3OYYA

Structure of pseudomonas aeruginosa elongation factor p
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
189
structure length
187
Chain Sequence
MASMKTAQEFRAGQVANINGAPWVIQKAEFNKSGRNAAVVKMKLKNLLTGAGTETVFKADDKLEPIILDRKEVTYSYFADPLYVFMDSEFNQYEIEKDDLEGVLTFIEDGMTDICEAVFYNDKVISVELPTTIVRQIAYTEPAVRGDTSVMKTARLNNGAELQVSAFCEIGDSIEIDTRTGEYKSRV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of elongation factor P from Pseudomonas aeruginosa at 1.75 A resolution
doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Translation
molecule keywords Elongation factor P
total genus 32
structure length 187
sequence length 189
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-09-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01132 EFP Elongation factor P (EF-P) OB domain
A PF08207 EFP_N Elongation factor P (EF-P) KOW-like domain
A PF09285 Elong-fact-P_C Elongation factor P, C-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.30 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3oyyA01
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3oyyA02
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3oyyA03
3RZDH 2JEBI 3PUZA 4A3MG 3BZKA 2BH2A 2JA8G 1BBWA 4AQYQ 2UUAL 1VQ6T 4OWTB 1VQNT 1GO3E 1XPOA 4YTLA 2VUMH 3HOYH 3HOVG 2DUDA 3F2DA 3CCJT 4HJ5A 1UEBA 1SLJA 4DV1Q 2JA8H 3I55T 4LFCL 3KYHC 1UE5A 2PNHA 4R4QA 3EBEA 4JI8Q 3UDGA 4A93G 3T1YQ 3KDFA 1EQQA 4LF9Q 1N36Q 1HZ9A 2B29A 3FKIG 4XIGS 2I5LX 4OONA 3I2ZA 3LGJA 2PQAB 4B3TL 4DV6Q 2A1AA 2NN6G 1SMXA 3PUWA 1SRUA 2XGTA 3W5OA 5HGQA 3KJPA 2UUCL 4JI3Q 3KBGA 2JA5G 1NPPA 1KL9A 1VQMT 5GAEC 1YHAA 4C3HH 1HR0L 3PF4A 3S1NH 3A5ZB 4C3IH 1HH2P 2YV5A 4RG1A 1NMGA 4X64Q 4CRIA 2VW9A 1QVGS 4KLKA 3RR5A 2EIFA 2OCEA 4JI5L 4GLXA 2JK8A 1Q1BA 2JE6I 1CUKA 2HIXA 3M4PA 1HNWQ 1VQPT 4OX9Q 1Q81C 2BH8A 3GO5A 3RLNA 4AQYL 2UUAQ 2N49A 4P75A 2QEXA 4AIMA 1P16A 2LQ8A 2AMCB 2VQFQ 4DV5Q 1EIYB 4P72A 3J7ZC 4BY1H 1HNXL 1JB7A 1M1GA 1S3OA 1B8AA 2VQEQ 5JJIA 2A19A 3K7UC 3AFQA 1OTCA 4JI4Q 4JI7L 1YHQT 1NE3A 3GTGH 3GTOH 1Q82U 4BY1G 4BBSG 5GROA 2K4KA 3S15H 1E24A 4LFAL 1Q46A 3SGIA 1L2FA 4K0KL 1XNRL 2R6GA 3K0XA 4JI3L 2JA7H 2R93H 2KENA 1L1OA 2VL6A 3I4NH 1N9WA 1TXYA 5IWAL 2E8GA 1S72A 2K75A 4X62Q 4HIKA 2YTYA 1KXLA 2B63H 1WYDA 4ALPA 1D7QA 3G6ET 1N36L 5J3BA 3I4NG 1XTDA 4LF5L 3CCMA 3CCLA 3IRBA 4A3IH 3LGLA 3CCSA 1Z47A 2PQAA 2RHQB 4APVA 4GOPA 4OX9L 3HOWH 2OWOA 3VDYA 1PH6A 1I6HH 1YJNT 3CXCS 1UE7A 1YVCA 1WFQA 4DV6L 2K5HA 1XNQQ 4UY8C 1H95A 4BA2I 3CMAA 3CD6T 5FJ8H 4BXXH 3KLWA 3W1GA 5C44H 1PH1A 3WWVA 1UE6A 4YHHL 4LFCQ 1C7YA 5FJ8G 4BXXG 2B3GA 4IO9A 5LMNW 4LF9L 3FP9A 2QEXT 5AJ3Q 1X56A 1YJWA 3M7NA 3CC4T 5FLMH 3GTPH 4DV7L 4X34A 2UU9Q 1WI5A 4YWKA 3PUXA 4L5RC 4GNXA 2A8VA 1V1QA 3GTQH 2JEAI 1NBWA 4IPCA 1YIJA 1JJGA 5FLMG 4LUOA 1QVGA 2D62A 4DR5Q 3ICEA 2KBNA 1HZAA 4GN5A 4DR1L 3ZJYC 4DV0Q 1UWVA 1WJJA 2WB1E 3CC4A 1A8VA 2EQSA 1XMOQ 3KJOA 2Q2UA 4OWWB 1K9MC 3G6EA 1Q86U 3T1HQ 1K8AC 4P74A 1CKNB 4DR2Q 5LMNQ 2UXDL 4BY7H 4FDBA 1JE5A 1MKHA 2IHFA 3PSIA 4JBMA 1PH7A 3H3VH 2ZTEA 1GM5A 1B7YB 3S24A 5IY0A 3I4OA 4AYBE 1KHIA 4OO1I 1K0RA 2ZJPA 4DV0L 1A63A 1S72T 3DM3A 1Q7YC 1PH4A 4QQDA 3HOXH 2ES2A 1XPUA 1Y1WH 1QUQB 5IT9c 3CCQA 3B6YA 4QJFA 4LF4L 4LFAQ 1A62A 1I5FA 3CMET 2C35B 2K5NA 1IXRA 1XPRA 3E9IA 1KQSS 3KOJA 3NELA 2I5MX 3KF6A 3LGFA 1TWCH 1PH3A 1K3RA 4YWMA 1TWAH 2VZAA 3MEFA 4A3KG 1EYGA 4QQBX 3CAMA 4P73A 4A75A 2IX1A 4BA1I 3AEVA 1HR0W 2CKZB 2Q2HA 3AFPA 2VY3A 4GS3A 1IBMQ 1PVOA 1RIPA 1X3EA 5IYCG 1M90U 1M1KU 1VQKT 1FL0A 5C4XG 4QY7A 3S16H 2I0QA 4NXNL 4LW1A 4R4CA 1XNIA 1HNZL 5C0XG 1VQIA 2WAQE 1VQ9A 1SN8A 3G71T 3JAMi 1X9NA 1IBLQ 4Y7NH 1KRSA 5HY6A 2IT1A 4X65L 4JI2Q 1N34L 4ZN1A 3S14H 1QUQA 2MO0A 2VNUD 4A3LG 1VQFA 2KCMA 5JJLA 3ULJA 2UUBQ 1VQJA 4DV4L 1YHQA 5FLXE 1PYBA 1NPRA 1PFSA 4DV2L 3J81i 1HZBA 1JJ2A 3CCST 1Y1VG 4IJHA 4A3LH 4YHHQ 3CCLT 3L7ZC 1YJWT 3H0GH 3I56A 4LF4Q 4GOPC 4GLVB 2KCTA 2VQEL 4C2MH 4BY7G 3HOUG 2E2HH 1KRTA 1U0LA 3CP0A 2UU9L 4YCVA 2VQFL 4DV5L 4JOIC 5BR8Q 5M3MH 3GDEA 4LF7L 4GKKL 3CF5A 3JAME 1Q86C 4UPAA 2RF4A 3CMAT 2RHSB 4DAMA 3PO3H 3DB4A 2MWPA 4JC0A 4L5SA 1SE8A 1WCMG 2CKKA 4A3JG 1PA6A 2QA4T 1RL2A 5C4XH 1Y1WG 1PH9A 1EOVA 1NMFA 4A4IA 4DR3L 1PH8A 1N33L 2CQOA 4IPGA 1IYJB 3CCVA 1IL2A 2AWNA 2F3IA 3S2HH 4DV4Q 3KDFB 4A3GH 5M5WH 3J80E 1I3QH 2ZTDA 4A3EH 4YY3Q 2ALYB 3J81E 4JCVE 1LYLA 1WOCA 4OXPA 4NXMQ 1L1OB 4MZ9A 4LF5Q 1KD1U 2JOYA 1VQ8A 4KI0A 5GAGC 2ZJRA 3HOVH 1GKHA 2CWPA 2BA1A 2OTJA 1G6PA 3F2CA 4C3JH 1CSQA 5IP7G 1VQ6A 1VQOT 3T1YL 4A3MH 1W3SA 1VQMA 5M3FG 4A3DG 1CSPA 2CFMA 4GOPB 3U58A 4R4OA 3UE0A 3G4SA 1AE2A 2UUCQ 3FHWA 2K14A 2Z6KA 2R7FA 2DGYA 5BR8L 4DV2Q 4LF7Q 3G4ST 1SFOH 3HKZE 2JA6G 2R92H 2K50A 2JVVA 2K52A 1VQHA 4LUVA 1K73U 2JA5H 1WCMH 4LF8L 5IP9H 1KC8U 4X64L 3DLLA 2E70A 3TREA 1EFWA 1Q81U 3M9BA 1E1TA 2OTJT 4JI8L 4DR3Q 5DM7R 1Z9FA 4L5QA 2FXQA 2ZM6Q 3ULLA 1C9OA 2MO1A 1T9HA 4GKKQ 2G3RA 5M3MG 2F4VL 1VQLT 2PI2A 1K9MU 4OWXB 4HIDA 4B3TQ 1LM0A 1K83H 5C44G 4DR1Q 3U4VA 1KAWA 5C0XI 1VQKA 1VQ7A 4JG2A 2WB1G 5IYDG 4HJ8A 2JNGA 1X3GA 1N33Q 4O2DA 1TWGH 2LCLA 1YITT 1D8LA 2V1CC 4GLAC 4DUYQ 3RNUA 4BBRH 1AH9A 1O7IA 4PG3A 3RLOA 1E3PA 1BVSA 5IYCH 4POFA 4DAYB 3PO2G 1TWHH 4R4IA 3KF8B 1Q7YU 3I55A 5JJKA 1W2BA 5IAYA 4PZ6A 2ID0A 2KHIA 4JI2L 3PIOA 5IE8A 2Y0SE 1C0AA 1N32L 3A0JA 1VQAA 2AKWB 3U4ZA 1XMQL 4DK6C 1YHBA 2UXCL 2L3RA 1YBYA 2Q2IA 1YI2T 1VQ8T 1IBKL 5ELOA 4HJ9A 5IP7H 3K8AA 5EAYA 2R7ZH 4UP8A 1EQRA 4B3RQ 1PHJA 3T1HL 4LWCA 4GNXB 2E2JH 2QGQA 1KD1C 4IPHA 4JI5Q 1YJ9A 2F4VQ 2ZM6L 1TWFH 1HNZQ 3BU2A 1EUJA 4RG2A 3J7AF 3S1RH 3HOUH 4IFDG 4JOIA 2IY5B 4LNQA 3CCQT 2NVTH 1E7ZA 4DUZQ 4P71A 1VQDA 1VQ9T 5JEAG 1FJGQ 2QA4A 2MQHA 5C0XJ 3OTOQ 3H3VI 4IOAA 3GTLH 1MIUA 4X66Q 4IJLA 3GTKH 4PZ8A 1Q8KA 1VS0A 3CPWA 1G51A 5C3EH 1OXTA 4JI0Q 4LFBQ 5GADC 5A2QE 3G71A 2XHCA 2YTXA 3F1ZA 4DK3C 5LMUL 1BBUA 2UXBL 4A3FH 1LTLA 2KHJA 2OTLA 1VQCA 3I4MG 3AQQA 3I56T 3NEMA 4DKAC 1NJIC 1U5KA 2GVAA 3KFUA 5GQOA 2OQ0A 3OTOL 1JT8A 3CCUT 5ELNA 4HIMA 3CD6A 3ER0A 3CC7T 2JA7G 1VQ4A 3H15A 4AYBG 1QVFS 3PUVA 2KVQG 1DGSA 1YIJT 3E0EA 3FKIH 3K7AH 2NZHA 4JI1Q 3U50C 5C4JH 4JBKA 4JBWA 3ERSX 3NBHB 4DV7Q 1NZ9A 2DO3A 3HOZG 1SSFA 2VUMG 1ASYA 2LXKA 3CCEA 1B70B 3PF5A 1X54A 4JBJA 1HR0Q 4JV5Q 1FGUA 3RLFA 1VQBA 4DR5L 1I94Q 4A93H 3HOZH 5DLQE 4DR4Q 3AYHB 4IFDI 3CQZH 3CMEA 4YWLA 4B3RL 1FJGL 4PMWA 4EQ5A 4IFDJ 1CKNA 1OXSC 2HQLA 2LSSA 5IP9G 2VS1A 3JAMc 1SR3A 3G48A 5M5XH 3OW2S 3D31A 2JUFA 2N3SA 1OXXK 3GTMH 1V9PA 3PV0A 3PO3G 1YJNA 1N8RC 1JJCB 3RZOH 1M1KC 1M90C 4A3FG 4A3IG 1PV4A 3HOWG 1X3FA 3CC2T 4A3KH 1I50H 3I4MH 3I7FA 3CPWS 3HKZG 3STBC 3UDIA 1P8LA 3E9HA 2Y0SG 2RCNA 2YTVA 2WFWA 3PUYA 4JI7Q 3J7A5 4LF8Q 4LF6Q 2BA0A 5C3EG 1K73C 3K80C 4OO1G 1XMOL 2Q2TA 4BBSH 4JI6Q 3KF6B 1PH5A 2AHOB 3CC2A 2MI6A 2NVYH 1EWIA 5IWAQ 3W1BA 3CPFA 3RN2A 1N32Q 2NVXH 4TVAB 1G291 4JI4L 4MNOA 1IBML 2D0PA 4B3SQ 4KHPL 3OYYA 1OXUA 1UE1A 1S40A 3M4OH 2JJQA 2E6ZA 3JC66 4K0KQ 3S1MH 5E7NA 1OXVA 4GKJL 1V43A 4LUZA 2R92G 1L0WA 3J81j 2N78A 1Q12A 3M85A 2K5VA 3M4QA 4ME3A 3TEHB 3OW2A 4NPSA 1Q1EA 4JV5L 1CKMA 1YI2A 2UUBL 2IG0A 3DB3A 4EX5A 4KHPQ 1HZCA 1VQNA 1FVIA 3A5UA 1GVPA 2I5HA 3UDXA 4HIOA 3HFZB 1JMCA 2WP8J 2JQOA 4JI6L 4POGA 5LMNL 1YEZA 4A76A 3A74A 1SROA 3BJUA 2UXDQ 2E2IH 1IBLL 2ASBA 2HT1A 3TS0A 1KQSA 3TRZA 5IYDH 1YNXA 2Z6KC 4X62L 3CCUA 1YZ6A 3HKSA 2IHEA 3J80i 3EN2A 1VQPA 4BBRG 4DV3L 2AWOA 1HJPA 4HJAA 3TS2A 3BZCA 1VQ7T 5IYBH 2NN6I 4WJ4A 1VQEA 4YCUA 2NZOA 3P8BB 2CCZA 3LH0A 1R9TH 4GKJQ 2GN5A 4Y52H 4IOCA 5LL6S 2D0OA 2LXJA 3M3YH 4NB3A 1KC8C 4O0AA 5GAHC 4DUZL 4TVRA 4YCWA 4YY3L 2YU9H 1EIFA 1NY4A 4DR7L 4B3SL 2ZTCA 2EXDA 1VQ4T 2JA6H 3CCRT 4GN4B 2JA9A 4A3CG 1X55A 3GTJH 1KIXA 4B3ML 3D0FA 3CCMT 1Y14B 4QIWE 2H5XA 3HOXG 4R1JA 1XJVA 2B63G 1HNWL 1X65A 2OTLT 1JJ2S 4QGUA 5M3FH 2MFIA 3F2BA 4A3DH 2WAQG 3UDFA 4DR2L 3CCET 4GNXC 2HHHL 4IPDA 3PGZA 3H0GG 2ZJQA 1Q82C 4J15A 4JI1L 3RN5A 2F52A 4MTNA 1K8AU 3CXCA 4UP7A 2YYZA 2GVBA 1L1OC 3STBD 2E5LL 1VCIA 4X6AH 4RMFA 2PI2E 4H02A 5IYBG 1AE3A 2R7ZG 1YJ9T 3GD7A 1I94L 1IZ6A 1J5EL 1XNRQ 4A3EG 1PH2A 1QZHA 1ASZA 5LMUQ 4R4TA 4AH6A 2XTIA 3EIVA 3J81c 2UXBQ 4X65Q 4PZ7A 1N34Q 3CCJA 1W2BS 3J80c 2ATWA 4L5TA 2CWAA 2E5LQ 4DR4L 1E22A 1QZGA 3F8TA 5K36G 2PMZE 4DV1L 1HNXQ 1N8RU 4A3CH 4JYAL 1E1OA 4DV3Q 4NXNQ 1X6OA 1QVFA 4X66L 1QVCA 1MJEA 3S1QH 3CW2C 1PYSB 4TQUS 3PO2H 3CC7A 4QL5A 3L0OA 5JEAJ 3S17H 1CKOA 2R93G 4LF6L 2L15A 1MJCA 1YITA 2KDSA 4ZN3A 4DR7Q 2N8NA 1NTGA 2R7DA 3TQYA 3PCOB 1XMQQ 2OQKA 4UP9A 3HOYG 4JYAQ 1VQGA 1Y1VH 4HJ7A 3K81C 2UXCQ 2MNAA 1VQOA 4DR6L 2LVMA 3CCRA 2IX0A 4KHZA 4XTCS 5AJ3L 4GN3B 5J26A 1J5EQ 1VQ5A 1IBKQ 2HIVA 4DUYL 2NVQH 1BKBA 3L2PA 4LFBL 5H1SE 3ULPA 3Q8DA 1NJIU 4WJ3M 1VQLA 5FLXc 2MWOA 3UE1A 4A3GG 3MXNB 1A0IA 2Z0SA 5IT9E 4DNIA 2HHHQ 4JI0L 4DPGA 1XNQL 4A3BH 1GD7A 4A3JH 1J6QA 4DR6Q 1VQ5T 3CCVT 3NENA 5M5YH 3S2DH 4NXML 1K8GA 4B3MQ 1LUZA 3PIPA 4A3BG
chains in the Genus database with same CATH superfamily
1ZBJA 1AW7A 4IIMA 4DK0A 2ESWA 4C3JG 5E4WC 4IKFA 4HXJA 4XK8E 3RMQA 2F69A 4A3MG 4KTAA 2KSSA 2LJ3A 3BDCA 2JA8G 1RAAB 4J9CA 2P4RA 2GQVA 1VQ6T 5CVIA 5FU6B 4Z8AA 2DUDA 4BB7A 1UGVA 2RK1A 1UE5A 2HCIA 4ZGJB 2L9HA 4JI8Q 4A93G 1OPLA 4JLGA 4LF9Q 4J6HA 4C3JB 2DTOA 5KGUA 2F5TX 3FKIG 4HVVA 5D7UA 5FRMA 3OS2A 2A08A 2VWFA 1RI0A 2A1AA 4RTXA 4CBVA 4M77G 3FIFA 2YHTA 3CRKC 2KECA 3W5OA 5HGQA 1HUNA 2IWHA 1EIGA 2G5DA 3TN2A 1HRJA 2G6FX 3VJPA 1OQKA 1G3TA 2R58A 3MP8A 4RG1A 2VW9A 3QSUA 1PZKD 2A36A 3EJIA 1QVGS 2K5WA 3NK9A 4GLXA 2GFUA 2CS7A 1M90R 2RNAA 1Q1BA 2JK8A 2JE6I 1CUKA 2HIXA 1F9QA 3I73A 4OX9Q 1HSQA 4A4HA 5BN4A 3SWNC 1Q81C 3RLNA 3NE5B 4P75A 2QEXA 4OMFB 3CRLC 1NYGA 4AIMA 3N5BB 3X3MA 2VQFQ 3EG0A 4DV5Q 4CC3A 2DY8A 1XYIA 2HQXA 4BWGB 1CKAA 5GJWB 2QF7A 1VUBA 1M1GA 3K6OA 8AT1B 1B8AA 1EOTA 2XN9C 4ME5A 3H0HA 4M7DB 3K7UC 3AFQA 3GLXA 4PLLA 4ZUJA 1Q82U 1SRLA 1H641 5GROA 2C06A 1UGRB 2K4KA 2QQSA 3A98A 4FL6A 3SGIA 1L2FA 2KEEA 4LFAL 3HRUA 5FOBB 2JA7H 2V8IA 1C4QA 1L1OA 1BBXC 1ZSZC 1VYVA 1AN8A 1N9WA 1TXYA 1ZQ1A 2EBPA 2XG8D 4OMPA 1SNOA 2YTYA 5C3XA 4HIKA 2B63H 4D8KA 2VC8A 3NSWA 4K8JA 1F2LA 4KK7A 4ZGDB 3CCMA 3CCLA 3IRBA 4A3IH 3LGLA 3CCSA 2RHQB 3NGPA 4CKCA 1IXDA 2LY7A 3VDYA 4C1NI 3S3MA 4R8IA 4JJDA 1YVCA 1ZUUA 3PTAA 3CMAA 3CD6T 5DNFA 4L5GA 4BXXH 4F7UE 4RWSC 3KLWA 3MEHA 1SXTA 1PCXA 1UE6A 4LFCQ 4DBRA 2X4YA 3GTOB 1D5XC 1Z9QA 1C7YA 4BXXG 2DIGA 2B3GA 2KT1A 2COWA 2QEXT 1K4US 2X6GA 3FP9A 1YJWA 4LK1C 5FKAC 2JW4A 2RM4A 4M75G 3CC4T 1NSNS 4DV7L 4X34A 3KFVA 4KKTA 3MJXA 3GTQH 4FXGC 4WJWA 4K2KA 2B2TA 1NBWA 3MFYA 1JJ2P 4FYDA 2F0TA 1LCKA 1HZAA 1PXUA 1VF7A 1GXIE 4K5WA 3TDQA 3L2ZA 4JS4A 3CC4A 4MN3A 4JRKA 2F0JA 1D1AA 4P74A 2Y4YA 1PFMA 1CKNB 2JN4A 2E12A 1UFFA 2X9HA 1DOMA 3EG2A 1CTMA 2IHFA 2JM8A 3O8VA 1PH7A 2O4XB 1GM5A 2YLBA 1B7YB 2X3WD 3I4OA 3GV6A 4OO1I 2AZSA 5EBCA 2O9VA 4C92B 4N4GA 2J7IA 1PH4A 3HOXH 1CKBA 3HKZB 3Q0AA 4P5NA 1GUGA 4JI3Q 3B6YA 2L3PA 4LF4L 4KULA 4KGXB 2NYZD 2DD5A 3CMET 2K5NA 2FFKB 2KCNA 3M7GA 2QDLA 1TWCH 4JRQA 5LL6X 1EYGA 1FWZA 4QQBX 1EFNA 5LJ3f 1SRMA 4EGVA 3PQIA 5A0LA 2Q2HA 1HR0W 1IBMQ 2VY3A 1X3EA 2XICA 1M1KU 1DYQA 1FL0A 4LW1A 1Z7TA 4FT4A 1XNIA 1QJOA 1HNZL 2B63B 1IBLQ 1K28A 2F1MA 2IT1A 3M4YA 5JJLA 4ZN1A 1QUQA 3UT1A 5GAOl 1Y57A 1TQOA 3ULJA 1YHQA 5FLXE 1NPRA 4PFZA 1PFSA 2PZWA 4DV2L 2QGFB 1HZBA 1TS3A 1UJ0A 3S1QB 4XTWA 5C4ZA 3QHSA 3VS0A 1ZA2B 3HSBA 4GOPC 2QK0A 1BOSA 2PVOB 2J6KA 1JCKB 1TS4A 3RNJA 1SYEA 3CP0A 2UU9L 2R93B 5BR8Q 1U4MA 4NL2A 1EQTA 3CF5A 3JAME 4UPAA 3FEWX 4DAMA 2ZPIB 2K7VA 4JC0A 4L5SA 3E6ZX 2CKKA 3OQ5A 1TU0B 5GAN8 3EROA 3EGDA 1STBA 3L2VA 2WB1B 4PLIA 4C92G 2L2PA 2AWNA 4C3IB 5G3LD 4A3GH 4FYXB 3J80E 1QG7A 4WRDA 2YSQA 1TT2A 4UDUC 3UA6A 1HXDA 3J81E 1WOCA 2DJGC 4OXPA 1AZGB 2CZ0B 2E6NA 1SF9A 1VQ8A 1MD2D 4KMUC 5EKLA 2L8DA 5GMKi 4DU9A 2Q8IB 1S5ED 1T3SA 3I9QA 5CKBA 5IP7G 2LRQA 1VQMA 2KROA 2P84A 3A8KE 4K6DA 4R4OA 5M5WB 2VV5A 4DV2Q 4G7HC 3MEAA 3OMCA 2DE0X 3RUXA 3HEJA 5ISRA 3JCMV 2FMCA 2K52A 1D7QA 3H9NA 1WCMH 3GTLB 4ZKBB 1KC8U 5GAN7 3TREA 1EFWA 1RACB 3M9BA 3MWYW 2P0KA 1E1TA 3DHQA 4OHJA 4RCOA 2DEQA 4RTWA 2WIIB 5J22A 3OYLA 1OU9A 3D4RA 3HS0C 3I5RA 3HGBA 3Q1JA 2FXQA 3N52A 1XQHA 4L5QA 1TS5A 4GKKQ 5E4XA 1YCSB 4ZAIA 1V1OA 2DL5A 3SDZA 4OWXB 4HIDA 4C5EA 2F03A 2HNIA 1F9RA 2BOSA 1PD1A 1CA6A 1VQKA 3SR1A 1SNCA 2EJGA 1X3GA 1Q81R 1X75C 2V1CC 1D8LA 4BBRH 1JRIA 1O7IA 2EYWA 3R6OA 1H9SA 2FEIA 1E3PA 5IYCH 5ECAA 5CKHA 1RTNA 4DAYB 4A3JB 1MMAA 1EZ6A 3KF8B 3I55A 2K2MA 2B8FA 2KBTA 4PZ6A 3C3LA 5JJKA 4JRIA 4LUDA 1MV0B 2E5QA 4UHVA 2QG9B 3EFOB 3R8BA 5JAVA 2F0HA 5I2XA 4M7AB 4KN4C 1LTBD 3V7CA 1I8FA 2AKWB 2EGEA 2F4IA 2NTTA 4M8AA 1XMQL 4LMQD 1YBYA 2Q2IA 1I0CA 1JWUD 3OB9A 1YI2T 1IBKL 1WQ7A 3OYGA 3K8AA 5EAYA 2NVXB 4OP0A 5A35A 2VGMA 5CMDA 4M7DG 2YUQA 4ANJA 2QGQA 4IPHA 1PHTA 1DXMA 2ZM6L 1TWFH 4B9XA 3J7AF 4KT0E 4FM4B 3S1RH 3M0TA 4LNQA 2OAWA 1PZID 1WPYA 1TUCA 3EGUA 4F8MA 2C9OA 2KMTA 5GAMh 2E65A 1PTOB 3VKIA 1FMVA 4BACA 1AEYA 1O7LA 4XQNA 5C0XJ 2CP0A 3CCUQ 2H8HA 5GAOr 2IX3A 1VS0A 3A7LA 2JMCA 1G51A 2DK3A 3PFSA 1FX7A 2XHCA 4M7DE 2J7ZA 3F1ZA 4DK3C 1BBUA 5LMUL 1NG2A 4DBHA 1IB8A 1LTLA 3SD4A 4UC4A 1KQ2A 5COYA 1PLFA 2GVAA 4ZTFA 3ME9A 2F0IA 4QB4A 4IUPA 3OTOL 3GTKH 3KFUA 2XRQD 4HIMA 2M16A 1LV9A 3QZ9B 3ER0A 3TP8A 1ACMB 4LD6A 4FF1A 3KF8A 4AYBG 4A93B 2KVQG 1WDXA 1LT4D 1G8XA 2DYIA 4PFPA 5CQYA 4JBKA 1M27C 3FB9A 3NBHB 4M4ZA 3HRSA 2CGHA 3AT1B 3HOZG 2EJMA 4F7UG 3G6EQ 2LXKA 1B70B 4IZ8A 3HZXA 1KFZA 5IHIA 3JCMf 4JBJA 3RLFA 4XU1A 4WORA 4A3MB 1GUTA 3CQZH 1BR9A 1DJRD 2SEBD 3NBIA 1VQ4Q 4EQ5A 2C0OA 2HQLA 3ND9A 1WQWA 5KE3A 1GCQA 2HD3A 1OX9A 4KUDK 5M5XH 2OX7A 3G7ZA 2JA8B 3LW5E 2K05A 4IQZA 2IVWA 4AFSC 5CR3A 3PO3G 1N8RC 1JJCB 2G9HD 1M90C 3OWFA 4A3FG 1V8QA 4A3IG 1EY9A 2PUKB 4ID6A 3I4MH 3I7FA 1T3LA 3HKZG 1SG5A 1B07A 3STBC 2DZ9A 2NYSA 2Y0SG 4OMNA 1KDAA 3SXHA 1SNMA 2DRMA 3RIRA 2K5IA 3GP7A 2CZ1B 2E64A 4OO1G 1STYA 1VQ7Q 1LJOA 1LTRD 3PIP3 2L12A 4LDVA 1L0XB 2PUOB 3RD4A 4J9HA 1MGQA 3CC7Q 1D3BA 2SOBA 1KK7A 5BN3A 1I07A 1G291 1NEGA 2Q8TA 2RQXA 1IBML 2D0PA 4FU6A 4KHPL 2JTEA 1OXUA 2CH4W 2LS01 1Y7XA 4KV6A 4GLMA 4MZTA 2LX7A 4R55A 5IODA 5C0XH 1BNZA 2A6HD 3E19A 5E7NA 3DWAA 3JCMQ 3NHNA 1JOOA 3JCMd 4LUZA 4OEMB 5GAMj 2J0TD 3M85A 1FNVA 2EY2A 5HGTA 3M57A 4RCCA 3HFNA 3OW2A 1Q1EA 5FW9A 4PMBA 1YNJD 3KBXA 3DB3A 5D65A 2YWWA 4ZUIA 1HZCA 3QYGB 4EIKA 4M7AG 1DCZA 3CMEQ 3CCQQ 4KY6A 2I5HA 4JI6L 1X2QA 5KH6A 1HPCA 4A76A 2KAFA 1YHQQ 3CU7A 5LHY1 2FPFA 2K9GA 5C4HA 4PJLA 1KQSA 2NBFA 2WSEE 3EHQA 1EY6A 2Z4IA 4II1A 2FHTA 1YZ6A 2AWOA 1C0MA 4K11A 3E3XA 3BZCA 3JB9J 1SMYC 3R2TA 4G57A 4KD3A 5IYBH 2ZAEA 4CC4B 3OOCA 5CV8A 1IL8A 1VQ5Q 4E7LA 1Y69U 1BCOA 2CCZA 1CM9A 1ILPA 4GKJQ 4BY6B 1NR2A 2ZPEB 4WCIA 1RF2D 4OVAA 2LXJA 4QF4A 4QW2A 4EMKA 1A15A 4NB3A 4O0AA 2YU9H 4YCWA 2AUJD 4PJNA 2PCFB 2WKCA 4OF1A 4DR7L 4FW1A 2D9TA 1VQ4T 4A3CG 2JA9A 1WJQA 1BI2A 3A8JE 1KIXA 2QKIC 3VRYA 2XK0A 3HOXG 1XJVA 1JWSD 1OX8A 1X65A 4XDXA 4XYQA 2LFNA 3LWHA 2MFIA 2WAQG 3CC2Q 3TP7A 1WXBA 3UDFA 3QO2A 4IPDA 1EZZB 1UGSB 2HBPA 3RN5A 1U9RA 2F52A 3FMCA 1K8AU 1K0SA 3CXCA 3P7JA 4QIWB 1L1OC 1N9SA 2Z6BA 3STBD 3LX7A 1U4RA 2PI2E 4NMZA 1KABA 2VASA 2MPXC 1PKTA 2O31A 1IZ6A 1J5EL 1NYFA 1JICA 4A3EG 1SE4A 4DN4M 1BBZA 1VMCA 4K8IA 3HFOA 1PTOH 3H0FA 2JP1A 3PO3B 2UXBQ 4C5IA 2FHDA 3J81c 4BY6C 1QNUA 3J80c 1SAPA 4ZK9B 5K36G 3CCLQ 4N8FA 2PMZE 5T1IA 4M7DF 2EKHA 1HNXQ 1ZEQX 2DPPB 2FG0A 1TY2A 1X6OA 4QQGA 5CQXA 2M1HA 4X66L 2K4YA 1QVCA 1MJEA 2DBKA 3SWNB 5JEAJ 2H4OA 2R93G 2F3WA 4KKUA 3IFTA 1YITA 3S1RB 1Q90A 2N8NA 4DR7Q 1NTGA 4H0LC 4DGZA 2R7DA 3MEVA 4RKLA 1RDPD 4Y7NB 4KGZB 3FLGA 3I5SA 3TCJA 1SSOA 4XTCS 1BIBA 1PTOC 1VQ5A 2B2YC 1IBKQ 2NVQH 1M8VA 1BKBA 2DIQA 4LFBL 1NE8A 3GOXA 5H1SE 3SB2A 2RQWA 3ULPA 4QT7A 3Q8DA 4FF4A 1XJWB 3QYHB 4QKUA 3OYDA 2HHHQ 4A3GG 1YN8A 2JXBA 3D6WA 1GHJA 1R4QB 2EQJA 3M0SA 1BCPC 3VV0A 1J6QA 1M9SA 1VQ5T 4AFZC 2DL3A 2EQKA 1M3AA 4B3MQ 2DVEA 1B9NA 3FRPB 2PO4A 1GCQC 4FCYA 4V2SA 2CSQA 2JEBI 2H1EA 1SHGA 1TG0A 1BXTA 3JCMe 1IHVA 1WNLA 2RHIA 1N8RR 1BBWA 4AQYQ 1TVXA 1X32A 2DETA 2UUAL 2B2TC 4OWTB 1OOTA 1XPOA 3HOVG 2DJQA 1NEBA 5GANe 3CCJT 3NPPA 3K5MA 3CQZB 2D9UA 3E0JA 3I55T 4LFCL 3DM1A 3KYHC 2NUPA 2WSCE 3C12A 3QWYA 3T9NA 4N9TA 3HOXB 1WHGA 1EQQA 2YU9B 3GF5A 2OTLQ 1HZ9A 2B29A 2DERA 1XWEA 4JDSA 2TMPA 4OONA 1U4PA 2PQAB 2RBMA 1XXGA 4DV6Q 2QDBA 4L6TB 1SMXA 5C4JB 4NKLA 3KJPA 4DOWA 1Y8PB 4KY5A 1VQMT 5GAEC 2XDDA 1YJNQ 1HR0L 1SYGA 2F0KA 1E2ZA 4DV4Q 2XRSD 2HBWA 2RF0A 2YV5A 2CSIA 1H8KA 2J4XA 3RZDB 4JI5L 2CREA 3IL8A 2EYQA 2F0PA 4FF3A 2B2VC 1HNWQ 4JJCA 1VQPT 1D1IA 1SHFA 2A68C 1KIKA 3GO5A 4OMMA 4HMJA 1V1PA 4E7KA 2F0GA 1K73R 1EIYB 3D4WA 2E2IB 3V8LA 4JUVA 1MUZA 3NQIA 4BE1A 3VS5A 1S3OA 2E76C 2VQEQ 1RAIB 1ZHIA 1Q3LA 2NUCA 5C3WA 1OTCA 4IURA 2K04A 3GTOH 2Z8LA 4BY1G 1UUEA 3FPPA 1WFWA 4J83A 1E24A 1Q46A 3S3NA 3T4AC 4OB1B 2LQNA 3QB3A 2SEMA 2R93H 2KENA 1TWHB 2VL6A 3I4NH 5GAMd 4X62Q 1F9PA 2E8GA 4ZQ3A 3QIIA 1BCPB 3F2UA 1WYDA 4C3HG 5KYLA 1EYCA 1N36L 5J3BA 2COZA 5M9OA 2IL8A 4GY5A 2PQAA 3MFGA 4APVA 1K83B 4GOPA 2NN6H 1AWOA 4J1MA 1QNKA 1M5Q1 5GAOp 1JQQA 4O1NA 3CXCS 1TUDA 1LTAD 1STNA 1XNQQ 4ATOA 4BA2I 1SYDA 2CYZB 3FPUB 3W1GA 5C44H 2F0EA 4H7BA 1PH1A 1HTPA 2D1XA 4M7AF 5EQ0A 4F87A 1EYDA 4IO9A 4BS9A 5GANj 5AJ3Q 3KLSA 5FLMH 1WTHA 1TOVA 3GTPH 1E6GA 2NWMA 3T51B 3S9WA 2UU9Q 1WI5A 3MTSA 3M58A 1FMWA 1UG1A 1TWBA 2GFAA 3CCJQ 1NNXA 1V1QA 5GAOn 2A69C 3PUXA 3OS5A 2DL7A 4IPCA 4OO1H 1JJGA 1IKMA 2HL3A 5FLMG 4J7FA 3ICEA 2DXTA 1TIID 3PIO3 4XT3B 1HCZA 2WB1E 1WJJA 5I21A 5J39A 1VQNQ 1A8VA 1ESFA 5NUCA 1XX8A 4MDXA 1KC8R 2CW0D 3KJOA 1XMOQ 3G6EA 2Q2UA 1Q86U 3T1HQ 4R56A 1NLPC 1ZYRC 4JPBW 3VS6A 3JV3A 4AG2C 2UXDL 1LNXA 3FKIB 4FDBA 1Z9ZA 5FROA 3U23A 3QR8A 3H3VH 1FYNA 2ZTEA 1SNQA 3VYUA 2MIOA 1B53A 4ABNA 2CQAA 1A63A 4N0AC 3PMFA 4FVMA 1S72T 1M4VA 3Q22A 4IUUA 3GP8A 2ES2A 5D3DA 3X24B 4PJOF 4QJFA 1ZSZB 4OGQC 4DNTB 1MV3A 1I5FA 3C2PA 3E9IA 3KOJA 3QXEB 2I5MX 3KF6A 3NELA 4A3EB 3V8JA 1TWAH 5GMKe 5CCAA 6AT1B 2FYKA 4BA1I 3AFPA 1ZLMA 5LJ5j 5CKDA 1RIPA 1VQKT 1YITQ 2QQBA 1UB4A 1MBYA 2EJGC 3MZ5A 3S16H 2RPNA 3JCMh 4R4CA 1CHPD 2SDFA 2K5FA 5C0XG 1VQIA 1WD0A 3JAMi 4E2FB 5KYXA 4LXCA 2F0WA 1KRSA 2EPBA 2R5MA 3I72A 3WXMB 2OI3A 1B1ZA 1U5SA 1N34L 2MO0A 4A3LG 5C6SA 2M0YA 4KD4A 5GAOq 2A74C 3H6MA 4OL7A 3X26B 4XXEA 4BBSB 1VQJA 4DV4L 3GBQA 1EY0A 3MXNA 2DXCA 3CCST 1Y1VG 4A3LH 4YHHQ 1G3YA 4M77A 4E7ZA 2E3IA 3H0GH 3I56A 3J7AV 3JRZA 3HOUG 4DFAA 3CHBD 3L3OC 5JPNC 2E2HH 3M54A 4FYWB 4EMHA 1U0LA 4YCVA 2VQFL 4DV5L 4C8QG 4GKKL 2A28A 4GZYC 3VA7A 2XSCA 4OMLA 1YNND 2RHSB 4XAXB 3AB9A 3DB4A 2MWPA 1MI2A 1SE8A 4JZ4A 2F0SA 4A3JG 1X3PA 3S3OA 5C4XH 2CHBD 4CC7A 1NMFA 4OGEA 4A4IA 4Y7NH 4DR3L 3NFCA 2PZTA 3MXGA 4IPGA 5E1FA 4PJJA 5A2QL 1M1FA 2AK5A 1AHJB 1M4ZA 1IL2A 1LT5D 5D6WA 1SNPA 3C46A 2O9SA 5EPJA 3A8MB 1STEA 3VR2A 5HK0A 2QEXQ 1ILQA 5M5WH 5G3LF 1S5BD 3NXWA 4IALA 5KNBA 3MAQA 4LNPA 4QVZA 1RADB 3Q24A 4KI0A 2R3ZA 1T0JA 3EFXD 2BA1A 2OTJA 3R93A 2QILA 1CSQA 3GV3A 2MPMA 2VB3X 4A3MH 1V76A 1AZPA 4Y92A 3EAEA 3U58A 5CV4A 4V190 3E9GA 3FHWA 2Z6KA 2R7FA 2DGYA 1CA5A 4LF7Q 1RUWA 3G4ST 4K5VA 2JA6G 3I90A 2EYXA 1EQVA 2K50A 4IN3A 3GTKB 4E7IA 2JVVA 3ZYYX 3I55Q 1EY4A 2JA5H 5IP9H 4X64L 2RK2A 2E70A 1RJTA 3SVMA 1Q81U 5C6AA 1JXMA 1JOQA 1ZX6A 4EMKB 5DM7R 1NUCA 5IXFA 2IPKD 3IQLA 3ULLA 1A2UA 5JJZA 2QXFA 4TRDA 2G3RA 2F4VL 1VQLT 5FLXL 1X43A 2F5KA 1K9MU 4B3TQ 1D09B 2MMPA 1LM0A 4MHEA 5GAMe 4UAIA 2XD0A 2MOXA 2NVQB 2WB1G 1W70A 2JNGA 1RAEB 1ONLA 4O2DA 4KJOA 3VS2A 4FT2A 2QAZA 4DUYQ 1AH9A 2F2VA 2B86A 1LT6D 2RVLA 3RLOA 1WLPB 1SBBB 3I4NB 3PO2G 1TWHH 2CVRA 2A7YA 4R4IA 3PVQA 4EDUA 4RGNA 3TZUA 1EL0A 5IAYA 4HEDA 2ID0A 1BYMA 2Y0SE 4A53A 4S3SA 1JEGA 3SK6A 1C0AA 1N32L 2CUDA 2HMAA 4XU3A 3NWTA 2E2HB 3PT9A 4FF2A 1Y8NB 1H9RA 1IO6A 4ME7A 3VUZA 3VS1A 4HJ9A 2YUPA 2M00A 4H44C 2FZKB 2P4TA 2LZ6B 2E4HA 3T1HL 2KYBA 4LWCA 1PHJA 4PV1C 2E2JH 5LJ3d 5EGTA 2CDTA 4FSSA 4RTTA 4C0DB 1YJ9A 3S14B 2DJFC 3BU2A 4C8QD 2M9VA 3NTHA 2IY5B 2LMCB 2NVTH 5ELCA 4DUZQ 4XTYA 1VQDA 4P71A 5JEAG 2QA4A 2MQHA 4JS5A 1BCPF 2OTJQ 1QWYA 1WCMB 2EY1A 3OTOQ 2F0QA 3GTLH 3QJYA 1Y0MA 4PJOA 1Q8KA 1H9MA 5TSSA 3GPLA 2ZCFB 3VA5A 1BUVT 4DOVA 4JI0Q 4LFBQ 4M7AC 2AIRB 2UXBL 4HCSA 3UA7A 4J5YA 4A3FH 1STHA 3BYTB 2V26A 5DLOA 4DXFA 3FDTA 4QQ6A 3AQQA 3VYHB 3G7LA 3LLRA 3QPHA 1JT8A 1K8AR 1PZJD 4R8NA 4PNYA 3CCUT 1AFPA 3KXTA 4GBQA 1KG1A 2MF2A 2AKKA 2VGNA 3CD6A 3OSOA 1QVFS 1PH3A 1DGSA 3E0EA 3U50C 5CIUA 3SK4A 1W4SA 1ICWA 1EIHA 3R6NA 1VA7A 1Y71A 3FJ5A 4XTXA 1PRTC 3CBOA 3VS7A 3L2WA 4G7OC 3GTGB 1RCVD 4QUCA 1HR0Q 1FGUA 2K5QA 1VQBA 1HA5A 4IFDI 3OYHA 2L11A 5HURA 1WGSA 1H9JA 1MSGA 1FJGL 3I8ZA 4OELB 2EQIA 2RSNA 4A3BB 4L63B 4RA8A 1W6JA 5I9OA 1OXXK 2F0LA 1AZQA 1V9PA 1BO0A 1VQLQ 2X35A 1M1KC 1WTRA 2ECZA 3RERA 1SDFA 3OYCA 1PFBA 3M9QA 1X3FA 2KHSA 4A3KH 1LTGD 1OV3A 1B3QA 3E9HA 2DNUA 2YTVA 4RGTA 1ZYRD 4LF6Q 3PMTA 5C3EG 1CZWA 2SRCA 2X4XA 2RA4A 1JC7A 4JI6Q 2PPBC 2HL5C 1SYCA 2MI6A 2XWJB 1EWIA 3W1BA 3CPFA 2JZ2A 3RN2A 3HPWA 3GQBA 2E5KA 2EYLA 2LT4A 2WV6D 3DXJC 2FJ2A 3OHXC 4TVAB 2YRDA 2LNHB 1GUWA 4C8QA 3V8KA 3SFMA 1UE1A 2JJQA 3X20B 1WA7A 4PJMA 4HCZA 1VYTA 4GKJL 1V43A 2K6DA 1U1SA 5AT1B 1WI7A 1Q12A 2PTKA 1SE2A 3A7AB 2K5VA 3MCAB 4NPSA 3MO8A 4M75F 4C1NK 3CCSQ 4AT1B 2E2JB 1GUOA 1IYVA 1OU8A 1VQNA 1FVIA 1D3BB 3RMSA 1FYCA 4KH1B 1WHJA 1Q86R 2LJ0A 1U06A 1EEFD 1GVPA 4PJOE 3MC0B 2JN0A 4HIOA 2R7ZH 2UXDQ 4PJOC 3OYMA 3UATA 4EMKC 1TU2B 1I4PA 3ITPA 2FPDA 2ED1A 3NTIA 3TRZA 1JORA 2VYTA 5IYDH 4D6WA 2F0UA 3V05A 4X62L 1NBEB 5M5XB 3CQTA 2DRKA 1U8RA 3EN2A 4DV3L 5GAN2 3DUZA 3RZOB 1HJPA 3TS2A 4F7UA 2E2DC 3META 1VQ7T 2RJDA 1VQEA 2LP5A 4YCUA 3HL8A 3VYGA 2CT3A 2YT6A 3P8BB 3CBMA 2EYFA 3FVQA 1R77A 2E1HA 3LH0A 1K0XA 1A2TA 2GN5A 3BZDB 3L9AX 4IOCA 5LL6S 2EKOA 3M3YH 4M77F 1D0ZA 1KC8C 3EG9A 4DUZL 2EVBA 3OBYA 1QE6A 4YY3L 1EIFA 4C92D 5K36H 2MHVA 2O88A 3QUIA 5LJ5h 1G2SA 4B3SL 1Q82R 2JA6H 4RKBA 2B8GA 3GTJH 4GNXA 1M30A 3RKYA 5IGGA 4ZGEB 3LWIA 2H5XA 3ASKA 4EQOA 5KYNA 4OB0B 3VU3C 4HKEA 5KYWA 1QILA 3MA2B 2AQ2B 4QGUA 3MEWA 4ZKCB 5M3FH 4A3DH 3DWPA 4DR2L 2P0QA 4OB3B 2W10A 5CK9A 3H0GG 1Q82C 4J15A 4PK4A 3DLMA 1DD2A 1JU5C 2CP2A 3IFDA 2GVBA 3NWSA 5C5MA 4A3IB 2RKSA 3K5LA 4J9DA 4KH0B 1H3ZA 4QUFA 2M02A 3VYRA 1F9SA 1FD7D 3MKDA 1AE3A 3C95A 3H8ZA 3JB9D 1PRTF 2XWBB 1I94L 3LWUA 4FO2A 2HZYA 4N4HA 1XNRQ 5KNCA 2HKQB 5HKCA 1PH2A 3MPUB 4AH6A 1V1CA 1N34Q 2FVUA 4NS5A 3ULRB 4PZ7A 1WHKA 3M0UA 4L5TA 1FNUA 1E22A 1LVKA 1TXQA 4M78F 4FSXA 2EGCA 4A3CH 1YJ9Q 2OAUA 2N88A 4HAEA 2B2YA 4X9DA 4M78E 2RO0A 1BQQT 1S72Q 4TQUS 1YCYA 4C56C 5BN5A 3LX0A 2LKVA 2WAQB 2L15A 5GMKh 4AFUC 2EWNA 4PJOB 2C0IA 2EQUA 1SYBA 4BE0A 2DY7A 2OQKA 1VQGA 1N5ZA 1LT3D 4L59A 2DBMA 1HA6A 2K5LA 5ELFA 5GAN6 3S15B 4LF5Q 2DXUA 2VKNA 5GAMg 2HIVA 3I4MB 1WTVA 4Z02A 3ZBDA 4LDWA 1QLYA 3HG9A 4PMCA 4RMOA 4ORZA 1TWGB 3OYNA 4WJ3M 2DD4A 3MXNB 3VYTA 5IT9E 3SWNA 4DNIA 5KEEA 3URGA 4MZPA 1G3WA 2GBQA 2ZZDA 1SE3A 3GTMB 1R8OB 3RDVA 1E2WA 5M5YH 5IT9L 4K6LA 2DTIA 4ZCKA 3S1NB 3PIPA 3JCMJ 4C8QE 2K28A 4A3KB 3HOYB 2EY5A 3WVDB 4B9WA 1A0NB 4M77E 2HD0A 1Y8OB 3BZKA 2OXPA 2KK4A 3MVVA 2LCSA 1VQNT 1GO3E 5LJ5f 4RUGA 3HOYH 4HJ5A 2KY9A 1E6HA 1UEBA 4C0FA 2OT2A 2PMZB 4DV1Q 2JA8H 5LJ5e 3REAB 3E1SA 3JB9G 1FR3A 3EBEA 3SK8A 2EPDA 3T1YQ 1LABA 1N36Q 3JCMb 2YDLA 2KRMA 4NP5A 4XIGS 3I2ZA 4B3TL 2XMFA 2NN6G 3ZL7C 4L8JA 4BI4A 3M53A 2DNEA 2XGTA 1W1FA 1EYAA 2BIVA 3EHRA 1STGA 1KL9A 4C0GA 1MNEA 2DN8A 2JMAA 5DM63 1TUGB 1YHAA 4C3HH 1GCPA 1D5ZC 3TBIB 5DY9A 1D1BA 3A5ZB 1JE4A 3OYEA 1OYXA 4NW2A 2KGTA 3OA6A 4CRIA 4X64Q 3RR5A 3T1YL 5T1GA 4L6V5 2JJ9A 2K3YA 4C8QB 5GMKl 5FU6C 5FO8B 5KIXA 3IKJA 3QDFA 4DBQA 2JS0A 5ELEA 4F88A 3MXUA 2LQ8A 2HCCA 4Q0FA 3PGGA 4DBFA 2Y0SB 3BG3A 3J7ZC 4PJOG 2JXMB 1C8CA 1HNXL 1JB7A 3OBWA 2DLPA 5EBDA 4JJNK 1AWJA 2A19A 1M2OA 3A8OB 2E10A 1Z6HA 4JI4Q 1HJDA 1YHQT 1DOLA 1OI1A 2PU9B 3V7RA 4BBSG 1WJRA 3NHHA 1RI9A 2D2CC 1HD3A 5GANf 3OYFA 1PWTA 3S15H 3EH1A 2KOLA 3BDOA 2LNVA 2K5DA 4C92E 3K0XA 5GAN3 4JI3L 1KD1R 5IWAL 1OULA 4BUGA 2K75A 1B34B 4RTUA 1YJWQ 5CBAE 1E0BA 5FU7C 2X69A 4ALPA 1GJXA 3G6ET 4C3IG 2FB7A 2JT4A 4XTVA 1XTDA 2NLUA 2EYOA 2FZCB 3HOWH 4KN7C 1Z47A 4OX9L 3UDCA 2WINB 4FW2A 4A63B 1UDLA 1I6HH 1TWCB 1P92A 1YJNT 1CHQD 4DV6L 4IIOA 3UPUA 1TR5A 3TU4K 2KEDA 2F2XA 3W3AA 4UY8C 1H95A 3M59A 3D6CA 3QO3A 5FJ8H 5EKKA 2RHZA 4WTOB 1RKNA 1LTSD 2JTMA 3M0PA 2ZPBB 3WWVA 4C5HA 1K3BC 5IIFA 3FEOA 4YHHL 1O7ZA 2DF6A 5FJ8G 1S5FD 4ELZC 3PNWC 3S16B 5LMNW 2KJXA 5GAOm 2XIWA 4RHRA 2XDBA 3M7NA 3EFRA 1UHFA 3ZEHA 1QCBD 5GAMf 1M2VA 4HA8A 5KCOA 2A8VA 3NPFA 1UUPA 1GRIA 3H6ZA 3HP3A 4TSSA 1YIJA 1VQ6Q 2FZGB 4DR5Q 2NUTA 1QVGA 2D62A 4LUOA 3H3VC 4HVWA 2KBNA 1JXOA 2BZ8A 4GN5A 5M3FB 4DR1L 4A3DB 3ZJYC 2K7AA 4DV0Q 2KE9A 2JA5B 2A0FB 1D2BA 2EQSA 1EU4A 2E74C 1BF4A 4OWWB 1K9MC 1ABQA 3I4LA 1GFCA 1K8AC 4OB2B 4DR2Q 1GXDC 1BIAA 2ICEC 3L1AA 5LMNQ 3OS0A 1WTQA 4BY7H 5I9PA 1ZSZA 4M75C 1MKHA 1PDQA 2PW5A 1EWHA 1LTTD 3S24A 4C0DC 8ATCB 5IY0A 1KHIA 3A1PA 1EFID 4RCNA 4DV0L 1KNAA 3BVGA 3SE0A 3DM3A 5L23A 1GBRA 2QA4Q 5LJ3e 3C1EA 3DMUA 1XPUA 3SEMA 2RJCA 1Q7YR 3OSVA 4KGVB 1QUQB 2BCOA 3CCQA 4Z9CB 1Y1WH 3HHTB 1I3QB 4LFAQ 1A62A 1XPRA 3G71Q 2LTOA 4DNRB 2KNBB 4LE9A 4YWMA 2ZPFB 4QCLA 3CAMA 5HK3A 3OYIA 4P73A 5KRUA 3AEVA 4D8DA 4GS3A 2DILA 1U3OA 3RR6A 5IYCG 5C4XG 2RQUA 2DZCA 1LLRD 2EQMA 2A6ED 1YFNA 2V4DA 5GANd 2I0QA 4NXNL 1HFNA 1WTXA 5EKIA 1X9NA 2PNIA 3WDNA 1GFDA 5HY6A 1BU1A 4JI2Q 4M77D 3S14H 2D0QB 1K76A 1PD0A 4M7AA 1VQFA 2F0OA 2VNUD 3KK7A 1GUSA 4C2MB 2ED0A 4BDZA 2OF1A 4LD9K 1UEAB 3J81i 4ODGA 4IJHA 4CI0C 1L0YB 4M7AD 3L7ZC 3NUCA 3WOEA 5ELDA 1O78A 4LF4Q 4JW0A 4GLVB 2KCTA 2VQEL 2DXBA 1X01A 2RJFA 3VR4A 1WVLA 1PTOF 4LDYA 1WTWA 4JOIC 4CDDC 4LF7L 2HQEA 3C4SA 4HCEA 4HT8A 4E47A 1Q86C 1X27A 1DM0B 2V1RA 4Q5VA 2MP1A 1PA6A 1SNDA 4EQNA 1HK9A 1KJWA 2QA4T 1HUMA 3JAML 1RL2A 4BBRB 5KYIA 2RD1A 4PKCC 4Y91A 1OEBA 4KUIA 1WHHA 3CC4Q 1ARKA 1EOVA 1PH8A 1KLGD 2PQEA 1KQ1A 1IYJB 2YLCA 2RQTA 1ENAA 3D8GA 3KDFB 3J81L 4M7DC 2ZTDA 3FC3A 3SEBA 2RH2A 1QVGP 1XTCD 5I2SA 4NXMQ 1ABOA 2IJ0A 3A8HB 1X2KA 1KD1U 2ZJRA 2J06A 1T5EA 1VMPA 2CWPA 1DONA 1Y96A 1G6PA 3F2CA 1SFOB 2YRCA 1UGPB 4PFOA 5IHNA 3CCEQ 1QWFA 3A55A 1VQ6A 1VQOT 2O2LD 5M3FG 4LDUA 2HDMA 4A3DG 2ENMA 2CFMA 2KQWA 3HTRA 1AE2A 2P5ZX 2UUCQ 4IFDJ 1EU3A 2K14A 2B2UC 4XQQA 2K6AA 3K7AB 2L55A 1K8OA 4LUEA 1SJHD 2HSPA 4LUVA 2RQVA 4LF8L 2F2WA 4RKUE 3EFOA 2A68D 2K2VA 1FGBD 2L0CA 5C44B 2ZM6Q 1C9OA 1WHLA 3P8DA 5M3MG 2A6EC 1PFNA 5FRNA 1S5DD 3AU7A 4HCCA 3GTPB 5C44G 2KR3A 2BTTA 1QVFP 4QVCA 2RI3A 4GLKA 4DR1Q 2EY6A 3GTQB 1VQ7A 1N33Q 3VYSA 3EGXA 5IYDG 4HJ8A 4RTYA 2LCLA 4MZMA 3RNUA 4GLAC 2BKDN 3BFMA 3EH2A 2ENBA 1UGQB 2CZ7B 4POFA 1Q7YU 1YWOA 1W2BA 5CV9A 2K79A 2XIDA 1UECA 3PIOA 3WVEB 1ZBXA 5GANh 4JZ3A 5KYUB 2X51A 1YIJQ 1G83A 3H0GB 4ILWA 3A0JA 2I2LA 1MHNA 2DX1A 1YHBA 2L3RA 4BI8B 4AMCA 2Z9HA 1T0HA 4BE2A 1WHMA 1EQRA 3TMEA 4GNXB 2KXCA 5KYUA 2CP3A 2I0NA 5A0GA 3NMZC 5FO9B 3DEPA 2EZVA 1HNZQ 5FO7B 1JBMA 4RG2A 2FO0A 3X3NA 4FP5D 4IFDG 3MP1A 4JOIA 3BE3A 4LJZC 2JA7B 1QKXA 2MCNA 3GNGA 1YNNC 1PSFA 5I11A 1RD9D 1E7ZA 3O13A 1KSWA 3INZA 2XU8A 3OMGA 3S1MB 1A3VA 1BCPD 4IOAA 3JCMX 1MIUA 3KLSX 4X66Q 1QMCA 3M0QA 2FL7A 2PYKA 5GAN4 3OW7A 4IJLA 4M1UB 3DKMA 2OEOA 4PZ8A 3CPWA 1WIEA 2QI2A 1EZ8A 5C3EH 3L2UA 1J9OA 1F2ZA 2YTXA 1T5XD 5I2YA 2EE1A 2O2OA 3FRNA 4C8QF 5IGFA 3RMHA 4C92A 1JO8A 1VQCA 1U1TA 1G2TA 3I56T 2JM9A 2XKOC 2HUGA 1NJIC 1U5KA 2A5HA 3NEMA 4DKAC 2E41A 4C92F 3RBBB 1II3A 1RLQC 2VXEA 3PE0A 5ELNA 4YIJA 3GTJB 2RDGA 5A0DA 3H15A 1AD5A 1QW1A 1MSHA 4MIUA 2JA6B 4J6WA 3FKIH 3K7AH 4JI1Q 2NZHA 3ND8A 5C5LA 5C4JH 2F0DA 4JBWA 1BB9A 2CH4A 1NZ9A 2DO3A 2ZXPA 2VUMG 5F2DA 2WACA 3CCEA 4B6MA 4G4KA 3Q23A 2XNAC 4JV5Q 1SEBD 4DR5L 3OIQA 3H09A 5JEAH 4U673 3HOZH 3OIPA 3AYHB 4DR4Q 3CMEA 4PMWA 1OXSC 2LSSA 2VUMB 1BK2A 2VS1A 1EWCA 3D31A 2N3SA 2EFIA 3MEUA 3OYAA 1O9SA 3HOWG 3JCMP 1BI1A 5JPMC 4QMGA 1VYUA 4IUQA 3CC2T 4ZRZA 1I50H 1MNDA 1PKSA 3BDUA 4M78A 4M75D 1TS9A 4AG1C 4KJNA 3OYKA 1IRXA 3UDIA 1P8LA 1D0YA 2X3XD 2WFWA 4JI7Q 4XU0A 1A3UA 4RH6A 3JCMg 3NP8A 2BA0A 4XTUA 1H9KA 2AUKA 1KDCA 1K73C 3K80C 1I4GA 2Q2TA 4BBSH 1PH5A 5EG2A 2AHOB 3URYA 3CC2A 2DMOA 4RG8A 2MAMA 4M78B 2DVJA 2SNMA 5IWAQ 4AFQC 4RTVA 2NVXH 3C94A 1QOHA 5IOCA 2DFUA 1RAGB 1D1KA 3MXPA 4B3SQ 3OYYA 4RCBA 4X9CA 1JB3A 4LN2A 1S40A 1ET9A 2E6ZA 3M4OH 3JC66 2R5AA 1G3SA 3N6RA 5KYYB 3S1MH 1O80A 4LAAA 1OXVA 2R92G 1L0WA 3JSCA 3QDRB 2N78A 1MHWC 4ME3A 4JV5L 1IGUA 4R9WA 2DAQA 2K03A 1ZSGA 3E2UA 4DK1A 3A5UA 4MDWA 2IPOB 1JMCA 2D8HA 2BE7D 3P8HA 4POGA 4U68A 2JQOA 5LMNL 1YEZA 1RHPA 2RCFA 3BJUA 2EVRA 1K9AA 3OSSC 1TS2A 2L5QA 3TS0A 3T56B 4DAVA 3L2QA 2B2WA 1PC0A 2HEQA 1YNXA 1YWPA 3CCUA 2Z6KC 4PNOA 2IHEA 3J80i 3C1FA 3J7YW 1M3CA 1Y1WB 4MMKA 4OMOA 4H13C 1CFMA 2NN6I 1JOKA 3RESA 2KEAA 2PNRC 2COYA 1QVPA 2WSFE 3TEEA 5IH2A 1QQJA 5CC4A 1R9TH 2Z4HA 5EJWA 2D0OA 2R92B 4ZTJA 4BY7B 3EG3A 1KAAA 4TVRA 4E7HA 1F2MA 2K33A 4AYBB 1K8MA 3HP9A 1J3TA 2EXDA 2NUZA 2ZTCA 4GN4B 2ICIA 4IUVA 1R9TB 4ULLA 2C5CA 3D0FA 4B3ML 4QIWE 2B63G 3VUBA 3TQ7P 2OTLT 1LPLA 1CQFA 1NCVA 2K3BA 1JJ2S 3H0IA 4NL3A 2PVDB 2RHXA 2AQ1B 2PW7A 4X3KA 3F2BA 2HHHL 3CCET 3UF4A 2L4NA 1G5VA 1DZ1A 3MP6A 1SYFA 1C1AA 2L0AA 2PVGB 4F7UF 3CMAQ 2F3VA 2O01E 3S2HB 5KE2A 3LWEA 4J6YA 3SHLA 1VCIA 4RMFA 1I1JA 2E3HA 2RHUA 1B9MA 4H02A 2DYBA 2R7ZG 2KRNA 1YJ9T 1LTID 3GD7A 2AKLA 2Q8RE 9ATCB 4N8X1 2BDNA 2NVTB 1JB0E 1QZHA 4O5VA 4A4EA 3VRZA 1W6XA 2M51A 5DM73 2E5LQ 5AYFA 1EY7A 3TZDA 4QVDA 5FWBA 1E1OA 4DV3Q 4NXNQ 4J8QA 1VQOQ 3QIAA 2MYSA 1M2VB 4BY1B 2LMJA 3CW2C 3PO2H 1EEID 1E2VA 3NTKA 2LQKA 5KNDA 4LF6L 4HSPA 3CXCP 4HT9A 4EPCA 4ZN3A 1VQMQ 2K32A 2EYYA 1TH7A 3CCMQ 3PCOB 1Q8IA 4VUBA 2UXCQ 1W2BP 3A8LB 3HOYG 4JYAQ 1Y1VH 4IFDH 3K81C 1ML0D 2MNAA 1VQOA 2V1QA 2LVMA 2IX0A 4KHZA 4M75B 5CKEA 5J26A 1YNZA 4B08A 4L5RC 3QKJA 2QTXA 1YI2Q 5IGEA 3L2PA 3EVQA 4WFN3 2ZPHB 1VQLA 3HRZC 3UE1A 2KXDA 5FU7B 2YUNA 5I22A 2KUMA 2NVYB 4A3BH 1GD7A 4M78D 1NAPA 4M75A 2DA9A 2QDYB 3BVZA 4A3JH 2KA7A 3NENA 2IW3A 1K8GA 3H3VI 4A3BG 1AT1B 3RZDH 3PUZA 4HN7A 5GMKj 5L8RE 2BH2A 1IHWA 2QASA 2GTJA 4E7SA 1C6VX 1YNJC 3Q6SA 2OJ2A 3EG9B 4ZYSA 4YTLA 2VUMH 1KNEA 3F2DA 3EG1A 2GQIA 5LJ3j 1SLJA 4KKSA 4DXGA 4DQ2A 2A37A 3VS4A 4R4QA 2PNHA 2BDOA 3UDGA 3HOVB 2A6HC 2X6LA 3KDFA 1JWMD 1N9RA 3OYJA 1B50A 1TY0A 1VQ8Q 2I5LX 3LGJA 5IXBA 5CORA 1ZKOA 3EGDB 2YXYA 1FNWA 1SEMA 2DL8A 1X69A 1ET6A 1SRUA 3PUWA 4HR7B 4PQXA 3TP6A 5JVH3 2UUCL 3KBGA 3H94A 2JA5G 1NPPA 1CT1D 1I81A 2GTOA 4A3GB 5CR2A 3PF4A 3S1NH 1XOVA 4C3IH 1HH2P 1NMGA 3CD6Q 1I4QA 4KLKA 4JRPA 2EIFA 2OCEA 3EA6A 1M1KR 1V29B 2RB6A 2RI2A 3ZFJA 3M4PA 1AP0A 1VIFA 2X4JA 2BH8A 5M3MB 2K57A 1VDZA 2N49A 5J1ZA 5K5PA 3REBB 4AQYL 2HQHA 4HTHA 2UUAQ 1P16A 2AMCB 5I6WA 1N6AA 1O75A 3I3CA 3G6JB 4P72A 3K0YA 2Y4XA 1N27A 4BY1H 3GNFB 1PM3A 1VF5C 2YUOA 3M4OB 4A4FA 1G91A 5JJIA 2QCPX 1HFGA 2Y90A 4JI7L 1NE3A 3GTGH 5D6XA 2R61A 4Z89A 1X6GA 4K5XA 4TKOB 4K0KL 1WZOA 1XNRL 5KCHA 1SMYD 4I7ZC 2R6GA 2B2WC 3HRTA 2KVMA 1SSHA 1F1BB 1S72A 3GIBA 2N55A 5EC7A 4M7DA 1KXLA 2NTSA 2DJZA 1QCOA 2CUBA 1V1PB 2LJ1A 2F0NA 2EJFC 2O5IC 3VS3A 3I4NG 4LF5L 3PO2B 3IAYA 2RN8A 2DNCA 2I46A 1HYOA 2D8JA 2OWOA 1S1NA 3EFSA 1PH6A 4Z88A 2QW7A 1UE7A 2L3SA 1WFQA 2K5HA 2ROLA 2B8AA 1F77A 3QZ5B 1PSEA 3BYYB 1DJ7B 4V0BA 3C0CA 1B44D 2XVSA 5I2MA 4OMQA 4OGCA 2FMMA 2A69D 4RGMA 3CPWP 3I56Q 1OZ2A 4LF9L 1X56A 1VQPQ 1B3AA 3RKWA 1TKWB 4YWKA 3UI2A 4NDXA 2JEAI 4ELYC 2K1BA 3R3OA 1K1ZA 4C8QC 1WYXA 3QJ6A 4RFBA 1UWVA 2R57A 3VR6A 5ELBA 4M77C 3F70A 3FJPA 3UWNA 3OPOA 4C3HB 5CBEE 1I4RA 4I7AA 2EYZA 2WKDA 3M3YB 1JE5A 1GHKA 4JBMA 2VB2X 2PQWA 3PSIA 5D6YA 1R4PB 2B2UA 3A54A 1G2BA 3QG1A 4AYBE 1K0RA 2F1LA 1I6VC 4CDCC 2CP6A 2ZJPA 5C4XB 3S2DB 5M5YB 1Q7YC 2QQ9A 4QQDA 1E7OA 4RGOS 1JR0D 1CK1A 3QOLA 1WTOA 4E6IA 5IT9c 4NOYA 1HTLD 2V8KA 3A8GB 1PRLC 4J9BA 3EQLC 2C35B 1R0BG 2KQ3A 4DF7A 1IXRA 1KQSS 2AZVA 1PRMC 3LGFA 3JB9I 1IYUA 1K3RA 3ERQA 2VZAA 3MEFA 1UJYA 3T16A 4A3KG 4A75A 2IX1A 1IREB 4BD3A 1C48A 5CGKA 2CKZB 5IN1A 3V96A 2R7ZB 2M9UA 1I6HB 1RABB 3KUPA 1AWXA 3BW1A 1M90U 1CI3M 4QY7A 3U9OA 1ZUKA 1D1CA 4F14A 5LJ5d 2VB6A 1VQ9A 1IW7D 3G71T 1SN8A 4J9EA 2WAQE 5CV7A 1Y1VB 1QWEA 4X65L 4EMGA 2KCMA 4CHTB 2PZUA 1YP5A 2UUBQ 2RQRA 3JB9H 1PYBA 2FINB 5DAUA 4RAUC 1JJ2A 3CCLT 1DOKA 4XT1B 1YJWT 1BI3A 1AEXA 3AHUA 3I91A 4C2MH 2TSSA 2GCXA 3E5SA 2KYMA 7AT1B 4IUNA 1WTPA 4BY7G 4JJBA 1KRTA 2IIMA 3J80L 2Z1CA 1MMDA 3QWXX 5M3MH 3GDEA 4F17A 2RF4A 3CMAT 4FYVB 3DWQA 3BS1A 4N0AA 2NUPB 3TVTA 2P0PA 2H3JA 2GNCA 1X6BA 2ROTA 5FK9C 1WCMG 3P20A 3SK5A 2G9DA 2NZ1D 5EPLA 4ZLTF 1VIEA 1Y1WG 1PH9A 1N33L 1EY5A 2CQOA 3THKA 2BE5D 2C0TA 3CCVA 2F3IA 4M77B 3S2HH 4FXKC 1QP3A 1I4XA 1IKLA 3JCMc 3K5OA 4FNFA 4M7AE 1I3QH 4A4GA 1FMKA 4DEYA 4A3EH 3LYIA 4YY3Q 2HDAA 2ALYB 4JCVE 1LYLA 5LJ3h 4CKBA 5GAN5 1L1OB 4MZ9A 1PG5B 4CKEA 2JOYA 2CP5A 2X4WA 3CCRQ 5GAGC 1UHCA 4M78C 1GKHA 5JVG3 3HOVH 2LDMA 3M56A 2ZXOA 4CJ1B 4C3JH 1ENFA 4CDEC 1GOZA 2RI5A 1CSKA 4N4IA 3CKIB 3HOZB 1W3SA 1CSPA 2L5TA 5AFWA 4GOPB 3UE0A 3G4SA 2QYZA 1RAFB 3PMIA 4XU2A 5BR8L 1PTOD 2QTVA 3HKZE 4K2LA 1SFOH 1LO5D 3H41A 4PL6A 2R92H 1K9MR 1ZXTA 1H9SB 3X25B 1K73U 1VQHA 4FXDA 4G7ZC 3DLLA 5IGBA 1TTHB 2OTJT 2QQRA 4JI8L 3EGXB 3PO3H 4DR3Q 2VUBA 4FYYB 1GUNA 4M78G 1Z9FA 4HSVA 2MO1A 1T9HA 4R0KA 1NM7A 1Y96B 1GL5A 1MGSA 2D5DA 2PI2A 4MTKA 2DTHA 1MMNA 2NWGA 3M4GA 1K83H 2HCKA 5D3IB 4F04B 2KCCA 1WXTA 2QQAA 1KAWA 3A56A 2FRWA 3U4VA 2SNSA 5C0XI 1X3QA 1D5MC 4JG2A 3AMUA 2LT1A 1IGQA 5LJ3g 1TWGH 1YITT 3KUFA 1H92A 3FDRA 3TSWA 4PG3A 2JSOA 1BVSA 1R0CB 5CV5A 4CDFC 1HXYD 1UAPA 1AZEA 1RLPC 2ATCB 4JK1C 5DEHA 1S4ZA 4F7XA 2KHIA 4WF2A 2VXFA 4JI2L 1SPKA 3I35A 5IE8A 2RJEA 1WJSA 4J9IA 1KQSP 2NB0A 2AHJB 1QKWA 4E7JA 1M8AA 2M2LA 1VQAA 1HHVA 3CBPA 4M7DD 3MHBA 3U4ZA 4DK6C 1RAHB 1MMGA 1TWFB 2UXCL 2MJ8A 2EOTA 2O4XA 3QOJA 2DM1A 1VQ8T 5ELOA 5IGDA 1W6KA 5HCKA 3OY9A 5IP7H 2GA4B 2QGGA 4UP8A 2BE5C 4B3RQ 2CZ6B 4JI5Q 2F4VQ 1KD1C 4KY7A 3X28B 3E9FA 2RSOA 1AOJA 1D0XA 1EUJA 2K01A 2DL4A 2JS2A 3HOUH 3G4SQ 1J8IA 4J8OA 4HCBA 3PVLA 3CCQT 3A8IE 2YRVA 4DAPA 2RHYA 4HVUA 1VQ9T 3M0RA 1O7YA 3I70A 2KRSA 2B39A 4CJ2C 1FJGQ 3K57A 2H3EB 3LNNA 2O5JC 3P75A 4OIJA 1CQVA 1ICFB 3H91A 1OXTA 4IUTA 1PVOA 5GADC 5A2QE 3G71A 1KDBA 1KLUD 4ESRA 2KHJA 3NQTA 2OTLA 3I4MG 3W2DA 4J9FA 1KTKA 1CZGA 4CC2A 5GQOA 2OQ0A 3LH5A 2AT1B 2EDGA 1UNSA 2W0ZA 3CC7T 4C5GA 1VQ4A 2JA7G 2D0NA 3V7SA 1IW7C 2QEJC 3PUVA 4DEXA 4BDYA 1YIJT 1ESRA 3SHWA 1WD1A 3ERSX 2JYOA 2Z0WA 4DV7Q 2AQ3B 1SSFA 1ASYA 2HAXA 1IHZA 5FWCA 2EAYA 4JLIA 3PF5A 1X54A 3D7SB 1I94Q 2EJ9A 4A93H 1I5LA 2HDLA 5DLQE 3S6WA 1RODA 4B3RL 4YWLA 2GF7A 2CP7A 5KYWB 1CKNA 5JOBA 3V2TA 3NBHA 5IP9G 4KRTA 2F0VA 3JAMc 1SR3A 3G48A 3OW2S 2JUFA 2BZYA 3GTMH 3PV0A 1GBQA 1YJNA 3RZOH 3KLRA 1PV4A 1NJIR 4DA4A 2E75C 5D14A 1B4OA 2L89A 5CV6A 4X1VA 3CPWS 4J9GA 1VQ9Q 3T13A 2J05A 4J7IA 3J7A5 2RCNA 3PUYA 1FXXA 3MHXA 4LF8Q 3U9SA 1M3BA 2RMOA 2EYMA 1XMOL 2K3XA 1SJED 2CW0C 2ZGWA 3KF6B 4I65A 2M0OA 1QB5D 4X3SA 1VOMA 1HQRD 4XQJA 2NVYH 2RDHA 4RHSA 3RUZA 4A3FB 1G6ZA 1N32Q 2LX9A 2EGAA 3T53B 1ENCA 4JI4L 1TSFA 4XTZA 4MNOA 4X3UA 3D3RA 4HCKA 4KBMB 5KYXB 5CKFA 2BE9B 2L3QA 2ZPGB 1VQKQ 2B2VA 4K0KQ 1Y07A 2ABLA 5C0MA 1STAA 5CO7A 5E3FA 4M75E 3J81j 4F7UB 3TEHB 3M4QA 3S17B 1PYWD 1CKMA 1YI2A 2UUBL 2IG0A 4EX5A 2XI9A 4XQ3A 4O6JA 4KHPQ 1QP2A 1UTIA 5LJ5g 4F16A 1RTOA 4CGYB 2EYJA 3UDXA 3HFZB 3OS1A 1UE9A 1BI0A 1PRTB 2WP8J 2DEUA 3A74A 1SROA 1PNJA 4PJOD 1I4HA 2E2IH 1ZA1B 1IBLL 2ASBA 3VR3A 2HT1A 1BCMA 1AWWA 3WOFA 2KT8A 4X3TA 2EYPA 2F0MA 2BUDA 1WXUA 2HKNA 3HKSA 3CCVQ 1VQPA 4BBRG 4HJAA 5GJVB 4EQPA 4XYOA 3OW2P 2LC4A 2NUTB 2KI7A 4WJ4A 1EY8A 2VVKA 2NZOA 3BDLA 3ONAB 1QCNA 4O42A 4Y52H 5IHKA 1LACA 2EYHA 3M5AA 5GAHC 1SKUB 1B2TA 4C0ZA 2EW3A 3L42A 1H3HA 3O5ZA 1NY4A 3VR5A 5CAIA 3CCRT 3OWEB 1X55A 3K58A 2I07B 3CCMT 2JTFA 1EX4A 1Y14B 4HMIA 1HNWL 2CT4A 4R1JA 1AVZC 5GMKm 1OPKA 3DEOA 3TSZA 2MK5A 2BZXA 2FPEA 4GNXC 1B34A 3PGZA 2ZJQA 4JI1L 2HSEB 4MTNA 4OIKA 4LDXA 4UP7A 2MUYA 2YYZA 4CJ0B 1NR4A 5C3EB 3HOWB 2E5LL 3BVMA 4X6AH 1JQYD 1OO9B 3G1JA 3K5NA 2F0FA 1Q95G 3P1HA 5IYBG 3JCMW 1U4LA 5IGCA 3D4DA 2GGRA 1B7TA 1HQMC 4A54A 4Q5WA 1S5CD 2D6FA 4K14A 2A3LA 1ASZA 5LMUQ 3QWNA 4R4TA 4Y28E 2DKGA 2XTIA 3EIVA 5CYUA 4X65Q 3CCJA 1W2BS 3L2RA 2ATWA 3CEYA 4ZNXA 2CWAA 4DR4L 1QZGA 4BI3A 3F8TA 2RA2A 4DV1L 3K59A 1A6XA 1A3TA 1N8RU 4JYAL 1NLOC 4DA2A 1LOJA 1QVFA 3JB9F 1PRTD 4DAYA 2LCCA 1D6EC 3S1QH 1BDOA 1PYSB 3CC7A 4QL5A 3L0OA 4A4KA 3S17H 1CKOA 2A73B 4N9PA 5I4DA 3RKXA 1MJCA 1I4K1 2KDSA 5KYYA 2PZ1A 4RTZA 3HOUB 2ZT9C 4J6XA 3TQYA 2VXWA 2L1BA 1PMRA 4MMLA 1OZ3A 4P2CB 4C92C 2RDFA 4UP9A 4HJ7A 1XMQQ 2V8JA 2EXZA 4DR6L 1M8MA 3CCRA 5AJ3L 4GN3B 2EJFA 3TSSA 5EPKA 5L37A 1J5EQ 4FIBA 2FRYA 1I50B 4DUYL 1WX6A 1TWAB 1G8ZD 4E6RA 1NJIU 2J6OA 5FLXc 2MWOA 2LQWA 3OYBA 1A0IA 2Z0SA 1KHCA 4EVOA 5I6YA 2J6FA 4DPGA 5GANg 1F2YA 2MGSA 4JI0L 1XNQL 1I5OB 1QCFA 3BY7A 3M55A 3R2IA 4JVZA 4DR6Q 3QBYA 3CCVT 2ZXRA 3S2DH 4NXML 1ZUYA 2XDPA 1LUZA 4KHVA 3TP5A
chains in the Genus database with same CATH topology
4IKFA 4XK8E 3RMQA 2F69A 4A3MG 2KSSA 2JA8G 2GQVA 1VQ6T 5CVIA 5FU6B 2DUDA 4BB7A 2RK1A 1UE5A 4JI8Q 4ZGJB 4A93G 4JLGA 4LF9Q 2DTOA 2F5TX 3FKIG 5FRMA 3OS2A 1RI0A 2A1AA 4M77G 3FIFA 2YHTA 3W5OA 5HGQA 3VJPA 1G3TA 2R58A 3MP8A 4RG1A 2VW9A 3QSUA 1QVGS 4GLXA 2GFUA 2CS7A 2JK8A 1Q1BA 2JE6I 1CUKA 2HIXA 4OX9Q 4A4HA 3SWNC 1Q81C 3RLNA 4P75A 2QEXA 4OMFB 4AIMA 3N5BB 2VQFQ 4DV5Q 2HQXA 1VUBA 1M1GA 1B8AA 4M7DB 3K7UC 3AFQA 3GLXA 4PLLA 1Q82U 1H641 5GROA 2C06A 1UGRB 2K4KA 2QQSA 4LFAL 4FL6A 3SGIA 1L2FA 3HRUA 2JA7H 2V8IA 1L1OA 1N9WA 1TXYA 1ZQ1A 2XG8D 4HIKA 2YTYA 2B63H 2VC8A 4ZGDB 3CCMA 3CCLA 3IRBA 4A3IH 3LGLA 3CCSA 2RHQB 3VDYA 3S3MA 1YVCA 3PTAA 3CMAA 3CD6T 4BXXH 4L5GA 4F7UE 3KLWA 1UE6A 4LFCQ 2X4YA 1C7YA 4BXXG 2DIGA 2B3GA 3FP9A 2QEXT 1YJWA 2RM4A 4M75G 3CC4T 4DV7L 4X34A 3GTQH 1NBWA 1HZAA 1GXIE 3L2ZA 4JS4A 3CC4A 4JRKA 4P74A 2Y4YA 1CKNB 2E12A 2IHFA 3O8VA 1PH7A 2O4XB 1GM5A 2YLBA 1B7YB 3I4OA 4OO1I 4C92B 4N4GA 1PH4A 3HOXH 4P5NA 3B6YA 4LF4L 4KULA 2DD5A 3CMET 2K5NA 1TWCH 4JRQA 1EYGA 1FWZA 4QQBX 5LJ3f 5A0LA 2Q2HA 1HR0W 1IBMQ 2VY3A 1X3EA 2XICA 1M1KU 1FL0A 4LW1A 4FT4A 1XNIA 1HNZL 1IBLQ 2IT1A 3M4YA 5JJLA 4ZN1A 1QUQA 3UT1A 5GAOl 3ULJA 1YHQA 5FLXE 1NPRA 1PFSA 4DV2L 1HZBA 4XTWA 3QHSA 3HSBA 4GOPC 2PVOB 3CP0A 2UU9L 5BR8Q 4NL2A 3CF5A 3JAME 4UPAA 4DAMA 2ZPIB 4JC0A 4L5SA 2CKKA 3OQ5A 5GAN8 3L2VA 4PLIA 4C92G 2AWNA 4A3GH 3J80E 1HXDA 3J81E 4OXPA 1WOCA 4LF5Q 2CZ0B 2E6NA 1VQ8A 2L8DA 5GMKi 5CKBA 5IP7G 2LRQA 1VQMA 4R4OA 2VV5A 4DV2Q 3MEAA 3OMCA 3RUXA 3JCMV 2K52A 1D7QA 1WCMH 1KC8U 5GAN7 3TREA 1EFWA 3M9BA 2P0KA 1E1TA 2DEQA 3OYLA 4L5QA 3Q1JA 2FXQA 1XQHA 4GKKQ 3SDZA 4OWXB 4HIDA 4C5EA 2HNIA 1VQKA 1X3GA 2EJGA 1X75C 2V1CC 1D8LA 4BBRH 1JRIA 1O7IA 3R6OA 1E3PA 5IYCH 4DAYB 5CKHA 3KF8B 3I55A 5JJKA 4PZ6A 4JRIA 2E5QA 4M7AB 3V7CA 1I8FA 2AKWB 1XMQL 1YBYA 2Q2IA 3OB9A 1YI2T 1IBKL 1WQ7A 3OYGA 3K8AA 5EAYA 4OP0A 2VGMA 4M7DG 2QGQA 4IPHA 2ZM6L 1TWFH 4B9XA 3J7AF 4KT0E 4FM4B 3S1RH 4LNQA 1WPYA 2KMTA 5GAMh 2E65A 5C0XJ 3VKIA 4BACA 5GAOr 1VS0A 1G51A 2DK3A 3PFSA 1FX7A 2XHCA 4M7DE 3F1ZA 4DK3C 5LMUL 1BBUA 1LTLA 3SD4A 1KQ2A 4UC4A 2GVAA 4ZTFA 3ME9A 3OTOL 3KFUA 4IUPA 4HIMA 2M16A 3QZ9B 3ER0A 4LD6A 4AYBG 2KVQG 4JBKA 5CQYA 3FB9A 3NBHB 3HRSA 2CGHA 3HOZG 4F7UG 2LXKA 1B70B 3JCMf 4JBJA 3RLFA 4XU1A 3CQZH 4EQ5A 2HQLA 1WQWA 5KE3A 5M5XH 4KUDK 3G7ZA 3LW5E 2IVWA 3PO3G 1N8RC 1JJCB 1M90C 4A3FG 4A3IG 2PUKB 3I4MH 3I7FA 3HKZG 3STBC 2DZ9A 2Y0SG 3RIRA 2K5IA 2CZ1B 2E64A 4OO1G 1LJOA 4LDVA 2PUOB 1MGQA 1D3BA 1G291 1IBML 2D0PA 4FU6A 4KHPL 1OXUA 1Y7XA 4MZTA 4R55A 3E19A 5E7NA 3JCMQ 3JCMd 4LUZA 5GAMj 3M85A 3M57A 4RCCA 3HFNA 3OW2A 1Q1EA 3DB3A 1HZCA 3QYGB 4M7AG 2I5HA 4JI6L 5KH6A 4A76A 2KAFA 1KQSA 2WSEE 4II1A 1YZ6A 2AWOA 3BZCA 3JB9J 5IYBH 4E7LA 2CCZA 4GKJQ 4BY6B 2ZPEB 4OVAA 2LXJA 4QW2A 4EMKA 4NB3A 4O0AA 2YU9H 4YCWA 4OF1A 4DR7L 2D9TA 1VQ4T 4A3CG 2JA9A 1WJQA 1BI2A 1KIXA 2XK0A 3HOXG 1XJVA 1X65A 3LWHA 2MFIA 2WAQG 3UDFA 4IPDA 1UGSB 2HBPA 3RN5A 2F52A 1K8AU 3CXCA 1L1OC 1N9SA 3STBD 3LX7A 2PI2E 1IZ6A 1J5EL 4A3EG 3HFOA 2UXBQ 4C5IA 2FHDA 3J81c 4BY6C 3J80c 5K36G 2PMZE 4M7DF 1HNXQ 2DPPB 1X6OA 4QQGA 5CQXA 2M1HA 4X66L 2K4YA 1QVCA 1MJEA 3SWNB 5JEAJ 2R93G 1YITA 4DR7Q 2N8NA 1NTGA 2R7DA 3MEVA 3FLGA 3TCJA 4XTCS 1BIBA 1VQ5A 1IBKQ 2NVQH 1M8VA 1BKBA 2DIQA 4LFBL 1NE8A 3GOXA 5H1SE 3SB2A 3ULPA 3Q8DA 3OYDA 3QYHB 4A3GG 2HHHQ 2EQJA 1J6QA 3VV0A 1M9SA 1VQ5T 2EQKA 4B3MQ 2DVEA 4V2SA 2JEBI 3JCMe 1WNLA 2RHIA 1BBWA 4AQYQ 2UUAL 4OWTB 1XPOA 3HOVG 5GANe 3CCJT 3I55T 4LFCL 3KYHC 2WSCE 3C12A 3T9NA 1EQQA 3GF5A 1HZ9A 2B29A 4JDSA 4OONA 2PQAB 4DV6Q 1SMXA 3KJPA 4DOWA 1VQMT 5GAEC 2XDDA 1HR0L 4DV4Q 2YV5A 4JI5L 2EYQA 1HNWQ 1VQPT 3GO5A 4E7KA 1EIYB 3V8LA 4JUVA 4BE1A 1S3OA 2VQEQ 1ZHIA 1OTCA 4IURA 3GTOH 4BY1G 4J83A 1E24A 1Q46A 3S3NA 4OB1B 2R93H 2KENA 2VL6A 3I4NH 5GAMd 4X62Q 2E8GA 3QIIA 1WYDA 1N36L 5J3BA 5M9OA 4GY5A 2PQAA 4APVA 4GOPA 1M5Q1 5GAOp 3CXCS 1XNQQ 4ATOA 4BA2I 2CYZB 3W1GA 5C44H 1PH1A 4M7AF 4IO9A 5GANj 5AJ3Q 5FLMH 3GTPH 2UU9Q 1WI5A 3M58A 3PUXA 4L5RC 4GNXA 2GFAA 1V1QA 5GAOn 3OS5A 4IPCA 1JJGA 5FLMG 4J7FA 3ICEA 2DXTA 2WB1E 1WJJA 5I21A 5J39A 1A8VA 1XMOQ 4MDXA 3KJOA 2Q2UA 3G6EA 1Q86U 3T1HQ 4R56A 2UXDL 1LNXA 4FDBA 3H3VH 5FROA 2ZTEA 1A63A 4N0AC 1S72T 4IUUA 3GP8A 2ES2A 3X24B 4PJOF 4QJFA 1I5FA 3E9IA 3KOJA 3QXEB 2I5MX 3KF6A 3NELA 3V8JA 1TWAH 5GMKe 5CCAA 2FYKA 4BA1I 3AFPA 5LJ5j 5CKDA 1RIPA 1VQKT 2QQBA 1UB4A 3JCMh 4R4CA 2K5FA 5C0XG 1VQIA 3JAMi 4Y7NH 1KRSA 2R5MA 3WXMB 1N34L 2MO0A 4A3LG 5C6SA 5GAOq 3X26B 1VQJA 4DV4L 2DXCA 3CCST 1Y1VG 4A3LH 4YHHQ 1G3YA 4M77A 3H0GH 3I56A 3JRZA 3HOUG 2E2HH 3M54A 4EMHA 1U0LA 4YCVA 2VQFL 4DV5L 4C8QG 4GKKL 2RHSB 4XAXB 3DB4A 2MWPA 1SE8A 4A3JG 3S3OA 5C4XH 1NMFA 4OGEA 4A4IA 4DR3L 3NFCA 4IPGA 1M1FA 1AHJB 1M4ZA 1IL2A 5D6WA 3A8MB 5HK0A 5M5WH 4QVZA 4KI0A 2BA1A 2OTJA 1CSQA 4A3MH 3EAEA 3U58A 3E9GA 3FHWA 2Z6KA 2R7FA 2DGYA 4LF7Q 2JA6G 3G4ST 2K50A 4E7IA 2JVVA 2JA5H 5IP9H 4X64L 2RK2A 2E70A 1Q81U 4EMKB 5DM7R 3ULLA 2QXFA 2G3RA 2F4VL 1VQLT 2F5KA 1K9MU 4B3TQ 2MMPA 1LM0A 5GAMe 2XD0A 2WB1G 2JNGA 4O2DA 4FT2A 4DUYQ 1AH9A 3RLOA