3OZOA

Crystal structure of insect beta-n-acetyl-d-hexosaminidase ofhex1 complexed with ngt
Total Genus 190
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
190
sequence length
572
structure length
572
Chain Sequence
EDVVWRWSCDNGKCVKLKNDPRSSEPALSLEACKMFCNEYGLLWPRPTGEADLGNFLSKINLNSIEVKILKKGATDDLMEAAAKRFKEQVSLAIPRGSTPKLTGKAVDVYLVNENPNEKAFSLEMDESYGLRVSPSGADRVNATITANSFFGMRHGLETLSQLFVFDDIRDHLLMVRDVNISDKPVYPYRGILLDTARNYYSIESIKRTIEAMAAVKLNTFHWHITDSQSFPFVTTKRPNLYKFGALSPQKVYTKAAIREVVRFGLERGVRVLPEFDAPAHVGEGWQDTDLTVCFKAEPWKSYCVEPPCGQLNPTKDELYQYLEDIYSDMAEVFDTTDIFHMGGDEVSEACWNSSDSIQNFMMQNRWDLDKESFLKLWNYFQQKAQDKAYKAFGKKLPLILWTSTLTNYKHIDDYLNKDDYIIQVWTTGVDPQIKGLLEKGYRLIMSNYDALYFDCGYGAWVGAGNNWCSPYIGWQKVYDNSPAVIALEHRDQVLGGEAALWSEQSDTSTLDGRLWPRAAALAERLWAEPATSWQDAEYRMLHIRERLVRMGIQAESLQPEWCYQNEGYCYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal Structure of insect beta-N-acetyl-D-hexosaminidase OfHex1 complexed with NGT
rcsb
source organism Ostrinia furnacalis
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords N-acetylglucosaminidase
total genus 190
structure length 572
sequence length 572
ec nomenclature ec 3.2.1.52: Beta-N-acetylhexosaminidase.
pdb deposition date 2010-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00728 Glyco_hydro_20 Glycosyl hydrolase family 20, catalytic domain
A PF14845 Glycohydro_20b2 beta-acetyl hexosaminidase like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3ozoA02
3.30.379.10 Alpha Beta 2-Layer Sandwich Chitobiase; domain 2 Chitobiase/beta-hexosaminidase domain 2-like 3ozoA01
2CXGA 1C3FA 3PN8A 2G4FA 1UD5A 2JALA 1JF6A 2WHJA 2XGBA 1VBRA 1M7XA 3WQ6A 1ITCA 2BVYA 5HPCA 1H0GA 1H0IA 1UHVA 5C70A 5D8ZA 3ARXA 5FKYA 1V0LA 2ZXDA 4BF7A 3RM9A 4W84A 3W81A 3FY1A 4GKLA 3QHOA 2UY4A 3UETA 4P7LA 1MQPA 4AYSA 4PTXA 4QFUA 1E6XM 1HJWA 4B16A 1V02E 1DP0A 4ZE4A 3B8SA 4GIAA 5CXPA 3VGFA 4RE2A 4PSRA 4PMYA 3ZJ7A 4D1IA 4GQRA 2DSVA 3VKKA 3GH4A 1UQYA 3BH4A 3PZIA 1GNXA 1EQCA 1PX3A 4ACZA 3NDZA 3F5LA 1FFQA 1VAHA 4W88A 3K8LA 1FH9A 4JAWA 1UA3A 2QHAA 4EANA 4E8DA 4UTFA 4W8AA 4BQ5A 2VT0A 3GXIA 1MYRA 2PWDA 1LG1A 4KGLA 1NWTA 5I24A 3MSGA 4P7NA 3QR3A 3WF0A 2FGLA 2XM1A 1UD8A 4H2CA 3TTSA 5A8QA 3WELA 1NOFA 3VD4A 1LLOA 1JXJA 1YHTA 1UWQA 1QI3A 2WC3A 4JFSA 3AMGA 2QPSA 4Y7EA 3RILA 2F61A 4AD0A 4GINA 2DSUA 2X2YA 1QOXA 2J7EA 1LQ0A 1NOUA 3KL3A 3ARSA 5CLWA 2WB5A 5JIWA 1TA3A 3ZMRA 1UH2A 2AMGA 5E70A 4CN1A 3VMPA 1NP0A 3A3HA 4W8LA 1E71M 2WKLA 2YBUA 4PTMA 2UWFA 4AXNA 3W27A 1QNPA 2DSKA 1WE5A 5A8MA 4C7GA 2NT0A 1E6NA 1X1NA 3W25A 3EMCA 4PUEA 3MKKA 1V03A 3PTQA 4AD5A 3WEMA 4HA1A 4B3KA 1U2YA 3AIRA 1XH0A 1BHGA 1E6PA 2CHNA 1HKIA 2DPEA 4NRRA 5D9PA 3WENA 3LPGA 4TVDA 3WQ4A 3JUGA 1E40A 1VEMA 2XIBA 3A4XA 3T0BA 3WQVA 3ZR6A 1C90A 5DT5A 1CNVA 1EH9A 1BYAA 4JHOA 3WNKA 1LJYA 1TA3B 3BCDA 5IHSA 2F8QA 1W32A 3AHYA 3IJ8A 1CXIA 7CGTA 1H3GA 1W9UA 2EPKX 1SFSA 9CGTA 2VVSA 3ARQA 4PN2A 2PWGA 2WHLA 3FXYA 3OZPA 1FP9A 3UG3A 2J79A 1C7TA 1V0KA 1CENA 3SUWA 5FCZA 3VIGA 4H8HA 2AAAA 1CYGA 4FMVA 2D3LA 2WHMA 1OT2A 3NUKA 2ZIDA 3OBAA 4NF7A 3EDEA 1H41A 1V3LA 4AISA 4Z2IA 2BHZA 3SCPA 1XH2A 1IZKA 2O92A 2XWDA 4J27A 4Z2LA 1TZ7A 3SCQA 3VDAA 4HZ7A 3AISA 3WDJA 3GTNA 1R85A 2VCBA 1BYDA 4GO8A 5HDRA 1XYFA 1UWRA 4P7OA 2ZWZA 3BAIA 3AS3A 2DSZA 4QP0A 5BXRA 5EB8A 6TAAA 4Z2KA 4HPGA 1GOMA 2YL8A 1WPCA 3WF2A 5CSYA 4JCLA 3U7BA 1KCLA 1C92A 3KWXA 3CHDA 3AHXA 4ZFMA 2ZUVA 3KE0A 1JDCA 3BMVA 3WL1A 3EMZA 5DT7A 4WK9A 4U5KA 3WNPA 2G3IA 4S3JA 4P8UA 4HA4A 4D6EA 4XZBA 1UD6A 1QI2A 4A3HA 1NM9A 2EBNA 1BYCA 4AIEA 4P8WA 2VL4A 1CBGA 2YA1A 3GH5A 3AHZA 1W3JA 2E9BA 3RIKA 1JGIA 2ZUUA 1NQ6A 5D9MA 1QNRA 4LGXA 1HJUA 3WIJA 1J0KA 3M07A 1EA9C 3VX1A 4AZCA 3AS2A 3WF3A 5AY7A 5FIPA 1TE1A 2IUZA 3VX0A 3ARPA 1TFVA 3PZNA 3SCSA 3GNRA 4NI3A 4J3XA 1HKMA 1MW1A 4BCEA 1J10A 3WDHA 3NJ3A 2E8YA 4MNKA 1RP8A 4YN5A 4FK9A 2XUCA 5E9AA 1BPLB 4M56A 5A69A 1UR0A 4UFLA 3L4TA 5EBAA 3N04A 4DWSC 4D6HA 3DYPA 2J75A 1EIBA 4UZSA 8CGTA 4HZ8A 4EKJA 2V38A 4CN6A 1CTNA 4RL3A 3GNOA 2YJQA 2VVNA 3PHAA 1HN1A 5IXEA 1J12A 1UKOA 3MUAA 2QMJA 1WAWA 1GQJA 5I2UA 3WNNA 4BS0A 4J3WA 2XSAA 1MW3A 1JZ6A 2IXVA 4C7DA 4CU7A 2D1ZA 2VX6A 1EXPA 3WQ5A 2E4TA 2A3EA 2Y5EA 1J9YA 4LXFA 1HX0A 5A6BA 3SCVA 3TA9A 3GH7A 2J7GA 2GJRA 4UQ9A 4U2ZA 5EFDA 2VZSA 1VJZA 4UQEA 3L4YA 4JFTA 2OWXA 1PJ9A 3MV01 2CCRA 3S2CA 2A3BA 1J0IA 1JD7A 4Z2GA 4ATLA 2D22A 3EDJA 3U7VA 1Q6CA 1UYQA 2WVVA 2JIWA 1UD2A 3DC0A 5BCAA 3NCOA 1HJSA 2BVDA 3MMUA 3AXXA 3WFLA 3SCWA 1FHLA 1R7AA 4JFUA 2CESA 4W7VA 3VGBA 3OB8A 2GFTA 3AIQA 2VCAA 1B90A 3BAWA 4AZ7A 3ZJ6A 2UY2A 3A47A 3K4DA 3F5KA 1V0NA 1GQLA 4GZJA 1IV8A 4ZEPA 4N0RA 3CMJA 2RGMA 4CKQA 2J62A 2DSWA 2ZX8A 1B31A 1JXKA 3TTOA 5C8BB 4F9JA 2W67A 3KL5A 1ZB5A 3L2LA 4ZENA 2QF8A 4OIFA 3SCTA 4CD7A 2DH3A 3CZJA 1XYZA 2YBTA 4F9DA 1R7OA 2J8FA 4S3KA 3WUBA 1E9LA 3A4AA 3SCNA 2G3JA 5BXTA 1FHDA 1FH8A 1PZ2A 4IM4A 3AICA 1L0PA 4K68A 4R27A 1UR8A 3TP4A 4MAVA 1F4HA 1NARA 4HZ6A 4PCTA 1O6IA 2ZX9A 2WZHA 1HL9A 3OLDA 2W92A 1SYTA 4PBGA 1K9TA 1KWGA 4GQQA 5E0CA 1H2JA 1QNOA 2BY0A 2WSKA 1MQRA 2AOSA 4KGJA 2D2OA 3ZIZA 3WF1A 4U3AA 3EBVA 3AS1A 1JAEA 2WYSA 5AYBA 2O9PA 4BQ4A 2VR4A 5IFTA 1DWIM 3WD2A 5D9NA 5I79A 3W53A 3MU7A 3WMBA 2XG9A 4JFWA 1HVQA 1WO2A 5CLTA 5E0FA 1X6LA 4IISA 1CLXA 2Z1KA 5BRQA 1JYXA 1MFVA 1EDGA 2J8GA 3L4WA 1XCWA 1ZJAA 3VIIA 3WNMA 5CPTA 1AMYA 4DM2A 2OSYA 1PZ3A 1KQYA 4TOQA 3AIBA 1ISVA 1BGGA 2G8ZA 1UR9A 3IJ9A 2XVGA 2Q8XA 5AC4A 2VX4A 2VRJA 1JI2A 3GYCA 1I75A 3WDIA 1OINA 1SMDA 2O9RA 1I1XA 4YHEA 1HP4A 2EJ1A 1V3MA 2ZX7A 4UOJA 4Z2JA 1WKYA 2CBIA 2VOTA 5IDIA 3WD3A 2GDUA 1VEOA 3WNLA 2X8RA 2CIPA 3VTRA 4AZBA 2DIJA 1XCXA 1QI4A 3VOCA 5IFPA 4J7RA 4F79A 3PTMA 2NT1A 4B9YA 3FHAA 1KBKA 1JNDA 1XSIA 3AZRA 1UD4A 1V3HA 1JYWA 4W5UA 4ATWA 2WWCA 1RPKA 4P8VA 1QW8A 1JZ4A 2WCSA 4RE3A 4JKLA 1H09A 4DUXA 5A6JA 1V6YA 2FGZA 1OD0A 3CBWA 4W7WA 3SCOA 4UFJA 3U57A 5I23A 4TX8A 1BVZA 2XFYA 4MJ4A 2Y24A 3SUVA 1N82A 3ZOAA 2WMIB 5I5RA 3RM8A 4AD3A 5HOSA 2FDMA 2VZTA 5LA1A 1RP9A 1UKSA 1E6RA 1ZJBA 5GNYA 1KR0A 2WMIA 3VM5A 1J0HA 1E5JA 2C0HA 4GPNA 5CG0A 4HOXA 1BFNA 3W4RA 3ARUA 1W91A 3OGSA 5JIPA 1CPUA 2J74A 3SEPA 3B9DA 5EFFA 1DWHM 1E1FA 3BAXA 1EGZA 4P7RA 1TR1A 2WCAA 3NDYA 5E09A 3L4VA 4QLJA 4CU6A 3MV11 1E6QM 4AZCB 1B30A 2WZIA 3DHUA 4D1JA 4AWEA 1TVNA 4V27A 3TOPA 2FH6A 2IXUA 3ZJ8A 1H1NA 2CPUA 4W89A 3MANA 4PMVA 2EQDA 5A6KA 4JIEA 3CMGA 4M8UA 3WBEA 1OT1A 4AD4A 1VFOA 4MNJA 4D72A 2X05A 3LMYA 4GXPA 1JFHA 2XFFA 1WZAA 4UQAA 3RO8A 2WMJA 2YDRA 1HNYA 5F7UA 1VIWA 1V3KA 2ZUMA 3KL0A 3QOMA 2GVYA 1UR1A 1MXGA 1W1PA 5E6YA 2YLAA 5HBFA 1WDQA 2BHYA 3AIWA 1S46A 1HT6A 3WH9A 4KMQA 2OSWA 4A4AA 2TAAA 2VMFA 3VD3A 3AQUA 2GJPA 2WLYA 4ZXOA 3VGHA 5CPSA 4QLLA 1BVNP 1GCYA 1LF1A 1WZKA 2BY2A 5LYRA 3AFBA 3L4UA 2YA2A 3AMDA 1GOKA 3S6TA 3HJEA 1CXLA 1NWUA 2D3NA 3PZTA 3TONA 1TMQA 1KGUA 1OM0A 4WLCA 4X9YA 4L4OA 5DF0A 2WBKA 2UY3A 1CWYA 2X1IA 1HKJA 1ZL1A 2BXYA 2W91A 1W9VA 2NSXA 4A3YA 2EPNA 4GI8A 1PEZA 3BAYA 2A3HA 1C8QA 2J7FA 1W9BM 4WIWA 1OCQA 5A94A 5BRPA 1GOQA 5M3WA 3O9NA 2PBOA 3APGA 3WH8A 3WH7A 3CZEA 3WQWA 2QLYA 2V5DA 1EOKA 4HA3A 3UCQA 4YPJA 1DWFM 4TVCA 5A3HA 3VPLA 4J3VA 5DO8A 4U2YA 3CPUA 1B9ZA 3OA5A 3WEZA 2VZVA 1UH4A 3OLEA 4D6CA 5EMYA 1K6AA 2VRQA 2ZXQA 1ODZA 2OWWA 5A1AA 3WKZA 1FFRA 3UERA 1V6UA 1G94A 3VGGA 3PZOA 3RJYA 1CZ1A 1RD6A 2JE8A 4JFVA 2D23A 4H8VA 4V28A 3SIMA 1H11A 1KXVA 5JBDA 3N1AA 3RJXA 5CGMA 3FN9A 4PMXA 2CETA 1KBBA 5A2CA 3MSDA 5LA2A 4GI9A 4V2XA 1Q6GA 1QHOA 4FLOA 3M7SA 3RPMA 1ODUA 2V5CA 1CGUA 3BSHA 2BY3A 2BVTA 1D7FA 1XGZA 1GJWA 1UWUA 3I3BA 5JBFA 4B15A 3PTKA 3VDHA 1HJVA 1XSJA 2W5FA 2F2HA 1PPIA 3BAKA 3TTQA 4OUEA 1KFWA 3PZ9A 1E73M 3IAPA 1FH7A 3II1A 1CXFA 3ARVA 3VIJA 3OGVA 1LL6A 1RH9A 1GZJA 3HU7A 1MFUA 1J0YA 2E3ZA 2XFRA 5FL0A 5IHRA 3L4XA 2G41A 3CUIA 3EDKA 2WWDA 1CGXA 2DIEA 1M04A 2YL5A 1Z32X 2CBVA 5AYIA 4PRWA 1WP6A 4AEEA 3O6AA 1HIZA 3RCNA 5GQBA 1JYNA 2X0YA 2OLHA 3F4VA 2XIIA 1E15A 3D5HA 1WDSA 2VO5A 3MUIA 4CU8A 3EDFA 2EPMX 4MJ2A 4UCFA 1TVPA 1LWHA 2VX7A 3HN3A 2PC8A 2VURA 3BLPX 3W0KA 1Q6EA 5BYWA 2GK1B 4FF5A 1J18A 1W1YA 3FHQA 3T0AA 1WNOA 2ZXAA 3ZT7A 1UZ1A 3G6LA 3BC9A 1C91A 1CEOA 3WUGA 2D0FA 2G3NA 5M03A 2JEPA 3CUGA 1XV8A 3PBGA 4MDOA 1QPKA 3VIOA 1ISXA 1IZJA 3AYSA 3ARYA 3ZT5A 3AZTA 3CZKA 4BQ3A 3W24A 3AI0A 1W9XA 3L2MA 4PSPA 4PMOA 1E55A 3CZGA 3VMOA 4PMZA 1QVBA 5I0DA 1K9EA 1OWQA 3AS0A 3WQ8A 1PIFA 1A3HA 2G3MA 1ESWA 5A95A 3EMQA 5CGTA 3CUFA 4MB5A 3O2LA 3BSGA 3FW6A 1MW0A 4MPKA 1GHSA 4AW7A 1KXQA 2E0PA 3SCRA 3AIUA 3GXMA 4ACZB 5DFAA 2WSPA 3EYPA 2J47A 3NSXA 4QDMA 1JL8A 5A2BA 1E0XA 1V6VA 1U30A 1CXEA 3DECA 1B1YA 4XZWA 3LPOA 3VM7A 4WF7A 5GNZA 5BROA 4UZUA 1E4NA 1XRVA 4M1RA 3AMCA 4LPCA 2XHYA 2ZX6A 3T09A 1L8NA 2XJ7A 4CN4A 4IPLA 5KZ6A 3MUZ1 4QCEA 4PCSA 2PF0A 2PBGA 4ZXLA 1E56A 1QNQA 2VJXA 1NWRA 4UFHA 2A3AA 1HJXA 2UY5A 1Q6FA 2XGIA 5A2AA 1OB0A 4UOQA 1TG7A 2RGLA 1DEDA 1JF5A 4CD4A 2VZUA 5DEZA 4PTWA 4EK7A 4HU0A 5HNNA 1LL4A 1DTUA 3WMSA 1LWJA 3AHVA 2JIEA 4MB4A 2E9MA 2FHCA 2PWHA 4WKFA 1KGWA 8A3HA 5CQ1A 1H4PA 1GONA 4AZIA 4WKAA 1UKQA 4GO9A 2D0HA 3VIFA 4CVWA 2WAGA 1VFMA 1E4MM 3DYOA 1BYBA 4UFKA 1FP8A 1ZBVA 1ITXA 3WL0A 3CHEA 2YOCA 1FOBA 4D6JA 2EXOA 3OG2A 4M80A 1R8LA 4N42A 2WLZA 2ZUTA 1KXTA 4ATDA 4HOWA 4CGTA 2WK2A 5D8WA 1EOMA 1BLIA 2WBGA 3WBAA 4F8XA 2BNJA 4LYPA 1PIGA 4JL2A 4Q22A 3IANA 2V3GA 4PMRA 1XSKA 1ZBKA 3KZSA 4ACYA 2W62A 3J7HA 4DUVA 1VF8A 3W38A 3CIVA 4QLKA 1KGXA 2FHFA 4UQDA 1E6SM 4B3LA 1U33A 1CGWA 3VINA 3CHCA 1WZMA 1W3LA 2J7CA 3K8MA 4P8XA 5DMYA 5ABFA 3UR8A 2GK1A 5ABGA 1GQIA 3K8KA 1UR4A 4RE4A 4UNIA 5ABHA 4UQCA 4EE9A 3VGEA 3BGAA 3MUY1 1CIUA 5CSUA 1TCMA 2BV9A 2WMGA 4E8CA 3M46A 1UZ4A 3ARWA 4PMDA 4OOZA 3ZO9A 4TUFA 3AOFA 2XVNA 2V3DA 3OGRA 2B31A 5LA0A 3VDBA 1OD8A 3AROA 4HP5A 2YL6A 1B3WA 2CYGA 1JZ5A 4M24A 1GPFA 3LPFA 1W2VA 3ZM8A 5FOOA 3A6OA 4MTVA 4W86A 1JI1A 1O7AA 3PZUA 1OSEA 1C8YA 4AEFA 3AIVA 1B2YA 1I1WA 4OBSA 1EHAA 3UG4A 5TD4A 2D20A 3EDDA 3HMCA 1ISWA 4J28A 4F66A 1GVYA 1QW9A 1W1VA 1K9FA 3E1F1 1G1YA 1UH3A 2O9TA 4EAMA 1E4LA 2JEQA 3WDPP 2BXZA 2VRKA 2GSJA 1ZBCA 3W82A 2WMFA 1PX8A 2WVSA 1VJSA 3PZVA 3UEQA 2VR5A 2GUYA 3OLGA 3VMNA 2XVLA 4CUCA 5I77A 4PUDA 1XD1A 2DH2A 2WZEA 5A6BD 1MVYA 1AQHA 4LYRA 2YL9A 1E6ZA 3N13A 1UKPA 1OIFA 1W1TA 2OSXA 1JFXA 1BF2A 1V0MA 1DWGM 3B9AA 5HPOA 1CDGA 2CKSA 4M29A 1GQKA 3POHA 4HTYA 1PAMA 1JZ2A 2EEXA 1DWAM 4D6DA 3FAXA 4E4PA 3GXDA 1HL8A 3SURA 1R86A 2W4XA 1DWJM 4DWSD 3WD1A 1US2A 3WD4A 2Z1SA 3ECQA 1ZBWA 2JF6A 3AIEA 4TTUA 2JFEX 3SUTA 4MNMA 1F4AA 1AVAA 4AC1X 2W66A 1MWOA 2YKKA 3W6LA 4MNLA 3G6MA 1JZ3A 2ZOXA 3W26A 2WVTA 3SUUA 2VI0A 1EO7A 4W93A 5GPRA 1CGTA 3VU2A 5I78A 3VD9A 1W3HA 1B3ZA 3RDKA 3RM4A 2HVMA 3IK2A 2CERA 1E0WA 3UG5A 2Y8VA 1Y7VA 2VQTA 3BXWA 1KWKA 3T2PA 1VENA 3N18A 2YA0A 3QHMA 3VNZA 3NSMA 2VZOA 1HJQA 1CXKA 4NSBA 2PWEA 1NP2A 3DHPA 3MO4A 4XB3A 1JYVA 3VDCA 4OOUA 1EQPA 1C93A 4H04A 4XV0A 1E3ZA 3OIHA 4AD1A 1UWIA 4C7FA 3CZLA 1V3JA 1E1EA 3OZOA 1GW1A 4XX6A 2CEQA 3WF4A 2DDXA 2ZUWA 5A6AA 4D6GA 1V3IA 1UQZA 4HMDA 2Y4SA 4PMUA 2XTKA 2E40A 2OYMA 4AY1A 5M5DA 2FHBA 5A6LA 4C90A 3VIHA 1BQCA 4BZYA 2WPGA 2QV4A 4HMCA 4U31A 3VO0A 1WDPA 4H7VA 2XWEA 3CUHA 3K4AA 4J3TA 4DM1A 4KRUA 1WDRA 4TX6A 1KQZA 3WY1A 3WDRA 1M03A 4FLSA 1GHRA 2WCGA 1ZS2A 3CTTA 3T0DA 1QHZA 2VNCA 5I3DA 4LQ1A 3GZAA 1V08A 1JDAA 3WUEA 1W9DM 4IUGA 4D6FA 5JUVA 2BY1A 1HKKA 2V3EA 1ISYA 3MS8A 3SCUA 1H5VA 4UOZA 4PEEA 3QHNA 4OZOA 3AZSA 2E8ZA 2OWCA 1V6WA 1BTCA 2PI6A 3ZJKA 3BAJA 3T2QA 3VIMA 3L4ZA 2CBUA 1NH6A 5A6MA 4UQBA 4PYSA 2PB1A 1BG4A 1R87A 4ML4A 3ZT6A 1C7SA 2WVVB 2XVKA 5HXMA 2QPUA 1BGAA 1GVIA 1M01A 4CD8A 4WSKA 3U5UA 2CHOA 2DT3A 3AMLA 1QBAA 1SR0A 1PX4A 4CD5A 4KRTA 3ZSSA 2VX5A 1UKTA 3A4WA 2XM2A 3WH6A 1ZU8A 1BG9A 1V6XA 3ZSTA 1E0VA 3CHFA 3GM8A 4CD6A 1TUXA 1HXJA 2J25A 4AZHA 4HU8A 5A8OA 2ZICA 2ZUSA 2Y8KA 1CXHA 3FAWA 3W29A 4BQ2A 4JKKA 1D3CA 2HISA 3W28A 4MB3A 5CZKA 5GNXA 1OGBA 2QMKA 5A6SA 4MB1A 3WMCA 3ARRA 1W9PA 4H41A 2O9OA 2DGAA 2W63A 4KWUA 4TTGA 2J7HA 4XUYA 1ISZA 1HP5A 4M82A 4DUWA 1B0IA 4D71A 3PZGA 4W87A 4YHGA 2BS9A 4TXEA 3WFZA 1UR2A 2WMKA 2X0HA 4NZCA 4DWSB 2GDVA 3D3AA 4HPHA 1MQQA 1KCKA 3WH5A 1OGGA 2Y2WA 1UG6A 3BCFA 3DYMA 5ECUA 4PMNA 1UUQA 1JNEA 5E6ZA 1QI5A 1UOKA 1P6WA 3CGTA 4R5EA 2ZXBA 3F5JA 1J0JA 4U3CA 3AXIA 4PMQA 4HOZA 1ECEA 1NWSA 1HF6A 1SMAA 3FNDA 3I3DA 3ALFA 1HVXA 3ARTA 5AC5A 5A8NA 3WEOA 3QGVA 3VILA 2WC7A 4MDPA 2XSBA 3VUPA 1G5AA 1QNSA 2VUYA 1JZ7A 7A3HA 3I3EA 2WC4A 2DT1A 3THCA 3K1DA 2YIHA 4OKDA 1AQ0A 1VB9A 1MW2A 3PZMA 1KB3A 4TVUA 2A3CA 1WZLA 2J7DA 2WNWA 3UR7A 4P7QA 2VQUA 2GJXB 4C91A 1QI0A 3VGDA 3GBEA 4CVUA 7TAAA 1EO5A 1J01A 3WDQA 2WKGA 3GBDA 3ARZA 2W61A 3VNYA 1EDTA 1JD9A 1VFUA 2VC9A 2VCCA 1NOWA 4WKHA 3GXFA 1UWSA 1LG2A 3CO4A 3N12A 1X6NA 1WB0A 3GDBA 4AIUA 1VBUA 4CCEA 4MAZA 4GI6A 3ZR5A 2XPKA 4AD2A 1H49A 2WMHA 2PWFA 1JIBA 4U5IA 5BXSA 4JCMA 3THDA 2EPOA 3MMDA 2GJXA 3VD7A 1Q6DA 3WD0A 2OYKA 2E9LA 2J78A 1BAGA 2ZWYA 3ZQ9A 3OLIA 2X09A 2YDSA 4DWSA 1GOOA 1B3VA 1C8XA 5CPQA 4B9ZA 1JAKA 3N9KA 4AZ6A 4X0NA 1K9DA 1VFFA 4J3UA 4H8UA 4FLQA 4IPNB 4AMCA 4UR9A 1J0ZA 3IAQA 2WANA 2V3FA 4L4PA 3T2OA 3MMWA 5ABEA 5D9OA 3WNOA 2ESCA 3CLWA 2WXDM 3VIPA 1AQMA 3T08A 1XC6A 4AZGA 1E4IA 3NSNA 4Z2HA 1M53A 2CBJA 1GORA 3PZQA 1GJUA 2CITA 2XYLA 1WCGA 5A8PA 1CLVA 3W6MA 3CZ8A 5C71A 2DT2A 1KXHA 4AIOA 1GOIA 1VEPA 2ZX5A 1QHPA 1JDDA 3WSUA 1LL7A 1D2KA 3QOKA 1B3YA 1OBAA 4KH2A 1PBGA 1MXDA 2CKRA 4WJXA 1G0CA 4W85A 4CCDA 2OYLA 3W37A 1UA7A 5BWFA 1JG9A 4W5ZA 4FLRA 1VRXA 1Q4NX 2BHUA 4PTVA 2C8NA 1E70M 1E3XA 5I6SA 3N17A 3AMKA 3NYDA 2ZUNA 1US3A 1A47A 3POCA 4URIA 1W2PA 2J4GA 1CECA 3AXHA 4JKMA 5FD0A 4UFMA 3N11A 4M81A 4D6IA 2BFGA 2FH8A 3LPPA 2DEPA 4U33A 1B3XA 1G01A 3AHTA 3BLKA 3SUSA 1CGYA 1E43A 4LYQA 3TTYA 4BA0A 2EPLX 3CH9A 1V02A 2J7BA 4GZIA 5ABFB 1IT0A 3K46A 2J77A 2WHKA 4AZ5A 6A3HA 2MANA 4HMEA 4GZEA 3BMWA 1KR1A 4CCCA 2XVPA 2C7FA 2D0GA 4MADA 4JHZA 3UESA 1EDQA 3WN6A 2CNCA 5M17A 3WUFA 2VTFA 4LX4A 1UD3A 3KEHA 3U5YA 3NIYA 2D24A 4ZE5A 5FL1A 1QBBA 1J11A 1G9HA 3B9EA 4J3SA 5D4YA 1YQ2A 1DHKA 4UFIA 4JZ5A 4W8BA 4WSJA 4OJYA 2YDQA 2WM0A 1FA2A 4QCFA 2WW5A 1JZ8A 1XHGA 3GNPA 5KEZA 1BSIA 2DQXA 4E2OA 3CUJA 5CJ5A 1OIMA 1UWTA 3IJ7A 4OBRA 2ZE0A 1XD0A 1XH1A 3ALGA 3VVGA 3AJ7A 2YLLA 5JBEA 3RMEA 3N15A 4Q7NA 2WVUA 3AYRA 1EHNA 2DT0A 1GOWA 2NW0A 1GUVA 3VIKA 4QAWA 6CGTA 5BXPA 4W7UA 1CGVA 4X0VA 4JL1A 1OGSA 1W3KA 2EO7A 3VD5A 1E5NA 3M6DA 1E72M 4NRSA 2JF7A
chains in the Genus database with same CATH superfamily
2CXGA 1C3FA 3HA1A 3PN8A 2JALA 3E2RA 4GJJA 2WHJA 4J2PA 3EKLA 3WQ6A 4DO5A 5HPCA 4XBJA 4HPJA 5D8ZA 1V0LA 4BF7A 3S6DA 1YTDA 3FY1A 1YRRA 3VNMA 3QHOA 4R7WA 2IKHA 2Q01A 2G50A 2NXIA 1H7NA 2DZVA 1QUMA 4AYSA 1TELA 4N7QA 1V02E 3TWAA 4B90A 3AC0A 4K8HA 3B8SA 5CXPA 1Z69A 5JMUA 4PMYA 5CPOA 4FR1A 3FJ6A 2VM8A 4D1IA 1JCTA 3KBNA 3VKKA 4WX2A 5FJPA 3PZIA 4MM1A 1G67A 1J6OA 1GNXA 1TV3A 4IG2A 1XDJA 1PX3A 2QCLA 3R8HA 4ACZA 1OCJA 3F5LA 2AAMA 4GKTA 2BXVA 4PEKA 2DZSA 1Z48A 3UY8A 3TVAA 3GXIA 1D3HA 3G1AA 4KGLA 1RXOB 3MSGA 3QPZA 4H2CA 5A8QA 3H2FA 3WELA 3VNKA 4GVFA 3THQA 1LLOA 1OG0A 1G7UA 2C1GA 3PJTA 1F2JA 1YHTA 1SO6A 2WC3A 3P61A 3UZYA 3CTLA 3AMGA 4Y7EA 3RILA 3W87A 4HNCA 4AD0A 2DSUA 1QK0A 4O16A 1SVDA 5C54A 1Z41A 4LUTB 4REQA 3ZLGA 4C6MA 3W00A 3PK7A 5JIWA 5KZMA 3DGBA 2AMGA 4RX0A 1QFEA 1ME7A 1NP0A 2OX1A 1S3HA 3GRIA 2XN0A 4UTTA 2PURA 4AXNA 3W27A 6TIMA 3ABZA 2I17A 1WE5A 1WUEA 4FF7A 3CM4A 3SIZA 1T96A 1OJXA 3STPA 2Y7DA 2DP3A 3T9PA 3WQVA 1EPXA 5DT5A 1QPOA 4S3EA 1PB0A 4GCAA 1EH9A 4KFPA 1YTKA 4FX7A 5IHSA 3W2MA 5EGRA 4US6A 7CGTA 2RDWA 1H3GA 3HQ1A 2IPFA 3EWUA 2P88A 3LBMA 4OQVA 4NI8A 3V0TA 4PN2A 5B7YA 3RR1A 3DZ1A 1FP9A 2C13A 1V0KA 1J79A 3UNDA 1CENA 1M1BA 5FCZA 1LWIA 3VIGA 4H8HA 2C6QA 3GVQA 4K8GA 4PCNA 1OT2A 1EZ2A 4JTTA 3PAJA 4KIRA 4XQ6A 2YCKX 2GWGA 1VFTA 3EDEA 2X16A 4AISA 2GZXA 1V93A 2BHZA 3SCPA 3G24A 3W1LA 5FJTA 1G4SA 4XIAA 3ZYZA 3P0XA 1RLDA 1TZ7A 4GLEA 3W7PA 3VDAA 1PKMA 3E49A 1M5WA 1XRTA 4GOAA 1W8GA 1MRAA 4GO8A 1XYFA 3C4UA 4P7OA 3VNJA 3N73A 1TRIA 3BAIA 3AS3A 4XIMA 3LHZA 5EB8A 6TAAA 3WBYA 4C6CA 2QXWA 3GXTA 5LIKX 2PDQA 2YX0A 4Y9OA 3WJWA 4ASTA 1C92A 1MDRA 4NASA 2A2IA 4GHRA 5FF2A 3BMVA 4D8ZA 1DJGA 4P8UA 4HA4A 4D6EA 4XZBA 1UD6A 3FIGA 2EBNA 3GIQA 2PWVA 4HK6A 3NQ8A 2DIKA 3AHZA 1W3JA 2MNRA 3PY2A 4IQEA 3RK8A 4M5PA 4MZ1A 1NQ6A 4NX5A 2GUUA 1QNRA 1X8CA 1LBFA 1JUKA 1O66A 3WIJA 2CWNA 4AZCA 1TFVA 4JTEA 2HSAA 4BCEA 4XO7A 3G3MA 1NF7A 1P0KA 3NQGA 3NJ3A 1XXXA 2E8YA 2E1WA 4LCRA 2ZDRA 3KDNA 4R7OA 3G18A 3PWIA 5CC3A 1LLWA 4PUKA 1JEZA 4TV6A 4DAFA 1EXBA 1AL7A 4D6HA 3DYPA 8CGTA 3QLDA 4HZ8A 4U10A 1WKFA 5CAKA 5EBUA 2QT3A 3AWOA 1KLYA 3UVIA 2F6UA 1FWFC 3GNOA 4E4FA 2IQ0A 2VVNA 3UT0A 1LQ2A 1J12A 4ZO6A 2V81A 1TV7A 1GG0A 1S2VA 3KHDA 3DGRA 1T5AA 4R3UA 4BS0A 2IXVA 3WLKX 1EXPA 2ZADA 3EEZA 2FPTA 2Z2AA 1J9YA 2J7GA 4C6LA 3MP4A 1VIZA 4UQ9A 4U2ZA 1VJZA 3D0CA 4JFTA 3IJQA 2QS8A 1TPFA 1J0IA 1JD7A 3RYSA 4FNRA 1DQXA 3LERA 5AHFA 3IRSA 2HXUA 2OQHA 3BLIA 3U7VA 1UYQA 1UD2A 3M0VA 3DC0A 5CSSA 3NCOA 1HJSA 1FWIC 2OODA 2G4JA 3C0LA 1FHLA 1R7AA 4JFUA 3BGGA 4NZ3A 4BFAA 3GHRA 4DNMA 1FXPA 3BOFA 3HB9A 1OK4A 1QATA 3SQSA 2A7PA 2WNNA 3F5KA 4GZJA 4ZEPA 5FSDC 2RGMA 4IIHA 3GDLA 3TTOA 3FDGA 1US0A 1UUMA 1ZB5A 4V15A 4ALDA 2QF8A 3N2BA 4IGHA 1UUOA 4CD7A 3QTPA 4S38A 3LUTA 2QCNA 2J8FA 1M9HA 1SZGA 5BU9A 3SCNA 2E28A 1KCZA 1FHDA 4YTQA 1PZ2A 1L0PA 4AX6A 4QQ3A 4WVXA 4R27A 1NARA 3QLLA 1KO0A 4HZ6A 1YEYA 5KTLA 2ZX9A 2WZHA 2FDSA 3M0LA 4JTLA 5J5RA 1SYTA 1H2JA 3FEQA 2D2OA 3ZIZA 2WJDA 3WF1A 3BW3A 3LN3A 1DWIM 2C91A 3WD2A 5D9NA 4DBSA 3B3DA 2Y62A 5I79A 3V4BA 3MU7A 3WMBA 4LVGA 1XIMA 3LS9A 4WDXA 2W27A 8TIMA 5ENLA 2D2GA 5E0FA 1CLXA 2Z1KA 2BOEX 1NY1A 2WJFA 2J8GA 3E2SA 1XCWA 3T0TA 1KBLA 2ACQA 3UCDA 1KQYA 4TOQA 1Q66A 4X61A 3WJXA 1MI3A 1YPXA 4HHHA 2Q8XA 2VX4A 1T40A 1J93A 1QO2A 2OX4A 1SMDA 5I3JA 2EJ1A 3SY1A 4YMZA 3VKCA 4UOJA 4KEZA 4P2VA 3LQGA 4XAZA 2VOTA 1VEOA 3QC3A 1IQ8A 2X8RA 4LS0A 1RD5A 4L6HA 5FF7A 4AZBA 1XCXA 1QI4A 4ICMA 5IOBA 1GEHA 5G2IA 1NF0A 3C3NA 2NT1A 4B9YA 1KV8A 1WDWA 1JNDA 2A0NA 3AZRA 1JYWA 3SGUA 4ATWA 2ZRUA 4CEXC 1RPKA 3CV6A 4DUXA 4NZJA 1G6CA 1TWZA 1KC7A 3W1RA 3SCOA 1RVGA 2Z26A 4PB3A 3PJXA 5I23A 1BVZA 2GGIA 4MJ4A 3TC6A 1XYCA 1TJPA 3DHFA 1REQB 3FGCB 2VZTA 2HWGA 2E77A 4HJFA 3ZVHB 1RP9A 1UKSA 2V9DA 1BRLB 1MZRA 2GDQA 2O7SA 4C1NA 4GPNA 2OR2A 4HOXA 1BFNA 1W91A 2QJGA 3OGSA 3G1FA 3SEPA 4FNPA 3SAZA 3TIMA 2CZEA 3LNPA 2CLIA 1XQLA 5E09A 3VKBA 4GUFA 4QLJA 1SW0A 3QYQA 2ODOA 1IIGA 2Y89A 3L12A 3NG3A 3C5QA 4JTGA 1F76A 2FH6A 4BI6A 5CBBA 4GH3A 4W89A 3TKFA 3IRDA 1YNPA 1OT1A 1IXOA 1VFOA 1F5ZA 1IGWA 4D72A 3UW6A 4FP1A 2RDXA 3HM7A 2WMJA 1GTEA 2HZGA 2YDRA 1HNYA 3A21A 5BOEA 1BWKA 5K9XA 2ZUMA 3QOMA 4JIIX 4QGCA 4FNQA 1UR1A 4EF8A 5TIMA 3M9YA 1D7KA 4AHPA 2WOQA 3WH9A 1DE6A 2OSWA 4HNOA 4A4AA 2WPBA 2GJPA 1GW9A 4ZXOA 2DJLA 4JIRA 3CWHA 3DC8A 3H4WA 4QLLA 4ZCWA 1DYSA 1BVNP 4GXWA 5LYRA 4ZB5A 2YA2A 4YIWA 1R3TA 3S6TA 3RR4A 3H2MA 3O06A 4JQ1A 1TMQA 1XFCA 2Z24A 2PDXA 3CO8A 2UY3A 1HKJA 2BXYA 4R85A 4S3CA 4MKNA 2J9YA 3Q94A 2A3HA 4JYDA 4WIWA 1OCQA 3E5BA 3WH8A 2AQOA 3GG1A 3VFCA 2HS6A 4R53A 4HA3A 4LAUA 2YZ5A 1U1UA 4KT2A 4IICA 3CHVA 3W7DA 4YNGA 3FEMA 5DO8A 1R3RA 4U2YA 3BE7A 1FCBA 3OA5A 1G69A 2VZVA 4RJEA 1R2RA 5A1AA 3KVKA 2OLSA 4RW5A 3KOZA 1IT8A 2ZRYA 4MIMA 3WLOA 3PZOA 1VS1A 1MO0A 4LC6A 4PC8A 4V28A 1O1HA 3RLGA 3MBFA 3KFTA 3M0IA 3M5ZA 3NZ1A 2QUUA 1ONWA 4NL1A 1AJZA 3GR8A 3URBA 2A79A 4NAFB 4M0XA 1O1ZA 4HN4A 4V2XA 2E09A 4FLOA 3OP2A 1ZENA 3U48A 5JBFA 2DJXA 5T9BG 3HZ3A 4F0KA 3D3FA 3UZXA 4Z1YA 1XIIA 4LB3A 1FWWA 3LDVA 2IKJA 1AG1O 3TTQA 3QJAA 4IXXA 3II1A 3EB3A 5LIXX 2PTWA 2V30A 1HGYA 1LL6A 1RH9A 3PG9A 4HG6B 3HU7A 3I4EA 3FKRA 2RDTA 3LM7A 1V8EA 3GUWA 2BOFX 4DF2A 3HV9A 1EC7A 1MEHA 2G41A 2ZA3A 3CUIA 1LRQA 2DIEA 5MF5A 4XK2A 4DIAA 5AYIA 5KSWA 4Y9AA 4AEEA 2ASHA 4FXJA 4GX8A 3O6AA 5HANA 5DY3A 5GQBA 2H3DA 2X0YA 2QZRA 2OLHA 3F4VA 3S5OA 1A53A 1VCGA 4FI4A 1WDSA 3KVMA 2VO5A 3MUIA 3EDFA 5D37A 2I5GA 1JUBA 2G3FA 4CNTA 4UCFA 3DENA 3U6WA 1H1ZA 2NUWA 4NNCA 1XS2A 3SJ3A 1RCXB 2GK1B 3NL6A 1DV7A 1LYXA 1HG3A 4NP7A 1WNOA 2ZXAA 4P02B 2Z29A 3QFWA 2CLOA 3S2MA 1TQXA 3W07A 1CEOA 3OBKA 3DCPA 2GGHA 2JEPA 4DWDA 3UYIA 3CUGA 4OU1A 5CZSA 3LTPA 3PBGA 3JS3A 3KBMA 1MNSA 1V7YA 1ISXA 3AYSA 1L6YA 3CZKA 5D32A 1OZQA 3NL3A 3VKDA 1W9XA 1OK6A 4PSPA 2QJMA 3PANA 4PMZA 2INZA 2BX7A 5HWMA 2OG9A 1YADA 4IF2A 3V1PA 4XTIA 1MW0A 4PUUA 4FNTA 3VAVA 2POZA 3KXQA 3DFOA 3M16A 2PDHA 3RHGA 5DFAA 3MUXA 1GYMA 2J47A 2PDFA 2DW7A 4IJCA 1R9ZA 3KOWA 3RLHA 5A2BA 1WOAA 3DECA 3VM7A 4MZ8A 4XZWA 4PR4A 1E4NA 4PE8A 5T8GA 4M1RA 4XUGA 4LPCA 2XHYA 3I7SA 2XJ7A 4RZBA 4DBEA 4QCEA 2PF0A 4ZXLA 3PPHA 3PWAA 4M6UA 1P48A 1U1HA 1HJXA 3SRFA 2WJZA 1KBIA 3NEVA 3WJSA 3QKEA 3E2QA 2JKEA 5A2AA 3PULA 2HPIA 3GR4A 3ZS4A 1XIEA 4UOQA 5DRIA 3W23A 5FI8A 1B57A 2EGZA 3K2GA 2VWTA 3LD5A 1ZY9A 4FX6M 5DY2A 5T91A 1QNVA 3PBUA 4H9MA 3P3BA 3F2BA 3NQMA 3S9YA 4JX4A 3BSMA 2QKFA 2A85A 4EXBA 4MB4A 2OO6A 1RQEA 2FHCA 3SFWA 4WKFA 3E3HA 1OF8A 1TJ1A 3LV6A 3JZUA 1GONA 4AZIA 3KTCA 4GO9A 3CC1A 5AVNA 2D0HA 4CVWA 2PP3A 4NZ5A 4MGGA 4UFKA 4K38A 5HWJA 3T55A 4IFOA 1VFHA 3QW4B 4M80A 4N42A 1Q4WA 1TR9A 3TQPA 5H8PA 2WLZA 2BZNA 3KM8A 4CGTA 2Z0IA 3W2JA 1E9IA 2OELA 5L9FA 1AH4A 3UZZA 4JL2A 4S3FA 5C5YA 4PMRA 1XSKA 3NZGA 2GVJA 3KZSA 4ACYA 2W62A 1QASA 4AHQA 4HYRA 3W22A 4I3GA 1AODA 4LC8A 1KGXA 2FHFA 2PRLA 5LNWA 1WZMA 4LVBA 1XPYA 3QYSA 4LSBA 1KM0A 4UTIA 3UR8A 1XLKA 1GQIA 3O3RA 4UNLA 4RE4A 4UNIA 4EE9A 1Q7ZA 3BGAA 3MUY1 2ISVA 3M46A 1UZ4A 4PMDA 3G77A 3AOFA 2XVNA 1AW1A 4HSNA 3KVLA 4HGXA 2BTMA 4NJKA 1OD8A 2YL6A 4IQLA 1LOSA 3DG7A 4G56A 1JZ5A 3SFKA 4TIMA 1N8WA 3FOKA 4MTVA 3I6RA 1W54A 3HQOA 2OFJA 3CAQA 1O7AA 1OSEA 1C8YA 4AEFA 3AIVA 1B2YA 1I1WA 3VYLA 1U5HA 3ZR4A 1FCUA 3UJFA 3UG4A 2C19A 5GJMA 2ZRXA 4WGHA 1UIOA 1SSGA 1JPKA 1UPMB 2Y1HA 1KLZA 3IARA 4O15A 4RV8A 5HA7A 5FESA 2GUBA 4EAMA 5FEZA 1E4LA 5HMDA 3UWQA 3WDPP 5EJZB 1ZBCA 4HN8A 3W82A 1AK5A 5JH2A 1KTNA 1PX8A 4QNEA 4MKVA 1VHCA 4G2DA 3OLGA 5I77A 3JRKA 2ZCGA 1J4EA 2PTXA 1XD1A 2WZEA 1MVYA 4MWAA 1K1DA 1AQHA 2YL9A 3N13A 3I7QA 3EA3A 4X2PA 3BTNA 2V69A 5HPOA 4YTTA 2CKSA 4G6CA 4M29A 4GYPC 3TQ0A 3V5CA 3C2OA 5CEWA 2OXNA 3QF0A 1DORA 2H6RA 1LM1A 4E4PA 3GXDA 1HL8A 1R86A 3L0NA 3LCHA 5LGZA 1DWJM 4QE4A 3C6CA 5FF0A 5I09A 5HJLA 3ECQA 3AIEA 4TTUA 5F2IA 3SUTA 4MNMA 3ORWA 3IIXA 1JCLA 1ITUA 5TBOA 1I8JA 1I4NA 4MMWA 4K3ZA 3K4WA 2OKOA 5I03A 3QW3A 2ZOXA 4K36A 3AJXA 2ICSA 4W93A 1CGTA 3VU2A 1RQBA 3ATYA 3LOTA 3G0SA 4I5UA 3RDKA 3Q45A 3T78A 3IK2A 1E0WA 3UG5A 2Y8VA 2POTA 2VQTA 5CH9A 5PTDA 3VE9A 4WR3A 1J5TA 1KWKA 1IHIA 1PHQA 3QHMA 2FPYA 3WQDA 1Q7QA 1HJQA 5AVHA 3UXKA 1CXKA 1NP2A 3MO4A 1JYVA 4OOUA 1XKYA 2V5KA 4NG3A 3LI0A 1IXNA 5G5IA 4AD1A 1XDLA 1UWIA 4C7FA 1EC9A 3FKKA 4R7JA 3V5FA 3U4FA 4IFKB 2Z27A 5C7VA 2CEQA 3FVDA 4WQ6A 2DDXA 4XSMA 4PBFA 3S6OA 1UQZA 1XRSA 2C16A 4HMDA 2Y4SA 5HAOA 2XTKA 1SSDA 4WDTA 3ITYA 3BJSA 2WPGA 4AY7A 4KCUA 3VO0A 4Q4PA 1WDPA 2VP8A 3MKVA 3CUHA 1OZMA 4FIRA 3GXPA 3GS6A 5HNTA 3L9CA 4E3VA 4TX6A 1KQZA 3UY7A 1KBJA 3TW9A 1AUSL 2YCEA 1EJSC 3PWGA 2QULA 4LH8A 2CLHA 2AGKA 1RAKA 4LQ1A 3GZAA 1V08A 3CT2A 4XSLA 3PM6A 4D6FA 5JUVA 4Y96A 2BY1A 3W76A 4OHQA 4GC4A 2FZMA 4Z1AA 1XFBA 1H5VA 3PUGA 4E5TA 3GC2A 4EPKA 3N4EA 4F2UA 3O15A 4OZOA 2PI6A 5FEXA 2XSXA 1WOBA 2FMNA 1OEPA 4IP7A 4LAZA 4PYSA 2PB1A 1R87A 2WVVB 1Q6LA 1WXYA 2XVKA 1QOPA 1ZQ5A 2QPUA 5I3GA 4JEJA 4YJ5A 4X60A 1KFJA 1M01A 2GQ8A 3L5LA 3U5UA 1ONEA 4GNJA 1SR0A 4Z1BA 1HO1A 1KM6A 2G0WA 2O7QA 3PAOA 3W2NA 2XM2A 3KBJA 1ZU8A 2OT1A 3GYEA 1TUXA 2HBXA 3P8IA 1KD0A 2XIMA 4H9TA 1M6JA 4LOCA 4JKKA 2HISA 4TQTA 3P5YA 5GNXA 4GJ1A 1OGBA 4ZA0A 5A6SA 4DEFA 1IEWA 1TTJA 2IQTA 3TAKA 3VUSA 2BGSA 3ARRA 2OKTA 2PDGA 1W9PA 3QTGA 4H41A 3N9RA 1Q8AA 4XUYA 5AC7A 1HP5A 3NM3A 4M82A 1B0IA 3PZGA 4UR8A 4KWOA 3UJEA 2BS9A 4WSHA 2GDVA 4RNIA 1FWJC 1GQNA 3D3AA 4HPHA 1MQQA 3WH5A 3NYZA 2ZQ0A 4M6VA 4NX0A 1UG6A 4WUIA 3DYMA 4PMNA 4DI9A 4J5NA 2IMRA 3S5ZA 3CGTA 3E74A 2V67A 3RITA 2ZXBA 4LCQA 4S3DA 5FJRA 3T6CA 3W7IA 4HOZA 3M0MA 4ZO8A 3WLQA 4KESA 3TN3A 3FNDA 3I3DA 3ALFA 5K2ZA 2DQWA 3U2CA 5A8NA 2XSBA 3L0KA 7A3HA 3I3EA 3THCA 4EWJA 3DFSA 2QUNA 1A5MC 2YCLA 1H60A 4ADSA 2I9UA 1KB3A 4TVUA 4WCJA 2OT0A 1TJRA 2GJXB 3NQBA 5G1MA 3GBEA 5IM51 1ICPA 1DJXA 3ARZA 5C55A 3XISA 4J35A 4H6RA 5BWAA 1R5YA 2VCCA 4GUGA 3FJ4A 2PU1A 4WKHA 4L9ZA 3W1TA 3GXFA 3P62A 1UWSA 1LG2A 4GIYA 3N12A 4NJJA 1R46A 2ZBTA 4IIBA 3VCRA 4DYJA 2Q6ZA 1XM3A 3CQKA 2DVUA 4LU0A 1WXZA 2WMHA 3MZ2A 3N14A 4WXYA 3CV1A 3XINA 5BXSA 4JCMA 4MZYA 3THDA 1A4MA 2H8XA 4HHPA 2E9LA 2R82A 2ZWYA 3GNXA 3S0CA 3B4YA 3ZQ9A 4GNVA 4JIQA 3FCPA 3SN0A 3QVQA 1GOOA 5LSMA 1Y0EA 4B9ZA 4ES4A 4XD5A 4FLQA 4AMCA 4UR9A 4L4PA 4GCXA 5CPNA 3FK4A 2Z1BA 4WJ8A 3TFCA 5D04C 4LV4A 4LBSA 1LT8A 4KERA 1MEWA 4WXZA 4P00B 1GOXA 3BZJA 4Z2HA 2CBJA 1GORA 3R8GA 1XLDA 2CITA 1WCGA 7REQB 5C0QA 3MB9A 2DT2A 4FS9A 3M44A 3RLVA 3KTXA 4MY9A 3TMLA 4QE1A 4YS1A 1QHPA 1LL7A 1XIGA 1PBGA 3LZ5A 4ORIA 2F7FA 4W85A 2VEPA 4CCDA 4PUJA 1RY0A 4G5DA 4O17A 4W5ZA 2W9MA 1VRXA 2HNEA 1Q4NX 1QU4A 2BHUA 3IACA 1NEYA 2FTYA 3HIJA 3VOFA 2C8NA 5AYYA 3DKJA 4JNZA 1X38A 1HO4A 2J4GA 4NKCA 5TQLA 4QHRA 3AXHA 3UXAA 4JKMA 1A0CA 1Z42A 1EEXA 1OABA 3GKAA 4U33A 1KFEA 4IMGA 4AG0A 1FKWA 4ZQPA 3BLKA 3SUSA 1CGYA 4BA0A 3IK4A 2ACRA 1V02A 1U5VA 5AECA 5ABTA 1P6BA 3QGKC 1DIDA 3HPAA 3BMWA 1KR1A 3S5YA 3PBVA 5EMLA 4JHZA 3UESA 3SI9A 1O4UA 4ENLA 2VTFA 3KEHA 4WOZA 4DI8A 4QRNA 2WQPA 4ZE5A 1AZ2A 3LI1A 4Y9NA 4OBTA 4H7ZA 4MYAA 2E5DA 2QJJA 5D4YA 3PFMA 3G8EA 4DBUA 3UPWA 1JRCA 4WSJA 2CWXA 4RDVA 4W8BA 4OJYA 3ID7A 4KWWA 3VNIA 4LAKA 3S4TA 3OTRA 1XHGA 3H2AA 4ONVA 4QBXA 1OIMA 3NGFA 4ICNA 3VOIA 1SU5A 1UWTA 5H2ZA 4E0CA 1EF3A 5HNUA 2ZE0A 3GXNA 5C9ZA 1XD0A 3ALGA 1QR7A 1W37A 5C2XA 1EHNA 1GOWA 1V6TA 2FPVA 1HGWA 3W88A 3P84A 2O4QA 4W7UA 1AD4A 4XKMA 2XZ7A 4PZVA 3IJ6A 4N02A 1CW2A 5FJIA 5DANA 3B0XA 1SW7A 2AGTA 4XG1A 3MHGA 1UD5A 1JF6A 2XGBA 1Q3NA 4FIQA 2P76A 5EU9A 5CAHA 1OADA 3I7RA 4JTFA 1H0GA 1RZMA 2OGYA 3CL6A 5J8LA 3RM9A 4W84A 3W81A 3V35A 4GKLA 3FDKA 3QR0A 3UETA 1MQPA 1HJWA 1OX4B 3KCOA 1DP0A 4AMAA 2DU2A 4GH1A 2GQAA 5C6MA 4KFNA 3WLMA 3ITVA 3GH4A 3GHUA 3CQIA 3BH4A 4AXKA 1L6GA 1VPYA 3N29A 3SSZA 1FFQA 3K8LA 4NUWA 1FH9A 3P6LA 4EANA 5DMMA 4LRTA 4H9YA 2PWDA 1NWTA 4CLMA 2Y8UA 4P7NA 1JDFA 6XIAA 3W9ZA 2P0IA 3NQ2A 5DX7A 2FGLA 4O54A 1UD8A 4HK5A 1FWGC 1NOFA 1PDZA 2OQLA 9XIAA 1TWDA 1TV8A 2R8WA 2PGWA 4US5D 1UWQA 4LUTA 4REQB 1QI3A 1YBQA 3LGEA 1FRBA 3CXOA 4GINA 1Q2SA 2PLKA 2J7EA 3ANYA 1NOUA 3IWPA 3HF3A 5CLWA 3ANUA 3CQ0A 3TYUA 1UH2A 2Z28A 1EYEA 3LHWA 5KITA 3BCJA 3VMPA 1EB3A 1AFSA 1DJZA 3BZGA 3SDOA 4R9XA 3TXZA 3T05A 1RY8A 4LTSA 2PTYA 4Q3MA 2UWFA 1ICQA 1QNPA 2VFEA 4D9PA 3TJ4A 1OC7A 3EMCA 3P67A 3BQ5A 4MLRA 3C2FA 1U2YA 3TJIA 3AIRA 2CHNA 1ONRA 1EP3A 1VEMA 3MWCA 1SGJA 3UG8A 1C90A 3C8NA 2WNZA 4JNYA 4A22A 1BYAA 4JHOA 3APTA 1IEQA 4UTWC 4C6EA 1TA3B 3QC0A 3BCDA 2F8QA 1Y65A 1W32A 1W9UA 3HFYA 4N9EA 5DXXA 1SFSA 9CGTA 2VVSA 1AJ0A 2PLCA 1YW1A 1ZAHA 3VCNA 2WHLA 2ISWA 3G5EA 3H53A 3UG3A 4ERIA 1T0OA 3MVTA 1UWAA 1C7TA 3SB0A 4ADTA 1CYGA 2GJNA 4YVXA 1FBAA 4IJRA 3OBAA 3LA4A 4WRHA 1H41A 1V3LA 2FZNA 4C6OA 2O92A 1KM1A 2X1SA 4Z2LA 4AF0B 2I16A 4HZ7A 5I00A 3GTNA 1R85A 3WZ0E 4Z17A 2R94A 4FNUA 1DE5A 5HDRA 4I6VA 1UWRA 4Q4RA 3PP7A 1O5KA 1F6PA 5HMSA 3M5YA 5BXRA 3W6YA 3I68A 3TV8A 1WPCA 3WF2A 4B4HA 4JCLA 4MY1A 4L61A 2VELA 3KWXA 3T7VA 3AHXA 4RV3A 2ZUVA 3KE0A 2B7QA 3P60A 1VCVA 3LG3A 4WK9A 4DF0A 2GYIA 1S1PA 3A12A 4OV4A 3U9IA 4AIEA 2VL4A 2OMAA 3BLLA 4E6MA 4N4PA 2J8TA 1J2BA 3VZYA 2YYTA 1XKJA 3RIKA 4IIFA 3TQKA 1JGIA 4X22A 1XR2A 2VDHA 4L64A 1FDJA 3O16A 5DBTA 1TV4A 4L56A 3GFXA 1ZNNA 1EWDA 3RF9A 3AS2A 3WF3A 2IUZA 3VX0A 3ARPA 2DZBA 4NI3A 5DMNA 3EOLA 2Z00A 3O6YX 2YFOA 3OZYA 2E1DA 3WDHA 4K39A 3A23A 5E9AA 3L67A 3AUOA 3LENA 3H22A 4M56A 4G1NA 4XD4A 4QG8A 1EJ7L 3L4TA 3N04A 1TV2A 4DWSC 4JIHA 5XIAA 1Z7AA 1EIBA 2PLJA 4UZSA 1JJKA 4EKJA 5U7SA 3QH2A 4HSHA 3V16A 4RL3A 3R25A 5H8MA 1RQHA 3W01A 5AZ0A 2ANUA 4G7FA 5DCDA 5IXEA 1DJQA 3FA4A 3CEPA 3DEQA 1AA1B 4H1ZA 4L5ZA 3HBLA 2Q71A 3WNNA 3U2EA 1MW3A 3M7WA 4MYXA 1LRTA 1GWJA 2VX6A 1A5LC 1RBOB 2REQB 2A3EA 2Y5EA 4LXFA 1DKWA 4PRTA 4L1GA 4IQJA 3L4YA 3GG7A 2OWXA 4KWSA 3CPRA 4Z2GA 1WKDA 4I8DA 3QV6A 3CWNA 2WVVA 1THFD 3MMUA 5F4WA 1RJRA 4O0QA 2YXXA 2CESA 3GWQA 4AZ7A 3GLCA 3ZJ6A 3BUVA 3A47A 1C8VA 1GQLA 2FTPA 4N0RA 3CMJA 1LZOA 4MWAC 2B81A 5G4EA 4H00A 1BWVA 2W67A 3DH7A 3B8VA 4GWEA 3L2LA 4BWLA 3SCTA 3LRLA 4M3PA 4YYCA 2DUZA 1O95A 2YBTA 1R7OA 1XIJA 4S3KA 3ANVA 1C9WA 3IGUA 1FH8A 1A0DA 2PDCA 4NZ4A 4X9SA 2ALDA 4NJIA 4K68A 4J2MA 2GGEA 4MAVA 2QIIA 3S2NA 4TV5A 1O6IA 4YWIA 4F40A 4LJ3A 3OLDA 4PBGA 1KWGA 5E0CA 4DXXA 4ZFCA 2EAWA 3EBVA 2XIQA 1JAEA 1YDOA 4BQ4A 1FKXA 5IFTA 2X7VA 3QV9A 3W7KA 1GTHA 2P0OA 4JFWA 4AAJA 4A3UA 1MFVA 3DFHA 3AALA 1AMYA 3NO5A 4IPJA 1ISVA 1BGGA 3EPNA 3MO7A 2QAPA 1UR9A 4LCSA 3M64A 2WSRA 4INFA 3TSBA 3URQA 2VRJA 1JI2A 1Z44A 4Z0JA 3GYCA 1I75A 3NDOA 4RNHA 2Z2UA 4IIEA 1V3MA 1FWHC 3C2EA 4Z2JA 2CBIA 2VXNA 3WD3A 3WQCA 3WNLA 3PNUA 2E6FA 1XG4A 3VTRA 1LQAA 3GTFA 3W3OA 4A29A 3Q58A 1M65A 4UB9A 3H23A 1GVOA 1NQKA 4L65A 4XZMX 5IFPA 3O63A 4J7RA 3LSCA 3FHAA 4LF2A 1XSIA 1UD4A 2YDAA 5EMJA 2WWCA 5CJNA 4P8VA 1QW8A 1QT1A 4JKLA 4Q6XA 2PRMA 2QYGA 1OD0A 4PL1A 2VDIA 4W7WA 4UFJA 3RRAA 1AH0A 3JU2A 2FJKA 1IGSA 1UJQA 2Y24A 3SUVA 3W1NA 1IR1A 2WMIB 3RM8A 4AD3A 1OYBA 2Y70A 4FHAA 1ZJBA 1E6RA 5GNYA 4DVOA 4S3AA 3T81A 1Y5WA 3ARUA 1CPUA 1P1MA 3GO2A 1E1FA 3BAXA 3GU2A 1VFSA 4B5TA 4AFYA 3KZPA 3V36A 2Y85A 4AWEA 2GGGA 3RU8X 1H1NA 4PB4A 3NPWA 5LHEA 1NDWA 4M8UA 3WBEA 4XBKA 3KDOA 3EWWA 4IMFA 3PC0A 1RA0A 2LLEA 3LMYA 3RCYA 2XFFA 1VHNA 4UQAA 3T8LA 1FWDC 1PTGA 5HR7A 3CMFA 4L4LA 5I06A 2V5LA 3GNNA 2YLAA 3W85A 3B8TA 2Y5JA 3AIWA 3F4WA 4HBKA 3VD3A 3AYTA 2WLYA 2J9ZA 1BF6A 1TPH1 3RRXA 1LF1A 1LOLA 1WZKA 4MJMA 4TMBA 2Q8LA 1IWPA 4UTJA 3PZTA 3LRMA 1MUWA 2E5BA 3TONA 2OU4A 3BURA 3AUJA 4WLCA 3NOEA 3QQ1A 5DF0A 3F1QA 1BQGA 1TJ0A 1CWYA 3R43A 1F7BA 2X1IA 2XDFA 2V5JA 2QUTA 4A3YA 4WZHA 1VLIA 3S47A 2P50A 3GFZA 1C8QA 1W9BM 5BRPA 3O9NA 2XIJA 4JTIA 2ADAA 3WQWA 2V5DA 5D33A 1UOZA 6REQB 1EOKA 4IH3A 3UCQA 5LNRA 2YCJA 1F6YA 3DX5A 4H9ZA 1Q6QA 4TVCA 5A3HA 3TYAA 3VPLA 2X30A 1HUVA 4JTSA 4O12A 4BHYA 3USZA 3WEZA 2PCQA 4HT3A 1VJIA 1F6KA 2YSWA 5BOOA 1KA9F 2ZXQA 3CB3A 1FFRA 1V6UA 1YYAA 1H1YA 3VGGA 4HHMA 1DJNA 3RJYA 1DIEA 1CZ1A 3CUZA 2D23A 1H11A 1XLCA 1MUMA 2GQ9A 4PMXA 2PS2A 5AHMA 5A2CA 1E0UA 4C6QA 2A21A 3M7SA 2V5CA 2OGJA 1D3GA 2PD5A 3NTYA 2AL2A 2BVTA 3QMSA 1D7FA 2QAFA 1XGZA 3O0KA 4AVFA 4B15A 3DDMA 3VDHA 1SM9A 1REQA 2C3ZA 3OVGA 2W5FA 1KV5A 4O28A 4B3ZA 4GIEA 1FHVA 3BQ6A 3PJUA 2PGRA 3GFYA 3RG6A 3IAPA 3ITTA 3RX3A 3SM0A 3HO8A 5C9UA 2X1UA 3UR2A 3FV9A 1GZJA 4EIVA 1J0YA 5IBXC 5HATA 2NQJA 5FL0A 1R9XA 4C5YA 2AKZA 5IHRA 2V2DA 3QY8A 4LV9A 3ITXA 4IT1A 3PR2A 3BANA 1WP6A 5DLCA 1U83A 2XIIA 5FEPA 4B5WA 3ABXA 1RK5A 4QNWA 3CH0A 1FWAC 1X8FA 4CU8A 1H5YA 3M0HA 4MJ2A 5E1QA 2FZ8A 2VX7A 4Z1DA 2VURA 3GX9A 4IMDA 1AQFA 1TPEA 4NXSA 1PTAA 1CB2A 3L7RA 4FF5A 2PLMA 3M0JA 3MI2A 1A5NC 4DJFD 3FX4A 4Q8PA 4HCLA 1PUDA 3ZT7A 1XLMA 3TLLA 4O8AA 3TFXA 4PFMA 3LHUA 1MEIA 1KFKA 4RR4A 1AJ2A 3PPFA 5FF3A 1AW5A 1RK6A 5EKYA 3FA3A 4L7ZA 4KCTA 1J5SA 1O5XA 4ZTYA 4U28A 3VIOA 3ZT5A 5CPMA 4LAMA 4QE5A 2AQVA 4KFOA 3ERPA 5I02A 3CZGA 3VMOA 1WX0A 3MSYA 1V7AA 1K9EA 3AS0A 1T7LA 1A3HA 1PZ1A 2G3MA 4B5SA 5CGTA 3IUHA 1XG3A 3O2LA 3FW6A 4ZQMA 3BJFA 4MPKA 3TUUA 4V1XA 2E0PA 4UCGA 3UJ2A 4XAGA 1TIMA 4O0KA 2KX9A 4C60A 1U5JA 3NVTA 5GNZA 5BROA 4UZUA 4YYFA 3EOUA 5LNSA 3TSDA 3EB4A 1OFPA 5J04A 4A2SA 4GFIA 2DY3A 2QJNA 5EMUA 3TOYA 2CZDA 4UFHA 1OX4A 5A5WA 2HPMA 3IEBA 3G0XA 3APYA 3UD6A 3M0XA 1EJVC 2C0AA 3LSBA 4LB4A 2ISFA 1OB0A 3PPGA 3GUGA 3MA8A 3W1MA 1DEDA 4Q8OA 3TJLA 5CGQA 3JR2A 4H7CA 3G2GA 2FB2A 1L2QA 4IPIA 3L2IA 5HNNA 2VR2A 1T99A 4E38A 5HJYA 3VK5A 4MF4A 1Q6OA 3W7MA 2E9MA 4MVAA 1DQUA 3ITCA 2PWHA 1W3TA 3P82A 1S2UA 3VIFA 5KINA 1IIHA 1TX0A 2ZRWA 3MP3A 3DYOA 2YZRA 1LOQA 1BYBA 1TPC1 2R1PA 5CZTA 4ML9A 3PSWA 1K7FA 5D2YA 1ADDA 3OG2A 5C7HA 2ZZ1A 1OQFA 4CQ8A 4KEMA 4RW3A 4ATDA 3PSVA 4XWUA 3UBPC 3SECA 3VDGA 4HOWA 3W84A 3EWXA 1TMLA 2WK2A 3CEUA 1BLIA 1JPDX 2WBGA 4GNKB 3WBAA 4ZVJA 4XVEA 4ROQA 4LYPA 1PIGA 1JCNA 3UPBA 3GZ3A 4ZB0A 3LB0A 5LNVA 1ZPTA 2CLPA 3J7HA 4DUVA 1VF8A 3CIVA 1IE7C 1E6SM 1U33A 1CGWA 5I3FA 3VINA 3CHCA 3VOGA 5ABFA 1B4EA 4UQCA 3R89A 4OOZA 1N8FA 4QITA 4FR6A 4O4VA 1UC4A 3VDBA 1L2UA 4JTUA 3AROA 1TWSA 2WSYA 4RK8A 2XH2A 2A3LA 1GPFA 3LPFA 5HNRA 1W2VA 1CI1A 1ITQA 3GDKA 4BWLC 4UR7A 1JI1A 1K77A 3LYEA 4OBSA 1EHAA 1GPWA 3TX9A 1QOQA 2QW5A 1H7RA 3B9NA 2P10A 3MMTA 3HMCA 1ISWA 4J28A 3WYZA 3ATZA 3MYOA 3TYDA 4AF0A 1W1VA 2QPXA 1G1YA 1UH3A 3B0YA 1F07A 4F48A 3IGSA 1AZ1A 3PPCA 2PU0A 2WMFA 3U0HA 1VJSA 1ZRQA 3UEQA 3MPGA 3MI6A 2OQYA 3INPA 4UXDA 3VMNA 1EBHA 1R2TA 4JY8A 4L1XA 4PUDA 4XD6A 3S5NA 5A6BD 3P81A 1BRLA 1PE1A 2B0MA 3H54A 3MW7A 3EAUA 3TXVA 1UKPA 1W1TA 2OSXA 2ABBA 1JFXA 3FYOA 3WQOA 1JPMA 1DWGM 3B9AA 2NV1A 4O1CA 1GQKA 3POHA 3R7MA 2PSNA 2EEXA 1DWAM 3FAXA 4P5UA 2SFPA 2RAGA 2V8ZA 3HGJA 1PZ0A 2W4XA 4DWSD 3N6JA 3GDTA 1IWAA 1US2A 4ZO7A 1IZCA 2HBVA 2JF6A 1F3EA 5E5CA 2BMBA 1LBMA 5T26A 1AVAA 4AC1X 2UZ9A 4JPGA 1W31A 4DBWA 3DFNA 3OHIA 2YKKA 4ZO9A 4MNLA 1X7IA 2QJIA 3BO9A 2WVTA 3L5AA 3LCIA 2FZDA 2VI0A 4BF5A 1P43A 1R3VA 4V33A 4DZHA 2CU0A 2X2GA 4XO6A 3TC3A 3VD9A 1TWWA 1MSSA 5CC7A 2X1TA 3LHYA 1S39A 3UFYA 4ZTXA 3BXWA 4ZQOA 2GLKA 5HR6A 1VENA 2YA0A 4WDWA 4BK9A 1T8XA 4NSBA 4HIBA 4XB3A 1ZLPA 3R10A 1EQPA 4GXMA 4DJDD 1W56A 1R47A 3OU8A 2P5NA 3BV4A 3CZLA 4DXVA 2X42A 1R3SA 3A9BA 3H4XA 4XX6A 3W7JA 4JICA 4D6GA 4CQDA 2CLEA 1MZHA 4PMUA 4CNUA 5C9RA 2OYMA 1XBXA 5A6LA 4C90A 4BZYA 3E5PA 3ZWSA 4HMCA 2QV4A 3S83A 1RHCA 5HQMA 1BSLA 1W6TA 4JR5A 1XLHA 3QMRA 1OY0A 4KRUA 3WDRA 5EPDA 1ZCOA 1TYGA 1GHRA 3LRKA 1NIUA 1ZS2A 4MKSA 5I3DA 2YFNA 1JDAA 4OFCA 3NXLA 3KS6A 1VLWA 4LUSA 1HKKA 1S3TC 2V3EA 4ZODA 3TC7A 1POJA 1N55A 2PWUA 1GKQA 3W7NA 4UOZA 3EOEA 5XINA 5AHLA 2Y88A 2E8ZA 1RALA 2INFA 4PA8A 3BAJA 2OEJA 4EX4A 3L4ZA 1DVJA 2CBUA 4BJHA 3XIMA 5A6MA 4UQBA 4ZMGA 4OE7A 2VC6A 4AU0A 1JVNA 1UIPA 1S5MA 1BGAA 4YCPA 4DO6A 4CQAA 1KM5A 3AMLA 1QBAA 1PX4A 1Q8JA 2V68A 4HJWA 4NJGA 4ZSUA 5E9XA 3W83A 3WH6A 2XH7A 1E0VA 4PCPA 1X98A 2J25A 4Q4MA 4AZHA 3M0KA 1OCNA 1XLGA 3QV8A 1CXHA 5I3KA 3P2VA 3W29A 1LTDA 1D3CA 4XAPA 4IHCA 5DMLA 4MB3A 5CZKA 3OVPA 3R12A 4MB1A 3WMCA 3L23A 2NVDA 2O9OA 2DGAA 4Q8VA 3M5VA 4RDZA 1DIKA 1BKSA 4AB4A 4DUWA 1N2VA 1KKOA 3QPEA 4W87A 4AIBA 4GK8A 2ZDSA 4XTDA 4TXEA 1SW3A 1UR2A 2WMKA 3W86A 1TJ2A 4JTHA 1OFEA 1KCKA 4FA3A 2XGZA 1XUUA 5ECUA 2WV8A 2PAJA 1UOKA 3GTIA 5F1VA 4JOMA 2NQ5A 4R5EA 4U3CA 3AXIA 4GRSA 4PMQA 2BVWA 3Q2DA 4G7EA 9XIMA 1HVXA 3ARTA 5AC5A 1PSCA 3ABSA 3MQTA 3M1ZA 4HNLA 3UVAA 3QQWA 1UC5A 2QJHA 4C6FA 1G5AA 1QNSA 2NUYA 2WC4A 1TREA 3K1DA 2YIHA 3HGRA 4O19A 1K8YA 2QGYA 1VB9A 1MW2A 3PZMA 3TW6A 1Y5VA 1VBJA 2GVEA 2J7DA 2WNWA 3UR7A 4Y90A 4P7QA 4C91A 3KTSA 1UW9A 3C2YA 3VGDA 1V79A 1J01A 2VGFA 2WKGA 3GBDA 3DFTA 4Q8QA 2Q3OA 2NX1A 4X2RA 1EDTA 2X41A 2P53A 4XVDA 1RCQA 3VFLA 3LLFA 4PL2A 2DZPA 2RHGA 1WB0A 2UBPC 2AMXA 4MUPA 3B9OA 2VFHA 3EX1A 4RXGA 4AD2A 1H49A 2ZKMX 4DJFC 3IJDA 3TROA 4U5IA 2Z6IA 4IL2A 3OBEA 4MWAE 2EPOA 4MSSA 1BD0A 1H63A 1Q5MA 4M51A 3WD0A 2OYKA 2J78A 3KWSA 3F7JA 1P7TB 3SSJA 4TO8A 3KBSA 3Q67A 5CPQA 3HMJG 4RKAA 4J3UA 1A5BA 1F61A 2QF7A 4IPNB 3WLPA 3IAQA 2PDKA 1EF2A 1Q45A 3V0SA 3WNOA 5HUPA 1DXIA 3VIPA 4C6PA 4IUOA 3UGRA 1JCMP 4JX6A 1XLLA 1M53A 3VI2A 3PZQA 1GJUA 1CLVA 3CZ8A 2Y6ZA 4GJIA 1NFBA 3UZJA 3OPSA 1K8ZA 4PULA 3E0WA 3GDRA 3WSUA 2EG6A 5D2TA 1B3YA 5MKGB 3B8DA 3OJGA 2ZZ3A 1UA7A 2YW3A 5BWFA 1IWBA 4PTVA 3R6IA 3EA2A 3PB0A 3UA3A 4Z42C 2W79A 1E70M 2VFDA 3SBFA 3N17A 1US3A 3O6DA 1CECA 4QEEA 5FD0A 1YPFA 5D38A 4O10A 4LY4A 3N4FA 3N11A 2HS8A 5EYWA 4D6IA 2FH8A 3KRUA 3PUEA 3QPYA 2XH4A 2O4MA 2RKXA 3S1XA 1SFJA 3AHTA 3TTYA 4S39A 1YNQA 4GZIA 2V5BA 1IT0A 5FAJA 3K46A 6A3HA 3AXKA 3IUIA 2C7FA 2D0GA 4WY0B 1EDQA 3WN6A 4N2YA 5M17A 4LX4A 3U5YA 4K7VA 3MHFA 4O4WA 5FL1A 1XIHA 4ORMA 3N2TA 4DJDA 1UP3A 1BWLA 4J3SA 2IS7A 1YQ2A 1DHKA 1KM2A 4ZGYA 1NU5A 2YDQA 4O52A 2OOGA 3CAVA 2WSQA 2DQXA 4YTRA 3ABRA 4FZIA 5TNVA 1PCWA 3UXDA 4OBRA 1IT7A 1XH1A 2WKJA 1FXQA 2DVTA 1YX1A 2YLLA 2X7WA 1X1ZA 3N15A 4Q7NA 5MKGA 2WVUA 3AYRA 2R1NA 2DT0A 4G9PA 3QMTA 6CGTA 1SUXA 1UBSA 4ZOCA 3CNYA 1EX1A 2VC7A 3WO8A 3BWWA 3M6DA 1E72M 1C29A 2JF7A 3R5EA 1VBRA 1M7XA 1DHPA 4YXGA 1DOSA 2BVYA 1H0IA 1UHVA 2NV2A 4MPQA 3ZLFA 5FKYA 2HE5A 2CZVA 4DYKA 1NDYA 4G7EB 2UY4A 4AHOA 3ELFA 1FVPA 4P7LA 2D69A 2A7NA 4QFUA 1EP1A 4B16A 5BZAA 2YPIA 2V0TA 4NAFA 4UTLA 3QFEA 4ZE4A 1W5NA 4FXRA 4GIAA 4RE2A 3DKLA 4LNYA 3ZJ7A 2NQZA 4Q6JA 3DI0A 2DSVA 3TJXA 3W1PA 1QPQA 1EQCA 4TR9A 1XGEA 2QHAA 2XZ9A 3NOYA 4E8DA 3ZVIA 4W8AA 4O18A 3DBPA 2VT0A 1MYRA 4RZ5A 4DBDA 4J9JA 4FOUA 5I24A 4O1AA 4N9DA 3QR3A 3STEA 4UNKA 2XM1A 5K3VA 3TTSA 3S1GA 4EVZA 2I57A 4HCHA 3HPXA 3VD4A 3B04A 2GSEA 4H6QA 4QISA 4JFSA 1NAL1 3GVVA 1E9ZB 4MY8A 2X2YA 2NSOA 5AFDA 2PDPA 3FYPA 3KL3A 3ARSA 2O56A 2WB5A 1IEXA 1TA3A 3ZMRA 4H83A 4NILA 4IX2A 3WJZA 4RPPA 3N19B 1TTPA 4EXQA 1KFCA 1WAUA 3A3HA 2ZTJA 1E71M 2WKLA 3A4JA 4F0HA 4PTMA 1EGVA 1VCFA 5A8MA 4KWVA 3T1GA 2PZNA 2ZRZA 3W7EA 3W25A 3V18A 1V03A 3PTQA 1ZZMA 4GYFA 4HA1A 3NAVA 4B3KA 1XH0A 4F0RA 1BHGA 2ZVRA 1HKIA 2R6OA 2P8BA 3QZAA 2DPEA 4NRRA 5D9PA 4TVDA 3B05A 2NLYA 1DPMA 1W3NA 3WQ4A 3JUGA 1E40A 1WA3A 4EPEC 2CHRA 3O1NA 2PODA 4HNUA 1SJDA 1O94A 3B40A 3DUGA 5AC6A 1Q6RA 2FQIA 1XLAA 4G1KA 5JVLA 3IJ8A 1CXIA 3ENLA 2EPKX 1IXQA 1F05A 4MWAB 1LT7A 4DRSA 4DJDC 3FXYA 3DU0A 1P1XA 4DY1A 2J79A 1CT5A 3LCLA 1YDVA 4O50A 2D3LA 2WHMA 3NUKA 2ZIDA 3FJLA 1VQTA 4NF7A 4W4QA 2FZBA 4GY1A 3A5FA 3MDWA 3N25A 1Z6KA 3N3MA 1ZFJA 2HV5A 3AU6A 3THAA 2TRSA 4Q8UA 4C6BA 1DXFA 4N6EA 3AISA 1JCYA 3W70A 4S2CA 1BYDA 1SFLA 3UWEA 2ZWZA 3CASA 2DSZA 4ICCX 4HPGA 3NO1A 1GOMA 4FSAA 3JW7A 3WLIA 4FXSA 5AC8A 1EC8A 1KCLA 4HU4A 3TLQA 5K9DA 3CHDA 4ZFMA 5BOFA 1JDCA 3WL1A 3EMZA 2CXEA 2OPJA 3WNPA 2G3IA 3TK7A 1NELA 3KX6A 2YA1A 3GH5A 9RUBA 2E9BA 4UTMA 1NDZA 2ZUUA 4RCXA 1XRFA 5D9MA 3FS2A 3QZEA 4LGXA 1PHWA 1J0KA 3M07A 1FWSA 5REQB 3VX1A 5FIPA 3UF9A 3SCSA 1HKMA 1MW1A 2PTZA 3EWZA 3I65A 4AEOA 3M6YA 1NTHA 1SO5A 1RP8A 4MNKA 5KETA 1KCXA 4FK9A 2XUCA 5HQLA 3EKGA 2QNEA 1VGAA 3TDFA 5A69A 3FLUA 1GJPA 4QXIA 3NNTA 4CNPA 2J75A 1Z9AA 5A8GA 4GYJA 5KZDA 2R9RA 1CTNA 2EKGA 2PF8A 1G7VA 3S1WA 3PUOA 2A6NA 2YJQA 3PHAA 4KIEA 3MUAA 2YGYA 2BGQA 1ALDA 5T9CE 2FKPA 3BLDA 3QZ6A 5GVJA 4PGLA 1TKKA 5HMEA 5I2UA 1NFGA 4J3WA 2XSAA 3TN4A 1JZ6A 4C7DA 4CU7A 4ZBCA 1L6FA 3WQ5A 2E4TA 5A6BA 3SCVA 1I0DA 3TA9A 4LUIA 3GH7A 3LCXA 5LHFA 1HKVA 2CW6A 2VZSA 4UQEA 1F8MA 1PJ9A 3I4KA 3MV01 2CCRA 3GQYA 1OYCA 3LBCA 3CV7A 2ONEA 1H61A 4ATLA 4GBUA 4LBUA 1Q6CA 1XDMA 2JIWA 4ROPA 3VE7A 3UWWA 3L66A 5BCAA 5C2CA 1O68A 2B4GA 2BVDA 4H6EA 3AXXA 2J13A 2GFTA 3EKZA 3QN3A 5BU6A 1FWBC 2UY2A 3K4DA 4PH6A 5H91A 1ZP3A 5SWUA 2NXGA 5CZJA 2DUXA 1IV8A 2QCFA 3GHTA 5JQ9A 1A80A 3NFUA 2ATMA 2DSWA 1JXKA 1XPGA 5C8BB 3LEPA 3LLXA 4OIFA 2DH3A 2EJAA 3IS4A 2OVLA 4CNNA 1I2OA 3WUBA 3YPIA 3A4AA 2VFFA 2G3JA 3OIXA 5BXTA 1YE6A 1HW6A 4IM4A 2R14A 3AICA 5C9XA 5EY5A 5LGXA 4IMEA 1EA0A 2ALRA 4A2RA 1MXSA 1HL9A 1DBTA 4GQQA 3TZNA 2WSKA 4FNSA 2ZZ5A 4U3AA 1E1CB 2WYSA 5CKSA 2O9PA 3ES8A 2VR4A 2DZUA 1FDYA 4LWWA 1T6MA 4KCWA 2XG9A 3V1HA 4DPQA 2Y7FA 5CLTA 3EA1A 1S2WA 1RPXA 2KZHA 1ZJAA 4DHGA 3WNMA 5CPTA 1JCJA 3DFPA 3FYYA 1XQKA 4DM2A 1KTBA 4JD4A 4JTAA 3AIBA 3B8IA 3PVFA 1JQXA 1QW7A 2G8ZA 5HQEA 2PDLA 1TTQA 2RDUA 1KRBC 3IJ9A 4Q33A 1S5TA 5AC4A 4XKYB 2FFIA 4FB7A 2O9RA 3R2GA 3G1SA 3AXMA 4YHEA 3LK6A 2MUCA 1HP4A 2ZX7A 3QV7A 1WKYA 4RUBA 2PZ0A 4GYPA 4IZGA 3BK0A 5AB3A 1ZALA 2DIJA 3TE9A 1FDZA 3PTMA 1TB3A 1KBKA 4O1EA 1V3HA 5FEWA 2JBMA 2F6KA 3UU0A 2WCSA 3NQDA 4KKXA 5A6JA 1V6YA 2FGZA 1FWEC 4E8GA 1ZGDA 5IBXA 4Y9PA 3NM1A 1DTNA 3ZOAA 4TMCA 4OWGA 2FDMA 3IV3A 1KR0A 2C14A 1YXYA 1KW1A 3RNDA 1E5JA 2C0HA 5CG0A 3W4RA 2VENA 1U1JA 3KRBA 5JIPA 4JQAA 2ZZ4A 4ERAA 3B9DA 1DWHM 4Q8NA 3REQB 1ENUA 1A5OC 1TR1A 7REQA 4KETA 2ZA1A 3NR0A 3W7LA 1Q85A 1X7FA 2IXUA 2NZLA 3ZJ8A 5DN1A 4QG6A 3PB2A 4JIEA 4XZ9A 3PJWA 1WBJA 3FGCA 3SZ8A 3T42A 4KEVA 4AD4A 3DOPA 4MNJA 5AHIA 4GXPA 1Q2RA 1N8IA 2PDYA 1W8SA 3H7RA 1LUCB 2CZ5A 4QM1A 5F7UA 1VIWA 1V3KA 3IIPA 4N9BA 2E7FA 5B7ZA 3KL0A 1MXGA 4NY2A 1RLCL 5E6YA 6ALDA 1WDQA 2ZC8A 1JUEA 1RCOB 3KUMA 1HT6A 3IVUA 2I14A 2ZYFA 3NPXA 3AQUA 4FOJA 4B2DA 4GISA 2R1LA 1X39A 1GCYA 2BY2A 1K8CA 3AFBA 4A6GA 4E2VA 1GOKA 4DO4A 4JQ4A 3HJEA 3GW3A 1CXLA 1NWUA 1Z89A 1M3UA 4BEUA 3QGAC 2F6XA 1SZNA 1EJTC 1OM0A 4EF9A 3GE7A 4X9YA 4L4OA 5AHEA 4I5XA 2W91A 3MVIA 1RUSA 1ICSA 4Q4SA 2NSXA 2ACUA 4US5A 2ISSA 2RH9A 2HE8A 5A94A 1GOQA 1K6WA 2C1HA 5BNKA 3W7RA 3E6EA 2PBOA 3HPZA 2WQDA 1J96A 1ML1A 1OX5A 1SO3A 4YPJA 1SJCA 3LCGA 2NWSA 5LXEA 4LNCA 4J3VA 5HULA 3CPUA 1EJRC 4TU1A 1UH4A 3O07A 3OLEA 4LS1A 4D6CA 5G2WA 2WZMA 2OWWA 5CSRA 2YXOA 3UERA 4PODA 1XL9A 3DFQA 3WK1A 1ME8A 2JE8A 4H8VA 2WJEA 3G1HA 3H7UA 1PKLA 4FXFA 2OZ0A 2PD9A 3F03K 3SIMA 1KXVA 5JBDA 1W5MA 1P0DA 3N1AA 3RJXA 5CGMA 3FN9A 3LV5A 3MSDA 5LA2A 4GI9A 1GEQA 4CQ9A 1QHOA 3RPMA 4C65A 1GJWA 3I3BA 2BWGA 1Q63A 4JS3A 2BB0A 3PTKA 1AL8A 4JQ2A 2L5HA 4AH7A 1KFWA 3KHJA 3PZ9A 1CXFA 4ZOBA 3AO0A 3ONCA 3VIJA 4RNJA 3GAKA 2VUNA 3OGVA 1MFUA 4GI4A 2XFRA 1EFZA 1ONXA 3GY1A 2A1YA 1S5WA 4AVOA 1OYAA 4DJED 3K30A 3EDKA 5DQPA 4GBDA 2WWDA 1CGXA 1OC5A 3NL5A 3VA8A 4RPQA 1M04A 4QS6A 3CYJA 2YL5A 5I7GA 1YBQB 3VC6A 5CBJA 1LCOA 4K7YA 1W3IA 3PF3A 5K7JA 1GVRA 3RCNA 2PFHA 1JYNA 4QDWA 1QMLA 3KRSA 1I2RA 4IL0A 3UYCA 5LXXA 4Q7IA 3D5HA 4A8RA 5G1YA 2J27A 2VEMA 3G1XA 1TVPA 4L9YA 1LWHA 3B0VC 2VEFA 2H90A 1Q6EA 5BYWA 4LRSA 2AL1A 4HVXA 1J18A 1W1YA 3FHQA 3R79A 3T0AA 2I56A 3B8UA 3LHVA 3O8AA 4Z0SA 1UZ1A 3G6LA 4ZL1A 3WG6A 3WUGA 2G3NA 1QWGA 5M03A 3SGZA 4K6AA 4KBXA 3RMJA 4W9TA 5D2WA 1R38A 4Q4KA 4MDOA 3P7YA 4Q8MA 2ZFAA 3GVGA 4LYKA 3ARYA 2RJGA 4A05A 3AZTA 1Z3NA 3W24A 4DNHA 3L2MA 3W7GA 1QVBA 1RVKA 3FFSA 4KF1A 4L6OA 3V0UA 3WQ8A 1PIFA 1TE6A 3EWBX 1VYPX 4MB5A 1K3UA 5C9WA 1W1A1 1GHSA 3IVTA 5K4XA 4AW7A 3SCRA 4ACZB 4NNAA 2WSPA 3EYPA 4P61A 1RBLA 3NSXA 2PUZA 3EPOA 1GGOA 4QDMA 3HG5A 1V6VA 2QCGA 3LPOA 1M7PA 1TMHA 4GYKA 3T09A 3LTSA 4IPLA 1FHUA 3U8GA 4M7TA 3MUZ1 3W1QA 1E56A 1QNQA 3G1DA 1YMYA 1TPB1 2O55A 4NXKA 1NWRA 2EG8A 1HFBA 5F4XA 4H4IA 4BI7A 3GR7A 3T07A 4QDPA 1UP2A 4PTDA 2UY5A 3B0UX 5BW6A 1Q6FA 2XGIA 3E0FA 2OZTA 2RGLA 1CB7B 3PNZA 1JF5A 2G5WA 1SZFA 2VZUA 5DEZA 4PTWA 5HMFA 3IIOA 4PBEA 3DG6A 1K7EA 4DF1A 3C0JA 4AC7C 3MT1A 4HU0A 3CJPA 1TVLA 1DTUA 3CAWA 3WLHA 2JIEA 1X6UA 3LGDA 1F73A 2YCLB