3OZOA

Crystal structure of insect beta-n-acetyl-d-hexosaminidase ofhex1 complexed with ngt
Total Genus 190
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
190
sequence length
572
structure length
572
Chain Sequence
EDVVWRWSCDNGKCVKLKNDPRSSEPALSLEACKMFCNEYGLLWPRPTGEADLGNFLSKINLNSIEVKILKKGATDDLMEAAAKRFKEQVSLAIPRGSTPKLTGKAVDVYLVNENPNEKAFSLEMDESYGLRVSPSGADRVNATITANSFFGMRHGLETLSQLFVFDDIRDHLLMVRDVNISDKPVYPYRGILLDTARNYYSIESIKRTIEAMAAVKLNTFHWHITDSQSFPFVTTKRPNLYKFGALSPQKVYTKAAIREVVRFGLERGVRVLPEFDAPAHVGEGWQDTDLTVCFKAEPWKSYCVEPPCGQLNPTKDELYQYLEDIYSDMAEVFDTTDIFHMGGDEVSEACWNSSDSIQNFMMQNRWDLDKESFLKLWNYFQQKAQDKAYKAFGKKLPLILWTSTLTNYKHIDDYLNKDDYIIQVWTTGVDPQIKGLLEKGYRLIMSNYDALYFDCGYGAWVGAGNNWCSPYIGWQKVYDNSPAVIALEHRDQVLGGEAALWSEQSDTSTLDGRLWPRAAALAERLWAEPATSWQDAEYRMLHIRERLVRMGIQAESLQPEWCYQNEGYCYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal Structure of insect beta-N-acetyl-D-hexosaminidase OfHex1 complexed with NGT
rcsb
source organism Ostrinia furnacalis
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords N-acetylglucosaminidase
total genus 190
structure length 572
sequence length 572
ec nomenclature ec 3.2.1.52: Beta-N-acetylhexosaminidase.
pdb deposition date 2010-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00728 Glyco_hydro_20 Glycosyl hydrolase family 20, catalytic domain
A PF14845 Glycohydro_20b2 beta-acetyl hexosaminidase like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3ozoA02
3.30.379.10 Alpha Beta 2-Layer Sandwich Chitobiase; domain 2 Chitobiase/beta-hexosaminidase domain 2-like 3ozoA01
1H1NA 2D24A 2YBUA 4D6EA 1CNVA 5IDIA 1MXDA 1CDGA 1GPFA 4PRWA 1XRVA 4TXEA 5A6BD 1HN1A 2ZXBA 4BF7A 2D20A 1SR0A 4LGXA 3CUJA 1W32A 1ISYA 2YDQA 1CIUA 2VX6A 1UKSA 3U5YA 3VIOA 3RCNA 3SCSA 3WD1A 2D22A 3D5HA 3OGRA 2YDRA 3WD0A 1JXKA 5BXSA 3L4UA 1JFXA 1HJUA 3A3HA 3MANA 2VR5A 1KXTA 4HMEA 2JF7A 3CUGA 4BS0A 3W37A 2CETA 1MW2A 2XGBA 3PTMA 2ZX5A 1OD0A 4UNIA 4ZE5A 4MDOA 1E4IA 1OT1A 2YL9A 1V3HA 4ZENA 3L4ZA 2OYKA 2WSPA 1FH9A 2WMJA 3N11A 2ZXDA 2BVYA 3CZ8A 4W7WA 1BPLB 3UR7A 1ISZA 5I2UA 3PBGA 1V6VA 3T2PA 1J01A 3W6MA 3VNZA 1JDAA 4RE2A 1SFSA 4U2ZA 3KEHA 4GO9A 1XYZA 2WHJA 2WZIA 3RM4A 3VINA 3WL0A 3WUFA 4IUGA 4PMUA 5FL0A 3CMJA 3L2LA 3AI0A 3SUVA 3N17A 1H5VA 4W93A 2VQTA 5CZKA 1VFOA 3VGDA 3UERA 4D6FA 2VZSA 1QHPA 2WSKA 5LA0A 3MV01 1JXJA 6A3HA 3WD2A 3PZTA 4Q7NA 1UKPA 1LJYA 2E9LA 3O6AA 1TG7A 5GNZA 2XGIA 4AIOA 5A95A 3L4YA 1KR0A 3L4XA 4D72A 3EMZA 5BRQA 3PZMA 2VT0A 1U33A 4J3TA 4E2OA 1KBBA 3AXHA 4TX8A 4RL3A 4ZXOA 3MMWA 2PC8A 3OA5A 2D3NA 1CEOA 1X6NA 3BCDA 4GZEA 4KRUA 1MW0A 1CTNA 1V02E 4A4AA 1EHNA 3ALGA 4FLOA 4D1JA 1TMQA 1GNXA 4OBSA 1BF2A 3NYDA 5C70A 1GORA 4CU8A 3GNRA 4JKLA 3E1F1 2JEQA 4JZ5A 4JCLA 3FXYA 4EANA 3BH4A 2VCCA 3N1AA 2BVTA 3W81A 3CUFA 1NWUA 3BSHA 4CKQA 2BY3A 1WZKA 1F4AA 2E9BA 1HKJA 2JIWA 4D6CA 7CGTA 4UFIA 2G3MA 4ML4A 4OBRA 1V0KA 3ARPA 4Z2JA 5BXPA 1NOUA 1WNOA 1JZ5A 2QMKA 2CITA 4AEEA 1NWRA 4QLLA 1BAGA 2OWXA 2XFFA 3TONA 5ABFA 2Y5EA 1GHSA 4P8XA 3JUGA 1MFVA 3WH8A 8A3HA 1HJSA 2GDVA 5LA2A 1FHLA 1E0WA 1XC6A 3MUAA 2F61A 3QHNA 5A6AA 1TZ7A 1UR1A 2A3HA 3AS3A 4WJXA 5I77A 1SYTA 3WD3A 1IZKA 2XVPA 4KRTA 4J28A 3CHFA 2EEXA 4M1RA 2W61A 1OWQA 3NJ3A 2FHCA 3QOKA 1OCQA 2WMIB 1DWJM 1JIBA 2J7GA 3MUZ1 4PUDA 2WC4A 1AMYA 1BLIA 1QHOA 3AYSA 1BGAA 2V5CA 1W2VA 1XCXA 4ACZA 1ZU8A 2ZWZA 2PWDA 3T2QA 4JFUA 3L4VA 1MQQA 2YL6A 2PBGA 4U3CA 3M7SA 4PN2A 5DEZA 1RP8A 1UD3A 5ABHA 4LX4A 5FCZA 2EPLX 1UR2A 2WLZA 1WE5A 1ZBKA 5A8NA 3FY1A 4JL1A 3GXMA 3HMCA 3POHA 1V3JA 1HNYA 3WELA 1CXKA 2WCGA 1XSKA 3LPFA 1G01A 1CXFA 3WNMA 1FA2A 2XIIA 5D8ZA 1HT6A 5F7UA 1QI5A 1WKYA 1CPUA 5BCAA 3BAKA 3VVGA 1VAHA 3PZQA 1GVIA 4HU0A 4Y7EA 2PBOA 1B90A 4U3AA 1UR8A 1W1TA 4R27A 3W53A 2J75A 1P6WA 3W38A 4L4PA 2Z1KA 2ZWYA 3WNKA 2C8NA 3UG5A 1HIZA 4F79A 4OZOA 4KWUA 4OIFA 2VI0A 2Q8XA 1WP6A 3VGHA 3L2MA 4UOZA 1E5JA 4HA4A 3BMVA 5IFPA 1H49A 1HVXA 1TR1A 1VBUA 2E0PA 3UETA 3APGA 4UQCA 5D9NA 3TTSA 1EDQA 2JIEA 2WCSA 3VD9A 3SUSA 1UD5A 3SCPA 2QPUA 4AZ5A 1MQPA 4K68A 2A3BA 2FH6A 1WDSA 2G3IA 1C8XA 2W62A 1C3FA 2W66A 2WHLA 1JF6A 3DYMA 2QV4A 5A8QA 1R85A 1FOBA 2WW5A 3N9KA 3AHZA 3PN8A 3AROA 4DM2A 1R7OA 1I1XA 2NSXA 2CNCA 1ZB5A 4UOQA 4MNKA 5EMYA 1H11A 5E09A 3RO8A 1KWGA 4BQ2A 2E4TA 1G5AA 1E40A 1EH9A 4UFHA 4WIWA 4W86A 3BAWA 4NSBA 2WANA 3S2CA 4QAWA 4B9YA 1U30A 3TTQA 3ZMRA 1PBGA 2BS9A 1E6PA 2IUZA 4CCEA 1JAEA 4A3HA 3VD4A 4EAMA 4D1IA 1V0LA 1WDRA 1JD7A 1QBAA 3T08A 1KXQA 3HJEA 5CLTA 2J78A 4PSPA 4CU7A 3FN9A 1EO7A 2VR4A 1UKQA 2DSUA 3WENA 2TAAA 4HZ7A 1KCKA 2XVLA 3NIYA 1NWTA 2W92A 3VD3A 1V6YA 3T09A 7A3HA 4JFVA 1RH9A 2J77A 2VZVA 3BLKA 2DH3A 2DT1A 2WMFA 4BQ5A 1JAKA 4B16A 1JZ6A 1C92A 1ZBVA 2NT0A 1BHGA 4AYSA 5CQ1A 1X6LA 1NP0A 2VX4A 3VGFA 4GXPA 4W87A 2EXOA 1E70M 1RPKA 2XM1A 3SCVA 3SURA 1B3VA 1K9FA 2XVGA 5BRPA 2V3DA 2OYMA 1OIMA 1VRXA 3VIPA 1H41A 3WL1A 2EPOA 2Y8VA 2PWFA 4J3WA 1KB3A 4AZCA 2WLYA 2UY3A 3BGAA 4FK9A 2O9TA 5AC4A 4LYPA 3ZJ7A 5ABEA 4PYSA 1UUQA 5CGMA 3K46A 3GBEA 4W8BA 1I75A 2Z1SA 3MMDA 3WFLA 2W4XA 5M17A 3OIHA 4CCDA 2BXYA 3BXWA 1K9EA 2O92A 1SMDA 2ZE0A 1JD9A 3BCFA 3ZJ8A 3UR8A 4WKAA 5C71A 2VJXA 1OM0A 4MB5A 1VB9A 2GK1B 1HKMA 1JYNA 7TAAA 4HA1A 2W5FA 2VVSA 4CN1A 5A6MA 5DMYA 1WZMA 4W8LA 2WAGA 4EKJA 2J74A 4H8HA 1CLVA 2OWWA 2OWCA 3VIKA 1HJWA 1Q6FA 2QF8A 3SUTA 2BHYA 2DSKA 3ARXA 1UA7A 1WAWA 3ARYA 1UR4A 2DIJA 4L4OA 2J8FA 1E6SM 2EO7A 3A4WA 2YA1A 4ATDA 1EOKA 1X1NA 1TA3B 1KQZA 1TE1A 2V3FA 2GJXA 1EGZA 1M01A 1V03A 4DUXA 5KEZA 1Q6DA 4GPNA 4UOJA 4JL2A 1JYVA 3SUUA 5LA1A 2F8QA 2OSWA 2UWFA 1W3KA 2VQUA 3CZGA 1W1VA 4GO8A 5GQBA 5D9OA 3VD7A 3PZUA 3CZKA 1JZ3A 4TVUA 1V3KA 3ARRA 1A47A 4Z2LA 1DWFM 1LL7A 6CGTA 2XUCA 3W4RA 1J12A 1NWSA 4U5IA 3N04A 3W6LA 4MNJA 4RE4A 3CHDA 1OBAA 4W85A 4HTYA 2WNWA 4GIAA 4FF5A 3IJ8A 2FGZA 1B31A 1OIFA 4UR9A 4PTWA 1DP0A 3UCQA 1VJZA 3RDKA 4KMQA 3T0DA 3HU7A 3VGEA 3CZJA 5CSYA 1ZBWA 2CESA 5D9MA 1J0ZA 3KWXA 4JKMA 4OJYA 2YBTA 3O2LA 1C7SA 3LPOA 1ZBCA 1UWRA 3AS2A 2DH2A 4H7VA 1BYBA 1CLXA 1BVZA 4TTGA 1JNEA 3IAPA 4AD2A 4FLRA 1KQYA 4FLSA 2E8ZA 2CBVA 1EDTA 1J9YA 5M3WA 1C93A 2WK2A 1JGIA 1Q6GA 2QHAA 4U33A 1LWHA 3GM8A 1WDPA 1E0XA 2ZXQA 1W3LA 3F5KA 1E6NA 2D1ZA 2WPGA 4U2YA 5D8WA 1CXIA 3WY1A 2GJXB 2ZOXA 3WDRA 4AD5A 1CXHA 1Q6EA 2AAAA 1TA3A 4WSJA 1E56A 1FH7A 3NSXA 3KL5A 3EDFA 1OSEA 3EMCA 2W67A 1UH4A 1E5NA 4AD0A 5JIPA 3PZNA 2YDSA 5LYRA 4WSKA 3VX0A 1HF6A 4MJ2A 4BQ4A 1BG4A 1HP5A 4IPLA 2WC7A 2WZHA 2V3GA 3RJXA 1E6RA 4HMDA 1UZ1A 3OG2A 3ZSSA 1E4LA 4V28A 5EFFA 1UZ4A 3LPPA 3MUIA 1WB0A 2BY1A 1JZ2A 1KGUA 4UCFA 2A3CA 4BZYA 2J7BA 3AS0A 2XHYA 3GNPA 3QHMA 2EPKX 2J62A 1GOWA 4JIEA 5I5RA 3U7VA 4WLCA 5FD0A 5ABFB 1KCLA 2VMFA 5GNYA 2C0HA 5DO8A 3CHCA 2DEPA 1K6AA 4CN6A 4TX6A 1JZ8A 5FOOA 1HKKA 1V3LA 3EDJA 3BAYA 1CGVA 2ZX6A 3PZIA 3K8KA 2ZX9A 3M46A 4MNLA 1VEPA 4F8XA 4NZCA 3VNYA 2O9OA 4PMDA 2DIEA 1QPKA 4PMRA 1NOWA 4MDPA 3WQ6A 1G9HA 1MW3A 5C8BB 2YA0A 1B3XA 2CBUA 3VIGA 1ODZA 3EYPA 4HOWA 1XD0A 3AMDA 1WO2A 4PTVA 3WDIA 3WH6A 2RGLA 3AJ7A 1KBKA 2WVSA 1UQYA 4PBGA 1JZ7A 2G4FA 3QOMA 1VBRA 2DT3A 3WF2A 4F9DA 5A6SA 1L0PA 2J47A 1JZ4A 4LXFA 2BXZA 4ZE4A 2DDXA 4IISA 3WDPP 2ZUNA 4E8DA 1XH1A 3VDCA 4D6JA 3CLWA 1TCMA 4LPCA 3CIVA 3CUHA 4P8VA 3AIRA 2WM0A 2BFGA 3CTTA 3ZIZA 2BY0A 4X0NA 3OLIA 1VFMA 4W5UA 5M5DA 3W24A 1FP8A 4OOZA 2MANA 1VENA 2BY2A 5HNNA 3VKKA 2VNCA 2YL8A 1E55A 5HPOA 3W27A 2WBGA 1ISVA 1VFUA 1KR1A 3MSDA 1BYAA 4J3SA 3OGVA 6TAAA 2F2HA 3AIEA 3WBEA 4AZ6A 1J0IA 1JF5A 3WFZA 2WVVA 1GOMA 4PMVA 1AQMA 3GTNA 4TTUA 1CGWA 1TVPA 5D4YA 1W9DM 4H04A 1CWYA 3EDEA 5HXMA 4AZ7A 3A47A 4M81A 2DT2A 4CD5A 1VIWA 4NRSA 3NUKA 1WCGA 2XG9A 1ISXA 1ECEA 4OUEA 2BNJA 2X2YA 3WNOA 1W9UA 3S6TA 3AIBA 5FIPA 3ARTA 3BC9A 2JALA 3AXXA 3EDKA 3VDHA 1PEZA 4CGTA 2G41A 5I23A 4JFSA 2XPKA 4V2XA 5A69A 3DC0A 4GZJA 3KZSA 3OGSA 4AWEA 2ZX8A 1R87A 2OLHA 3TTYA 3AMKA 1E9LA 1MWOA 2D0FA 3W26A 2CEQA 1JDCA 3WQVA 4GZIA 2WHKA 2PI6A 4AIEA 2J79A 1ITCA 1BGGA 2J25A 3VOCA 3RILA 4URIA 1CGYA 2FHFA 2CXGA 3MS8A 1HJVA 3PTQA 3RIKA 3VGGA 2J7CA 2VTFA 1DTUA 4LYRA 3CHEA 2XFYA 2DSVA 4C7GA 5A2CA 4HPGA 3WD4A 4ZXLA 2DGAA 1NARA 1SMAA 1E3ZA 2FH8A 3AFBA 3WQ8A 2WKGA 2J7HA 1MYRA 3OBAA 5I78A 3U5UA 5I0DA 2VRKA 1XD1A 2CHNA 2XSAA 1HL9A 1NH6A 1EHAA 1PZ3A 3EDDA 3MUY1 2ZIDA 1E4NA 3IANA 4WKFA 5E6YA 4LYQA 1H3GA 4M24A 1E4MM 3FHAA 2J7FA 1YQ2A 4D6IA 4TVCA 1W9VA 2X05A 4D6GA 1E1FA 1UKTA 4UQDA 2D0GA 1DWHM 5ECUA 4KGLA 1D7FA 3T2OA 5E0CA 3WSUA 3VIIA 1UD4A 3WDJA 3ZSTA 2VUYA 1CENA 2Y4SA 2WXDM 4PMNA 1H4PA 4GI9A 1V6WA 3TOPA 2WYSA 1BVNP 1W9PA 4W5ZA 1JYWA 3WNPA 1US3A 1J0HA 4J7RA 3VIMA 3CMGA 4Z2GA 3CPUA 4EK7A 1IV8A 1W91A 5JBFA 2DSWA 3B9DA 1PAMA 1O6IA 1J0JA 4AZGA 1UD8A 3K8LA 4HZ6A 3NSNA 1GUVA 2AOSA 4UQBA 3ZOAA 1E1EA 4M82A 3G6MA 1OGSA 1GHRA 2VC9A 3SCQA 2XVKA 1S46A 3WH7A 1JL8A 2X8RA 1UQZA 3WH5A 3GYCA 1LL4A 4JAWA 4AXNA 5IFTA 3A6OA 4WK9A 2Y8KA 4IM4A 2C7FA 1PJ9A 2YL5A 2WKLA 3WQ4A 2DT0A 4N42A 3VPLA 1D3CA 1R86A 4MB4A 1M04A 1H2JA 4MNMA 2V38A 4CN4A 3CUIA 5HDRA 1W9XA 4ZEPA 1VFFA 3WF0A 4Z2IA 3WMCA 4MJ4A 2WVUA 1HL8A 4DWSC 3RM9A 1EIBA 3CH9A 1AVAA 3UEQA 2YA2A 3AS1A 1HJQA 3VDAA 4UZUA 4X0VA 1AQHA 3GXFA 1C91A 3W28A 4GQQA 1V3IA 3M07A 1RP9A 3AHTA 1V3MA 4QCFA 4E8CA 3W0KA 4NRRA 5E6ZA 1JI1A 4C90A 4RE3A 2VO5A 5A2AA 3POCA 2GDUA 5JUVA 4W88A 3IJ7A 1QNSA 4ACYA 2CBJA 1OGBA 1G94A 5FKYA 3VILA 1JFHA 1MQRA 1E6QM 4AD1A 4C7FA 4AZBA 3WMBA 3WN6A 1AQ0A 3GXDA 4UFKA 4PTXA 3GNOA 3OLDA 1K9DA 3PZGA 4CVUA 4AIUA 1FH8A 4PMQA 4UFMA 1GJWA 4DWSA 5DT7A 3SIMA 4BQ3A 3ARUA 5DF0A 3THDA 2GFTA 1NP2A 5E9AA 3RM8A 3BAIA 4JHZA 4YHEA 1CGXA 2D2OA 1W3JA 3N18A 1TVNA 2GSJA 3GH5A 3OZPA 1JG9A 4MTVA 2YKKA 2XFRA 5GNXA 3GH4A 1DWAM 1GW1A 2EQDA 3QHOA 1VJSA 3TP4A 1HX0A 4PMZA 2ZUMA 2JE8A 3LMYA 3AIWA 3VUPA 1D2KA 4A3YA 5A94A 3DHPA 5EBAA 1CGUA 2WWCA 3BLPX 5A1AA 3FNDA 2E3ZA 3QGVA 2HISA 2NT1A 2BHZA 1LG1A 4P7OA 1B9ZA 5CPQA 3AISA 4OOUA 5A6LA 3QR3A 3MU7A 3TTOA 1O7AA 2VRQA 3MV11 3WEOA 1E3XA 3II1A 3AICA 2FHBA 4PEEA 2XWDA 2WHMA 3WUEA 3VTRA 2XM2A 4U31A 4UZSA 3F4VA 1BQCA 4S3KA 3D3AA 3RMEA 3WDQA 1PPIA 3VU2A 1KWKA 4MAZA 4Z2KA 3ZJKA 1IZJA 2O9RA 2G8ZA 1UWIA 4HU8A 2QMJA 2E9MA 2J7EA 2WVVB 3ARSA 4AZCB 4Z2HA 2ZUSA 1PX4A 4W8AA 1MVYA 3F5JA 1QW9A 3ZJ6A 5HPCA 5JIWA 1V0MA 2WMKA 3FAWA 4CU6A 2ZXAA 2YJQA 2YOCA 4XZBA 5KZ6A 2UY5A 1XSJA 1FFRA 3DYPA 3AZRA 1KGWA 2D0HA 4D71A 1G0CA 1M7XA 3BMWA 5CLWA 1J0KA 4B9ZA 2JF6A 2EPMX 9CGTA 3WF3A 1C8QA 1UWQA 4N0RA 5AYIA 3SCRA 1PIGA 2BV9A 3VM5A 4M56A 2WMHA 2PF0A 3IJ9A 4JFWA 5A6JA 3MO4A 1BFNA 3B9EA 4HP5A 2PB1A 1E6XM 3F5LA 2WMIA 1KFWA 3A4AA 2IXUA 1UG6A 3K8MA 4MB3A 1NOFA 1XHGA 1EQCA 1GCYA 1EQPA 2CKSA 5CGTA 4QCEA 4E4PA 3W25A 1PX3A 1NM9A 3CZLA 1EDGA 2GJPA 1EXPA 5ABGA 4D6DA 4JCMA 1W1YA 1GOOA 1XCWA 2NW0A 4CUCA 3THCA 1WPCA 2ZUTA 3VX1A 1UH2A 2QLYA 3OLGA 1ISWA 1QI3A 1JNDA 1HVQA 5CPTA 5A3HA 3N12A 2WB5A 3CO4A 3UESA 1UWTA 2ZUUA 3ZR6A 3AHVA 4C91A 4FMVA 5E0FA 1JYXA 1QOXA 5HBFA 2ESCA 3VMPA 4WKHA 1Q6CA 3WIJA 3G6LA 5CPSA 5M03A 2X0YA 3SCWA 1LG2A 1GOQA 1PZ2A 4EE9A 4U5KA 2V3EA 1UHVA 4UQAA 4B3KA 1GONA 3NDYA 1E71M 2ZUVA 4GI8A 3AIQA 4QDMA 4M80A 3PTKA 2XSBA 4XV0A 2E8YA 1CGTA 4V27A 3ZO9A 3B8SA 1E43A 4PMOA 2QPSA 3T0AA 5A8PA 1TFVA 1A3HA 4ATLA 5A6BA 2D3LA 2ZUWA 5BYWA 4IPNB 5FL1A 1KGXA 2ZICA 1HKIA 1WZAA 3VGBA 2GVYA 1UOKA 2EPNA 3NSMA 3ZT5A 2FDMA 5HOSA 1QVBA 3N15A 1GVYA 1QW8A 4HMCA 4DWSB 2CKRA 2VZUA 4D6HA 3OB8A 1QNQA 1LLOA 1WDQA 4XX6A 1ZL1A 3WEMA 4W7UA 2XIBA 2XYLA 1W2PA 1OD8A 4UQ9A 5IXEA 5I24A 1B2YA 2PWGA 5JBDA 3BAJA 3VO0A 4PUEA 3DECA 3ZR5A 3I3EA 1CYGA 3WDHA 4HA3A 4ATWA 4P8UA 3AXIA 1RD6A 3ZT7A 1QNOA 4P7QA 1UR9A 5GPRA 3SEPA 5I3DA 3WKZA 3RJYA 4J3UA 4LQ1A 3VIFA 1J0YA 2A3EA 5TD4A 1ZS2A 3BSGA 3IK2A 2DSZA 2YLLA 2CPUA 4GKLA 4UFJA 4DUVA 2CBIA 4XUYA 1KXHA 1V02A 1H09A 5CXPA 3WH9A 3MKKA 3NCOA 1WZLA 3W29A 1Z32X 2UY2A 1GQLA 1QNRA 1UD6A 4CD6A 4TUFA 3SCNA 2EBNA 1L8NA 1R7AA 3I3BA 3AHXA 1VEOA 2CIPA 2VZTA 3SUWA 4QLKA 1LF1A 3VIJA 3ZQ9A 1B30A 3UG4A 1GZJA 1NQ6A 4NI3A 1TUXA 5JBEA 1Q4NX 3VDBA 1EOMA 4CCCA 3AZSA 3UG3A 1I1WA 2WVTA 3GZAA 2VX7A 3ARWA 4W84A 2ZX7A 2WBKA 4UQEA 2W91A 3ARQA 3WNLA 1QI0A 1XH0A 2GJRA 3ARVA 3WQWA 4ACZB 3AYRA 4MB1A 2J7DA 2VCAA 2VCBA 1M03A 1OT2A 4AD3A 1W3HA 1VF8A 1V0NA 1HP4A 5DFAA 2Y2WA 3SCUA 3T0BA 1J11A 1LWJA 4JHOA 4AMCA 1ESWA 3WUGA 3WUBA 2VURA 4J27A 3M6DA 5AYBA 1GOKA 4AC1X 3AMCA 2JEPA 2WMGA 1XH2A 4DUWA 3AIVA 1B1YA 1CXEA 3ZT6A 1MFUA 4ZFMA 2IXVA 3PHAA 1E15A 1FFQA 3VIHA 3WF1A 4AD4A 1CZ1A 2BHUA 2O9PA 1UWUA 4PMXA 3RPMA 4MPKA 1MXGA 3VMOA 2GK1A 2AMGA 4JFTA 1YHTA 2B31A 4H8VA 2CCRA 3L4TA 4H8UA 1VEMA 4XB3A 4PSRA 1UA3A 2VL4A 2GUYA 4CD7A 1E73M 2G3JA 8CGTA 2VOTA 5A8MA 1QHZA 4AW7A 3CBWA 3ARZA 4JKKA 3B9AA 2UY4A 3OZOA 4BCEA 4P8WA 4J3VA 4J3XA 1UD2A 3W82A 2XVNA 4Q22A 4DWSD 1N82A 1UYQA 4QFUA 4HPHA 5CSUA 2HVMA 3ALFA 1M53A 2VRJA 4HZ8A 4AEFA 5A2BA 5BROA 4XZWA 3WQ5A 1H0GA 3K4AA 3O9NA 1C8YA 2EJ1A 1DWGM 2XWEA 4MAVA 4NF7A 2XJ7A 3CZEA 5D9PA 1HXJA 2X09A 4F66A 3WEZA 1G1YA 4MADA 3DHUA 2XTKA 1W9BM 3FHQA 3WF4A 5CG0A 1HJXA 3HN3A 4AZHA 3VM7A 3MSGA 2V5DA 3U7BA 2VZOA 4R5EA 1H0IA 4C7DA 1ODUA 2DPEA 1U2YA 1XGZA 2VVNA 2RGMA 3I3DA 1UH3A 2G3NA 5BXRA 4B3LA 5EFDA 4P7NA 2J4GA 3FAXA 2WZEA 4PMYA 2J8GA 1CBGA 1GQKA 5E70A 3AZTA 4QP0A 4W89A 4CD4A 4TOQA 1UKOA 3BAXA 3U57A 3K1DA 1ZJAA 4AZIA 2BVDA 4M29A 1CECA 1E72M 4W7VA 2WCAA 5I79A 3J7HA 2WC3A 4HOZA 3L4WA 1B3WA 1BTCA 5BWFA 3CGTA 2DQXA 1B3YA 1GQIA 3SCOA 3ZM8A 4GQRA 3AMLA 1DEDA 4YHGA 1BYCA 2A3AA 1DWIM 3GH7A 3IAQA 5I6SA 1PX8A 1B3ZA 3DYOA 3AOFA 4HOXA 4KGJA 3MMUA 1XSIA 2YLAA 3K4DA 1PIFA 4UFLA 2VX5A 4OKDA 5EB8A 4AY1A 2D23A 1OB0A 2OSXA 1XYFA 1BG9A 4TVDA 1GJUA 4F9JA 1Y7VA 3WNNA 1US2A 1V6XA 3A4XA 3N13A 5DT5A 4YPJA 4CD8A 4X9YA 4AISA 3PZ9A 3ECQA 1C7TA 4H2CA 1QI2A 4GINA 1K9TA 2PWEA 4DM1A 2CYGA 1LL6A 1JDDA 2PWHA 3PZVA 4QLJA 1E6ZA 1FP9A 3FW6A 2X1IA 3GBDA 4M8UA 1B0IA 3SCTA 4BA0A 5IHSA 4UTFA 4S3JA 4KH2A 5AC5A 1E0VA 1EO5A 1DHKA 2YIHA 3OLEA 3AQUA 1OGGA 2W63A 1EA9C 3WBAA 1FHDA 3LPGA 1BYDA 4WF7A 2CERA 4PCSA 2FGLA 1ITXA 3NDZA 2X0HA 1ZJBA 4H41A 4PTMA 1XV8A 1J18A 1F4HA 4P7LA 1V6UA 3GXIA 2WWDA 5BXTA 1W1PA 3AIUA 4PCTA 1QBBA 2JFEX 3EMQA 5A8OA 2OYLA 4YN5A 3KE0A 4GI6A 3GDBA 3KL3A 4B15A 1UWSA 1GOIA 4P7RA 3TA9A 1CXLA 1QNPA 1V08A 1JI2A 5A6KA 1R8LA 3WMSA 1KXVA 1J10A 1MW1A 5IHRA 4FLQA 1OINA 3VD5A 3PZOA 3VMNA 2OSYA 1GQJA 3AMGA 1UR0A 1LQ0A 1IT0A 2E40A 3AHYA 1C90A 2CHOA 5AY7A 5CJ5A 1QI4A 4CVWA 3EBVA 3KL0A 2Y24A 1BSIA
chains in the Genus database with same CATH superfamily
1H1NA 2YBUA 5JXQA 3ES8A 1CNVA 1UUMA 5IDIA 1GPFA 4PRWA 1XRVA 3KCLA 5A6BD 3OJGA 3C0JA 3W7CA 4OBTA 5CZTA 2BOGX 1W32A 2VX6A 4UMBA 1UKSA 4AG0A 3RCNA 4YMZA 2D22A 3D5HA 4XKYB 3ANUA 4YVVA 4IICA 3L4UA 1JFXA 3A3HA 3W7DA 2VR5A 3CUGA 4BS0A 1JEZA 2O55A 3PUDA 3GR4A 3PY2A 1EPXA 1WDWA 2FMNA 2QT3A 2YL9A 2E68A 1PIIA 3W9ZA 2OYKA 4JYEA 3LX9A 4DO4A 1MNZA 2I14A 3CZ8A 3QN3A 1IR1A 1ISZA 3C3UA 4I9TA 3IJDA 3M5VA 1UPMB 1SFSA 1YDNA 3MZ2A 4GO9A 1RLDA 1WBHA 1XYZA 3U2ZA 3EZ4A 4WDUA 5FL0A 1S2VA 4F0MA 1T8XA 2DZUA 4NZJA 3HB9A 4W93A 3TUUA 2WQPA 4LUYA 3FXGA 3WYZA 3VGDA 3UERA 3R0UA 2OZ8A 1XW8A 1DYSA 4XZLX 2I5IA 1L9WA 3VK5A 1BEUA 1UKPA 7PTDA 3T8LA 4D72A 2FPTA 1FBAA 5D2XA 1Q65A 4LB4A 5DRIA 1FWEC 2QJMA 5C6MA 3I7QA 3SGZA 1U1UA 4Y9AA 3MMWA 2PC8A 2D3NA 4QDWA 1CEOA 5MHBA 3BCDA 4LJ3A 1S5WA 4IGNA 3W00A 3C2EA 4DB7A 3RMJA 4S23A 4Q8WA 2ZC8A 1F3XA 3N2TA 4OBSA 1H60A 4KFOA 1KLYA 3P80A 3IIVA 3CPGA 3DESA 4HVXA 4JKLA 1M5WA 4Q4OA 4K39A 2OOGA 1XL9A 5G1TA 3CL7A 3BH4A 3IJLA 3ME3A 3N1AA 3Q2DA 4O1DA 4CKQA 2BY3A 3M16A 1F4AA 1LROA 2NWSA 2OU4A 2P3EA 1NDWA 4H1ZA 2G3MA 3FJ4A 1F6PA 1V0KA 5EJ1B 2Y0FA 2E28A 4Z2JA 1JZ5A 4D8AA 2GZXA 3GKFA 4GRSA 2CITA 4YL2A 1POJA 3I68A 2ALRA 4MMWA 2XFFA 5ABFA 4HCLA 4P8XA 2ON3A 4JX5A 1MFVA 1KM0A 4ZODA 2F7FA 3WLJA 3R11A 1FHLA 1FHUA 5A6AA 3TEVA 1XLKA 1UR1A 1GZGA 2PD5A 5A6TC 4JS3A 4WJXA 1SYTA 1IZKA 3PG8A 1K3UA 1IEVA 3N2XA 1OWQA 3NJ3A 3KHDA 4GA8A 3S2MA 3QOKA 1BD0A 1DWJM 5C54A 4ONVA 5G2WA 3BWWA 3WLNA 3TSMA 5MKGA 3FGCA 1BLIA 2D69A 1E9YB 1QHOA 4R88A 3FJLA 1PB0A 2V81A 1ZU8A 1VH7A 4O8AA 2YL6A 2PBGA 4H9XA 2ZZ3A 3NURA 1F73A 3EOLA 4CNSA 1ICPA 1LQ2A 1UR2A 1WE5A 1ZBKA 3T07A 4JL1A 4EXBA 3HMCA 3QVQA 4HZMA 3POHA 4XZNX 4KEUA 1HNYA 1GTHA 4ZO7A 1XSKA 1GVEA 3UZZA 3UVIA 4XQ6A 4Y6GA 3B8IA 4DZHA 1QI5A 1WKYA 3VYLA 5BCAA 3P62A 1GVIA 2R8WA 3NQDA 4HU0A 2PBOA 4Y7EA 2Y6ZA 2QUVA 4TIMA 2VC7A 3GC5A 3GXNA 3Q67A 3EWUA 2QGYA 4S3EA 4J5NA 2OEKA 1P6WA 4CNUA 1I6NA 3W38A 3WCZA 3LK6A 3QLLA 2C8NA 4KIEA 3UG5A 1HIZA 1U5JA 2DUZA 3TAOA 2G0WA 4H01A 4UOZA 3BMVA 1HVXA 1IQ8A 3PM6A 3APGA 3UETA 3PS7A 3VD9A 9XIMA 3KVMA 2GSEA 2QPUA 1MO0A 4MYAA 2Y5SA 1VCVA 4QITA 2WHLA 4Z08A 2OKOA 2ZZ1A 1JF6A 5FA5A 3HFYA 3K5XA 2QV4A 3QZ6A 4YVPA 3LI0A 1S5MA 1EL3A 4IF2A 1RJPA 3AHZA 4DM2A 1R7OA 5D30A 1XQLA 1ZB5A 2DVXA 4OVXA 3TA6A 1XLGA 1H11A 3P8IA 2PCQA 4GIRA 1MXSA 4UTLA 1YNQA 3TR2A 1KV8A 1GYLA 4IJRA 3U4AA 1W5OA 4W86A 4B9YA 1U30A 2BS9A 3D47A 1W5PA 2AL1A 2IUZA 3O8AA 4EAMA 1JD7A 3SN4A 4IP4A 2DZSA 3E38A 3EOEA 3EWWA 3LGEA 3O0FA 1DJQA 4HPXA 4B3ZA 3WENA 2XVLA 4HZ7A 3VD3A 2X41A 3B4YA 3BUVA 4LAZA 4JBRA 3T09A 3N4AA 1WA3A 4O1CA 7A3HA 3PK7A 1VLWA 1RH9A 4IPIA 2YFOA 2J77A 3BLKA 1I2NA 2DT1A 3G1SA 3UGVA 4B16A 3T0CA 1JZ6A 3WQPA 2NT0A 1ZBVA 3GIPA 1NQKA 2X42A 2PC4A 5E5CA 1TV3A 3SADA 4DI9A 3DGRA 4NZ3A 1E70M 3ZWSA 5LKYA 2NV1A 3SGGA 1LRNA 2QJGA 4WDTA 2XM1A 3VDGA 3QSRA 3IJIA 4MY9A 1YNYA 1OIMA 2YCIX 3TOYA 2QF7A 4XISA 2PP3A 1KB3A 3VABA 1GT8A 4FNRA 3ZVHA 5ABEA 4PYSA 3EGJA 3BQ6A 1SZFA 3E2SA 3EWBX 3WFLA 1J96A 3S2LA 3S3GA 3BXWA 3TXZA 4LS1A 2O92A 4HNNA 4GC4A 4INFA 5I07A 3HGRA 2ZTKA 3DFNA 3FSUA 3QFEA 2W5FA 3W7LA 1KTNA 4W8LA 4EKJA 2J74A 3TW6A 1CLVA 4U4MA 5FSEC 3VIKA 2NZLA 1CCWB 4PFMA 1B4EA 4HYVA 3ARXA 3U48A 1LRTA 4FXJA 2ACUA 3ARYA 1UR4A 2DIJA 2EO7A 1W8SA 2YA1A 3PWGA 4IJBA 4LB3A 4PTDA 4MHBA 1EOKA 4G7FA 1YDOA 1EGZA 4H83A 1VJIA 1XYMA 1GVOA 5KEZA 2E25A 4GD0A 3M0KA 1GVFA 4GPNA 4Y90A 3NAVA 3QV7A 2CC0A 2VQUA 3CZGA 1W1VA 1M1BA 5CGQA 5D9OA 1LOQA 4TVUA 1TWDA 4N4PA 1LL7A 1J12A 4MZ1A 3CWOX 3UWUA 3N04A 4MNJA 1T41A 2V82A 4IMDA 4RE4A 3IGHX 3QF0A 4W85A 3G8RA 4GIAA 1NVMA 3EWDA 4RZ6A 5FJUA 3E9AA 5B80A 1EJSC 4US5D 1B31A 2AKMA 3AWOA 3T8QA 1TX0A 3QV9A 4XO7A 4KMQA 3HU7A 5CSYA 5AHEA 1ZBWA 3PUGA 2A21A 1UR3M 3GR8A 3O2LA 1YXDA 3LPOA 1ZBCA 4EP8C 3VCRA 4TTGA 4GYPA 4FHAA 3CQIA 2I17A 3BLLA 1XRTA 3V0TA 2E8ZA 4M19A 1J9YA 4AVFA 1WUEA 5HMSA 2ZADA 1Q6GA 4GH1A 3RU8X 1K77A 3LNPA 1WDPA 5BMWA 2I9UA 4G7EA 2GJXB 4AD5A 4DJFD 3D0CA 3IVUA 1Q6EA 5CSSA 3H24A 2AAAA 3WLMA 3B05A 4HJFA 4WSJA 3LU2A 3LGGA 3W7OA 4DNHA 4S1FA 3NWRA 3MUCA 1EUNA 1GKRA 3CMFA 2W67A 3PNUA 4A21A 1M7JA 4BI6A 1X1OA 1RCQA 4O11A 3W3OA 3LLDA 3QYQA 4I9AA 3FYOA 1SFJA 4CLMA 3PZNA 1DTNA 2TRSA 3LBCA 2YDSA 4MY1A 1HF6A 4MJ2A 4BQ4A 4JTRA 1YBQA 3UPMA 1HL2A 2WC7A 3NXFA 1E6RA 4XVEA 5H6HA 2QZRA 1Z69A 4GX8A 4HMDA 1UZ1A 2P0OA 3OG2A 3FJNA 1E4LA 4GXMA 5EFFA 4AUBA 3MUIA 4CQ9A 1G4SA 2DW6A 1JZ2A 1KGUA 4MVAA 3W87A 2XHYA 3GNPA 4ZFCA 1WOAA 4L4MA 4O1FA 5GNYA 2XU2A 2PWVA 4CN6A 5D2YA 1HKKA 5DMMA 2Z2AA 3BAYA 5AHIA 1NDVA 1KRBC 4QJ5B 2PFHA 2VELA 3A5VA 4AQLA 5L6UA 1K8XA 1KRCC 2WJFA 4RLIA 4GBDA 4PMDA 2DIEA 1FWBC 3DC8A 3WQ6A 1SW3A 3N3MA 1MW3A 5C8BB 1S3TC 3C8FA 1B3XA 1D9EA 4K8EA 4XAZA 1ZAIA 1TIMA 5AHFA 2VC5A 1KBKA 1OFRA 1JZ7A 5I09A 3B8TA 2H8XA 1VBRA 3VNLA 1DXIA 2XIQA 3CL6A 5A6SA 3LRKA 3G18A 4KETA 4O28A 1JZ4A 2BXZA 4IISA 3UZJA 2FPYA 5H8PA 1XFBA 4D6JA 3OVQA 1VPQA 4H2HA 3CUHA 1XG4A 3AIRA 2JGQA 1IEQA 3ZIZA 3G3MA 4O0ZA 1LLWA 4IJCA 4X0NA 4ZOAA 5SWUA 5M5DA 3HQNA 1VZWA 2R24A 3M64A 1DE6A 3MMTA 2ZZ4A 4G8TA 2PZ0A 4QG6A 3S1UA 1PHQA 3WJYA 4KEZA 4M51A 1AFSA 1E55A 1V7YA 5HPOA 4GQ0A 3OBKA 3T55A 4QJ4B 2WBGA 2XH4A 2Q71A 2NX1A 2QUTA 4YTQA 2CFFA 3BW3A 4UTHA 2F2HA 3AIEA 1NAL1 3E5BA 1YYAA 1SO4A 1L6GA 1GOMA 3KOWA 1M9HA 5KTLA 1AQMA 3GTNA 4TTUA 4NKCA 4LWWA 1NEYA 4H04A 4V1YA 3UBPC 2NQZA 3PJTA 2G5WA 1MZRA 3CQHA 1W54A 2R6OA 5HXMA 2VR2A 5MF5A 1KCZA 3A24A 3EB2A 3RF9A 3FVDA 1XLHA 3WNOA 3S46A 1RY0A 3GKAA 3OQEA 1W17A 3VDHA 1PEZA 4V2XA 2XPKA 5DY2A 1KFLA 4QSFA 3SBFA 2OLHA 3OHIA 4XTDA 3AMKA 5GVJA 3W26A 2CEQA 4AIEA 3BCJA 2V2HA 1OFEA 1TTPA 1WBJA 1ZNNA 5KMYA 1CGYA 2CXGA 2VGGA 1FDYA 3NM3A 3MS8A 1FCVA 4JY9A 3T78A 4RDVA 3CHEA 2XFYA 4OQVA 2NV9A 3WD4A 4KFPA 3UZWA 1KM2A 1NARA 4GK8A 4A22A 1SMAA 4BF5A 2W9MA 3AFBA 4I8YA 2WKGA 4H7ZA 3I7SA 3QMTA 1OYCA 5I78A 3U5UA 2EGZA 2VRKA 4QG9A 2QQ6A 1REQB 1XLBA 1VBGA 2ZA2A 4E2DA 4ZTYA 4L6DA 4FXFA 4R33A 1E9ZB 2O4MA 1Q6OA 5TNVA 2ZIDA 4Q8PA 4O16A 4L9ZA 3LRLA 2RJHA 5E6YA 4LYQA 5H8MA 4D6IA 4TVCA 2X05A 2PUZA 4S3BA 2C71A 1DWHM 1XYAA 4R3UA 1YXYA 3WDJA 2VUYA 1T99A 4JTKA 1R3QA 4REQB 1US3A 1GYMA 1T5AA 3VIMA 3BARA 4JGDA 4G5DA 2HEJA 2EG7A 1X1ZA 1LBLA 4NXKA 1UD8A 4HA0A 5BU6A 1GUVA 2AOSA 3MBDA 1ELSA 4UTWA 2NXGA 4RJEA 4LW7A 3ZOAA 3M0YA 1TUFA 5GJPA 1GHRA 2VC9A 3SCQA 4CEXC 1S46A 3WH7A 1JL8A 3WLIA 1UQZA 2Q8ZA 4H9VA 3FEMA 1S39A 1DJYA 1KRMA 4ERAA 2Y8KA 4NQ1A 1QPNA 2DT0A 2GJNA 4MB4A 1RY8A 4HBKA 1M04A 3SFWA 4FF7A 3VXGA 4CN4A 4ZEPA 2PWUA 3G1YA 4B4FA 4DWSC 1IEIA 5IOBA 3H7VA 4J9JA 3LUTA 3APYA 4DF1A 2ANUA 1V7AA 1AQHA 3GXFA 3S1GA 5DN1A 4GQQA 1GW9A 3M07A 4Q32A 4ORIA 1P0NA 2A1YA 3W0KA 3STPA 7REQA 2RKXA 1JCXA 4LBRA 3WQCA 2ZDSA 2YYUA 3POCA 5AZ1A 1QNSA 4ACYA 5FKYA 2XN1A 4LC6A 4AD1A 3WMBA 4TMCA 3GXDA 4Q4PA 4XK2A 2I57A 3PZGA 4CVUA 4AIUA 2QCNA 4PMQA 4UXDA 3UT0A 4ZB0A 4MM1A 4DWSA 5DT7A 3SIMA 4KQNA 4BQ3A 3HPXA 4HU4A 1XIGA 2H3DA 2GFTA 2A7RA 3MKCA 3N3TA 3BAIA 6XIMA 3N9RA 3UNDA 2D2OA 2PDCA 2GSJA 1UASA 3AJXA 3BOFA 4WY0B 4QX4A 4MTVA 4JTEA 1IGWA 1TSIA 4G6CA 5G4HC 2EQDA 3QHOA 3KTCA 3LMYA 3A12A 1X38A 1TIWA 3O07A 4A3YA 1V6TA 2WWCA 4FNQA 3C3NA 3BG3A 1O1ZA 2INEA 3P0XA 4QROA 3WK3A 1X8FA 4F2TA 2FMOA 5D05A 3LM7A 1DIKA 1R3RA 3QR3A 4NXSA 5EMKA 3SRKA 3UWZA 4U10A 3II1A 2ONEA 3AICA 4MFEA 4JEQA 4ML9A 3GG8A 1OF6A 2XWDA 1O5QA 2WHMA 3URBA 1YX1A 4UZSA 2DZWA 2XGZA 3F4VA 1T0OA 4PULA 3D3AA 4PB4A 4GVFA 3RMEA 1PPIA 3SSZA 1KWKA 4Z2KA 1IZJA 1UWIA 2E9MA 2J7EA 2DZBA 3TAKA 3ARSA 1EZWA 1GG0A 3V16A 4AZCB 4Z2HA 3NPWA 4W8AA 3TYCA 1WQ5A 3BPWA 4IMCA 5JIWA 1AJ2A 5CC7A 3NVTA 2X1SA 2QJJA 2YOCA 5D37A 1T6MA 5KZ6A 1FFRA 4AWSA 4CQ8A 4K1GA 4HSHA 3C0SA 4Q8UA 5HNRA 1OC7A 4N9DA 5FAJA 1J0KA 4B9ZA 4DQWA 4LYKA 9CGTA 4HK5A 3WF3A 3QZEA 1A5UA 1C8QA 1UWQA 4E2BA 5AYIA 4M56A 4EWND 4QE1A 1EBHA 3IV3A 3S5OA 5DRCA 4HP5A 1MSSA 4JR5A 4JIPA 2QCDA 3K8MA 3GNDA 1XHGA 2YR1A 4RUBA 2I5QA 3G1AA 2CKSA 4N9EA 4QNWA 1VS1A 4ZO6A 3HO8A 4DPPA 3THAA 3RCYA 5KITA 1PX3A 3HOJA 3CZLA 1R9XA 3DFHA 2DP3A 2YPIA 1W1YA 4BK9A 4CUCA 3THCA 1KTBA 2DJXA 2ZUTA 4K7YA 3O06A 2EKCA 4C6OA 1JNDA 1AG1O 3NZQA 3N12A 2WB5A 3BG9A 5G1YA 2W6RA 3IVTA 2PDJA 2ZUUA 4CCZA 2HJPA 4C6BA 1JYXA 3OVRA 4REQA 4PZVA 5HA7A 5M03A 2JQXA 3G6LA 5IBXA 3B0YA 3TN5A 1LG2A 1L2UA 4U5KA 1LUCB 4DYEA 4B3KA 1E71M 3H12A 1KBLA 4GI8A 1TPH1 4XV0A 4JTHA 2E6DA 4AXKA 2KAUC 1E43A 1K1DA 4JTUA 4L61A 5DXXA 3P82A 1TFVA 4WY0F 1HW6A 2Y61A 3HGSA 5A6BA 4O0KA 2ZUWA 5BYWA 4IPNB 4HU3A 1BWKA 2FZNA 3ABRA 3QV8A 4BEQA 1NF0A 2G95A 3VGBA 1L8PA 2GVYA 1UZDA 4AY7A 2EPNA 5HOSA 2P10A 4P2VA 2NQJA 4DWSB 1QW8A 4BR1A 3SGUA 2RUSA 2VZUA 1LLOA 1WDQA 3W7IA 2Z6JA 3M0XA 3GVRA 2P8CA 4PUWA 2XIBA 4UQ9A 3F2BA 1W5QA 3LN3A 5JBDA 1V5XA 3VO0A 2C1IA 4PUEA 4DF2A 3DECA 3L0GA 3BW2A 2HV5A 2PGWA 5F2MA 4ATWA 4P8UA 1LBMA 4UTKA 6REQA 2J66A 4LV4A 1QNOA 1Y5XA 1PTGA 4F0KA 1U5HA 4PA8A 5GPRA 1I2PA 3RJYA 4LVBA 3GG1A 4GLEA 1M65A 3WJZA 3BSGA 1WV2A 1TTIA 3IK2A 1HGWA 4UFJA 5HANA 4HN4A 1KXHA 2BDQA 3H23A 4FX6M 2BOFX 7ODCA 3MKKA 3NCOA 2PS2A 2BZNA 5G4WA 1TELA 2GOKA 3NQ8A 4CD6A 4GI4A 1XLCA 3SCNA 3LCWA 3W2JA 2I5GA 2EBNA 1L8NA 1XJBA 1P4CA 3CB8A 5EBUA 1EWEA 3KTSA 3SUWA 2NVAA 3TN3A 4AWUA 1VQTA 1B30A 2WSQA 3UG4A 2BX7A 1EB3A 1GGOA 4O1AA 2E6FA 2F6XA 2VD9A 1OK4A 1X8CA 3UG3A 1I1WA 4NX0A 2WVTA 4LUIA 2BGNE 3ARWA 2QYGA 2WBKA 2W91A 3LHYA 3UJEA 1L6FA 1WYIA 3KDNA 3W83A 3H26A 3WX7A 2VCBA 1M03A 1OX4A 5CBJA 5D04C 4DYKA 2Y2WA 3T0BA 3AXMA 4H19A 4RZ5A 3R0DA 4QNEA 2HBXA 4DBWA 1EIXA 2NLYA 4F3HA 2WMGA 4DUWA 3VOJA 4XD6A 3NO5A 3LNMA 4QEEA 4QSHA 1MFUA 4ZFMA 4ZBCA 3HFTA 1W0MA 5TF0A 3PHAA 2HDJA 5JVLA 4HKPA 5MKGB 8RUCA 1A0EA 2O9PA 4RNFA 1OFPA 3DIPA 1H5YA 4MPKA 2AMGA 3L4TA 3LTPA 3ENLA 3GTHA 1UA3A 3FYPA 1G6CA 4CD7A 3NNTA 1F61A 3VNDA 8CGTA 1S1RA 4HIBA 1VYSX 3HQOA 4AW7A 4F4RA 2Y70A 1A4LA 1QCWA 3QM3A 3OZOA 1P0BA 4J3VA 4L64A 3W82A 4M6QA 1IWBA 2IKHA 3RGTA 3JW7A 1UYQA 4QFUA 4HPHA 3I6TA 4NIRA 1LZOA 1M53A 2VRJA 2HVNA 5EY5A 2OGYA 4XZWA 3CH0A 1JQVA 1C8YA 5HK4A 5HATA 2C18A 1F3TA 2F6UA 1HXJA 3N6QA 4PUKA 3VI2A 3WEZA 5FF4A 1S2TA 5CG0A 3MP3A 1HJXA 4E8GA 1TJ1A 2PDFA 3TR9A 4C7DA 1SZNA 1XGZA 2VVNA 1BVWA 3QEZA 5FF7A 2FFIA 5HAOA 3Q45A 1MUWA 3H2OA 4B3LA 3FAXA 1LCOA 3TK7A 2TSYA 3L0NA 1VPXA 1FDZA 4QP0A 3GVQA 4W89A 4KIRA 4S3GA 3NZGA 3A22A 8TIMA 1CECA 2WCAA 4HK7A 3EB4A 4LU0A 1R2TA 1Z9AA 2WSYA 2WC3A 3MKVA 4I6KA 3GD6A 4KESA 5BWFA 3CGTA 2DQXA 3ZM8A 3H2CA 1TZZA 1TRIA 4YHGA 3UP8A 3R5EA 2CWNA 3IAQA 4ZO8A 3UJRA 5I6SA 4X2RA 1B3ZA 1Q45A 1XLEA 1XSIA 2YLAA 1QO2A 1XBXA 1YKWA 2EG6A 2VX5A 2OSXA 3HV8A 4RDZA 1GJUA 3E0LA 1UC4A 3WNNA 1US2A 4MOZA 3RXZA 3N13A 4X9YA 1O5KA 2YX0A 1XXXA 3H2FA 1TPFA 5CEWA 4H2CA 4GINA 1K9TA 7ENLA 2PWEA 1E1CA 2CYGA 2OZ0A 4ZVJA 4DO6A 2OXNA 3ITTA 4JX4A 4NP7A 3TWAA 1E6ZA 4ERIA 2X1IA 3O16A 3SECA 1JUKA 3UXLA 2V69A 1OX5A 1XIDA 4A05A 4KH2A 4I5UA 1DHKA 4ICNA 1PDYA 1OF8A 1EA9C 3WBAA 1XM3A 4KFNA 2XH2A 2AKZA 1F76A 1ZJBA 4XTIA 3H2MA 1PO9A 4QISA 1F4HA 4IQJA 5LNWA 1RZMA 4AB4A 3TQKA 3WLPA 1FCQA 2CLFA 1QBBA 3TU9A 5HWMA 1XFCA 3KL3A 4QJ3B 5EMUA 1JI2A 2DV0A 1J10A 2PLKA 4FLQA 4HNOA 3W2LA 1UR0A 1XIJA 1UBPC 2QDDA 4M1BA 3GDTA 2BVWA 3KVJA 2CHOA 3R89A 2V9DA 4CVWA 1PV8A 3P14A 2B7NA 2Y24A 2D24A 4D6EA 1CDGA 5CAKA 3RPDA 3IIXA 3W1AA 4LGXA 1Z89A 1CIUA 5G4EA 3ANVA 3VIOA 3FFSA 5I00A 3PVFA 1ZQ5A 1KXTA 4HMEA 4A8NA 3WLSA 3W37A 5F4XA 1MW2A 3Q58A 4NAEB 4F0RA 3PTMA 4ZE5A 4MDOA 5CZ0A 1C9DA 3EWCA 1T7LA 3N2CA 3N73A 1PSCA 2WSPA 2D2GA 4GIYA 3NL2A 4BI7A 4IX0A 1NJJA 4S3CA 4DY1A 4Y2WA 4LY4A 3UR7A 3OVPA 4UR8A 3TE9A 3T2PA 1UJPA 3ONBA 1JDAA 4Q4SA 4ALDA 4WSHA 1EUAA 4R9XA 3VINA 1TTJA 4EPKA 4PMUA 3CMJA 3L2LA 1OFQA 1SUXA 4LCQA 2GJLA 1LRQA 2DIKA 1K02A 2VZSA 3PSVA 1QHPA 2OLAA 4B5XA 5LA0A 3JZUA 1JXJA 3KDOA 3LA4A 1J79A 2R1PA 1AJZA 3WD2A 1BSLA 2GYIA 4V1XA 3TX9A 2E9LA 3VNIA 1H1YA 1LWIA 3L4XA 3U4FA 4XKYA 3PZMA 1KFEA 2C1GA 5I3HA 3STFA 5IM51 2PE4A 3AXHA 3MHFA 4ZXOA 4HHPA 3G0XA 5BZAA 2FVMA 1NU5A 1EHNA 3LSCA 4QXIA 3ALGA 4D1JA 3RITA 2V8ZA 3ONCA 2HWGA 1SFLA 4DBSA 5C70A 1GORA 1BXNA 2Z2UA 1J2BA 3UZYA 3PANA 2P0IA 4UTMA 3DDMA 2BVTA 3W81A 1RALA 3CUFA 5LNSA 1WZKA 2E9BA 2VDIA 1SZGA 5JU6A 2FVLA 4IQEA 1PVNA 3QJAA 7CGTA 2A7PA 1I4NA 3B9NA 3G1VA 1OQFA 3CV2A 3LBMA 2CZEA 3KBMA 2QMKA 4KRZA 4HNLA 4KCTA 4JNMA 4FNPA 2Z29A 3LGDA 4S3AA 5DBUA 1A5AA 4AEEA 5BWAA 4X22A 3U2OA 2WNNA 2OWXA 3GB6A 4I7UA 2IKIA 1K4GA 1EEXA 4F2UA 4HYRA 2GDVA 3CM4A 4J1OA 3QHNA 2PZNA 2HZGA 1MMFA 3AS3A 1SVDA 5FJJA 1X7IA 5DX7A 4KRTA 2JKPA 4J28A 1V51A 2EEXA 2JKAA 2W61A 3N14A 1M3UA 2J7GA 1QO5A 1A3WA 5K9CA 3NPVA 4IFRA 1A0CA 4DLFA 3LQGA 1KM4A 1TTQA 3AYSA 2V5CA 4PUUA 1H7OA 3W1RA 4ACZA 1DVJA 2PWDA 3MW7A 3P2VA 1X39A 4H6EA 2ZFAA 4U3CA 4GOAA 4PN2A 1FWNA 1KLZA 1KBIA 1JUEA 3PJXA 5ABHA 5HUPA 1J8VA 2HNEA 2WLZA 3PBWA 5A8NA 1VYPX 5KZDA 3GXMA 4ZOCA 3W02A 2YBVA 3DOPA 3WELA 5XIAA 1CXKA 2WCGA 1TZ9A 1F9CA 4EXQA 3LPFA 1CXFA 3RU6A 3B4UA 1FA2A 3IIPA 1PYFA 2XIIA 3LDVA 5D8ZA 1ML1A 4A3QA 5F7UA 1CPUA 3VVGA 3EOUA 3NL6A 1VAHA 3O05A 1UP0A 3PPCA 1B90A 4U3AA 1ADDA 3DFTA 1ZCOA 3LHTA 2ZWYA 5G2IA 4GCAA 5AYZA 2VGBA 4F79A 4JIRA 4OZOA 4OIFA 4ENLA 2VI0A 1A80A 2Q8XA 1WP6A 3VGHA 4TMBA 1E5JA 3E2VA 4RR4A 3BLIA 1TKKA 2I1OA 2E0PA 4E3TA 1TPDA 1HTIA 1EDQA 4HB7A 1QNVA 4JN8A 1UD5A 3SCPA 4QQUA 4HK6A 4K68A 1GZ1A 1C3FA 1Y5WA 2JKEA 3TJLA 3S5YA 2Q3OA 2ZZ2A 2Z1BA 2NSOA 3KLKA 6TIMA 1TX2A 4FB7A 2EAWA 2X7VA 3S9IA 3PN8A 1I1XA 2NSXA 1GTEA 3GTIA 2CNCA 4H3DA 2HPMA 4MNKA 3WBXA 1PKLA 2PDPA 4UBPC 1KWGA 2E4TA 3G1HA 1WOBA 1EH9A 1LOSA 3OYZA 1DPMA 1LOLA 2QPXA 3A9IA 1Z8AA 4R9OA 4JPGA 2ZRUA 1PBGA 1E6PA 4CCEA 4A3HA 3VD4A 4D1IA 2QS8A 1R3TA 1TPVA 3T08A 2GUUA 3BGJA 3HJEA 5CLTA 4PSPA 5AKQA 3FN9A 3VCNA 3PFRA 3R2GA 1ONXA 1VCFA 4DZIA 1R9ZA 3RYSA 1OCBA 5E1QA 1KCKA 3NIYA 4CQCA 3M6YA 2A79A 3MP4A 3RLHA 3FOKA 2DH3A 2WMFA 4BQ5A 2J13A 1JAKA 3TJIA 2QUMA 1Y5VA 1C92A 3NDOA 1SR9A 5CQ1A 1JULA 1ZAHA 2VX4A 3QY8A 3N2BA 3V5CA 4GXPA 1EYWA 2FZ8A 3UNTA 1RPKA 3IACA 4CNNA 1XBZA 1ZGDA 1B3VA 3CU2A 1PUDA 1IWAA 3LM3A 2QVHA 3P74A 1ZY9A 4NASA 2V3DA 1H41A 2EPOA 3GTXA 2UY3A 3WBWA 3AYTA 1LLZA 4ZB5A 3K46A 1I75A 4B5WA 1GEHA 3H2AA 2BXYA 1AH3A 1KW1A 1K9EA 1PKMA 2C1HA 1SMDA 2ZE0A 1L6WA 3CWHA 2VJXA 1OM0A 1S5TA 3L23A 2PTXA 4KPLA 3S47A 4AMAA 1HKMA 1Z7AA 4HA1A 5CJNA 3NPXA 3BICA 4N2YA 5A6MA 5L9FA 4QR6A 4O4WA 3NQ2A 2OWCA 1HJWA 2VFGA 2PEVA 4J35A 3TYEA 3MVIA 2QF8A 2AGKA 5ECVA 3CB3A 2V6AA 2BHYA 1HO1A 4JQAA 4O53A 4DXVA 1G69A 3BDKA 3BZGA 1E6SM 4DO7A 1G67A 3E0VA 4LEFA 2BXVA 1X1NA 4QS6A 1TA3B 4NZ1A 1GQNA 1R2RA 2V3FA 2VDHA 5C9XA 1M01A 4C6NA 3SM0A 2PDYA 3PPHA 1Q6DA 3WFAA 3HPZA 5T9CE 3E0FA 4FXSA 2F8QA 2OSWA 2UWFA 4WD0A 1OX6A 3G1XA 2Y7FA 4GO8A 3M0IA 1A47A 4Z2LA 4HSNA 6CGTA 2PDQA 1YDYA 2ZKMX 3TFCA 2YSWA 3W6LA 2EG8A 2OQLA 2DZAA 3RX4A 3FA5A 4NUWA 3SO7A 1US0A 3RDKA 1KFJA 1YTKA 3NO3A 1XRSA 4M6VA 3CZJA 4GUJA 2YBTA 4OJYA 1C7SA 3K1GA 1H7NA 3AS2A 4H7VA 1CLXA 4HGXA 3OU8A 1JNEA 4RZ4A 1KQYA 3QBUA 4MJMA 1KFKA 4S3DA 4F0HA 3S2JA 1CI1A 2CBVA 3H22A 4UC5A 5M3WA 1JPHA 1Y0EA 3VNMA 4TR9A 3WLKX 1LWHA 3KP1A 3PUOA 2ZXQA 3MP5A 3PPGA 3UFYA 1E6NA 1I9CB 2CZDA 3WY1A 4P5UA 1XLFA 6XIAA 4O18A 3KRSA 2ZZ6A 4GUIA 3KL5A 1U5VA 1OSEA 4EF8A 3EMCA 1S5VA 4IIFA 3EX2A 3TW9A 3REQA 3UYCA 3NEHA 3AWNA 1E5NA 1RA0A 4DAIA 3QR0A 5EMJA 4AD0A 3M41A 4FR6A 3EOOA 4AX7A 3DH7A 2BOEX 5CC3A 4WSKA 3VX0A 3I7RA 1BG4A 5DCEA 2PU1A 2GGJA 3GWQA 5TIMA 2AGTA 4IPLA 2V3GA 1F8IA 3O63A 5DELA 5IBXC 3ZSSA 5PTDA 2Y88A 1A5KC 1XWYA 2ZC1A 1XIFA 3LPPA 5C9WA 3PAJA 1VBJA 1CB7B 2EPKX 3UXKA 4MWAA 3VC5A 3E0WA 4B5SA 5ABFB 1KCLA 2VMFA 5DO8A 1DL3A 1MZHA 1K6AA 2BGQA 4TX6A 1V3LA 5EA9A 3PZIA 2GSHA 2ZX9A 3G24A 1DHPA 4MNLA 4F8XA 1D7KA 4G56A 4NZCA 4C1LA 1JRBA 2Z26A 3FDGA 3M47A 3MWAA 2VKZG 4PMRA 5FJTA 3QPZA 1NOWA 4MDPA 4DVOA 5LGZA 1G9HA 2YA0A 2RJGA 2OG9A 5E0KA 4A3RA 4GJ1A 1ODZA 3K30A 5FEPA 3UYIA 4PBGA 1KM3A 4PUNA 2PDBA 5HWJA 5LIYX 3R7MA 1L0PA 1RCOB 3WDPP 3EA2A 3N25A 4ADUA 3XINA 3VDCA 3LXBA 5I03A 2C0AA 3H53A 3PBYA 3CLWA 5TQLA 5LHEA 4IMGA 3CTTA 5T9BG 1XG3A 1OYAA 4L1WA 4OV9A 3OLIA 1VFMA 4W5UA 2AQWA 5GJNA 4OOZA 5LXEA 4O1EA 4YTTA 4JTDA 4DN1A 2VFHA 2MANA 2VEPA 3VKKA 2PDIA 2VNCA 2YL8A 3W27A 3NA8A 1VFUA 2E5DA 2OCZA 5I7GA 4DBDA 5I3IA 1DIDA 3OGVA 1PL9A 4AZ6A 3QV6A 1JF5A 3LHVA 4Y9PA 3VZYA 1CGWA 3TV8A 5D4YA 3V1PA 3HURA 2NXHA 4IQLA 2NLIA 3T7VA 3EDEA 2XN0A 5C9RA 3A47A 4CD5A 3NUKA 2CLHA 3QYSA 1ADSA 1ECEA 3UR2A 2BNJA 3BJSA 1W9UA 4KW2A 3S6TA 3AIBA 2OO6A 3ARTA 2YW3A 3EXRA 3EDKA 2FZMA 2FFCA 1HKVA 1EF3A 3SY8A 1E9LA 2D0FA 5M2FX 1IXPA 1JDCA 3DFOA 4M6UA 4GZIA 2J79A 4UIOA 1BGGA 4HCHA 2FHFA 4LUSA 3STCA 1HJVA 3PTQA 3RIKA 1DTUA 4LYRA 3P61A 2VGIA 2DSVA 5A2CA 4DJDC 4HPGA 3OQ8A 4ZXLA 2G4JA 1DJXA 2DGAA 3VNJA 5DXYA 3KM8A 2IQ0A 1MYRA 1JCMP 1OFBA 2JBMA 3IK4A 3QPEA 3OA3A 4XG1A 1EHAA 1PZ3A 3EDDA 3SSJA 1EC8A 3IANA 4LFYA 1EKOA 1VBHA 1HFBA 3L2IA 3W88A 3UQNA 2GQ9A 1W9VA 1E1FA 4UQDA 2D0GA 2OFJA 3WSUA 3T2OA 1LYXA 5E0CA 3H2EA 3VIIA 3W7EA 2NQ5A 3NYZA 1VFTA 1A0DA 1B57A 1V6WA 2WYSA 3NXLA 1W9PA 2QDEA 3R43A 4W5ZA 4M6PA 1VIZA 4BEUA 4JQ4A 4J7RA 3WZ0E 4K6AA 3CMGA 4JEJA 3GHRA 3L5AA 4AHPA 1XIIA 3W22A 1NSJA 3V5FA 5AZ0A 3RO6A 4NJHA 3HTWA 4AZGA 4HZ6A 3E74A 2YB4A 5F4SA 3EA3A 3G6MA 4XUGA 1OGSA 3THQA 3WLRA 3NOYA 1PWMA 1U83A 4GBUA 3WH5A 3GYCA 1LL4A 4K8HA 4JAWA 2P8BA 5IFTA 2ZVRA 3G1FA 1EJVC 3TWBA 4LBUA 5K9DA 3EXSA 1TV5A 4I90A 4IM4A 2GVLA 2I7GA 2WKLA 1JCYA 3MPGA 4K37A 1HKWA 4Q3MA 3VPLA 4L7ZA 2CXEA 1H2JA 4O57A 3TMQA 4H9UA 2E77A 5HDRA 1W9XA 3C2YA 4Z2IA 1WKFA 3WMCA 3CS2A 2WVUA 5E93A 3QPYA 3SN1A 3LOTA 1FWFC 1R47A 2YA2A 2X1RA 1HJQA 5H8UA 3W28A 3BLOA 3NGJA 4IMEA 2HE8A 3OVGA 5EU9A 5E6ZA 4RE3A 2VO5A 5F2IA 4K1WA 2FTPA 4O17A 3GHTA 5A2AA 1Y8BA 2YXXA 2CBJA 3CWNA 4FI4A 1G94A 3IS4A 3VILA 1JFHA 1JGMA 3W1NA 4C7FA 3TC6A 4PTXA 3GNOA 1GVRA 2BASA 2DZPA 1T96A 1FH8A 3A13A 2OR2A 5M1TA 4Y9OA 2C3ZA 3AALA 1DJIA 1AMKA 1N8IA 2IPJA 5AHMA 1RVKA 5E9AA 1VD6A 4DZAA 3U0HA 1DXFA 4YHEA 1CGXA 3UA3A 4QJ1A 3KOFA 1TQXA 7REQB 1UJQA 2YGYA 3GH5A 3OZPA 4WJ8A 4PBEA 1NDYA 3NZRA 5GNXA 2YFNA 1ZP3A 3GH4A 4IFKA 3KOYA 1G4EA 1GW1A 1K7XA 4Y8FA 5RUBA 3GFZA 1D2KA 1Q8AA 2MUCA 3VAVA 5A94A 3UGRA 5AN7A 3F4WA 3FEQA 1QDSA 1RHCA 3FNDA 3QGVA 1EC9A 1RA5A 4NJIA 1LG1A 4P7OA 3BJFA 4RXFA 1X96A 5A6LA 3F03K 3RLVA 1U1HA 2WM1A 3MU7A 4IMFA 3GUGA 3ZYZA 2KX9A 3MV11 6REQB 1E3XA 1W3NA 2WNZA 1BRLB 1XLIA 4PEEA 1PCWA 3VTRA 4C6KA 4U31A 4FAMA 4S3KA 3E02A 3ZJKA 3EKLA 3HG4A 3CLMA 2O9RA 3GW0A 2G8ZA 4JICA 2QMJA 1KFCA 4QE4A 4XVDA 3MBFA 4LAMA 1SJAA 3URQA 2ZYFA 3UZ5A 3HIJA 3CAKA 4JOMA 4JN6A 1QPQA 2F2KA 1KRAC 1C8VA 1EJUC 3I4KA 4UUIA 5F1UA 1K03A 4KWSA 2Y1HA 4Z1CA 1RBLA 1V4YA 2L5HA 2UY5A 3QGKC 3C61A 3DYPA 3AZRA 1YIXA 4D71A 2VM8A 3BMWA 2EPMX 4DELA 1XGEA 1SO6A 1PKYA 3RN6A 3TNBA 3TTEA 3PB2A 5C9ZA 3R1ZA 2BV9A 3KS5A 3WJSA 4CNOA 2PF0A 2DVTA 3DAQA 3B9EA 3F5LA 2XIJA 2Z0IA 1NOFA 4MKSA 4PODA 1EQCA 2IPWA 3HGJA 3HZ3A 4E4UA 4QCEA 1TMHA 3W25A 3NPUA 1EXPA 2PODA 5ABGA 1RBOB 1GOOA 1GJPA 3LCFA 1OZMA 3FDKA 1XX1A 3LSBA 3KAOA 1HVQA 3UD6A 3K2GA 1ZP4A 3VKDA 2PDWA 3UESA 2NVCA 3L21A 1UWTA 4ICMA 4FMVA 3SQLA 1Q6CA 2QDHA 4HTBA 3AU2A 4F2BA 3SIZA 4EE9A 1PZ2A 2PRMA 1GONA 3NDYA 1OFAA 2ZUVA 2XSBA 2ISFA 3W7NA 4N6FA 1FWHC 2E8YA 1EC7A 2PMQA 3S5SA 3ZO9A 3GHSA 3QSTA 2G97A 4PMOA 4MG4A 1UPPA 4GNVA 3ZXWA 3L9CA 2C13A 5A8PA 1WKEA 4ATLA 3BK0A 2E5CA 2D3LA 1QOQA 4Z0JA 3WK2A 1WZAA 2VEFA 2B0MA 3WK1A 2FGBA 2VFDA 4QRNA 4JTIA 3KRBA 1QVBA 4L6HA 1GVYA 1K8YA 3AAMA 4D6HA 1FTXA 3OB8A 1KCXA 1UB3A 1XKJA 4IMAA 1ZL1A 3WEMA 3VC6A 4FPSA 1W2PA 3GSMA 1OD8A 3V0SA 3QMSA 3KHJA 4RXGA 1B2YA 2GGEA 1P5BA 2PWGA 3BAJA 1JPDX 1I45A 4G7EB 3ZR5A 3I3EA 1CYGA 3WDHA 3SI9A 5LIWX 2GGHA 4HA3A 1LP6A 5CJMA 5FJOA 1FKWA 1J2WA 4GISA 3ZT7A 4M7SA 4LVAA 1PS9A 3LI1A 1UR9A 3SEPA 4ZQMA 1ME8A 1J0YA 3N2OA 1R38A 4GWEA 1FXQA 2Z00A 1YW1A 1PXGA 2YLLA 5I3JA 1Q6LA 2FJUB 3M0HA 4DUVA 3M0ZA 3O1NA 2CBIA 1DQXA 3S9ZA 4PUJA 4XSLA 1IT7A 2HXUA 2Y7EA 4IWWA 1WZLA 2E67A 1K6WA 2GUBA 2PP1A 1QNRA 1O5RA 1SZRA 1R7AA 4GX9A 1VEOA 2CIPA 3ISIX 4QLKA 2CWXA 3HA1A 1CB2A 3C5QA 2PDKA 3TLLA 3VDBA 3V35A 3M43A 3TSBA 2PRHA 3ITXA 5BOEA 4GIEA 3GZAA 4GMEA 4A2SA 2VX7A 3LCIA 1P1XA 3BJTA 3M4HA 4UQEA 2W79A 4XKMA 1FRBA 1YADA 4WUIA 4ACZB 4P00B 1OT2A 3FIGA 2MNRA 1LTDA 4PBFA 1Z6KA 1LWJA 3IJQA 4JHOA 1QPRA 1ESWA 3WUGA 3G2GA 3WUBA 2VURA 4S2CA 1GOKA 4JNYA 4QS5A 5I3GA 1SO3A 5AC6A 3ZT6A 1JUBA 1OC6A 1X6UA 1KBJA 3SN0A 1FFQA 3M0VA 3ABXA 3WF1A 3DUGA 4LANA 3RPTA 2QAFA 3PNZA 1ICQA 4LOCA 5CBIA 2GK1A 1TWWA 4H8VA 2CCRA 2QCFA 3DI0A 1VC4A 3R13A 4ROQA 2VL4A 5J8LA 3O6DA 4DBUA 2VOTA 4B2DA 1XIHA 3ITCA 1KV5A 1XUUA 3N4EA 4QIUA 4DO5A 1FWAC 1GG1A 4YCOA 3ARZA 3LS9A 4JKKA 4P8WA 2I16A 1GPWA 3KW3A 1ITQA 1GK8A 3U6WA 3ABOA 4J2MA 2FZDA 1N82A 4NJJA 2HVMA 3ALFA 3IWPA 4KF1A 4AEFA 1H7WA 3D46A 2EJ1A 1IR2A 1OADA 2BP1A 5D9PA 3OO2A 3S4TA 1G1YA 3LV6A 2ACQA 4LV9A 1DKWA 3L65A 1ADOA 3C2RA 2XTKA 1W9BM 2OTDA 4OE7A 1BQGA 4RW3A 2DJLA 1GVSA 4R5EA 4C5YA 2DPEA 3W1XA 2RGMA 4GQBA 3KCJA 1IWPA 3BQ5A 3REQB 3BV4A 5GJMA 2C19A 5BXRA 2DFAA 3UA4A 1TPWA 6PTDA 2J8GA 4TU1A 4XD5A 3VOIA 3L68A 4RV8A 1SW7A 3BAXA 4DJDA 4OU1A 4F0SA 4W7VA 5I79A 1W1IE 4B5UA 5AECA 3FSTA 2WOQA 4LUSB 1EX5A 1BTCA 3KVLA 1HG3A 3GYEA 5FJRA 4PRTA 1CW2A 3KBWA 2X0SA 1THFD 5AHLA 2A3AA 3GH7A 1SPQA 1PX8A 4HOXA 1FWIC 3ITYA 3K4DA 1UOZA 3MI6A 3BLEA 1ME7A 3PC0A 3AYVA 2GWNA 2J6VA 4TVDA 1DQUA 4ZQRA 1OY0A 3JZEA 1AW5A 4XAFA 1W8GA 4CD8A 4BY3A 4B91A 4HPNA 1C7TA 3ECQA 2F9RA 4IQDA 2R1NA 4MSSA 3W75A 2PWHA 3PZVA 4QLJA 1O95A 3LXAA 3VKBA 1FP9A 4AAJA 2Q09A 4DHGA 2IW0A 2OB3A 4M8UA 1DJGA 2BG5A 3SCTA 4BA0A 3IRDA 4UTFA 4S3JA 4JX6A 1FWCC 3QQWA 5AC5A 3CNYA 1R3YA 3O15A 3B06A 3R79A 1FHDA 1BYDA 5CAHA 3NDZA 3DXIA 4W4QA 4H41A 3TCSA 1J18A 1V6UA 2DZTA 2WWDA 1ZSXA 4RK8A 3MT1A 2QIIA 5A8OA 3EMQA 3CAWA 3GDBA 4B15A 1UWSA 1GOIA 2QCHA 1XLDA 5A6KA 4PTNA 4ZL1A 3T81A 1OVDA 4E3VA 5EIYB 4C6IA 1TV4A 1GQJA 1BTMA 3AMGA 2ISDA 3WQEA 1UMLA 4PEKA 1C90A 3H55A 1A50A 3HPFA 3B3DA 3HM7A 1BSIA 4DUOA 1AZ1A 3K13A 3M0MA 2FB2A 1HN1A 2ZXBA 5CG7A 4UTTA 2D20A 4UTJA 2PLCA 3CUJA 1ISYA 3LTYA 2IKGA 3U5YA 1EEPA 3WG6A 3WD1A 3BVJA 1R2SA 4JTAA 2YDRA 1M41A 1JXKA 3WD0A 5BXSA 5AB3A 1HJUA 3MANA 4QQ3A 4OUIA 5F2LA 4RX0A 2CETA 2P3ZA 2XGBA 3EOSA 2ZX5A 1XLAA 3WQOA 1E4IA 1OT1A 1V3HA 1UZHA 3L4ZA 4FSAA 1MUMA 5KINA 3TKFA 1PZ1A 1BWVA 5CBBA 1UW9A 3N11A 4WXZA 3MTWA 3MDWA 3UU0A 2BVYA 4W7WA 1BPLB 4IIGA 5HNTA 5I2UA 2RH9A 1V6VA 3PBGA 8XIAA 2CLMA 3VNZA 3RUBL 2A6NA 2VHLA 3KEHA 2Z1XA 3C6CA 4N6EA 2WHJA 2WZIA 3WUFA 2FQIA 4IUGA 3H4XA 3GU9A 2PTDA 1FWWA 3N17A 2XZ7A 5G5IA 5H2ZA 2ALDA 3NL3A 2VQTA 5CZKA 4YCPA 2OZ3A 4CNPA 3U9IA 2UBPC 2WSKA 4E0CA 3MV01 6A3HA 2F84A 4A3UA 3PZTA 1LJYA 2OQHA 3O6AA 1TG7A 5GNZA 3SRHA 2XGIA 5A95A 2PLJA 1KR0A 3L4YA 3CV7A 4IXHA 3W76A 4CQDA 2ATMA 2CLEA 3VNKA 4C6MA 3GAYA 1J4EA 4C6DA 1U33A 3W74A 3QH2A 1KBBA 3LXCA 4TX8A 1I60A 1X6NA 3L12A 1V02E 4A4AA 4FLOA 3WQDA 3SY5A 2QJNA 3T05A 3STGA 3W01A 2R1KA 5HQEA 1BF2A 3NYDA 4CU8A 4WRHA 4E2VA 4GVHA 4EVZA 4UMCA 4YLWA 3FXYA 2FZ9A 3USZA 1E0UA 4M7TA 3ABSA 2C14A 4F48A 4JXCA 3S42A 1ICSA 1NWUA 1EP1A 4C1KA 1LUCA 4D6CA 1RBAA 1TV2A 4GFIA 2NUXA 3NQGA 4PL1A 3O6YX 4O4VA 4DYJA 2OODA 1AW2A 1WNOA 1TRDA 4OHQA 4KWVA 3KRZA 3INPA 2H9AB 1BAGA 2RDXA 1RQHA 4GKTA 4JTFA 3TONA 1GHSA 1IE7C 2GL5A 1XRFA 3WH8A 3W1MA 1HJSA 5LA2A 1E0WA 5LNRA 3MUAA 1DJWA 2F61A 1TZ7A 3XISA 3DI1A 2Z6IA 3GDMA 3V7PA 4IGMA 5HNUA 5I77A 3WD3A 2XVPA 2A7NA 3ZLFA 2UV8G 4M1RA 2QKFA 3NQ7A 2FHCA 4L5ZA 1OCQA 3C56A 4KCWA 4X60A 2J6XA 1V93A 4PUDA 3T44A 2V5BA 2INFA 1W3IA 1S2UA 1H7PA 3MVTA 1W2VA 2NUWA 4MWAD 1XCXA 2YW4A 2ZWZA 2PDXA 4DZ5A 3T2QA 2J88A 3L4VA 1MQQA 4Q4KA 4GG9A 3M7SA 1TPEA 1UD3A 1Q4WA 3ZR4A 5FCZA 2C79A 2A3LA 2VFEA 5BRBA 4ZR8A 3ITVA 1V3JA 3K4WA 1GVQA 1F3EA 3IPWA 1UP2A 2CLIA 1RK5A 3WLQA 4NY2A 3NFUA 1S3HA 4TX9A 2VEMA 1HT6A 3GY1A 4AIBA 2PDUA 3GAKA 3PZQA 4LVFA 3E3HA 2Z4GA 3LCGA 1UR8A 1W1TA 3T4CA 4YVXA 4Z42C 1UWAA 4NI8A 4L4PA 2Z1KA 3BG5A 1FY6A 2QUUA 3WNKA 3QXBA 1J93A 4RKAA 2GGIA 4KWUA 1D3GA 4U28A 4RW5A 3IRSA 1SW0A 1QMLA 2IS7A 4GY0A 5AHNA 4HA4A 1R30A 1H49A 2FTYA 3A23A 3V4BA 1L6SA 1AK5A 3DCPA 4UQCA 5D9NA 3TTSA 3SW6A 4HT3A 2CLPA 4AZ5A 1MQPA 2A3BA 2FH6A 1WDSA 3I65A 4K8GA 4IX2A 2W66A 5CSRA 1A49A 3UG8A 3P5ZA 3DYMA 2FJKA 1PTAA 4GUFA 5A8QA 1FOBA 3CUXA 3N9KA 3ZLHA 2E09A 1X98A 2OQYA 2FB3A 5EMYA 1LDCA 4AEOA 1XUZA 4BQ2A 1G5AA 1E40A 3KCOA 4GY1A 1EGVA 4WIWA 1AH0A 3V36A 4LNCA 2OKTA 5T26A 1X7FA 2WANA 3ZMRA 2WQDA 1R0MA 2YDAA 4IHCA 4LS2A 3M1ZA 3MYPA 1JAEA 1V0LA 3CJPA 3VUSA 1PYMA 1KXQA 2EJAA 4CU7A 3MQTA 4G9PA 1I2QA 4DBEA 2VR4A 3R0KA 1UKQA 3GDKA 1B9BA 3L5LA 1GKQA 2TAAA 5K4XA 1NWTA 1FQ0A 1P0EA 3KP0A 3SRFA 1V6YA 4LBSA 2GDQA 3EPMA 5BOFA 3H2NA 2VZVA 5D2TA 2TODA 3IUDA 1WKDA 3G0UA 3FA3A 4HNCA 3IUHA 2Q02A 4NZFA 3ANYA 1RSCA 2O4QA 3NM1A 4OTKA 1IXQA 2DZVA 2EXOA 4R7WA 4NHVA 9XIAA 4QTGA 3SCVA 1QK0A 1K9FA 4LCRA 2XVGA 4KBXA 4Q4QA 3L67A 1VRXA 4EAYA 3VIPA 3WL1A 3I6RA 4J3WA 4H6KA 1H1ZA 2HMCA 2WLYA 2DVUA 3EX6A 4FK9A 5AC4A 1K8CA 2X1UA 2PD9A 2XINA 4W8BA 3MMDA 3PBMA 4RDYA 5CKSA 4GVGA 3OIHA 4POCA 1NDZA 4LCSA 4JIHA 3KOXA 4XAGA 1ZJIA 3BCFA 4AHQA 3ZJ8A 3UR8A 4RV3A 3TLQA 4WKAA 3BURA 4GY7A 4HSOA 1EX1A 3GHUA 1JCJA 1EJWC 1JYNA 3GC2A 2HK1A 2VVSA 4K2SA 4CN1A 5DMYA 1FX6A 3UCDA 3E6EA 1Z48A 4PCNA 1XYLA 3PULA 2OWWA 2PGRA 1RJRA 3UXIA 3DHFA 4JTGA 3CQJA 3S1XA 3SUTA 5G1MA 1LT8A 1RVGA 2Z2BA 8XIMA 3RK8A 1XKYA 4L4OA 1QWGA 1N2VA 4ATDA 2H90A 3BZJA 2GVJA 1KQZA 1TE1A 4ECLA 1P7TB 4NVTA 1NF7A 4UOJA 4JL2A 1JYVA 3UPWA 1P6CA 5LA1A 4Q33A 2WO5A 4H6QA 1W3KA 1G4PA 4H9TA 4B92A 4UTIA 3CTLA 4S38A 5GQBA 2EF9A 3CZKA 3PZUA 1V3KA 1R9YA 1J6OA 1YPXA 2ZCGA 5U7SA 2XUCA 4YJ5A 4LAKA 4C1NA 4U5IA 3TYZA 3FVMA 3O3RA 1BXCA 3USBA 1H63A 2WNWA 2B7PA 2INZA 3IGUA 1Q2RA 4RNHA 4AFYA 3R8RA 4FX8A 2E6YA 4LS0A 3L0KA 1OJXA 1JRCA 3IJ8A 5D03A 1GYNA 1X97A 3CXOA 3VA8A 1VJZA 3T0DA 3VGEA 1OZQA 2CESA 5D9MA 2NQHA 1FUYA 1XLJA 3VFLA 3EWXA 3W2KA 4ZMGA 4AY8A 3FV9A 3W7QA 4EXAA 4JQ3A 3IAPA 4FLRA 2B7QA 1OABA 1H51A 4MLJA 1EDTA 1P0DA 3UJSA 2WK2A 3E5PA 4Y8EA 1JGIA 2A85A 4U33A 4O8RA 3QY7A 1O68A 1W3LA 1S2AA 3T6CA 2D1ZA 2WPGA 3UXDA 5D8WA 1CXIA 2ZOXA 6ALDA 4G1KA 2CLOA 2OGJA 3NSXA 4JTTA 5E9XA 4O12A 3HF3A 4Q8OA 1W5MA 3RLGA 2VEIA 3W7RA 5J5RA 1ONEA 5LYRA 2Z27A 1QK2A 3P93A 3W86A 1FVPA 1HP5A 4HNTA 3M5ZA 1TVLA 4JTCA 2Y5JA 2WZHA 4UCGA 2VEGA 1LT7A 3RJXA 3UW6A 4A29A 1JPKA 1UZ4A 4IGHA 4MFDA 4UCFA 2A3CA 4BZYA 3AS0A 4YYCA 3QHMA 5F2GA 1EPVA 3GO2A 2PAJA 4JIEA 5I5RA 3U7VA 4ZSTA 3WO8A 3CAVA 1EP3A 1AJ0A 3S0CA 2C0HA 1QRQA 4EPBC 1QFEA 5FOOA 1DJHA 4PL2A 1CGVA 1N8WA 3KBNA 2YCLB 4M0XA 2ZDRA 3K8KA 3M46A 1VEPA 3SRDA 4OT7A 3SB0A 3FJ6A 4IH3A 1S1PA 2Z1VA 4XBSA 4QEHA 5EMLA 1TV7A 3B8DA 3VIGA 4ZQPA 4HOWA 3UWYA 5HULA 3AMDA 4HMNA 1SJCA 4O52A 3WDIA 3WH6A 3AJ7A 2WVSA 1UQYA 3PUEA 2G4FA 1SM9A 3QOMA 2DT3A 3WF2A 3ITLA 3S8HA 4LEQA 2J47A 3LERA 1UROA 5FEXA 2DDXA 4N9CA 4R7JA 4E8DA 1XH1A 1Q7MA 4L56A 5D2WA 1MRAA 1L2QA 1YTDA 3R8HA 2NWRA 1M7PA 4P8VA 1VGAA 4KCUA 3HJZA 1C29A 4V15A 3ELFA 3BV7A 3CASA 4DJEC 2VXNA 1XI3A 4M3PA 3IUIA 1VENA 2BY2A 4WZHA 2AQOA 3E96A 4YNGA 2V68A 1XPGA 1SFTA 3EEZA 1L6YA 1QUMA 1ISVA 4LUTA 5FAGA 1KR1A 3MSDA 2GWGA 2BSLA 2HPIA 1J0IA 3UR5A 5FF0A 1Q8JA 4PMVA 1TVPA 3TZFA 3DN5A 1J5TA 1CWYA 5D38A 4Z1DA 1E0TA 4AZ7A 1P48A 3M0JA 3LCHA 4M81A 1JQXA 1VIWA 4NRSA 2ISSA 2XG9A 4NU7A 3VOHA 4FO4A 4AYGA 4WOZA 1A5OC 3ES7A 3V18A 3WLHA 4OUEA 4NJKA 3BC9A 2JALA 4NJGA 3AXXA 1XDMA 2G41A 3W6YA 5I23A 5A69A 3BLDA 4HN8A 1NFPA 3DC0A 3OGSA 4DJFC 2ZX8A 1R87A 1D8CA 5HQLA 4ZZ9A 3WQVA 2B7OA 4K38A 2PI6A 4C1NB 3G22A 2J25A 2ZZ7A 3VOCA 3RILA 2A5HA 3PG9A 3GVWA 1SSDA 2Y85A 2VTFA 1KKOA 2Z25A 4WGXA 3UWQA 1JJKA 2VWTA 3O7UA 1TE6A 5DY3A 5LZLA 1E3ZA 4JN7A 3ZLGA 2QR6A 2FH8A 1P43A 5C9UA 3OBAA 2PSNA 5I0DA 1QATA 1K7FA 3KRUA 4YYFA 2YCEA 4GYFA 3MJYA 2CHNA 2NX9A 4C6EA 4QM1A 2A4AA 2WZMA 2O7QA 2PDMA 1K7EA 3MUY1 1E4NA 4H9YA 4YXGA 4WKFA 3PWIA 1TJRA 1H3GA 1NIUA 4M24A 2XH7A 1SO5A 1E4MM 3FHAA 3NR0A 1PE1A 2BMBA 5LIKX 5FF3A 4D6GA 3B0XA 1XIBA 5DCBA 1YTEA 1K70A 3W1LA 4WVXA 1UD4A 4YTRA 3DERA 3C2FA 1CENA 2Y4SA 2WXDM 4PMNA 2RAGA 1H4PA 4GI9A 1VCGA 4RE0A 1J0HA 3G3DA 3S1VA 3LYEA 4EK7A 1W91A 5KZEA 3GG7A 3KUMA 3SR7A 4GGBA 1O6IA 1J0JA