3OYYA

Structure of pseudomonas aeruginosa elongation factor p
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
189
structure length
187
Chain Sequence
b'MASMKTAQEFRAGQVANINGAPWVIQKAEFNKSGRNAAVVKMKLKNLLTGAGTETVFKADDKLEPIILDRKEVTYSYFADPLYVFMDSEFNQYEIEKDDLEGVLTFIEDGMTDICEAVFYNDKVISVELPTTIVRQIAYTEPAVRGDTSVMKTARLNNGAELQVSAFCEIGDSIEIDTRTGEYKSRV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Elongation factor P
publication title Crystal structure of elongation factor P from Pseudomonas aeruginosa at 1.75 A resolution
doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Translation
total genus 32
structure length 187
sequence length 189
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-09-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01132 EFP Elongation factor P (EF-P) OB domain
A PF08207 EFP_N Elongation factor P (EF-P) KOW-like domain
A PF09285 Elong-fact-P_C Elongation factor P, C-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.30 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3oyyA01
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3oyyA02
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3oyyA03
3G6EA 2BH2A 1Y1VG 3KYHC 3U58A 2HIXA 4GLVB 4JI4L 3CCLT 5GAEC 4GLAC 1Q46A 1OXVA 2KHJA 4MTNA 4DUZL 4DUZQ 1V9PA 1MJCA 3CD6A 2K5VA 3HOZG 3CCQA 3ER0A 1X3FA 3S24A 4L5SA 2MWPA 1VQMT 1OTCA 4FDBA 2R7DA 3K0XA 4XTCS 3AEVA 4DR7L 4LWCA 4DR7Q 2PNHA 1QZHA 2K75A 4B3SL 2K4KA 3MXNB 2JA8G 5IAYA 4JI7L 4A3CG 1GD7A 3UDXA 4JI7Q 1XPRA 1QUQA 4IPCA 1SE8A 5JEAG 1IBLL 1VQNA 4DV1L 4DV1Q 1VQKT 1A8VA 4OWTB 4C3HH 4OX9L 3A5ZB 1XPUA 1Q7YU 1VQ8T 1L1OB 3S1QH 4DK3C 1PVOA 4QGUA 1VQEA 5C0XG 2IG0A 1YHQA 1Y1WH 1XTDA 2VL6A 2ZTEA 3I4NG 2IHFA 4DR5L 5C44G 4DR5Q 1JJGA 1E7ZA 2NZOA 3FKIH 1VQ5T 4XIGS 2N8NA 1BBWA 4UP8A 1KRTA 2H5XA 2AWNA 1TXYA 4DV5Q 1XJVA 1LM0A 4R4CA 3NBHB 5J26A 2NVTH 3M7NA 3T1HL 1IZ6A 2JQOA 5HGQA 3T1HQ 1HNZL 1HNZQ 2VQFL 1NBWA 1VQHA 2VQFQ 3K8AA 1PA6A 2E2HH 2UUAQ 5IYBG 4BY1H 1K8AU 4B3RL 4JOIC 3F8TA 3JAMi 5IYDH 4LF8Q 2MFIA 3JAMc 1LYLA 3AQQA 4X6AH 3K81C 3HFZB 1TWCH 1CKOA 5IT9E 4DNIA 3GTJH 1EIYB 1Q86U 1KD1C 2ZTCA 4A3BG 2UXBL 2UXBQ 1WOCA 3CF5A 4UP9A 3PUXA 3UDGA 4X64L 1MJEA 3L0OA 3NEMA 4X64Q 1UE6A 4A3KG 1R9TH 4B3ML 1CKMA 2DGYA 5EAYA 4DV0Q 4AYBE 4UP7A 4B3MQ 1H95A 4UPAA 4OWWB 2AMCB 3CCUT 3KLWA 4YCUA 1X3EA 1YHAA 3RR5A 4O2DA 4A3FH 2E2IH 3PO2G 1QVFA 1YIJA 2ZJQA 4X62L 1A63A 3G4ST 4X62Q 5FLXc 2B3GA 5LMNW 2JOYA 2Q2IA 2ZM6L 3CMET 1VQKA 2Y0SG 2ZM6Q 1QVCA 4A75A 2MNAA 3DLLA 2LXKA 2UUBL 4B3TL 2I5HA 4B3TQ 4LUZA 3HOWG 2Y0SE 3RLFA 1MIUA 1YJ9T 1K9MC 2ZTDA 3KJOA 4HIMA 1YITA 2F52A 1PH9A 2R93H 4JC0A 3GTMH 2GVBA 4JI5Q 4WJ4A 1TWFH 2OQKA 4GNXC 2DO3A 1Z9FA 1VQ4T 3M4PA 3CPFA 1CSQA 2QGQA 1VQGA 5LMUL 4X65Q 5LMUQ 1VS0A 3H0GH 1VQ7T 5IT9c 2FXQA 4ZN1A 4P72A 4BA2I 1WFQA 2OTJT 3KF8B 4P74A 4YWLA 4YCVA 2BH8A 1N9WA 1Y1WG 1IXRA 1DGSA 3SGIA 2NN6G 3RLOA 1Q8KA 3U50C 2E2JH 3FKIG 2YV5A 3J7A5 1VQBA 4BBRH 4HIDA 4LFCQ 4IOCA 2YYZA 5LMNQ 4A76A 2V1CC 1HH2P 3HKZG 4KI0A 3CCUA 2JUFA 1S72T 3PV0A 1LTLA 3H3VI 4OO1I 4DV7L 3W5OA 1X54A 4IFDJ 1K83H 3HKZE 1KL9A 4DR6L 1VQDA 4YWKA 4DR6Q 4KHPL 2NVXH 2ATWA 4JV5L 1AH9A 2RHSB 1JMCA 4Y7NH 2E5LL 2E5LQ 4JV5Q 3J81i 4HJ7A 3I7FA 3J81c 3CW2C 3F2DA 3ULPA 1N34L 5IP9H 1QZGA 2HHHQ 2HHHL 2JA5H 2IT1A 1SR3A 1JJ2S 1S3OA 4C3IH 2K5NA 4DV3L 1XNRQ 3HOUH 2K14A 2VZAA 3A0JA 3AYHB 4HIKA 1GKHA 2L3RA 1PH3A 1NZ9A 1NPRA 1NY4A 1PHJA 1D7QA 1YBYA 1K73C 3UDIA 1L1OA 1NE3A 4A3EH 4O0AA 1JT8A 2MI6A 4A3FG 1L0WA 1E22A 1KRSA 2JEBI 5FLMH 2IY5B 4JI4Q 3PUWA 2IHEA 4EQ5A 3JAME 3I2ZA 2JJQA 5DLQE 5C0XI 4DR2L 2R7ZH 1I50H 2RCNA 1VQ7A 2I5MX 2LSSA 1OXXK 2IX0A 1VQIA 2CWPA 2UUCL 3DB3A 4TVAB 3KFUA 5JJKA 1X56A 4QQBX 3OYYA 3KDFA 4LUOA 1Q86C 5LL6S 1P16A 3NELA 4DAYB 3F2CA 2PMZE 1HNWL 1CSPA 2OCEA 2HQLA 4BXXH 1YJNT 5ELOA 1ASZA 4A93G 2PQAA 3I4MH 3E9IA 4B3SQ 2R93G 4PZ7A 3HOXH 4BBSH 4ZN3A 2KDSA 4H02A 4JI2Q 5FJ8H 4JI2L 1XNQL 1XNQQ 1IBLQ 5IWAL 1I6HH 1UWVA 1VQ6A 5IWAQ 4K0KL 4K0KQ 5M3MH 2JA6H 4OX9Q 1RIPA 1EYGA 3E9HA 4GS3A 4DPGA 1NMGA 2VQEL 1EUJA 2VQEQ 4QL5A 2UU9L 2RF4A 3TREA 5FLXE 4GNXB 3HKSA 2UU9Q 4IFDG 4A3MH 4LFBL 1VCIA 2N49A 1M90C 3H0GG 4LUVA 4PZ6A 4NXNL 4DR3L 2YU9H 1QVGS 2WB1G 4DR3Q 1G6PA 1V43A 3T1YL 1HR0W 3CC4T 1A62A 1C9OA 3M3YH 2OWOA 2CWAA 2WB1E 5M5XH 2Q2UA 3M4QA 3LH0A 1JJCB 4BY7H 4J15A 4LF9L 3CQZH 2XHCA 4LF9Q 3KF6A 2WFWA 3CC7A 2ID0A 1X3GA 3Q8DA 4RMFA 3HOVH 1SN8A 3STBD 1PFSA 2JA9A 1I5FA 2BA1A 4B3RQ 3M4OH 4A3GH 1VQPA 4BBRG 1IBKL 4IO9A 1IBKQ 4A3LG 3CCET 1FVIA 1OXSC 3PUVA 1EOVA 3GDEA 5M5WH 1M1GA 1K3RA 1Q81C 3CCRT 4JI6Q 3CCLA 2I5LX 1UE1A 1CKNA 2R7FA 3OW2A 2OTLT 1HZCA 2MQHA 2Z6KC 1XNIA 5IP9G 3HOYG 3BJUA 1Q1BA 1NJIU 3B6YA 1W3SA 3FHWA 3CCMT 1VQMA 4MNOA 4HJ5A 3HOUG 1FL0A 2AKWB 3J80i 3EBEA 1BVSA 5IP7H 4A93H 1SMXA 5JJLA 4GKKL 1QUQB 4CRIA 2C35B 5GAHC 3CXCA 1M1KC 1AE2A 3F1ZA 1N8RU 2KVQG 3GTPH 1EQRA 1KAWA 4A3EG 3U4VA 2R92H 1VQ8A 4GOPA 1HR0L 4QY7A 2UUBQ 5FLMG 1HR0Q 4LNQA 4HJ8A 1XPOA 4JYAL 4JYAQ 3J81E 3S1RH 2R7ZG 4OXPA 2ZJPA 1FGUA 3G71T 3I56T 2NN6I 5H1SE 5IYCH 5C3EH 2B63H 1BBUA 1VQ5A 3CC4A 1AE3A 1NTGA 1T9HA 1Y1VH 1E24A 2IX1A 4TQUS 1K8GA 1UE7A 4APVA 4JI0L 3I4MG 1K0RA 4R4TA 4JI0Q 3JC66 1W2BA 5GADC 3HOXG 4BBSG 3PIOA 1KQSS 3CPWS 4L5QA 2JEAI 1B8AA 1RL2A 3CC2T 1V1QA 4DR4L 4IPHA 1HJPA 5M3MG 4JOIA 1KHIA 4PG3A 2JA6G 4DV2L 2NVYH 1C0AA 3CCEA 5GQOA 4C2MH 1Q82U 1GVPA 3CCRA 4A3MG 3M85A 4RG2A 3S15H 1TWAH 1X65A 1MKHA 2EXDA 3CCJT 5A2QE 3J7AF 3W1BA 3LGJA 3RN2A 5C4XH 5DM7R 3CCVT 1U0LA 4JG2A 3LGLA 3G6ET 4BY7G 5JJIA 4YCWA 1YNXA 1YZ6A 1X9NA 3FP9A 5M5YH 4DV7Q 3S17H 3AFPA 1I94L 3P8BB 4JBMA 1I94Q 4LF7L 4BY1G 3G4SA 5LMNL 1KD1U 3K80C 3CD6T 4IJLA 4IPGA 4A3JH 5IYDG 1Q7YC 4LF6L 3HOYH 3CMEA 1OXTA 1PH7A 2NZHA 1N34Q 1CUKA 1SRUA 5ELNA 1VQOT 4DV3Q 3OTOL 4HIOA 2PI2E 5IY0A 4JBJA 4P73A 1YJ9A 2NVQH 4UY8C 3S1MH 2WAQG 4TVRA 1VQNT 3I56A 3G71A 2BA0A 2MO1A 4YHHL 3L2PA 1UEBA 5M3FH 1ASYA 1GM5A 2E8GA 2WAQE 1YI2T 4HJ9A 4X66L 4DUYL 3RZDH 4X66Q 4LFAL 4LFAQ 1VQ4A 3AFQA 5C0XJ 2F3IA 3CCST 4GNXA 4JI6L 2CKZB 1PYBA 3KJPA 1K8AC 1XMQQ 5IP7G 1TWGH 3TS0A 2LCLA 1XMQL 1PH4A 1IBML 4A3BH 1IL2A 4DR2Q 4IJHA 1K9MU 1E1TA 4A3KH 3D0FA 1PV4A 4A3DH 1VQLT 4KHZA 3RNUA 4POGA 3TRZA 5GAGC 3K7AH 2N78A 2UXDL 1XMOL 2UUCQ 2UXDQ 2OTJA 1EWIA 1XMOQ 2YTVA 4IPDA 1VQJA 4JI8L 4L5RC 2CFMA 2R92G 3DM3A 1KXLA 1HNWQ 2KENA 1Z47A 3PO3H 5K36G 2G3RA 4QJFA 2F4VL 2CKKA 5HY6A 1EFWA 1NJIC 2F4VQ 1N32L 2ASBA 2VNUD 1N32Q 5C3EG 2B63G 2VUMH 1PH2A 3J80E 2QA4T 2AHOB 2K52A 1QVFS 3CMAT 2CQOA 4DK6C 1KIXA 3S16H 4X34A 1S72A 4GN5A 4NPSA 3CXCS 4A3IH 2QEXT 1N8RC 2A1AA 5GROA 4LFBQ 3ULJA 4DKAC 3VDYA 3TQYA 3EN2A 1WCMH 4NXNQ 4Y52H 3PF4A 4KLKA 4GKJL 4GKJQ 1YJWT 4R4QA 3RLNA 3T1YQ 3KOJA 3BZCA 1VQOA 4BA1I 1KC8U 3J81j 4NXML 1HZAA 3CP0A 1VQCA 4OONA 2ES2A 4NXMQ 1YIJT 1G291 4NB3A 2JA7H 2XGTA 3I4OA 1VQAA 4YY3L 4YY3Q 3U4ZA 1WJJA 3UE0A 4DAMA 4GOPC 2MO0A 5C4XG 3GD7A 2Q2TA 1YI2A 3I55T 2ZJRA 3H15A 3PUYA 2YTYA 1W2BS 1EIFA 1I3QH 3CCSA 2ALYB 2N3SA 1JJ2A 2PI2A 1Q1EA 3RN5A 3S2HH 1YITT 1BKBA 1Y14B 4A3JG 4DV5L 1VQLA 3E0EA 1LUZA 4LW1A 2YTXA 2JA5G 2D0PA 1Q82C 1JE5A 3KDFB 4MZ9A 5AJ3Q 5AJ3L 4QIWE 1N36L 1K73U 4DV6L 1N36Q 4JI3L 4DV6Q 2HT1A 4JI3Q 4A3LH 3J80c 1SFOH 1NPPA 2PQAB 1YJNA 2UUAL 4DV4L 3M9BA 4DV4Q 2VY3A 3S14H 3ICEA 2KHIA 4GKKQ 1L2FA 5M3FG 4LF8L 2L15A 4KHPQ 3G48A 4WJ3M 2LXJA 3PIPA 2QA4A 4EX5A 5E7NA 3CMAA 4JBWA 2Q2HA 1JB7A 1A0IA 2QEXA 1WYDA 5C4JH 4LF4L 2MWOA 4LF4Q 4AYBG 5J3BA 4A3DG 2A19A 3PSIA 3J7ZC 2VS1A 4DV0L 1VQ9T 1UE5A 1YJWA 2E70A 1E1OA 2D0OA 4P71A 3STBC 4POFA 3H3VH 3K7UC 1TWHH 3PO3G 2VW9A 3EIVA 3RZOH 3KF6B 3F2BA 4BXXG 4LF5L 1SROA 4DR1L 4LF5Q 4DR1Q 3ZJYC 2K5HA 3MEFA 4A4IA 2OQ0A 5FJ8G 3HOZH 1M90U 2B29A 2VUMG 1WI5A 1PH5A 1HZBA 3I55A 1QVGA 4DR4Q 2EIFA 1X55A 3TEHB 5IE8A 4DV2Q 3ERSX 3BZKA 3S2DH 4A3IG 4ME3A 2HIVA 2JA8H 1EQQA 1FJGL 4A3CH 1CKNB 1FJGQ 1GO3E 2JE6I 3ULLA 3GTOH 1WCMG 2D62A 1HNXL 1L1OC 1OXUA 4JI5L 3W1GA 1PH6A 2OTLA 2KCMA 2Z0SA 3PCOB 3UDFA 3A5UA 1HNXQ 3IRBA 2I0QA 3CCMA 2Z6KA 1J5EL 3GTLH 3LGFA 1J5EQ 1PYSB 4JI1L 2JK8A 4JI1Q 4X65L 1X6OA 1SLJA 2JA7G 4PZ8A 4GN4B 4PMWA 3HOVG 3I4NH 1Q81U 3L7ZC 5C44H 2R6GA 2XTIA 4LF7Q 4JCVE 2UXCL 2UXCQ 4AQYL 1NMFA 2LQ8A 3WWVA 3CCQT 4HJAA 4AQYQ 4A3GG 4YWMA 3UE1A 4LF6Q 1B7YB 2KBNA 1G51A 2CCZA 4JBKA 3GTQH 1D8LA 4GOPB 2KCTA 1S40A 1IYJB 4C3JH 3OTOQ 1YHBA 3CAMA 1N33L 1N33Q 4L5TA 4YTLA 4AIMA 5IYBH 2JVVA 4RG1A 5JEAJ 1HZ9A 2AWOA 4LFCL 4IOAA 1VQ6T 4YHHQ 2JNGA 1KC8C 2EQSA 3KBGA 1B70B 1M1KU 1VQ9A 1J6QA 3D31A 3GO5A 1SSFA 3PUZA 4R1JA 4OWXB 4DUYQ 1U5KA 2GVAA 3DB4A 1YHQT 4R4OA 4AH6A 2A8VA 3GTGH 1PH8A 1IBMQ 1O7IA 2WP8J 4R4IA 3PF5A 4QQDA 4IFDI 5BR8L 5BR8Q 1XNRL 3CC2A 3S1NH 3TS2A 1P8LA 3PGZA 4JI8Q 4ALPA 2E6ZA 3PO2H 3BU2A 3CC7T 1YEZA 1YVCA 2LVMA 3OW2S 1VQFA 3A74A 3NENA 1C7YA 1E3PA 1Q12A 1PH1A 4GN3B 3CCJA 1VQPT 2GN5A 5IYCG 4GLXA 3GTKH 2RHQB 2K50A 4OO1G 1KQSA 4P75A 2DUDA 3CPWA 3CCVA 3HOWH
chains in the Genus database with same CATH superfamily
2PYKA 1WXTA 1Y1VG 3P20A 1G6ZA 1E2VA 5HK3A 3EHRA 3BDUA 2M2LA 2VWFA 2KE9A 3R2TA 2X35A 1V9PA 3TQ7P 2PVGB 1X3FA 5LJ3h 1B1ZA 3S24A 1M27C 3M0UA 4DEXA 2F0WA 2MWPA 1VQMT 4IUQA 1ZLMA 3NTHA 4DR7Q 1BI0A 1F77A 4C3IB 3S1NB 4B3SL 4CDCC 5D7UA 2K03A 2K4KA 4JI7L 4A3CG 1KDAA 4IPCA 5JEAG 2ATCB 4DV1L 2HAXA 1G8ZD 1Y96A 4MTKA 5F2DA 4C3HH 4OX9L 1IRXA 2RCFA 4HCBA 1JWMD 1Y07A 1L1OB 1PZID 1WJRA 1STNA 5FKAC 1XPUA 2Y0SB 5C0XG 1Y1WH 3V8KA 4DEYA 2EXZA 1YFNA 3I4NG 3HOWB 2NUTB 4C0GA 4DBHA 1K3BC 1WTOA 1JJGA 2NZOA 2R7ZB 4XIGS 1BBWA 3EVQA 4UP8A 4X3KA 2AWNA 4HCSA 2CT3A 4R4CA 2IX3A 1JU5C 5J26A 3A56A 3M7NA 1IHWA 1VOMA 2BZYA 2CP0A 4EMKB 1ET9A 1QG7A 2DERA 1S5DD 2DY8A 1NBWA 1PA6A 2VQFQ 5ELCA 1PSEA 2E2HH 1EOTA 5IYBG 1QE6A 1SRLA 3THKA 4JOIC 3F8TA 3JAMi 2A36A 1G3SA 1ZYRC 1YNJD 3HS0C 5CQXA 5ELFA 3BY7A 3PFSA 1ZUYA 5IT9E 2COZA 1NM7A 2JN4A 3GTJH 4ZKBB 1BNZA 2VB6A 3OS5A 4A3BG 3S1QB 2UXBL 1WOCA 3CF5A 1MJEA 2ED0A 3DWPA 3L0OA 1UECA 4X64L 3NWTA 4A3KG 2DYIA 5IGEA 5HCKA 3PMIA 4LK1C 4B3MQ 2YDLA 1W70A 2HMAA 3CCUT 4YCUA 1QKWA 1X3EA 1YHAA 5ISRA 3RKWA 3CCUQ 4AMCA 3QXEB 1YIJA 3QHSA 1JO8A 2ZJQA 1LTSD 2I46A 4NKLA 1U1SA 5KIXA 1BCPF 2JOYA 4BY1B 1VQKA 3K57A 2F0HA 1QVCA 3M4OB 3HGBA 1GCQC 3ME9A 4FO2A 2Y0SE 2DF6A 3RLFA 1YJ9T 3MEHA 2I0NA 2LT1A 3I9QA 1SE3A 2FRWA 3A98A 2A73B 7AT1B 4FT2A 1WXUA 2F1LA 2YRDA 2E64A 3G6JB 1WTRA 3FEOA 1JJ2P 2RQXA 2DLPA 1TWFH 1XWEA 2LP5A 2EYJA 2A7YA 4GNXC 2EDGA 2EYPA 2F0FA 1SG5A 1NCVA 5LMUL 1PFBA 4A3FB 1VQ7T 2E2IB 5LJ5h 1SYGA 2AKKA 1ZXTA 3QZ9B 2FXQA 5JAVA 9ATCB 1VQ7Q 3NMZC 2OTJT 4P74A 2B2VC 1OZ2A 5CYUA 1N9WA 3BDOA 2K5LA 3FJPA 2C9OA 5KYYA 1TT2A 2WSCE 2NN6G 5CV8A 4ZGDB 4HVVA 1HFGA 1Q8KA 2G5DA 1E0BA 2G9HD 4ZTJA 4X1VA 2G6FX 2L3PA 4IOCA 1UDLA 2DTHA 4M7DE 2YYZA 1SMYD 1VQ6Q 4KI0A 2PZWA 1S72T 3PV0A 4C8QD 3H3VI 1CHQD 2VYTA 3H6ZA 2RDGA 3I70A 3W5OA 1K83H 4HN7A 4DR6Q 2NVXH 1M9SA 2SEMA 4R56A 4KN4C 4A3MB 4Y7NH 3CBPA 2HUGA 2JJ9A 3H94A 3ZBDA 3I7FA 3P7JA 5I2XA 3J81i 4K5XA 1PFNA 2F0LA 5IP9H 4C5EA 4RKUE 2M16A 1SR3A 1XNRQ 4C3IH 1T0HA 2RQWA 3EFSA 1JCKB 3QDFA 3OYFA 1PTOF 1U5SA 1O7YA 5KYIA 3CC7Q 1D7QA 5GANj 1PRTD 1K73C 3OYLA 2E2JB 4N4IA 2MI6A 4OHJA 3H9NA 3HL8A 4ULLA 1QCFA 1EZZB 1N5ZA 2HDAA 4A4KA 3PUWA 2JMAA 3EFOA 3I2ZA 2BZXA 2JJQA 3EHQA 1M3BA 3N6RA 3K59A 2R7ZH 1A2UA 2HNIA 3VKIA 3E1SA 1U9RA 4RA8A 4FYYB 5CO7A 2IWHA 1WTVA 2K5WA 1WTXA 2UUCL 3KFUA 5JJKA 1P16A 4PMBA 3MP6A 2PMZE 3URYA 3NBHA 2O5JC 2JA5B 3Q24A 4E6RA 1YJNT 1WHMA 5ELOA 1ASZA 3I4MH 5LJ3j 2WSFE 2EYZA 4B3SQ 2SNMA 2J6OA 3HOUB 2R93G 3MP1A 3LH5A 4JI2Q 1XNQQ 1I6HH 4K2KA 2VASA 4K0KL 5M3MH 2EJGC 4OX9Q 4EMHA 1K1ZA 1VQKQ 2X6LA 3E9HA 2HKQB 1NMGA 2J06A 3RUZA 2DL5A 4DPGA 5CBAE 2VQEL 2UU9Q 4MN3A 4A3MH 2V26A 5GMKe 4AFZC 2K3BA 1O7LA 2DX1A 2NYZD 2YU9H 4BI4A 2WB1G 5HGTA 3M3YH 1TQOA 1A62A 3R8BA 3NTIA 3ND9A 2Q2UA 3LH0A 4BY7H 2R57A 1KTKA 2F2VA 3REBB 4PMCA 3EGXB 5DAUA 1V1CA 4C92B 5EQ0A 2WFWA 2ID0A 2RA2A 1I5FA 2QYZA 1WQWA 2BA1A 1WVLA 3M4OH 4A3GH 1ESFA 1VQPA 4BBRG 4IO9A 1H9SB 1CKAA 4OMMA 2DD5A 3TSZA 1FVIA 1OXSC 4KULA 4MZMA 3RIRA 1M1GA 2JA6B 3TVTA 3CCLA 1U8RA 2DJFC 2I5LX 1A6XA 2DM1A 3ASKA 3ZL7C 4AG2C 2GNCA 1WHGA 1H3HA 4WORA 4JRKA 2RHZA 2PZTA 3T1HL 1C4QA 1XNIA 1GUGA 3VR5A 3BJUA 5BN3A 3HOYG 1I8FA 1NJIU 3OOCA 3V8LA 5I2YA 2O5IC 2MF2A 1ZEQX 3NE5B 3MKDA 2VGNA 2AKWB 2E6NA 3HSBA 5M5XB 1SMXA 3NP8A 4KHPL 4CRIA 5GAHC 4WJWA 3GTPH 2DILA 2DN8A 4EPCA 1WA7A 4FF4A 3LWHA 5GANe 4A3EG 1D0ZA 1VQ8A 4GOPA 3L42A 4A4HA 3LX7A 2RJEA 1RAFB 4JPBW 2C5CA 1I3QB 4OXPA 5H1SE 1UGRB 1F9QA 3PIO3 3QG1A 3HRSA 1VQ5A 1CK1A 4OGCA 1J9OA 2NWGA 1EY8A 2KRSA 1G91A 1AE3A 3I8ZA 2LRQA 4R0KA 2NUZA 1Y1VH 2RJCA 1D5ZC 1YN8A 3ULRB 4E47A 1VQ4Q 4C92E 1RACB 1UE7A 4I65A 4JI0L 1G2TA 3HOXG 1KQSS 2B2TA 4A93B 1ENCA 4L5QA 1M1FA 1B8AA 3CC2T 1WD0A 2ROLA 4IPHA 1HJPA 1KHIA 3BZDB 1JXMA 2NVYH 2CSQA 3CCEA 5GAN5 1AEYA 1T3LA 5LJ5j 2JS2A 3JB9D 1Q82U 1ET6A 1GHKA 2J7ZA 4M75G 3CCRA 3VYSA 4RG2A 4JLGA 3M85A 2R92B 4QUCA 1MKHA 1HCZA 4M7AF 2GF7A 3MVVA 5C4XH 2OAUA 3OYDA 1ZQ1A 4UHVA 2B63B 4M78C 5IIFA 2A6HD 1UUEA 1K8AR 2JM9A 4YCWA 5EG2A 3FP9A 1IW7C 3QOJA 1I94L 3P8BB 2EVBA 2NBFA 3G4SA 3K80C 4JRIA 4N4HA 1Q7YC 2L11A 4DAVA 1Q86R 1CUKA 1B3AA 5C4ZA 1VQOT 4FT4A 3OTOL 5KYUB 5IY0A 1VQOQ 2ZPHB 4KD3A 1JR0D 4TVRA 1VQNT 3I56A 3G71A 5HURA 3L2PA 1A3TA 2DL8A 1ZSGA 2DPPB 3A7AB 4HR7B 1KLUD 1GM5A 2RD1A 4X66L 4LFAL 2JXBA 2RH2A 4F7UB 3CCST 3UATA 2CKZB 1PYBA 4JI6Q 2RQVA 4A3BH 5IP7G 3TS0A 1JXOA 2NWMA 3CCSQ 1M90R 3TMEA 1K9MU 5M5YB 5FU6C 4A3KH 4KHZA 3P75A 3TRZA 4D6WA 5GAGC 2N78A 2DIQA 2UUCQ 2RDFA 5I22A 1VQJA 3O13A 3UPUA 4FSSA 3VS6A 2G3RA 3E6ZX 4WF2A 2F4VL 2CKKA 1EFWA 2K01A 1NJIC 1FYCA 1D0YA 2PZUA 5C3EG 3QBYA 2JXMB 3EH1A 1KG1A 5IGCA 1PH2A 2QA4T 1TS3A 5J22A 4KN7C 3C1FA 4DK6C 1CTMA 2DXBA 3G7ZA 4X34A 2QA4Q 2LJ3A 5CQYA 3VDYA 4M75A 3T4AC 1JOQA 3L9AX 4GKJQ 2DIGA 3H3VC 2QQBA 4OIJA 1RAIB 2FZGB 4M7DF 3KOJA 4QCLA 3SD4A 3HP3A 3C3LA 4GZYC 3J81j 4NXMQ 4KMUC 5DM63 4XYOA 1PRLC 5LJ5e 1OEBA 3QJ6A 1VQAA 1M1KR 1GOZA 2HDMA 3U4ZA 1JB3A 4GOPC 1B7TA 1NBEB 1YI2A 2RHIA 1S5CD 2F3VA 1X2QA 2V1QA 1MUZA 4F7UE 1VF5C 3K5LA 1EIFA 2R58A 1I3QH 2PI2A 1STBA 2ZXOA 3RN5A 1Q1EA 4JW0A 1SNQA 2F0KA 1BKBA 2AT1B 4XK8E 3CCRQ 2ZXPA 4A3JG 4A3IB 2A68C 4LDYA 5M9OA 1LUZA 3DHQA 2YTXA 1G8XA 1Q8IA 1OZ3A 2D0PA 1CQFA 1Q82C 1IO6A 3OQ5A 5BN5A 1QP3A 5AJ3L 1N36Q 3JCMQ 3FPUB 3PIP3 3K58A 4JI3Q 4A3LH 3QWYA 3ITPA 2BTTA 2FRYA 3BFMA 3FLGA 2EQMA 5DNFA 1GFCA 2F0IA 2VY3A 2ZPEB 1TTHB 3QIIA 2ESWA 2KHIA 5M3FG 1HFNA 2L15A 4KHPQ 3G48A 4KUIA 2ABLA 1D09B 3M55A 3S9WA 3M0PA 1PYWD 1PRMC 3RERA 3NQTA 2L4NA 2QEXA 2ZPBB 4J7IA 2LJ0A 2FPEA 3UA7A 3RNJA 3S2HB 2L9HA 3RUXA 1LTRD 1YJWA 3OA6A 4POFA 3H3VH 2NZ1D 3HZXA 1QNKA 3PO3G 4BXXG 3EIVA 2P5ZX 4DR1L 4M78D 3OYMA 2K5HA 2DZ9A 3IFDA 1SFOB 3Q6SA 2J6FA 1IW7D 1M90U 3A8KE 3NK9A 3S14B 4JJNK 1TU0B 4ZUJA 1QVGA 1T3SA 1W6XA 2L0AA 3QZ5B 3I5SA 1IREB 3BW1A 2DEUA 4ME3A 1V76A 1EQQA 4IKFA 1GUWA 3R6NA 4FSXA 4RFBA 2V4DA 3M7GA 1WCMG 1HNXL 3W1GA 2GFAA 2RSNA 2JZ2A 2P0KA 3CCJQ 1TR5A 2RF0A 3X25B 3GNGA 2RM4A 3M54A 1HXYD 1J5EL 3LGFA 4OELB 2JK8A 3UI2A 1HXDA 1X6OA 2KNBB 1GHJA 4I7AA 2BE5C 4PQXA 2F1MA 4PMWA 1MSHA 3Q1JA 2JA7G 2A5HA 1Q81U 5C44H 3HOVG 4JCVE 4M77C 4RCNA 4YWMA 1OV3A 2KBNA 1FGBD 2EKHA 1G51A 4A4GA 3G7LA 4TKOB 1UHCA 4Q5VA 3CXCP 3TCJA 3OTOQ 1TSFA 1W6KA 2NTSA 1HQRD 5KNBA 1N33L 4E2FB 3MEUA 2BKDN 5E4WC 1OPKA 2AWOA 2PCFB 2JA8B 4LFCL 2LKVA 1MV0B 1MHNA 1B3QA 1B70B 1M1KU 3SK5A 5LMNL 1SSFA 4BACA 3SWNB 4PK4A 1STGA 1PD0A 3MXGA 5GJWB 4J9IA 4OMFB 2IW3A 1C48A 3E19A 1X3PA 2K5DA 3SK4A 2K05A 2NB0A 3OMGA 5KYWB 3VR3A 4C8QG 3CQTA 3PF5A 4QQDA 5KYXA 5CKHA 4KKTA 1EY4A 4F8MA 5I9PA 3BE3A 1W2BP 3TS2A 1P8LA 4M4ZA 5LJ3g 2CP7A 4O5VA 1HUNA 4PKCC 3BU2A 1YEZA 2LFNA 3NUCA 3BS1A 4LUEA 3A74A 1Y71A 1C7YA 1ACMB 1I4GA 4C3JB 1PH1A 1M4ZA 1VIFA 2EJMA 2K7VA 1O80A 4GLXA 4OO1G 4LD6A 4BE2A 2QDBA 5G3LF 2PZ1A 4KUDK 4QT7A 1V1PA 1TUGB 3G6EA 2YT6A 3R6OA 3U58A 4GLVB 1STEA 1WHLA 2Z8LA 4H7BA 1M2OA 3QUIA 1I6VC 1ZSZA 3LYIA 1ENFA 1KQ1A 2D2CC 1QJOA 1WJQA 2QEXQ 2KHJA 2FZKB 3QYGB 4MHEA 1MJCA 3CD6A 3HOZG 5D6WA 3CCQA 5GANf 1WHHA 2KT8A 4DXFA 2DBKA 3S3NA 1Z9QA 1DOLA 1LTBD 3K0XA 4FDBA 3ZFJA 5GAMd 4DR7L 1YJWQ 2BZ8A 5FU7C 3SB2A 2K75A 2XDDA 2LC4A 5IAYA 1Z6HA 3KLSA 1QUQA 5C3WA 2NUPB 3PO2B 4J9HA 1A8VA 4OWTB 3MEAA 4N9TA 2DBMA 3A5ZB 4KK7A 2JTMA 4DK3C 2MAMA 4KH1B 1AZPA 1Y57A 1YHQA 2OXPA 4C5HA 2ZTEA 4ATOA 1D5XC 1DZ1A 5COYA 4DR5Q 3I73A 1DOMA 5IGBA 1NLOC 1E7ZA 1YITQ 2B2YA 2EY1A 3BDCA 3FKIH 1F9RA 2COWA 2A08A 5A0DA 2H3JA 1TXYA 2MYSA 1WZOA 1MNEA 4CI0C 4AG1C 5CR2A 1BCPC 2L2PA 1IZ6A 3I35A 2JQOA 1ZBJA 2PTKA 2KVMA 5HGQA 5FLXL 2VQFL 3K8AA 4B3RL 4BDZA 4K5WA 4R9WA 4CC4B 1RDPD 4LNPA 2EJFA 3A8MB 2PU9B 5GAN6 4C8QA 5CR3A 4G7HC 3AQQA 1TWCH 1CKOA 2HDLA 4C3HB 1EIYB 1NLPC 1VUBA 4RTZA 1KD1C 4B9WA 2ZTCA 3UDGA 4UP9A 1Y1WB 1G2BA 1LPLA 2MIOA 3NEMA 3SR1A 3MP8A 2ZXRA 3JB9J 4R8IA 4OIKA 4B3ML 4EIKA 4IUTA 4ORZA 1RHPA 1WQ7A 4ILWA 5EAYA 2CQAA 4UPAA 2AMCB 3KLWA 3RR5A 1KDBA 2EOTA 2QCPX 1M2VB 4L6TB 5IT9L 4PJOB 3L2RA 1A63A 4X62Q 4DFAA 3N5BB 2DK3A 5FLXc 2B3GA 2RO0A 3N52A 2E2HB 4K14A 3JV3A 3CMET 2Y0SG 5IGFA 2RI2A 2ZM6Q 2XDBA 4ZK9B 2MNAA 1H9RA 3DLLA 1BOSA 2J4XA 2I5HA 4B3TQ 4LUZA 3HOWG 4M77D 1LTID 1K9AA 2X4XA 5HKCA 1ARKA 2V8IA 1HRJA 2EGCA 3HG9A 3SXHA 2EYLA 2ZTDA 3GTJB 4JC0A 3GTMH 8ATCB 2GTOA 4XTWA 2EY5A 2YRCA 1EIGA 1WGSA 4WJ4A 1AW7A 1B34A 4J8OA 4PL6A 2OQKA 2AUJD 3NBIA 2DO3A 2YWWA 5KCOA 1NAPA 2QG9B 3GPLA 1CSQA 5D3IB 3OW2P 2QGQA 3BVMA 4IFDH 3LW5E 3C95A 1FR3A 1VS0A 4KD4A 3U23A 3H0GH 5C3XA 5GAMh 5IT9c 4P72A 1I4PA 2RJDA 1Z7TA 4PJNA 1WFQA 4YWLA 4A53A 3AT1B 4ZYSA 3CCQQ 1PTOC 4QQ6A 2KEAA 4RTWA 4IURA 5FWCA 5JPMC 4IUVA 1LT6D 1CQVA 4TSSA 4M7DG 2DTIA 2L1BA 1C6VX 1KJWA 3JB9G 3J7A5 1Y69U 4LFCQ 4DOVA 3EGDB 2Y4XA 1ZSZC 5LMNQ 3S16H 1YCSB 2ECZA 3CCUA 2JUFA 3M9QA 1TXQA 1TWFB 2MP1A 1X54A 4PJOE 4DR6L 5LJ5f 4XU2A 2ATWA 4V2SA 4FVMA 4JV5Q 1JMCA 2E5LQ 3GBQA 3ULPA 5GAN4 3CW2C 3PNWC 1QILA 1OYXA 4K6DA 2HHHQ 5A35A 2VXFA 4DV3L 2F3WA 3MAQA 3OYJA 1E6GA 3AB9A 2R61A 3AYHB 3KFVA 2L12A 1IKLA 1I4K1 1RI9A 2DFUA 2K4YA 2IPKD 4QB4A 3T51B 1YBYA 4DGZA 5D6YA 3UDIA 3QKJA 1WIEA 1L1OA 2Y4YA 1NUCA 4CDDC 4PJMA 2EYXA 4E7LA 1E22A 2JEBI 3E5SA 1L0WA 5FLMH 4A3FG 2IY5B 2VB3X 2LQNA 2B2YC 1QQJA 2NUTA 5C0XI 1AP0A 1MI2A 1I50H 1VQ7A 2D0NA 1K83B 1PXUA 1U4MA 1HK9A 2EAYA 4HT9A 4M75F 1H3ZA 1VQIA 4IQZA 2HL5C 2NVXB 1RUWA 1B9MA 4LUOA 4Y7NB 3OSSC 1PKTA 3L3OC 1PTOH 1CSPA 1HNWL 3KLSX 2OCEA 1KSWA 4QVZA 5CVIA 1VQMQ 2HQLA 4EMKA 5DY9A 1MGSA 1SNCA 2ICEC 4BXXH 4DBRA 1RCVD 4QMGA 1R0CB 5FRNA 4BBSH 4JI2L 2SNSA 1HA6A 1XNQL 5I11A 1UWVA 1VQ6A 2MHVA 1WFWA 5JVH3 1EYAA 2YLCA 3LLRA 2LQKA 1HPCA 1EUJA 2UU9L 3WVDB 4QL5A 4GNXB 3TREA 5FLXE 3HKSA 5FW9A 4LFBL 2KSSA 2J7IA 2N49A 2E5QA 4NXNL 4LUVA 4N9PA 1QVGS 3X3MA 4DR3Q 5AYFA 1G6PA 2NLUA 1TVXA 1V43A 2EQUA 3CC4T 1H9MA 4M7DA 2OWOA 2F03A 3QO2A 5C0MA 3CC4Q 1CA6A 3CQZH 2L8DA 2BH2A 3CC7A 3KK7A 4HSVA 3VA7A 5BN4A 3HOVH 1PFSA 4B3RQ 1KK7A 3MO8A 3EG9A 3I4MB 1XXGA 2EBPA 3EG1A 1NNXA 2LDMA 4F04B 4PFOA 2KUMA 2OI3A 2B2WA 1I6HB 5M3MB 3HTRA 1K3RA 5M5WH 5ELDA 3WDNA 1DONA 1PZKD 3JCMd 2F0VA 3OW2A 2X3WD 2OTLT 1HZCA 1I0CA 2XMFA 2HD0A 2PW5A 1QWFA 4KH0B 2Z6KC 2AQ2B 2Z6BA 2YU9B 2R3ZA 3DLMA 4HJ5A 1W3SA 3CCMT 3HOUG 3M3YB 3P8HA 1H9JA 2V8JA 3V7RA 3EBEA 4BY7B 3PVLA 4L6V5 4LE9A 3IAYA 1SBBB 1XTCD 1N8RU 2KVQG 1Y96B 3CRLC 4K8JA 4A3GB 2QXFA 5CGKA 4JS4A 3R2IA 1R4PB 4KRTA 4HJ8A 1BBXC 5KYNA 4M7AC 4P2CB 5K36H 1LCKA 2AHJB 3S1RH 1UGSB 1YJ9Q 1AN8A 1FGUA 1SNDA 2NN6I 1K8MA 1W4SA 5KEEA 4K2LA 3EFRA 1NSNS 4C92G 3T16A 2FPFA 2X9HA 1JBMA 2RB6A 2X3XD 2XU8A 3D6CA 3AMUA 3S6WA 1E24A 1O9SA 1JC7A 2FHTA 4R4TA 1GUNA 3JC66 2J0TD 3PIOA 1Q7YR 1WHJA 5CKDA 5EJWA 1WTQA 2IPOB 1V1QA 2CW0C 2Z9HA 2JA6G 1C0AA 4E7IA 1F2ZA 3IQLA 3GTPB 2OTJQ 5GAMj 2FPDA 1TWAH 4PJOD 3KUFA 4ELZC 3J7AF 4N8X1 3Q0AA 2PPBC 3LGJA 3CCVT 1U0LA 5GAOp 4FW2A 1TG0A 4NL3A 4O1NA 1PG5B 1YNXA 1YZ6A 1AZQA 3S17H 3AFPA 1S72Q 2FMCA 2O2OA 1TWHB 1Y1VB 2Z4HA 3QPHA 2YLBA 4LF6L 4RHSA 1D1CA 1G3TA 1OXTA 4KY7A 3BDLA 2N88A 4DV3Q 3OYGA 4HIOA 3SVMA 2SOBA 2F5TX 2NVYB 2EE1A 4J7FA 2QGGA 5CV7A 4UY8C 4XQ3A 3JCMJ 4J9BA 2BA0A 2MO1A 3MXUA 4VUBA 4YHHL 4PNYA 1DJRD 3GTOB 5E4XA 3M4GA 3RZDH 4DUYL 3H91A 2GQIA 3JCMh 1VQ4A 5C4XB 4JI6L 3QDRB 3WOEA 4PFZA 2H3EB 4A93G 1IBML 4JJBA 4PV1C 3JCMP 3FEWX 4M7DC 1E1TA 4GLKA 2AZVA 1N9SA 3OY9A 3D0FA 1VQLT 3RNUA 4POGA 4A3DH 2KA7A 4FF3A 2UXDQ 4XTZA 1VQLQ 1XMOQ 2R92G 4L5RC 3DM3A 4XU1A 1HNWQ 2EYYA 3H0IA 4C0ZA 4C92A 1Z47A 5I6WA 2PW7A 2VXEA 3VS2A 1YJNQ 3D7SB 3M58A 2HQXA 4KT0E 4MZPA 1FD7D 1A2TA 2B63G 3JCMW 2VUMH 5FO9B 1GBQA 2PUOB 2F0UA 2K52A 3CMAT 5FO8B 4EMGA 2MGSA 4GN5A 1EYCA 3CXCS 1RAEB 3CMAQ 1ZYRD 1N8RC 1OPLA 2E2DC 4LFBQ 3ULJA 1AWXA 3EN2A 4NXNQ 1MNDA 4A3BB 1JWUD 2QAZA 4GKJL 3WOFA 4AYBB 2CT4A 4A3KB 3CRKC 1Y8PB 1VQOA 3NFCA 4NXML 3X20B 2L0CA 3CP0A 4OONA 4BY6C 1YIJT 2P4TA 1G291 1RJTA 2VB2X 4NB3A 3V2TA 5IGDA 3I4OA 4YY3Q 2K28A 3UE0A 3VS1A 2RHUA 4DAMA 5JPNC 1IB8A 4F7UG 2EZVA 4HAEA 2Q2TA 3I55T 1F1BB 4FIBA 4C8QF 3I55Q 1W2BS 3CCSA 1JJ2A 3AU7A 3EFOB 1KHCA 1M3CA 4M78B 2WKCA 2OAWA 4CC3A 2DNCA 2EYOA 3Q23A 2OT2A 3MXPA 1Q95G 4M7AD 4LW1A 1KABA 2KK4A 5GAN8 1MV3A 1SSOA 4MZ9A 1N36L 4F87A 1CA5A 2ZPGB 5CAIA 4JI3L 4DV6Q 1AWWA 2HT1A 2O9VA 2O01E 4NDXA 4AFSC 4DV4Q 1D3BB 4OF1A 1PRTF 1WX6A 3VR2A 3PIPA 2QA4A 4XYQA 1L0XB 2YUPA 5KE3A 1PFMA 2A6EC 1U4LA 5E7NA 4B9XA 5GAN7 3F2UA 1A0IA 1HSQA 4HVUA 2XICA 2DNEA 1WYDA 4FXGC 1ZHIA 4LF4Q 1EY7A 2A19A 3L2UA 2KAFA 2BCOA 3PSIA 3J7ZC 2JS0A 1F2LA 4DV0L 1JEGA 3OWFA 1VQ9T 2H4OA 1GFDA 2D0OA 5FU6B 3STBC 4KTAA 2VVKA 1VQ9Q 4RKBA 5I21A 1TWHH 2VW9A 3JCMc 4OMPA 3RZOH 4J8QA 4DK0A 1JORA 3MWYW 2K6AA 1SROA 2EY2A 2K3XA 4DXGA 1G83A 2EY6A 3MEFA 4A4IA 5FJ8G 5LJ3e 2I2LA 2OX7A 5D3DA 4JUVA 1HZBA 2KY9A 3PMTA 2EIFA 4FF2A 5DEHA 3CC2Q 1II3A 4K11A 5KYUA 3S2DH 4A3IG 1BO0A 4ID6A 4M78E 4A3CH 4OB2B 2JE6I 2HL3A 1FJGQ 3GTOH 1S4ZA 5JEAH 1OXUA 4JI5L 1PH6A 5C6SA 3A5UA 2I07B 4AFQC 4RGTA 2I0QA 2HQEA 1VYTA 4JS5A 4F7UA 5GAN3 5E3FA 3GTLH 2FMMA 5C0XH 4JI1Q 2E41A 3TP5A 2YHTA 1PD1A 2CDTA 3I4NH 4OVAA 2HEQA 5EGTA 4OB3B 2UXCQ 4L5GA 3WWVA 2KGTA 3FRNA 4B6MA 4CKEA 4HJAA 2FZCB 4AQYQ 1K8OA 3UE1A 3VYTA 4LF6Q 1B7YB 4DAYA 3GTQH 1K28A 1YWPA 2C0TA 4GOPB 4JI7Q 4CDFC 1MMDA 1MMNA 1YHBA 1UTIA 2RBMA 3VRZA 1JWSD 2L3SA 3GIBA 2O2LD 3A8LB 5IYBH 4RG1A 4H0LC 5T1GA 2M1HA 2JNGA 2VC8A 3GO5A 3R3OA 1VQNQ 4YHHQ 1J6QA 4R1JA 4OWXB 3PUZA 4DUYQ 2XWJB 1IKMA 2GVAA 1MSGA 4ZKCB 3GTGH 2QGFB 3SDZA 1ZUUA 3M5AA 5CBEE 2EGEA 1ONLA 1PHTA 1MHWC 1U1TA 2BDOA 1IYVA 4IFDI 1B53A 1Z9ZA 2E65A 5C44B 3FC3A 5GAOn 2KHSA 4ALPA 4ME7A 2E6ZA 5CV5A 1RKNA 1OQKA 4H44C 5EPJA 2AZSA 4Y28E 3OW2S 4KJOA 4J6XA 2C06A 2MPMA 3CCJA 1VQPT 2QTXA 1FNWA 2PNIA 1EYDA 5IYCG 3GTKH 2RHQB 4ZUIA 2Q8TA 4DV7L 4BS9A 2RKSA 3OYBA 4BBRB 4J6WA 4JI4L 2HIXA 3CCLT 2EFIA 2ZPFB 5CK9A 5GAEC 3OB9A 1Q46A 1HQMC 3X26B 2LNHB 4MTNA 2CZ7B 5IGGA 4DUZQ 1D1IA 5A0GA 4L5SA 1T5XD 2R7DA 3AHUA 3CBOA 2MCNA 4J9DA 3AEVA 1PLFA 2O4XB 3JB9F 3HOYB 1JE4A 4B08A 2NVTB 2PNHA 1QZHA 2XRSD 1ILQA 3MXNB 2WACA 2JA8G 1KIKA 1Y8NB 1XPRA 1GJXA 3GP7A 1R8OB 1IHZA 2ICIA 4ZCKA 1NYFA 3TSWA 1VQ8T 1PVOA 4QGUA 4O6JA 2IG0A 3K5MA 2XD0A 3A8OB 3QO3A 2NN6H 1BIAA 3K5NA 4DR5L 2D5DA 2PVDB 3DEPA 1EU3A 4L63B 4Z8AA 3V7SA 1VQ5T 2M02A 4OMQA 2H5XA 3QJYA 3NXWA 4R8NA 1LM0A 4M77B 1E7OA 1S5ED 5E1FA 1A3VA 4C3JG 2B2TC 4FXDA 1X43A 1VQHA 3BYTB 5JOBA 1K8AU 3RKXA 1BQQT 1KDCA 3MA2B 4FL6A 3D6WA 5I4DA 1ZUKA 1KLGD 3HFZB 4DNIA 4RTYA 4JDSA 2DAQA 2X4JA 3OYNA 1Q86U 5JJZA 1U3OA 2EWNA 3PUXA 4TRDA 1BK2A 4G7OC 4M75B 1UE6A 4N8FA 4ZLTF 4JZ3A 1H9KA 1R9TH 3BG3A 5CV4A 3M56A 4OMOA 2LQWA 3FDRA 1A0NB 1M8AA 1EU4A 2F0OA 5J1ZA 4DV0Q 4OWWB 1H95A 2X69A 3FKIB 4RTVA 3E9FA 4O2DA 2K2MA 2B2UA 3PO2G 4II1A 5EKKA 3HKZB 3GV3A 3H0FA 4X62L 3G4ST 1LOJA 5LMNW 4RCBA 3JCMV 2Q2IA 2ZM6L 4C56C 4RGMA 4A75A 5GAMg 2UUBL 4B3TL 4JJDA 3SHLA 2QQRA 4QW2A 1K9MC 2KXCA 1PH3A 1TWCB 3KJOA 2R93H 1YITA 1WTHA 2F52A 4J1MA 4HMIA 1KC8R 4JI5Q 2ZGWA 2ZCFB 4Z88A 5G3LD 1VF7A 4V190 2HBWA 1AZGB 3SWNA 4M77E 4XXEA 2EPDA 3VUZA 2K5IA 1VQGA 3C94A 1GUSA 3PE0A 5AT1B 5KYWA 3EG2A 5FU7B 4ZN1A 5A0LA 4PFPA 4BA2I 1ESRA 3EQLC 2A3LA 1LTTD 2RQUA 3FIFA 4C3HG 4QQGA 3KF8B 3GQBA 3OBYA 2QTVA 4YCVA 3VS4A 4XTUA 2AQ3B 2BH8A 1Y1WG 2IVWA 1DGSA 2P4RA 1LACA 1BB9A 2A69C 3RLOA 3TZDA 3U50C 5EKLA 3LWUA 4FU6A 2YV5A 4P5NA 3RR6A 1EY6A 4BBRH 4HIDA 3C46A 3GTMB 2MMPA 2Z1CA 2JTEA 4PJOG 3E0JA 1HH2P 4RAUC 5C3EB 4A76A 4OO1I 3RBBB 2LMJA 1K76A 1AD5A 2J6KA 4QKUA 3MZ5A 3OPOA 4NMZA 4M75C 3HKZE 2YXYA 5GAMf 1KL9A 3MHBA 2B8FA 3NSWA 2DKGA 4YWKA 5K5PA 4LDUA 4BDYA 4JV5L 1BCPB 2M00A 2RHSB 2E5LL 5EKIA 2F0TA 4HJ7A 3F2DA 1SAPA 3I5RA 3FB9A 3LX0A 4PJLA 3H0GB 1QZGA 2HHHL 2NVTH 2IT1A 3HOYH 1JJ2S 4HKEA 4G7ZC 3GF5A 1RF2D 2VZAA 3FDTA 4ELYC 4HIKA 2L5QA 1PKSA 2XSCA 3OBWA 1GKHA 4C92F 1LV9A 3META 1AVZC 4DQ2A 1NZ9A 2LCSA 1NY4A 1XOVA 1VMPA 4KJNA 2LX9A 1C1AA 2K2VA 5DLOA 1G3YA 2YSQA 1QLYA 2RQTA 1BBZA 1CT1D 3EG3A 4KBMB 2CGHA 5GAN2 1NE3A 4A3EH 2QK0A 1SE4A 1Y0MA 2DL7A 1KRSA 3SEBA 3JSCA 4JI4Q 1BR9A 5IOCA 2X4YA 3M0QA 1B07A 3S16B 5DLQE 2RCNA 2I5MX 4OP0A 5ELBA 2LSSA 4MIUA 4S3SA 2IX0A 1T0JA 3OIQA 1YNNC 3BVGA 4X3TA 1WDXA 4QQBX 3OYYA 3KDFA 4XTYA 3RKYA 1Q86C 5KNDA 3F2CA 2VGMA 1EWCA 3V05A 2DY7A 1U06A 2A68D 1QCOA 2PQAA 3E9IA 2KRMA 4PZ7A 2RK2A 2VV5A 1CKBA 4C1NK 3HOXH 4ZN3A 4H02A 5FJ8H 2RPNA 3IFTA 2NVQB 2YRVA 3L2VA 4ZRZA 5IWAQ 4FM4B 2EYQA 1RD9D 1SYCA 5M3FB 2IL8A 4IZ8A 3E9GA 1DOKA 3URGA 1FMWA 3H8ZA 2LY7A 1V1OA 1VCIA 2X6GA 1AT1B 1M90C 2RA4A 4DR3L 5LJ3f 2QQAA 1WI7A 4PNOA 3T1YL 1X32A 1I50B 2HBPA 5KYXB 2RQRA 1C9OA 4KKUA 4NOYA 1JJCB 3K7AB 5C5LA 4ESRA 4LF9Q 1M2VA 2XHCA 4PJOA 3KF6A 4RMFA 1PTOB 1U4PA 1X3GA 1SN8A 1R4QB 2JA9A 4N0AA 4F7XA 2QQSA 1L0YB 3KXTA 4BBSB 3HPWA 1IBKQ 4A3LG 3OHXC 1V1PB 3PUVA 3GDEA 3UDCA 2QILA 1Q81C 1ZSZB 3M0RA 1E2ZA 3X3NA 1CKNA 2QDLA 4CKBA 5GMKi 2R7FA 2MQHA 5IP9G 1STYA 1ICWA 4XU0A 1FXXA 1KAAA 1VQMA 3D3RA 1NEGA 4C3IG 2PUKB 1X69A 3VS3A 1I07A 1D6EC 1HNZL 5IP7H 5JJLA 2F0DA 5FROA 3CQZB 1QUQB 3VUBA 2C35B 1S1NA 2CH4W 5GANd 3CXCA 1M1KC 3F1ZA 1XQHA 3HOVB 2JA7B 4ZGJB 5FOBB 1SEBD 2BE5D 3U4VA 2KI7A 1I5LA 3GNFB 3CMEQ 3VYGA 4LNQA 4QY7A 2UUBQ 1HR0Q 4UDUC 1XPOA 1X6BA 2K9GA 4JYAQ 5IODA 4IUUA 1UEAB 2E74C 2R7ZG 2ZJPA 5M5WB 2K6DA 1ZKOA 5GMKm 2XIWA 4EQOA 3QOLA 5IYCH 5C3EH 2Y90A 1BBUA 3CC4A 2WAQB 2L89A 4JLIA 4FP5D 1T9HA 1NTGA 4J9EA 5IXBA 2QEJC 2XN9C 1NG2A 3TEEA 4F7UF 4DA2A 5KNCA 2PVOB 4GLMA 1K8GA 4APVA 3I4MG 2X4WA 1K0RA 1YNJC 4J9FA 1W2BA 5GADC 2EYWA 4HVWA 2D6FA 1EY5A 3PMFA 4QF4A 2JEAI 4M75D 4KGXB 2JW4A 2LJ1A 2QQ9A 4DR4L 2LT4A 1K0SA 4JOIA 2R5MA 4PG3A 5M3MG 4DV2L 2EKOA 4C2MH 3PVQA 1GVPA 3W2DA 4A3MG 1GUTA 3S15H 3TU4K 1PWTA 5GMKh 1X65A 4HT8A 2EXDA 4RWSC 4EQNA 1QWYA 2ENBA 5A2QE 3W1BA 1K73R 3V8JA 1QCBD 5FRMA 2DZCA 3S1RB 5DM7R 3OW7A 1PC0A 3G6ET 2DRKA 5CKFA 4BY7G 2H8HA 1LLRD 2E76C 2HCKA 4RG8A 2QKIC 3U9SA 3VS5A 1B4OA 4DV7Q 3JCMg 4JBMA 4C0DC 1T5EA 3CHBD 4BY1G 4LF7L 4E7KA 2GBQA 3CD6T 4IPGA 3BVZA 4LD9K 2G9DA 5IYDG 4A3JH 5C6AA 1W6JA 3SE0A 1UGPB 3EH2A 2SRCA 1PH7A 1VYUA 2KJXA 2BUDA 2RSOA 3DMUA 1GCQA 4JBJA 4LJZC 1YJ9A 4P73A 4ABNA 2NVQH 3KBXA 5GMKl 3S1MH 5T1IA 4KGZB 4CJ0B 2X51A 5M3FH 1UEBA 1SPKA 4WCIA 1D1BA 1DYQA 1TWAB 1X3QA 1B34B 2BDNA 2WAQE 1IXDA 3MEWA 1I5OB 2WINB 1J8IA 3AFQA 4DN4M 2EYHA 5C0XJ 4GNXA 2H1EA 1WJSA 3KJPA 1XMQQ 2LCLA 2DMOA 4E7SA 4V0BA 1PH4A 1J3TA 4FF1A 2KCNA 2C0IA 3OYCA 2N55A 4IJHA 3PT9A 1JRIA 3X24B 2DJZA 3S17B 4LMQD 4HA8A 3K7AH 2UXDL 8AT1B 1I4XA 1XMOL 2OTJA 2CZ1B 2EQJA 1EWIA 3SEMA 2E1HA 2YTVA 4IPDA 4JI8L 1SJED 3MFGA 4HTHA 1KXLA 2KENA 2B2VA 3JRZA 4O42A 3PO3H 1EL0A 2NTTA 1SSHA 4N4GA 1OI1A 2EJFC 4QJFA 2J05A 1SMYC 5HY6A 3ZEHA 3INZA 4C8QC 1S5FD 4M7AB 1BCPD 2ASBA 1N32Q 2CH4A 2VNUD 3V7CA 2GFUA 3J80E 2AHOB 3M59A 1UB4A 3S3MA 2AUKA 1S72A 1IGQA 1RAHB 3RZDB 4NPSA 1WYXA 2FYKA 2JA8H 4XQJA 2A1AA 4DKAC 2LTOA 4R55A 4Y52H 2W0ZA 4F16A 3LWIA 1WCMH 3PF4A 1D1KA 1AWOA 3T1YQ 4R4QA 2WIIB 4A3DB 1TIID 3BZCA 5LJ5d 4RHRA 1HZAA 3A8IE 1PRTC 2ES2A 1KQ2A 3HRZC 3QIAA 2RDHA 2JA7H 3DWAA 2XGTA 2MUYA 4YY3L 1EX4A 3RMSA 2MO0A 4HXJA 5C4XG 3GD7A 3H15A 3PUYA 4GBQA 3M0TA 3BYYB 4J6HA 2KCCA 3SFMA 2V1RA 5I6YA 2VUMB 3EFXD 3CKIB 1LTAD 1GUOA 2HSEB 2KYMA 3OS0A 5C5MA 4FW1A 1RTOA 3CPWP 1Q90A 1Y14B 2Q8IB 1VQLA 4DV5L 1Y7XA 1XJWB 4U68A 2JA5G 1JE5A 2OTLQ 2RJFA 3M57A 1K73U 2A0FB 1PMRA 1X75C 3T53B 1JICA 4DV6L 2NYSA 3CCMQ 1YJNA 1I4HA 5EC7A 4DV4L 5L8RE 2UUAL 2QI2A 3ICEA 1L2FA 2CVRA 4LF8L 2XI9A 4M7AE 3K5OA 1ZA2B 2OJ2A 2OF1A 4A54A 1RLPC 4EX5A 3CMAA 5CKEA 4UAIA 2P0QA 2EJGA 5IXFA 3OIPA 4PLIA 3P1HA 5C4JH 2F2WA 1PTOD 4AYBG 4LF4L 2CSIA 1WTWA 2K3YA 2KEEA 1ILPA 1RI0A 4OO1H 4A4EA 1UE5A 4M7DB 2E70A 3REAB 2WV6D 4P71A 5CV9A 4HCEA 3TBIB 4U673 1GBRA 1QB5D 2K79A 2KQWA 5GAOq 1BI3A 1BXTA 5J39A 3H41A 4LF5Q 3VYRA 2P84A 1CHPD 5D6XA 2HCIA 3QWNA 3EG9B 2OQ0A 4Q5WA 2B39A 3HOZH 1XX8A 2FG0A 2CUBA 4K8IA 5CV6A 3I55A 4DR4Q 1X55A 2ZT9C 3NPPA 4JZ4A 4M78G 4EQPA 4DV2Q 1QKXA 3ERSX 3BZKA 2DRMA 2QF7A 2HIVA 1FJGL 2K32A 1BIBA 3VR4A 2L55A 1M3AA 3ULLA 3C2PA 1SYFA 2E3HA 1L1OC 2KCMA 3WVEB 2ENMA 4L59A 2Z0SA 1CZGA 1JQYD 4OGQC 4DU9A 4FYDA 4CGYB 2WKDA 1X27A 5CMDA 5GMKj 1R77A 1F2MA 4AT1B 2MK5A 2AKLA 4DBQA 3CCVQ 4JI1L 4CC2A 1TY2A 4X65L 4KY6A 1SLJA 1S5BD 3VRYA 2B86A 1OU9A 3L7ZC 4LF7Q 2XTIA 2UXCL 3RZOB 4BY6B 4AQYL 1NMFA 1EY0A 4RH6A 3TDQA 2PQEA 2XVSA 1BI1A 4EMKC 2F2XA 2O88A 1QVFP 1H92A 2GA4B 2PMZB 2CCZA 4JBKA 3QSUA 1S40A 1IYJB 1TKWB 2EPBA 5I2MA 3CAMA 2K5FA 3C12A 3A8GB 4YTLA 4L5TA 1NJIR 1LJOA 4AIMA 3S2DB 3OYIA 4IOAA 1VQ6T 1SNMA 2E12A 2EQSA 1YNZA 1VQ9A 1LTGD 3ONAB 3H09A 2A28A 3D4DA 1STAA 1U5KA 1OULA 3CBMA 3VV0A 3I72A 1AWJA 3OYKA 4HEDA 4R4OA 4GY5A 3GTLB 5CC4A 1ZBXA 2TMPA 3I4NB 5BR8Q 4RTXA 3CC2A 3S1NH 1D2BA 1E6HA 1N9RA 3MC0B 3GP8A 4JI8Q 2K57A 4CHTB 4NS5A 1SE2A 4UC4A 4MDXA 3EGXA 3GTQB 1DM0B 5KYYB 3NPFA 3CC7T 2LVMA 2DEQA 3DUZA 3NENA 5KE2A 1E3PA 4DK1A 2RI5A 4GN3B 1SYEA 2A6HC 2B2WC 4E6IA 2DUDA 3CPWA 3EAEA 3OYEA 2CP5A 1UE9A 1H9SA 1JOKA 2XKOC 5LHY1 3HOWH 2RNAA 3KYHC 2KQ3A 4IN3A 1RTNA 5L23A 1B50A 1RAGB 4M78A 4GLAC 1UAPA 1KNAA 1OXVA 3NTKA 1YWOA 1GL5A 4HMJA 3SK6A 4DUZL 3GLXA 4J9GA 3GTGB 2K5VA 3ER0A 4M1UB 1Q82R 1BDOA 2JTFA 5CORA 4XTXA 1XYIA 1OTCA 1EZ8A 4XTCS 1LO5D 1TY0A 4LWCA 1QW1A 3T56B 4XQQA 1JOOA 4PJOF 1BUVT 5GAMe 4LUDA 4QVDA 2CP3A 1GD7A 1D3BA 3UDXA 5DM73 3JAML 1YIJQ 1SE8A 1X6GA 1VQNA 1I81A 1IBLL 1IGUA 1O75A 1QWEA 4DV1Q 1VQKT 3E3XA 2CUDA 1FMVA 3OS1A 1Q7YU 3S1QH 4EDUA 1UJYA 4C5GA 1VQEA 3GTKB 1XTDA 2VL6A 2KYBA 2IHFA 1DXMA 4DAPA 1N6AA 2IIMA 5C44G 1A3UA 2TSSA 3LNNA 6AT1B 3JB9H 3C1EA 1CSKA 1WHKA 2N8NA 1KRTA 2ED1A 1RAAB 4DV5Q 1XJVA 1UHFA 3NBHB 2OEOA 4BWGB 3T1HQ 3DWQA 2M0YA 1M8VA 1HNZQ 2KRNA 1OOTA 4BY1H 1TUCA 4RTUA 2UUAQ 2F5KA 5IYDH 4LF8Q 2MFIA 3JAMc 1LYLA 1TUDA 2RI3A 3IL8A 3TSSA 5C4HA 5JVG3 5LL6X 1SRMA 2L3QA 4JJCA 2HKNA 3TZUA 4X6AH 2LCCA 4DA4A 3K81C 4NW2A 3GV6A 3FPPA 1K9MR 4RCOA 1JQQA 4XT1B 2CW0D 2V8KA 2UXBQ 4X64Q 1QCNA 1BU1A 2BE9B 2D8HA 5KGUA 1CKMA 4WTOB 2DGYA 3L2ZA 3A8JE 4UP7A 3NHHA 4AYBE 4EGVA 2A37A 4IUPA 4A3FH 5GAOm 3VS0A 2E2IH 2D0QB 1QVFA 1RABB 1NR2A 2F0QA 4KV6A 1HD3A 1EWHA 3RDVA 1BCOA 1P92A 1SF9A 1CFMA 2LXKA 1D5MC 2JYOA 4HCKA 4IUNA 1WD1A 1MIUA 2JN0A 3L2QA 4DNRB 3H6MA 3QR8A 1PH9A 1PNJA 1BF4A 2Q8RE 2GVBA 4M77G 4PJJA 4C0FA 3NGPA 2RN8A 5KH6A 4BE0A 2HD3A 1MMGA 2XIDA 1VQ4T 1Z9FA 3M4PA 5IHNA 1R9TB 2COYA 3CPFA 1G2SA 2DXCA 1B2TA 2K04A 4LN2A 1TH7A 4RTTA 4X65Q 5LMUQ 1CM9A 4K6LA 3IKJA 3J81L 2NUCA 5KYLA 4KGVB 2CZ6B 2F0PA 3UWNA 2EVRA 1GXIE 1M5Q1 3DM1A 3FJ5A 3D8GA 5GJVB 4C92C 1KNEA 4M7DD 4KHVA 2F69A 4HCCA 1IXRA 2DD4A 2YUOA 3SGIA 2HCCA 2CHBD 4Z02A 1D0XA 2E2JH 2BIVA 3VU3C 3FKIG 5L37A 2R93B 1VQBA 5KRUA 3UF4A 1EYGA 5GAOl 2V1CC 3HKZG 5FWBA 4OB0B 1LTLA 1NYGA 2D9TA 3EROA 1HYOA 4XT3B 4IFDJ 1VQDA 4G57A 2RK1A 1ZA1B 2BE7D 1AH9A 2PO4A 3FVQA 2DETA 1E2WA 3J81c 2JA5H 1M8MA 1N34L 4CDEC 1FNVA 1S3OA 2WB1B 2K5NA 4CC7A 4FYXB 2O4XA 1FYNA 2D8JA 4ZNXA 2K14A 4C1NI 3A0JA 3HOUH 1EQTA 1I4RA 3MXNA 2W10A 4RGNA 2L3RA 1QVGP 3TP7A 1LVKA 1NPRA 1PHJA 2DL3A 2HQHA 2KROA 3RESA 5GAOr 1EFID 3SHWA 2K1BA 3C0CA 1VQPQ 3PGGA 1ZX6A 4O0AA 2FFKB 1JT8A 4FCYA 1TU2B 4J83A 2IHEA 4EQ5A 3JAME 3D4RA 4OL7A 1D1AA 4DR2L 3CCLQ 3OSVA 2E3IA 1OXXK 1IYUA 2CWPA 3DB3A 4TVAB 1X56A 1HJDA 4BD3A 5LL6S 3NELA 4M77A 2DA9A 3VJPA 3K6OA 2ZAEA 4DAYB 2DVJA 2JSOA 1X2KA 1RADB 2FO0A 3I4LA 3H0HA 2O9SA 1K4US 1VIEA 2AQ1B 2KDSA 2XWBB 1PCXA 2Z4IA 1IBLQ 5IWAL 4BI8B 4JRQA 2QW7A 4K0KQ 3KUPA 2JA6H 2FEIA 2VUBA 1RIPA 3QWXX 4GS3A 1Q81R 1G5VA 3MJXA 3FMCA 1QNUA 2DE0X 4F14A 1KD1R 1VQ8Q 2RF4A 2VQEQ 4A3EB 3MCAB 1DCZA 4IFDG 3H0GG 2HZYA 2A6ED 4PZ6A 1TWGB 4NL2A 4WRDA 4RCCA 1TS9A 1HR0W 1WXBA 2CWAA 3HHTB 2WB1E 3U9OA 5M5XH 4A4FA 1VQ5Q 3M4QA 4J15A 4LF9L 2XDPA 5ECAA 3OMCA 3HRTA 3Q8DA 4QUFA 3A54A 2LS01 3STBD 2M9UA 4LXCA 1UGVA 2EQIA 1VMCA 3HOXB 3HP9A 1IBKL 1OO9B 3LWEA 3A55A 3CCET 5EBDA 3WXMB 1EEFD 1EOVA 3CCEQ 2BOSA 3FRPB 3CCRT 2L5TA 1F2YA 1UE1A 4CJ2C 2F0NA 2GGRA 4X3SA 3S3OA 3L2WA 4BE1A 1Q1BA 1M30A 1NE8A 3JCMe 3B6YA 3FHWA 4XQNA 4MNOA 1IBMQ 2D9UA 2CZ0B 4HSPA 3HEJA 5D65A 1FL0A 4ZQ3A 3J80i 2JP1A 1BVSA 1AHJB 4A93H 1MBYA 4WFN3 1FNUA 1NR4A 4GKKL 2GCXA 2ZZDA 1AE2A 3EGUA 3G4SQ 1EQRA 3KF8A 3I90A 4BI3A 1KAWA 3W3AA 1HUMA 3I91A 4KY5A 5D14A 2R92H 1PSFA 1SXTA 4NP5A 1HR0L 1ENAA 3PQIA 5FLMG 1FWZA 4H13C 4JVZA 4JYAL 2ZPIB 4C92D 3J81E 4Y91A 3JCMX 1AEXA 2RHXA 4ODGA 3I56T 3G71T 2ROTA 2LZ6B 2PNRC 2B63H 3I56Q 3G71Q 3O8VA 3C4SA 1B9NA 2CREA 1TS2A 2VXWA 4BB7A 3A8HB 1V29B 2WSEE 1ICFB 1LABA 1O7ZA 2IX1A 4A63B 4TQUS 1TWBA 1SJHD 1O78A 5I9OA 2GQVA 4OGEA 4JI0Q 3UA6A 1QVPA 4CKCA 3M4YA 1GRIA 4BBSG 3RMQA 3CPWS 2KMTA 4F88A 1RL2A 4AFUC 2CYZB 1STHA 4KKSA 3TN2A 2YUQA 5GQOA 2F0JA 5EBCA 3ZYYX 4J9CA 3OWEB 2CP2A 4OEMB 2E10A 3CCJT 2LX7A 4M75E 5KCHA 3G1JA 2K7AA 1EEID 3RN2A 4JG2A 1EFNA 3LGLA 1NEBA 1WNLA 1SDFA 1VDZA 2FHDA 5JJIA 1ABOA 2LMCB 1EIHA 4IIOA 4C5IA 1X9NA 4M8AA 1MGQA 5NUCA 5M5YH 1I94Q 4HCZA 4D8DA 1Y8OB 1KD1U 4IJLA 4X3UA 2CS7A 3CU7A 5A2QL 4OMLA 2C0OA 3CMEA 3TP6A 2VKNA 2NZHA 1N34Q 1SRUA 2B8AA 3K0YA 3CEYA 5HK0A 4X9DA 4RGOS 5ELNA 3SK8A 2PI2E 3EG0A 5GANg 2F4IA 4C2MB 2WAQG 1ASYA 1BI2A 1UG1A 2NUPA 2QASA 1F9PA 2AK5A 3NWSA 4IALA 3Q22A 3S15B 3O5ZA 1EQVA 2E8GA 1YI2T 4HJ9A 4X66Q 2CP6A 4DOWA 1VA7A 4LFAQ 1YI2Q 3M0SA 2F3IA 4K5VA 3MEVA 4YIJA 5EPKA 1XMQL 3KLRA 1K8AC 2F0SA 2XRQD 1TWGH 5FK9C 2EJ9A 2Z0WA 1IL2A 4DR2Q 3E2UA 4M78F 1PV4A 5CKBA 2DYBA 4I7ZC 3VA5A 4FYWB 4A3JB 2KBTA 1ML0D 4QIWB 2CFMA 4XU3A 5I2SA 4ANJA 1DJ7B 2KOLA 1OX9A 1AFPA 5K36G 4X9CA 2F4VQ 1N32L 4RKLA 2RMOA 1HTLD 2F0EA 3UT1A 3MFYA 3S1MB 2JM8A 1C0MA 2O31A 1LT3D 2FJ2A 1K0XA 1TS5A 3OSOA 1QVFS 2CQOA 1KIXA 4BUGA 1SNOA 1EZ6A 4A3IH 2QEXT 2DTOA 4XTVA 5GROA 2DNUA 1OU8A 1SYBA 3EA6A 5IH2A 3DXJC 3TQYA 1RLQC 1IL8A 1VYVA 4KLKA 3A1PA 5ELEA 3R93A 1YJWT 3RLNA 2B2UC 2PQWA 2XNAC 3I3CA 3J80L 1Q3LA 4BA1I 1KC8U 5CCAA 3L1AA 4E7ZA 2FB7A 2RVLA 1VQCA 2R5AA 1WPYA 3PO3B 4ME5A 1WJJA 1WLPB 2EW3A 4Z9CB 2JT4A 4OB1B 1QP2A 1YP5A 3VYHB 2XG8D 3NHNA 2ZJRA 2YTYA 4LAAA 3M53A 2ALYB 2N3SA 3D4WA 1AOJA 3S2HH 1YITT 2KECA 1KQSP 3VS7A 4MDWA 1KFZA 3SWNC 3MPUB 2FVUA 3QYHB 4C0DB 4MZTA 3E0EA 1SEMA 2D1XA 3KDFB 1WCMB 5AJ3Q 4QIWE 2DJQA 4FYVB 2KXDA 4CBVA 4EVOA 4PLLA 5CIUA 3J80c 4RUGA 1NPPA 4OMNA 4M7AG 1SYDA 1LT4D 2PQAB 1SFOH 3M9BA 3S14H 1PM3A 4GKKQ 4JRPA 1HTPA 1JB0E 1M4VA 4WJ3M 2LXJA 1QMCA 1I1JA 4Y92A 4JBWA 3JCMb 1MD2D 2Q2HA 2DVEA 1JB7A 2KR3A 1AZEA 1UGQB 1I4QA 1SHFA 3X28B 1U4RA 2MWOA 4E7HA 2DXUA 3DKMA 1N27A 1IHVA 5J3BA 1A15A 3V96A 3A7LA 4A3DG 1YCYA 3OYAA 4G4KA 2VS1A 2KEDA 3VYUA 2SEBD 4DNTB 2A69D 1OX8A 3EGDA 2EGAA 1E1OA 2MJ8A 4LDVA 3JB9I 2RHYA 1PDQA 3K7UC 1H641 3QB3A 1SHGA 1HHVA 4J6YA 3KF6B 3F2BA 5LJ3d 5IHIA 4LF5L 3T9NA 2M51A 4ZAIA 3ZJYC 4DR1Q 1MMAA 2B8GA 2MPXC 1G3WA 2B29A 2EQKA 2HSPA 2K33A 1WI5A 5LJ5g 1PH5A 2VUMG 1H8KA 4C8QB 4RMOA 4FNFA 3TEHB 2IJ0A 5IE8A 2FINB 2JMCA 4MMKA 2FL7A 1TS4A 3EJIA 2MOXA 2GTJA 1BCMA 2XK0A 4D8KA 4Z89A 4LDWA 1CKNB 2M0OA 1GO3E 3MTSA 1QOHA 2D62A 4L8JA 1HNXQ 4Q0FA 2OTLA 3PCOB 3UDFA 5FO7B 3NQIA 5C4JB 1DD2A 4DF7A 4FXKC 3IRBA 1W1FA 3CCMA 2Z6KA 3ND8A 3RMHA 1J5EQ 1PYSB 3VR6A 4XAXB 1UFFA 4IIMA 3G6EQ 3J7AV 3F70A 4PZ8A 1LT5D 4GN4B 5IN1A 4E7JA 1X01A 2R6GA 1PRTB 1WTPA 2E4HA 2LQ8A 4A3GG 3CCQT 2QDYB 1SKUB 1UNSA 3T13A 3CD6Q 3GOXA 5IHKA 4DBFA 3HOZB 1D8LA 3MHXA 2KCTA 1TOVA 3HFOA 3DEOA 4CJ1B 1FMKA 1UJ0A 4C3JH 1R0BG 1YNND 5EPLA 1PZJD 1N33Q 1UUPA 2AIRB 2E5KA 2JVVA 1BYMA 1V8QA 2F0GA 4M7AA 1HZ9A 4JK1C 3RD4A 5JEAJ 4QVCA 3HRUA 1FX7A 1KC8C 4LDXA 3D31A 3KBGA 3OS2A 1EY9A 4HIMA 2K5QA 2EYMA 1F9SA 4J5YA 3J7YW 2E75C 2DXTA 1SNPA 3DB4A 1YHQT 4F17A 1N8RR 1RODA 2A74C 2M9VA 4AH6A 1PH8A 2A8VA 1YHQQ 1GXDC 1O7IA 5TSSA 1HA5A 2DJGC 2WP8J 4R4IA 3ERQA 5BR8L 2P0PA 1XNRL 1ABQA 4ZGEB 4MMLA 1GCPA 4C8QE 1LNXA 3OYHA 4PJOC 3PGZA 5GANh 1B44D 4M77F 3PO2H 4N0AC 2F0MA 2KT1A 3PTAA 4ZTFA 1YVCA 4XDXA 1VQFA 2LNVA 5AFWA 3HFNA 1Q12A 3P8DA 2DL4A 1CZWA 2SDFA 2GN5A 1C8CA 1CI3M 2EYFA 2K50A 1KQSA 3JCMf 4P75A 2YUNA 3CCVA 3TP8A
chains in the Genus database with same CATH topology
1Y1VG 5HK3A 3BDUA 2X35A 1V9PA 2PVGB 1X3FA 5LJ3h 3S24A 2MWPA 1VQMT 4IUQA 3NTHA 4DR7Q 1BI0A 4B3SL 2K4KA 4JI7L 4A3CG 4IPCA 5JEAG 4DV1L 2HAXA 1Y96A 4C3HH 4OX9L 4HCBA 1XPUA 1Y07A 1L1OB 1WJRA 5C0XG 1Y1WH 3V8KA 3I4NG 4C0GA 1JJGA 2NZOA 4XIGS 1BBWA 4UP8A 2AWNA 4R4CA 5J26A 3M7NA 3T1HL 4EMKB 1HNZL 1PA6A 1NBWA 2E2HH 2VQFQ 1PSEA 5IYBG 4JOIC 3F8TA 3JAMi 1G3SA 5CQXA 3BY7A 3PFSA 5IT9E 3GTJH 3OS5A 4A3BG 2UXBL 1WOCA 3CF5A 1MJEA 4X64L 3L0OA 4A3KG 3PMIA 4B3MQ 3CCUT 4YCUA 1X3EA 1YHAA 3RKWA 3QXEB 1YIJA 3QHSA 2ZJQA 1U1SA 2JOYA 1VQKA 1QVCA 3ME9A 2Y0SE 3RLFA 1YJ9T 2LT1A 4FT2A 2E64A 3FEOA 1TWFH 4GNXC 2A7YA 5LMUL 1VQ7T 5LJ5h 2FXQA 3QZ9B 2OTJT 4P74A 1OZ2A 1N9WA 2K5LA 3FJPA 2WSCE 2NN6G 4ZGDB 1Q8KA 4ZTJA 4IOCA 2DTHA 4M7DE 2YYZA 4KI0A 4A3LH 1S72T 3PV0A 4C8QD 3H3VI 2VYTA 3H6ZA 3W5OA 1K83H 4DR6Q 2NVXH 1M9SA 4R56A 4Y7NH 3CBPA 3J81i 3ZBDA 3I7FA 5IP9H 4C5EA 4RKUE 2M16A 1SR3A 1XNRQ 4C3IH 3EFSA 3OYFA 1D7QA 5GANj 1K73C 3OYLA 4N4IA 2MI6A 3HL8A 4A4KA 3PUWA 3I2ZA 2JJQA 2R7ZH 2HNIA 3VKIA 3E1SA 5CO7A 2UUCL 3KFUA 5JJKA 1P16A 3MP6A 2PMZE 1YJNT 5ELOA 1ASZA 3I4MH 5LJ3j 2WSFE 4B3SQ 2R93G 3MP1A 4JI2Q 1XNQQ 1I6HH 4K0KL 5M3MH 4OX9Q 4EMHA 3E9HA 4DPGA 1NMGA 2VQEL 2UU9Q 4A3MH 5GMKe 2YU9H 4BI4A 2WB1G 3M3YH 1A62A 3NTIA 2Q2UA 3LH0A 4BY7H 2R57A 4C92B 2WFWA 2ID0A 2RA2A 1I5FA 2BA1A 1WQWA 3M4OH 4A3GH 1VQPA 4BBRG 4IO9A 2DD5A 1FVIA 1OXSC 4KULA 4MZMA 3RIRA 1M1GA 3CCLA 1U8RA 2I5LX 3ASKA 4JRKA 2RHZA 1XNIA 3HOYG 3BJUA 1I8FA 1NJIU 3V8LA 2MF2A 2VGNA 2AKWB 2E6NA 3HSBA 1SMXA 4KHPL 4CRIA 5GAHC 3GTPH 4EPCA 3LWHA 5GANe 4A3EG 1VQ8A 4GOPA 3L42A 4A4HA 3LX7A 2RJEA 4OXPA 5H1SE 1UGRB 3QG1A 3HRSA 1VQ5A 4OGCA 1AE3A 2LRQA 1Y1VH 2RJCA 4E47A 1UE7A 4C92E 4JI0L 3HOXG 1KQSS 4L5QA 1M1FA 1B8AA 3CC2T 4IPHA 1HJPA 1KHIA 2NVYH 3CCEA 5GAN5 5LJ5j 3JB9D 1Q82U 4M75G 3CCRA 3M85A 4RG2A 4JLGA 1MKHA 4M7AF 2GF7A 5C4XH 2OAUA 3OYDA 1ZQ1A 4M78C 4YCWA 5EG2A 3FP9A 1I94L 3P8BB 3G4SA 3K80C 4JRIA 4N4HA 1Q7YC 1CUKA 1VQOT 4FT4A 3OTOL 5IY0A 2ZPHB 4TVRA 1VQNT 3I56A 3G71A 3L2PA 2DPPB 1GM5A 2RD1A 4X66L 4LFAL 2RH2A 4F7UB 3CCST 2CKZB 1PYBA 4JI6Q 4A3BH 5IP7G 3TS0A 1K9MU 5FU6C 4A3KH 4KHZA 3TRZA 4D6WA 5GAGC 2N78A 2DIQA 2UUCQ 1VQJA 3UPUA 2G3RA 4WF2A 2F4VL 2CKKA 1EFWA 1NJIC 5C3EG 3QBYA 1KG1A 1PH2A 2QA4T 4DK6C 2DXBA 3G7ZA 4X34A 5CQYA 3VDYA 4M75A 4GKJQ 2DIGA 2QQBA 4M7DF 3KOJA 3SD4A 3J81j 4NXMQ 5LJ5e 3QJ6A 1VQAA 3U4ZA 4GOPC 1YI2A 2RHIA 4F7UE 1EIFA 2R58A 1I3QH 2PI2A 3RN5A 1Q1EA 1BKBA 4XK8E 4A3JG 4LDYA 5M9OA 1LUZA 2YTXA 1OZ3A 2D0PA 1Q82C 5AJ3L 3OQ5A 1QP3A 1N36Q 3JCMQ 4JI3Q 3FLGA 3BFMA 2EQMA 2VY3A 2ZPEB 3QIIA 2KHIA 5M3FG 2L15A 4KHPQ 3G48A 4KUIA 3M55A 3RERA 2QEXA 2ZPBB 4J7IA 3RUXA 3H3VH 1YJWA 3OA6A 4POFA 3PO3G 4BXXG 3EIVA 4DR1L 4M78D 3OYMA 2K5HA 2DZ9A 1M90U 4JJNK 1QVGA 3QZ5B 1IREB 3BW1A 4ME3A 1EQQA 4IKFA 4FSXA 1WCMG 1HNXL 3W1GA 2GFAA 2JZ2A 2P0KA 3X25B 3GNGA 2RM4A 3M54A 1J5EL 3LGFA 2JK8A 1HXDA 1X6OA 2JA7G 4PMWA 3HOVG 3Q1JA 1Q81U 5C44H 4JCVE 4M77C 4YWMA 2KBNA 1G51A 4A4GA 3TCJA 3OTOQ 1N33L 3MEUA 2BKDN 2AWOA 4LFCL 1MHNA 1B70B 1M1KU 5LMNL 1SSFA 4BACA 3SWNB 4OMFB 3E19A 3OMGA 4C8QG 3PF5A 4QQDA 5CKHA 3TS2A 1P8LA 5LJ3g 4O5VA 4PKCC 3BU2A 1YEZA 1C7YA 3A74A 1Y71A 1PH1A 1M4ZA 1VIFA 4GLXA 4OO1G 4LD6A 4BE2A 4KUDK 3G6EA 2BH2A 3R6OA 3U58A 4GLVB 3QUIA 3LYIA 1KQ1A 1WJQA 2KHJA 3QYGB 1MJCA 3CD6A 3HOZG 5D6WA 3CCQA 5GANf 3S3NA 4FDBA 3K0XA 3ZFJA 5GAMd 4DR7L 5FU7C 3SB2A 2K75A 2XDDA 2LC4A 5IAYA 1QUQA 1A8VA 4OWTB 3MEAA 3A5ZB 2JTMA 4DK3C 2MAMA 1YHQA 4C5HA 2ZTEA 4ATOA 4DR5Q 1E7ZA 3FKIH 5A0DA 1TXYA 2H3JA 4CI0C 5CR2A 1IZ6A 2JQOA 5HGQA 2VQFL 3K8AA 4B3RL 4BDZA 2EJFA 3A8MB 2PU9B 5GAN6 4C8QA 3AQQA 1TWCH 1CKOA 1EIYB 1VUBA 1KD1C 2ZTCA 4B9WA 3UDGA 4UP9A 3NEMA 3MP8A 3JB9J 4B3ML 4IUTA 5EAYA 1WQ7A 4UPAA 2AMCB 3KLWA 3RR5A 4PJOB 3L2RA 1A63A 4X62Q 3N5BB 2DK3A 5FLXc 2B3GA 2RO0A 3CMET 2Y0SG 2ZM6Q 2RI2A 2XDBA 2MNAA 3DLLA 2I5HA 4B3TQ 4LUZA 3HOWG 4M77D 2X4XA 5HKCA 2V8IA 2ZTDA 4JC0A 3GTMH 4XTWA 1WGSA 4WJ4A 1B34A 4J8OA 4PL6A 2OQKA 2DO3A 5KCOA 3GPLA 1CSQA 2QGQA 3LW5E 3C95A 1VS0A 3H0GH 5IT9c 5GAMh 4P72A 2RJDA 1WFQA 4YWLA 4A53A 4QQ6A 4IURA 4IUVA 4M7DG 2DTIA 3JB9G 3J7A5 4LFCQ 4DOVA 2Y4XA 5LMNQ 3S16H 3CCUA 2JUFA 3M9QA 1X54A 4PJOE 4DR6L 5LJ5f 4XU2A 2ATWA 4V2SA 4JV5Q 1JMCA 2E5LQ 3ULPA 5GAN4 3CW2C 3PNWC 1OYXA 2HHHQ 2VXFA 4DV3L 3OYJA 3AYHB 1I4K1 2K4YA 1YBYA 5D6YA 3UDIA 3QKJA 1L1OA 2Y4YA 4E7LA 4A3FG 1L0WA 1E22A 2JEBI 5FLMH 2IY5B 5C0XI 1I50H 1VQ7A 1HK9A 2EAYA 4HT9A 4M75F 1H3ZA 1VQIA 4LUOA 3OSSC 1HNWL 1CSPA 2OCEA 5CVIA 4QVZA 2HQLA 4BXXH 4EMKA 5DY9A 5FRNA 4BBSH 4JI2L 1XNQL 1UWVA 1VQ6A 2YLCA 3LLRA 2LQKA 1EUJA 2UU9L 3WVDB 4QL5A 4GNXB 3TREA 5FLXE 3HKSA 4LFBL 2KSSA 2N49A 2E5QA 4NXNL 4LUVA 1QVGS 4DR3Q 5AYFA 1G6PA 2NLUA 1V43A 2EQUA 3CC4T 2OWOA 4M7DA 5C0MA 3CQZH 2L8DA 3CC7A 3HOVH 1PFSA 4B3RQ 3MO8A 2LDMA 5M5WH 1K3RA 3JCMd 3OW2A 2OTLT 1HZCA 2HD0A 2Z6KC 3DLMA 4HJ5A 1W3SA 3CCMT 3HOUG 3P8HA 2V8JA 3V7RA 3EBEA 4L6V5 1N8RU 2KVQG 1Y96B 2QXFA 4JS4A 4HJ8A 4M7AC 2AHJB 3S1RH 1UGSB 1FGUA 2NN6I 1W4SA 3EFRA 4C92G 1JBMA 2RB6A 2XU8A 3S6WA 1E24A 1O9SA 4R4TA 3JC66 3PIOA