBA 3M0TA 2HD3A 4C3HH 2ATWA 4QCLA 1A63A 2OTJA 1WXBA 4M7AB 4JI7Q 4G57A 1K9MC 4F14A 4BDZA 1KNEA 1RAAB 4FT2A 2CP0A 5GMKe 3CCUT 3UDXA 2A37A 2QTXA 4N0AA 4YCUA 2K14A 4BXXH 4DQ2A 1IHWA 1G8XA 2OAWA 3A8HB 2H3JA 1HFGA 2H1EA 3R3OA 4M78A 1QKXA 4RTVA 2YRVA 4DV0L 1IO6A 5LMNW 3J7AF 3L0OA 4QQDA 1X9NA 2RK2A 5ELNA 5LMUL 2EZVA 2R92H 3Q1JA 4GN5A 1ZBXA 3CC4A 1QILA 4BA1I 1WYXA 2RJEA 1SE3A 3MXPA 2DKGA 3VKIA 4HT9A 2WSCE 1Y14B 3THKA 5GMKi 1JJ2P 2CCZA 2RJFA 2IIMA 1IBML 1S40A 2DVJA 1GO3E 3H0FA 3E9GA 3CCMA 1PH6A 3PT9A 3P8BB 1VCIA 3KF6A 1V1CA 3LH0A 3M5AA 3A55A 5BR8L 4CDFC 1R0BG 1CKAA 1Q46A 2V8KA 2YUNA 1S3OA 4XIGS 4LD9K 2XWBB 5JJZA 1WPYA 3D4DA 5M3MH 3SDZA 3GTQH 3I5RA 4XK8E 4J9DA 2XN9C 3MWYW 3M4OH 5KNDA 2FPEA 2OTLT 5KRUA 1LVKA 2XI9A 1ESFA 4E7ZA 3DWAA 3PQIA 3CAMA 2AKLA 3AT1B 3JCMf 1G2BA 1EOVA 1TWCB 3D6WA 3MZ5A 4C3IG 1STBA 2NLUA 3CXCS 1SAPA 1AW7A 1OXTA 3RZOH 4BY7G 1SYFA 4JBKA 3C1EA 4HEDA 3JAML 1F9RA 2QGGA 2QA4A 3PIO3 2GQIA 3PCOB 1WGSA 1HR0L 2LKVA 3GP8A 2XVSA 3RN2A 2MOXA 3JCMd 4C3HG 3C12A 2L55A 1M3CA 1D0YA 4M75D 2B2WC 2A68C 3I7FA 2CZ7B 4QIWE 4NDXA 1SFOH 2LX9A 2PPBC 3M56A 4A3JB 4DR6L 1WJSA 4ME3A 2O9VA 2EGEA 3TP5A 2JN4A 4BXXG 3P20A 1I4GA 2KVMA 4ZLTF 1VQ6A 2GCXA 2E5KA 4RTUA 2PMZB 3NK9A 3EGDA 1TWFH 1B53A 3MO8A 5ELDA 1WJRA 4DOWA 2NZOA 2R92G 1IL2A 2KENA 4A4HA 2JMCA 2XK0A 4KKUA 1L0XB 1PTOB 2L5QA 3GTMH 4V0BA 1C4QA 5BN4A 2KVQG 2HL5C 5I22A 4PMCA 1OI1A 2FYKA 5LJ3j 2O31A 2K6DA 2K04A 3CCVT 3ZJYC 1PH9A 1NJIU 4A3EH 2M02A 3CKIB 1WA7A 1NCVA 5GANg 2VASA 2ZTDA 4PZ6A 4IKFA 4CKBA 1HNXL 4ZYSA 5JJIA 1D7QA 3FKIB 4I65A 2G5DA 2HCKA 3EBEA 4OMQA 1J9OA 2D1XA 1Z9FA 1TWGH 3PSIA 2P0PA 3EGXA 5A0GA 4DBFA 1K9MU 1STNA 4NMZA 4TSSA 4XYOA 1N32L 1VQBA 4JI6Q 1MI2A 1S5DD 2CREA 1E3PA 4IFDI 3DUZA 5M5YH 4NXMQ 5GAN4 4QQ6A 4PJLA 3A1PA 4IUPA 5KYNA 3H94A 5GAN5 2ICIA 4PMWA 4U673 2DL7A 3CRKC 1R8OB 1M4ZA 1RLPC 4C8QA 4RHSA 3SWNB 4ZUIA 5CBAE 5EPLA 4E6RA 4J9GA 4M78F 1CM9A 1PWTA 2UUAL 1I5FA 2B2TA 3R2IA 4JI5Q 2CWAA 4Y92A 4F16A 1AHJB 3C1FA 3KOJA 3KBXA 3RMHA 3DB3A 1A15A 2CVRA 1PXUA 1LPLA 5FWCA 2ID0A 4HSPA 4KHPL 3UATA 2HDMA 2R7DA 3WXMB 2LNHB 5J1ZA 1SEBD 5DLOA 4M75E 2A6HC 3NPPA 1PA6A 1PVOA 3IL8A 5KYYB 4CHTB 2VGNA 4DEXA 1IYUA 4HTHA 1MMGA 1BCPB 4DV5L 1QMCA 3VS3A 1OEBA 2PZ1A 4BS9A 2LXKA 2RNAA 3G1JA 2AZVA 2SEBD 4KH0B 1UE5A 2Z6KA 1WTQA 2L2PA 2DNCA 1JCKB 1BCOA 2AKKA 2JTFA 1I0CA 4WCIA 1GXDC 4X3KA 1A6XA 1TTHB 3GTGH 3PUXA 4X3SA 1EWIA 1ZBJA 5CORA 4OB1B 5CV6A 1K73C 1A8VA 1UGPB 3CEYA 5CV8A 2L89A 1M27C 2DX1A 1GL5A 1AT1B 2VVKA 1AE3A 1SYGA 3QO3A 1V8QA 1YNJD 4J1MA 1PNJA 3MP6A 4KHVA 4A3EG 1B7TA 3DHQA 4JI8L 5GAOp 1KLGD 1QKWA 2BA1A 1SNCA 2PQAA 1OU9A 4GKKL 2R6GA 2DXUA
chains in the Genus database with same CATH topology
4GN3B 1VQMT 3FDRA 4R56A 2HQXA 1E1TA 1YHBA 3RUXA 4FSXA 1M1KC 3OYNA 5GAMe 4P5NA 3NTKA 4OWTB 3CC2A 4LF6Q 4JI1L 1VQ8A 2HAXA 2AKWB 3KXTA 4QGUA 4APVA 3VV0A 3RZDH 5I21A 1MJEA 4E7IA 4LWCA 4DV3Q 1L0WA 1VQPA 5M3FH 3JCMW 1Y1VG 2XG8D 4HIOA 3UT1A 3G6ET 2K52A 1Y1WG 3MEWA 2UXCQ 3EN2A 2ZPBB 1KXLA 1VQ7A 4C5HA 5LJ5j 2C06A 2EJFA 1FJGL 4C92D 2LNVA 4M75G 2EAYA 1FX7A 2LRQA 3F70A 3M9QA 4QQBX 2LC4A 1R9TH 1GM5A 2HQLA 5CQXA 2VUBA 1U5KA 2GVAA 5GMKm 1L2FA 1WQWA 3E1SA 3LGJA 4LF9L 3CPFA 1N36L 4RG2A 5GAN3 2XICA 3CCRT 2XDBA 3WVEB 4DR7L 4XU3A 1Q7YC 4H02A 4C3JH 4WF2A 1K73U 2RA2A 4A3IH 5M3FG 5C6SA 4LD6A 1UB4A 1O75A 3JB9J 2JVVA 3CCQT 1VQJA 2LQ8A 1VQOT 2HIVA 5A2QE 1VQLT 3OSSC 1E1OA 2ZZDA 2YTXA 3L2VA 5FRMA 4BY6C 4A54A 2QQ9A 4C92E 1TWAH 1IBKQ 2RJDA 5J26A 4PLIA 2RHQB 4LF8Q 4GS3A 1PH5A 2ZTCA 5GAOl 4DAMA 5CIUA 2ZJQA 3HRTA 4BY1H 3H8ZA 4M7AE 4RMFA 4PJOD 1VQFA 2XDPA 3L1AA 1Y71A 5CKHA 2HBPA 3BDUA 4C0FA 2QQBA 4LW1A 2LQKA 1PYBA 2PU9B 3RNUA 2DD4A 3J80i 5CKEA 2DTOA 5GMKh 2JEAI 2MWPA 3RKYA 4A3IG 2RM4A 2Y0SE 1KRTA 1RIPA 3HOXG 1XPRA 3I4NH 5D6WA 1T9HA 3OBWA 2R58A 2CFMA 4VUBA 5J39A 3VYHB 5KE3A 2OQ0A 1QUQB 2BH2A 2ZPHB 3OYMA 4GN4B 3RMQA 4NXNL 3H15A 1NMGA 3HFNA 2EQUA 2EQSA 3J81c 4HJAA 1A62A 1Q7YU 2DZ9A 5KCOA 1PSEA 4BY1G 1JB7A 4M75C 2L15A 2JA6G 3BU2A 2JQOA 3DLLA 4PJOE 1TWCH 2IG0A 1JMCA 1B7YB 2PMZE 4C92G 4C5EA 3MEUA 3X26B 4OO1G 3X24B 4LF7Q 4LDUA 3JAMi 3HRUA 4B3MQ 2RCNA 4GNXC 3I4NG 5HGQA 1QVCA 5IAYA 4DR3Q 4FU6A 3CCEA 1GD7A 4B9XA 3LGFA 1M9SA 1CUKA 5LJ5f 5GAEC 1X01A 3PMTA 3MHXA 3G71T 1RL2A 4AQYQ 2RK1A 3J81E 4L6V5 4LUZA 4DV2Q 2Y0SG 1XMOQ 2N3SA 3E9FA 3HOUH 5IYBH 2B63H 4IUQA 4P71A 1B34A 1XNIA 1YIJT 2K2VA 1KQ2A 4LFAL 4OB2B 2UUCL 2DUDA 2DIGA 2VC8A 3MEAA 1W3SA 1NPRA 2NN6G 4UY8C 2PVDB 2F4VQ 3U50C 1U8RA 1FWZA 4BI8B 3QSUA 1CKNA 4N4HA 3S3OA 2CKZB 1BI3A 2EYQA 4LNQA 4KUDK 2VNUD 3QHSA 4JS4A 2IHEA 1HH2P 5JEAG 1RI0A 2K5VA 4LFBQ 1E24A 1YHQA 2M9UA 4E7HA 4C0DC 1JB0E 1N33Q 4PJOG 4MZ9A 2DXCA 3W5OA 3LWHA 1VQIA 4XTVA 3RR5A 3KF8B 1XMQL 3KDFA 1OXVA 4JS5A 1X3EA 3VYGA 3LGLA 3HKZE 1Q86C 3HOUG 4NB3A 3PGZA 1BI1A 2EQJA 3A8GB 5IT9E 4B3TL 4QVZA 4QJFA 2EFIA 3CD6T 1JRIA 4EMGA 1WI5A 1VQKA 2EQKA 2RI3A 3A8OB 3A5ZB 2VXEA 2WACA 1Y96B 3G48A 4M7DD 2A7YA 4RMOA 4M78B 1ZHIA 1YITT 2VGMA 2XGTA 3F2CA 1G291 2RHZA 2VQEQ 4B3RL 1FVIA 4J6YA 2V8IA 5LJ3g 5GAGC 2OCEA 1I3QH 2NVYH 4UPAA 4C92C 4IPHA 3KF6B 5IWAL 1IBLQ 1K8AC 3ZEHA 1N34L 3I4MH 1YJWT 4DV7L 1YHAA 2RO0A 4YTLA 4M7AC 4HJ7A 5JJKA 3JAMc 5GQOA 3NBHB 4MZPA 2HT1A 2GFUA 4Q5WA 1W2BS 3LYIA 4BI4A 4LFCQ 3CCJT 3OMGA 4M7DF 1OTCA 3GDEA 2MWOA 2WAQE 1G3TA 4JI2L 3CCST 3J81j 2DD5A 1HZCA 5EG2A 2E70A 2V1CC 1YJNA 4A3MH 2R7ZH 1ZQ1A 3URGA 1QVFA 1SE8A 1UWVA 1X75C 1J5EL 3HKZG 1JJCB 2DGYA 1UGSB 2HIXA 3VDYA 1NE3A 4A53A 2DPPB 1VQNA 3EFSA 4XU1A 3OYYA 4X9CA 3CMAA 3OYEA 3BY7A 2JEBI 3M58A 1Q86U 4XTZA 2VQFL 3OYGA 2O4XA 2B29A 3QYGB 4ELZC 2GQVA 3OYDA 1VIEA 3JCMb 5GANe 1PYSB 3S6WA 3RERA 3OTOL 4MMLA 3CPWA 4C0ZA 1VQ9T 1BBWA 2Z0SA 4DV6L 4N4GA 4PJOC 3HPWA 2LCLA 1V29B 3HOZH 4JRIA 4C8QB 1XNRL 2HNIA 1NBWA 3JCMX 4X64L 3L2WA 4X62Q 3U4VA 4ZGDB 4C5GA 5M9OA 2YHTA 1SSFA 5FU7C 4DV1Q 4A3MG 1VQEA 2R7ZG 2KDSA 3J7A5 3OS0A 1E22A 5FROA 2OTJT 1K8AU 4DV4L 4HA8A 1P8LA 3TREA 1X56A 1NY4A 2WAQG 4L5TA 4M75A 3MP8A 4PNOA 3A8LB 2NVQH 5D6YA 3L2ZA 4A3DH 1G3WA 3RN5A 3CC4T 2DXUA 3SWNC 5GAN2 5GAN8 1H3ZA 2X4JA 4M7DG 4JI8L 1OZ3A 1YBYA 1UEBA 3EIVA 3CC7A 3PFSA 2JA9A 4O0AA 4QVDA 4GKJQ 4YWLA 4FDBA 3A0JA 4GNXA 3JRZA 2KHJA 3FB9A 2AWNA 2VW9A 3LW5E 2F5TX 3E9HA 2KY9A 2E5LQ 1OXXK 4II1A 4YCVA 2ZPFB 5IN1A 4YY3L 2N49A 3CF5A 1BIAA 3OTOQ 2YU9H 3PO3H 3L2QA 2HQEA 1G3SA 1VIFA 2QA4T 4DK3C 3PIPA 5CKFA 3HFZB 1XNRQ 4HJ9A 2KK4A 5HY6A 1HNWL 4A3CG 4XAXB 2PVOB 1BI2A 5LJ3h 5H1SE 3AFQA 5AJ3Q 3OSVA 1VQ6T 4EQ5A 4DUZQ 1K83H 2D9TA 3MEFA 4X66L 3C94A 4GOPC 1VQAA 3GIBA 4JBJA 4A3FH 4KBMB 4JUVA 1MJCA 4HKEA 2ZTEA 2E6NA 2N78A 4YCWA 3QJ6A 4EMKB 1HNZL 4E47A 4R4IA 3L2RA 2MFIA 3M53A 3NENA 1Q12A 4DV0Q 4WJ3M 5LMUQ 2ZJPA 5GAMf 3KUFA 5M3MG 4JI8Q 3FRNA 3QYHB 5GROA 3RIRA 1NZ9A 1IBMQ 2VYTA 3PO3G 3OW2A 5GAMd 4M75F 4R4QA 5BR8Q 4DOVA 4GLVB 4XTXA 3L2UA 3U4ZA 1TWHH 3V8KA 4A4FA 3S16H 2QXFA 1YVCA 3CCVA 4JV5L 1B70B 4E7JA 1X55A 2YTYA 5FLMH 4A3KH 1D8LA 3CBMA 4RCCA 2EXDA 3WWVA 2RHUA 1HR0Q 4A4KA 3H0GH 4Y28E 3S1NH 4XQ3A 4DR6Q 2QQSA 4JLGA 2K57A 4WJ4A 4NS5A 1I50H 3RLNA 3HHTB 4IOCA 4C92A 2EWNA 1SN8A 2E65A 1QVGA 4C0GA 2ZPGB 3SD4A 4A3LH 3N5BB 3HRSA 4K0KL 1HNZQ 3E0EA 3S2DH 4M7AA 3I4OA 1QVFS 2B8AA 4M77B 2AHOB 2LXJA 1HNXQ 1VQ8T 3JB9H 2F5KA 1UGRB 2BKDN 5FRNA 1N32Q 5A0LA 1VQPT 2E64A 3TCJA 5FLMG 4DR5L 5GAN6 3M4QA 1UE1A 3HOYH 5KH6A 2JK8A 1QVPA 4E7LA 3GTOH 3O8VA 3S2HH 3DM3A 1VQMA 4TVAB 2UUAQ 4FL6A 2XDDA 4X65L 1KQSA 3TEEA 2CYZB 4BBSH 3NFCA 1K3RA 3H0GG 1VQ7T 3CPWS 4KHPQ 4AYBE 4R4OA 1Q8KA 3RKWA 2HHHL 3GTLH 4DV5Q 2R7FA 1EQQA 2I5HA 3OS2A 1EYGA 3MEVA 4IFDJ 1TH7A 4A3LG 1VQCA 4OMFB 2RHXA 4M7AD 3OBYA 2FL7A 4DUYL 2E12A 3G6EA 2XU8A 1V43A 2YTVA 2JOYA 2UU9L 4F7UB 4J8OA 4NL2A 4PJOA 4J15A 4R4TA 5JJLA 4MZTA 5DM7R 3JB9G 4GKKQ 4DR2L 2LVMA 2ZGWA 3ZFJA 2DZCA 3HL8A 1UE7A 4OGEA