The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
32
|
sequence length |
189
|
structure length |
187
|
Chain Sequence |
MASMKTAQEFRAGQVANINGAPWVIQKAEFNKSGRNAAVVKMKLKNLLTGAGTETVFKADDKLEPIILDRKEVTYSYFADPLYVFMDSEFNQYEIEKDDLEGVLTFIEDGMTDICEAVFYNDKVISVELPTTIVRQIAYTEPAVRGDTSVMKTARLNNGAELQVSAFCEIGDSIEIDTRTGEYKSRV
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
publication title |
Crystal structure of elongation factor P from Pseudomonas aeruginosa at 1.75 A resolution
doi rcsb |
molecule tags |
Translation
|
source organism |
Pseudomonas aeruginosa
|
molecule keywords |
Elongation factor P
|
total genus |
32
|
structure length |
187
|
sequence length |
189
|
chains with identical sequence |
B
|
ec nomenclature | |
pdb deposition date | 2010-09-24 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF01132 | EFP | Elongation factor P (EF-P) OB domain |
A | PF08207 | EFP_N | Elongation factor P (EF-P) KOW-like domain |
A | PF09285 | Elong-fact-P_C | Elongation factor P, C-terminal |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Mainly Beta | Roll | SH3 type barrels. | SH3 type barrels. | ||
Mainly Beta | Beta Barrel | OB fold (Dihydrolipoamide Acetyltransferase, E2P) | Nucleic acid-binding proteins | ||
Mainly Beta | Beta Barrel | OB fold (Dihydrolipoamide Acetyltransferase, E2P) | Nucleic acid-binding proteins |