3OZOA

Crystal structure of insect beta-n-acetyl-d-hexosaminidase ofhex1 complexed with ngt
Total Genus 190
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
190
sequence length
572
structure length
572
Chain Sequence
EDVVWRWSCDNGKCVKLKNDPRSSEPALSLEACKMFCNEYGLLWPRPTGEADLGNFLSKINLNSIEVKILKKGATDDLMEAAAKRFKEQVSLAIPRGSTPKLTGKAVDVYLVNENPNEKAFSLEMDESYGLRVSPSGADRVNATITANSFFGMRHGLETLSQLFVFDDIRDHLLMVRDVNISDKPVYPYRGILLDTARNYYSIESIKRTIEAMAAVKLNTFHWHITDSQSFPFVTTKRPNLYKFGALSPQKVYTKAAIREVVRFGLERGVRVLPEFDAPAHVGEGWQDTDLTVCFKAEPWKSYCVEPPCGQLNPTKDELYQYLEDIYSDMAEVFDTTDIFHMGGDEVSEACWNSSDSIQNFMMQNRWDLDKESFLKLWNYFQQKAQDKAYKAFGKKLPLILWTSTLTNYKHIDDYLNKDDYIIQVWTTGVDPQIKGLLEKGYRLIMSNYDALYFDCGYGAWVGAGNNWCSPYIGWQKVYDNSPAVIALEHRDQVLGGEAALWSEQSDTSTLDGRLWPRAAALAERLWAEPATSWQDAEYRMLHIRERLVRMGIQAESLQPEWCYQNEGYCYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal Structure of insect beta-N-acetyl-D-hexosaminidase OfHex1 complexed with NGT
rcsb
source organism Ostrinia furnacalis
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords N-acetylglucosaminidase
total genus 190
structure length 572
sequence length 572
ec nomenclature ec 3.2.1.52: Beta-N-acetylhexosaminidase.
pdb deposition date 2010-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00728 Glyco_hydro_20 Glycosyl hydrolase family 20, catalytic domain
A PF14845 Glycohydro_20b2 beta-acetyl hexosaminidase like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3ozoA02
3.30.379.10 Alpha Beta 2-Layer Sandwich Chitobiase; domain 2 Chitobiase/beta-hexosaminidase domain 2-like 3ozoA01
3LPOA 5FIPA 3UETA 3AHZA 4JKLA 2EXOA 2XYLA 1DHKA 1GOMA 1OGGA 1PJ9A 1FH9A 4L4PA 3VIIA 2BVDA 1W1YA 3IANA 4UQBA 4PBGA 4J3VA 3AS1A 4JIEA 4J27A 3VIKA 1VFFA 1GOKA 4FMVA 1WP6A 2DT1A 3WNPA 3OG2A 4MDPA 2Y5EA 1L0PA 4ZXOA 1PX4A 1GUVA 2D3LA 3SCTA 5A69A 1X1NA 4FLQA 2O9PA 3K8MA 4JL2A 1QHZA 1UD2A 4OKDA 3WDJA 3CGTA 4C7FA 2W62A 2V3FA 2CBVA 4P7OA 1UA7A 4DUWA 3RPMA 2Y24A 3MUY1 1MVYA 3KL5A 3GH5A 2ZUWA 2V5DA 3TP4A 2WMHA 1CGUA 1CBGA 2CKSA 1J11A 1Q4NX 3WN6A 4D71A 2WPGA 4D72A 1F4AA 4CGTA 1QVBA 4HMCA 1B3WA 5IXEA 1MFVA 3NSXA 4GPNA 2E3ZA 1HF6A 3L2LA 1QNOA 1E6RA 3AIUA 3MANA 2OLHA 4M1RA 2YL8A 1KXHA 3A4XA 1GOIA 2EO7A 1BQCA 5CQ1A 1OWQA 5E6YA 2J7BA 3PZMA 1E6XM 3NYDA 2YKKA 1V0NA 4PMUA 4W8BA 3AMGA 3CZGA 5JUVA 2Q8XA 1OIFA 1HVXA 4K68A 3FNDA 4W8AA 1DWAM 1E0VA 1V6UA 1ZBWA 1E9LA 5HDRA 2A3AA 1QOXA 5A6SA 5A6AA 1NOFA 3CHCA 4HU0A 1CTNA 4ZE5A 1PX3A 1MQQA 1C8XA 3CHFA 4KGLA 1MW0A 4FLOA 5HBFA 3BAWA 1V6WA 1WZMA 1KQZA 2WC7A 4Q22A 4E8DA 2QMKA 3RDKA 2OWCA 4MNJA 1JFHA 4M56A 5A6LA 4TVCA 1C3FA 5LYRA 3RM8A 1W1TA 1G5AA 1OT1A 1WAWA 2V3GA 4QFUA 4TTUA 1BAGA 3N15A 3AS3A 3WIJA 1ODZA 8CGTA 1HN1A 2X09A 4GI8A 3W81A 5JBEA 1UWRA 1XV8A 1TVPA 2ZWZA 2VZTA 3GTNA 5ABHA 5FCZA 4QCFA 2J7HA 2ZE0A 1E5NA 1F4HA 3NSNA 5F7UA 5CG0A 3AHVA 1NOUA 2YA1A 2WBGA 2EJ1A 4Z2KA 5FL1A 1V3HA 1QNPA 1M03A 2Y4SA 4CU7A 4GZEA 4PYSA 3MUIA 3ZJKA 1E3XA 4NRRA 3WF4A 1J9YA 2YOCA 1W9DM 3WNOA 1KWGA 5FOOA 1BVZA 5FKYA 2GJPA 5AY7A 1PIGA 4FLSA 4BQ5A 1H49A 1LWJA 2CETA 3CZEA 1H41A 2GDVA 3RILA 2CCRA 4HP5A 1B1YA 2YDSA 1UQYA 2FH8A 1C92A 3VX1A 5D9NA 1G0CA 1LL4A 5BWFA 2GVYA 2WHKA 2WMIB 4GZIA 2V3EA 4PMQA 1SFSA 3ZJ6A 2WVTA 2X2YA 3KL0A 3WH6A 3DYOA 2OYMA 4N42A 1W9VA 2OYKA 2WANA 2J47A 1VJZA 4D6CA 1BHGA 5DFAA 3M07A 4MNKA 4GXPA 2ZIDA 2RGMA 4U5IA 3ZR5A 2JALA 4PMDA 4UFJA 2PWGA 5CLTA 3PTKA 4W89A 4Y7EA 1VBRA 4HOXA 1BYCA 3IK2A 4ZFMA 1CYGA 4JKMA 2OSYA 3G6MA 2PWFA 1NARA 1US2A 5C70A 1V6YA 3MV01 3SCNA 3N12A 2ZUTA 4LYQA 3F5LA 1CENA 2A3CA 3N11A 3DHPA 1UH4A 2DT2A 2JE8A 1ZBVA 2WLYA 3U57A 3NJ3A 4PSPA 3CTTA 4IM4A 1R7OA 3VDBA 2CHNA 1RD6A 4FF5A 3BGAA 3J7HA 3SCUA 1H09A 2CXGA 1EHNA 3IJ9A 4OJYA 3A3HA 1C8YA 1JI1A 1QW8A 3O9NA 2Z1KA 1W9BM 2J7GA 3VNZA 3AQUA 3W27A 3PZVA 4D6IA 2CEQA 1DWGM 4CKQA 2GDUA 1H3GA 4AD4A 4AISA 2VCBA 3L4YA 3CHEA 2UY5A 3UG5A 4AD5A 1LJYA 3VGDA 4BQ3A 4IPLA 2D1ZA 3CZ8A 1GPFA 3WNNA 4PMVA 1KR1A 4UCFA 4P7NA 1ZU8A 3CBWA 3AI0A 4D1JA 4WSKA 4JHZA 2B31A 4PN2A 4KRUA 1KCLA 4BQ4A 2VC9A 4MDOA 4J7RA 4HPGA 3AMCA 2X05A 3VGBA 3WNKA 1FFRA 1J0ZA 1VFMA 5ABEA 4GI9A 3UG3A 3I3BA 5IDIA 4GO8A 4J3WA 1HKJA 1WKYA 1GHRA 2XSBA 3GXMA 1E43A 1O7AA 2YDRA 1VFUA 2F61A 3RM4A 2C7FA 3VMNA 1UD4A 1H11A 5CSUA 2VX6A 2WCGA 3GYCA 1EDTA 3WFLA 1W3LA 3WH8A 3DC0A 3QHNA 3W25A 2DH2A 3SUWA 1HJQA 4TXEA 4TX6A 4W8LA 3SCQA 1MXDA 3M6DA 1GQKA 3CMJA 3TONA 1JZ6A 4DWSC 5EB8A 3TTOA 1UR0A 1VJSA 4M24A 4JZ5A 4IPNB 4W5ZA 2OYLA 3MO4A 5CZKA 1OIMA 1LWHA 1UUQA 2VL4A 1PAMA 3MMUA 1G01A 5BXTA 5A6BD 2FGLA 2ZWYA 2DSWA 4D6HA 2ZXQA 1HKIA 1EO7A 2J8GA 2QMJA 1KGUA 3VIMA 2GJXA 1UWUA 4D1IA 3EDFA 4QAWA 4AIUA 1PZ2A 3WMBA 3BAIA 4F9JA 1XYFA 1NWTA 3BC9A 2V38A 1BLIA 3GXDA 4HMDA 5BROA 1KR0A 3HN3A 3VGEA 2WLZA 2YDQA 3TTYA 1JG9A 2XM1A 4AZ6A 3GM8A 3E1F1 1E56A 1TMQA 4A3YA 1WDPA 5CSYA 4HZ7A 4CD6A 5BXPA 1ISYA 1WCGA 3FY1A 3LPGA 1FH8A 1R8LA 3AIRA 1EIBA 4CU6A 2OWWA 3EMZA 5LA0A 1FP9A 3W24A 2NT0A 1CLXA 4GQQA 1WB0A 1IV8A 2BV9A 4ACZA 3VTRA 5M3WA 4TTGA 1V0KA 3VIFA 1J0YA 1C91A 1E6PA 1NQ6A 2FHFA 3UERA 1WNOA 1LL6A 2C8NA 1ZBKA 4PSRA 2A3BA 3UEQA 3EMQA 2DSZA 1TA3A 2VZUA 3CZKA 3MSDA 5AC4A 1CXKA 2GK1A 1WDQA 1ZJBA 1Q6EA 3B8SA 1EGZA 4W5UA 4XUYA 2DSVA 2UY2A 2X0YA 3IAQA 3WQ4A 1JDDA 1KXVA 4FK9A 4AIEA 2WHMA 2WVVB 2CESA 2BNJA 1NWSA 1K6AA 3GXFA 2EPLX 1VEOA 1UWIA 1HJVA 3SCPA 1JYWA 2CBUA 4JHOA 2F8QA 1BG4A 3WH9A 2ZUSA 3B9EA 4XX6A 5GPRA 1HJUA 2XWDA 3SCRA 2WSPA 5ECUA 2VOTA 2ZUNA 2WKLA 4EE9A 4GQRA 2HVMA 2WYSA 1NOWA 3GH7A 3TTSA 2G41A 5IFTA 3AZTA 3U7VA 2VT0A 1V03A 2DIJA 1FP8A 4PMRA 1ECEA 3WUEA 1ZL1A 4UOQA 3ZQ9A 4LX4A 1UR2A 4RE2A 5KEZA 5JBFA 1WO2A 2O9TA 2W4XA 3MMWA 2XVKA 2YL6A 1B30A 4WSJA 1C7TA 5E0CA 1P6WA 3VMOA 4QLJA 2FHBA 3OBAA 3VINA 1JYVA 3CUJA 2EBNA 1E4LA 1JFXA 1W9UA 5D9OA 2ZUVA 3WENA 5D8ZA 3QOKA 1UH2A 2XVLA 3GZAA 3OLIA 3VD5A 3PN8A 1HT6A 2PBOA 2W61A 3CUIA 5A8NA 4B3LA 2DEPA 5HOSA 3VNYA 2W66A 1JZ4A 3VM7A 1HL8A 1CXFA 4TOQA 5D9PA 2J79A 3M46A 2Z1SA 2BY0A 1B3YA 2VX4A 6CGTA 4J3TA 3WQWA 2WMKA 2O92A 3VDCA 3WEOA 5CJ5A 3II1A 1CNVA 1SMAA 3T0DA 1V6XA 2YBTA 1EOKA 4ATLA 3BAXA 2FH6A 3BAYA 1CXEA 3PBGA 1VFOA 5HNNA 2VO5A 4JCLA 5A6BA 1V02E 4A3HA 1QI4A 1HVQA 2PWEA 3AJ7A 1H4PA 1ITXA 2X8RA 1JD9A 3BLPX 1JNDA 3T0AA 4B15A 2VVNA 4AZHA 4W7VA 1ZB5A 1X6NA 1D2KA 2QLYA 4R27A 5BYWA 2AOSA 5I24A 4UZSA 5BRQA 1E15A 5I23A 1EH9A 1O6IA 1M01A 1UQZA 1TVNA 1NP2A 1CECA 3K4DA 1KFWA 1UYQA 5CGTA 3WBEA 3AMDA 2J74A 3NCOA 4H8HA 1W2VA 1I1WA 4DM2A 3NDYA 1RP8A 1EDQA 1UKSA 1E4MM 4DM1A 1XD0A 2YL5A 2EPKX 2J78A 1FA2A 1A3HA 4S3JA 3WUBA 1MWOA 3OB8A 2PB1A 4LYPA 4PTWA 4RE3A 4P7QA 1TUXA 2VI0A 4MNLA 2XPKA 3CH9A 3AISA 5KZ6A 2J77A 2JEQA 1E4IA 1JYNA 1BYDA 6TAAA 4HTYA 4V2XA 2ZOXA 2CBIA 4PTXA 1KQYA 2ZXBA 4W87A 5FL0A 5IHSA 1KBKA 3SIMA 1UKOA 3WQ6A 1J10A 4UOJA 3VDHA 1DEDA 1OINA 3WDQA 4BS0A 4D6GA 2VRKA 2VURA 4QDMA 3AHXA 4PMXA 3L4TA 4X0NA 3VVGA 2WK2A 4JFSA 4HOZA 2E9MA 3PZUA 2VNCA 2CPUA 2F2HA 5E0FA 3SCSA 2WB5A 3W28A 3RM9A 4C90A 5I6SA 2C0HA 2YBUA 3PZOA 1UR9A 1N82A 4WKAA 5IHRA 3ZIZA 1MQRA 4XV0A 3NIYA 1CXIA 5I78A 3NUKA 1EOMA 2W67A 3UR7A 1B3VA 5HPOA 1VBUA 5A2CA 1U33A 2E8ZA 3W53A 1VF8A 1W32A 4AD1A 1JZ5A 3ARUA 4A4AA 3VIOA 1CGYA 2DPEA 1Q6FA 5JIWA 3T0BA 3F5KA 3GNOA 2XG9A 4EAMA 4EKJA 2MANA 3T2OA 4R5EA 4XZBA 3PZIA 1HKMA 4AZ7A 1D3CA 4DWSA 1PPIA 2EEXA 4M29A 3AYSA 2D23A 5M03A 1W3JA 1DTUA 4U2ZA 1GVYA 5GQBA 4NI3A 3D5HA 5ABFB 3U7BA 3CZJA 4F8XA 1G9HA 1KXQA 5I3DA 4CN4A 5A6MA 1J0JA 1LQ0A 3ZJ7A 4GIAA 5LA2A 4UZUA 1KBBA 5IFPA 4UNIA 3VILA 1QI2A 2XFFA 4NF7A 3F5JA 1FFQA 2D0HA 2WSKA 5I77A 3ZT7A 1VEMA 5CPTA 1HX0A 4F9DA 4HPHA 1C90A 1NM9A 3HJEA 1VRXA 4URIA 4WLCA 1J18A 4P8WA 1E0WA 1EDGA 3VDAA 4ZEPA 3MUZ1 1E3ZA 1XH1A 3ZM8A 2PWDA 2CYGA 5M17A 4ZXLA 1J0HA 2RGLA 4XZWA 1UR4A 1HKKA 3LMYA 3ARPA 3PZTA 1MYRA 4QLLA 1UWQA 3BXWA 1GVIA 3UESA 3OIHA 2BXZA 2AAAA 1D7FA 3HMCA 3QR3A 1M04A 1GQLA 1E55A 2YJQA 4MADA 4W7WA 4LQ1A 2W91A 4WK9A 5I5RA 4W84A 2YL9A 2UWFA 2J75A 4AZCA 1UR8A 2QPSA 5BRPA 4CD8A 3WQ8A 5E09A 2FHCA 1UHVA 1E40A 4TVUA 4YHGA 2X0HA 2WAGA 2V3DA 4F66A 4LGXA 5CXPA 4E2OA 1PBGA 1Q6DA 3AZSA 2EQDA 3BCDA 2ZUUA 2GJXB 4J28A 4D6EA 3EDKA 1XGZA 3BAJA 3POHA 1MW3A 5EMYA 2D20A 2O9RA 4WKHA 3DYMA 1W3HA 1R86A 5BXRA 2BY2A 2ESCA 5D8WA 3SUSA 5C8BB 2JIWA 4OOUA 1XCXA 3RIKA 7TAAA 1HP5A 3OLGA 2ZXAA 4ZENA 1OGBA 3CHDA 1LL7A 2BFGA 3FAWA 4S3KA 3W82A 2G3JA 3WD0A 6A3HA 1OCQA 3L4UA 3S2CA 1LF1A 4B9YA 4E4PA 1UKQA 2D3NA 3ZSSA 4PMOA 1FOBA 3N17A 1BTCA 3S6TA 4BA0A 3BH4A 4M82A 2XFRA 4W86A 3M7SA 1DWFM 1RPKA 3QHOA 3ZO9A 2XVGA 4MB1A 1V02A 2G3MA 3ALGA 1UD6A 5A2BA 1K9DA 1SYTA 1UH3A 3ARRA 4H41A 2DQXA 1VAHA 5FD0A 1IT0A 3RJXA 2WC4A 1GOWA 3WNLA 2Y8VA 2CITA 4W85A 1W2PA 3ZJ8A 2VQTA 4PEEA 2G3IA 4H8UA 1GQJA 1VIWA 2WC3A 4L4OA 4JFWA 1EQCA 3BLKA 4HMEA 3KWXA 2OSWA 4LXFA 1U2YA 3OZOA 1DWHM 4UFLA 1CEOA 3PTQA 4NRSA 2DIEA 3AXIA 4CD7A 4FLRA 3EMCA 3MSGA 3THDA 1PX8A 3L4WA 5E6ZA 4V27A 5E9AA 1EHAA 3IJ7A 4IUGA 3EDJA 4HA4A 4PMNA 1CWYA 5A2AA 2ZX6A 3W0KA 2WVVA 3WL0A 3CO4A 3VD7A 1HIZA 5AYIA 1IZKA 1FH7A 3WKZA 2W63A 1BFNA 3K1DA 2PWHA 4QP0A 3VMPA 1ISWA 2XVPA 1R87A 4AD2A 3QHMA 4AZ5A 4AEFA 3U5YA 2FGZA 4P7LA 2CNCA 1L8NA 3VIPA 1OM0A 5TD4A 3LPPA 4AZIA 3QGVA 3WNMA 2XM2A 2J7CA 3VOCA 2J62A 5ABFA 1BGGA 1Q6CA 4H04A 4U33A 4UFKA 4MB3A 3W37A 3VPLA 1BF2A 1TR1A 3ARVA 3L2MA 2WZHA 2VRQA 1JAKA 1QNSA 3APGA 2WNWA 1CXLA 1WPCA 2XTKA 4CVUA 5CPSA 1VENA 4MJ2A 4PCTA 3K46A 2EPNA 4M81A 4ZE4A 3WH5A 5CGMA 3WBAA 1I75A 4PMYA 5EFFA 5DO8A 4AWEA 4D6DA 1H2JA 4GINA 2J7EA 2E4TA 5A8OA 2JF7A 3ZSTA 2E40A 4EANA 2XWEA 3OGRA 3WY1A 3T08A 3K8LA 4HU8A 3GBDA 3W4RA 1V08A 1UOKA 1MW2A 1ODUA 2WWCA 1B2YA 3BMWA 3AFBA 1K9EA 1OB0A 3WUFA 4OBSA 1MXGA 3WEMA 3WF3A 2G4FA 3AIEA 5A8PA 5DMYA 5GNZA 4B3KA 1ISZA 4PRWA 2BHZA 5DF0A 2J4GA 4Z2JA 3OZPA 4NZCA 2DSKA 3ZT6A 5ABGA 3A47A 4GI6A 4KRTA 3WL1A 7CGTA 1C8QA 4JL1A 1KWKA 1OD0A 1GNXA 2GSJA 1XSKA 2WMJA 4H7VA 2EPOA 1YHTA 1SR0A 4UFMA 4LPCA 4CU8A 2YA0A 4AZCB 4KWUA 2A3EA 4PUEA 3PHAA 1UKTA 3KEHA 4IISA 1BYBA 3JUGA 1ISXA 3GH4A 4CN6A 2Y8KA 3PZ9A 2XGIA 2VUYA 3ARYA 3ZMRA 4BCEA 1BGAA 4AXNA 1JI2A 4CCCA 3O6AA 3VU2A 2ZUMA 2FDMA 1G1YA 3GDBA 1J0KA 1CGTA 4MAVA 2WHLA 4MB4A 1CIUA 2WHJA 1B31A 1XH2A 2WMFA 3AIVA 1LLOA 1TZ7A 4JCMA 1ZS2A 1GCYA 5A6JA 1JNEA 3ARSA 2J7FA 3SUUA 2EPMX 1K9TA 2NT1A 1B3XA 1E72M 4N0RA 1X6LA 1JXKA 4MNMA 4MAZA 3ARQA 5EBAA 1GORA 1H5VA 4JKKA 1V6VA 5LA1A 4U31A 4X0VA 1HNYA 3W6LA 2O9OA 3N04A 3BCFA 5I79A 2WMIA 2J25A 1HJXA 3B9AA 4Z2IA 1C7SA 2VCAA 2ZX8A 2YIHA 2V5CA 4RL3A 3W6MA 1I1XA 1NWRA 1LG1A 1TFVA 1GW1A 3ZT5A 4PCSA 3CUHA 1V3KA 4MTVA 3WF1A 4B16A 1E6NA 1V0MA 4JFTA 2XGBA 3SCOA 1AMYA 1AVAA 3WDIA 1UZ4A 1R85A 1E0XA 4PTMA 3WMSA 2VZVA 2GK1B 3MMDA 1XSIA 3RCNA 4AD0A 1W9XA 3T2PA 4JFUA 2XIIA 3WF0A 2UY4A 1NP0A 3VX0A 1GOQA 4M80A 1BVNP 1JD7A 4AY1A 2J8FA 4BF7A 1UR1A 2G8ZA 3MS8A 1DWIM 2VMFA 1ISVA 2GUYA 3OA5A 1E1EA 1UD5A 3AIQA 4OBRA 3WFZA 3TA9A 4HZ8A 1QI0A 2VX7A 4P8UA 1KGWA 1B90A 2XFYA 5DT7A 1PIFA 3I3EA 3N9KA 4HOWA 4CVWA 5BCAA 1GOOA 1AQ0A 3N1AA 1US3A 4F79A 2VR5A 3ARWA 3WDRA 2DGAA 4J3UA 1FHDA 1XD1A 2IUZA 4TUFA 3PZNA 4H8VA 3L4VA 1C93A 1EA9C 4MB5A 2XSAA 4H2CA 3D3AA 1MFUA 1UWTA 2PBGA 4U3CA 3VD9A 3WH7A 2PI6A 4UFHA 3ALFA 2ZX9A 1XC6A 2XUCA 1V3JA 2DT0A 5A94A 4U5KA 4PTVA 1ITCA 3AOFA 2VR4A 1OBAA 4LYRA 1M7XA 1XH0A 4UOZA 1Q6GA 3W38A 5A8QA 2JEPA 4CD5A 4HA1A 1W91A 2D0FA 4UR9A 1QW9A 3HU7A 2WMGA 1V3IA 3AXHA 1UKPA 2CERA 1EO5A 1MW1A 1XRVA 4DUXA 5DEZA 5D9MA 2DH3A 1R7AA 4BZYA 3CUFA 1M53A 2OSXA 3GNRA 3DECA 3IJ8A 4OUEA 1V0LA 2BVYA 2UY3A 2AMGA 4CN1A 3MKKA 3PTMA 4GZJA 4JFVA 1ZJAA 3VGGA 3N18A 3WSUA 1QPKA 2PC8A 4GO9A 3SEPA 1JZ8A 5CLWA 2CKRA 2XVNA 2WM0A 2VRJA 1BPLB 4U3AA 3ZR6A 3T2QA 1J01A 3B9DA 2WVUA 1KCKA 3NSMA 4JAWA 4QCEA 2CHOA 4PMZA 1PZ3A 1GJWA 4PUDA 3RJYA 3AIBA 4WIWA 1W9PA 2E9LA 1ESWA 3O2LA 4UQEA 1KGXA 4D6JA 5A95A 4OZOA 1OT2A 4UTFA 2VTFA 2TAAA 4AZGA 1QNQA 5GNXA 4J3SA 1WZAA 3AMKA 3WD2A 3ARXA 2VZSA 1E5JA 3UG4A 3CPUA 1LG2A 4P8XA 4TX8A 4DUVA 4ATWA 2WWDA 4OIFA 1JF6A 1WE5A 1W1VA 3WF2A 1AQHA 1JAEA 3AZRA 2E8YA 2OWXA 4Z2HA 3UCQA 1UD3A 7A3HA 2Y2WA 2VCCA 1H0GA 4HZ6A 2XHYA 2XJ7A 4E8CA 1DP0A 1W1PA 2NSXA 3AMLA 2W92A 3F4VA 1K9FA 2ZX7A 5A3HA 5I0DA 3WUGA 4C7GA 3AIWA 3FN9A 4CD4A 4UQAA 3BMVA 4AIOA 1TCMA 2XIBA 2D22A 3CIVA 1WDRA 2A3HA 2IXVA 2WXDM 4CCEA 3AHYA 2BXYA 1S46A 1OD8A 8A3HA 5M5DA 1HL9A 3CLWA 2QHAA 3SUVA 2ZX5A 1CZ1A 3ARTA 4BQ2A 1JXJA 3DYPA 5JIPA 1CGXA 4UQCA 1VEPA 4B9ZA 3W26A 1E6ZA 3KZSA 2HISA 3AS2A 2WBKA 5A1AA 4AW7A 3I3DA 2BVTA 1OSEA 3A4WA 4YHEA 4UFIA 3VIGA 1GJUA 1JIBA 1H0IA 2CBJA 3AICA 1V3MA 3VIHA 1OGSA 3PZGA 1WZLA 3VGFA 5HPCA 1KB3A 2D0GA 3GNPA 3EDDA 3FXYA 1QBBA 1HJWA 2YLLA 4UQDA 1PEZA 3FHAA 1FHLA 1CXHA 1JDAA 2ZXDA 5A6KA 4DWSB 5EFDA 1A47A 1E1FA 2WZEA 1J0IA 3ARZA 2WCSA 2WW5A 1IZJA 4ACYA 1B9ZA 3QOMA 2D24A 3WQVA 2BS9A 2JF6A 4YN5A 3VKKA 2VX5A 4OOZA 3TOPA 1Y7VA 4WF7A 4XB3A 4UQ9A 1XCWA 4ML4A 1TG7A 3EBVA 5D4YA 2WCAA 3ZOAA 4P8VA 3WMCA 4QLKA 1MQPA 1E4NA 3SCVA 1XSJA 3TTQA 4DWSD 4P7RA 3PZQA 2VZOA 3K8KA 2IXUA 1GHSA 3MV11 4CCDA 2NW0A 4TVDA 1JZ3A 3T09A 1GQIA 4HA3A 5JBDA 1DWJM 3DHUA 1XHGA 1V3LA 3SCWA 2JIEA 3VIJA 4M8UA 2D2OA 1SMDA 1CGWA 1JGIA 1QHOA 5I2UA 3MUAA 3ECQA 1CGVA 4AD3A 1E6SM 3OLDA 4AZBA 2WVSA 2QPUA 1QI5A 1JL8A 3IAPA 4W93A 1CDGA 4J3XA 1GZJA 4MPKA 2J7DA 3POCA 3U5UA 1BSIA 3UR8A 1WZKA 3VD3A 1UZ1A 2WZIA 4NSBA 3KE0A 2W5FA 1BG9A 3CZLA 1RP9A 4V28A 2YA2A 2G3NA 1UG6A 3K4AA 1AQMA 1JDCA 1Z32X 3OGVA 4W88A 3MU7A 1HP4A 3AXXA 4ACZB 3OGSA 4GKLA 3AROA 2BHYA 3L4ZA 3L4XA 4C7DA 2YLAA 3WD3A 3FW6A 3GBEA 3RMEA 1E73M 5E70A 2ZICA 3VM5A 2VVSA 1UWSA 4U2YA 3WD1A 1NWUA 2BY3A 3A4AA 3EYPA 3AYRA 1ZBCA 2VJXA 3RO8A 2PF0A 5CPQA 1YQ2A 4AYSA 4KMQA 3OLEA 5GNYA 4X9YA 2DDXA 1B3ZA 4KH2A 1E71M 4Z2LA 1E6QM 1HXJA 2DSUA 2QF8A 2QV4A 1HJSA 2GJRA 4Z2GA 1QBAA 3FHQA 4WJXA 1XYZA 1U30A 3KL3A 2E0PA 1QI3A 3FAXA 4W7UA 5DT5A 4WKFA 2BY1A 1TE1A 1E70M 1RH9A 3N13A 5A8MA 1EXPA 2X1IA 3W29A 3BSGA 1BYAA 1VB9A 3WQ5A 3WDPP 5C71A 3WD4A 1CLVA 1JYXA 1J12A 9CGTA 1G94A 2E9BA 1KXTA 3WDHA 4AMCA 5BXSA 1QHPA 1TA3B 3VO0A 2BHUA 4KGJA 4ATDA 1W3KA 3THCA 3NDZA 2VQUA 3CMGA 1QNRA 4D6FA 3G6LA 1JZ7A 3LPFA 1JZ2A 4EK7A 5AYBA 2DT3A 3VGHA 1NH6A 1GONA 2CIPA 3WELA 3EDEA 5AC5A 3AS0A 3CUGA 4MJ4A 2JFEX 1H1NA 1CPUA 4RE4A 3SURA 4CUCA 3SUTA 3BAKA 4Q7NA 3VD4A 4C91A 4YPJA 3VUPA 4AEEA 1WDSA 1EQPA 3WEZA 1B0IA 3AHTA 1UA3A 1UD8A 3A6OA 3BSHA 4AC1X 2WKGA 2GFTA 3GXIA 1JF5A 5HXMA
chains in the Genus database with same CATH superfamily
3W7HA 1LROA 3F7JA 2ZC1A 2QUTA 4LVDA 2YFNA 4HD5A 1TPDA 2EXOA 4QG6A 1DHKA 1PJ9A 1FH9A 3VIIA 2WV8A 2PGRA 4J3VA 4J27A 1WOBA 1VFFA 4DI9A 2QJMA 2OKOA 4O11A 1WP6A 3WNPA 3GE7A 2WQPA 2Y5EA 3W71A 1L0PA 1X1NA 4D8AA 5C9ZA 2Z2AA 3AALA 3C2VA 2O9PA 3K8MA 1QHZA 3RHGA 1VPYA 3IV8A 4JHMA 4GFIA 2W62A 2WSYA 2CBVA 4P7OA 4CCZA 2DW7A 1EJSC 3RPMA 1NTHA 4QNWA 1V93A 3V0SA 1NVMA 3TP4A 4IP5A 1IXNA 1CBGA 1YXYA 1PIIA 2PU0A 1F4AA 4C6JA 3QY7A 3ZZ1A 2Y5JA 4NI8A 3E2VA 5IXEA 5HK4A 2PRHA 4GPNA 1HF6A 3R2GA 4OFCA 3RITA 3MANA 2OLHA 4O8AA 4HYVA 2YL8A 3A4XA 2EO7A 2DZTA 5CQ1A 3W85A 1MNZA 3PZMA 4FNSA 3CAVA 1SPQA 4Q7BA 3W7IA 1RY0A 3FNDA 4M0XA 4FB7A 4O1AA 4GIRA 3CB3A 1VCGA 2DV0A 3CHCA 4HU0A 2LLEA 5XIAA 4HPXA 1SGJA 1C8XA 3TN5A 5E0KA 3GU9A 3WLSA 5C5YA 2P8CA 1CW2A 1KQZA 3M64A 2ZTKA 4E8DA 1Q6QA 5A6LA 5HJLA 4REQA 2C15A 4BWLA 5DQPA 3EA3A 4UTHA 4Z42C 3GNXA 4QFUA 4RUBA 4TTUA 2P50A 5HQEA 3AS3A 3WIJA 2YCIX 2P53A 3TKFA 4GABA 2XN0A 2X09A 4GI8A 3LHZA 1FWHC 4GISA 1UWRA 2X41A 3MUXA 3IEBA 5T9BG 4ZQNA 3PUEA 5SWUA 2J7HA 1E5NA 2ZA3A 1FKXA 2PDQA 1R30A 1M1BA 4LUSA 4J2MA 4Z2KA 4LS2A 5FL1A 1QNPA 1M03A 4O18A 4ZQMA 1QPNA 2AKMA 4NRRA 2ISVA 3U8GA 1RHCA 1QCWA 4IIFA 3IUHA 1W9DM 1VPQA 3B8VA 2CLOA 4HGXA 3WLQA 2GJPA 5AY7A 1PIGA 1BXNA 1S5VA 3F4CA 1DORA 1H49A 2CETA 4G1KA 1H41A 3DIPA 3ICJA 3PAOA 1B1YA 4XO6A 3LQGA 1ITQA 2OG9A 2FH8A 1C92A 2V5KA 3TQVA 5GJNA 2WHKA 3FDKA 3EWZA 2V3EA 1MMFA 3ZJ6A 2OOFA 4G2DA 1K02A 2C18A 1VFLA 4JDBA 3LTPA 2OYMA 5AHEA 3R8GA 4RZ6A 5CBBA 1TJRA 1IGSA 1F3TA 3UWQA 1VJZA 3DI0A 4IMDA 3QPZA 4MNKA 4GXPA 3ONBA 2JALA 2Y61A 3PTKA 4W89A 5AHNA 2QDEA 2YW3A 1VBRA 1BYCA 1GK8A 2BVWA 1M7OA 2PWFA 2WJDA 2X30A 3SCNA 3UNDA 4FO4A 4LYQA 3N11A 5D03A 2JE8A 4US6A 1GQNA 1ZBVA 4PSPA 3VDBA 3TK7A 2Q6ZA 3GHUA 1Q65A 3MBDA 1A5MC 1FUYA 2MUCA 3LM7A 3IJ9A 5FJPA 2JGYA 1C8YA 3NVDA 1IIGA 2J7GA 3AQUA 4S3EA 2FZ9A 5XINA 3M9YA 4CKQA 2D73A 2GDUA 4EOUA 3STPA 3CHEA 2YB1A 1ZPTA 2Y6ZA 2BG5A 1LORA 1F76A 5LIXX 1FWBC 4P7NA 5CZTA 4MM1A 1ZU8A 1YTDA 1O12A 4OBTA 3LN3A 3FA5A 2B31A 5EMLA 2ZVRA 1A4MA 1KLYA 4LNYA 5LIYX 3HQNA 2OZTA 4HK5A 3AMCA 3VGBA 5ABEA 3NQCA 3CQHA 4GI9A 3UG3A 3I3BA 5IDIA 4H00A 5FAGA 1HKJA 3SRDA 2VWSA 3FGCA 1GHRA 3GXMA 1E43A 2G50A 1VFUA 2GUUA 3O6DA 2C7FA 4L1GA 5REQB 3C3UA 4XZNX 2VX6A 3UU0A 3EWCA 5T91A 1Q2RA 1SSGA 3WFLA 5DRCA 4DELA 4QDPA 2J9ZA 3WH8A 3C4UA 4O4VA 1S5NA 1R3SA 3DC0A 4FZIA 2DH2A 2ZC8A 2ABBA 2ISFA 4TXEA 4TX6A 1SSDA 3GS6A 4W8LA 3SCQA 3KOXA 1MXSA 3CUZA 1RPXA 2VHLA 1VJSA 4W5ZA 4IFKB 4M24A 4IPNB 1UUQA 2VFEA 1RA0A 1G01A 1R47A 4KWOA 3OYXA 3R4IA 2E77A 1EO7A 1ZQ5A 1T8XA 5D38A 3EDFA 3HURA 2FGBA 4AIUA 3GG1A 3TMLA 2BB0A 1ZAJA 3GXDA 4EX4A 4WX2A 2OQYA 3M0VA 3HN3A 4HNNA 1W17A 2YDQA 3BDKA 3DG7A 2AQVA 3NL5A 3GM8A 3O7UA 1E56A 4A3YA 4ALDA 5A8GA 4XVDA 3MA8A 4LBSA 1NFBA 4H8NA 1DVJA 1DHPA 4B2DA 1A5BA 1RY8A 2OWWA 5BU9A 3A24A 2AMXA 3QFEA 4AX6A 1PB0A 2VENA 4GQQA 1YYAA 3QVQA 4TTGA 1V0KA 1R46A 4H3DA 3H4XA 3QZ6A 3GXTA 1N8IA 2PDIA 1CX9A 1ZBKA 2A3BA 2DSZA 4FPSA 3TR2A 3MSDA 3DENA 4XUYA 1P43A 2DSVA 2X0YA 3V1PA 1ZAHA 1E9IA 1BWVA 3CASA 2WVVB 3G1XA 1NWSA 4KW2A 3CJPA 1HJVA 4HK7A 2CBUA 4FR6A 5LXXA 2Y85A 4DO7A 3NQ7A 3TJXA 1DXIA 4DBDA 3VKJA 2WKLA 3BARA 4NZ1A 4P00B 3GH7A 4O50A 1V03A 3PANA 1ZL1A 4UOQA 1UR2A 1VBJA 2ZZ3A 2NQHA 3UJFA 1K8XA 3F4NA 2J13A 1EYWA 3K30A 3MMWA 3TN4A 3W72A 1EJTC 1PWMA 5DANA 3VMOA 3KCLA 3OBAA 3VINA 2J27A 3JU2A 3CUJA 4GH3A 5JVLA 1CB7B 4GCXA 2J6VA 4MLRA 3MC5A 1EC8A 4MY1A 5D8ZA 4G9PA 1IT7A 3KRBA 1TTQA 2J9XA 2VELA 4NU7A 1GVRA 3CUIA 4GD0A 1I45A 3VNYA 2W66A 4Y90A 2WNZA 2NSOA 3VM7A 4JEJA 3GIYA 4I6KA 2BY0A 3HM7A 4JX4A 3F2CA 2AGTA 4J3TA 2O92A 5CZJA 3II1A 3MPGA 3QC0A 4L6HA 2QDGA 4R7OA 1XIMA 3GR7A 2YBTA 1TJ2A 3N34A 3UXDA 1LLZA 2Y5SA 1VFOA 1EKOA 4JCLA 4XIMA 2YX0A 5K2ZA 3MCOA 3AJ7A 1H4PA 2H6RA 3C8NA 1SFLA 3LGDA 5FJJA 4QQUA 1JNDA 4B15A 4N02A 4KEVA 1ZB5A 4FF7A 1X6NA 1D2KA 2QLYA 4R27A 4UZSA 4A8IA 5BRBA 5BRQA 1JPDX 4YLWA 1E15A 3OODA 2I14A 3TUUA 1WAUA 4B5UA 1XQKA 1NP2A 5I3HA 4FIRA 1Z41A 2PLCA 1UYQA 3NCOA 5I02A 2X16A 1I1WA 2A21A 2O0TA 2ZRZA 1XD0A 2YL5A 3FCPA 1FA2A 1A3HA 3B8UA 3MZ2A 3OB8A 1DJXA 3NL2A 2PP1A 4RE3A 1QTWA 3UY8A 2YFOA 3GC5A 3IVSA 2VI0A 4MNLA 4HHPA 2J77A 2JEQA 3VI2A 1F61A 1E4IA 3NA8A 1JYNA 3L9CA 3WO8A 4LUJA 1AD4A 3DFHA 2ZZ7A 3W7LA 3EB2A 3T8QA 5BU6A 1KQYA 2ZXBA 4GKTA 3BE7A 4GNJA 1I2RA 2GL5A 3SY1A 4UOJA 1OINA 1YXCA 4PB5A 4BS0A 2CC0A 2PDYA 1OX6A 2EKCA 2VRKA 8XIMA 3I7SA 3FJ6A 3P8IA 3R0UA 3NQ8A 3MSRA 1PHWA 1H7WA 4IGMA 3HG2A 4X0NA 3QW3A 1AH0A 1HFBA 3CL8A 1S39A 1VH7A 2ONEA 2E28A 5E0FA 1BF6A 3RM9A 4DF0A 3TQ0A 1I9CB 1F5ZA 3PZOA 3S0CA 4WKAA 3HOJA 3MW7A 5IHRA 2YYUA 1MQRA 3ZLHA 4H7ZA 4NJHA 4H2HA 3UR7A 1VHNA 1AODA 3K1GA 3AYVA 3W53A 3NO5A 1JZ5A 2VP8A 4XK2A 5D2VA 4C6DA 1DJWA 3C0SA 3NNTA 2NQJA 1H7NA 3D47A 3H21A 1AD1A 3ZXWA 2C13A 4EKJA 3WLIA 1OYCA 2FJKA 4R5EA 5LNVA 4NILA 1A5LC 2X1TA 4DWSA 3DFYA 4EIVA 3EXRA 3L21A 2IKHA 1EWEA 1XLHA 3KOYA 1DTUA 1XICA 3UA4A 1XGDA 3D5HA 3DC8A 3U7BA 4DUOA 3BJSA 1S5TA 4FAMA 1J0JA 1BXCA 1LQ0A 4GIAA 1AUSL 3QLLA 5LIWX 4UZUA 4GC4A 2A2IA 5IFPA 2HK0A 1OC7A 1X8CA 1JCJA 3B4YA 4MHBA 1FWWA 1JQXA 3BZJA 4F9DA 4CNPA 4DY1A 2AKZA 4MKSA 4XAFA 4RCXA 5C6MA 3UPMA 1J18A 1G4PA 2NXIA 4GIYA 4ADSA 2C6QA 1EDGA 3U9IA 4ZEPA 2CYGA 2Y8UA 1KM4A 3P2VA 2ZRXA 3ARPA 3UESA 3H53A 3ZYZA 3U2EA 4J5NA 2AAAA 4UMAA 4GI4A 4O1DA 2YJQA 4GY1A 1DXEA 2FYMA 2J75A 4AZCA 1KO0A 1W54A 4CD8A 3WQ8A 1FY6A 3E3HA 1UHVA 3QM3A 5AB3A 2CXEA 2WAGA 4EXBA 2DZAA 3BLFA 1Y5XA 4LGXA 4INFA 1TWIA 1Q6DA 3AZSA 2EQDA 3LY0A 3ANUA 3BCDA 3YPIA 2YCLA 4XZHA 1WKEA 2JBMA 4MKVA 4PL2A 3BAJA 5EMYA 4US5D 2O9RA 3MHGA 1EFZA 2DZUA 1W3HA 4L1XA 3UJSA 1NDWA 2V6AA 1W6TA 1KV8A 1XCXA 7TAAA 3SRKA 2DFAA 5IM51 2BFGA 3LBMA 3B8TA 2G3JA 3WD0A 1OCQA 3IACA 4OVXA 1MEIA 1AJZA 2J8TA 1OFOA 5FACA 4B9YA 3D46A 3ZSSA 2H3DA 3E2QA 1KFKA 1XIIA 3N17A 4JPGA 3S6TA 6PTDA 4JTUA 4I7VA 4BA0A 2V5JA 2XFRA 2OR2A 1EJXC 4W86A 1RPKA 1R3WA 4MB1A 3PUOA 1V02A 2G3MA 4F0KA 1Q7QA 3ALGA 3CAKA 5B80A 1WUFA 1SYTA 1ICSA 5FD0A 3GC2A 1NF0A 3ABXA 4L64A 4WDUA 2GOKA 6XIMA 2OZ8A 2IPJA 2X1RA 1XLDA 4GUIA 1W2PA 2IQ0A 4G1NA 5LIKX 2NZLA 4PB3A 4YTQA 4DO4A 3DG6A 3VXGA 1RJPA 3NG3A 3QMRA 7ODCA 2V0TA 1U2YA 3OZOA 1H51A 4UFLA 1CEOA 3PTQA 2ZZ5A 3H12A 1HUVA 3C8FA 3T05A 4FLRA 1PX8A 4QDWA 2BZNA 2A0NA 1U1JA 2GWNA 3V0UA 4X9SA 3CB8A 4R7JA 4HA4A 3M41A 3IIOA 3W0KA 5HMFA 2WVVA 4P61A 3CO4A 3UYCA 3XINA 1IZKA 1FH7A 1A49A 5AYXA 3PPFA 1RUSA 1X38A 3IIPA 4HG6B 2QCFA 1OJXA 4GX9A 4AD2A 3U5YA 3BGGA 5CCZA 2CNCA 3EKZA 1OM0A 4A8LA 4PGLA 3QGVA 2HTMA 4IL0A 4TX9A 1VKFA 1XPYA 1Q6CA 3W3OA 4H04A 4B5VA 3V18A 1IWBA 4OUIA 3R58A 3W37A 3VPLA 1BF2A 1TR1A 3ARVA 3L2MA 1QNSA 3APGA 5CPSA 4MJ2A 3K46A 1V6TA 3G1RA 3NGJA 4JQAA 3PFRA 2KAUC 3VE7A 4HSHA 3TTEA 3WBAA 2KZHA 1F6KA 2VFDA 1H2JA 3GNDA 1Z69A 3H2OA 3ZSTA 2E40A 1YKWA 2XWEA 1SZGA 2VGIA 3NVTA 3T08A 3WY1A 3ABSA 5PTDA 3W4RA 2XFWA 1Q6OA 1U1HA 1MW2A 3IJLA 2WWCA 3GVGA 4E4UA 2E1WA 1K9EA 4IXXA 3I7QA 2PWUA 5FF7A 1MXGA 1NQKA 3WEMA 2ZQ0A 2G4FA 2C1IA 4NZ3A 5DMYA 4PRWA 3LEPA 5DF0A 1Q2SA 4NZCA 1YLVA 1IWPA 2ZTJA 2CZ5A 5ABGA 1QPOA 1NY1A 4KRTA 3W1AA 2ZCGA 4GNVA 4JL1A 1KWKA 1XSKA 1M7PA 3DFNA 2XZ9A 2G5WA 1YHTA 4UFMA 4LPCA 4CU8A 4UTUA 4JTHA 2XN1A 3N9SA 1PVNA 3JUGA 1ISXA 3MB9A 2XGIA 3ZMRA 3KXQA 4ZR8A 4LCQA 4CCCA 5FEXA 3O6AA 3V16A 4E0CA 2FDMA 3PB0A 4JIHA 3UF9A 5BNKA 3R5EA 5AN7A 5F2IA 4AQLA 1LT7A 1FKWA 1EZ2A 1OZMA 4J2PA 2XH2A 5EJZB 4JTEA 1LLOA 2F7FA 1CLKA 3Q37A 5AHIA 1GCYA 4XAZA 3ARSA 3SUUA 2EPMX 4OTKA 5LIUX 2NT1A 1B3XA 1ECQA 3U2OA 3WYZA 4N0RA 1X6LA 1D7KA 1KKRA 2NLIA 1FWDC 1V6VA 3LI1A 2XU2A 1BSLA 4YU1A 3N04A 3B04A 1P6CA 4GZ7A 4JY8A 2EJAA 2VCAA 1T7LA 2V5CA 3NXLA 5C55A 3VOJA 1KW1A 3GKFA 4JN7A 3P6LA 4KFNA 3E5BA 4XUGA 1KBLA 1V3KA 4MTVA 3WF1A 1XJBA 3S1GA 1AVAA 4NX0A 3S42A 4WEVX 4E4FA 1BQGA 2VZVA 2A7PA 1XSIA 4AD0A 4RV8A 3KOWA 1JR1A 1W9XA 3T2PA 4AAJA 2ATMA 2WJZA 5HR7A 1GOQA 1BVNP 4AY1A 4YVVA 3MO7A 2G8ZA 3WLTA 1OG6A 4RXFA 3OA5A 4QR6A 3SZ8A 4PCNA 3AIQA 2OTDA 4OBRA 3TA9A 2VX7A 6XIAA 4KERA 1MUWA 4RPPA 2VUNA 5BCAA 3W7GA 3QYSA 5EMKA 1ZZMA 3N1AA 4O17A 3E38A 1Q3NA 3AXKA 1FHDA 1S1RA 2PGFA 4LVBA 3R89A 2IUZA 3L4VA 3S9YA 1ICQA 3W87A 1EA9C 4MB5A 2R6OA 4FXFA 1MFUA 4Z0JA 3H7RA 1FCUA 1QOQA 2W0UA 5DCBA 2DT0A 1KNWA 3VCNA 2Z1WA 4ASTA 4ZOAA 1Q6GA 1YBQB 5I7GA 1N55A 3NEVA 1DBTA 1H1YA 4UR9A 3HF3A 4HPNA 2QKFA 3EX3A 4Q4RA 1V3IA 3C2YA 3GKAA 5DEZA 4ADTA 3PWGA 5HATA 2DH3A 4KEZA 1R7AA 1M53A 4FX6M 2NLYA 2F6KA 3IJ8A 1V0LA 1S2WA 2HS8A 4JFVA 2PDGA 2G3FA 3TAKA 1VCFA 3N18A 4A29A 1QPKA 1JZ8A 2G96A 2VRJA 4QS5A 1BPLB 4U3AA 5FF3A 3GHTA 1K6WA 3T2QA 3B9DA 1XFCA 3EA2A 4L5ZA 1PZ3A 3RJYA 1DJYA 2GVLA 4XAPA 3MDWA 3P7YA 4WIWA 1W9PA 2E9LA 1ESWA 3FJ4A 1ENUA 4UQEA 1WDDA 1OC6A 2NUXA 1KLZA 2Z6IA 4UTFA 1J6PA 4P5UA 3CHVA 3BWWA 3BGJA 1GW9A 5C0QA 3DFTA 2YZ5A 2HPMA 1AQFA 4HVXA 3GRIA 3ARXA 2VZSA 1E5JA 3UG4A 4AYGA 2VM8A 4DUVA 4LB4A 3BLOA 5EA9A 1TPVA 4OIFA 1JF6A 3BPWA 1S2VA 4FI4A 4H9VA 1W1VA 2E8YA 3TYCA 1JUEA 1YIXA 2NWSA 3UCQA 2Y2WA 5IOBA 4HZ6A 2QEZA 3NZ1A 3R7MA 4E8CA 5LNWA 4A22A 1N7KA 1TV5A 3N4FA 5A3HA 4IP4A 3T81A 3WUGA 4C7GA 1RAKA 1T96A 2PDCA 3W7KA 2A85A 5C54A 4QJ3B 3E0FA 2XIMA 2R91A 1OD8A 4JTGA 8A3HA 4Q33A 1RQBA 5M5DA 3LZ3A 3G0SA 2Q8ZA 3OHIA 3SUVA 2Z7GA 3TSDA 4KKXA 2I17A 3M5YA 1OF6A 3SIZA 3PR2A 4EVZA 1CGXA 3NQAA 4UQCA 1VEPA 3ONCA 4HHLA 3W26A 4NG3A 2OODA 3EWWA 1UUMA 5BMXA 2PTYA 3OU8A 2WBKA 1JCYA 1R3TA 2V2HA 3RX4A 2ZA2A 2GYIA 1GJUA 1JIBA 1IGWA 2DUAA 3GYEA 1TJPA 3W7PA 3RUBL 4NJIA 1V3MA 4GGHA 2HWGA 3VGFA 3QLDA 3M47A 2D0GA 3STCA 3KDOA 3EDDA 2G4JA 3T4WA 4EPKA 1KM3A 1PEZA 3FHAA 1CXHA 4N7QA 4IGSA 1JDAA 2R82A 5A6KA 4KCUA 3NEHA 5EFDA 5HWMA 1E1FA 2WZEA 1J0IA 4AVNA 1IZJA 4ACYA 1D3GA 3QOMA 3WQVA 1YTEA 3RYSA 3CIXA 3VKKA 4BI5A 4OOZA 1XS2A 3MUCA 4WF7A 3EOUA 1TG7A 3ZOAA 3PJTA 1QT1A 1XSJA 2GQAA 1RR2A 4PBFA 1GHSA 2O4QA 1GKQA 4R3UA 3UWEA 2NVCA 3QMSA 1VHCA 4HA3A 4LSBA 1LP6A 4P02B 4IIHA 3W88A 3OHMB 1MZHA 4AC7C 1ZALA 1EF2A 5EMJA 3TX9A 1SMDA 1CGWA 1QU4A 1JGIA 2WNQA 1JDEA 3ECQA 3TWBA 1UASA 4HK6A 5BMWA 1VRDA 1XW8A 3WLHA 1JL8A 1FWIC 3IAPA 5CPMA 3VAVA 4J3XA 3B9OA 1GZJA 4MPKA 2J7DA 3MCMA 1AG1O 3GSMA 1VP5A 4GE8A 2Z2BA 5EKYA 3EWYA 4AG0A 2RAGA 3UR8A 1LCOA 2QJJA 3VD3A 1J5TA 1T6MA 4NZFA 3C61A 3KRZA 2WZIA 3HV9A 4R34A 4FXSA 4DB7A 2R24A 3IGSA 3H26A 3BOFA 5DMMA 1Z32X 4W88A 1K70A 3CQ0A 4WQ6A 1OY0A 2Q02A 2TODA 2PC4A 3HGSA 3NM1A 3RFAA 3T55A 4I8DA 1V79A 2PFHA 5LGZA 4U2YA 4IG2B 1VIZA 4DO5A 2BY3A 3EYPA 3TW9A 2PDUA 2PDPA 5CPQA 4AYSA 4KMQA 1JRBA 5L9FA 5GNYA 4GIEA 4ECLA 3C56A 3QC3A 1MDRA 1XLBA 5I3IA 1B3ZA 4GJIA 4AX7A 4HNUA 3W7DA 5DRIA 4I9TA 4Z2GA 1Z3NA 1KM5A 1QBAA 1OFAA 3QKEA 3KL3A 3FAXA 3E96A 1JUKA 4WKFA 1UOZA 4MY9A 5D33A 3TJ4A 5CC7A 1J12A 4RK8A 1W5NA 2RH9A 2E9BA 3KWSA 3UQNA 3BQ6A 4LS1A 3KW3A 3PP7A 4B5SA 3PBVA 2I56A 3VO0A 2BHUA 1W3KA 3UCCA 2W6RA 3QTGA 3NDZA 3DI1A 4GVHA 2ZRUA 1LOLA 4CNSA 4DWDA 5AC5A 2ZDRA 2JFEX 1Q6RA 4RE4A 3SURA 4XKYA 3RLGA 3ZVIA 5D02A 4JIIX 4Q7NA 4QISA 4C91A 3VD4A 3TYZA 3TFXA 4QXIA 5T26A 2KX9A 3GTIA 2VYOA 1UD8A 3AWNA 4MYAA 4U4MA 1ONEA 4O1FA 3B97A 3H4GA 3V5OA 3W70A 2F38A 4IJBA 2PD5A 3GFYA 1H63A 4Q4KA 4JKLA 1W5MA 1ADOA 2XYLA 1GOMA 2NX1A 2BVDA 2PURA 3IANA 3ZR4A 3M0HA 5T9CE 2PSNA 1SZRA 1S1PA 3MYOA 4IXHA 5HINA 4FMVA 2E09A 4ZODA 3PB2A 4D2JA 1PX4A 1GUVA 1TRDA 3NDOA 3C3NA 3D0CA 4FLQA 4JL2A 5I06A 1UD2A 3W2JA 4Q4PA 4OKDA 3O3RA 2P10A 2CW6A 3BANA 3QTPA 1XIGA 3CGTA 2G95A 2V3FA 5FJTA 4I7UA 1YBQA 4AY7A 2TSYA 1UA7A 2Y7GA 4J3ZA 3MUY1 1US0A 4RKAA 2V5DA 1B5TA 2QZRA 1J11A 3EX6A 1AW1A 1Q4NX 4HU4A 3WN6A 2WPGA 4AF0A 1X8FA 3V1HA 5I00A 4ZB2A 3T44A 4KIEA 4CGTA 1NSJA 1QVBA 3G1HA 4ZOBA 3NSXA 2NV1A 4KT2A 2E3ZA 4JIRA 4GNKB 3BK0A 3C0LA 1OWQA 5E6YA 2HEJA 2EAWA 1E6XM 1L6YA 3TFCA 4PMUA 2FPVA 5JUVA 4UTTA 1OIFA 1HVXA 3LCHA 4E6MA 4C6KA 2QIIA 4B90A 1DWAM 3G3MA 4UNLA 2A3AA 5A6SA 5A6AA 2FJUB 1MQQA 1K7XA 3CHFA 2YXOA 3ID7A 4RX0A 2GQ3A 1ZFJA 1V6WA 4Q4SA 5JH1A 4E2DA 2QMKA 3UZ5A 1JFHA 1XYBA 2QDDA 4B4FA 4MWAD 3GDLA 1G5AA 1VFHA 1OT1A 3WMLA 4ZBCA 2V3GA 2FZDA 2QCMA 3B8DA 1ODZA 3LOTA 3I4KA 4DPQA 5JBEA 4AUBA 2ZWZA 2VWTA 2C91A 4MFEA 3GTNA 5FCZA 3MJYA 4QCFA 4PFMA 1KBIA 1O68A 3AHVA 4FOUA 4QE5A 1V3HA 1B4KA 1HW6A 1K77A 2GGJA 1UUOA 1RZMA 3W2KA 4BJHA 2ZA1A 2QJHA 3DBNA 1RCOB 3GC4A 1LWJA 4C6QA 4HP5A 4IQLA 3MMTA 4RE0A 3F4WA 3W2MA 5EPDA 3MI2A 4MPQA 2WVTA 1L6FA 4NAFB 3KL0A 4M6PA 3KTCA 2QAFA 3ZWTA 4TMBA 2B81A 4E8GA 1JEZA 3SQSA 2QAPA 3ATZA 3M07A 2PGWA 3P93A 4K1WA 2ACQA 2RGMA 2ZIDA 3R0KA 4U5IA 1B9BA 1L6SA 3F2BA 2PWGA 2W9MA 1Q6LA 3B9NA 2JKEA 1K1DA 2PLKA 3UWWA 4L4LA 1Q63A 1CYGA 4ZOEA 5ABTA 5C70A 3B03A 3RLVA 2DT2A 1X7FA 2WLYA 3U57A 3NJ3A 5AZ1A 1R7OA 4H19A 5JU6A 1J2BA 1LTDA 2GZXA 4K8GA 3BGAA 3PS7A 3J7HA 4C60A 2BOGX 1TMHA 1H09A 2CXGA 4JTLA 3B06A 2D2GA 1TPUA 4OJYA 3A3HA 4QBXA 3F1QA 3LENA 4DJDC 1JI1A 2CHRA 3R6IA 3VNZA 4Q6XA 3DDMA 3W27A 3IVTA 4FIQA 1NDZA 1U22A 3GUGA 1ZP4A 2WO5A 2HCVA 4AISA 3L4YA 3UG5A 3PTDA 4AD5A 2FB3A 4IPLA 2O56A 2OEMA 4PMVA 3GVQA 1YADA 1F05A 3H8AA 3W7RA 2GVJA 3WLOA 4UCFA 2OVLA 3HFTA 2XDFA 3S5YA 3CBWA 4DI8A 9XIMA 4D1JA 1QR7A 4JHZA 1B57A 4PN2A 2VC9A 3CWHA 3BLLA 4HPGA 1C9WA 1F8IA 2OMAA 3WZ0E 1KBJA 4JY9A 1A53A 2ZDSA 3HPAA 2NX3A 7TIMA 2QGHA 2Q8LA 2O4MA 3RM4A 3A5FA 3VMNA 4ZO7A 5LNRA 3NR0A 1H11A 2WCGA 4KF1A 1XBVA 2C14A 4IQJA 1PZ0A 3KAOA 3VNLA 5F2GA 3LBCA 3Q2DA 3SUWA 2A1YA 3KTSA 5I07A 2HJPA 1UZDA 5EB8A 3TTOA 3U48A 3N2MA 3DCPA 1SUXA 1E51A 4MZYA 1XIEA 4EP8C 4B4HA 4IICA 3MMUA 3S3GA 5BXTA 5A6BD 2DSWA 3TOYA 4N4QA 3UVAA 4DLFA 3UCDA 4IPPA 4D1IA 1H60A 3W7JA 1PZ2A 5CC6A 4F9JA 4L61A 3AO0A 2VKZG 3HGRA 3IGUA 4Q8VA 2ALRA 4HMDA 1SJAA 5BROA 3VGEA 1TPC1 2D2JA 4UTLA 1KM2A 3PJWA 5CSYA 5BXPA 2PE4A 2A7RA 4FX8A 3LPGA 4Q6JA 4AIBA 4YWSA 4XZMX 4JX5A 2QYGA 4REQB 4GYKA 8TIMA 3MDUA 5LA0A 3VNMA 3WQFA 3RX2A 4N4PA 4QJ4B 1CLXA 3UXAA 4PRTA 3GHSA 1WB0A 3GWQA 4GJ1A 1O5QA 1OCJA 3GDMA 1C91A 1LL6A 2V2CA 3NQVA 3LNPA 1RCXB 1UB3A 2OX4A 2XN2A 4YIWA 1WX0A 1CXKA 1Q6EA 3B40A 3WK0A 2UY2A 2GGEA 4I8YA 1TTIA 2NVDA 3H54A 4AIEA 2WHMA 3PNZA 1FBAA 4ICNA 4M3PA 4WRHA 1K6AA 4MKNA 2EPLX 3MHUA 2OQHA 1UWIA 2PDJA 4ORIA 1JYWA 2W3ZA 1BG4A 1E0UA 4XZIA 1W1A1 3N14A 5GPRA 2XWDA 3SCRA 4Q8NA 3CWNA 2PCQA 2VOTA 3G8RA 1WYIA 4EE9A 2HVMA 4O4WA 3VOHA 2RDWA 2WYSA 1NOWA 4UR8A 2BOEX 2G41A 4H6EA 5IFTA 1PDZA 3AZTA 3U7VA 3MWCA 4PMRA 4IWWA 4TU1A 3TYEA 3WUEA 4LX4A 5TBOA 4OHQA 4LUIA 3CWOX 3NZQA 4RZ5A 2W4XA 2YL6A 3H2FA 1IHIA 3V5FA 9XIAA 4WSJA 4H9TA 1YE6A 5E0CA 4FS9A 4KCWA 2FHBA 2B7NA 1JYVA 4Q8MA 1E4LA 4IHCA 3WLJA 3E12A 1N8FA 1JFXA 1W9UA 4WY0F 3V4BA 3TR9A 4AU0A 3NQ2A 3QOKA 4YXGA 3O0FA 3VA8A 2XVLA 3EZ4A 3PN8A 1HT6A 2PBOA 2W61A 3STFA 5A8NA 2DEPA 3T07A 5HOSA 3GTXA 3CV7A 2HXTA 4TOQA 4NXKA 2Z1SA 3KLKA 1A5AA 3GG0A 4LC6A 3WBWA 4GH1A 3WQWA 3VDCA 3WEOA 1E1CA 5CJ5A 3L66A 1MSSA 4WSHA 3ZVHA 4ROPA 3DKJA 1V6XA 4R9XA 4EPEC 3FLUA 3OBKA 3S8HA 3QQWA 2FH6A 3N25A 3W1MA 5HNNA 3G1YA 3PK7A 1V02E 1QI4A 1HVQA 3D6NA 1ITXA 1WBJA 1Q8AA 3FGCB 2I5IA 1MDLA 1JD9A 3BLPX 1SO3A 3T0AA 3IRSA 4XKYB 3TCSA 3VZXA 3DUGA 2WZTA 3ENLA 3UR5A 4LVGA 2QCEA 4NNAA 4FNQA 4H9UA 4GRSA 3KLLA 3EPNA 4DXKA 3BW2A 2POZA 1W2VA 4DM2A 3NDYA 1RP8A 1EDQA 1UKSA 4BKNA 1M65A 4PRRA 2PCEA 4H4IA 3P8JA 2EPKX 4QS6A 4S3JA 1O5KA 1MWOA 1UW9A 2PB1A 3DKLA 4PCFA 1EBHA 4HCDA 1SR9A 4P7QA 3INPA 4A2RA 1A5OC 3CH9A 4JQ4A 3UZXA 3T8LA 4HQVA 3ORWA 1P0DA 4H6QA 2VEKA 2QCLA 3LB0A 4Y9PA 1C29A 1HG3A 4ZCWA 4QAIA 5IHSA 5FL0A 3APTA 1UKOA 4EWJA 3WQ6A 4UTKA 4WGHA 3H2EA 3P61A 3VCRA 3WDQA 4NL1A 5HNUA 1OX4A 4HNVA 2CWXA 3VFLA 1B4EA 4L7ZA 4IF2A 1X96A 3G8EA 4FXRA 3FDGA 2BMBA 2PA6A 3BCJA 2IW0A 1I8JA 4R85A 4O1EA 2RHGA 3OOQA 4M6QA 2R14A 3TN6A 1DJNA 4C90A 4BK9A 5I6SA 2C0HA 2YBUA 4GOAA 2PRMA 1DXFA 4K6AA 3ZIZA 4XD4A 3RR4A 1CXIA 4IGHA 4NAFA 3NUKA 1EOMA 2W67A 3UJEA 4QNEA 3SBFA 1YDOA 2RKXA 5A2CA 2HV5A 2E8ZA 3CV6A 1VF8A 1W32A 1IZCA 1YX1A 3ARUA 3BMXA 4RLIA 4A4AA 1XUZA 4NKCA 2DPEA 3IWPA 3GNOA 1XWYA 4FNPA 2XG9A 4NJJA 4EAMA 1KCXA 3T2OA 1FQ0A 4XO7A 1RVGA 1IR2A 4AZ7A 4DBUA 1QRQA 1TZZA 3MY9A 2PWVA 3AYSA 2X1SA 4TV6A 3I6TA 5M03A 4Q8PA 1B54A 3UG8A 1QNVA 3FVMA 4M1BA 4F8XA 4CN4A 2E6DA 2XSXA 3MKCA 1I60A 4JS3A 3QY6A 1KBBA 4AH7A 3RK8A 4LRSA 3OYZA 3VILA 6ALDA 4LW7A 3T1GA 2XFFA 4NF7A 1FFQA 4L4MA 3QZEA 5I77A 1O5RA 5KINA 4M51A 3ZT7A 1AJ2A 1VEMA 1J93A 5CPTA 4HPHA 3QY8A 1S3TC 4KFPA 2F6XA 5DLCA 1E3ZA 1ZP3A 2W79A 2PLJA 2I9EA 2QUUA 4HN8A 2PWDA 3SJ3A 3LS9A 1XIBA 1J0HA 1DE6A 2RGLA 1UR4A 1HKKA 3WJSA 2GVEA 3LMYA 3FA4A 4BR1A 4QLLA 3DFOA 1UWQA 2QCDB 3G5EA 1OVDA 3GW3A 3H23A 1M04A 2HRWA 2YZRA 4W7WA 2W91A 1SQ7A 4O53A 4WK9A 2ACRA 4Y2WA 4W84A 1YNQA 5BRPA 3WJYA 4YHGA 3MYPA 3UPWA 3PBMA 3SECA 1PBGA 3HQOA 1BRLA 2GJXB 1KV5A 1ME9A 4J28A 4H9XA 3FYOA 4JTRA 1ITUA 4EACA 1MW3A 4K3ZA 4YWIA 4J9JA 3GIQA 1H7PA 4DN1A 4MUZA 5BXRA 2ESCA 5D8WA 3SUSA 2JIWA 3ABQA 4NX5A 4OOUA 1IE7C 3W1QA 3QPEA 4A05A 2E1DA 1LL7A 3KHDA 3FAWA 4E5TA 1F6YA 3E2SA 2QUMA 3S2CA 1LF1A 1XDJA 2D3NA 2BSLA 3GXPA 1BWKA 1W3TA 1DJHA 4G7FA 1XYAA 3OEXA 3QHOA 1PV8A 4GXMA 4O0QA 1V7YA 1K9DA 1SFTA 1UH3A 2GDQA 4AWSA 4H41A 1Q8JA 1V4YA 4DJDA 4MZ8A 3RG6A 1GOWA 2Y8VA 3LLXA 2QS8A 1S5MA 4H8UA 1GQJA 1VIWA 3FK4A 1P6BA 4JFWA 3BLKA 2OSWA 3HQ1A 1TREA 4GX8A 5LHFA 3RLHA 4C5ZA 2MNRA 3CM4A 2DIEA 3P67A 3NPWA 4LUSB 3AXIA 4CD7A 1QK2A 1FWNA 3THDA 3EPMA 5K4ZA 3L4WA 1Q66A 3TV8A 2CLHA 3RN6A 1ZGDA 5E9AA 2H9AA 2QCGA 4QJ5B 3E0LA 4GWEA 3WL0A 3VD7A 1HIZA 1NU5A 2W63A 3PJXA 2VFGA 2VDIA 4QP0A 2H9AB 3M0ZA 3G77A 3S6DA 4UTWA 4AZ5A 1O4UA 3TIMA 1DTNA 5GJPA 2ISSA 3P74A 1SO4A 1DQXA 4NHVA 5TD4A 3O1NA 3WNMA 2XM2A 1XIHA 3A3XA 3GXNA 2ZRYA 3VOCA 2J62A 2Y1HA 3USZA 1OQFA 1P1MA 3PPCA 3ZLGA 4MB3A 2Y7DA 3K2GA 4IOTA 2DY3A 5MKGA 4E3VA 3LHTA 2VRQA 3TYUA 2FZMA 5FEWA 2AL1A 4JTTA 1AH3A 4M81A 3WH5A 5FF0A 5CGMA 1I75A 4LRTA 1TV3A 2ZZ4A 3WBYA 4BY3A 2VOMA 3ATYA 4AWEA 4XAYA 4D6DA 3TSBA 3W7QA 5A8OA 1UP0A 3OGRA 3K8LA 1UOKA 1ODUA 3BW4A 1B2YA 1ZSXA 3BMWA 1L8PA 2ZYFA 1JCNA 2Y70A 3WF3A 3AIEA 4H1ZA 4MF4A 5GNZA 2QT3A 3KBNA 3VABA 4GJJA 5G2HA 2GSHA 3P5YA 4JTCA 2J4GA 4Z2JA 3OZPA 4UBPC 4JR5A 3ZT6A 4GI6A 4QIUA 3M0JA 1KM1A 4YVXA 7CGTA 1EJ7L 4JTSA 4Z08A 4MWAC 4RDWA 1OD0A 3TVAA 2WMJA 2WNNA 3A23A 2FIQA 2B0MA 3BG5A 4AZCB 5CJMA 4I5XA 4H6KA 1UKTA 3SFKA 1BYBA 3TXVA 2R1KA 4YCPA 3UD6A 3CQIA 3GLCA 2Z24A 3KBJA 4HKPA 1YNYA 4LF1A 1ZLPA 2VUYA 3URQA 4BCEA 4YVPA 5FJRA 1GKPA 3VU2A 1DJZA 1G1YA 3CO8A 2VGBA 1WKFA 3UWUA 5G4WA 2C79A 2WHLA 4J4KA 1SZNA 2WHJA 1DQUA 2WMFA 1DJGA 1TZ7A 4JCMA 5FJOA 1JNEA 5C2XA 1KTBA 1NAL1 5DN1A 3CK5A 2OELA 1RA5A 5EBAA 4MNMA 3ARQA 3TN3A 3CYVA 4U31A 2VC7A 2V68A 4WXZA 4XBJA 2O9OA 4DZAA 1NEYA 3PM6A 1GEQA 1PKNA 5I79A 3GQYA 1HJXA 3CT7A 3QGAC 4F40A 4HA0A 4LCRA 4RL3A 1NWRA 1H50A 1TFVA 1REQA 5LZLA 3FJNA 1GW1A 3ZT5A 4RXGA 5K9XA 4B16A 4UMBA 2R1LA 4JFTA 4H9MA 2XGBA 4GYPA 3WDIA 1OCBA 3JRKA 1XBYA 1R85A 3G0XA 4PTMA 3WMSA 1EL3A 3AJXA 3FJLA 4WZHA 4CNOA 2GK1B 4S3BA 3MMDA 3U2ZA 3GO2A 2Z7KA 3OP2A 4JFUA 5I03A 2UY4A 3LGEA 1Q45A 3VX0A 2AGKA 1JD7A 2QF7A 4M7TA 3MS8A 4QQ3A 4QITA 4O12A 3W1XA 1ISVA 5FI8A 1XIDA 1E1EA 1UD5A 1FX6A 2CU0A 1B90A 2XFYA 1BWLA 1IXPA 3N4EA 1L2UA 1VFTA 3RMJA 4CVWA 1EF3A 4PBEA 4QRNA 1AQ0A 1ZCCA 1US3A 3ARWA 1WBHA 1K7FA 4BEQA 4H8VA 2YCEA 1TWZA 1C93A 5ENLA 2P88A 3D3AA 3VD9A 3S9ZA 3GX9A 3KCJA 1V3JA 4GUGA 4O14A 4H6RA 4Y9AA 3AOFA 2VR4A 3KRUA 1OBAA 1K4GA 1I0DA 3VNKA 4Z1AA 3JW7A 4CD5A 1N2VA 3BLEA 1W91A 1QW9A 3AU2A 2INZA 1PWLA 4GUFA 1SZEA 1EO5A 1XRVA 4DUXA 4B92A 3IRDA 3CUFA 1VBHA 1DE5A 2E6FA 2QNEA 3LX9A 2BVYA 1POKA 2UY3A 3VYLA 1XLGA 4CN1A 3VKCA 2CZVA 4GZJA 4HYWA 1ZJAA 1MEHA 3VGGA 3BLDA 4WR3A 3SEPA 2PC8A 3FOKA 3LD5A 4GO9A 2DVXA 3T9PA 1UROA 2CKRA 3VZYA 1IT8A 3TYDA 1J01A 3O6YX 1XG4A 1KCKA 3GTFA 4QCEA 2CHOA 3WJZA 1F3WA 1F3EA 1V7AA 3EWXA 4GACA 3NQ6A 4FR1A 1KGXA 2QXWA 4D6JA 5A95A 3VCCA 2TAAA 4AZGA 3NGFA 3CPGA 4J3SA 4RDYA 2FVMA 4XVEA 2EG6A 2WWDA 5HUOA 1AMKA 3R0DA 3QGKC 3FEQA 1TELA 5KMYA 3WF2A 1JAEA 2YB4A 1DJIA 2OWXA 3H2MA 4WDWA 4ZTYA 3UJ2A 5FSEC 4O57A 2IPWA 3STGA 2NSXA 3AMLA 3W1TA 1K9FA 2HNEA 3FN9A 3FA3A 3BMVA 3IJIA 4O13A 3LXBA 1QOPA 2XIBA 3Q58A 1WDRA 1FWRA 2WXDM 4Q4OA 2BXYA 7PTDA 2NQLA 1GWJA 4DYKA 3SQLA 2QHAA 3DHDA 3OG3A 4HHHA 1XKJA 4LVFA 3BQ5A 3W7NA 1GVQA 1XLJA 3MHFA 1XCFA 4MSSA 1RBLA 3HTWA 5JIPA 1EWDA 1TCDA 2OGJA 3KZSA 3OZMA 2J9YA 1EIXA 2BVTA 1SO5A 1KFEA 4UFIA 3S6OA 3E02A 3VOFA 1H0IA 3P3BA 2HK1A 3AICA 4DIAA 4Y9MA 1JVNA 1S3HA 1KFBA 1WZLA 2Q71A 3BSMA 5HPCA 3GNPA 2H3BA 1W1IE 3ZS4A 2CFFA 1FHLA 2G97A 5J5DA 5K3VA 2V5BA 2VEPA 1WOAA 3N3TA 3W6YA 3IUIA 1EBGA 3QR1A 1B9ZA 2ZRVA 4POCA 5FAJA 1R2TA 2VX5A 2HVNA 3QEZA 3TOPA 4P2VA 4F2BA 1Y7VA 1XCWA 4ML4A 2WCAA 1A0CA 3WMCA 1WUEA 1XIFA 2GPTA 1E4NA 3SCVA 5HR6A 2VZOA 1ME8A 3BUVA 3K8KA 2V67A 1V8EA 1GJPA 3SJNA 1LT8A 3NQGA 2X42A 1CB2A 2NW0A 4NJKA 4GQ0A 2X1UA 1K8YA 3M0YA 1JZ3A 5JBDA 3LV5A 1NF7A 1JJKA 3DHUA 3VIJA 3N2CA 4G5DA 1FWTA 1XLEA 3TQPA 4FP1A 1RSCA 1QHOA 2EF9A 2IKJA 1DV7A 1E6SM 2QPUA 5LNSA 3RO6A 2WZMA 1CT5A 1CDGA 4I3GA 3U6WA 2ANUA 1A4LA 1VD6A 5MKGB 4UTMA 1DIEA 2PTXA 3MJMA 5H91A 2PZ0A 3ZFHA 1FVPA 4NSBA 3KE0A 1BG9A 3ES7A 4V28A 2G3NA 5KSWA 1JDCA 3OGVA 4DJFC 2PTDA 3L65A 3QRHA 1KRMA 5G5IA 3AXXA 1HQTA 4GKLA 3NZPA 2GGIA 3AROA 3SM0A 1JUBA 4S3AA 3NPUA 1E73M 3L0GA 2J24A 1UWSA 1NWUA 4H83A 3R94A 2PF0A 3TZFA 2RDXA 1XLFA 3OLEA 4Z1YA 4GA8A 3E0WA 4V33A 3NFUA 3P62A 3THQA 4EPDC 2FDSA 3MCNA 2E5CA 4Z2LA 4AWUA 1HXJA 2PODA 1ONWA 3CL6A 1F73A 5G1TA 3VKBA 4AF0B 2GOUA 4WJXA 3P0XA 4ERIA 1XYZA 1U30A 2F2KA 1QI3A 4M6VA 4W7UA 5DT5A 1PYMA 3LNMA 4F3HA 2Q01A 1TVLA 1TE1A 1T5AA 5CH9A 3BVJA 1FWCC 3N13A 4NVTA 1EXPA 5D09A 1VB9A 4WGXA 4FOKA 4PUKA 3Q4DA 5C71A 4F4RA 1JYXA 2Y62A 4ZL1A 2GSEA 2HQAA 4D8LA 1QATA 1TYGA 3A22A 4ATDA 4AEOA 1UR3M 3PPGA 2VQUA 3KDNA 3LPFA 2G0WA 1JZ2A 4OQVA 3RF9A 4ZO9A 1GONA 3WELA 3CUGA 4MJ4A 4ZZ9A 3WQDA 4A8NA 4CUCA 3SUTA 3SN0A 1T41A 4YPJA 4PMJA 4ZA0A 4AEEA 4WJEA 4O16A 4XSLA 1EQPA 2WOQA 1ME7A 4TIMA 3A6OA 3NQMA 3BSHA 2PDLA 1IF2A 4LH8A 3U0HA 3OVQA 3V36A 1UWAA 1YDVA 4PB4A 2GFTA 1JF5A 5HXMA 4KWSA 2P0OA 4J40A 4L4PA 1TMLA 2HBXA 4PBGA 1A80A 1PCWA 2IPGA 3VIKA 4L1WA 2A79A 4EF8A 1OHLA 3T4CA 4YNGA 3W7MA 3OG2A 1GEHA 4B5XA 4ZXOA 4O1BA 4U28A 3SCTA 3UNTA 5A69A 4IFOA 2Z0IA 4DYJA 4LOCA 4N9EA 2VD8A 1HO4A 5HNRA 4ZGYA 3HBLA 1BD0A 1ALDA 3C0QA 3WDJA 2JKAA 2Z25A 3DBPA 1R38A 1XQLA 2A3LA 4J1OA 2B7PA 2Y24A 3KL5A 3GH5A 4JEQA 1WXJA 5CBJA 2ZUWA 2WMHA 1JCMP 4D71A 3JVAA 4D72A 3EX2A 3LXAA 5HULA 1TO3A 1B3WA 1MFVA 1IEQA 3G1AA 1QNOA 1E6RA 2RJHA 1KXHA 1BQCA 1XL9A 2Q3RA 4NJGA 3WLKX 4C1NA 1K4HA 2YKKA 1UMLA 2UZ9A 3GNNA 5CPLA 4W8BA 1UC4A 3AMGA 3CZGA 2Q8XA 4ML9A 2E25A 4K68A 4Q8TA 1IIHA 3CQJA 3RXZA 3ITGA 1E9LA 1QOXA 4ZE5A 3REQA 3UA3A 5D04C 5HBFA 5C2CA 1J96A 2WC7A 4Q22A 3W75A 2QR6A 3CC1A 3EB3A 1OEPA 1BKHA 2ZRWA 3BJTA 4Y8FA 2ASHA 4TVCA 5LYRA 3RM8A 3GFZA 3LGGA 2QJGA 1WAWA 4UC5A 2ZE3A 2Z29A 4PEKA 1BAGA 2ZADA 3TZNA 8CGTA 1K8ZA 4JBRA 4ADUA 1BVWA 1LRQA 1TVPA 1Q5MA 3HG3A 1QJWA 4MFDA 3Q67A 3M0KA 4Q8OA 3SRFA 2ZE0A 1EC9A 1F4HA 3NSNA 4IMEA 5F7UA 5HMDA 5CG0A 4KS0A 4D9PA 1LBMA 3LHUA 2VD9A 2V5LA 2YA1A 4DZ5A 1TKKA 5J5RA 1DOSA 1PXGA 4TR9A 1TJ1A 4ERAA 2V2DA 3ZJKA 2BP1A 1YW1A 1AK5A 1J9YA 1O94A 5FOOA 1BVZA 3NPXA 4ICCX 4QEHA 5FKYA 2INEA 5HUPA 3QN3A 2PTWA 4BQ5A 1XG3A 3CZEA 2GDVA 3Q65A 4NXSA 5I3GA 3N2OA 4XZLX 5D9NA 1G0CA 1LL4A 4GZIA 4IIDA 4G6CA 1KFCA 2OCZA 3EWUA 2E5BA 3O16A 2FZNA 4Z1BA 2WSRA 4OWGA 4CNUA 1HL2A 3UGRA 3W23A 3DYOA 2VFIA 4F0MA 1IYXA 4MY8A 1FDYA 5EU9A 4KQNA 2WANA 1DJQA 3R13A 4JD4A 4D6CA 1BHGA 1F2JA 3S1UA 4LF2A 1XP3A 3VE9A 3WLPA 2ACUA 1PTAA 4PMDA 2HE5A 4IQDA 4UFJA 2YSWA 2PMQA 4ENLA 1Y65A 4Y7EA 3H2CA 4FXJA 3LV6A 3C52A 3IK2A 4JICA 1UP3A 4JKMA 2OSYA 3MZNA 4WOZA 1V6YA 3MV01 3N12A 1CENA 2A3CA 3LBOA 3DHPA 1UH4A 2ICSA 2CHNA 3B0VC 3FS2A 2DZPA 1RD6A 2QV5A 1Y5VA 3ITLA 3TNBA 3SCUA 3N6QA 1EHNA 3S5SA 5CGQA 1QW8A 2Z1KA 3OVPA 1S38A 4C6EA 1A0EA 4D6IA 2CEQA 1A3XA 4GYPC 4OE7A 1EJRC 1Z44A 1QFEA 4AD4A 2VC6A 3TLLA 2UY5A 4CLMA 4M6UA 3LDVA 3C86A 1IEXA 3A4JA 3VGDA 3CZ8A 1GPFA 5KZEA 1KR1A 4IMCA 3UZWA 5U4NA 5C9WA 3IGHX 3P84A 4JYDA 4QX4A 4LYKA 3KHJA 1A3WA 1JCLA 1KCLA 3H22A 3A13A 4K8EA 5A5WA 5EMMA 1X1OA 2X05A 2TPSA 3WNKA 1J0ZA 1UJQA 2Y7EA 3NXFA 4U10A 3I7RA 4GO8A 4J3WA 1WKYA 3REQB 3EX1A 2AQWA 1O7AA 2YDRA 1NJJA 4Z1DA 4C5YA 3WK2A 2CZFA 4DEFA 5HANA 3KS6A 5JH2A 1AFSA 1UD4A 2GGGA 5CSUA 3WQOA 2PLMA 1IXOA 4HNCA 2HNHA 3GYCA 4UTJA 5G4EA 3B0XA 1TV8A 3QHNA 3W25A 1HJQA 3LCLA 1XC4A 1VPXA 1WA3A 1FHVA 3CMJA 1JZ6A 4K37A 2C1HA 4I7WA 4K38A 4DWSC 2XISA 1UR0A 2OYLA 4JZ5A 1VBGA 3FYPA 5CZKA 1OIMA 1LWHA 2VL4A 3KCOA 3QBUA 4EF9A 1FXQA 2PEVA 2EGZA 5KITA 2X7VA 2ZWYA 1YXDA 4A3RA 1W3IA 4D6HA 4KESA 2AAMA 5LNUA 4WXYA 4JDYA 3VKDA 3OBEA 3TCEA 1ADSA 2L5HA 1NWTA 1POJA 4JQ3A 1BLIA 4I9MA 3T7VA 1KR0A 1TE6A 3SB0A 3TSMA 1XRFA 2WLZA 3TTYA 4JOMA 5C2GA 4AZ6A 3WLMA 1TMQA 2E6YA 1E1CB 1WCGA 1HZYA 2QCDA 3FY1A 4WOQA 1FH8A 1R8LA 2PDWA 3AIRA 5IDZA 4PUUA 4CU6A 1HTIA 3EMZA 3W24A 2FPYA 3OTRA 2UBPC 4ACZA 2C3ZA 3T42A 5M3WA 1J0YA 2FHFA 3UERA 1A0DA 3MP5A 4PSRA 3EMQA 4N6EA 3W1NA 1TA3A 1H61A 4DJEC 5AC4A 1WDQA 3B8SA 4W5UA 3IAQA 3V7PA 5HMEA 3ITYA 3KBMA 3S1VA 4S23A 3GZ3A 3GXFA 3QH2A 1EJUC 2F8QA 4G56A 3WH9A 3COTA 3UVIA 5H8MA 3KOZA 4KEUA 4X2RA 2WSPA 3EOEA 3HO8A 1K3UA 1QDSA 1QO2A 4LBRA 4IX0A 4PULA 1XLAA 3MSYA 1OFQA 2XZ7A 2IPFA 4ZB0A 2VT0A 2DIJA 2PDFA 3ZQ9A 1SVDA 3WLNA 2NV9A 4WD0A 1TWWA 5KEZA 1FWSA 1WO2A 2O9TA 7REQB 2XVKA 2H90A 3P81A 3ZWSA 1W1B1 1P6WA 3TROA 4QLJA 4ROQA 4XTIA 2EBNA 3NM3A 3ABZA 2VXNA 4FSAA 3LCWA 5CG7A 5D9OA 2ZUVA 2Z26A 2P1FA 5FEPA 3WENA 4L80A 1UH2A 3LCFA 4A2SA 3URAA 3OLIA 1HGYA 3VD5A 2PD9A 5CAKA 3AUOA 1JZ4A 2REQB 1HL8A 4F0LA 4RZBA 3M46A 4DJED 2V8ZA 5DELA 1R3VA 1B3YA 1QMLA 4PE8A 5C9RA 1PYFA 1JPMA 1W8GA 3DG3A 1EOKA 2FMNA 4ATLA 3WQPA 3AYTA 1TTPA 1XLLA 4XISA 4X63A 3BAXA 3BAYA 3RPDA 2VO5A 5FA5A 3BW3A 5CZSA 2P0IA 2TMDA 1EJVC 3VFCA 4W7VA 2E6AA 4K8HA 5AECA 1UQZA 1XUUA 4MJZA 2AQOA 1TVNA 3NTYA 1RK5A 1DL3A 1CECA 2YGYA 3K4DA 1KFWA 1LUCA 3N4AA 3QFWA 1FDZA 1I6NA 2CLLA 4H8HA 1G6CA 3W86A 1E4MM 1PTDA 4DM1A 2YXXA 3MVIA 2J78A 4S3DA 3RPTA 1AL8A 4LYPA 4PTWA 1G7UA 3QXBA 2CLMA 1VFSA 4F2TA 3EGJA 3KP1A 4UIOA 3AISA 2IKGA 1BYDA 6TAAA 5AC8A 2ZOXA 2NWRA 4W87A 1VC4A 3UP8A 3VDHA 1DEDA 1UBSA 3LSBA 1XRTA 4D6GA 3E0IA 4NZJA 2VURA 5EYWA 4UR7A 4QDMA 2QW5A 5K4XA 2WPBA 5B7YA 4G7EA 3HB9A 4KEMA 1H1ZA 3L4TA 4W4QA 1RVKA 1TX0A 4F0RA 4R9OA 1ZUAX 3TC6A 1Q4WA 2DZBA 4JFSA 4CQ9A 4HOZA 2E9MA 1A5KC 5AC6A 3EEZA 1EJWC 3PZUA 3XIMA 2F2HA 3FKKA 4QHRA 4KPLA 1QO5A 3A3WA 4DYEA 1OADA 1N82A 5LSMA 3RX3A 4DX3A 2J66A 2Z2UA 4NAEB 3A64A 4S38A 3NOEA 2ISDA 3WJWA 1B3VA 4EXQA 1GVEA 1U33A 3NZRA 4PA8A 4AD1A 1GVOA 1TSIA 3VIOA 2Z6JA 1C9DA 2NUYA 1CGYA 3AUJA 3BURA 4JIQA 1Q6FA 5JIWA 3VNDA 3T0BA 5AKQA 2IQTA 3F5KA 7REQA 2FTPA 4QE4A 3W01A 1O5XA 1ELSA 1J5SA 2EEXA 3UZJA 1V77A 4ONVA 4B2DD 1W3JA 4X2PA 4FOJA 2QVNA 5ABFB 4H9ZA 3NOYA 3CZJA 4BI6A 2P3EA 4CEXC 1O60A 1G9HA 4X60A 3ZJ7A 1MI3A 1DQWA 2DORA 3B3DA 3R79A 4HSOA 3N6HA 3CIWA 2ATSA 4XD6A 2RDTA 3O05A 5IBXC 1EUAA 3F5JA 5C9XA 3SDOA 2D0HA 1C90A 2PDXA 1Y0EA 1NM9A 3N29A 3EAUA 1TPFA 1MNSA 3PBUA 4WLCA 4P8WA 4O52A 3LTYA 4S3FA 5I3FA 4JNZA 4ZXLA 3RRAA 1OABA 1XRSA 4B5NA 3RU6A 1GYLA 4S39A 2DZWA 3PZTA 1MYRA 1GVIA 3STEA 3OIHA 1D7FA 3QR3A 4JYEA 3GIPA 4MUPA 1V51A 3IIZA 3O07A 5I5RA 5IRPA 3TYBA 2OX1A 2YL9A 4GYJA 3WK1A 3O06A 1A5NC 1UR8A 2QPSA 5ECVA 3ZLFA 2FHCA 4LAKA 1E40A 2X0HA 3S5OA 3HV8A 4YTTA 3CL7A 1DKWA 3DH7A 2QVHA 1Y8BA 2ZUUA 4IIEA 2C19A 2HE8A 1H5YA 4D6EA 2WKJA 4BI7A 1XGZA 5TQLA 2PDMA 3WLRA 5DBTA 2D20A 5T8GA 3IIXA 4WKHA 3LUTA 3G1DA 5RUBA 1R86A 2HROA 3PUDA 3AXMA 3BLIA 3BL3A 4EWND 4FNTA 3A9BA 2I9UA 3LMZA 1HP5A 2Y89A 3N3MA 3GUWA 1PUDA 2PS2A 1GVFA 3UXKA 1OGBA 6TIMA 3QQ1A 4RW5A 4S3KA 2ABAA 3S2NA 6A3HA 3L4UA 4G8TA 4WCJA 4ZSUA 4E4PA 4K1GA 4A21A 2ADAA 1TIWA 1FOBA 1UIPA 3EX4A 1R9ZA 3S5NA 1ZAIA 4GMEA 1X7IA 5FF2A 3M7SA 1DWFM 3PC0A 5CKSA 3TJLA 4MWAB 4JYFA 3IJDA 1UD6A 3W9ZA 2DQXA 1IT0A 4Q8QA 3RJXA 5EMUA 1AA1B 4IH3A 1FXPA 2WC4A 1OX4B 4I6VA 3QV8A 1UC5A 4F0HA 2ZBTA 1X1ZA 2G3IA 1WV2A 2QCCA 3FIGA 1PS9A 3H24A 3VUSA 2YCJA 4L4OA 4IQEA 3RAOA 3TMQA 3EPOA 4LXFA 1DWHM 3BO9A 3TDFA 5H8UA 2NVAA 1FCVA 3GU1A