3OZSA

Rat catechol o-methyltransferase in complex with a catechol-type, trifluoromethyl-imidazolyl-containing inhibitor - humanized form
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
213
structure length
213
Chain Sequence
DTKEQRILRYVQQNAKPGDPQSVLEAIDTYCTQKEWAMNVGDAKGQIMDAVIREYSPSLVLELGAYCGYSAVRMARLLQPGARLLTMEINPDCAAITQQMLNFAGLQDKVTILNGASQDLIPQLKKKYDVDTLDMVFLDHWKDRYLPDTLLLEKCGLLRKGTVLLADNVIVPGTPDFLAYVRGSSSFECTHYSSYLEYMKVVDGLEKAIYQGP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Catechol O-methyltransferase
publication title Molecular Recognition at the Active Site of Catechol-O-methyltransferase (COMT): Adenine Replacements in Bisubstrate Inhibitors
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transferase/transferase inhibitor
total genus 70
structure length 213
sequence length 213
ec nomenclature ec 2.1.1.6: Catechol O-methyltransferase.
pdb deposition date 2010-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01596 Methyltransf_3 O-methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3ozsA01
2Z6UA 2IFTA 3JWGA 5E1DA 4LG1A 2IBTA 2GH1A 3KQMA 5K0LA 4OQDA 3X0DA 2ERCA 3EVGA 2PSSA 3OFKA 2O57A 2ONYA 3DTNA 1BC5A 5FULA 4F85A 1X1AA 2JHAA 3KQQA 5EZSA 5EG5A 1D2CA 2V74B 2JHCA 2HNKA 1SUIA 2HR1A 5EIFA 2NXEA 2XBMA 2OXTA 4UOEA 3PX2A 3AXTA 1R8YA 2HMYB 1VLMA 2IIPA 3FUWA 3HCEA 1TPYA 4ER0A 1RI1A 1NKVA 1VQ1A 3HM2A 3M6UA 3HP7A 3UFBA 3V8VA 5GIPE 2ZFUA 1RI4A 3MHTA 5K0GA 5DPMA 5ICEA 4K6MA 1RI3A 2IH4A 2BM8A 5F2NA 3CKKA 4RVFA 4G56A 4PGHA 3A7DA 4PYMA 5DSTA 4AZSA 5CVUA 3UA3A 3M6VA 5E2BA 10MHA 3EVAA 3IHTA 1KPHA 4ZTBA 1FBNA 3EVFA 5ICGA 1L9KA 2OB1A 2VS1A 3K0BA 2FK7A 3D2LA 3EGIA 3A26A 2P35A 4EK9A 1EIZA 5HILA 3SX0A 2WA1A 4EKIA 1EJ6A 1KYWA 1YZ3A 4PYIA 3VYWA 3SR4A 3UJCA 3LDGA 1TW2A 1M6YA 5HIIA 3JWJA 3OU6A 2IGTA 4QVGA 3MQ2A 2OKCA 1VBFA 3KQYA 4DM3A 4RTNA 1WXWA 2O07A 5E1BA 4OA5A 5LR6A 5CM2Z 2QRVA 5DM4A 3HA3A 3C0KA 2H1RA 4QTTB 1R74A 1EQAA 2GB4A 2BZGA 3QOWA 2OY0A 4RV9A 3O7WA 4KDRA 1UIRA 2VP3A 3TQSA 1ZGAA 1Q0SA 1X1DA 4X61A 2IP2A 3UZUA 1D2HA 2IPXA 4LWOA 1AF7A 2FRXA 3IEIA 2Q41A 3PB3A 2N47A 5EEHA 2OBFA 1BOOA 5EMLA 1XCJA 3B7PA 3FPEA 3PS9A 1O9HA 3BT7A 3G7UA 2AOXA 3I53A 5K0BA 5G02A 4YUYA 4DCMA 5GOZA 3TLJA 2IH2A 5K8VA 3O31A 2H00A 2VZ9A 3G2QA 4POOA 1DCTA 1G60A 2O06A 7MHTA 4RVGA 2NYUA 1B42A 4GOLD 5K0FA 4KIFA 2YUIA 3FTFA 3DH0A 1ZG3A 4C4AA 5K03A 1MHTA 4E2YA 2YX1A 5HZMA 3BGVA 4KIGA 5F2KA 1I4WA 2UYHA 5F2OA 5E8RA 3CC8A 3M70A 4KRGA 1NV8A 2XVMA 3DLIA 2C7OA 4GBED 1KPGA 1SG9A 2UYOA 4MIKA 3LX6A 3THRA 2ESRA 1EJ0A 1JG2A 1IM8A 1OR8A 3DULA 1P39A 2PXXA 3BWBA 3MCTA 3TOSA 4L7VA 3LL7A 5DXAA 2AOWA 2A14A 4PIMA 5DRTA 2FCAA 3EMBA 1L3BA 4QQNA 5GINE 2P1DA 5GWXA 5HIMA 3RW9A 3KKZA 4A6DA 2ZWVA 1NBIA 2ONZA 3G5LA 4KVZA 5FTWA 4R8SA 5K09A 3GRZA 4XUDA 2UYQA 2ZVJA 3QOXA 3TM4A 1Q0TA 4DCGA 3CJRA 2ORED 5HIJA 2PXCA 3T7TA 2QYOA 3SM3A 3BWYA 1FP1D 3GNLA 4XUEA 2QM3A 3ER8A 2O05A 1WZNA 4Y30A 5K0JA 3ER9A 3HCDA 4DF3A 5EPEA 5EZQA 3NDIA 4E33A 2AS0A 3H2BA 5BXYA 4IV8A 2AN3A 3FUVA 4DKJA 4BLWA 3DOUA 3EMDA 4HSGA 2PT6A 3HA7A 3ERCA 2AR0A 5K05A 3NVKI 5BP7A 3HA5A 1QAQA 2YTZA 2YVLA 1YF3A 5DLYA 1ORIA 3PVCA 3SSMA 1ORHA 2Z6AA 1NBHA 3FPHA 1VPTA 2NXJA 4RYLA 3MAGA 4CKBA 3KPUA 1AQIA 2IDKA 4PYOA 2YR0A 5CIYA 3FZGA 5B1SA 5EC8A 4YV1A 3KPJA 2B2CA 4GF5A 3PT9A 3REOA 2PLWA 2GLUA 2PVCA 4QDKA 1QAOA 2ZWAA 3B3JA 1N2XA 1KYZA 5LQCA 3TM5A 3PX3A 4E2ZA 3GDHA 4PINA 2PX8A 3LECA 5EOVA 4CWAA 3EVBA 3FRHA 4RVDA 3T0IA 2PJDA 3VC2A 3TFWA 1JSXA 1SVUA 3G8BA 3OZTA 5DX1A 2P8JA 1XDUA 5FWAA 1P91A 3VC1A 2I6GA 4LECA 4PGGA 3O4FA 2C7RA 3M4XA 3P9IA 2PY6A 2H11A 2Y1WA 5EQJB 5EVJA 4CTJA 3OE4A 5DM1A 4EQZA 1UFKA 5HIKA 4P7KA 2ZBRA 3U81A 3FTDA 2ZBQA 4FT2A 2FPOA 2B25A 4CTKA 1JR4A 1SKMA 4X1OA 3FYCA 2B78A 3P2KA 3UA4A 5K01A 1NW7A 1NV9A 3GRVA 3B3GA 4ISCA 2GA9A 4AUKA 4JXJA 2GS9A 2PX5A 3AWIA 3KQSA 4FR0A 1NT2A 4GQBA 4HGZA 5DTQA 5LQUA 2C7PA 4IV0A 2XYRA 3HVKA 4RWZA 1L3IA 1JG3A 3ELDA 5FQOA 5FWDA 4AZTA 1G38A 3P71T 1HNNA 3ELYA 4XCXA 3OU2A 3OZSA 4PYNA 3P9KA 5IH3A 3THSA 2JJQA 2YXDA 2NXCA 3EVEA 4PYKA 3KQWA 3OFJA 3MGGA 1O9GA 1ZQ9A 5FADA 3UBTA 2IBSA 2NP7A 4PNEA 2KW5A 4FT4A 3ME5A 3QV2A 5CVEA 2GAFA 1VE3A 4M36A 5T67A 1G6Q1 2PGXA 2I7CA 1EG2A 3UJ9A 5KS2A 3BWMA 4MTLA 5D1HA 5EEGA 4GC5A 4HTFB 1X1CA 3LCCA 5FHQA 4YMHA 1I9GA 5DTRA 1XCLA 5DWQA 5FUBA 5LQNA 3GGDA 3MTIA 5DT2A 4A6EA 3LDUA 1YUBA 2P3QA 3DMHA 4GEKA 3GRYA 1T43A 4QQKA 2ZULA 3FRIA 3TKAA 2I62A 3KQPA 5DX8A 5DM0A 2G8NA 3NJRA 3UJ8A 2VDVE 3G2PA 3DUWA 5CVVA 2QE6A 4RSRA 2G70A 3F4KA 5EGSA 2JG3A 2PX2A 1UWVA 1NW5A 2CWWA 4H0NA 5IKMA 2CMHA 4YUWA 4RTMA 3BUSA 1TW3A 3FTCA 2YQZA 4PONA 5DTMA 3SMQA 3EVDA 3GIWA 1KIAA 3GU3A 3CJTA 3R24A 3RODA 3TKYA 2HV9A 2AOTA 5EMMA 3EEOA 1RI5A 2ZW9A 1HMYA 1WS6A 1NW8A 1JQEA 3DMGA 4P7FA 2P3OA 4KDCA 2V7EA 4EMSA 2AVNA 2BH2A 5FA5A 3HCAA 1RI2A 2K4MA 3HEMA 2PKWA 3AJDA 2XYQA 3FYDA 4QPNA 5GM1A 5HFJA 5GIOE 5CD1A 1D2GA 2HWKA 2PT9A 4C08A 2NP6A 4QPPA 2AZTA 3TPZA 3SGLA 1P1BA 2HTEA 1P1CA 5EKUA 3P2IA 4R8RA 5D1NA 1JQ3A 1IY9A 3BKWA 4FS8A 3SSNA 5LQJA 4CKEA 5CCBA 1YB2A 3G2OA 3M6WA 2BR3A 3NDJA 4M38A 2GPYA 3FPGA 2BR4A 2ZLBA 4RTQA 4E31A 3KQOA 3KU1A 2CMGA 2G72A 4PYJA 5FQNA 4CXMA 3HNRA 4OX9Y 1QANA 3B3FA 2DPMA 2O0LA 2IDJA 4MHTA 2FK8A 3FUUA 2CL5A 5E8JA 4RTKA 3SVZA 3L8DA 3MB5A 5CVJA 3GCZA 5K0CA 1JG4A 3PTAA 3E23A 4GOND 2ZZKA 2I9KA 4U7PB 5HEKA 3KHKA 2EJTA 1YFJA 2Y1XA 3EEYA 3OU7A 1INLA 5ERGB 4DMGA 3T7SA 1XJ5A 4Z2YA 5K0EA 5T64A 5BW4A 1FP2A 3A4TA 2FHPA 1R8XA 2ZIGA 5GP1A 5M5BA 3FPFA 2AOTB 1R00A 1FPQA 3NWBA 5EIWA 1EAMA 3P2EA 2JH8A 3GJYA 1SQFA 3HVJA 2LD4A 1KP9A 2FYTA 4GUAA 4X41A 3V97A 2Z6QA 4HTFA 3UJDA 4DA4A 4IWNA 1WG8A 3DMFA 4C07A 1KHHA 5JR3A 4BP3A 1PJZA 3EVZA 3KR1A 4YUVA 4YUZA 3LDFA 3LHDA 4HGYA 3EGEA 1IXKA 4FP9A 4FSDA 5P8WA 4C03A 2E5WA 5T6BA 4R6XA 2OB2A 3CCFA 3DXYA 5C1IA 2PXAA 1XXLA 3BZBA 3I58A 2OYRA 5EHIA 5EHGA 4FZVA 3VSEA 4P7JA 5KQSA 4F86A 5GM2A 2IH5A 4OBWA 1KPIA 1VP3A 5FHRA 3Q7EA 1BKYA 3S68A 1X1BA 1NW3A 4CKCA 2VDWA 1XTPA 2AOUA 5LQKA 3IV6A 1RJGA 3AY0A 4GOMD 5E1OA 4XUCA 2WK1A 2WA2A 1VL5A 5EKXA 3LCVB 2PWPA 3HCCA 3LKZA 3LSTA 4HG2A 3M6XA 4X63A 3TRKA 3HVIA 3KR0A 3LBFA 4FGZA 4YV0A 2PWYA 5DSXA 1DL5A 3EGVA 4C04A 2ZZNA 2F8LA 2ZSUA 3DR5A 3E05A 5E9WA 3G5TA 1O54A 3PFHA 4MQ4A 1Y8CA 3CVOA 2PBFA 1F38A 3HCFA 3BGIA 3Q87B 5MHTA 3HCBA 2P40A 1N7JA 2ZBPA 4RTRA 3PFGA 1XVAA 3R3HA 3NWEA 4PYLA 3ORHA 1ZKDA 2CKDA 3OZRA 4E2WA 1MJFA 3ANXA 9MHTA 4PIPA 2EX4A 2OO3A 1QZZA 4GC9A 5DM2A 2NXNA 4BLUA 4BP1A 5JUWA 4YUXA 1RJDA 5E1MA 1X19A 4GOOD 4EVIA 3C6MA 3BKXA 2QY6A 1M6EX 3KR2A 3LKDA 1XDSA 3G8AA 1G55A 3PLAE 3EVCA 1JQDA 5CCXA 3KPYA 2R3SA 4HRAA 2OPBA 4LWPA 3I5UA 5DXJA 2PX4A 3B89A 1G8AA 3LCUA 4HC4A 4NECA 4QTUB 4RX1A 3UJBA 5K0NA 3KPWA 4B17A 1QAMA 5C0OE 5ICFA 5LQAA 2BM9A 1N7IA 2AOUB 2AVDA 3LBYA 4BY9E 2P41A 4DZRA 1ZHFA 2JHPA 4RTSA 3MTEA 3P97A 5E9JA 1R18A 2ADMA 1R6AA 3GXOA 3UJ7A 3FTEA 3RIEA 4EKGA 4ER6A 3TMAA 4AZWA 4KW7A 3A25A 3P9NA 2ZIEA 5EMKA 1JTFA 3C6KA 3KQVA 3G89A 1ZGJA 3K6RA 2UZ4A 4ATNA 3AXSA 4PYQA 4AZVA 3MCZA 4OBXA 3MERA 3NMUF 8MHTA 1YZHA 4RTJA 3BGDA 3C3YA 3FPJA 1XDZA 3OPNA 5U4XA 3UJ6A 4ER7A 1YFLA 1NW6A 4U7TB 3KR9A 4V0QA 1Z3CA 1KXZA 3I64A 3TR6A 3GRUA 4P58A 2XYVA 3IYLW 3GWZA 3G88A 2EFJA 2B3TA 1WY7A 2YXEA 1DUSA 3BWCA 3FUXA 4QVKA 2EJUA 3CJQA 3JWIA 3ELWA 3WSTA 4ER5A 4YMGA 2JH9A 3NTVA 1BHJA 5E9QA 3ELUA 4E2XA 4E32A 1I1NA 4E70A 3E7PA 2BR5A 1L1EA 2R6ZA 3EPPA 1NE2A 3LPMA 3A7EA 5FA8A 2C7QA 2ZZMA 4WVLA 1VIDA 4C06A 5KVAA 3NW9A 3OCJA 3M33A 1WXXA 3SXJA 3CBGA 2AN5A 2UYCA 3I9FA 1L3CA 1SUSA 3ID6C 4HH4A 3DXXA 3KPVA 4KWCA 4V0RA 4E30A 5KQRA 3HTXA 4Y2HA 4DQ0A 5ICCA 1RJEA 3GO4A 5FCDA 4OQEA 3R0QA 5C9ZA 1JSZA 4IKPA 1QYRA 3R6TA 4RTPA 2P7HA 4M37A 2EG5A 2AN4A 4YV2A 3UJAA 5KYGA 2G71A 2QRVB 5H02A 4WXHA 3B5IA 1V39A 3C3PA 3JWHA 3NVMB 1G8SA 3P8ZA 4PWYA 4PCAA 4QDJA 5LSAA 1AQJA 4X60A 2B9EA 2PV0A 5BW5A 2OZVA 3BXOA 1JG1A 3G2MA 5CVDA 3CGGA 3FUTA 3KQTA 5DRYA 2VDUE 1U2ZA 2YXLA 1F3LA 1M0EA 4PCLA 1FJXA 3UWPA 4O29A 3GRRA 4ER3A 2XVAA 4AX8A 2P7IA 1RJFA 3LGAA 4RVHA 3OE5A 3E8SA 4F84A 5CUQA 5E2AA 3HVHA 2P3LA 4P7GA 1H1DA 4RTOA 4BLVA 4OA8A 5HOQA 3T7RA 2NNWB 3DP7A 3P9CA 4R05A 2DULA 2G1PA 1SQGA 2ZIFA 3DXZA 3A27A 5EMJA 4RTLA 2AOVA 4FSXA 1KR5A 4C05A 5DX0A 1JTEA 4R6WA 2ZTHA 1AV6A 1PRYA 1VP9A 3SSOA 5LQRA 3DLCA 2ZCJA 3R9XB 4M7RA 4MWZA
chains in the Genus database with same CATH superfamily
5CJ2A 2ZQZA 3N8DA 1BN6A 3AEQA 4YJGB 3Q5DA 4UHFA 3RF7A 1Z28A 1E69A 4EFKA 2ZYSA 5C31A 5KYXB 2RE8A 4PZCA 4C7VA 1E5TA 2WF9A 1VJ5A 2A1TR 2A5DA 2C9YA 3F49S 3CEPB 3G2HA 5HHTA 3FH0A 4U2CA 4C1BA 4GXTA 2V74B 1SO8A 2DQSA 4ASUA 2HNKA 3JVEA 4YQYA 3DAPA 1J5PA 4XOUA 4IH1A 3PX2A 5EQFA 5M2QA 1Y1TA 2NMVA 2DBRA 1MR3F 4NL4H 3S2ZA 1SVWA 4JVOA 2PL9A 4RACA 3PEVA 1WE2A 3SQMA 1QG6A 4IDNA 4WCVA 2CJYA 4ZI7F 1XPUA 2Q9UA 4C7KA 4UPVA 5HP4A 4D0RA 1JR3A 4N40A 2QOEA 1QUFA 5ALXA 5EJMA 4PGHA 1EU1A 1NF2A 1PS0A 1DS6A 4OGLA 1T9KA 5DZSA 1IXRC 1Q74A 2CL7X 3EIFA 4EITA 3ZXIA 5BN4A 4YCSA 1YQXA 2RH9B 2Y6VA 4O5OA 3UKJA 1KQNA 1RE0A 3WP0A 4F04A 3Q2IA 1A8SA 2XF2A 2YY5A 5JSZA 4FWTA 5JLAA 5LU9A 1A72A 4ZO9A 3V00A 4BN5A 2G9ZA 4JYBA 1YIAA 5JLJA 2D5IA 3Q85A 3OU6A 1G2OA 1EA7A 4IQ0A 3BXFA 4KIJA 4LNUB 4BASA 1QX3A 4HDSB 3BRWD 1T0IA 2PANA 1FYEA 3GJSA 1LC0A 1VB3A 2EC5A 4OXNA 2SCUA 2AL7A 4J75A 2QJOA 3SJUA 1TTPB 1JJ7A 4O4HF 3KYCB 4ZT5A 4KN6A 2M6LA 1YAHA 1PFWA 1GPNA 2DBZA 2HXGA 4RMJA 5DBGA 3VR2A 2F48A 5FFMA 1IZ0A 1ZGAA 1E58A 1X1DA 4FMDB 4MPJA 5B3KA 2GPNA 4FYMA 3WLIA 1J99A 2BELA 1UMBB 2DJ5A 5HCNA 3S2EA 2NVBA 2CSUA 2V6MA 1Q7TA 2N47A 4WLVA 1WUTA 1P45A 1G17A 2CNNA 3WLPA 4H7HA 2QV7A 2A7QA 3OKCA 2V7UA 4IP0A 4UARA 2AFHA 3C5HA 2AOXA 3G7UA 1FQJA 3HUFA 1G5HA 4TMTA 1Z36A 1XZLA 4ESOA 1KAQA 1G8GA 4WNCA 4Y2YA 4B6PA 4WLUA 2IH2A 2AG6A 1CDZA 2HNAA 1ECJA 3ECAA 3O95A 3PXDA 3WWOA 2YIVX 4POOA 4CGZA 4N7RA 4UHHA 1N3YA 2REBA 4UEQA 3ZLUA 1O7JA 4O08A 3Q2OA 3AJAA 3PDWA 1JIXA 2R60A 4N0PA 3REQA 2WIFA 3FYUC 4J7CA 2YX1A 3H9BA 5BN1A 5J4KA 3QRWA 2NYVA 2WTNA 1VE7A 2I1QA 1MAAA 1QC5B 3IVAA 2AJDA 4EO4A 2DU8A 1SOUA 4MV6A 1T35A 3DF7A 1VMIA 3GB9A 4AY2A 1NA5A 4ERXA 4JS0A 3RT7A 1OZGA 3RASA 3AFIA 3JQ6A 3T7JA 1H65A 2BBOA 3HP1A 4CU5A 4HBZA 3E9CA 1OW3B 5DASA 1NIJA 2C4WA 5HQ3A 1R88A 1SG6A 3DL0A 5JNWA 3BYZA 4JLNA 2JRLA 4BFSA 2NO1A 3AH8A 2VXCA 1MQSA 3HADA 4L73A 2A0YA 2PS9A 2ORED 3DAHA 1AUOA 1E2PA 5DTEA 3BWYA 3DLHA 2V7XA 1JHPA 1XU4A 1YBHA 2H4YA 2ZI9A 3LUBA 3QLVA 3HCDA 4HAOA 5ALZA 4IV8A 3L6UA 5JJCA 3PUIA 1X1RA 3OX2A 4RSHA 3C7KA 2CXTA 5A9SA 1N6NA 2YNMA 3OCVA 2QGFA 1HOTA 4A2CA 2FSGA 1F8YA 3L8FA 1NM5A 4MW7A 5AICA 4EUHA 1XCGB 3LP8A 3A4NA 4P93A 3UHFA 4D56A 4RVOA 3HB1A 2O0KA 3QBDA 3RCBA 4DRYA 4WCFA 1B8NA 4M83A 5B1SA 1S3SA 5A4JA 1U2TA 1FMFA 3WLRA 3GH1A 4YV1A 4IMIB 4CF4A 2HBYA 4NLLA 3IP5A 4NCNA 1UK9A 2UZ0A 1LV7A 3PX3A 4E2ZA 4NJOA 3P4YA 3TB6A 1PW7A 3CW2A 3ZGLA 3G68A 4B32A 3FRHA 3EYAA 3TZKA 2PJDA 3R7BA 4L9WA 1UDCA 5FD8A 5I8PA 4RD3A 4CL3A 1HQKA 3O8OA 2WF8A 2CF6A 1QHHA 4XVHA 1CHNA 2H11A 2UZ1B 2XB6A 1EDDA 5EQJB 1M8KA 5AOCA 2ECKA 3D3KA 4URHA 1CRPA 2JCYA 4LBVA 2R8YA 2B25A 1BRMA 1S2LA 2RGNA 1D6SA 4IIDA 4KVGA 3TWOA 3PD7A 3UCEA 3VTZA 4Q4HA 2WHEA 3L7LA 3NETA 4YMVA 1BDBA 4JXJA 4DSTA 1NC3A 3KT0A 4FR0A 4GM1A 2A88A 3CVXA 3DV0B 3KEFA 2QQ0A 2ZTVA 3QEMA 1IUPA 5ALWA 1JG3A 3NKFA 3ZGOA 2VRCA 4ZP1A 1IN8A 3FYTA 3OU2A 2YFYA 2BFCA 2QW0X 3WXBA 1CFJA 4OEHA 2IV2X 1GRQA 4H15A 3QVJA 4BBZA 1L5WA 1ZQ9A 4EM6A 2B0CA 3RTDA 4DRXB 5JROA 1E0SA 2JEZA 2VP6A 3U7JA 1DAGA 3ROPA 1G0NA 1L5YA 3A3PA 1CRWG 1K3UB 3QV2A 3LC2O 1ZCFA 4L8WB 4X9XA 1UAYA 4XWTA 3ZTWA 4I9GA 2PMDA 1G6Q1 1E60A 2XOKA 1HFJA 1FSZA 3GFQA 4PTZA 3UJ9A 3RVOA 1I4LD 1I4EB 4YRZA 2DERA 1R4MA 1V25A 5IDVA 5D84A 1SG0A 2V9CA 2QLBA 5J40A 5KYUB 1G7SA 1T2UA 2OQRA 5JRJA 5DTRA 2FJ0A 1D4ZA 1CY8A 4LQDA 5I7SA 1X7DA 2XQJA 4LRWA 2ZU0C 1LD3A 4CV0A 1EJBA 3GOQA 2I2FA 5JS8A 5LZ9A 3IAHA 3ZOZA 1ZSVA 5FR2A 2GZMA 1S1CA 1R4NB 2VDVE 2PDAA 4YXWA 1FQOA 2X8BA 3DUWA 1CUIA 2VJKA 3FSGD 1M2OB 4L27A 2VBGA 5EGSA 1SCBA 1UWVA 2P4UA 3REGA 2BGGA 4M8KA 4C78A 2MSCB 8AT1A 1EWVA 4FUTA 3F6PA 5C8YF 4DR1B 1GQYA 3GYBA 1PUIA 5JYCA 4MRSA 1ULBA 1N8KA 1BDJA 3EISA 3HO8A 2G04A 2VXOA 2H59A 4ABYA 5L53A 2R00A 3F9IA 4LA4A 2W2NA 4YAUA 2WU8A 3GN1A 1UBGA 1HMYA 4IIGA 3EE6A 3F2VA 3OJEA 3QPUA 2BDTA 5IVHA 1DJNA 3DHVA 3NC4A 2AVNA 2R7AA 2PO5A 1W59A 4NOMA 5B5SA 4C0BA 2OVBA 1JIJA 3AJDA 4US0R 1XVTA 1UR5A 5JCJD 3E48A 3ILXA 4M7OA 3WR5A 4DWOA 4BO1A 1TM5E 3C87A 1WSBA 4JK3A 1H9AA 2NTJA 1FXWF 4Z9YA 3JYPA 3DAOA 3TQCA 5CA1B 1QHGA 1R6UA 3IBCA 3L0DA 1E3TA 3PXUA 3QEOA 2WJPA 4Q24A 4MKZA 3HNRA 4EKGA 2HU5A 2QWXA 2JLXA 4OX9Y 3I2JA 2IYLD 3D2BA 3WGOA 3NPAA 2HCFA 2WVJA 4X92A 4EL5A 1H5QA 2E1PA 1I4TD 3L8DA 3ZU4A 4Y9SA 4ETWA 5KNDD 3O8LA 4JWTA 2BPOA 1OYWA 4UU7A 4J8PA 3CWZA 1ITZA 2W8BB 2YJ3A 2D4AA 3CF0A 3QBTA 2I33A 2MJLA 1Y7IA 5ERGB 2R6AA 1J1ZA 4LJ6A 2EERA 1GL9B 1SBCA 2DGDA 3TCNA 5HE8A 2EJWA 4KO8A 4NQRA 1FDIA 4PSVA 4PZYA 3PJRA 1DBIA 4NPAA 2AXEA 3SF8A 4FDAA 2OP1A 3AY3A 3TRDA 4URVR 4N6NA 3GA0A 1KSGA 1EGHA 3VPFA 3LO5A 3QE9Y 1T4MA 5AIAA 1M2GA 1DJMA 1UMCB 4J9VA 2RDMA 4QLAA 1CPYA 5T6MA 2C58A 1EM8B 2W2LD 4H35A 5AESA 5KB3A 3DDOA 1O4VA 4RL6A 1U5BB 1U0JA 5HJ2A 1ECFA 2PD6A 4MIEA 4YUZA 1NW9B 1T5IA 2GESA 5KNCD 4DIKA 2Z2ZA 3W3AD 2OCPA 3MJSA 3V2IA 1FNDA 1XELA 1OAKA 2Z0MA 4IDOA 2CLEB 5A9RA 3RFFA 3E0XA 3HL0A 3IERA 2IYYA 1O6BA 3C7AA 4HLDA 4H6WA 4J0KA 4PLYA 5F1OA 3OF5A 4GL2A 4JT9A 5CW1A 2JL1A 2LPMA 4FFBA 4AUNA 3BSWA 1TM2A 3D6FA 3FBGA 4CKCA 3HJFA 2WSMA 1NVVR 4QODA 4XLTA 1G3RA 5KTKA 4M1QA 1TQDA 5B1IA 3VTAA 2ZVDA 1I5OA 2VF2A 4RJLA 3VOTA 4XUCA 2BRUC 2NUAA 2X7XA 2I7DA 2XR1A 4KQIA 4LBWA 4HV4A 5B2FA 4AUMA 4G0MA 4MAAA 2YMPA 5EKXA 1LLCA 5EWJB 2BM1A 2HA5A 3JPWA 2LKDA 3P26A 1S02A 4EBBA 4EGJA 5HF5A 1TVMA 1D4OA 1ZKMA 3USES 4KXYA 4J0HA 1Z7BA 2E37A 2NSJA 1QIFA 2VAWA 3G5TA 3EXHA 2CW5A 1P2DA 2B94A 1LGYA 2ZS7A 1DXHA 1XLUA 1QIGA 1Z5PA 2P40A 3KIPA 4UM8B 4YRRA 5FWYA 1SBHA 521PA 1ZKDA 1AXRA 4JHXA 3OQIB 3SVTA 5KPJA 3FYHA 1KIMA 1PAUA 1VYTA 2D59A 2ZWOA 3BBPA 3RBZA 4NJEA 3AF4A 2GNOA 3CR8A 4KQKA 4L2IA 5EP2A 5JNUA 1QH9A 5D5HA 3RYIA 2IHYA 4PG5A 1EK5A 3WKEA 3S40A 2VWQA 1IQPA 1NQUA 1YJXA 3IGFA 4AC9A 1CCWA 2FSUA 2J3HA 2D5AA 4W5HA 4W5TA 3ADCA 1P81A 3E03A 2YJNA 3OZIA 1N75A 1ADGA 4TTAA 4S04A 2OC4A 3EVCA 4RHFA 1U9JA 3PNQA 4JLJA 1T0BA 2VR1A 4LWPA 1D6JA 1A77A 1U7ZA 2IUTA 3I5UA 3NFYA 1KYIA 3IQFA 2XEDA 1E2LA 2Q1XA 1R37A 3C3XA 2G5PA 5JMOA 4TTVA 1CQJB 5J1TB 3H16A 2UXBB 3AINA 1N2GA 3GLFB 3UFXA 2PRYA 2BN4A 3HJUA 4N41A 5LB2A 1EP2B 3AV0B 3ITNA 4FYJA 4TQUS 2NT4A 2X8AA 3P97A 2Y0PA 3ZHTA 4RJJA 5EUBA 2OP0A 1GDHA 5F3DA 4ARUA 2C3PA 1LK5A 2QEQA 1NW4A 3F9CA 2VK4A 3DFUA 1K2VN 1JTFA 3C48A 3COPA 3GJ3A 3K6RA 1OJLA 1Q2XA 4AZVA 3NIDB 2IYEA 3MERA 3OECA 2R8XA 2Q5FA 1XQYA 1YZHA 3PBKA 5IKEA 1A4UA 1SKUA 4RIFA 3PFNA 4WZZA 3D1JA 1XF1A 3I64A 4MA4A 1P44A 1DG3A 2WIKA 4HNSA 1P19A 2PMEA 3HUTA 3BWEA 4YRDA 4A36A 3OQJA 5IKPA 2GCNA 3CKLA 2YXEA 1A5ZA 4YO8A 2C1EA 3DBHA 1H85A 2Q3BA 3WSTA 2QTBA 2PZMA 4C7OB 2DHDA 4Q02A 3JQ7A 1TUBA 3ELUA 4DMFA 3QVWA 4N3AA 3L4JA 1YR9A 3EYWA 4ZXPA 5TT0A 4QYIB 2P6NA 5EJ8A 3C5CA 3AVQA 4PQGA 1QG0A 2CJPA 1GJRA 2V3WA 3F74A 4P22A 5ALYA 3SYTA 1Z25A 1P9LA 1QMGA 1WL8A 4I9UA 4OVKA 1XQ6A 1TK3A 2XIQA 3PEFA 4EY8A 1ZLYA 2C99A 1YZYA 2O2DA 2O3SA 3D4PA 3CH5A 3GNSA 1QFZA 2ZVQX 3PG5A 2GN4A 2IP1A 3H6GA 2ZJ8A 2FB9A 3R77A 5T3YA 4JLBA 1QOQB 4BNGA 1AKNA 2H1OA 2PKCA 2OG1A 1M54A 3AR4A 5FKJA 2IW1A 3GJ7A 2PQ2A 2AKYA 3L49A 1KK1A 4P3YA 5ALOA 1OXMA 3CISA 3A32A 1A9TA 2HN9A 1RQ7A 1FFAA 2A1UB 3M9XA 4IEIA 1J8YF 5D01A 5FI5A 5IT5A 2QDKA 4R2XA 4UM9B 3EXIB 4P98A 2Y05A 1JSLA 3JV7A 3NNSA 1V26A 1BW9B 3GZNB 4X7RA 4V2IA 2GDZA 5KKAA 4C5CA 2CBZA 4BXOA 2VI5A 1XC7A 3DLBA 3ZXUB 4A9AA 1I6KA 2BSAA 4P82A 2NVUA 3COSA 5GONB 4QOFA 4LF9B 1YQUA 3LHKA 1QVWA 2HJWA 3HG7A 3RJ9A 3RK1A 1XPOA 4MPDA 2GBCA 3OE5A 3E8SA 4OI2A 1AO0A 3M6AA 4HB4A 1E3SA 4ZQCB 5I3ZA 3D3NA 4Q4DA 2XNCA 4WEQA 1RYHA 2JLSA 3O84A 3EASA 5I4BA 2JIZD 3P9CA 1H22A 4JJZA 3WMGA 3IAM6 2ZIFA 4BNVA 5BVGA 5C18A 1NVVQ 1XAHA 1ZD9A 4ZAFA 4ZAXA 1LBSA 1ZJJA 5FYDA 3ZJTA 5DX0A 1WDKA 5K4AA 4ESHA 1S3IA 4BPRA 1U7HA 4UHDA 4XIJA 1QBGA 3K70C 5FTMA 3K8QA 2LTAA 4ZV4A 4JCCA 5EZYF 1JEOA 2I3DA 5AOVA 2WD7B 3F97A 3QKRB 3IODA 4TYWA 2QU7A 3S44A 1K68A 4NP6A 2X8LA 1OT3A 2PBZA 2HMSA 3O8DA 4DLNA 3QJYA 4BWGA 1ANKA 2GEDA 3ZN2A 4O4JB 1PR9A 5CXUA 3VNBA 3D6AA 2E4YA 5EG5A 5JD4A 3NWPA 1B7GO 5IJAA 3OZDA 3MD0A 2GO7A 2Y1CA 5K3CA 3B5JA 3PGA1 3O2SB 4HLUA 1MC5A 4HLNA 3AV3A 4V0LA 3U7GA 1C1XB 1RI1A 4HXEB 2R6FA 5JNRA 3HXQA 4OAOA 4HN4B 1RI4A 3CNOA 2HQBA 4MCHA 4NBNA 4C21A 1NBEA 4Q9HA 5JE8A 5FOTA 1IPEA 1JT9A 3GOHA 2BEUA 4YGYA 4EG7A 2JLYA 1UPUA 2V7WA 4I0WB 4ZZIA 3A4MA 1Z39A 5FTLA 4EATA 4FOOA 7REQA 4ZTBA 3OTGA 2WTMA 2VYVA 4ZC8A 3TB4A 2XQVA 1B23P 1V7QA 1S2NA 2PV7A 3K0BA 4O6VA 1IVNA 2R8PA 2GEKA 3GRPA 3MJEA 1RPNA 2VJMA 4MWDA 3LYUA 5DBEX 2PNFA 1YOBA 1V7ZA 2H51A 2Z2YA 1E92A 4GFDA 4DSOA 1YZ3A 2CXPA 1W5FA 3NWOA 1N5RA 2YDXA 3NS7A 4TXHA 3UJCA 3BOSA 4KITB 1A8IA 4OIFA 1TW2A 5HIIA 1PT5A 3JWJA 3X2FA 1UBLS 1WXFA 3CN9A 3NBQA 4CM1A 5AQEA 2B1IA 2OKCA 4QASA 3M5CA 4DM3A 2GN8A 2WSYB 3W6UA 3I83A 1QH8B 1ZY2A 3O3MB 4ZOQI 4LTNA 3T3DA 1M7GA 1W93A 2VDMB 1JWAB 3P0JA 1XJWA 3NVAA 1G18A 2VBCA 4N3GA 5EKSA 2G17A 3RGGA 1XMSA 4L3VA 3TLGB 2TYSB 2PNJA 5G53C 1E3WA 1YIOA 1TMGE 4HAIA 3AHJA 4X61A 2YQ4A 1AV7A 1ZIOA 4NWIA 4LWOA 1TVKA 4HEA6 3STWA 1UADA 3Q98A 5FWNA 1TRHA 2VUUA 2YWDA 4JBGA 3FPEA 3LE8A 4NPCA 3ICEA 3WLLA 4IQFA 4JBYA 3U4HA 2NTNA 2YRXA 5K0BA 1FDTA 4PZLA 1U7TA 1EUDB 1RMYA 2IYSA 4HP8A 5FUMA 3PC8A 2F3PA 2XB2A 4ZRMA 3G1TA 4AULA 2QJRA 2CLCX 3TSAA 4R8VA 3GGCA 1KJJA 3F4LA 1FMJA 3CVJA 4GOLD 2J67A 1BJRE 4ZHQF 5KDOA 1ZG3A 3V7NA 2GI4A 2ON6A 5IVPA 4HUJA 4FB5A 5JSUA 1K5HA 1G2IA 4JI1B 4N3BA 3ESCA 1FFCA 3C8DA 2XVMA 2J0UA 4WOKA 3DLIA 4HB2A 5FP0A 5CAEB 4EY3A 4O2AF 2ESRA 2HFJA 3VKWA 3DULA 4C20A 1P39A 5FWXA 1WDLA 4RA9A 1P2TA 1T6NA 1R66A 1U7UA 1SKYB 2F67A 2XHZA 1HT1E 2AMVA 2P1DA 1X8XA 2X8JB 2FHSA 2ZWVA 3EOAI 4UPDA 1SCIA 4C14A 5JD6A 1KTIA 3LCRA 1UDBA 2FKNA 4BTEA 4XYBA 2CFCA 1XIVA 2GJAA 2PMCA 3B2NA 3GUHA 1L7PA 3IPYA 1T2EA 3KWLA 4RV4A 5KCZA 1Q0TA 4QXPA 2M6RA 2YASA 3GNLA 1FP1D 3ILSA 1LH0A 1QIKA 2GR9A 3JRWA 1OLUA 1T9DA 4LVCA 1PFYA 2P69A 3JVVA 3RS9A 3VRHA 2QHXA 3QOFA 5GOTA 5K0JA 1OFTA 1FQKA 3DUFB 4F0JA 3T0GA 4D46A 3RBXA 2GILA 1XX6A 1YZKA 4L3WA 1WU7A 1ZRMA 2BSXA 3RSGA 3NVKI 4FW9A 3RU2A 2P5UA 3H9EO 3HA5A 2E18A 2ZT7A 4L8YA 4BE9A 1AGRA 5BP7A 1VG8A 2OGTA 1YF3A 3ZDCA 4OI0A 3PVCA 4YP1A 4GAEA 5BUSA 1EE1A 1UBTS 4LZNA 1WQ4A 2I29A 4MUFA 4BBAA 3GK3A 3QVSA 4BEBA 2YBEA 2G7ZA 3DONA 1KI8A 3IP3A 3MAGA 4FGSA 4CKBA 3BMOA 5IJWA 2QMEA 4II7A 2DLNA 5BMOA 3HH8A 2EW8A 3PDUA 4YAEA 1N2XA 2HJRA 2HIHA 4MVWA 4RDHA 3TJZA 1BMFD 4RJ2A 4ROTA 3NXSA 2QTVA 2XTZA 4A10A 3VC2A 2GZDA 5J47A 1G8PA 5DBOA 3NHLA 1RFGE 3A1UA 2O1XA 4X00A 4HQNA 3S1AB 1E0KA 2I6GA 3GAAA 2YN4A 3QMPA 1R0BA 1WTCA 3P9IA 3LRPA 4L8LA 4MHSA 3AY6A 5FF9A 4P6VF 4DLYA 5LIPA 3KQHA 3N6RA 3K1AA 2NU9B 3ASYA 3VYRB 3K9BA 5K8CA 4PZUA 1YJ8A 1RMTA 4KK3A 1HDIA 1BKSB 2WSIA 1OIXA 3I9OA 2YOFA 3PL5A 2WV9A 2HKIA 3LQKA 1NDQA 3TUJC 3GHYA 5F78A 4FE3A 2ZR8A 4RKWA 3NRJA 4RHCA 3EZLA 1E4EB 4YJ3B 3T12A 4ENRA 3AWIA 4M1MA 3MUFA 3QNWA 4DUGA 5JAPA 2EKDA 3PKZA 1BGWA 4JKYA 4C0AC 4OYHA 2A1TS 1BO6A 3HVKA 1UPCA 4FQ5A 1CUHA 5HZGA 2EKLA 4NYMQ 1O97C 3VJKA 1HNNA 4XCXA 4PYNA 2H3HA 2ODQA 3GC6A 2IBSA 3CHYA 1MQAA 2RK4A 4X1KA 2POCA 4YC7A 5EWMB 3WNCA 3B1WA 3P0FA 4IBOA 4KPEC 4L4ZA 4JUCA 1H4TA 1A2OA 3IAXA 4J0IA 4BNDA 3ET4A 1AUXA 1YB4A 3IEXA 3U09A 1QGZA 1K8QA 2I6SA 1FNNA 1KK2A 2GF9A 4BMDA 2RGRA 1Y3DE 2PYDA 4KJZA 3ZE9A 3RIXA 4DLBA 4QLOA 2G5GX 5JTUA 4BO6A 3QUSA 4HGNA 3GGDA 1XLTC 1S8AA 1OWMA 4FEEA 1EESA 3MW8A 4YRAA 3FDXA 4BMZA 1E79D 3AI1A 2WJ6A 3QW2A 4XARA 3KXPA 3I9MA 1VHJA 4RK7A 2X77A 1G4UR 3NTLA 1PT6A 3I76A 4BFVA 5EJ9A 3OEWA 2JH3A 3OWHA 3FIJA 3S2UA 2C7GA 1F2UB 1FU7A 4YRMA 2CWDA 2CMHA 3A0UA 4YIKA 2CNOA 1SXQA 1NBAA 5KQLA 5KOYA 1XZQA 3G0IA 5JI3E 1D03A 3H04A 1UKCA 2FZ5A 4J91A 2PUHA 2H8KA 4MCAA 1JSCA 2FUG1 1AY0A 2JCVA 3VO1A 3CWCA 1U8XX 2CLFB 4MR8B 3L0PA 1Z29A 1H2BA 5COBA 3FWYA 1PJ8A 2NO6A 2GA8A 2IYXA 2Q99A 2GWHA 3KSRA 3LO8A 3NBUA 4OY3A 1E62A 1Q12A 4B85A 4NDZA 3CH6A 3MXTA 1II9A 2Q6IA 4RCYA 5JAHA 5LJLA 3FOAA 3ITDA 1FFXB 4RPHA 4WZ6A 4JI3B 2XYQA 3VUEA 3L8MA 5C1DA 2JFFA 3IKTA 1YGYA 4QDTA 3NH9A 1NQAO 3NV9A 2UAGA 2IXEA 4MR7B 4PHCA 1T10A 1ZNYA 2IYVA 3G7NA 5DW0A 5H3HA 2WHXA 3ZZ1A 4F2HA 1KAEA 4TV9A 1KY5A 1MFPA 3H8JA 3FPKA 3O92A 3W05A 2WZBA 5CCBA 2R8OA 5AVRA 3O1JC 3EPLA 4RMIA 3NDJA 5DH9A 3FPGA 5LLSA 3ZCPA 1K06A 3EQ2A 3HNOA 3FMPB 3KU1A 4GRIA 3NIGB 2QAGC 4J7AA 4X1IA 2JATA 1DV1A 1L4KA 5KAPA 1PF7E 1QANA 2FN8A 1SELA 2KLBA 3W8FA 3CR3C 1V41E 3QXJA 2X9GA 1J39A 1ES9A 3VPHA 4Y2UA 3MB5A 1U8ZA 3TLYA 4D9IA 1EM6A 3G5MA 3GVIA 4FHGA 1YRAA 1EMDA 1IMJA 2JK1A 2WT8A 4IIUA 2I9KA 3KOUA 4XJSA 4Y2XA 5HEKA 3W6PA 2FWBA 1TF2A 4WINA 4ADSG 4R2LA 1U4OA 2GUWA 2V4ZA 3DHNA 5T64A 3IMCA 2JW5A 4HFNA 2C97A 3W8NA 1C4WA 2OQVA 3V1UA 4UUOA 3GFTA 4Y1EA 5JO9A 1B8VA 1DFIA 1JQJC 4UTZA 1Y1RA 3F3MA 3VBCA 3HVJA 5AVWA 1KP9A 4GUAA 3TBHA 2JK0A 2FPIB 3MRTA 3W9YA 3STTA 1KRHA 2Q46A 4JGBA 3UWDA 4DA4A 3MS2A 2OESA 4WV3A 1LW7A 3OIFA 5HZHA 1IJBA 1GNPA 3CVVA 4ES6A 1A04A 2BL4A 3NBAA 1KEVA 4FSDA 5AVOA 1NQXA 1DIGA 1NFFA 4P0PB 3NKVA 3R8XA 4EQ6B 1XXLA 3E58A 3VU9A 1G5TA 1UWCA 1QYCA 2Q5JA 4CEJB 3LXXA 1SHJA 5DHSA 1DKRA 1E64A 2WFMA 3KSUA 3W7AA 2BLLA 4G97A 2JFOA 4LK3A 5F73A 5A4KA 3K1YA 1T29A 3UXEA 3K5IA 4LHZA 3FR7A 3KVRA 2RHWA 3WRYA 4REOA 4BVJA 1CLUA 1DE0A 1MO2A 4EYQA 3GA5A 4LRSB 4O2BB 4OH1A 2JLVA 4R5MA 3KUCA 5F21A 4C6RA 2HIMA 4B6EA 3H5LA 4K03A 3RVMA 5BVHB 4H59A 4TL6A 2P9TA 4FI3F 4PPGA 4FFRA 2AJCA 1W35A 2ZQ5A 1L7OA 2BFEB 1NXPA 3F98A 4DCVA 5IYZB 5JRZA 4N8DA 4KQMA 3M6XA 4X63A 2H8GA 1CV2A 3JVIA 4F2WA 1LCIA 4F93B 1VCMA 2AZ4A 5CFRA 3FLMA 3PXGA 3E05A 2WAOA 3LT0A 5DISB 1OPXA 4UD2A 3EZYA 1G5FA 1JWBB 2FR0A 4P3KA 3HDHA 1XB2A 5KMGB 3ZZUA 3DS8A 3JWPA 1LY1A 4PN3A 1G4HA 2GARA 2MSWA 3R3HA 3ZDFA 3MPOA 4E5NA 4DANA 1FP4B 5LYJF 5BOSA 1H4VB 4HL6A 2FPGA 2O0JA 4NOKA 2ERXA 2Z2IA 2L42A 1M8FA 3GLSA 4J1TC 4DCTA 4RA6A 4MR9B 1C1DA 4YUXA 1BA3A 3SHOA 2PSJA 2YFKA 3TXYA 1F2TA 2H7CA 3GVCA 2XGOA 2VBFA 3FCOA 3U7QB 1FDWA 4NABA 1HE4A 4N9QA 1WXGA 2OCAA 4Y2SA 4Z4HA 4XD7D 2H7XA 2QS9A 4R2WA 1E1KA 1JQDA 5CCXA 3MMNA 1XA3A 4ZEMA 1XO1A 2H1WA 1FNCA 3A05A 1VLHA 1UWLA 1NMZA 3ZDAA 1E5QA 5AFSA 1GG9A 1M1YE 2QSJA 3BRQA 4TMVA 1DAIA 1QAMA 2ZE7A 1U7DA 3PVSA 4NCBA 2BGTA 3FBWA 4DWVA 3A3OA 4EY7A 2E55A 2JFGA 3R0ZA 4QHTA 1WHSB 1JB1A 4PCUA 4U2BA 2JHPA 1P4AA 4MVJA 3CLSD 4D26A 3BTSA 1SVMA 2IIBA 3DOHA 1LQ2A 4Z0TA 2TMKA 4KFCA 3DB1A 1C5KA 4DHWA 3IVRA 5TF4A 2WD9A 4JC4A 5ER6A 4PLTA 3ZX5A 1I7LA 3GAFA 2X8WA 4U7TB 4DDMA 1TZ2A 2CK3D 1EHYA 4TSKA 3GRUA 3IYLW 1QQTA 2QZJA 3J7TA 3KB6A 2FWRA 1C29B 1JE0A 5G0TA 4LHEA 3AERB 2HF9A 2PKQO 1WP4A 1NJ2A 1EGMB 2COUA 2FP4B 4TROA 2EL9A 4P54A 1GEGA 1E2MA 1N5IA 4C87A 4CLEA 2PEZA 3SHQA 1Q7BA 3LQ1A 2FMTA 1NJFA 1JW9B 1U28A 5EQTA 3OOHA 2EARA 1H0HA 3IAUA 3KUDA 3WIUA 2IU6A 1T8SA 4QEKA 4XJXA 5JASA 2I3GA 2Q2QA 5HF9A 2WWVD 1HFKA 2QRMA 4IJMA 4ARIA 1MJGM 1OC2A 1Z47A 3INNA 5GZ6A 2CHFA 5BURA 2SKEA 3PGKA 3UAXA 3HUUA 1JRLA 4JT2A 1CWUA 3RS4A 2H0RA 3NAGA 4Q47A 2R8ZA 3QVTA 1MA0A 5LA6B 2P7HA 2BUAA 1CNEA 4IHKA 5KTSA 1S96A 1J8VA 2NUTB 1KZ7B 4N8SA 3VH4A 2FZKA 1L7BA 1UZAA 3MS7A 1NASA 3MJHA 2OMKA 1GPJA 4O2LA 3L0IB 4Z49A 3WI7A 1YIDA 3IR6A 3V8RA 5A3VA 2HA0A 2L69A 3BGOS 3ZBUA 1V6SA 4B6OA 1BVRA 5MDHA 2ACWA 2P5SA 4FFSA 3NBKA 1XQXA 1I3CA 1E7MA 5JOQA 4ZARA 3I3OA 5FT9A 3KQTA 1A8UA 2YXLA 1FK8A 1SUWA 2GEUA 3LQRA 4LRTB 1CDDA 2FOIA 3C16C 5K8LA 1F4PA 2A78A 2HA2A 3I3SR 1MP0A 2IPLA 3H9CA 2XCTB 1UPXA 2OOSA 2SHKA 3IDAA 3GJ0A 2HK7A 4CLHA 4F84A 5KKCA 1PK7A 2IELA 4Q3AA 1MXFA 2GYUA 3AUKA 3I28A 1P2UA 3T7RA 1N5JA 1Y7HA 4Z9BA 3AILA 3DXZA 4QSHA 3EH2A 3JQBA 1ZD1A 3ZVMA 1JPJA 2OLKA 4KR0A 2O19A 4IUCS 2Z1MA 1E5XA 1JTEA 4H0CA 1EUCB 2M6KA 3WBKA 2VFAA 4HDSA 3PPIA 5LKRA 1RXIA 3PXAA 3AR2A 1NMSA 3AEKB 2MMCA 1FTSA 1RAHA 3C2QA 5E1DA 5SZHB 3V7UA 5DHPA 5ALGA 1ZGCA 4FHCA 4WZAE 2QRJA 1X94A 4XSGA 5FULA 1PQ4A 5FPYA 5DGTA 2GCGA 3LBIA 1QK3A 3T3NA 2EKBA 4QVIA 4ZYZA 2Z08A 3FYUB 5BO5A 2I3AA 3S8MA 4ENVA 1WWKA 2P9HA 5T4BA 5KHOC 1S4MA 1RHQA 4KNYA 1UMBA 3JZAA 1A9OA 4RADA 5INTA 1YC2A 3O1HB 1CG6A 5KJ1A 1JYSA 2GVZC 3OETA 3OJWA 3GRAA 4J16C 5D3MA 5FNVB 1NR5A 2NADA 5DNYB 3A6PC 4B3JA 4ZCTA 1JBQA 1WEHA 2BGRA 1Y48E 2ZWPA 3TLZA 4YRIA 1MZPA 2QROA 2XUDA 3KOXA 1TECE 4AZSA 4B33A 3GFGA 1DC5A 1J2YA 3B6JA 1K8RA 1T8TA 2OHJA 1IB6A 4HADA 3OM1A 5CVUA 3OOYA 3T5PA 1UC4B 4UDYX 1B8UA 4MGKR 3EVFA 1PNVA 4LYFA 1L9KA 1GZSA 4ARCA 1WQ3A 4JC5A 4CF7A 3GY0A 1QBKC 3KJNA 3SYMA 3ZJ4A 2IKQA 1SXPA 3KSBC 3TXXA 1NJ5A 4BX8A 1PUXA 4Z3DA 5AYVA 3ZKAA 1ZAYA 2JI9A 2YS7A 1T9HA 4IIBA 4RCVA 1M6YA 1TAHA 1ZXBA 3NHZA 4O1IA 4W8OA 5BSUA 2IXDA 5IF9A 5IZCC 5BR8B 3CT6A 3FY4A 2GD1O 3SJZA 2CFIA 2I4OA 3GRFA 4N54A 3G13A 2REQA 3X1WA 3RK4A 3PENA 2UZ3A 4MVJG 1K89A 1NOKA 1SGWA 1YCGA 1YZFA 2IEZA 2JAHA 3SI7A 4MLPA 1AMNA 4WJZA 1ZW1A 2Z2KA 2J5RA 3S8EA 4ZU1X 2QUHA 4AD8A 3T4UA 3UOGA 4IGFA 3RIMA 1WQ1R 1ZIDA 3QI2A 1TMYA 4F71A 2CY0A 3HCWA 1D2HA 3HDQA 3L84A 5D3ZA 3TZLA 2EKZA 2FRXA 2QN1A 2Z5GA 4G6ZA 3I2HA 2PS3A 5EMLA 4CR6A 1I3NA 3WC4A 4EI9A 1M1NA 1QHXA 1G63A 3RM3A 4NE9A 1DINA 1H2WA 3PHCA 3UAZA 4B9EA 1H8EA 1HQYE 2WIGA 1ULAA 2H5LA 4LISA 2V0GA 4G5RA 4PAOA 4U02A 4UBLA 2CLMB 5GOZA 4JUIA 4Z8YA 1BXRB 3VSCA 2EGUA 3CNEA 4AMYA 2PKQP 4KRFA 4W5NA 1DTSA 1TTHA 1RBYA 2C7VA 3GZ4A 3UB4A 4D9EA 4FKBA 4ITUA 4E3WA 3TW6A 4ZYTA 4C0KA 4ZIRB 1XDWA 3BGVA 3V42A 2DCUA 3LH5A 5F2OA 2DFDA 1NF9A 1E2EA 4A8TA 2BCEA 4ZO7A 3ROXA 3BH7A 2IRWA 1K9VF 3CF2A 4RHUA 2XMRA 4KSBA 3I5AA 4Z2AA 1FZQA 1JU4A 2Y66A 3MCTA 3EEQA 5JC8A 3SBOA 2A14A 3L4EA 2ID9A 4K0KB 1NHGA 4HXYA 4C0XA 4NRDA 1NBIA 2UZ1A 3DPIA 4L6AA 3RRXA 4KE7A 3ZY5A 4PPFA 4S1TA 2AHOA 4G1BA 5T4HA 4Q16A 4RZ3A 4IFEA 4BUJA 3M6MD 3RDPA 5DLQC 3C6BA 4D4GA 721PA 4XUEA 3OJLA 3HP4A 1K7EB 4CQMD 3MQFA 1UZNA 2QTMA 3FDFA 4C3ZA 1CIPA 5KSPA 1QZTA 4DF3A 3G9ZA 2OBBA 4A03A 4OQYA 4Z4FA 1K9SA 3DV0A 2AN3A 2ISQA 1W9HA 2GT1A 4LJKA 5T41A 2OEPA 4AO8A 3DEKA 3WYAA 2B6NA 1N4DA 1H9BA 3HB7A 3RTAA 4IICA 2P11A 2B1JA 2XOXA 4OMDA 1X9GA 3TH5A 3ZVRA 1YZTA 4KUHA 1V8BA 4YT2A 3D2AA 2VEOA 5BV2P 3M2PA 3BD7A 4A73A 2F9LA 3B6EA 2INGX 3R09A 4GX5A 4PSKA 4EJSA 1SQSA 1Z26A 2IDKA 1GTL1 1X7XA 2J6IA 3AHIA 5CIYA 3RSLA 1Y42X 1YRWA 3QFCA 5EC8A 5EKDA 4WAUA 3ZD6A 3PT9A 3QFHA 1OFVA 1S8FA 3PDCA 4GZ3A 4GE0A 4FLMA 3TMYA 1T3TA 3TNLA 5BQFA 2QF7A 1WCYA 3G59A 3OSUA 4NYJR 1YDEA 1Q0ZA 4MYUA 1Z7WA 2YY6A 2QRZA 2A0FA 5BYAA 1EK6A 4O0MA 3T3GA 3ZD8A 1OKKD 2VPPA 3DBVO 5HIKA 1R4NA 3H6KA 4NK4A 4ZAZA 3T54A 4OV6B 3TI7A 1NHWA 3GL9A 4U9UA 1M2OA 2PA0A 4WGGA 1MT3A 4X94A 4D4MA 3FWHA 3NBMA 1E7YA 2FPOA 2Z95A 3M6IA 3JQ8B 4WLNA 3WIDA 1T15A 1ADJA 3FYCA 1PFUA 1QWSA 2XEXA 4ZREA 2X5KO 2FG7C 2ZJZA 2C5GA 1ML4A 1OI4A 1KH2A 4CG0A 1PX0A 2IU0A 1P31A 3T0FA 4X8MA 3DZFA 4HPJB 1I0LA 5C5EA 2HREA 3RYHB 1BRTA 1Q0HA 2A5GA 3ONEA 3P20A 2QG4A 3WLKX 1PO7A 2X14A 1P8AA 3QWIA 4IUBS 4XLZA 4BQPA 4QUKA 4YCDA 3EBPA 4Z86A 3KKOA 4PBTA 4PYKA 4DCSA 3MGGA 5JRDS 3K96A 1P0CA 4GDMA 4II3A 2Q28A 4L4UA 1SQ5A 1U4NA 3QU7A 1GRVA 2XZTA 5BQOA 4E51A 2GAFA 3A8TA 4IZOA 1E1RD 2VP9A 4JP3A 4DDWA 4JCOA 1A76A 2RHCA 2X3FA 5CGZA 5E95A 3KEOA 2HT6A 1ZUWA 1UJMA 2GXQA 4ZO4A 3UG7A 2XQIA 4F3YA 1VKJA 3BREA 1SB9A 1VJTA 2P2LA 3EW7A 4KPFC 3L04A 4EBFA 1GPDG 2A9OA 3EPRA 3DHEA 2ZJ2A 3AC0A 4JEHA 1PBTA 4OKSA 3CVWA 1P5FA 4IYJA 1R4AA 2Z58A 1U0LA 5H3CA 4ZI7B 1MEJA 3DP9A 1IHPA 2OYSA 4WASA 4EUNA 1PZMA 1ESDA 1UFOA 4US1R 4WK0B 4DCPA 2G8NA 3IT2A 3HYTA 4NI5A 3TD2A 4F5WA 3G2PA 1U8AA 1VSUA 2QE6A 5CLQA 3OEHA 2WMOB 4BNLA 4NDAA 2W8BA 1NW5A 1FX0A 2MYNA 5TVGA 3BK2A 3A1NA 5K8IA 1NBMD 1JLLB 1GGJA 2GM9A 3BUSA 3I09A 3SBEA 1E0JA 1Y7TA 3CPSA 3P2JA 3PZBA 4Y9UA 2QG6A 3K31A 1ORWA 1U4SA 2EWVA 1IWPB 3RODA 3UICA 2HV9A 2C07A 1P5RA 4IDHA 5C34B 5REQA 5I9NA 1A2BA 5TQ2A 2ZUSA 2L0XA 2HHJA 2P3OA 1TQ8A 1UPAA 1XRPA 2XPCA 3C4QA 2F9MA 1EM8A 1E1YA 5ALRA 1RI2A 2R1TB 2UVPB 3NT2A 4PC2A 3I5XA 1A5TA 3IFSA 2F1OA 4EPWA 3ROEA 3VJRA 2NP6A 2ES4A 4O4HB 2YZMA 3CCBA 3QVXA 4JFRA 5BSFA 3ADOA 2BGNA 4N5MA 3SKYA 2WE8A 2ZBFA 1PJLA 1PV2A 3QG1A 2QVYX 1WB6A 4LVOA 2BTOA 5LBTA 1IEWA 2J9GA 1SVOA 3R3ZA 3Q3GE 2CLLB 4LHVA 1WKVA 3UAVA 5JD3A 3DMNA 3AG5A 3B6KA 5LQJA 4DAEA 1PEDA 5ARBA 2FH5B 5G1PA 4KWTA 1UDXA 4QTYA 5C8VA 2CMGA 3NC1C 4DV7B 3VUFA 4EPYA 3W1VA 3URMA 5LWHA 1ENOA 1P9WA 2QL7A 4L1KA 4C4PA 5JBIA 2C0PA 4EMTA 1Z6XA 3QYJA 4IPTA 5AW6A 3EG9B 4B47A 3NCTA 2VT7A 2KBEA 2WTAA 1U99A 1QV7A 4EPXA 4F97A 3ADKA 1JX6A 3SU8A 3TL2A 2FSPA 2GPWA 3HJGA 4NFSA 3E23A 4UUMA 4Z4QA 2TECE 2E49A 2SNIE 1D8AA 2ONJA 3RC9A 3TGPA 2PUTA 1RCUA 1T91A 2JBHA 3PGLA 1QYVA 1WDWB 4DMGA 3WWZA 1Z4QA 1SC4A 1Y4UA 3HJCA 1SAYA 3WL3A 4UTXA 1HEUA 1M0WA 4JFAA 2CFSA 3F96A 1B0UA 1RFLA 4BNYA 3BAFA 1QHYA 5LDGA 4JJAA 4JZKA 1EAMA 1U0FA 1XL0A 2YC4C 1PZGA 3KHSA 3OQIA 4I8DA 2FYTA 4JB0A 2ZPTX 4OF4A 1X7GA 1OC4A 3D6HA 4ZDIA 4EHKA 4NYJQ 4KXLA 4RSMA 3HVRA 1J1UA 1CT9A 3KLPX 1YR3A 2JCBA 3LHDA 1DBSA 1NVWQ 1IXKA 2GSWA 2Y0BA 2PQMA 4EHLA 2NIPA 3BRSA 3MINA 5BSWA 2CBGA 5AJZA 5L7WA 1P5JA 1UQTA 1I3OA 1P1FA 1W1UA 2L19A 3QMWA 2XNDD 3QSGA 4XTCS 9LDTA 2OYRA 4AKTA 5LZ8A 3OPYB 5EHIA 4CMBA 4O8CA 1XYVA 3VSEA 5GM2A 1U0NA 3AUYA 1HE5A 5ALEA 2XOEA 2NQ2C 3FLEA 3ECCA 3SX2A 3QX3A 3DFFA 2CFOA 3OKPA 4RD1A 1Z2NX 1CQJA 1XTPA 2FEAA 2OQ2A 4KEAA 4PZDA 3DM5A 5EHQA 1F5SA 4J3NA 3DEHA 4QGGA 1J49A 2IK8A 4DIBA 2G4LA 3E3NA 5CMLA 4EHHA 3D1VA 4CW7A 4K8OA 5AP9A 4H9GA 2LDXA 3RUHA 1GT6A 2B21A 2CCKA 2G67A 5F9FA 2PWYA 5L3VA 2Z2XA 4K0RA 2F8LA 3DFKA 5E9WA 5LP6C 4UZFA 1NMXA 1Y8CA 2BEVB 3CUWA 4YI5A 3WLNA 3ZWCA 1Q1ZA 1HLFA 2FFBA 3DNFA 1N7JA 1OUMA 1TDJA 3ICPA 1B6GA 4K6CA 2GUGA 4ZVUA 5BWBA 2QT9A 4FZJA 2CKDA 3OHSX 3SYKA 2P68A 4X5OA 5KTOA 1FTNA 2JEYA 1MJFA 4YR7A 4DXAA 4XIYA 1OQAA 2J30A 4LOHA 2GN9A 1BA2A 4NMHA 4EUFA 2CJWB 5DM2A 3IKJA 1IRIA 2UZIR 4DE5A 4GIBA 1RJDA 5SYAA 1E59A 1KOFA 3PR2B 1U6KA 3B52X 2HBRA 1A1SA 3BKXA 3OTQA 1XZJA 4F91B 1XDSA 2HQ1A 2BW0A 2P1ZA 4A0FA 1EXDA 1UJNA 1DBPA 3PITA 4J6FA 2R3SA 4U7DA 4R71A 2PX4A 5AJXA 4LFBB 4OHXA 3QQPA 3GCXA 1VL8A 3NBFA 4KX5A 2RHJA 3TOSA 3QKIA 5B2EA 1N7IA 2MIIA 2AVDA 1EFRD 1VFPA 3FNRA 2QV0A 4CGYA 1TPZA 3PR3A 5ALUA 1ONPA 1F0NA 2RKBA 5IUKC 2ADMA 4X6LA 3Q7IA 4FS3A 3RIEA 5DCYA 4L6CA 4CMGA 5CITA 2A1UA 4FCWA 1HKHA 2W6NA 3A25A 1L5FA 3IDOA 3DE1X 4JN6B 3NEYA 4QHSA 1RJ9A 2D6FA 1ST3A 2ZS8A 4O0LA 3RJ5A 4QYXA 2OUKA 3RIHA 4F3CA 3BE5A 3BGDA 3FPJA 3HCOA 1YU6A 2HMWA 2MSLA 3SHFA 1KO1A 3T5CA 3TEFA 3ZKWB 5A1JA 2X5XA 5GONA 3OPXA 2Q50A 5T8KA 3LPLA 4Z8XA 1KJ8A 3YASA 5JECA 3EK2A 4L51A 2P5YA 3HFSA 4DTCA 1SKAA 3BEDA 4ZODA 5JSKA 4W9RA 5DB4A 2O9JA 4CTMA 1E1MA 3ETGA 1SPBS 5E9QA 2ZM5A 1TKCA 2Z1NA 1H0SA 4B3DA 4JI6B 2GO1A 3GRCA 1J2RA 1M7HA 1L1EA 4QBTA 4IDQA 4GI1A 4IWXA 2HMTA 4EH1A 1H6DA 2RGBA 5FI1B 4U2EA 1M74A 1TX4B 5TGTA 3AB8A 5AM2A 4G5OA 3VPSA 2FN4A 5C8YB 1HT2E 4BCDA 1O94D 3QKRA 1LC3A 1SFRA 2HZBA 4H1TA 5LZ4A 3P19A 3LQYA 1G5IA 1RJEA 1U81A 3HKEA 4I5DA 3DFIA 4EHNA 1NVTA 2GK3A 1FLAA 3A9VA 3MJCA 1PEKE 4O4JA 4EB8A 2IUSA 4B3RB 3WWEA 1AXGA 3M2TA 4QT0A 2Q3JA 4N7MA 2AN4A 1HE8B 2A9VA 3R7DA 1Y63A 1IBSA 3GLGA 4Q7EA 5I9BA 3AUSA 3DNPA 3K6JA 3RC3A 1XMXA 2Q3CA 3E6AA 3NVMB 2WB4A 3FAKA 1II0A 2DUWA 4JJKA 4ID3A 6PFKA 13PKA 2PA3A 1OGYA 3KZMA 4P86A 1MB4A 2EIHA 1JG1A 2CD7A 2E6KA 1XD8A 2ECFA 2EQAA 2NX2A 2NYRA 1QZXA 2ZI6A 1SUEA 4NENA 3BH6A 3ADBA 1YACA 4CM6A 2G25A 3H11B 2FOXA 1K5GA 1OTYA 4QAQA 1NVKA 3AI7A 4R8LA 4E4YA 4A5OA 1UKAA 3NX4A 4Q4AA 3EEIA 5SICE 1YS1X 4UHEA 4EO9A 5AKGA 5F98A 4NC9A 5C37A 1NUPA 2WYUA 1ZI9A 1E6MA 4GR9A 4M55A 4MUHA 3NEPX 1CP3A 1ILWA 1LBTA 4ZYUA 4XQ9A 2C8KA 1NI5A 4ENWA 1Z0AA 3BA6A 1GYPA 3OHMA 4M1EA 4R1PA 4W9NA 3UIEA 3E9NA 3D3JA 5A06A 1U94A 3ZQKA 4BVBA 1RXVA 4RIIA 3ANSA 1E4OA 1US8B 1ZS9A 4HUQB 1T3SA 4JAVC 4ZYWA 4PQEA 3WP1B 1XE3A 3DCYA 1QH8A 4RXTA 3IESA 3RGWS 4KNWA 1NN3A 3B2QA 3UMRA 3T95A 1Z6PA 4IZHA 1W36C 3X0DA 1VHTA 5JS7A 1IG3A 2PS0A 2X0RA 4B7AA 1ZONA 3ITKA 2JHAA 3OE7A 4M6WB 2QD2A 3N0RA 4K1XA 3DGEC 3HZOA 3PKJA 4IEFB 3TOCA 4HN9A 1II8B 1WW2A 3K20A 4ZOBA 3WLHA 3VX4A 1JBEA 3WLEA 5EIBC 5IAKA 2IGBA 2J7PD 4M87A 5ALVA 3RBAA 1PG2A 2ZTMA 3FUWA 3I30X 4G9BA 2RJNA 1N8TA 3QLTA 4ZVLA 4BAGA 3GJRA 3UTDA 4IDAA 1CQXA 2ZOSA 5AVZA 1R9JA 3D8UA 3MHTA 5K0GA 1EUDA 4RY0A 3NBXX 1YHNA 5A5GA 1ZI8A 2ZSEA 1GRCA 3CX6A 1CD5A 2Y2UA 3PQFA 3AYZB 4M0MA 2ERYA 5E2BA 5HTKA 1GAWA 1Y7PA 1P2VA 4CR8A 2UUOA 5JZVA 1PDVA 2QTTA 2BJHA 4Q1AA 2V0CA 3PF8A 1ZYUA 2B4YA 1XA0A 3A26A 3AL2A 3R6LA 4MV1A 4PHFA 4PPYA 5LLDA 1EIZA 4D44A 1M0SA 1FPMA 1N9KA 1KYWA 1W581 3G85A 5TVKA 1KS9A 3DV2A 3QHAA 1LRKA 4FKZA 5D3QA 5CGQB 4G0PA 4AZ0A 2OXFA 3BK7A 3WL6A 4JB8A 2EBHX 3JYHA 1K4MA 4FBMA 4R16A 5E1BA 2D2XA 3KCNA 4B7XA 2OCIA 2QRPA 4GGOA 1KFEB 2PKYX 4M8LA 3OZEA 4AJ2A 5ICSA 1MOZA 3EA4A 5AI0A 4B83A 4QTTB 3NDBB 2OECA 3UG6A 4ABTA 2LXNA 1ZJ5A 1O0SA 1L1QA 1XZMA 2ZSFA 2DC1A 4C4SA 5IT0A 3VGPA 3OHPA 1IULA 1H0RA 4I6EA 3IBTA 1GRNA 4L3OA 5G0VA 2ZJFA 4NH4A 1CUWA 1EFPB 1GT91 3DUFA 1B0ZA 1QZ3A 2NTVA 2SICE 1J8DA 1UJ5A 2ETVA 2F90A 3IULA 2ZTLA 2DTEA 4HZUA 1DBVO 1CB7A 1DOAA 1G20B 4JJ8A 4KXQA 4QGAA 2BY4A 5AM0A 2LCQA 3TX2A 3WY9A 3FAZA 3IEPA 2WWRA 2VPXA 3ILYA 1BD4A 4QAJA 4QDZA 1ZICA 5HR5A 3AF6A 3G2QA 1DCTA 1ZOIA 1PSWA 2GSDA 3CKMA 4KI0A 3T3MB 1EVKA 2O06A 1VPWA 1XNRB 3HNPA 5B6JA 3FNEA 3V8EA 3OEED 5IMBA 1C9DB 2WZDA 3I45A 4G3XA 1CY6A 1KZ4A 2GN1A 1AQLA 3QTBA 5IBPA 5LQSA 3BXHA 3UN1A 3DPUA 3FSRA 1ZVVA 4BLRA 3EF0A 1AN9A 3R0IA 4MIKA 2WC1A 2HIGA 4GXNA 3LX6A 3RKSA 5IXSA 4PLCA 3G8CA 2BBWA 4G36A 1BJKA 1FOEB 5LQKA 2BF7A 3M82A 4OGGA 4AJHA 3LD9A 1EE2A 3S1AA 4HZIA 2DZDA 3CH4B 1J42A 3R44A 4ODIA 3OKFA 2WHYA 3NEJA 2NU9A 3AQ4A 4DBVO 4BVKA 1F0PA 5KHLB 1WRBA 2VATA 4YAJA 3WWYA 3CVYA 1CR6A 4Y6OA 2EJCA 4FJ2A 1UMKA 3B85A 2WQ6A 1X8KA 1CUGA 2Z30A 1QO0A 2HSGA 4N5LA 4BWVA 3Q9NA 4L74A 4RIEA 2AN1A 3PI7A 4ZPXA 4AT1A 3P7MA 1C9MA 1TYDE 2XUQA 3V4ZA 4BV3A 4PN7A 5KVCA 2C2BA 4DJJA 4WCFC 3LUPA 4HSGA 2PT6A 3D7KA 1VLZA 1FUUA 1RQGA 4H6XA 1JEYA 3S7TA 4F4IA 2WPDD 3JWEA 1HDYA 5E38A 1MB9A 2VPTA 1L5SA 1VGRA 2WW8A 3AF0A 3KLBA 3LQ4A 3RAPR 2PZFA 3SSMA 3PNLA 5JJ5A 5TMPA 5K3FB 4BKPA 4QUEA 1U8EA 4QG7A 2D5CA 3WIBA 1TCVA 3KOYA 2B99A 3NZEA 1J5XA 4DMCA 3AM1A 2C3YA 2ZT5A 1IN4A 3BBLA 3JRNA 5GV8A 3K2QA 4JJ6A 4NBVA 4Q37A 4IM7A 3B3JA 4UTVA 3M8KA 4RPJA 1DKQA 4HJRA 1TYZA 2JFBA 3HBFA 1E9EA 3DZCA 1KEUA 2FV8A 3FD8A 3HLKA 1GZ5A 1NULA 4KRXA 4DADA 2A1IA 3DWFA 3PA6A 4ZVNA 4TZKA 5DX1A 4L8GA 2QL9A 2PT7A 4H7JA 1X6VA 2Q1SA 2QPAA 3FVVA 4M60A 5FWAA 3RS5A 1NKSA 2JBAB 3TDKA 3RS3A 1IATA 3R0XA 1AZTA 1M67A 3U0BA 3ADPA 2CNLA 2PIDA 2QD5A 4IYRA 4LGMA 4P3OA 3M4JA 3CW9A 3ZV4A 2A94A 2R85A 3BMCB 4CCWA 1KNXA 1F2UA 2FSVC 1MH9A 3R3WA 3L8ZA 5BNZA 4JT8A 1BX0A 2B8TA 4KE8A 4UUQA 1EVZA 3OA2A 1HE3A 4TWBA 8ATCA 4DR4B 3I8OA 4QICA 5G3ZA 5GADl 4LTMA 1T1SA 1OAOA 3OPMA 4GKVA 4IV0A 4UNQA 3V1MA 9ABPA 3VR5A 1L3IA 1JWLA 1DEXA 3UW1A 2QAGB 3I6QA 2FG6C 1LA2A 3E2PA 4BTLA 3EF1A 1S3FA 1ORTA 1UZMA 1YZLA 3PC3A 2VSQA 1FFEA 1WBJB 2ZRBA 2I78A 2JJQA 2ZRQA 4QJIA 5EZYB 4DIEA 1E3QA 1OYOA 2H7VA 3B6IA 2Z5LA 3L8CA 4QO8A 1SR8A 4UVHA 5KWIA 3P0EA 5LFAA 1LWNA 1F4LA 4ZT4A 3OD1A 4FONA 2XT6A 3EUWA 3ZQ4A 3ISTA 3VI4B 3O4HA 4MR7A 2VTBB 4OLBA 4EFNA 1M34E 5F7ZA 3I5MA 1YQTA 2K7ZA 4FU0A 4M89A 4GWGA 3G0HA 121PA 3EXEA 1U9IC 4RGQA 2Z98A 3CBQA 2UVDA 3HS3A 5DWQA 2E5LB 5IW8A 1FS4A 4JJ4A 1Y1SA 3UGQA 1PJRA 4H3SA 3ZHYA 3GLHB 1IEQA 1AIPA 4MA5A 4DPMA 2QT0A 2D0PB 5F4ZA 1JAYA 1TK2A 4P2BA 2P9QA 3KKNA 4KCGA 4LOAA 4QXQA 5B1HA 3OAAD 2Y1OA 4PANA 4QUBA 2XUGA 3BD6A 2XITA 2Q8PA 1YSCA 4E94A 2GRAA 4Y2QA 4RQTA 4BQNA 2FFJA 1ZJYA 2OXCA 3ZTTA 2A5FA 2F1HA 2NU7A 4K9LA 3WLFA 4YUWA 2YZ7A 1E8NA 5H4HA 1F14A 3EVDA 1EK2A 1Q1AA 5ITVA 2O2YA 4C0WA 1Q0LA 1WXDA 1KZHA 4HLCA 4ECEA 1M33A 1HTTA 4L08A 1RVDA 1W0KA 4UU8A 2Q4TA 5IVKA 3CEMA 3N1UA 1W1WA 4QRDA 4AKEA 1C80A 4DR5B 2ODBA 1LBHA 2BFWA 4YS6A 1V16B 3RUAA 2RHHA 4P2GA 2IE0A 2O5CA 2VYCA 5ENDA 5TXGA 4OHBA 1WKCA 2HWKA 4FDVA 3EQ6A 4C08A 1U2DA 4BN0A 3QJGA 4BO2A 2Y1KA 3A3YA 4URFA 4ZMSA 1ZJ6A 1DG9A 4EQ6A 2OO7A 1E3IA 2VNAA 4PFQA 2H1SA 3H4MA 3E3LA 3IBYA 4KBGA 4OHUA 1SCNE 3DZDA 2QBYA 1R27A 3G2OA 4UVIA 5DOZA 5JEEA 4PHTA 2W70A 5CTJA 4G4GA 4CXMA 2AFRA 4Y9RA 4GPEA 1PZHA 1RLTA 1AKTA 3LLCA 3KU4A 4IINA 5JDIA 3QX8A 1LJ8A 3EGDB 5BVHA 1J0CA 5BWNA 4WOBA 3TNFA 3V55A 1XWWA 3JASA 1DAHA 3HWX1 2BFEA 4H3KB 3H9GA 3S81A 1SUFA 3HO1A 4KKXB 2RHTA 3Q12A 1VSTA 1TJ4A 4DIMA 4NTZA 3B12A 4ZHQB 4CEHB 1Q1BA 4M0CA 1V9CA 3GUVA 2W83A 2FX2A 2Y1XA 1O95D 3OU7A 2Z3ZA 2BGIA 5ALMA 4XYEA 1J9GA 2UZAA 1P72A 1SXJC 2QQ5A 3W9SA 1V4NA 2VOJA 1FYWA 2C5BA 4PTLA 4YRQA 2DHQA 4AWXA 5JCOA 2X0FA 1K88A 4O2AB 5ED0A 4KI7A 4BJ5A 4YGXB 5E6UB 4L5AA 1I5EA 2OCKA 5EIWA 3VR4D 4YRSA 3OQBA 4KREA 3V97A 1G9TA 1PI3A 2IEYA 2QYHA 3TPCA 3UMFA 2UYYA 3KRTA 3U9LA 2RBKA 1OA0A 1U0SY 1Z07A 3BD9A 4CMAA 3H2HA 3TVDA 3TRJA 1EXNA 1TLFA 2WKWA 4DNPA 2EJBA 3U7QA 2J5KA 1COWD 1UPBA 2YY7A 1C1HA 3HXMA 2ZTUA 2R5FA 2QORA 3DCNA 4DLVA 5KQSA 2EEZA 1IEVA 2OBMA 1PL7A 4N0DA 2EKQA 4DIDA 4DLAA 2H0QA 2V7QA 3M9WA 2PZLA 1X8LA 4P4LA 1R0LA 1VCOA 1CUBA 2E6UX 4OM7A 4QD3A 4DT1B 3AL3A 2Y0CA 1AM4D 4NEGA 2DLCX 3RAEC 3NH6A 1UPFA 1SUPA 1XN1A 2Q0XA 1MQ8B 2NUPB 4GEGA 4A91A 5KNCA 5IULC 4CKXA 3RAJA 3WLJA 4F1JA 1RRGA 1NXQA 1HLDA 1WNFA 2BP7A 4ENSA 1FDUA 2CDRA 3KR0A 4NARA 4NMXB 1W0JA 5AI4A 2DPXA 4D9NA 3U37A 2O20A 3TLBA 1QWOA 3BS4A 5K7SA 2PIAA 4C22A 2NO7A 3DE0X 3GGOA 3HCFA 3AM4A 4B3BA 3V3KA 1SWVA 3K4PA 1GQRA 5IKXA 3NWEA 4PZ0A 4Y1FA 4MJ7A 1IOLA 4LMRA 2I80A 3VVCA 2H65A 1B00A 4UAJA 3DE6X 4X45A 4E2WA 3AERA 5JCZA 4M1YA 4DDVA 3V4FA 4YQFA 1N1DA 2KLHA 1A5AB 1AQ6A 4TLAA 4GC9A 5JUWA 2N46A 1P9NA 3K0CC 1ECCA 4IJVA 3V8NA 4LPKA 2XLBA 3I1JA 1KJ9A 1X19A 3KDPA 4MNTA 1QP4A 5A4MS 1Q0PA 3H5AA 1STOA 4O3FA 1XZEA 3N8NA 2BMAA 3IALA 2IF2A 4OB7A 3AETA 1ZD8A 4CCYA 4DV4B 2ZUCA 3B89A 1KA9H 2PPVA 4RX1A 2QTFA 4S12A 2ZR0A 1TUGA 1ISMA 3PPYA 5LQAA 4MVYA 1QV9A 5LA6A 2HWWA 1DKOA 1ZK1A 1UBMS 3LBYA 2J7KA 4F4DA 2BSQA 1VOTA 4BB0A 1J33A 1RWMA 2PFSA 2RG7A 2WSSD 2WZCA 4TRNA 4RTSA 2O5EA 3GXOA 4JDUA 1DAOA 1OZHA 4G25A 3L0SA 1LLUA 2VC2B 3L18A 4K87A 1R16A 3UPDA 4KSCA 3CLTD 2F1IA 3AJ9A 1NNSA 1TC2A 2GJSA 3G89A 4TLMB 1H6CA 4Q03A 3K35A 4EKNB 5JFOA 5LQDA 4KG7A 1L7QA 1MGPA 5AW1A 3BIWA 2ZSAA 4E1VA 1NZDA 1NDUA 3K8ZA 4NONA 2GMWA 4WNAA 5SZJA 4D6YA 4DGSA 5CLJA 1Z3CA 1FFDA 5FEUA 1UXGA 4QGBA 5IXYA 2YN0A 1DUSA 1ZRNA 4XX0A 3M4NA 4XCQA 2WJGA 1W5AA 2V7GA 2J3KA 2PX0A 1ZVJA 3DAGA 1AT1A 2JH9A 3JQGA 4YMGA 2COEA 4N6GA 4CV2A 1NVEA 2IXGA 1YVDA 5KPDA 2WFAA 1MEOA 4TS9A 1PL8A 1W5BA 2H52A 2X6QA 2EYUA 2WHQA 3A9RA 3E5NA 3H2ZA 4UU0A 4EG0A 4BCBA 1EUCA 1Z62A 4J7UA 2F9FA 3TW4A 2AN5A 2UYCA 5CNMA 3D4NA 1DPGA 3G6WA 4IMPA 3KPVA 1QYXA 5TRTA 4DQ0A 5C51B 2FQWA 3EFHA 1JNYA 1UWKA 5CLIA 2D2FA 4GRDA 1KU0A 1EINA 1ZCZA 1PLKA 1TCAA 3NTOA 3RNOA 3V8QA 5JW6A 4JY7A 3FYUA 1DCFA 2O48X 3AX6A 2EG5A 2GTIA 3PWZA 1PJAA 2N1MA 4QX6A 2BDEA 1L5HA 2ZXFA 3N74A 2VBIA 5FEMA 2G71A 2WB2A 4K1LA 3VKUA 3QX7A 5BMVB 2FEKA 4A15A 1G8SA 1IONA 4M9UA 1YDHA 2J9FB 3KSDO 4GXQA 4QREA 4TWZA 3TD9A 2XUIA 5IDWA 5C3UA 2BMFA 2IVFA 2WR8A 1VJCA 4AMGA 3MLAA 4TV9F 5CVDA 2B30A 3FUTA 4LVNA 2YZGA 3PUJA 5B58C 3E9DA 3L92A 5M04A 2Q07A 1P7CA 2G0TA 1AUVA 1SU4A 2GN0A 3LGAA 4BKOA 5HKKD 2XYHA 3H1FA 3MBOA 3RUPA 2QU8A 3UM9A 4MUEA 3SR3A 1PDOA 3CQ9A 4BEJA 4OA8A 4RY8A 3RJZA 1KI7A 1VJRA 3WNVA 4BCCA 2C3OA 4R3WA 1C8BA 3L1IA 1DKUA 4DDKA 3COWA 4FSXA 4YDHB 3V1YA 5KYVA 3D43A 4HNAB 2X0EA 5HRCA 4MW2A 2WHPA 2IDMA 2R87A 1CUAA 1T4CA 4L02A 3WK7A 3MZ0A 4G01B 1SXGA 3WMEA 3WKAA 4EI8A 1Y1QA 3N59A 4LG1A 3AFNA 3DMYA 2EZ4A 3EIEA 3FB1A 4RPLA 1XDGA 1DNPA 3OFKA 4J1NA 4KMRA 4RXUA 2GZSA 3ZIDA 4Q9JA 2NSHA 3EGCA 1XU7A 4BUCA 3EDCA 3SC4A 5EA2A 1Q1QA 1T0JB 4RIHA 1TO1E 2NV2B 3N2EA 1JDTA 1P80A 4D97A 3L4SO 3UMGA 4BYMA 4RENA 3RRYA 4EGAA 3AIOA 1YS7A 1V1RB 2XF8A 3QXXA 2IIPA 4KNVA 4AXXA 5EJ7A 4GGPA 4XB1A 2DR3A 1MXHA 3OOEA 3DJFA 3O21A 1Q21A 4PQFA 3MB8A 3HDGA 4HDRB 4H4EA 4EJMA 2FPPB 3VOBA 1IAVA 4U9IS 4PYMA 1Q84A 1KYQA 4HFRA 2HMAA 4E03A 4X6YA 4MQEB 5BXQC 1WUIS 1QO9A 4UHCA 1FBNA 2HI0A 4FFWA 3V1NA 3WDLA 1A8QA 1MRZA 3I0MA 1UXJA 4JBIA 3QYAA 3SDSA 3EGIA 1FRNA 4U6SA 3AESB 5C1PA 221PA 3IXLA 4I1OA 2OKGA 4GI7A 4TRMA 3RH0A 4JP1A 4LYYA 4PYIA 1IQ0A 5AUOB 1TQHA 3L7BA 2D1FA 2AI3A 4TQAA 1CZLA 3ULKA 1OASA 5CBKA 1DMSA 3KUXA 4ZRNA 4JMPA 4HPXB 2OCXA 1NDHA 1I2DA 2GCPA 3CZCA 1V0JA 3LYAA 5TEWA 3WGNA 1ZQ1A 4KO3S 1OFUA 2BZGA 2ZE8A 3PFIA 1SWWA 1XF9A 5LYJB 3MLEA 2JJYA 2A0XA 1TCBA 3BMXA 5KX5B 2QUBA 4HLQB 1MPTA 4LHWA 4DNXA 3NORA 1C41A 2Q41A 3TQOA 4Q7LA 3ORRA 1SHZA 3VR3D 1XCJA 1Z4PX 2FUCA 2WUWE 5GGYA 1OZ0A 3UANA 3M6LA 4F3NA 1KRWA 2GJ8A 2ZSIA 2FWMX 5AO9A 1WXIA 2YWXA 2G1JA 2XE7A 3HB5X 3GQBB 4TLLB 2ZJYA 3L02A 4GECA 3O8NA 4IDBA 3AM3A 2XJ9A 3KC2A 5CU7A 3EX7C 2C5HA 1Y3IA 1C8LA 5AKZA 3C3MA 1K8ZB 5A0FA 3KZCA 5K0FA 4NDNE 2GCOB 4R01A 3BQNB 2LR0A 3PQ2A 3RBVA 4ITRC 5JJKA 1I4WA 4MUAA 5DBFA 3NYRA 3AB3A 4DEXA 1HA3A 2HA7A 4HNUA 3M70A 4HCJA 4QXAA 1SCQA 1YK1A 1R4ZA 3HJTA 3OMXA 4PAWA 1JG2A 1B14A 2Y92A 4OJTA 3O8RA 1J20A 3THXA 2FQXA 3RC8A 3MT7A 2CXQA 5DRTA 5HBGA 1EWQA 1T0HB 2HPAA 3AEUB 3W2GA 4BMCA 5SV2A 3PC2A 3IBFA 1OH8A 3C1UA 5J5AA 2ASVA 1G8HA 1F48A 3VSAA 2ZETA 4LFAB 4Y6RA 1Z34A 3PC6A 4MPPA 4MW1A 1Q19A 3JQ8A 3O2QB 3ZHVA 2ZPUA 1SIWA 3BCHA 3GLIA 3V32A 4DW8A 4JYMA 4UMEA 1T1GA 3ZH9B 5GVRA 2E4UA 4LDZA 5ALDA 1YR7A 1JAIA 2XMGA 3RYHA 3FPBA 4J76A 4N0EA 1RU3A 3N87A 4M1OA 1BH2A 5JBQA 2ISSD 1X92A 4PF1A 2DT5A 3UNXA 4W8GA 3ZE8A 3ROMA 2Y9MB 3OQOA 5KBYA 3PP8A 2BI4A 4XWKA 4PLPA 1T34A 5AW8A 2J3LA 3WIOA 3RRMA 2JLRA 1SVNA 1BDIA 4GP9A 1J9ZA 1I6MA 4YP5A 1Z3IX 2W71A 2ODEA 2J3JA 3OT1A 4TYMA 3NM4A 1X8JA 1AQIA 3OMWA 1V2HE 3ZHSA 4JL5A 2C2OA 2FMFA 3HKDA 1LNQA 3GN2A 4K6GA 2PLWA 4MP8A 1WEKA 1DX6A 1AX9A 3A3NA 3H5VA 2PRSA 2VAXA 1MQ9A 3T0IA 3IOCA 4AWBA 3HJAA 1AG9A 2HHCA 4MEBA 4WY2A 3RT1A 4ZI7A 4RS3A 5IEJA 1ONSA 3A04A 3NTQA 1QV6A