3OZRA

Rat catechol o-methyltransferase in complex with a catechol-type, bisubstrate inhibitor, no substituent in the adenine site - humanized form
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
213
structure length
213
Chain Sequence
DTKEQRILRYVQQNAKPGDPQSVLEAIDTYCTQKEWAMNVGDAKGQIMDAVIREYSPSLVLELGAYCGYSAVRMARLLQPGARLLTMEINPDCAAITQQMLNFAGLQDKVTILNGASQDLIPQLKKKYDVDTLDMVFLDHWKDRYLPDTLLLEKCGLLRKGTVLLADNVIVPGTPDFLAYVRGSSSFECTHYSSYLEYMKVVDGLEKAIYQGP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular Recognition at the Active Site of Catechol-O-methyltransferase (COMT): Adenine Replacements in Bisubstrate Inhibitors
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transferase/transferase inhibitor
molecule keywords Catechol O-methyltransferase
total genus 80
structure length 213
sequence length 213
ec nomenclature ec 2.1.1.6: Catechol O-methyltransferase.
pdb deposition date 2010-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01596 Methyltransf_3 O-methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3ozrA00
1TW2A 4H0NA 5F2KA 1R18A 3G8AA 3UWPA 5CCBA 3ER9A 1M0EA 1JR4A 3FYDA 5EZQA 3IEIA 1U2ZA 4RTJA 3UZUA 4P7FA 3ME5A 4QDKA 3FTEA 2EJTA 3MQ2A 4X63A 1IXKA 5DXAA 3A26A 4MHTA 5E9QA 1WG8A 3NVMB 3GRVA 4UOEA 3EVFA 2JH9A 3EEYA 4PCAA 1RJEA 1X1CA 5CCXA 3KQPA 5EMMA 5K03A 4BP1A 1X1AA 1G60A 4Z2YA 5GIPE 2HMYB 2I7CA 4R6WA 1KPIA 4ER7A 4RTNA 5BW5A 5ICCA 8MHTA 1VP3A 1D2GA 3REOA 2PT9A 2EJUA 4X41A 2OYRA 4CWAA 1YUBA 2NXCA 3SR4A 2O06A 3LKDA 2C7QA 1RI3A 3BWCA 3OCJA 3VC2A 4E33A 2ORED 3BGDA 4ER0A 2UYCA 3UJDA 1KYZA 3JWGA 3EGEA 1EQAA 1ZKDA 4CTKA 5IKMA 2HWKA 2EX4A 3GWZA 4A6EA 3MAGA 1KPHA 2FHPA 3MCTA 5K0LA 4C03A 3DTNA 5CVEA 2YVLA 3A25A 1XDZA 2B9EA 2Y1WA 5DM4A 3EEOA 4EMSA 3O7WA 4EVIA 3OZTA 3OE4A 2YXDA 4PWYA 3P2EA 2PT6A 3UJAA 3VYWA 1FP2A 3DULA 5CVDA 2IIPA 5FTWA 4YV0A 4IWNA 5LQNA 2AVDA 5G02A 4QTUB 3DOUA 3IYLW 1AQIA 2KW5A 4GOMD 5K09A 3AY0A 2ZULA 4C05A 3LKZA 5DX1A 2PX4A 1SVUA 1KIAA 3SXJA 4R05A 4C06A 3KR9A 2PSSA 5E1MA 2FK7A 5GOZA 1P1BA 3MB5A 1VLMA 1VPTA 2CMHA 3I64A 3C3PA 3ELWA 3G88A 3GO4A 3LBFA 3OU6A 4U7TB 5EHGA 3A7EA 3OPNA 5FQNA 4DF3A 3R3HA 3DUWA 1XXLA 3C6MA 2PXAA 2B2CA 5CVVA 2IBTA 4IV0A 3KR2A 4OA8A 3PFHA 4FS8A 3DXZA 5FADA 3KPJA 3GCZA 3HCDA 2B3TA 5FCDA 2CL5A 5T64A 2AZTA 1X19A 3KQOA 3NDJA 3PVCA 4X60A 5E2BA 4ATNA 5K0CA 2ONZA 2IFTA 3EMBA 3G2PA 5KYGA 3O4FA 3CKKA 3EMDA 1O9HA 3QV2A 1NBIA 3P2KA 5HIKA 2C7RA 3B89A 1NBHA 4CKBA 3UFBA 1IM8A 3EGVA 2ADMA 1EJ6A 3FPHA 3GGDA 1KXZA 3KPYA 1VQ1A 4IKPA 2OXTA 5K01A 2AVNA 3JWIA 1I9GA 5LQCA 3LBYA 3PX3A 2G1PA 2NP6A 3DMGA 2F8LA 3OFKA 5GM2A 1NW5A 4DZRA 2ONYA 5BP7A 4ER5A 3ERCA 4KWCA 4XUEA 3KQVA 4R8RA 4XUCA 2BR3A 5ICFA 2VDWA 2P41A 4E31A 3TM4A 2A14A 2CKDA 1NV8A 3FRIA 4P7GA 2P3OA 3FUTA 5K0JA 1NT2A 1NV9A 4HSGA 3G2OA 3BWMA 3A27A 2H1RA 3DXXA 3KPUA 4R8SA 2E5WA 1L3CA 3SX0A 4E30A 5JR3A 4CKCA 1XVAA 4GBED 4KIFA 4RV9A 5JUWA 1XDSA 2DULA 3KQYA 3NDIA 2ZTHA 3G5LA 4V0RA 3P9CA 5IH3A 2BR5A 3FZGA 3QOXA 4HGYA 5GWXA 1JTEA 3KPWA 5E8RA 3NW9A 4YMGA 3KKZA 5M5BA 5ICEA 5E9JA 1R8YA 2PX2A 2IP2A 3LDGA 4MQ4A 3DMHA 1FP1D 4Y2HA 3THSA 4C07A 3CC8A 3AXTA 5GIOE 2NNWB 3KU1A 3OZRA 2OO3A 4ISCA 2OZVA 2V7EA 1WXXA 3A7DA 3AJDA 3MCZA 3LDUA 3K0BA 3ELUA 3UA4A 3UJBA 1F3LA 5EMLA 2P35A 3X0DA 2ZIFA 2CMGA 2P3QA 5LQJA 1WXWA 3O31A 5EVJA 3PX2A 2PBFA 3M4XA 2I6GA 4F84A 1SKMA 2NP7A 3JWJA 3LPMA 3NTVA 5EIWA 5EIFA 3HNRA 1KR5A 1JQ3A 1WY7A 2GS9A 1YF3A 3P2IA 4U7PB 3OZSA 3L8DA 1Q0SA 1ZQ9A 2IH5A 2XYRA 5FA8A 4YUXA 4PIMA 3T7TA 1DCTA 3EGIA 3SSNA 4E32A 4F86A 5CD1A 3FTFA 1EIZA 2PWYA 2AN5A 2I9KA 1P1CA 1TPYA 2AOWA 4PYLA 1BC5A 1KP9A 4LG1A 5EG5A 2Y1XA 5GP1A 2P8JA 3FYCA 3R6TA 4GC9A 2QM3A 5EMJA 1X1BA 1ZGJA 1WZNA 1RJDA 2WA1A 1R6AA 4JXJA 4HC4A 2PVCA 5DPMA 5GM1A 5DX8A 4PNEA 2ZIEA 3RIEA 4BLUA 2H00A 5K0EA 5EQJB 2OKCA 5T67A 1RJFA 3EVEA 1JQDA 3P8ZA 1XTPA 3P9IA 2UYQA 2OB1A 1MHTA 1H1DA 3PFGA 4OQDA 5T6BA 3I5UA 4RTRA 5LR6A 4KDRA 2P1DA 2ZBPA 3Q7EA 3B7PA 3HM2A 3LL7A 1VBFA 5C9ZA 2YXEA 5CM2Z 1QAMA 2Q41A 3JWHA 3CVOA 1HNNA 1QAQA 3M70A 2AOXA 3MTIA 3SM3A 2O57A 2YTZA 3WSTA 3ID6C 4PCLA 3QOWA 1PJZA 2CWWA 2VP3A 2O05A 4HTFB 3BKXA 2OBFA 4NECA 1UIRA 3HCBA 4DMGA 4V0QA 4YUWA 1L3IA 3KR0A 1Q0TA 3FTDA 4QTTB 4OQEA 1ORHA 1FPQA 5E8JA 5HEKA 5KQRA 2ESRA 1NW7A 10MHA 3LCVB 4HRAA 4PYMA 4BP3A 3M6WA 2R6ZA 2PV0A 5EKUA 3GNLA 2AOVA 3FPFA 4MTLA 1MJFA 3T0IA 5FUBA 1F38A 3OU7A 3G2MA 4RVDA 3BT7A 2NXNA 3GRUA 4PIPA 1XDUA 4RTPA 4OX9Y 3C6KA 4ZTBA 2O07A 2IH2A 2FRXA 4GOND 3IV6A 4X61A 5DX0A 3C0KA 4WVLA 5KVAA 9MHTA 3UJ7A 4ER6A 4HG2A 1RJGA 1D2HA 1JSZA 1R74A 2HNKA 1JG3A 3DR5A 3G5TA 3LCUA 5BW4A 5HIMA 4K6MA 5C1IA 1G6Q1 1NKVA 3LHDA 5HILA 3CJQA 4PONA 2PWPA 5U4XA 2QY6A 3PLAE 2P3LA 2UYHA 2JG3A 3HTXA 3KQWA 4FT4A 4FGZA 5BXYA 3E8SA 4LECA 2FK8A 2AOUA 5DTMA 3AWIA 3HCCA 3SSMA 4FR0A 3TMAA 2IBSA 3CBGA 3EVDA 4PYKA 5E1DA 3FPEA 3HA3A 3NWEA 3EVAA 3PB3A 3GJYA 4RYLA 5MHTA 4MWZA 3M6XA 4OBXA 5ICGA 1DL5A 3ANXA 3E23A 2ZSUA 3R0QA 2ZBRA 4B17A 1QAOA 2AOUB 3HA5A 2YXLA 3HCEA 2QRVA 5CUQA 4IV8A 3UA3A 3T7RA 2ZIGA 4C04A 4RWZA 1QANA 3C3YA 2GLUA 4QVKA 5DM2A 5D1NA 2G8NA 2N47A 3B3FA 4E2ZA 4YMHA 4EK9A 3I53A 2IH4A 3HVIA 2JH8A 3ORHA 2AR0A 2PLWA 1EJ0A 2V74B 2C7OA 1KYWA 1NE2A 1SQGA 2QRVB 2YQZA 3GXOA 4AZTA 3FUVA 2GA9A 1L1EA 1ZHFA 2NXEA 5K0BA 1XCLA 1RI1A 4FZVA 4G56A 5E1BA 4PYIA 4Y30A 4KW7A 3TM5A 2VS1A 2VZ9A 3F4KA 3ELDA 4KIGA 3FUXA 4GOLD 3UJ8A 1JG2A 2I62A 5LQUA 2WK1A 1JSXA 2P7HA 4RX1A 5HIJA 3NWBA 2XBMA 1P91A 2FPOA 2PGXA 4FT2A 1PRYA 5FA5A 1YFLA 2ZFUA 2QYOA 2P7IA 3SMQA 3NJRA 2K4MA 2LD4A 5EKXA 1R00A 4HTFA 2VDVE 1I1NA 2EFJA 5DWQA 4P7KA 3CCFA 3DH0A 3HVHA 3TFWA 4PYNA 1BKYA 2XVAA 5DLYA 4XUDA 3UBTA 3U81A 3P9KA 1ZG3A 1SG9A 3KR1A 2OPBA 2BM8A 2G70A 2B25A 3BZBA 2HV9A 1BHJA 2YUIA 5KS2A 1VIDA 4PINA 2DPMA 2ZBQA 3HVKA 3MTEA 4PYQA 5EPEA 5K0FA 5DXJA 3HVJA 4EKIA 2ZZNA 5K8VA 1SQFA 4CKEA 1EAMA 5CVUA 4GF5A 5DTRA 1NW6A 3PS9A 3G7UA 4GQBA 3PTAA 3G2QA 5E1OA 5H02A 3KPVA 1I4WA 3KQQA 4BLVA 3H2BA 3IHTA 5EC8A 2IPXA 2JJQA 2OB2A 3FRHA 3LSTA 4FSXA 3TOSA 4YV2A 2BZGA 2FCAA 3GRRA 3KQMA 5EMKA 2BR4A 2PX8A 3V97A 4DCGA 5EOVA 2GB4A 1KPGA 2UYOA 5CVJA 4DQ0A 3VSEA 4CXMA 2YX1A 2BM9A 4X1OA 4MIKA 2AOTB 2Z6UA 1SUSA 3TQSA 5EEHA 1INLA 4ER3A 3D2LA 3R24A 5DTQA 1ORIA 5DM1A 2YR0A 3DLIA 2PJDA 4L7VA 2ZZKA 1YB2A 2C7PA 4QDJA 2O0LA 3AXSA 2AN3A 1Y8CA 5F2OA 4RVHA 5E9WA 3TLJA 2FYTA 4QPPA 3CGGA 2ZWAA 3HA7A 3HP7A 3M6UA 3TPZA 3MHTA 1RI5A 3B5IA 1QZZA 3MERA 5K0NA 2NYUA 1RI2A 4GOOD 5FULA 4YUYA 5LSAA 5LQRA 4E2XA 3ER8A 2ZWVA 5LQAA 3TR6A 5D1HA 1Z3CA 1JG4A 4YV1A 1G38A 3DP7A 3KQTA 4M37A 1TW3A 4RVGA 1R8XA 1T43A 4FP9A 2ZZMA 3FUUA 1V39A 4O29A 2GAFA 2XYVA 3OU2A 5FHQA 5EEGA 1JQEA 2ZLBA 1JG1A 3G8BA 3HCAA 4EQZA 5FQOA 5HOQA 3Q87B 3E7PA 4GUAA 3A4TA 1N7JA 3M6VA 4A6DA 4AX8A 3K6RA 3OE5A 1OR8A 1L9KA 1UWVA 3GRYA 4GEKA 5DSTA 4C08A 3NMUF 2HR1A 1L3BA 1BOOA 3LX6A 3GU3A 5HFJA 5DT2A 3S68A 1XJ5A 4P58A 4RTMA 4DKJA 3BWYA 3SVZA 1YFJA 1KHHA 1O54A 5P8WA 5DRTA 3R9XB 3I9FA 4YUVA 4M7RA 2AS0A 4AZWA 2PKWA 3EVBA 1D2CA 1P39A 4RSRA 1IY9A 4FSDA 4PYOA 2XVMA 3ELYA 3HEMA 2B78A 2IDKA 3BXOA 3UJCA 4E2YA 2P40A 2G72A 5LQKA 3EVGA 2BH2A 7MHTA 1N2XA 3EPPA 5EGSA 5F2NA 1DUSA 3B3GA 3P97A 1G8AA 2VDUE 4LWPA 1B42A 1EG2A 1HMYA 1VL5A 2H11A 3FPJA 2PY6A 4QPNA 3M33A 4RTQA 1NW3A 2EG5A 2Z6QA 3FPGA 5CIYA 4EKGA 3HCFA 1O9GA 3DMFA 3KHKA 4KVZA 1YZ3A 3LECA 4QQKA 5FWAA 5E2AA 3THRA 4KRGA 3RW9A 1FJXA 3FTCA 1M6YA 3EVZA 5C0OE 2R3SA 4PGGA 1AF7A 3I58A 3P71T 2GH1A 2PXCA 4RTSA 3FUWA 4HGZA 3EVCA 3GIWA 1WS6A 3MGGA 3CJRA 3E05A 3OFJA 2ZCJA 3GRZA 3PT9A 2QE6A 4RVFA 5ERGB 4E2WA 2UZ4A 4DCMA 1G55A 1SUIA 3BWBA 3GDHA 2IDJA 4GC5A 3T7SA 3TKYA 4AUKA 1UFKA 2AN4A 4CTJA 4RTKA 2IGTA 3DXYA 3P9NA 1X1DA 1VE3A 2G71A 4DA4A 5FWDA 4BY9E 2GPYA 4AZVA 1NW8A 2ZVJA 3UJ6A 4BLWA 5K05A 4C4AA 5HIIA 3BUSA 3TRKA 4AZSA 4KDCA 4RTOA 2WA2A 2ZW9A 4PYJA 2HTEA 2AOTA 4QVGA 3BGVA 4DM3A 4F85A 3BKWA 5B1SA 2PXXA 5EZSA 1FBNA 3LDFA 4PGHA 2PX5A 1JTFA 4RTLA 4YUZA 2Z6AA 4OBWA 5DM0A 1YZHA 3LCCA 5K0GA 2XYQA 2ERCA 2NXJA 3UJ9A 5EHIA 1G8SA 1RI4A 4WXHA 4QQNA 3CJTA 3TKAA 2JHCA 3G89A 3SGLA 1AV6A 1N7IA 2OY0A 1M6EX 4HH4A 2JHPA 4E70A 1VP9A 5FHRA 5DRYA 3KQSA 5KQSA 3VC1A 2JHAA 4M38A 4R6XA 1QYRA 3BGIA 3DLCA 1AQJA 3LGAA 4XCXA 3RODA 1XCJA 4LWOA 3B3JA 4P7JA 3V8VA 3SSOA 3NVKI 4M36A 4POOA 5HZMA 5DSXA 5GINE 4OA5A 1ZGAA
chains in the Genus database with same CATH superfamily
3QTTA 3KWLA 2FN8A 3CMMA 3G8AA 3M5DA 3SDZA 1QYVA 3FYDA 1L7BA 3IEIA 5AW6A 1H4QA 1BH2A 2M2IA 3R5FA 5HDQA 4DLAA 2JGRA 3FLMA 3V48A 1OXXK 1V4VA 2F90A 2ISSD 1G0NA 1IXKA 1BE0A 1PS9A 3LW8A 2I34A 3IR6A 2O5VA 4MDHA 4RVSA 2GEUA 3ZDFA 1HE5A 4UOEA 1P7YA 2NO6A 1T5BA 4IH4A 4JELA 5IKPA 2O8EB 1V1MB 3RHTA 5FFNA 1GPNA 3DYIA 2VBIA 4KO2S 4GL4A 8MHTA 3K09C 1JUDA 5DHUA 4WUVA 5JROA 5G1NA 2YZNA 3KTFA 3U7QA 2NSLA 2X5KO 5EWMB 4AX4A 1QG2A 3H3XA 1P0FA 2BW0A 4M9UA 4O5AA 4WOKA 3NJ8A 4XUGB 5DULA 2AMYA 3BWCA 3ZPXA 4B7UA 4R1MA 3U4GA 1GITA 1E9FA 5H80A 3WYBA 4ZDJA 1VM6A 4PSVA 5KSZA 2WQ6A 1ZOSA 3T7JA 3TTTA 4EZEA 2OC4A 4ZMRA 3H1GA 3V34A 4A26A 1Y98A 4JUCA 2P0AA 2N0SA 5JVDA 1CDOA 1W2WB 4RXUA 4X8LA 1JA0A 4NHOA 4EGAA 4Q4AB 5HZGA 2PL3A 3MCVA 3Q3VA 4PWYA 5LWQA 1KZ9A 4JJEA 5AVUA 2NTEA 2IYFA 4UD2A 3N8NA 1IBSA 1TM2A 3DHYA 4H1TA 1ZOPA 1C3VA 1EFVA 4ZRMA 4E94A 2GD2A 2ZU0C 3VPHA 2FEAA 1UMKA 2FFHA 3B9PA 1NI4A 4NRDA 1E1RD 5ES3A 2R1TB 1OT3A 3ZEAA 2FEXA 4A0FA 5AW0A 1KEWA 2PQMA 1SXJE 1DJQA 1ZXBA 1KEEB 4P53A 1E9AA 5CDYA 4A8HA 5C1DA 3U3JA 1NLUA 1PFKA 2D74A 2W6CX 4IJUA 5L4LA 3N2EA 3BTOA 3I64A 2XGMA 2I4LA 4K9RA 1EKXA 4Z99A 4O1MA 3O8CA 1V3UA 4F91B 1CUCA 1K3TA 4WOPA 5KNBD 5CVVA 2XQVA 4RFSA 5F35A 2NUAB 4JOQA 4HAIA 4IDHA 5DYGA 3L77A 3GLFA 3ND8A 5FPKA 3FZYA 4XYEA 4GSKA 4FNMA 1HZZA 4L6IA 1MHPA 5EJMA 4CU2A 4LV6A 5ULLA 1O4VA 2H07A 4H15A 4QXOA 5ER9A 2GJ4A 2BKVA 5IP5A 1K4MA 4ND5A 3CTPA 3T94A 5F2EA 3WLTA 1NYRA 2P65A 2OQVA 3RGWS 2C7RA 1NBIA 3O73A 4ITRC 4OQQA 5AM3A 3V1UA 1U0EA 1UQTA 1CIJA 3UFBA 4G81A 3QLEA 4FOSA 4JI6B 1CY6A 1XI2A 4S12A 1P4RA 3GGDA 3KPYA 4CW7A 1DEXA 3KQNA 1SC6A 2QMHA 3SNHA 1Z4PX 2XX3A 4RE5A 1EB8A 3JQ8B 2VATA 4FFVA 9GPBA 3WFJA 5TQ2B 1YQDA 3NAQA 3O38A 4Y67A 2HREA 4R1TA 1HE8B 3ASYA 1KO4A 1NG1A 4FFLA 3T15A 2J0SA 4NBLA 4XUCA 1DAPA 1DEKA 3IUQA 4DCUA 2DR3A 2D13A 4PC1A 4QDOA 2Y93A 5FPSA 5T4HA 5DGTA 4S04A 4K1LA 4BJ3A 4URFA 3PRYA 2ZRIA 4H7JA 1JU3A 1P31A 3P4XA 4PR0A 1KE2A 1A1VA 1MEOA 1YHNA 3FUTA 1ZLXA 1A71A 1YNOA 1Q3TA 2GCPA 3BG5A 3I34X 3S27A 3VSBA 2YBEA 4MW6A 5A6SA 5HFNA 5REQA 1K4YA 2BDEA 2VWPA 4LRTB 1MP0A 1VG1A 3WYFA 2EGGA 2IKSA 3I5YA 1NXWA 1EINA 4QUKA 3ET4A 5JUWA 4FOLA 3OIGA 5FV7A 1A9OA 1R4AA 3A9WA 5LQDA 2V03A 3UAXA 2YWFA 2WD7A 3TNDA 3Q11A 1WB9A 5ICEA 1NY6A 1FQWA 2IP2A 4P32A 4XPZA 2WG0A 2FR0A 1GO2A 3M4NA 1KQFA 2LCIA 2R1VB 4DHEA 1KFBB 1YB6A 1SY7A 1WB6A 2BFBB 4QJBA 4ALNA 2P91A 1FX0B 3H3FA 2B4TO 4MVWA 4RKFA 3EW9A 1SXJD 3TX2A 4H7EA 3N2YA 2NVOA 3ELUA 3B78A 4N7MA 3UA4A 3IMCA 1KI3A 1O08A 1Y7TA 4AJIA 3GH1A 4NMXB 2PQ6A 1UDBA 2YRXA 3A8TA 3FNIA 3JD1A 3STYA 2QZJA 3EHDA 3W6ZA 3A9SA 4UBKA 5F1KA 1JR3E 3COJA 3BHJA 3O95A 3L4BC 1FMFA 1E3IA 3IQIX 3PHIA 4EG1A 2FW8A 2Z56A 2WWYA 1QKJA 5A6SB 1SIUA 1KS2A 3QUCA 1JKXA 1L4LA 4G67A 4I55F 3TQCA 2HLNA 1BMDA 5FA8A 1QGUA 1KJIA 1NDQA 1H1TA 4E32A 4JBHA 1N6OA 1LDBA 1U90A 1G8JA 5C3MA 4DEXA 1J0AA 2BEUA 4FR5A 5C5IA 3MZ0A 4MUAA 1TPYA 2W6OA 4PG4A 1VGVA 4DCCA 1Z73A 3RKSA 3B2QA 5TQ2A 4NENA 2BFWA 8AT1A 1ZH6A 3UGQA 2WA1A 1RWWA 3ZWDA 4ZDKA 1VMKA 4HC4A 4KO8A 5BOVA 3V2HA 4EO7A 4YRJA 1M5RA 1ZH4A 4MR8A 2BSAA 3B1FA 2J67A 4ND7A 3ROQA 1OJLA 5EQJB 1H2XA 5AW3A 5LMUB 4ND8A 3AL0C 3EVEA 5LXTF 4F2HA 3ORFA 1IFXA 2EL7A 3PV0A 5EMHA 4AJ2A 5EFZA 4AD8A 2CKMA 1TE2A 1J00A 4IOMA 5DP1A 1LV8A 1JYFA 1Q91A 3FMFA 3GJTA 1EFUA 5L4NA 1FX1A 1W19A 2PAAA 4LDPA 3WGKA 1DDIA 5LOVF 3AKYA 2NUAA 4HT3B 3MT0A 2OENG 4CCAA 1FXWF 3RAGA 4DJDC 3WYDA 5I4IA 4Q9DA 3D8NA 1QQ6A 4QASA 2JFXA 1PJZA 2VP3A 2YJ3A 4K9DA 4LNHA 4YT4A 4F4CA 5FX2A 4AN1A 4MI3A 3H04A 1RQNA 1AB6A 4AVYA 2P0YA 3VISA 3EZGA 3ROGA 2IOFK 4QGGA 5TF4A 3S44A 3JZAA 2G9VA 2Z08A 1KO1A 2BDTA 2E3JA 2R68A 4V02A 1KZHA 1Z0JA 2ATXA 3ROKA 5HUHA 2Z0MA 1F38A 4CEJB 1J1ZA 1KZ7B 2BP7B 4OFZA 1SUDA 1DJMA 2D5LA 3QM1A 3MT7A 2O07A 4MV4A 4ZTBA 1BHQ1 4AF7A 5L7WA 1LSUA 2R8PA 3N2GB 5ALFA 5KVAA 1G21A 2WJ3A 2ARKA 2I2BA 3B1ZA 3WE7A 2ZI5A 3DMNA 3FGZA 3L7CA 3OQNA 1QG6A 3FJ1A 4J43A 1M2JA 1TYZA 5JAZA 3ZWKA 3PLAE 2NGRA 3GNSA 1H65A 2XUJA 4C6HA 4A5OA 2V7WA 3IT2A 4HGNA 2XYPA 3NBQA 4Y9UA 3ANYB 1ZX1A 2DQKA 1DUVG 5DFAA 4QTYA 4ZJZA 4UAVA 1KY2A 1Y3AA 4BO3A 4E22A 4LF4B 4L8GA 2GTPA 3R44A 4XZ3A 1WUKS 1F17A 4RK4A 1UBUS 2NUPB 3NONA 4CMKA 4Y8VA 5CFQA 2A78A 4EB8A 4NK4A 2VF7A 1DL5A 4G0OA 4ND2A 3G0CA 3VJRA 4B17A 3ZJVA 2IEIA 1KH1A 4LEIA 5B53A 2ZSJA 2VHCA 3E3MA 3BB3A 3ILSA 5JPCA 1XMOB 3HP4A 3S8MA 3TIXB 3AF6A 5A0VA 3SIRA 2P9TA 2H08A 3D64A 2A30A 1Q3HA 4NYIQ 4BRWA 3GEGA 1IHOA 4ALLA 4U7HA 1EVQA 4HEA1 2QL9A 4ESVA 3O3CA 2A1UA 4UDXX 2QM7A 3H86A 4RD3A 2FZKA 4BVKA 4LXIA 4XPIA 5K3FB 1BNCA 4PZAA 4H7HA 3D6AA 2JJ2D 4K8OA 1TF2A 1SKUA 2R7LA 3MFYA 1GPLA 2J5QA 2PM8A 1ZC3A 3QVMA 3MD9A 3KBOA 4G1BA 4RS3A 4NFHA 4XVCA 4QEKA 5G0WA 1FFWA 3M6LA 4WOBA 1SA0B 2IPAB 3MTGA 5HIJA 3CM0A 1EWKA 3W6NA 2FPOA 4FT2A 2PVSA 3INRA 4QHTA 4ZO9A 3PFCA 4BU0A 2P7IA 1UH5A 2W48A 1SD1A 3DGFC 3KKOA 2K4MA 5IUKC 1F2VA 2NU8A 1GPDG 4MUMA 3P1JA 2EFJA 4M1ZA 2DSNA 5A3VA 3NUQA 3VMFA 1OD6A 2PT5A 4ZI7B 4FB5A 5LZ4A 2WTUA 1GQSA 1SQ0A 2Q5LA 4ARIA 3H8SA 2XGOA 3BCRA 3TNFA 1WEHA 2NIPA 3I01A 4PFSA 4ZQBA 2EC5A 3I12A 3EIHA 1M73E 1RYFA 5ALZA 4D0RA 4D9FA 1NFRA 5I51A 2I78A 2CDAA 4YN3A 2UVQA 5CIQA 1E2LA 3RB8A 2XXAB 1HA3A 2FPXA 1W46A 3HKDB 4DSUA 3NHYA 2IUUA 3VJKA 3T5TA 1PEAA 4GF5A 4UEQA 1B00A 4UVHA 1D5WA 4XIFA 5JW6A 5D00A 4CN9A 5E4TA 1CEXA 1XQXA 3OZAA 4L50A 3AHCA 3ZC3A 1GZSA 3F4LA 4YIKA 1V5GA 2MTBA 1CY7A 2QGNA 4MJ3A 2VJQA 3EDYA 3L06A 5TEWA 3RREA 1C7JA 2H59A 4ZZ1A 5HNKA 1Q50A 1QDEA 4KR2A 3ZQ6A 3Q3EA 4WDQA 5AHOA 2CXQA 1OBOA 3NGLA 1ZUNA 4DCGA 1Z33A 5EOVA 3EY4A 5D5QA 5EJIA 1XZMA 5GPBA 4D98A 3FCSB 1P3Y1 1I0LA 2RGYA 3GOHA 1KXJA 3L49A 5C8YA 3UOWA 2ZYRA 2HRDA 5DTQA 3SYLA 2X9NA 3QYFA 5C18A 1NR7A 4Z9BA 4C7VA 3BB4A 3ET5A 3G13A 3FHCB 4Q00A 3ML1A 3AXSA 5DCYA 4Y3UA 5DW0A 1IAVA 4URVR 2H18A 4KR3A 3AI1A 4EY8A 1CX9B 2NUBA 1RI5A 3KFXA 2WZQA 2SKEA 1SC9A 2DU8A 4QVIA 3G9UA 3HWWA 3N8IA 4GOOD 2QE7A 4OIMA 1LBTA 5FULA 1OX5A 1PL0A 3GXBA 3G2IA 4R9RA 3MPOA 1PK7A 1HE4A 2IP1A 1T43A 2BE9A 4FP9A 1I3OA 2IF0A 1GSAA 1ORDA 2DF8A 2LGJA 3FUUA 4GVPA 4JQZA 4S2UA 3WP1B 2NQTA 1IONA 5EEGA 5L7YA 3HCAA 4ROSA 2PYDA 5FQOA 4HAVA 5IC4A 3T1TA 4NBRA 3QF7A 3H8WA 4MZXA 4TRJA 3L9WA 1R5OA 4OM8A 4UM5A 3HCWA 1HDZA 4C08A 2R2AA 4ETWA 5DLPA 1ZNQO 4GLOA 4FE7A 4KTVE 3FMOB 3L18A 3S68A 521PA 3TSZA 1A8PA 4ZAYA 1S1CA 1XJ5A 4RTMA 3MGAA 4WA7A 5AR1A 2G8LA 3O2QB 2NSJA 3IRUA 2IV2X 3V8MA 2WHQA 4MKGA 3QTLA 4U7DA 2JI4A 3DEKA 3PWTA 4RJTA 1MD9A 4A91A 4P6VF 4PFKA 4RSRA 4O1HA 5K8IA 2B78A 1XVUA 2JGAA 3SEZA 2WU1A 1UFRA 3EVGA 1EHYA 5EGSA 3L1UA 3DKIA 3NRJA 4EG6A 1W0JA 1G8AA 1PUJA 3EAQA 2BYTA 1ZUD1 2OZLA 4RHUA 1EX6A 3ROPA 4INOA 1TTQB 2AMJA 2IYRA 3GJ8A 3MEQA 4TVKA 4F96A 4C5CA 5CA0F 1Q21A 4OYYA 2EG5A 1JPJA 1ARZA 1DMSA 5G4KA 2PU7A 2FCRA 2O2DA 2VT6A 3VHXA 5BWBA 2OHVA 1YZ3A 4NV3A 2X8JB 1ISSA 3NHJA 1URPA 3IMEA 5BO5A 1JLHA 1H0HA 4LSGA 3RJ9A 1GGVA 2H1HA 3EVZA 3OFSA 1Q0QA 5C0OE 1FFEA 3H2SA 1VG0B 4IS2A 1Z8NA 1MB9A 3CH5A 3JAWA 2J4CA 3JU3A 1V37A 5JMPA 4LK2A 4LFCB 3HKEA 2KX7A 4JJIA 3L02A 4UNNA 3R7BA 1V8OA 5E3IA 4ZI7A 5ILOA 2GAOA 2IX9A 2CC2A 3IQEA 4BGEA 1KI7A 3S7TA 4CIYA 4YCCA 4K3UA 1YRQA 2GESA 4KRXA 3TCNA 1LV7A 1HYHA 1FFBA 4ABTA 4RLSA 2G5CA 1V4BA 4KN8A 5JDCC 4BQQA 3L6DA 1OI3A 4Q66C 1OW3B 4BLWA 1V47A 4CMJA 5K05A 3IH5A 4NJMA 2P2CA 1EHCA 2P6MA 2IS6A 1XNHA 2G08A 1NVVQ 1XU7A 2O23A 2VDNB 4OM7A 5HIIA 1HQKA 1IB0A 1S4MA 4Q4HB 3T4PA 3S2IA 2F2TA 3KD2A 3L4BA 3E9CA 2O20A 2WIFA 3BKWA 1SHTX 3F1KA 4JA2A 4KH0A 4V3BA 2NN3C 4J76A 4M7WA 1JHQA 3SD7A 1E7QA 1ISRA 2JEZA 5TQ0B 2WJHA 4WASA 4MUJA 5JSUA 2IXDA 1UM9B 2JIDA 2WT4A 2ISQA 5ELXA 2YYYA 4AYXA 2PLNA 3CKLA 1Z4OA 4OHKA 4Z4HA 1DFIA 2RBEA 2A94A 3SGLA 1MTOA 1S3GA 3GX1A 4Q4HA 3C6ZA 4E70A 2NZXA 3R7NA 2BFFA 3AJ8A 5ENDA 5FHRA 5LD2B 2JKYA 3VC1A 4RMGA 3S2EA 4BV8A 5IT4A 3R8FA 3NBYC 4KJXA 4D0SA 4MWCA 1F7UA 1E1QD 4C0SA 4DA7A 1L4NA 1CJMA 2IVFA 1YR7A 5JNRA 1GNPA 4DDUA 2HDHA 5KTYA 4XVQA 1WDWB 3CN9A 1KDOA 4J4HA 4W7IA 3VKUA 5AH0A 4KQJA 1BMTA 5AKGA 3HMKA 1GAJA 6ADHA 4S1NA 1Y4AE 5I4BA 3L6CA 4RMHA 1MPTA 2D7JA 1TA0A 1CUIA 1WXHA 4PLCA 3LHKA 4LTNA 1RM3A 2AUMA 1N2SA 2FY8A 2ZS8A 4GNRA 2XAAA 2XWBF 3AI2A 2Y0DA 1IVNA 1NRIA 3PCXA 2H0QA 3AI3A 1RJEA 2W2XA 2YRFA 2YV2A 2TMDA 4WDRA 5JNVA 5JSHA 5FBHA 3TZQA 3AR8A 2J31A 3QKSA 3OCVA 2ZM5A 1PT5A 1G60A 4GDFA 1JJBA 3ENNA 3DC2A 4QU0A 3X1XA 2PGLA 3AT1A 3KS9A 1DRUA 3NYWA 4X41A 1OGIA 3QOYA 4A10A 3JWPA 5A9RA 4B7ZA 2QG9A 3VU3A 5ES4B 1UPFA 5KNBA 1RI3A 4K6HA 4RDHA 5BQ3A 3OCJA 4L5JA 2VTBB 1NKTA 3EQ9A 2V1XA 4I9NA 4TL9A 4TT3D 1M10A 2C31A 2WAOA 2PRJA 3EGOA 4II7A 3O8LA 2AG1A 4OHRA 4A6EA 1KPHA 5FWYA 5KWSA 4C03A 2AI2A 1YS1X 3H84A 3LOUA 4OJKA 3PL1A 1EUCA 4PG6A 3O7WA 3LNCA 1EDEA 3GRCA 1JXAA 4G97A 4K6OA 4RXMA 1O94C 3GLIA 5ALIA 5MN5A 1Z4NA 3EJ6A 4NATA 3O94A 4QTUB 1F12A 4HF7A 5JLJA 1UMCB 1MVNA 1T8WA 1E5TA 1C7IA 3N59A 1MAVA 3N8KA 4PICA 3GVXA 2WUGA 1O0BA 3LKZA 5C4IA 3VVCA 2NU9A 1KTIA 4EYKA 1Z8FA 3MLEA 3TGPA 3KYBA 3NM4A 4ZXFA 2Z9BA 4C9BA 4EH1A 5C8VA 4UPDA 5LVAA 3ELWA 2EQBA 5G1OA 4C30A 2QLMA 1N6PA 4Q05A 3ZE6A 1FL9A 2YMMA 4NE7A 4ZA2A 4BNUA 4D8UA 1K63A 2Q5HA 3PYMA 2QAIA 1BHO1 2AXQA 2WUVA 2X1HA 4XB2A 3UXHA 2YOGA 2JAUA 2PO7A 1TM1E 3IELA 4R2IA 1E92A 3TJRA 4ATNA 4HWPA 2I4RA 2QLNA 2BBSA 4R3UC 3J81A 1TPZA 3Q7TA 4AQ7A 5F3WB 1YJ8A 2CUNA 3QFHA 3X1DA 1YBFA 2X0NA 3BFKA 5IDVA 2P6RA 4IFBA 1KIFA 3EGWA 2VDWB 4MI6A 2FWBA 2WLSA 2ADMA 3CSSA 4DFDA 5JSZB 1WABA 4ZYXA 5K01A 4HPWA 1HMPA 1ZNZA 3TLXA 4MP6A 1WVIA 2R1VA 1VMIA 2WF8A 2IF2A 1HTBA 5FPPA 2H7XA 4PWZA 3DB1A 4I55B 1Z3IX 3C15C 3DMGA 4M0EA 2V0CA 1J24A 3T7AA 1AHPA 3HDHA 1RADA 3F6PA 4U2KA 4MICA 1UC8A 2V8OA 3E7XA 4OJTA 4IPTA 1IJFA 3VU1A 2Z30A 4GBGA 2IPLA 2O19A 1QVZA 4B3XA 4OSOA 1C3JA 5KC9A 4N8EA 4HQRA 1ESNA 3T3HA 1JMVA 2OORA 2QP4A 3AP1A 1P7PA 3QWHA 3BERA 3DVQX 4FYPA 3EAFA 5K6AC 3P32A 3I4FA 4URUR 4YP0A 3A27A 4QGFA 1ORTA 3NHZA 4U3JB 1Y5IA 4DY4A 2BM1A 2C5SA 2P5TB 1HDYA 3WWZA 4NEGA 3MWDA 1CRZA 1YCDA 1Z5UA 3AY3A 4GP6A 4MUGA 2HA3A 1LS6A 3AUAA 1DXYA 4XD7D 3TCKA 4JBNA 3TNYA 4DUPA 4JLAA 1FUKA 4C7JA 4MPRA 3V8QA 2PUDA 2NX2A 1C2YA 1VJCA 2B20A 1RMQA 2VSFA 3TF5A 3FG9A 3AJDA 3UMMA 5CB0A 4WHMA 4TVSA 1Z08A 5B1EA 1AMNA 4Z9XA 3KB1A 1E7WA 4JP5A 2AUNA 4V38A 3EVNA 5TIIA 4QX6A 5I9SA 2ONJA 1G20B 3CCCA 4KBGA 1JPVA 2MWMA 1JEAA 2Z43A 1KI4A 3O5AA 4MV8A 5JAIA 1Z47A 3D4BA 3CISA 3DTVD 1PFVA 5E9AA 4XQ0A 2C3UA 1OWMA 1SKYE 5J4HA 1DHTA 2P9GA 2EGUA 4OQLA 4D0GA 1BW9A 1AF4A 4ZT5A 4JA0A 1W44A 4PIMA 5A62A 1PR5A 1A2BA 1FNDA 4XW2A 4IIHA 1GL3A 1ZM3A 2R25B 5DBOA 4I1UA 1MQ8B 5EERA 2J3MA 3OSZA 4P4NA 3NNNA 1CZRA 4HVLA 3T4EA 2WIAA 1FUYB 1XD8A 3JQFC 1NJ1A 1A5TA 3AHDA 1RFGE 5K0EA 4G8CA 2RGCA 4HAXA 4AWAA 2QAGC 3P8ZA 1RRKA 4YAUA 3RTCA 2WWXA 2OB1A 3TRIA 1M7BA 1H1DA 1Z12A 2D62A 3PFGA 4RQBA 5K3SA 2DQZA 1KDVA 1ZK3A 4DR3B 2O2SA 1WOYA 2WFLA 4ROTA 2CVFA 1J0BA 4X97A 4NBNA 1OTHA 1RWMA 1O5TA 2WUWE 3PF9A 5GAJA 1XA3A 1W1UA 3MS4A 5A4IS 5BNTA 3LBIA 1K2VN 1YBMA 4DADA 3N0TA 4YCSA 1YU9A 4IM7A 1ECBA 1FDOA 1AK2A 4I55A 1GXSA 3WLFA 1HRKA 2I54A 4QG3A 2MYNA 1HYEA 1K8XB 2P62A 2Z2XA 2WWWA 4PG5A 1H4SA 3C3JA 3FTDA 2EZUA 4MWTA 1PF7E 4TS3A 2W4IA 4BNTA 5E8JA 3CO5A 1TZBA 4L8YA 4XM0A 4N8DA 1TEXA 2E4ZA 4CKBB 2CLDX 5BSHA 4LRXA 1CJSA 3HBFA 4DMHA 3M81A 3SX2A 3UC9A 1GU7A 4CM1A 2H92A 4KACA 2Q7DA 3AKEA 3IP9A 3JQFA 3RTAA 1J22A 2Q4BA 3I4LA 4KK3A 2RHDA 1R0YA 4MPJA 4YP1A 2CK3A 3L07A 4CKXA 2X5NA 4JP8A 5JHGB 1D2HA 1JSZA 2JAWA 3ESQA 1NVTA 1R64A 1HI9A 3CN7A 3G5UA 1E3TA 1MX5A 4KGZA 5TT0A 5IDWA 3UMRA 5U4XA 1DBWA 1W47A 2W2OA 5IM4A 3CWQA 3KKNA 1T6YA 2OZPA 1TO2E 1D1TA 2BGIA 4ETIA 5LOVA 2DUWA 1VJDA 2FK8A 2QM0A 4GICA 4OQNA 3JAKA 2RK4A 4GXQA 2WJ6A 4CI9A 1XPUA 2DQYA 4LQDA 3ZR4B 4FQ8A 4WEQA 2I8LA 3EVAA 3NBXX 2AF3C 3GEIA 2Z8YA 3OC0A 4QO8A 3R0QA 2L2QA 4H3SA 5D84A 4FNAA 1KGDA 4ZCIA 3MWGA 1BXRA 5KJEA 3FB1A 4K0RA 4DQDA 4M1QA 2HH9A 1IATA 2XWPA 3ONNA 1MX9A 3FYUA 4WK2B 2EV9A 3L46A 1N2JA 1UMCA 1REQA 3MF4A 3ZHOA 4Q39A 3HVIA 2RAUA 2XD9A 2PH5A 4IDNA 4YBRA 2PLWA 4B48A 4XVHA 1VZ2A 5HBGA 4OBEA 4QQFA 3M5PA 2GA9A 1GPMA 1HT2E 1WD5A 2QG4A 3E8XA 4IHJF 4A92A 5KJ6A 1Y8QA 3C5VA 1QH8A 4Y2JA 3MJDA 4D9GA 5E1BA 1LB1B 5ADHA 2HRCA 4RY2A 4DTCA 1H8EA 3VPAA 2I55A 3CINA 3DP9A 1JSXA 4QHSA 4ENQA 1R0XA 2GEKA 3F5FA 3UO8B 1SK8A 3F8TA 3NOVA 3I2JA 3WNVA 2PRYA 3FGOA 3OBBA 5KNCH 2K5UA 4B6FA 2HTFA 3GJZA 4F5YA 1I1NA 5DWQA 4DLRA 1VB5A 5FWNA 4HB4A 1GTJ1 3B60A 3EXAA 3B8HA 2YV5A 1XTTA 2PWAA 4KE9A 4P4SA 3HK2A 2R7MA 5JJBA 1K6MA 4MS3B 1Y1RA 3U81A 4U8HA 1DGQA 4UMVA 4G0QA 4BGVA 2C5GA 5JE8A 4DCJA 3AKCA 1DPFA 4IHKA 1SUFA 2X0KA 3V2GA 1RM5A 3P9PA 3FR7A 2DPMA 3IO5A 3IAUA 4I5EA 4QAQA 3TZHA 5JXHA 1U5CA 3HS3A 1U0FA 4RZSA 4WLNA 2FPPB 1WKCA 3NANA 1NW6A 2LR0A 3E1GA 1NMYA 1NJ2A 4M0UA 4IOJA 4YLYA 5HKKA 2EJCA 2C0PA 2GN2A 3LK7A 3U0VA 2NG1A 1VL6A 3KUKA 2FMHA 1I4WA 2JGMA 2Q5OA 3WSVA 4WNYA 3PQ3A 1APBA 1EX7A 2IPXA 2Q6OA 5C51B 2HM7A 4KQ2A 4RF4A 4D8YA 3K9HA 2PX8A 1FJHA 3TZLA 1KZ1A 4OI2A 4DPLA 4P2GA 4MPPA 5AOCA 5EWJB 1T3GA 4EQ6B 5FF9A 1U9CA 2F9MA 1TIPA 5SYMA 3TQSA 1EGAA 3CUSA 3UHJA 1U7DA 2KE5A 4NJMB 4EJ0A 2YR0A 2ZRBA 1ZHHA 1G5PA 1RKXA 1XQVA 1KDYA 1P7VA 3GP5A 2MYPA 2O3JA 4B0PA 3L7DA 2B7LA 4EUSA 1G1MA 1T5IA 1E4EA 3OP1A 3HMQA 4K86A 4LXYA 4CKZA 3IIJA 3M6AA 4NARA 1TAUA 1E7MA 4CMBA 2CBZA 4BTLA 4NYIR 2GRUA 2VAMA 3TAXA 2ILTA 1ZLYA 2JRLA 3DZHA 1PT7A 1Z3CA 2BHTA 3BL5A 5AK4A 3TOXA 1V16B 4PTZA 4G5GA 5FBWB 3UEOA 2CLCX 1O94A 2X9QA 4JMPA 4GX5A 3ICWA 4YRZA 4GFDA 1N8NA 6AT1A 5TPZA 4B3FX 4DE5A 4M89A 2JLZA 2C5LA 1F4PA 1VHLA 4Y9TA 1ISHA 5CNKA 1GKLA 3FA2A 3DEHA 3IOCA 3N2IA 4OB6A 3VYTB 3TS1A 1ZRHA 4BVFA 4RDCA 3GU3A 4WNCA 4R1QA 1BU8A 2O1SA 4ZQHA 1FLAA 3P0JA 3JWEA 2JIZA 1KHHA 1EGMB 3C3WA 4PSUA 3THWB 3R9XB 4WJKB 5GQSA 5JO0A 4CM8A 4ZKDA 3CZ4A 2UZ3A 1YRHA 2G1KA 4MUHA 1XP5A 4C43A 1IY9A 1PJRA 3ZV5A 1FXSA 1VPVA 1BS1A 3ZOKA 3E3AA 4NDAA 3EZNA 4Q3KA 2C9CA 1U2RA 3HJCA 1C4KA 3WADA 4DA9A 3EPPA 3I23A 4DMUB 5KYKA 2XADA 3CKMA 3GLFE 3IQHX 2AMFA 3MJTA 1HMYA 4HSEA 4OY3A 4EVSA 3K9LA 2PY6A 3IQXA 4OP1A 2W0MA 2QW0X 2AQKA 2WNHA 2K2WA 2NU6A 3O92A 421PA 1CP3A 1YOVA 1NAIA 2GARA 4HZGA 3W4IA 3X43A 4GUDA 3E22B 4YROA 1NR1A 4O4JF 3WA6A 1NAHA 1R4MB 1TECE 1H2HA 3MT9A 3O8QB 4KC0A 4D41A 2RE8A 4RTSA 5JBNA 1RU3A 3OQMA 5JMOA 4EOGA 1JP7A 3MBOA 3MGGA 1ZCZA 3DDNA 3WLHA 3GRZA 3U61B 1WQ4A 4HEHA 3WGHA 1TTHA 4JLPA 4U5XA 3REQB 2UZ4A 3EWAA 2QTVA 1AE1A 4M0MA 4FMPA 2O8BB 2WUDA 1V9CA 3QSYA 4MW7A 2R84A 4NYMQ 2VHXA 1Y4UA 4IFTA 4DEYA 5KHAA 2O48X 2KQUA 4XASA 1Q7GA 3PP8A 1G9TA 5DT9A 5CNIA 3PPIA 4PQRA 4D6XA 2BSQA 2XUIA 2NU6B 3B1WA 3R23A 1Q74A 1W6UA 3IOYA 3CUKA 1J49A 2OZEA 2PX5A 3NQ41 4BQIA 1IIRA 6REQB 3PG5A 4D45A 1XEXA 2X9LA 2FMFA 4X3CA 5I9LA 5JD6A 5K0GA 1NVEA 1QGAA 1M0WA 4L15A 3UJ9A 2M9MA 4JR2A 1G8SA 1DKOA 3UCXA 3UT5A 3TKAA 1RRVA 1SUWA 1RQ2A 4H6WA 1FTGA 4RIHA 5JSYA 1OOEA 1W7AA 1IJKA 4PS0A 5FOUA 5BWNA 4X8HA 4FZ3A 3QPDA 5B6PA 4DB4A 3PFBA 4PNHA 3VKHA 3FPKA 2J9RA 3GMDA 5CVTA 4H27A 3KKEA 4PQEA 1AUPA 2JJ1D 5CDFE 4Y9RA 1BEEA 1KAEA 5AUPB 3QWBA 1G8PA 1ETUA 2VQSA 2PLFA 4N3CA 4EKDA 5B6JA 2UXDB 4URZR 3GMSA 4M60A 3X1YA 1K9SA 4HX9A 4QDKA 1VLQA 1O95A 4D74A 3BTVA 4RZXA 1Y80A 3L6RA 3Q7PA 9LDBA 4KRYA 4PCAA 2WMDA 5B55A 2IOHA 2AV6A 1KETA 2KMLA 4B5LA 2C1EA 4UTZA 4X45A 3LP8A 3I1JA 2P75A 3F9IA 5B1DA 1HDOA 3QY0A 3QP9A 5I47A 4EHFA 3ZW9A 2JLWA 3A4MA 3HXKA 5ECDA 3PNQA 1D2GA 5I3CA 1XAHA 1L1RA 1EU1A 1P18A 3U4HA 4WFIA 2W98A 3LKDA 4XFJA 1Q83A 3LQFA 2QPLA 5DN9A 5BMOA 2WTNA 3LQ1A 4S2EA 3T1OA 2UYCA 1HBJA 2QVXX 3EGEA 1K6XA 1Y6GA 3HKBB 3FWZA 4JI3B 2HV8A 7REQB 2FNAA 3VR4D 3KB2A 2YVLA 2EJVA 3FNBA 3T35A 2B9EA 4ED9A 3EEOA 2HU7A 1L7XA 4HGQA 3E5RA 5B2ZA 1H2RS 1QFJA 4P38A 3I42A 3FBTA 4WLOA 4N9QA 1ZKMA 1IQ0A 2WUEA 2YC2C 4GMXA 3ZNOA 2QG6A 3GFSA 3N3AC 1N2ZA 3BRSA 1NWCA 2I3DA 2X7HA 2ID8A 4IIJB 4GOMD 4MA0A 4UPEA 1SUCA 4OLJA 4C87A 1DAEA 2PG3A 2M6KA 2JANA 3L7MA 1OWOA 3M5CA 2QJOA 3C16C 3PD7A 3IJEB 1BVUA 1ZVKA 2PSSA 1AA9A 1E4YA 1H2ZA 1THTA 3DM5A 4CQMD 2ZTVA 1ZN8A 3QBVA 3WAJA 2WJVA 2PR7A 1PZMA 3N7TA 5LLTA 3IAEA 3ZXSA 1AKNA 1LDMA 1B73A 1A98A 3OEEA 1SU6A 2QP3A 1NONA 1IN1A 4TZ6A 1U8EA 2ZWOA 2AE1A 3E70C 3AF0A 3CUUA 4G86A 2Q3DA 3CRZA 2H52A 3PC7A 4AG3A 1ZHOA 2WU0A 5ESWA 3EF1A 3NT5A 1A3CA 1HT1E 5MN6A 1VI6A 2PFGA 1YB5A 4PLFA 4DV7B 3K9GA 3ASZA 2FGKA 1VLJA 2C84A 1PJQA 3LO8A 1GFSA 3O4FA 4QYMA 1N4AA 3RSHA 3T38A 5E3HA 5HIKA 5BXQC 5K4AA 1U6KA 3FE2A 4CR6A 3N2GA 2X2FA 1GNQA 2JFQA 3C6QA 4X00A 2SHKA 1KDZA 3WLJA 3A04A 2BFEB 3E1SA 5JADA 3MCUA 4CKYA 2K6GA 3L7OA 1D0SA 3OBIA 3OFND 4W8HA 1IOWA 2QTMA 3W2EA 2Z09A 1MOSA 2JD0A 3NHUA 2EYUA 2V54A 5JCXA 3PBKA 3U7GA 1PEKE 2QSJA 1Q7CA 3DWGA 3BHNA 2PRIA 2DPGA 1HKUA 1X94A 3KSDO 4GT1A 1R50A 4BUCA 1QC5A 1UJMA 3OJXA 3V4LA 3TLKA 1PFYA 2KYRA 1N5IA 3QWAA 4PZ0A 4M8NE 4HS4A 1DT5A 5D86A 3WGUA 4OIFA 3DXXA 2DGDA 3D0RA 1T0IA 1I7QB 1L3CA 2IY7A 4LCBA 2FW7A 1YASA 4B83A 4A1FA 3T0FA 3X2EA 5FBVB 4H77A 4IDOA 4M9QA 5IH3A 1JB1A 3ZHTA 3IKMB 2WJWA 3F5QA 5GWXA 4BN5A 1NSFA 1LQTA 2BCGY 3ZZMA 1BN6A 3P96A 4HZUA 1R8YA 3JSAA 1EVKA 1PGNA 3JXEA 4NZYA 3JS5A 4W7HA 5D2CA 2BISA 3KZKA 2WZBA 3M6IA 3UAGA 3ANLA 4UHHA 2QRMA 4YO7A 4H4CA 2PRZA 3ORQA 4RPGA 4BO2A 1CEYA 4DBVO 3KKLA 2PXHA 1JHMA 2RH8A 4FGJA 2A9VA 4WXRA 5JD4A 1WXWA 1D9XA 4K03A 3O4GA 3I83A 5FTLA 4E46A 1OAKA 1V7PC 3AB8A 3Q98A 3QVJA 3ZIDA 1SKMA 1M7GA 1BDMA 1L4KA 5AKHA 3N05A 1IUOA 1RYZA 3QE3A 1P1JA 3CRQA 3OHPA 1KR5A 2R62A 1CUXA 1UXKA 3IVRA 4C3ZA 2GBIA 3PC3A 4QRIA 3V4PB 3L8DA 2P0EA 3SBXA 5I6DA 1G63A 3H17A 3RTBA 4LBYA 3WV4A 3KOOA 4LYGA 3EGIA 4PSDA 3RTDA 1C9JA 3W7VA 1BDIA 2ZK7A 4ZMBA 3B38A 1J07A 1JEDA 5AT1A 5SZHB 1P1CA 1PR1A 3CHYA 5EE1A 2QQ0A 2DE0X 1JL3A 1AD2A 1EVEA 1A5BB 1CZLA 2I1WA 1L7QA 1U7WA 3IDSA 1ZGJA 2RGNA 1B0UA 1ZVVA 3C3KA 1UMDB 3JR3A 3QMWA 1GYRA 4UUAA 1IOLA 5IAOA 4W5RA 2BFBA 4IILA 1N8TA 2Z1MA 4ENVA 3W6OA 1F60A 3N0RA 1T8RA 1PSZA 4OLBA 1VHQA 2RH9B 2H4JA 1K66A 1N5DA 3KG2A 1EK2A 1NP7A 5LR6A 4IEIA 1NASA 1XRQA 1RQ7A 2FUNB 5SYNA 3S3TA 3WWYA 3BE5A 4S1OA 2NPFA 1RZRA 2WSSD 5DK6A 3FDXA 4QFCA 3HUUA 1EPUA 4MO9A 4DAOA 1U1FA 5FA6A 4DIMA 2MMCA 2MU1A 3C3BA 2ZRNA 4AS3A 4PCLA 2YWJA 5HF8A 1FUUA 2ZATA 3P0IA 4NECA 3ICQB 4A4DA 4YUWA 3E3LA 4DBLE 1RFLA 1XROA 1VKOA 4AMGA 1N8SA 1Z4IA 2NYVA 3N7AA 2KJQA 3GJ7A 4Q0MA 4UJ3A 3S7ZA 1MEJA 4CIAA 4DG5A 1HSOA 3I45A 4Z4QA 3W9BA 1JBKA 3KJZA 4W5OA 2FW9A 3EIFA 5FUBA 4IQ8A 1M2VB 2LCFA 3EXEA 5LA6F 2RONA 3U48A 5I7RA 2AUTA 3AZPA 1P7CA 3PEEA 1JQLB 3IV6A 1ZVMA 2EBHX 4J0DA 4WVLA 1GNLA 4TLBA 1TO6A 3V6MA 1O97C 2CYAA 3SZ3A 2GK3A 4QO7A 3W5BA 3FHTA 3H9BA 4ZN6A 1TUBB 1WF3A 1KJQA 5CDGA 3PUVA 1RRPA 1TFUA 3S29A 1L4FA 3UBMA 5IZ4A 1E62A 4MP3A 1HE1C 3PWZA 2P3LA 3CLHA 2GKGA 5BMVA 5BXYA 2Q5FA 2VSYA 5DI9A 1QZ3A 1YBVA 4ZVOA 1SH7A 3LHIA 3GNTA 1Y3IA 2P9HA 2G9NA 3MWLA 5A0FA 1PS8A 1E2DA 2HHLA 2J3KA 2ZDGA 1QSGA 2HK8A 3QVSA 3R20A 5JPIA 5MHTA 3K5PA 2P9EA 3I1IA 4MWZA 3O4IA 2APJA 4L8FA 4BLRA 1NVDA 3CLTC 1G3RA 2BUBA 3IIEA 3F97A 1PWZA 3T5AA 2VT7A 2IXFA 1AIPA 1IK6A 1V6AA 3WJ7A 2QRVA 2ZYWX 3PXCX 5A4KA 1PX0A 5EIXA 1XX6A 1YDHA 4RFLA 1DKMA 3B5EA 3HU2A 1ENPA 4QXRA 5D7BA 2VHWA 2N47A 5JALA 4HNHA 4TN1A 1J09A 1VE9A 2FZLA 1CLEA 4XE5A 3W9SA 1W73A 4IV5A 4Z4GA 5CBKA 3BIJA 1GTVA 3ABSB 5I7HA 1DLJA 3FUVA 2J9ZB 2CV1A 4PVCA 2FOXA 3F7MA 3PDIA 1I6LA 2WKSA 4PGAA 1L4UA 1NQXA 1Y7PA 1U65A 2PZBA 3TBHA 1SBHA 1TNDA 4OQMA 5B58C 4P34A 4KW7A 4XIYA 4ZI5A 5IM4F 1SBNE 2GTIA 2Q9UA 3Q5DA 2H3EA 3FUXA 1QHYA 1P5RA 2ZTSA 2QZSA 2UAGA 4E5DA 1UF9A 4D46A 4QNMA 4HYTA 3X2FA 1E58A 1J1IA 4BRUA 3OT1A 1RT9A 3SZLA 2QYOA 5E2IA 1DBRA 2FZEA 2OXRA 4AULA 4XWKA 4JJ6A 4EFKA 1O58A 4RQTA 4UXJA 3DKKA 2FF7A 3C2QA 1ORWA 3M9WA 4F2GA 4G2NA 4AAYA 3D81A 2RBGA 3G82C 4YT2A 4K2HA 3DAYA 4MOWA 1C50A 4P33A 4D9HA 4J2HA 1UDCA 4AIRA 3LQYA 2IUEA 1NC1A 3BIOA 3LLMA 3C5WP 5FT9A 4EYEA 4EO4A 3P9YA 4MB2A 1L7DA 1T0UA 4NZZA 2ODNA 2BGTA 2ZBQA 3CNEA 1IVSA 3M6FA 4FHFA 1S9DA 2AR7A 4BP9A 3DZ8A 2PHZA 3U17A 2WYWA 3VMMA 5FOXA 3BD9A 5K8VA 3BE6A 5IPFA 2L18A 1DKLA 1S8NA 3PS9A 3GK3A 3MWJA 2GYWA 5FLEX 1TZKA 1OKKD 2QRUA 4S1VA 2DEUA 4IHJA 2R0QC 1HL7A 1AMOA 1IZ8A 4EW1A 1W36C 3ZHCA 2OGZA 4IUYA 1T4BA 5DBGA 1FFGA 3PNYA 4LMRA 4R01A 5B7PA 3DL4A 2OB2A 3CLUD 4DM7A 2HK7A 3PDJA 2FPPA 3T54A 3KQMA 4YJDA 3ZW7A 2H5LA 1ZGBA 1VG8A 3QI2A 4C1NA 3HYRA 5JISA 1M74A 3GP8A 1II0A 1V11B 4IX1A 5BWCA 4O2BB 1SUSA 4P54A 4CYMA 3ZWOA 5F77A 3JD0A 4EBBA 5AUNB 1ZH8A 3KZMA 4HQNA 5ALXA 5FPYA 1TYAE 4K9OA 4YAIA 4C89A 3L7AA 1E6LA 4QARA 1S01A 2X2PA 5CK5A 5EKDA 3MERA 5C81A 1RI2A 4WKNA 4GPBA 1SC3A 2NO1A 4N8SA 5LSAA 2I2XB 2QTHA 1FS5A 2WTMA 4GKBA 4LW8A 3TSOA 1UJBA 3BMNA 3KRTA 5BYBA 1RXVA 4N0PA 3V5NA 1WXQA 4RENA 2IZZA 3WP0A 4IRUB 1UANA 2Z95A 3RJMA 3PWKA 4K46A 3R77A 2D0PB 4GR5A 3GQVA 4XDYA 2QT9A 2GAAA 2PQ2A 2Q50A 2ZSDA 4X66B 2R6JA 3EBLA 1ZH0A 2GYYA 1UWVA 2B7BA 2C61A 4G8BA 4QYIA 4AECA 2Y92A 2R4UA 1V1RA 3HB5X 5DT2A 3UJPA 3OF5A 3SVZA 2XUGA 4R2LA 4YC7A 2PUEA 4WLEA 3V9PA 4ZDWA 3AGQA 2XYGA 4UFNA 3RO7A 3ED1A 1H0SA 1UIMA 3M1LA 4GXRA 5F9FA 3IVXA 3P19A 1DDGA 2COUA 1G6OA 1XBTA 1KZ4A 1L4HA 1B43A 1C8BA 1Z8DA 4I14A 4XWTA 2D1RA 3JYQA 1V8BA 4IVNA 4P92A 1U2PA 2O50A 1IEQA 1R9MA 3LY7A 4R3WA 3SJZA 5IT9A 1FFCA 1NMQA 1SC4A 1XZEA 4RLHA 3VPXA 2QX4A 2QYSA 2PUTA 1JHXA 3EPRA 4LUCA 4TXJA 1Y48E 2B4QA 3ULKA 1QGOA 2IW1A 3OCWA 3SZOA 1R10A 5CMLA 5LOVB 3VNVA 3GZ4A 3HGQA 2J3QA 4Q1CA 1BS9A 3PK0A 2GNOA 2YJ5A 2BJVA 3RW9A 3VO1A 3O3MB 5CDSA 1J0XO 2R3SA 2LKCA 5G3ZA 3FSJX 1CJUC 2RI6A 2CXXA 1HG0A 1DC8A 2Q6VA 4KSBA 1K9VF 3GT0A 2YFYA 1Q0HA 4HGZA 4X84A 1Z56C 2DH5A 4FS3A 1M34B 3KE9A 1SKQA 4PAQA 4P9NA 2A5GA 3C1AA 3PT9A 4QBKA 2M6RA 4GZ5A 2HUPA 4TKLA 1KMHB 4C01A 1WB4A 2FMXA 3R5JA 3ZZ0A 4BYGA 4E2WA 3SIPA 1Z6PA 2V45A 1YA8A 5AOVA 2Q1XA 2GPBA 4IMRA 4RTKA 1JDNA 2FZCA 2ZSAA 3GA0A 1LBEA 1AGPA 1NJFA 5IMSA 1NUPA 1PEYA 1NMSA 5D5HA 3UJ6A 3OPVA 2HJHA 3KYIB 3WV5A 4C4AA 1J97A 1PT8A 3BIWA 3VX4A 4B3IA 1TTTA 4PTYA 4PYJA 2Z1DA 2WZCA 2LVBA 3UMSA 3AETA 3ZJ5A 4UHJA 4FJ2A 4MV5A 4OBWA 2QRGA 1E9EA 5DIFA 3TSWA 1Z2NX 1HY3A 2GTHA 2NZVG 2GN1A 5HMLA 2BHNA 5B4VA 4HEA6 5ELMA 4LY0A 1TQ8A 4G23A 2HQSA 1SBQA 3MRXA 3MWFA 1N7IA 4Q19A 5JCOA 1WCV1 3J81k 4EAAA 4J29A 1JF8A 4O4JA 1DKNA 4GLBA 3PXEA 4PC7A 5CU7A 4A3SA 5KNCD 1C4WA 2ZB4A 1A7UA 1P6UA 1XCJA 2DBYA 1Z22A 1E1DA 1RCTE 3A3NA 3T34A 2FWPA 3AJRA 4POOA 1WUJS 4QSMA 5DSXA 5KX5F 2GD6A 3LX5A 4UBNA 1ESCA 4H0NA 1ISJA 1COWA 2CUTA 2ORWA 4J3NA 5IXJA 3KSUA 4RH0A 2PGIA 2Q9BA 2VWGA 4H16A 3TQFA 5L6MB 4KMRA 2CFRA 2G4VA 3TZCA 2B1QA 4Q3DA 1PZNA 1DJNA 3ZU6A 5JC1A 4D25A 1XZBA 4IQ0A 4MJLA 5EMNA 3WBBA 2RHWA 4JH0A 1FXWA 3L1JA 3BJIC 4ZP1A 3S0JA 3TTYA 4J3JA 4ARZA 4R31A 2J0EA 2P6UA 2YUTA 4G8DA 4TKUA 2PMDA 4L02A 2ZWIA 4UMDA 3MYYA 1QO7A 4OLFA 4X71A 3T7CA 3OCXA 5CCXA 2FE1A 2RIRA 3U3KA 4ZEMA 1ZXXA 4RKYA 1Z88A 3L05A 2E1RA 1J7JA 4F6RB 1AKQA 4PZEA 1C9EA 1OFIA 4AP9A 1S3SA 2ABWA 3SPXA 2FAXA 1HLDA 1GY8A 1OJ7A 1TJNA 4KYTA 3SFTA 4CL3A 5M2QA 3RNLA 4D4KA 1EK1A 2K2QB 1MFZA 2KLBA 2WAMA 3OEHD 3KAPA 5GONA 2ORED 2HCBA 4GP9A 3L0YA 4HRXA 2NU9B 1YBAA 1LW7A 3KJHA 5I7SA 1E0DA 4EHAA 2Y4OA 1I5OA 4Q47A 1GR0A 3EG9A 1XDZA 1X70A 2GHQA 5I5EA 1DX6A 4CDNA 1KNXA 2R8BA 5DU2A 4RORA 2Q3JA 1PQYA 1FP2A 4FK8A 4IMPA 5CVDA 1CQXA 1ND5A 5BR4A 5FOQA 2QN9A 2UU9B 2O3RA 5EYPA 5CYFA 5G02A 2ZREA 1XL0A 3DOUA 2V7QA 2JJ1A 3QBJA 3V7YA 3K15A 5K09A 3RSSA 1VHTA 5SYAA 3JASA 3D3NA 3AY6A 1HG1A 3TAHA 3D6HA 3ZCSA 1J8FA 3CH7A 2MMGA 4LKOA 3ZJ4A 3PGA1 3L41A 1Y8RA 1W5TA 4Z9AA 4EY4A 1ZCBA 1U0BB 5L51A 4I3HA 1OI7A 1UWKA 1JG7A 2E49A 2JFWA 5B3LA 1V6SA 5AI9A 2BTEA 3OX2A 5AJUA 4Z1OA 3UGKA 3U7FB 3SOZA 4BGIA 1QFYA 3HN6A 1N36B 3R3HA 4M1YA 1AV7A 1TM3E 1XXLA 1JDSA 4DN6A 4EGSA 4IIVA 2A84A 1AUOA 1SXJB 4QJIA 4LDJA 2XMZA 5AQEA 1KSHA 2C92A 4BB6A 1GTG1 5T3UA 3GCZA 4OQFA 4IJQA 3U40A 1TQ2A 3SOPA 3EZ2A 5BYAA 4D8WA 5A71A 4EHJA 1NDHA 3LDHA 2VJMA 4TVBA 2TMYA 2XE8A 2PD3A 3GP3A 4ZODA 4ZOEA 4YP9A 2UUOA 3SHVA 5KJ1A 4N41A 4U8GA 1Q0UA 1XEAA 3U7HB 4Q9KA 1XZPA 3EGVA 5JCJA 4AIIA 1BTOA 4KDEA 1PTJA 5LMCA 3WYCA 2Z3WA 2CXHA 1YZUA 1N1DA 4RPJA 1JHOA 3CY6A 4X7RA 4DIUA 2IXBA 2Z5GA 2GPAA 3RRYA 3EA4A 1YMUA 4HDSA 4MMZB 2Q07A 5CM9C 1SULA 4PZ9A 5DVZA 2EHDA 2ZIXA 3V46A 1FZQA 2BFCA 2X4GA 3IT0A 2PTHA 3I0MA 3NKLA 1RBYA 1GDTA 2BBTA 3A6HA 2XODA 4JNCA 3ILVA 1V1JA 4YJFB 2BF7A 5H4HA 3K70D 3PHJA 4MHOA 2WF5A 3HBLA 3QEAZ 1NHWA 2A1UB 2KWIA 1Y6ZA 1NV8A 2B98A 4OYHA 2ZAOA 4UCXA 3SS7X 2HMTA 1E98A 3NHBA 3RYHB 3H6HA 5E6RB 4P7GA 4PBSA 1CCWA 2PWBA 3TQOA 2IS2A 3Q10A 2GI4A 3X1MA 1PS0A 1Z8HA 4RHFA 721PA 3M9XA 1FLNA 3PC2A 2HHCA 4P80A 1SUBA 5HQTA 5JR3A 3PHGA 4E30A 1GLGA 5DTEA 2EDAA 3ETCA 2EFHB 1ZGZA 3E9DA 5AJXA 1DAMA 2V59A 4D3DA 3TZ6A 4RE6A 2AYZA 16PKA 3BQMB 2COKA 2YW9A 3EXHC 3KKZA 1LF5A 4MJXA 3KIPA 5HDBB 2WTAA 3W2TA 3ZWMA 5ADUS 2HMVA 2WC1A 2J0VA 1U2SA 4ZOBA 1RNLA 4DABA 2HOQA 2OO3A 3SC4A 4C7MA 2OZVA 2O2CA 2V7EA 2DHDA 2XQJA 4G0YA 5IK2D 3X0DA 1F3LA 1TQDA 1LSOA 2P3QA 3DUFA 4TLCA 4WZBE 2VJLA 2D0DA 1XZHA 4U00A 4EY3A 3G68A 3M34A 2GWRA 3Q7SA 2PBFA 1Q7TA 3GN2A 3QSGA 3QZUA 3K8QA 3LBAA 4FDMA 3JWJA 2HWUA 3LPMA 4G2TA 4AN4A 3NEPX 2E85A 3UYKA 2WDZA 1LY1A 4JVNA 1X1SA 3OJEA 3V8RA 2GS9A 2M1XA 3BFXA 5EINA 3TW0A 3CRVA 3GLSA 3VR5D 3THYA 1QVVA 4CE6A 4HNVA 4JITA 4G1EB 1DCTA 3TTUA 5LKAA 5CD1A 4LVOA 3LCMA 4XQ9A 4DIBA 1FYXA 1XRSB 4ENWA 2QD4A 4FGKA 3F7TA 1QRTA 1X2BA 3LHSA 3VU9A 1Y6RA 4IKEA 4IMIB 4G07A 5B4TA 3IOBA 2J6CA 3OPYI 1PL6A 2XBUA 3NEYA 4O4IA 1C14A 3ECSA 4B7CA 3D3QA 3CVYA 2W71A 2O59A 1KSGA 2XCLA 4N54A 4B3HA 4URWR 4GVLA 4U0JA 4B35A 1DZ3A 4JX9A 3ZH2A 3YASA 3NJ4A 2CE2X 4BVBA 4GU5A 1BIFA 5I7FA 1WW8A 3HXLA 1P8JA 3G0GA 1TD1A 3PVZA 4JL6A 3ZZ1A 3K9FC 2FSFA 1AQ6A 2A58A 1J90A 5AQ1A 5B64A 3NDBB 4TQ9A 3J7AC 3WO0A 4B82A 3HM2A 3LL7A 2NVUB 3KP1A 1CYDA 3VOBA 3WL6A 3KDAA 2WAYA 3JWHA 4CV2A 4B2LA 1I6WA 3CONA 5FH9A 1YR6A 3T1HB 2MINA 2HCFA 4ZAGA 1XCMA 2X77A 1XZLA 1AU9A 3KSAC 4WLUA 2HCRA 2CWWA 4HTFB 4IQGA 3UK0A 2X1VA 1RIIA 3C1UA 2Q1TA 2VDRB 1JZQA 2MIIA 4H9GA 2VQEB 1E9RA 5BSKA 1Q0TA 1SMKA 5L9AA 4QYXA 5KYTA 1UJ2A 3DOJA 1EFCA 4ZQFA 1MNQA 1DV1A 2WNSA 1NW7A 4DNQA 1G7TA 4BP3A 4JR1A 3CVJA 1SQ6A 1O87A 3K5WA 4K9KA 3JYPA 3GNLA 3U44B 2CXNA 2NZJA 1DSSG 3CMCO 4INJA 3BE4A 4PSCA 4ZVLA 1ZM7A 1J5EB 1ISMA 2BAGA 5DX0A 4TTPA 1SU4A 3PE4A 5F1OA 5F7OA 3RYFB 1XCGB 3QIAA 1D09A 3QW2A 3DR5A 4GOKA 1U8ZA 1H6DA 3CS3A 4P7BA 5BW4A 4K6MA 4RD1A 4ZQEA 2Q6LA 4TX1A 5JVDF 5HG0A 2CNOA 1BCRA 1KERA 2XF2A 5D01A 2EW1A 5JS6A 2X6TA 2CLFB 3KQWA 4BX2A 4FT4A 4MVJH 3RSGA 2G7MC 1KYIA 1H8ED 4LECA 1N0VC 1GZVA 5HCNA 1NF2A 3EASA 4L3WA 4FR0A 1GN8A 1GU1A 2XLCA 3RG2A 1ACMA 1IY2A 4Z9FA 1J06A 5B5SA 1AVTA 5ELLA 1ZMTA 2GGSA 5BSWA 2NVWA 4TLAA 3OX4A 1WW2A 1P74A 2DTXA 5KSPA 2H51A 2HPVA 4DLYA 2UDPA 1NVUQ 3HCEA 2GD0A 5FI5A 3QKUA 3IQDB 3KLNA 3OHSX 5L95A 5HCUA 3LG2A 2I7DA 3EZ6A 1M2HA 1J7KA 2E7ZA 4L0CA 2D4HA 4Q9LA 1I10A 1B8NA 1X7YA 4JLKA 3O6VA 4TXHA 1UUFA 1XTZA 1SK9A 3P94A 4YMVA 1KYWA 1NE2A 3QBDA 4PC3A 2GWHA 1ZL2A 2ZJ8A 4WUTA 4CQMA 1Z2OX 4ESOA 3ZI4A 4CCSA 1EP9A 4U5QA 1D03A 3CT6A 2NU8B 4XRGA 1PNVA 4RVUA 5MGNA 4MGEA 1MRZA 4HXFB 1Z18A 1KP3A 3OLXA 4ODIA 3KLBA 2G1JA 1U9JA 3CT4A 3FYSA 1P3JA 2GVDC 4R2HA 5JWOA 4LF6B 3OX3A 5FR1A 1QX4A 3RGGA 3W8EA 4FN4A 3EXIB 4OFXA 4DLNA 1EJBA 1J2YA 1V0JA 3KB8A 2D2VA 1K4KA 1R00A 2PR2A 2VXBA 2WWRA 4MUBA 3BDIA 3QYJA 3FX2A 2WT8A 5ALLA 2BGKA 3HVHA 1O97D 1M6VB 3LE8A 3TFWA 3QE9Y 4KBFA 1P2TA 2HIMA 3DPIA 4Y1RA 2UUBB 1FTNA 2H2GA 2VA9A 3LQQA 4KPUA 3OG9A 2OPBA 4W63A 4XI9A 5EXDA 3V1KA 1LJLA 1X39A 1NN3A 1QG0A 3OZFA 1VE5A 4MTCA 1J9GA 2C3MA 1JDBC 1I2MA 3KT0A 5ADWA 4A0RA 1SVSA 3OOSA 3H1FA 4HZIA 4QTXA 5C7OO 1EAMA 4FB4A 4LJAA 1T1SA 2W37A 5JEDA 5HBRA 3W5VA 4C0JA 5ECWA 3H1EA 2J8ZA 3FY4A 3G2QA 3KZ1E 1CTQA 3A4NA 4U2GA 3RVBA 3IT1A 5ALJA 4E5SA 5F7XA 1EP2B 3A70A 1NU6A 2FN3A 1OXMA 4C29A 4GG1A 4MQBA 4O2AF 1LNQA 4YRPA 3S8EA 1LC0A 5TMDA 4YV2A 1UBKS 2AR9A 4QRDA 4PX9A 2H5IA 1P5JA 3WIVA 4A2PA 1WQ1R 2IHYA 4LBZA 4RIEA 3UXMA 4KVAA 1DMRA 5BV8A 5E7MA 5EEHA 2B9VA 2IIVA 3IAFA 2XR1A 3OIWA 1C1XB 3GPLA 1YQ9A 2HIGA 4Y2XA 4DLVA 5C7LO 1GAXA 1T9HA 3M7IA 5BR7A 4F06A 1FP7A 1BEZA 4YNBA 5DN6D 4A5SA 2GQ0A 4JIGA 1H9BA 2A4MA 3RI3A 1M83A 2XTMA 5CEFA 1UBEA 4DREA 3I5AA 2IVZA 3HL4A 2GYUA 1XU9A 3C8ZA 1ZD9A 1USWA 2WYOA 4YRFA 3RS3A 2FX3A 2FWJA 2HQBA 4G01B 3GVPA 3NRBA 1XXHB 3QRWA 1P7WA 3BHMA 1SD5A 2AKEA 1T6XA 2YY7A 3ANMA 4LISA 3TD2A 4CG3A 4JSYA 4BNIA 2UZ0A 1ADFA 3CUTA 3MC1A 5IC5A 1F8XA 1G6HA 1NMXA 1W35A 2P3SA 3C24A 5ARDA 5FHQA 3GT3A 5H81A 2CNWD 2ZLBA 1DTSA 2CZCA 1ZW1A 2LWIA 3MJCA 2P2ZA 3ANSA 3QE2A 4K28A 5LXTA 3FF4A 3C4VA 5DF1A 1DKUA 1IUPA 1KBZA 1VKJA 4BZQA 1Y8AA 1W5BA 3ZWXA 4RABA 1OBVA 3QEMB 1N2EA 4R41A 4C21A 1ITZA 5E38A 2ID4A 4QDTA 1PHPA 1GPBA 1QFSA 3CYFA 5ECGC 3W06A 1NQOA 4R16A 2R85A 1WULS 5JASA 1DVRA 1WMDA 4J7AA 4MW1A 5CHEA 1YFKA 4AMBA 1OBCA 2CFCA 5K6TA 4H08A 1E5VA 5JWHA 4W9MC 3FF1A 2GVNA 4QOFA 4OUKX 2WSIA 1UT8A 2QN7A 3MTBA 1I0ZA 5KYWB 4E2YA 2P40A 2G72A 1KJ8A 4ZIRA 1RBMA 1AT1A 3V4VB 3HJGA 1NY5A 3GLIB 1XNRB 3LBHA 3AR4A 2YV4A 1VB3A 4HPXB 5DHAA 4EPVA 2DWUA 3OQIA 3T7DA 2YJTD 2PKQP 1VA5A 3GFFA 1A9TA 1M67A 4EKGA 3KFVA 3LECA 3N87A 5KHOC 3MSCA 2J5KA 3MJFA 2FZ5A 1JKFA 2B8JA 3GEDA 3LWZA 2ZGVA 1JDJA 2FP4A 2JF0A 1XQ9A 3B6EA 2WEKA 5JAHA 1FTYA 1NSTA 4OUDB 1QS0A 3DT9A 3LL4A 3VR0A 4TKVA 2ZRMA 1NFFA 1WS6A 3OHMA 2FXIA 1BMFD 1T2EA 3NBZC 1G4AE 1M54A 2B8WA 1UBTS 5ERGB 1US8A 2C5FA 3ADOA 2HA5A 8ABPA 3VDQA 4JKYA 5B1HA 3WBKA 3FJOA 2HL6A 3RHSA 2AN4A 4I5IA 1PNOA 4TTTS 1SVNA 2WJPA 4IJWA 4FFNA 4I1PA 2BCEA 1K8ZB 2OCLA 4I6EA 5ITVA 5CLHA 3QXSA 4INPA 4KU4A 4LWZA 4KAFA 4NP6A 2ZAMA 5FWDA 2O2YA 2ATIA 3HJAA 3RS4A 4D8VA 5CYPA 1EFPB 4KDCA 1TKCA 2QQ5A 4ZAWA 2VRBA 1MO6A 3I2YX 1UXJA 2A5DA 2PPLA 5E0OA 1AS3A 5AW7A 1FBNA 4IJ5A 4PSKA 1SZCA 5FV4A 4QBIA 1I3KA 3K1AB 4I8IA 1YZHA 3GI1A 3HEAA 4EHBA 4Q3CA 5T4FA 5C2JB 2N75A 1ILWA 3OO1A 3UK7A 2ZOSA 3W2IA 2A33A 2J4DA 4TMWA 4AJJA 1VGQA 3KAJA 9ATCA 3H6KA 2RCNA 5I3ZA 1JHAA 1RLJA 2E89A 2GZMA 4O5OA 4ZU1X 5IBCA 3DCNA 3PEYA 1BX3A 1NZJA 3GLTA 3DKVA 2XKBA 1TF5A 4BNXA 5A4MS 4XCXA 4N7BA 4LYEA 2PUAA 1AC5A 1L8OA 2VXOA 1WP9A 1J9ZA 1XLVA 2VXCA 3QW4B 3UUGA 3WFZA 3CVXA 4M36A 2O5CA 1FP4B 1XR3A 3QX7A 1I4TD 2O8BA 4HD8A 1R6BX 1DJLA 2RHRA 2WYUA 1OZAA 3A9RA 3E4DA 1O96B 2HB6A 3C8UA 3GLHA 3PR2B 4XB6B 5B3JC 3HY6A 1ZRNA 5F33A 1T6NA 2OA0A 5CLGA 1H9CA 2EW8A 2BPOA 2C4UA 5IFKA 1MA0A 2EJTA 4V24A 4ZFNA 2GM9A 1T5OA 2JLCA 4CTOA 3A26A 3NHWA 3BWXA 2Z9CA 3N74A 4GBJA 1VTKA 4Y1FA 3EVFA 3RHZA 2QBYB 3EIUA 4UHFA 3SQOA 3WKEA 1Y1KE 4D3YA 1ZJ4A 1GSIA 2W6ZA 2K7FA 1HYBA 1ZBDA 1D7OA 1OU4A 2DWOA 3NBKA 3FOWA 4MITA 5JCPA 4BRSA 4RF5A 1HGXA 2GJ9A 1GDHA 4II2A 4W6QA 4KOAA 3GJQA 3REOA 4NU6A 2OYRA 2PCJA 3UWKA 2Z98A 1CNEA 1II9A 1ODKA 1W85B 2XDQB 1F6BA 2JS7A 1E3LA 5JS2A 2B5WA 1NNUA 3AU8A 4X8MA 2H1FA 4ON9A 5H9WA 1MJGA 2ECOA 5A3JA 3TMKA 3W5CA 4TQUS 1P62B 3DBRA 1JIJA 4BQOA 1LTKA 1U02A 2EX4A 3RWBA 3M4YA 5EJ5A 4DR7B 2W2NA 3RFUA 4L76A 2FHPA 4F60A 4M0KA 3GHYA 3FMGA 5KX5A 4JLSA 2WHYA 1E8DA 2C5HA 2R44A 2WD7B 2GHTA 1B8VA 3BXXA 3D2CA 1JI0A 4PZYA 5EJFA 4C0HA 3GG9A 2BKXA 1Z0FA 1D4AA 2OO5A 1MLDA 2FPRA 1OH7A 3DULA 3GLRA 3OT4A 1YCHA 4JBYA 3IMKA 4A2WA 5LM3A 2GILA 4PQGA 3G79A 3ZWAA 3FDZA 4S35A 1QH0A 1TTPB 3FJYA 2HQRA 4ID3A 1KYTA 3H1TA 2CNKA 1R3UA 1SVUA 1S89A 4XJSA 5AHKA 1F14A 5CAEA 2OWDA 1ULZA 3FW1A 4KAXA 2AXPA 4RLQA 3OWXA 5AUQA 3EPJA 4X20B 1AXGA 2YJNA 4YEDA 1JA9A 2ZIAA 5CCDA 3UKJA 4JGBA 4CFSA 1OV4A 3W0LB 1AKMA 3K2QA 3LA6A 3PDWA 3MN1A 3M82A 4CF3A 2V55B 3N75A 2WD8A 1YVPA 1WETA 1XA4A 2HF2A 4IP0A 1XV5A 1QH1B 1F4LA 3KQHA 2TYSB 3B82A 3NDJA 1H85A 2F62A 4O8CA 1JKIA 5E2BA 5FRDA 2PD6A 4ECEA 4PRYA 5KYGA 5HJ7A 2NTNA 4S1PA 1SVWA 1W4BA 2RIPA 3ASVA 1GZ4A 3AMVA 3LUPA 3P2KA 3Q6MA 4N0QA 2AFHE 1S2IA 4P4UA 4QBTA 2IOYA 1OZGA 3ABZA 4WA8A 3OTIA 5K2OA 4CIBA 1VQ1A 4TS9A 4AY4A 1I7PA 4DQUA 3B6KA 2RGEA 3OZVA 5LQCA 3SJCA 3RYCB 2UZAA 1ZAYA 4NNPA 2G1PA 1XYYA 2NP6A 2Z58A 2XRFA 4AP6A 4P86A 2XTNA 3OZDA 1C30A 3KQVA 5FKJA 4R8RA 2BTOA 2JLUA 2WW8A 1MRNA 3I01M 1JDTA 3WGGA 5BORA 3GBSA 4Q1VA 3BXHA 1I30A 1JIIA 2PGJA 3LPCA 4KI0A 4KODA 3DWFA 2Q99A 4YJHB 1EZ1A 2C4NA 4MDEA 2R6FA 3PJEA 1BX0A 4DNXA 2FZVA 4XX0A 3OWHA 3OEWA 3AVYA 3PTZA 1PEDA 1NT2A 2QN6A 4M1OA 4L95C 4B4UA 1MAWA 5T41A 4R40A 3CUWA 4LGCA 1V7ZA 4AZ0A 4YJ3B 1X7YB 4WKGA 4CKCA 1L8XA 1HX7A 3WMRA 3HNOA 1QG4A 2W2PA 4DDWA 4LDRA 5IVPA 2WUFA 2YNMC 3P9CA 1GRRA 2F43A 3LUBA 1JR2A 1JTEA 2JLAA 2YN0A 3Q3IA 5CLLA 4EO9A 2WINI 4WESB 1X13A 3RYIA 1UJNA 3FR8A 1EXDA 5B57C 3U37A 3AXTA 1LI4A 4AMUA 3ZE1B 1P19A 3KB6A 3AR5A 4QLOA 3T9CA 3ZH9B 2JLVA 4QA9A 3QLTA 1Y0BA 1STOA 2RGNC 2XE6A 3W5JA 1AQYA 1UWCA 5C31A 3VU8A 3RJTA 3UJBA 3D6VA 2OGUA 3HUTA 1KE1A 2OV6A 4FUTA 2QI9F 2XRMA 3IALA 1P60A 1Z7EA 3PF8A 4P8RA 3ND6A 4PR3A 4WFKA 5DHRA 3PX2A 3ESXA 3M4XA 5E7QA 3MJEA 5FOVA 1BMFA 1F06A 1NXPA 1YVEI 1YDMA 4JODA 2JFOA 4DGSA 1N3YA 2GO7A 3K0SA 2XMGA 3O91A 4N03A 3EG9B 3R1IA 4HPJB 4TV8A 2OBMA 1ZMRA 2IH5A 3TO5A 4ZI3A 1W48A 5EJGA 1JAXA 1ODSA 3DE3X 5HIAA 3UOGA 1U6IA 5IEJA 3ZLJA 3HYNA 2AN5A 5E6SA 5HK9A 2Y1XA 3SVTA 1EXVA 3S1AA 4JJ8A 3HU1A 1LDEA 4YVFA 4AP5A 3AVWA 2A0WA 2I2AA 2FSUA 3GUHA 3IMFA 1RJDA 1MC4A 4JJAA 2QHXA 3LOQA 4PZZA 3TQTA 2NYAA 2PSJA 4BNGA 5KVCA 1BD4A 2II6A 2CSXA 1A4UA 4JGIA 1H42A 3ZX4A 1U1EA 3G6KA 2JCVA 3T8YA 4L4YA 4EI7A 1YRYE 2UYQA 2AMLA 2YHAA 3ISVA 1W5EA 3HNPA 1YNSA 1YS4A 4R8MA 1LEHA 1G19A 1IN4A 4KLCA 3R74A 3ZD6A 2PZAA 2B83A 3Q8KA 2ZBPA 4O0MA 2DFNA 2GCOA 2O2IA 1VBFA 1YZQA 4RY0A 2HQOA 2K7ZA 1UPBA 2FFBA 1CERA 2QUKA 5IZCC 3GARA 1T0PA 5LXTB 2J9FB 1JDBB 3TEFA 1S8FA 2BGJA 4RACA 2LUOA 3ID6C 3N86A 1BJRE 4IO1A 4ZOAA 5HKKD 2F8SA 2JHGA 1GNSA 2PMKA 4DMGA 5KDOA 4HWKA 1R88A 2QV0A 1WZIA 2ZXEA 3HDVA 4HDRB 3TR5A 4Q93A 3TOZA 3GJ6A 5CYGA