3P09A

Crystal structure of beta-lactamase from francisella tularensis
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
268
structure length
264
Chain Sequence
QLDDSFKNLENKYDGKIGIYTLNTNIKYNESYHFPICSVFKFLLVGAILDYDMHNQGFLDKKIPINQDDIGKLGYAPITAKNVGKTLTISQLNYAAILSDSPASNILVRELGGLQNLNKFIKKLGDNDTIITADEPEINYTQPHSNINKTTPKAITKDIYKLAFGNILDKKHKDIFIKYLQDNNTGANRIAFSMPKDWIIGDKTGTCGQYAATNDVAIIWPKNQQPIALGILYTNPNDKNAPSNEEIIQQAAKLIANDLTNTYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-lactamase
publication title Crystal Structure of Beta-Lactamase from Francisella tularensis
rcsb
source organism Francisella tularensis subsp. tularensis
molecule tags Hydrolase
total genus 92
structure length 264
sequence length 268
chains with identical sequence B
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2010-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 3p09A00
1JTGA 4ZJ2A 4A5RA 1PI4A 1L0FA 4S2NC 4CJNA 1BT5A 3GMWA 1GHMA 3QHYA 2WKIA 5F1FA 4R4SA 5FQKA 3O87A 3DTMA 1ES5A 4U0TA 3MZFA 3C4OA 4DE0A 3M2KA 1AXBA 5FQQA 5DF7A 1XA7A 4R3BA 3DWKA 4N9KA 4YINA 1LI9A 4C75A 4E3IA 2XK1A 3W4PA 4ID4A 2A3UA 2XFTA 2EX2A 2PBYA 4B4ZA 3M6BA 5A92A 1MY8A 2EX9A 1BZAA 5FI2A 4FH4A 3IWOA 3MXSA 1LL9A 3IXBA 5EVLA 1DJCA 1DY6A 2HDSA 1JWZA 2ZQDA 5CHUA 3IF6C 2OLVA 4ZAMA 4BL2A 3G34A 1JTDA 4GD6A 1GHPA 4QY5A 4S2LA 4DXBA 1E4DA 4PMAA 3CZDA 4E3NA 2VGJA 4XXRA 2H0YA 4RA7A 5GLCA 3FKVA 4FSFA 4JF4A 3LCEA 3VP4A 1W5DA 1ZC2A 1SHVA 3A3EA 3IHBA 4NETA 2J7VA 4JXWA 4R0QA 1BULA 3V39A 1PWGA 1VM1A 3Q7VA 3UE0A 1HTZA 4IEDA 4N1HA 1XGJA 5TFQA 1GCEA 2XH9A 1K56A 1LHYA 1IEMA 2Y2JA 3ZG5A 3Q7VB 4WMCA 1J9MA 2HP9A 2X01A 3UDFA 4ZBEA 1LI0A 2G2UA 2V1ZA 3ZNYA 3QNCA 1QMFA 4WM9A 5GHZA 4DF6A 2FFYA 4F94A 2I72A 3A3DA 2XEPA 4OQIA 4N1XA 5EVIA 4MNRA 1YLZA 3TOIA 1FCNA 5EPHA 5CERA 3WS5A 4EUZA 4KZ6A 2WUQA 1E25A 1GHIA 1Q2QA 3SS4A 3P09A 3OPPA 1CEFA 4Y0UA 2RCXA 4JKTA 5EVIB 5EOOA 3VP0A 4Z9QA 4UA6A 5CXWA 5AQ7A 1PI5A 3DWZA 3UN7A 4ZJ3A 3MKEA 3SS3A 3N8RA 3HLWA 1JVJA 4OPYA 3CJMA 1MWRA 4GNUA 1CK3A 5HX9A 1ES2A 1LL5A 4KZAA 1TDGA 3HBRA 1M40A 1FSYA 3GSGA 2Y2NA 5EOEA 1PZOA 3AGDA 1ERQA 3UE1A 3BLMA 3QNBA 4FD8A 1FQGA 5KMWA 1NZUA 4LV2A 3WWXA 4RX3A 3E2LA 1IKIA 4OH0A 4OP8A 4S2JA 3UDXA 4DE2A 2EXBA 2OLUA 2GDNA 2UWXA 4JF6A 2B5RA 2WYXA 3HLEA 3C5AA 3PAEA 5FQMA 5CTNA 2HDRA 2JE5A 3IXDA 2XD1A 2Y55A 2G2WA 1RCJA 4UA9A 2Y4AA 2V20A 2ZM2A 1YLYA 4DDYA 1BUEA 2DRWA 1NXYA 4X53A 3O88A 4PM9A 4DDSA 3NY4A 3BM6A 3G31A 3OCLA 1C3BA 1H8ZA 1DJAA 3HL9A 2OV5A 4S2KA 2Q9NA 3MZDA 1W8QA 4XUXA 2Z2LB 1EWZA 1MWUA 3N6IA 2EFUA 3BECA 1YM1A 3UNWA 4WELA 3VFFA 4X68A 2X71A 1YT4A 4IVIA 5CEBA 5F82A 5CGSA 1K54C 3V5MA 5KSCA 2WGVA 2WZXA 4UAAA 1K55A 2WK0A 3TSGA 2ZQCA 3HLDA 1FSWA 3Q07A 2QPNA 3HLBA 4S2MA 2XFSA 3VMAA 2WAEA 5AQBA 1KGFA 2ZMAA 3WS4A 5EE8A 1ONHA 2ZQAA 2WADA 4E3MA 3VSLA 4E3LA 2Y2IA 3GV9A 1TVFA 4Y0OA 1MWTA 1FR1A 1LLBA 1XKZA 1FOFA 5BOHA 4KQQA 1YLWA 3A3FA 1MBLA 2EX8A 1XP4A 3OPHA 5HFOA 1PWDA 3N8SA 5CGWA 3Q81A 4R1GA 3UPNA 1Q2PA 3G30A 1KE4A 4GDNA 4O7DA 1K57A 2IWBA 1S6RA 4K0XA 2HP6A 4FH2A 3NC8A 2ZC3B 4OOYA 4L0LA 4X6TA 2H10A 1K4EA 5GL9A 5D3OA 3SH8A 3W8KA 1BLCA 4PM8A 4JLFA 4RVAA 2ZJ9A 5FAOA 4OP5A 1W7FA 4WZ5C 3SOIA 3D4FA 2H5SA 3OPLA 3M6HA 3NIAA 1EI5A 2Z2MB 1I2WA 4HESA 5CHJA 4EBNA 1Y54A 2ZQ9A 5DTKA 4KG6A 5I94A 3VP3A 2WGWA 2ZC5B 4LV1A 2E8IA 4BD0A 4DKIA 1FCOA 4KZ3A 2XDMA 4KZ9A 4WEKA 3IHAA 5M19A 5CRFA 2C5WB 1PW1A 2BLSA 2QMIA 1N4OA 3AGEA 3ZVTA 4E6WA 2VGKA 2WGWB 4LENA 4B4XA 2V2FF 3BFCA 1ERMA 4KZ7A 5M1AA 2A49A 1I2SA 2OSUA 2Y2HA 2ZC4B 3BEBA 4KQOA 3UO9A 4OPZA 3P98A 3ITBA 4OOLA 3RXWA 1NYMA 5HAIA 1IYSA 5M18A 3VOYA 4S2IA 5IHVA 3MBZA 3VOZA 2ZD8A 2HDQA 3IH8A 3GRJA 4GD8A 1MWSA 5CGXA 3LY4A 3ZHHA 5FI7A 4MEZA 1I5QA 3IH9A 3HREA 1GA9A 1EROA 3I7JA 3JYIA 4P0MA 3ITAA 1BLSA 1O7EA 3PAGA 4JBFA 3S1YA 1KE3A 1L0DA 4EBPA 3BFGA 5JYPA 4Y0TA 4LCLA 2P74A 3HLFA 5GLAA 5CECA 1K6SA 3ZVWA 1GA0A 1HVBA 3G35A 2QZ6A 2Y59A 3O3VA 4KZ4A 1NYYA 1IYOA 3BFFA 3GR2A 3BYDA 4M3KA 4P6BA 4B88A 3BFEA 4ZJ1A 2C6WB 5FQJA 1ZKJA 4NK3A 3E2KA 4P87A 5A91A 4R3JA 5E2EA 1NRFA 4D2OA 3BFDA 5KSHA 4GB7A 3ZFZA 5CHMA 5CTMA 4IBXA 1YQSA 2WGIA 1NJ4A 3TG9A 5CEDA 2ZM0A 1K56D 1KDWA 1WYCA 4MBHA 3IF6A 1ES3A 4X55A 4WMCD 4E3OA 1E3UA 5F83A 3HUOA 4HEFA 4GZBA 2WAFA 3CG5A 3IF6B 3OC2A 1U60A 3VP2A 3ZG0A 5U47A 3IQAA 2FFFB 3UDIA 2J9OA 5EUAA 3VSKA 1BLHA 4JXGA 1BSGA 4ZDXA 5KZHA 1SKFA 5A90A 3GQZA 4WEJA 5DF8A 4N9LA 3FV7A 2HDUA 4GDBA 3UY6A 2Y2MA 3CMZA 4HBUA 3HUMA 1S0WA 4YFMA 2ZC6B 4MBFA 3PBRA 1RP5A 2IWDA 1L0EA 4P85A 3HUNA 5E2HA 3ISGA 5GHXA 4WZ4A 5TR7A 4Q8IA 1L0GA 3B3XA 1PWCA 4KG2A 1K38A 1FCMA 4R23A 3LEZA 4BQMA 4EQIA 4N92A 4C3QA 1H8YA 3VFHA 1K4FA 5F1GA 1MXOA 3EQVA 3IWQA 4LV3A 4OPQA 3ZG7B 3FKWA 1MKIA 4U3TA 4QY6A 5HAPA 5HARA 1YLJA 3HVFA 1K25A 3MKFA 4IBRA 3MXRA 5FI6A 4KENB 5FQ9A 4OVDA 4ZTKA 2PU2A 1CEGA 2R9WA 1YMXA 1WE4A 3G2YA 4QB8A 5FAQA 1XPBA 4H8RA 1BTLA 4UA7A 3WS2A 4X56A 1H5XA 2Y2GA 3M2JA 1O07A 3BRMA 4DE3A 4HBTA 3AGFA 3W4OA 4BL3A 4JF5A 1XX2A 4JPMA 4PM5A 3WS1A 4KG5A 1PZPA 2PU4A 1DJBA 3G4PA 2DNSA 5HW3A 4XUZA 5EVIC 3GTCA 1IELA 1XGIA 3FZCA 3G32A 3MFDA 5HL1A 4RYEA 4BD1A 5FDHA 1Z6FA 4DXCA 3ZG8B 1TDLA 3IWIA 1W79A 3V3RA 4GN2A 3A3JA 4QD4A 4JXVA 1KGEA 1FR6A 1SDNA 3WRTA 1KDSA 3V3SA 4OQ0A 2DCFA 3V50A 2XR0A 3MZEA 3PBOA 5EECA 1ZG4A 4MBKA 4EV4A 3NDEA 4OKPA 3UE3A 2Y2LA 1RGYA 3OCNA 2HPBA 1SCWA 1NZOA 3HLCA 4E3KA 4EBLA 1VQQA 1M6KA 3WRZA 1ALQA 1G68A 4KZ8A 2XLNA 5J8XA 2J9PA 1K54A 2IWCA 2Y2OA 3A3IA 3VP1A 1G6AA 1JWVA 3N7WA 4EWFA 3PBTA 2J8YA 3NDGA 3FWLA 3SH7A 4QJGA 4C6YA 2X02A 4Y7PA 4OQGA 4KZ5A 3DW0A 1W8YA 2ZQ8A 2XQZA 3RXXA 4S2PA 5E43A 2ZQ7A 1L2SA 4WBGA 5AQ9A 3C7UA 5E2GA 4OQHA 4BJPA 3IXHA 5HAQA 3N8LA 2XF3A 1IYQA 1RGZA 2XGNA 4BENA 1YLTA 3IT9A 4RX2A 2XD5A 3WS0A 3SS5A 3C7VA 3PBNA 3IF5A 5FSRA 3ZNTA 1HZOA 3RJUA 3S4XA 4OONA 2EX6A 1ESUA 3OPRA 3GVBA 1YLPA 4E6XA 4FCFA 4OPRA 5FASA 1K55C 2EFXA 4K0WA 1ES4A 3Q1FA 5DTTA 5DTSA 2HP5A 2JCHA 5G18A 4DRTA 5TGFA 5JYOA 2CC1A 5FAPA 1SDEA 2BG1A 3PBQA 2R9XA 1KVLA 4U0XA 1PIOA 3HLGA 4WZ5A 4PM7A 5GHYA 4KZBA 5GLDA 3SH9A 1PW8A 3ZDJA 4OLDA 4OLGA 1BLPA 1MPLA 3BLSA 2Y2PA 3NI9A 1QMEA 1YMSA 2Q9MA 4GOGA 5EVID 4DE1A 1TEMA 4UHUA 1JWPA 4BLMA 1XA1A 3OZHA 2EXAA 1XXMA 2JC7A 3NBLA 3UPPA 2JBFA 1NY0A 3LO7A 2Y2KA 1ESIA 4IVKA 4LCMA 3W4QA 5FATA 3LY3A 1PYYA 2Y91A 4X69A 4E3JA 5FQIA 5GLBA 4CPKA 1K57C 1ONGA 3O86A 4PM6A 3FYZA 1CI8A 2RL3A 3Q82A 2ZC7A 5E2FA 5AQAA 4JXSA 1KE0A 1OMEA 4LV0A 3PBSA 4QHCA 5A93A 3Q7ZA 4S2OA 5DVAA 1E3UD 2P9VA 4GKUA 4OOMA 3G2ZA 3UPOA 1HD8A 3ZG9B 2P9VB 2Y2QA 4S2NA 2ZLYA 4PPRA 5DF9A 2WKHA 2WKEA 3S22A 4K91A 3N4IA 4QU3A 4KQRA 5L2FA 4R4RA 1K6RA 3PTEA 1IKGA 2ZM8A 1N9BA 1IYPA 1KGGA 2H0TA 3C4PA 3NCKA 4WYYA 3ZCZA 2WZZA 3IXGA 1CI9A 1ZG6A 4MLLA 3EQUA 5FA7A 1KVMA 1WYBA 3ZGAB
chains in the Genus database with same CATH superfamily
1PI4A 1L0FA 5F1FA 1ES5A 1VEUB 4HNBA 4DE0A 2VK3A 4M4XA 3T4LA 1H0MA 1XA7A 4R3BA 4N9KA 1T1BA 2XSSA 1JNUA 2XFTA 1F98A 2PBYA 4B4ZA 3IWOA 3MXSA 2QHKA 1DJCA 1UWPX 2HJ9C 2K7SA 3KSIA 4ZAMA 4HY8A 4S2LA 4KQDA 4PMAA 3CZDA 1ZC2A 4NETA 3KYZA 1DP6A 2J7VA 4R0QA 3V39A 1VM1A 1HTZA 1GCEA 2XH9A 1YSQA 4WMCA 4EETB 4ZBEA 2G2UA 2V1ZA 4DF6A 2I72A 3A3DA 1TD5A 4PKYA 1FCNA 3WS5A 4EUZA 4KZ6A 1E25A 3OPPA 5EVIB 4B9OA 2M7VA 5CXWA 5AQ7A 1LSXA 5MC7A 4GNUA 1CK3A 4MCWA 1ES2A 4KZAA 4R6LA 5C5KA 1M40A 3GSGA 3UE1A 1S67L 2W1RA 3V67A 1NZUA 4UQIS 1X0OA 3PR6A 4OH0A 4OP8A 3UDXA 2OLUA 2WYXA 3F1NB 5CTNA 2G2WA 2V20A 3U4LP 4X53A 3IS2B 4PM9A 5DJUA 3G31A 3OCLA 5TBMA 4LFUA 3MZDA 3NOPC 2Z2LB 1EWZA 2MJ6A 4L9GA 3VFFA 2X71A 2QJ5A 1YT4A 3NOUC 2VLGA 5CEBA 1K54C 5KSCA 2WZXA 4UAAA 5HDSA 2QJ7A 2ZOHA 4LRZE 1T1CA 2ZMAA 3WS4A 4CQHA 2JKTI 4PHTA 4E3MA 3VSLA 4E3LA 3GV9A 4YWZA 3UB6A 5BOHA 3SZTA 1KVMA 2EX8A 1XP4A 3KSFA 1PWDA 3UPNA 4Z1WA 1S6RA 4FH2A 3NC8A 2ZC3B 3PXPA 1BLCA 2PYRA 4JLFA 1F5MA 3SOIA 1W7FA 2J3WA 2H5SA 3OPLA 1I2WA 3LICA 4HESA 4KG6A 3CHWP 2WGWA 3VP3A 2E8IA 4KZ9A 5CRFA 1VETB 4Y13A 4E6WA 3UB7A 2VGKA 2OWHA 4YOFA 3T4QA 5M1AA 2A49A 2V9AA 2Y2HA 4KQOA 3UO9A 3P98A 4OOLA 3RXWA 2VKSA 5G4YA 3VOYA 4S2IA 2QWSA 1W63M 3IH8A 3GRJA 5FI7A 4MEZA 3QP6A 1EROA 3I7JA 2Z6DA 4XT2A 4EBPA 1KE3A 1L0DA 3BFGA 5CECA 4S2NC 4KZ4A 1NYYA 2C6WB 4Y15A 4P87A 4FUWA 5E2EA 1NWZA 3TG9A 4X55A 1GSWA 4MBHA 1E3UA 1OT9A 3HUOA 1P0ZA 3VP2A 4HH2A 5EM1A 5A8BA 4JXGA 4UQIM 1BSGA 5KZHA 4WEJA 5DF8A 3UY6A 3CMZA 4HBUA 1S0WA 3R7WB 1RP5A 1L0EA 5GHXA 5TR7A 4Q8IA 4KG2A 1FCMA 3LEZA 1YSPA 3C8CA 4HJ3A 2VV8A 1K4FA 1MXOA 2J80A 3EQVA 4LV3A 4U3TA 3MKFA 4I3IA 4ZTKA 5FAQA 1WE4A 2GX5A 4HJ4A 1XPBA 2HV1A 1BTLA 4UA7A 1H5XA 3M2JA 1O07A 3OBFA 3W4OA 1NLZA 4Y2FA 3WS1A 1PZPA 2DNSA 4XUZA 3GTCA 1IELA 1XGIA 4RYEA 3DTEA 1Z6FA 3ZG8B 5L8MA 4FOFA 3V3RA 4JXVA 1FR6A 1KDSA 2B95A 3PBOA 1H8MA 3NDEA 4OKPA 2HPBA 4E3KA 2WKPA 3WRZA 4EXOA 4KZ8A 3FG8A 4UEYA 1OTBA 3MJQA 3NDGA 3SH7A 2X02A 3KYEA 3BY9A 3DW0A 2UV0E 2XQZA 4S2PA 2OAP1 1CF0A 3C7UA 3N8LA 1IYQA 3CITA 1T18A 3WS0A 3SS5A 2Y8HA 5CX7A 3KO6A 1KOUA 1YLPA 1K55C 2JCHA 4DRTA 5JYOA 1SDEA 4F3LB 4WZ5A 1PW8A 3ZDJA 3BLSA 4GOGA 1TEMA 4BLMA 2EXAA 2JBFA 2VEAA 4LCMA 1OTAA 1MKMA 3O86A 4K08A 4JXSA 1KE0A 1OMEA 4LV0A 1N9NA 5DVAA 2PD8A 1HD8A 1T1AA 4MDZA 3T4JA 4HI4A 5DF9A 3S22A 4K91A 3N4IA 2ZMVA 2QKPA 4R4RA 4Q0IA 3MQQA 1ZG6A 4MLLA 1JTGA 4ZJ2A 3QHYA 3FPVA 3H9WA 4R4SA 5FQKA 4U0TA 2JKFA 2ZL1A 3C4OA 2OWJA 2HZ5A 5FQQA 4YINA 4DN0A 1LI9A 4C75A 2XK1A 4ID4A 4I38A 1MY8A 5AJGA 3CUEC 3IF6C 3GECA 3LR3A 1OTIA 1GHPA 2HF6A 3E4PA 5HWTA 3BQAA 2PR6A 3A3EA 1SHVA 3IHBA 4GCZA 4G3WA 3Q7VA 2VV6A 5TFQA 3S7QA 4FTXA 4GHIA 4WM9A 5L07A 2VJWA 4OQIA 2P7JA 3CI6A 4MNRA 1YLZA 3TOIA 5EPHA 1GHIA 1D1JA 1Y28A 2RCXA 1XJ3A 3VP0A 4Z9QA 2AVXA 1PI5A 3UN7A 4ZJ3A 3MKEA 3N8RA 4OPYA 1MWRA 3E98A 5HX9A 1BYWA 1LL5A 2Y2NA 3AGDA 3BLMA 1TS6A 2JKRM 3UB8A 5HSQA 4S2JA 2EXBA 3TJZC 3DTKA 2B5RA 2L0WA 2HDRA 3BW6A 1RCJA 4UA9A 4YNRA 4MMNA 5L10A 2ZM2A 4CLCC 1YLYA 4HHDA 2JHEA 4DDYA 2DRWA 4DDSA 1C3BA 1W8QA 4XUXA 1MWUA 2EFUA 3ZQ5A 5EM0A 5TBMB 3H82A 5CGSA 4G3KA 3TSGA 3HLDA 3C30A 1K0KA 3Q07A 2QPNA 2XFSA 2WAEA 3HJKA 1ONHA 3MFXA 2WADA 1VB6A 1TVFA 3MXQA 4Y0OA 1FR1A 1LLBA 4KQQA 1YLWA 4NKPA 4B93A 4O7DA 1K57A 2IWBA 4K0XA 4OOYA 4LGWA 4LRYC 3M6HA 3NIAA 2Z2MB 2VGLS 4EBNA 1Y54A 5I94A 3K2NA 4BD0A 1FCOA 4WEKA 2D02A 2C5WB 2BLSA 2QMIA 5HWWA 3EWKA 3ZVTA 2WGWB 3F1OA 1OTEA 5LBRA 2WKQA 4KZ7A 2OSUA 2ZC4B 3BEBA 4OPZA 5HAIA 1IYSA 2W27A 5M18A 2NUTC 1OT6A 5HD5A 2EWWA 4GD8A 2V8CA 3ZHHA 3ITAA 1BLSA 3PAGA 3S1YA 3HLFA 5GLAA 2WKRA 3ZVWA 1HVBA 3G35A 2Y59A 4P6BA 1IYOA 4XT2B 4B88A 3BYDA 3BFEA 4ZJ1A 5FQJA 3E2KA 3VE4A 1ODVA 5CTMA 4IBXA 2WGIA 2VA0A 1KDWA 4IHQA 2V1BA 5F83A 2GJ3A 3W2ZA 2YKFA 2FFFB 2J9OA 3VSKA 1YPRA 2PR5A 4ZDXA 4N9LA 4GDBA 2Y2MA 4YFMA 4P6ZS 4ESPA 4MBFA 2L4RA 4NXEA 1L0GA 3B3XA 3TRCA 4EQ1A 4BQMA 4EQIA 1H8YA 3VFHA 3FKWA 4QY6A 5HARA 3K3DA 3MXRA 4OVDA 2R9WA 3T12B 4ME4A 4X56A 2Y2GA 3TE8A 3NJAA 3AGFA 4JF5A 4I5SA 1OJ5A 1DJBA 3T1XA 1S4SA 5EVIC 4O8GA 2YKHA 5HL1A 2M1CA 4BD1A 3IWIA 1W79A 3IX3A 3A3JA 4QD4A 1KGEA 3WRTA 4OQ0A 3MZEA 4MBKA 4EV4A 3UE3A 3OCNA 1DP9A 4EBLA 2A2LA 1M6KA 4NEED 2VGLM 1K54A 3A3IA 4C6YA 5IU1A 5FL3A 3RXXA 3BWLA 1L2SA 3IXHA 2XF3A 5HL6A 1RGZA 5KIZA 4BENA 2VZWA 4WL9A 3E0YA 3D72A 3CPTA 1NRJA 3ZNTA 1HZOA 3RJUA 3S4XA 1W63Q 1TS7A 1AWIA 4E6XA 4OPRA 5FASA 3GDIA 3Q1FA 4NG2A 1MC0A 5G18A 1G6OA 4WF0A 5FAPA 2BG1A 3PBQA 4EESA 3SH9A 3LIBA 5HZHA 1S4RA 2KOIA 3EEHA 4OLDA 2Q9MA 4DE1A 5DKLA 1JWPA 3IX8A 3OZHA 3NBLA 1MZUA 3LO7A 3LIFA 3NULA 4DJ3A 4D60A 1ESIA 4ETXA 3W4QA 3LY3A 4E3JA 1ONGA 1CI8A 2RL3A 2B02A 3MQ0A 5EFWA 4S2OA 3T1SA 2FH5A 3S7OA 4HH3A 2ZMFA 4GKUA 1G28A 3LR4A 4OOMA 3G2ZA 3UPOA 4S2NA 3S7NA 3LEQA 3UMEA 2P08A 4QU3A 1F2KA 5DKKA 1IYPA 2H0TA 4EEUA 3F1PA 3JVUA 2ZOIA 3T4KA 5AVEA 2WKIA 1FILA 3EOIA 4LPZA 4RQ9A 3U2AA 5DF7A 3DWKA 2ZL1B 2ACGA 3W4PA 2A3UA 2EX2A 3PYPA 3FPWA 1ZHHB 4FH4A 1LL9A 3IXBA 5EVLA 2O9AA 2HDSA 1JWZA 2ZQDA 4BL2A 2W0NA 3G34A 3SW1A 1JTDA 4GD6A 4QY5A 1E4DA 3ICYA 4E3NA 3JPUA 2H0YA 4RA7A 4WUJA 3LIEA 3FKVA 5AVFA 3VP4A 1W5DA 4JGQA 1PWGA 3UE0A 2A24A 4IEDA 4CLCD 1XGJA 1LHYA 2Y2JA 3Q7VB 5EVEA 2X01A 1TF1A 1LI0A 3ZNYA 3QNCA 1QMFA 1L3LA 5GHZA 4IUHA 2XEPA 3B33A 4GHIB 2WUQA 3LR5A 1Q2QA 1XFNA 2XRNA 1CEFA 4JKTA 3DWZA 3SS3A 5TJJA 3HLWA 1LL8A 3CJMA 5J4EA 4DJ2A 3LYXA 5K5BA 3KX0X 1TDGA 3HBRA 1FSYA 2W3HA 4Y5FA 2FZ0A 3HJIA 3TW8A 4L9FA 1VHMA 3H7WA 3G6OA 4JGRA 4FD8A 4LV2A 4RX3A 3E2LA 4DE2A 2UWXA 3PAEA 3KSHA 3IXDA 2XD1A 2Y79A 3P7NA 2Y4AA 4AFIA 3BM6A 1DJAA 3HL9A 2Q9NA 3L7HA 3N6IA 1YM1A 5IS1A 4WELA 3QP4A 5F82A 3IBRA 1K55A 3H82B 4MN7A 4ARZA 4X1LA 4DMZA 1FSWA 4PAUA 3HLBA 3VMAA 1KGFA 4Q0HA 3FC7A 5EE8A 2Y2IA 1DRMA 1MWTA 5HPIA 3BJNA 1XKZA 2QYBA 3A3FA 2V1AA 1MBLA 3OPHA 2W1TA 3Q81A 4R1GA 1Q2PA 3G30A 3CLOA 1KE4A 4GDNA 1V9ZA 2HP6A 1P9WA 2H10A 2J3TC 1K4EA 1IOUA 3NHQA 5D3OA 4PM8A 4RVAA 5FAOA 1Z09A 2PYPA 1EI5A 5HPFA 5DTKA 2V0WA 4LV1A 1NLYA 3LFVA 4H6JA 1PW1A 1N4OA 3AGEA 2LB5A 4LENA 2V2FF 3BFCA 1ERMA 3DTIA 1I2SA 3F1OB 3EGXC 3UE6A 3ITBA 1SKOA 1ACFA 5IHVA 3VOZA 2HDQA 3LY4A 5F69A 3IH9A 3HREA 2EWVA 1GA9A 4P0MA 4JBFA 1O7EA 3LGOA 4LCLA 2P74A 1Y4OA 1GA0A 4M3KA 3O3VA 4HIAA 3GR2A 2HJEA 3EGDC 4NK3A 4CLCE 5A91A 5HD3A 1NRFA 4D2OA 5I5LA 3BFDA 5KSHA 4HQAA 4LLOB 3CUEA 4JGOA 3LI9A 3L9KA 2ZM0A 1K56D 1WYCA 3IF6A 4E3OA 2IA2A 4WLAA 3T1QB 5DFYA 4GZBA 2WAFA 3DBAA 3OC2A 2E8JA 3ZG0A 5U47A 3IQAA 4L9EA 3NOTC 2M7UA 3UDIA 3B42A 2DMWA 2PT7A 5HDDA 3VV4A 3LR0A 1STZA 3UB5P 2ZBBA 3HUMA 3K3CA 1LSWA 2ZC6B 2D01A 4P85A 3A0SA 5E2HA 4KUKA 3E4QA 1N9LA 4X25A 4R23A 4N92A 4GS9A 4C3QA 5F1GA 3IWQA 3ZG7B 4II7A 5FI6A 5FQ9A 2VX8A 1N9OA 4H8RA 3BQ8A 2H28A 3WS2A 3RFBA 3BRMA 4DE3A 4HBTA 1WA9A 2Z6CA 4O01A 1PNEA 4JPMA 4PM5A 3LIDA 4KG5A 1H3QA 2PU4A 3T4SA 5J3WA 3CWFA 3FZCA 5FDHA 1TDLA 2JKTM 4GN2A 4CLCA 1SZVA 1SDNA 2DCFA 3V50A 4PKYG 1ZG4A 5FDSA 1D7EA 3OOVA 4I39A 3HLCA 1VQQA 3D9YA 5J8XA 2XLNA 2Y2OA 3VP1A 1UWNX 2V8FA 1G6AA 1JWVA 3N7WA 3NECA 2J8YA 3RH8B 3FWLA 4QJGA 4E04A 5HDCA 4Y7PA 4MN5A 1W8YA 2ZQ8A 4OQHA 4BJPA 2I9VA 4Y3IA 1ZTUA 1YLTA 4RX2A 2XD5A 3C7VA 3PBNA 3IF5A 2JKRI 1PFLA 4OONA 3OPRA 3CPTB 4FCFA 3ZYTA 5DTTA 5DTSA 1P97A 2HP5A 5TGFA 2CC1A 4U0XA 5GHYA 4PM7A 1BLPA 2PD7A 1QMEA 1YMSA 1HLUP 1YKDA 4BMWA 1NY0A 2Y2KA 1J3WA 5DJTA 5FATA 5GLBA 4CPKA 4PM6A 4EUVA 3FYZA 2ZC7A 3EEAA 5AQAA 5A93A 3PBSA 3ULFA 3Q7ZA 2P9VA 3ZG9B 5FEFA 2Y2QA 2ZLYA 2W3FA 2WKHA 5L2FA 1K6RA 3PTEA 1IKGA 2ZM8A 3C4PA 1KGGA 3ZCZA 3NCKA 4WYYA 2WZZA 4KUOA 1UGUA 5FA7A 2PAVP 1WYBA 3ZGAB 1VEUA 3F1PB 4A5RA 5J7EA 4CJNA 1BT5A 3GMWA 1GHMA 4I3AA 2OAQ1 3O87A 2GNXA 3DTMA 2L1MA 3HCYA 3MZFA 3MMHA 4IUKA 3M2KA 1AXBA 1XJ2A 4E3IA 5A92A 3M6BA 2EX9A 1S66L 1BZAA 5FI2A 4BBVA 1DY6A 5CHUA 5F6AA 2OLVA 1IFQA 3KSGA 4DXBA 4R3AA 2PDRA 2VGJA 4XXRA 2BTFP 2GZAA 5GLCA 4JF4A 4FSFA 3LCEA 3LUQA 1D06A 4JXWA 1BULA 2HGVA 2O99A 3LI8A 4BBTA 2OOLA 4O0PA 4N1HA 1K56A 3UMDA 1IEMA 3ZG5A 4EERA 3CAXA 1J9MA 2A24B 2HP9A 4R38A 3UDFA 3DAVA 3A0RA 2FFYA 4F94A 2O9CA 4N1XA 5EVIA 2PBDP 5CERA 3SS4A 3P09A 4Y0UA 5EOOA 4UA6A 5DFXA 3A0VA 4ZRRA 1JVJA 2JKGA 2K2NA 5EOEA 1PZOA 4NXFA 1ERQA 3IBJA 2NUPC 3QNBA 1FQGA 5KMWA 1DP8A 2XROA 3WWXA 3F1NA 3T4OA 1IKIA 3H7WB 2GDNA 4JF6A 3HLEA 5FQMA 3C5AA 2JE5A 3IS2A 2Y55A 4P6ZM 1XJ6A 2W3EA 1BUEA 2J3TD 1NXYA 1GSVA 3O88A 3NY4A 2OV5A 1H8ZA 3T1RA 4S2KA 3QP5A 1GSXA 4HP9A 3BECA 3UNWA 4X68A 1S1ZA 4IVIA 2XA7S 3V5MA 2WGVA 4R70A 2WK0A 3PHYA 2ZQCA 3UB9A 2CMNA 4MN6A 5F5YA 1PRQA 4S2MA 4X1MA 5AQBA 3QP1A 4ARZB 4NXGA 2ZQAA 1A0KA 1FOFA 3MQOA 5HFOA 3N8SA 5CGWA 2W3GA 2W1TB 4L0LA 4X6TA 5GL9A 3SH8A 3W8KA 2PRFA 1T19A 2ZJ9A 4OP5A 4WZ5C 3D4FA 5CHJA 4ETZA 1VETA 2ZQ9A 2ZC5B 4DKIA 4LRXC 4KZ3A 2XDMA 5M19A 3IHAA 4B4XA 1EW0A 4H6JB 1G5UA 3OLOA 5EV0A 2BASA 3C38A 1NYMA 4IJGA 2V0UA 3MBZA 2ZD8A 2O0YA 5F68A 1SKOB 1MWSA 5CGXA 1OPXA 1OJGA 4G3VA 1I5QA 4GJ4A 5JYPA 4Y0TA 1K6SA 3VE3A 2QZ6A 3BFFA 2EA9A 1LT0A 1ZKJA 4R3JA 4WN5A 4QPRA 4GB7A 3ZFZA 5CHMA 2G7UA 1YQSA 1NJ4A 5CEDA 1ES3A 4WMCD 5L09A 1FIKA 2KLIA 4HEFA 2K31A 3QP2A 2KX6A 3CG5A 3IF6B 2INWA 1U60A 1V9YA 5EUAA 1BLHA 5HWVA 2JN7A 1SKFA 5A90A 3GQZA 3R7WA 4EW7A 3FV7A 2HDUA 3IX4A 1S1YA 3MS6A 3PBRA 2IWDA 2KDKA 3HUNA 3ISGA 4WZ4A 1PWCA 1K38A 2P04A 4OPQA 1MKIA 5HAPA 4GS9B 1YLJA 3HVFA 1K25A 2XA7M 4IBRA 4Y17A 3KYQA 4KENB 3BY8A 2PU2A 1CEGA 4QB8A 1YMXA 3G2YA 3R4KA 1LSVA 4BL3A 1XX2A 1CJFA 1TS8A 3G4PA 1F9IA 5HW3A 1CQAA 4NXBA 3G32A 4EEPA 3MFDA 3MSHA 4EU0A 3QP8A 3O5YA 4DXCA 3D3OA 5FEGA 3T4TA 2R78A 3V3SA 4CLCB 4HOIA 2XR0A 5EECA 2Q0OA 4JGPA 2Y2LA 1RGYA 1NZOA 1SCWA 4I3JA 3E4OA 1ALQA 1G68A 1XFQA 2J9PA 4HP4A 2IWCA 5IT5A 1TS0A 4EWFA 3PBTA 4BBUA 3RTYA 1P9RA 3P01A 4OQGA 3B47A 4KZ5A 5G4ZA 2LB9A 5E43A 2ZQ7A 4WBGA 4QWOA 5AQ9A 1XJ4A 5E2GA 5HAQA 2XGNA 3IT9A 3VOLA 5FSRA 2EX6A 2O9BA 1ESUA 4GW9A 1YAXA 3GVBA 2EFXA 4K0WA 1ES4A 4F3LA 4GLQA 2R9XA 1KVLA 5GLDA 1PIOA 3HLGA 4KZBA 3MF0A 4Q0JA 4OLGA 1MPLA 2Y2PA 3MR0A 3S7PA 3NI9A 5EVID 4UHUA 1XA1A 1XXMA 2JC7A 3UPPA 4IVKA 2B18A 1PYYA 2Y91A 4X69A 5FQIA 1K57C 3Q82A 4HJ6A 5E2FA 4QHCA 3T50A 1E3UD 3JVVA 3C2WA 1OTDA 2P9VB 2PHYA 3LIAA 4PPRA 2W3DA 2WKEA 4KQRA 4BWIA 1N9BA 2VV7A 3IXGA 1CI9A 3EQUA 3JYIA
chains in the Genus database with same CATH topology
1JTGA 4ZJ2A 4A5RA 1PI4A 1L0FA 4S2NC 4CJNA 1BT5A 3GMWA 1GHMA 3QHYA 2WKIA 5F1FA 4R4SA 5FQKA 3O87A 3DTMA 1ES5A 4U0TA 3MZFA 3C4OA 4DE0A 3M2KA 1AXBA 5FQQA 5DF7A 1XA7A 4R3BA 3DWKA 4N9KA 4YINA 1LI9A 4C75A 4E3IA 2XK1A 3W4PA 4ID4A 2A3UA 2XFTA 2EX2A 2PBYA 4B4ZA 3M6BA 5A92A 1MY8A 2EX9A 1BZAA 5FI2A 4FH4A 3IWOA 3MXSA 1LL9A 3IXBA 5EVLA 1DJCA 1DY6A 2HDSA 1JWZA 2ZQDA 5CHUA 3IF6C 2OLVA 4ZAMA 4BL2A 3G34A 1JTDA 4GD6A 1GHPA 4QY5A 4S2LA 4DXBA 1E4DA 4PMAA 3CZDA 4E3NA 2VGJA 4XXRA 2H0YA 4RA7A 5GLCA 3FKVA 4FSFA 4JF4A 3LCEA 3VP4A 1W5DA 1ZC2A 1SHVA 3A3EA 3IHBA 4NETA 2J7VA 4JXWA 4R0QA 1BULA 3V39A 1PWGA 1VM1A 3Q7VA 3UE0A 1HTZA 4IEDA 4N1HA 1XGJA 5TFQA 1GCEA 2XH9A 1K56A 1LHYA 1IEMA 2Y2JA 3ZG5A 3Q7VB 4WMCA 1J9MA 2HP9A 2X01A 3UDFA 4ZBEA 1LI0A 2G2UA 2V1ZA 3ZNYA 3QNCA 1QMFA 4WM9A 5GHZA 4DF6A 2FFYA 4F94A 2I72A 3A3DA 2XEPA 4OQIA 4N1XA 5EVIA 4MNRA 1YLZA 3TOIA 1FCNA 5EPHA 5CERA 3WS5A 4EUZA 4KZ6A 2WUQA 1E25A 1GHIA 1Q2QA 3SS4A 3P09A 3OPPA 1CEFA 4Y0UA 2RCXA 4JKTA 5EVIB 5EOOA 3VP0A 4Z9QA 4UA6A 5CXWA 5AQ7A 1PI5A 3DWZA 3UN7A 4ZJ3A 3MKEA 3SS3A 3N8RA 3HLWA 1JVJA 4OPYA 3CJMA 1MWRA 4GNUA 1CK3A 5HX9A 1ES2A 1LL5A 4KZAA 1TDGA 3HBRA 1M40A 1FSYA 3GSGA 2Y2NA 5EOEA 1PZOA 3AGDA 1ERQA 3UE1A 3BLMA 3QNBA 4FD8A 1FQGA 5KMWA 1NZUA 4LV2A 3WWXA 4RX3A 3E2LA 1IKIA 4OH0A 4OP8A 4S2JA 3UDXA 4DE2A 2EXBA 2OLUA 2GDNA 2UWXA 4JF6A 2B5RA 2WYXA 3HLEA 3C5AA 3PAEA 5FQMA 5CTNA 2HDRA 2JE5A 3IXDA 2XD1A 2Y55A 2G2WA 1RCJA 4UA9A 2Y4AA 2V20A 2ZM2A 1YLYA 4DDYA 1BUEA 2DRWA 1NXYA 4X53A 3O88A 4PM9A 4DDSA 3NY4A 3BM6A 3G31A 3OCLA 1C3BA 1H8ZA 1DJAA 3HL9A 2OV5A 4S2KA 2Q9NA 3MZDA 1W8QA 4XUXA 2Z2LB 1EWZA 1MWUA 3N6IA 2EFUA 3BECA 1YM1A 3UNWA 4WELA 3VFFA 4X68A 2X71A 1YT4A 4IVIA 5CEBA 5F82A 5CGSA 1K54C 3V5MA 5KSCA 2WGVA 2WZXA 4UAAA 1K55A 2WK0A 3TSGA 2ZQCA 3HLDA 1FSWA 3Q07A 2QPNA 3HLBA 4S2MA 2XFSA 3VMAA 2WAEA 5AQBA 1KGFA 2ZMAA 3WS4A 5EE8A 1ONHA 2ZQAA 2WADA 4E3MA 3VSLA 4E3LA 2Y2IA 3GV9A 1TVFA 4Y0OA 1MWTA 1FR1A 1LLBA 1XKZA 1FOFA 5BOHA 4KQQA 1YLWA 3A3FA 1MBLA 2EX8A 1XP4A 3OPHA 5HFOA 1PWDA 3N8SA 5CGWA 3Q81A 4R1GA 3UPNA 1Q2PA 3G30A 1KE4A 4GDNA 4O7DA 1K57A 2IWBA 1S6RA 4K0XA 2HP6A 4FH2A 3NC8A 2ZC3B 4OOYA 4L0LA 4X6TA 2H10A 1K4EA 5GL9A 5D3OA 3SH8A 3W8KA 1BLCA 4PM8A 4JLFA 4RVAA 2ZJ9A 5FAOA 4OP5A 1W7FA 4WZ5C 3SOIA 3D4FA 2H5SA 3OPLA 3M6HA 3NIAA 1EI5A 2Z2MB 1I2WA 4HESA 5CHJA 4EBNA 1Y54A 2ZQ9A 5DTKA 4KG6A 5I94A 3VP3A 2WGWA 2ZC5B 4LV1A 2E8IA 4BD0A 4DKIA 1FCOA 4KZ3A 2XDMA 4KZ9A 4WEKA 3IHAA 5M19A 5CRFA 2C5WB 1PW1A 2BLSA 2QMIA 1N4OA 3AGEA 3ZVTA 4E6WA 2VGKA 2WGWB 4LENA 4B4XA 2V2FF 3BFCA 1ERMA 4KZ7A 5M1AA 2A49A 1I2SA 2OSUA 2Y2HA 2ZC4B 3BEBA 4KQOA 3UO9A 4OPZA 3P98A 3ITBA 4OOLA 3RXWA 1NYMA 5HAIA 1IYSA 5M18A 3VOYA 4S2IA 5IHVA 3MBZA 3VOZA 2ZD8A 2HDQA 3IH8A 3GRJA 4GD8A 1MWSA 5CGXA 3LY4A 3ZHHA 5FI7A 4MEZA 1I5QA 3IH9A 3HREA 1GA9A 1EROA 3I7JA 3JYIA 4P0MA 3ITAA 1BLSA 1O7EA 3PAGA 4JBFA 3S1YA 1KE3A 1L0DA 4EBPA 3BFGA 5JYPA 4Y0TA 4LCLA 2P74A 3HLFA 5GLAA 5CECA 1K6SA 3ZVWA 1GA0A 1HVBA 3G35A 2QZ6A 2Y59A 3O3VA 4KZ4A 1NYYA 1IYOA 3BFFA 3GR2A 3BYDA 4M3KA 4P6BA 4B88A 3BFEA 4ZJ1A 2C6WB 5FQJA 1ZKJA 4NK3A 3E2KA 4P87A 5A91A 4R3JA 5E2EA 1NRFA 4D2OA 3BFDA 5KSHA 4GB7A 3ZFZA 5CHMA 5CTMA 4IBXA 1YQSA 2WGIA 1NJ4A 3TG9A 5CEDA 2ZM0A 1K56D 1KDWA 1WYCA 4MBHA 3IF6A 1ES3A 4X55A 4WMCD 4E3OA 1E3UA 5F83A 3HUOA 4HEFA 4GZBA 2WAFA 3CG5A 3IF6B 3OC2A 1U60A 3VP2A 3ZG0A 5U47A 3IQAA 2FFFB 3UDIA 2J9OA 5EUAA 3VSKA 1BLHA 4JXGA 1BSGA 4ZDXA 5KZHA 1SKFA 5A90A 3GQZA 4WEJA 5DF8A 4N9LA 3FV7A 2HDUA 4GDBA 3UY6A 2Y2MA 3CMZA 4HBUA 3HUMA 1S0WA 4YFMA 2ZC6B 4MBFA 3PBRA 1RP5A 2IWDA 1L0EA 4P85A 3HUNA 5E2HA 3ISGA 5GHXA 4WZ4A 5TR7A 4Q8IA 1L0GA 3B3XA 1PWCA 4KG2A 1K38A 1FCMA 4R23A 3LEZA 4BQMA 4EQIA 4N92A 4C3QA 1H8YA 3VFHA 1K4FA 5F1GA 1MXOA 3EQVA 3IWQA 4LV3A 4OPQA 3ZG7B 3FKWA 1MKIA 4U3TA 4QY6A 5HAPA 5HARA 1YLJA 3HVFA 1K25A 3MKFA 4IBRA 3MXRA 5FI6A 4KENB 5FQ9A 4OVDA 4ZTKA 2PU2A 1CEGA 2R9WA 1YMXA 1WE4A 3G2YA 4QB8A 5FAQA 1XPBA 4H8RA 1BTLA 4UA7A 3WS2A 4X56A 1H5XA 2Y2GA 3M2JA 1O07A 3BRMA 4DE3A 4HBTA 3AGFA 3W4OA 4BL3A 4JF5A 1XX2A 4JPMA 4PM5A 3WS1A 4KG5A 1PZPA 2PU4A 1DJBA 3G4PA 2DNSA 5HW3A 4XUZA 5EVIC 3GTCA 1IELA 1XGIA 3FZCA 3G32A 3MFDA 5HL1A 4RYEA 4BD1A 5FDHA 1Z6FA 4DXCA 3ZG8B 1TDLA 3IWIA 1W79A 3V3RA 4GN2A 3A3JA 4QD4A 4JXVA 1KGEA 1FR6A 1SDNA 3WRTA 1KDSA 3V3SA 4OQ0A 2DCFA 3V50A 2XR0A 3MZEA 3PBOA 5EECA 1ZG4A 4MBKA 4EV4A 3NDEA 4OKPA 3UE3A 2Y2LA 1RGYA 3OCNA 2HPBA 1SCWA 1NZOA 3HLCA 4E3KA 4EBLA 1VQQA 1M6KA 3WRZA 1ALQA 1G68A 4KZ8A 2XLNA 5J8XA 2J9PA 1K54A 2IWCA 2Y2OA 3A3IA 3VP1A 1G6AA 1JWVA 3N7WA 4EWFA 3PBTA 2J8YA 3NDGA 3FWLA 3SH7A 4QJGA 4C6YA 2X02A 4Y7PA 4OQGA 4KZ5A 3DW0A 1W8YA 2ZQ8A 2XQZA 3RXXA 4S2PA 5E43A 2ZQ7A 1L2SA 4WBGA 5AQ9A 3C7UA 5E2GA 4OQHA 4BJPA 3IXHA 5HAQA 3N8LA 2XF3A 1IYQA 1RGZA 2XGNA 4BENA 1YLTA 3IT9A 4RX2A 2XD5A 3WS0A 3SS5A 3C7VA 3PBNA 3IF5A 5FSRA 3ZNTA 1HZOA 3RJUA 3S4XA 4OONA 2EX6A 1ESUA 3OPRA 3GVBA 1YLPA 4E6XA 4FCFA 4OPRA 5FASA 1K55C 2EFXA 4K0WA 1ES4A 3Q1FA 5DTTA 5DTSA 2HP5A 2JCHA 5G18A 4DRTA 5TGFA 5JYOA 2CC1A 5FAPA 1SDEA 2BG1A 3PBQA 2R9XA 1KVLA 4U0XA 1PIOA 3HLGA 4WZ5A 4PM7A 5GHYA 4KZBA 5GLDA 3SH9A 1PW8A 3ZDJA 4OLDA 4OLGA 1BLPA 1MPLA 3BLSA 2Y2PA 3NI9A 1QMEA 1YMSA 2Q9MA 4GOGA 5EVID 4DE1A 1TEMA 4UHUA 1JWPA 4BLMA 1XA1A 3OZHA 2EXAA 1XXMA 2JC7A 3NBLA 3UPPA 2JBFA 1NY0A 3LO7A 2Y2KA 1ESIA 4IVKA 4LCMA 3W4QA 5FATA 3LY3A 1PYYA 2Y91A 4X69A 4E3JA 5FQIA 5GLBA 4CPKA 1K57C 1ONGA 3O86A 4PM6A 3FYZA 1CI8A 2RL3A 3Q82A 2ZC7A 5E2FA 5AQAA 4JXSA 1KE0A 1OMEA 4LV0A 3PBSA 4QHCA 5A93A 3Q7ZA 4S2OA 5DVAA 1E3UD 2P9VA 4GKUA 4OOMA 3G2ZA 3UPOA 1HD8A 3ZG9B 2P9VB 2Y2QA 4S2NA 2ZLYA 4PPRA 5DF9A 2WKHA 2WKEA 3S22A 4K91A 3N4IA 4QU3A 4KQRA 5L2FA 4R4RA 1K6RA 3PTEA 1IKGA 2ZM8A 1N9BA 1IYPA 1KGGA 2H0TA 3C4PA 3NCKA 4WYYA 3ZCZA 2WZZA 3IXGA 1CI9A 1ZG6A 4MLLA 3EQUA 5FA7A 1KVMA 1WYBA 3ZGAB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JTG A;  4ZJ2 A;  4A5R A;  1PI4 A;  1L0F A;  4S2N C;  4CJN A;  1BT5 A;  3GMW A;  1GHM A;  3QHY A;  2WKI A;  5F1F A;  4R4S A;  5FQK A;  3O87 A;  3DTM A;  1ES5 A;  4U0T A;  3MZF A;  3C4O A;  4DE0 A;  3M2K A;  1AXB A;  5FQQ A;  5DF7 A;  1XA7 A;  4R3B A;  3DWK A;  4N9K A;  4YIN A;  1LI9 A;  4C75 A;  4E3I A;  2XK1 A;  3W4P A;  4ID4 A;  2A3U A;  2XFT A;  2EX2 A;  2PBY A;  4B4Z A;  3M6B A;  5A92 A;  1MY8 A;  2EX9 A;  1BZA A;  5FI2 A;  4FH4 A;  3IWO A;  3MXS A;  1LL9 A;  3IXB A;  5EVL A;  1DJC A;  1DY6 A;  2HDS A;  1JWZ A;  2ZQD A;  5CHU A;  3IF6 C;  2OLV A;  4ZAM A;  4BL2 A;  3G34 A;  1JTD A;  4GD6 A;  1GHP A;  4QY5 A;  4S2L A;  4DXB A;  1E4D A;  4PMA A;  3CZD A;  4E3N A;  2VGJ A;  4XXR A;  2H0Y A;  4RA7 A;  5GLC A;  3FKV A;  4FSF A;  4JF4 A;  3LCE A;  3VP4 A;  1W5D A;  1ZC2 A;  1SHV A;  3A3E A;  3IHB A;  4NET A;  2J7V A;  4JXW A;  4R0Q A;  1BUL A;  3V39 A;  1PWG A;  1VM1 A;  3Q7V A;  3UE0 A;  1HTZ A;  4IED A;  4N1H A;  1XGJ A;  5TFQ A;  1GCE A;  2XH9 A;  1K56 A;  1LHY A;  1IEM A;  2Y2J A;  3ZG5 A;  3Q7V B;  4WMC A;  1J9M A;  2HP9 A;  2X01 A;  3UDF A;  4ZBE A;  1LI0 A;  2G2U A;  2V1Z A;  3ZNY A;  3QNC A;  1QMF A;  4WM9 A;  5GHZ A;  4DF6 A;  2FFY A;  4F94 A;  2I72 A;  3A3D A;  2XEP A;  4OQI A;  4N1X A;  5EVI A;  4MNR A;  1YLZ A;  3TOI A;  1FCN A;  5EPH A;  5CER A;  3WS5 A;  4EUZ A;  4KZ6 A;  2WUQ A;  1E25 A;  1GHI A;  1Q2Q A;  3SS4 A;  3P09 A;  3OPP A;  1CEF A;  4Y0U A;  2RCX A;  4JKT A;  5EVI B;  5EOO A;  3VP0 A;  4Z9Q A;  4UA6 A;  5CXW A;  5AQ7 A;  1PI5 A;  3DWZ A;  3UN7 A;  4ZJ3 A;  3MKE A;  3SS3 A;  3N8R A;  3HLW A;  1JVJ A;  4OPY A;  3CJM A;  1MWR A;  4GNU A;  1CK3 A;  5HX9 A;  1ES2 A;  1LL5 A;  4KZA A;  1TDG A;  3HBR A;  1M40 A;  1FSY A;  3GSG A;  2Y2N A;  5EOE A;  1PZO A;  3AGD A;  1ERQ A;  3UE1 A;  3BLM A;  3QNB A;  4FD8 A;  1FQG A;  5KMW A;  1NZU A;  4LV2 A;  3WWX A;  4RX3 A;  3E2L A;  1IKI A;  4OH0 A;  4OP8 A;  4S2J A;  3UDX A;  4DE2 A;  2EXB A;  2OLU A;  2GDN A;  2UWX A;  4JF6 A;  2B5R A;  2WYX A;  3HLE A;  3C5A A;  3PAE A;  5FQM A;  5CTN A;  2HDR A;  2JE5 A;  3IXD A;  2XD1 A;  2Y55 A;  2G2W A;  1RCJ A;  4UA9 A;  2Y4A A;  2V20 A;  2ZM2 A;  1YLY A;  4DDY A;  1BUE A;  2DRW A;  1NXY A;  4X53 A;  3O88 A;  4PM9 A;  4DDS A;  3NY4 A;  3BM6 A;  3G31 A;  3OCL A;  1C3B A;  1H8Z A;  1DJA A;  3HL9 A;  2OV5 A;  4S2K A;  2Q9N A;  3MZD A;  1W8Q A;  4XUX A;  2Z2L B;  1EWZ A;  1MWU A;  3N6I A;  2EFU A;  3BEC A;  1YM1 A;  3UNW A;  4WEL A;  3VFF A;  4X68 A;  2X71 A;  1YT4 A;  4IVI A;  5CEB A;  5F82 A;  5CGS A;  1K54 C;  3V5M A;  5KSC A;  2WGV A;  2WZX A;  4UAA A;  1K55 A;  2WK0 A;  3TSG A;  2ZQC A;  3HLD A;  1FSW A;  3Q07 A;  2QPN A;  3HLB A;  4S2M A;  2XFS A;  3VMA A;  2WAE A;  5AQB A;  1KGF A;  2ZMA A;  3WS4 A;  5EE8 A;  1ONH A;  2ZQA A;  2WAD A;  4E3M A;  3VSL A;  4E3L A;  2Y2I A;  3GV9 A;  1TVF A;  4Y0O A;  1MWT A;  1FR1 A;  1LLB A;  1XKZ A;  1FOF A;  5BOH A;  4KQQ A;  1YLW A;  3A3F A;  1MBL A;  2EX8 A;  1XP4 A;  3OPH A;  5HFO A;  1PWD A;  3N8S A;  5CGW A;  3Q81 A;  4R1G A;  3UPN A;  1Q2P A;  3G30 A;  1KE4 A;  4GDN A;  4O7D A;  1K57 A;  2IWB A;  1S6R A;  4K0X A;  2HP6 A;  4FH2 A;  3NC8 A;  2ZC3 B;  4OOY A;  4L0L A;  4X6T A;  2H10 A;  1K4E A;  5GL9 A;  5D3O A;  3SH8 A;  3W8K A;  1BLC A;  4PM8 A;  4JLF A;  4RVA A;  2ZJ9 A;  5FAO A;  4OP5 A;  1W7F A;  4WZ5 C;  3SOI A;  3D4F A;  2H5S A;  3OPL A;  3M6H A;  3NIA A;  1EI5 A;  2Z2M B;  1I2W A;  4HES A;  5CHJ A;  4EBN A;  1Y54 A;  2ZQ9 A;  5DTK A;  4KG6 A;  5I94 A;  3VP3 A;  2WGW A;  2ZC5 B;  4LV1 A;  2E8I A;  4BD0 A;  4DKI A;  1FCO A;  4KZ3 A;  2XDM A;  4KZ9 A;  4WEK A;  3IHA A;  5M19 A;  5CRF A;  2C5W B;  1PW1 A;  2BLS A;  2QMI A;  1N4O A;  3AGE A;  3ZVT A;  4E6W A;  2VGK A;  2WGW B;  4LEN A;  4B4X A;  2V2F F;  3BFC A;  1ERM A;  4KZ7 A;  5M1A A;  2A49 A;  1I2S A;  2OSU A;  2Y2H A;  2ZC4 B;  3BEB A;  4KQO A;  3UO9 A;  4OPZ A;  3P98 A;  3ITB A;  4OOL A;  3RXW A;  1NYM A;  5HAI A;  1IYS A;  5M18 A;  3VOY A;  4S2I A;  5IHV A;  3MBZ A;  3VOZ A;  2ZD8 A;  2HDQ A;  3IH8 A;  3GRJ A;  4GD8 A;  1MWS A;  5CGX A;  3LY4 A;  3ZHH A;  5FI7 A;  4MEZ A;  1I5Q A;  3IH9 A;  3HRE A;  1GA9 A;  1ERO A;  3I7J A;  3JYI A;  4P0M A;  3ITA A;  1BLS A;  1O7E A;  3PAG A;  4JBF A;  3S1Y A;  1KE3 A;  1L0D A;  4EBP A;  3BFG A;  5JYP A;  4Y0T A;  4LCL A;  2P74 A;  3HLF A;  5GLA A;  5CEC A;  1K6S A;  3ZVW A;  1GA0 A;  1HVB A;  3G35 A;  2QZ6 A;  2Y59 A;  3O3V A;  4KZ4 A;  1NYY A;  1IYO A;  3BFF A;  3GR2 A;  3BYD A;  4M3K A;  4P6B A;  4B88 A;  3BFE A;  4ZJ1 A;  2C6W B;  5FQJ A;  1ZKJ A;  4NK3 A;  3E2K A;  4P87 A;  5A91 A;  4R3J A;  5E2E A;  1NRF A;  4D2O A;  3BFD A;  5KSH A;  4GB7 A;  3ZFZ A;  5CHM A;  5CTM A;  4IBX A;  1YQS A;  2WGI A;  1NJ4 A;  3TG9 A;  5CED A;  2ZM0 A;  1K56 D;  1KDW A;  1WYC A;  4MBH A;  3IF6 A;  1ES3 A;  4X55 A;  4WMC D;  4E3O A;  1E3U A;  5F83 A;  3HUO A;  4HEF A;  4GZB A;  2WAF A;  3CG5 A;  3IF6 B;  3OC2 A;  1U60 A;  3VP2 A;  3ZG0 A;  5U47 A;  3IQA A;  2FFF B;  3UDI A;  2J9O A;  5EUA A;  3VSK A;  1BLH A;  4JXG A;  1BSG A;  4ZDX A;  5KZH A;  1SKF A;  5A90 A;  3GQZ A;  4WEJ A;  5DF8 A;  4N9L A;  3FV7 A;  2HDU A;  4GDB A;  3UY6 A;  2Y2M A;  3CMZ A;  4HBU A;  3HUM A;  1S0W A;  4YFM A;  2ZC6 B;  4MBF A;  3PBR A;  1RP5 A;  2IWD A;  1L0E A;  4P85 A;  3HUN A;  5E2H A;  3ISG A;  5GHX A;  4WZ4 A;  5TR7 A;  4Q8I A;  1L0G A;  3B3X A;  1PWC A;  4KG2 A;  1K38 A;  1FCM A;  4R23 A;  3LEZ A;  4BQM A;  4EQI A;  4N92 A;  4C3Q A;  1H8Y A;  3VFH A;  1K4F A;  5F1G A;  1MXO A;  3EQV A;  3IWQ A;  4LV3 A;  4OPQ A;  3ZG7 B;  3FKW A;  1MKI A;  4U3T A;  4QY6 A;  5HAP A;  5HAR A;  1YLJ A;  3HVF A;  1K25 A;  3MKF A;  4IBR A;  3MXR A;  5FI6 A;  4KEN B;  5FQ9 A;  4OVD A;  4ZTK A;  2PU2 A;  1CEG A;  2R9W A;  1YMX A;  1WE4 A;  3G2Y A;  4QB8 A;  5FAQ A;  1XPB A;  4H8R A;  1BTL A;  4UA7 A;  3WS2 A;  4X56 A;  1H5X A;  2Y2G A;  3M2J A;  1O07 A;  3BRM A;  4DE3 A;  4HBT A;  3AGF A;  3W4O A;  4BL3 A;  4JF5 A;  1XX2 A;  4JPM A;  4PM5 A;  3WS1 A;  4KG5 A;  1PZP A;  2PU4 A;  1DJB A;  3G4P A;  2DNS A;  5HW3 A;  4XUZ A;  5EVI C;  3GTC A;  1IEL A;  1XGI A;  3FZC A;  3G32 A;  3MFD A;  5HL1 A;  4RYE A;  4BD1 A;  5FDH A;  1Z6F A;  4DXC A;  3ZG8 B;  1TDL A;  3IWI A;  1W79 A;  3V3R A;  4GN2 A;  3A3J A;  4QD4 A;  4JXV A;  1KGE A;  1FR6 A;  1SDN A;  3WRT A;  1KDS A;  3V3S A;  4OQ0 A;  2DCF A;  3V50 A;  2XR0 A;  3MZE A;  3PBO A;  5EEC A;  1ZG4 A;  4MBK A;  4EV4 A;  3NDE A;  4OKP A;  3UE3 A;  2Y2L A;  1RGY A;  3OCN A;  2HPB A;  1SCW A;  1NZO A;  3HLC A;  4E3K A;  4EBL A;  1VQQ A;  1M6K A;  3WRZ A;  1ALQ A;  1G68 A;  4KZ8 A;  2XLN A;  5J8X A;  2J9P A;  1K54 A;  2IWC A;  2Y2O A;  3A3I A;  3VP1 A;  1G6A A;  1JWV A;  3N7W A;  4EWF A;  3PBT A;  2J8Y A;  3NDG A;  3FWL A;  3SH7 A;  4QJG A;  4C6Y A;  2X02 A;  4Y7P A;  4OQG A;  4KZ5 A;  3DW0 A;  1W8Y A;  2ZQ8 A;  2XQZ A;  3RXX A;  4S2P A;  5E43 A;  2ZQ7 A;  1L2S A;  4WBG A;  5AQ9 A;  3C7U A;  5E2G A;  4OQH A;  4BJP A;  3IXH A;  5HAQ A;  3N8L A;  2XF3 A;  1IYQ A;  1RGZ A;  2XGN A;  4BEN A;  1YLT A;  3IT9 A;  4RX2 A;  2XD5 A;  3WS0 A;  3SS5 A;  3C7V A;  3PBN A;  3IF5 A;  5FSR A;  3ZNT A;  1HZO A;  3RJU A;  3S4X A;  4OON A;  2EX6 A;  1ESU A;  3OPR A;  3GVB A;  1YLP A;  4E6X A;  4FCF A;  4OPR A;  5FAS A;  1K55 C;  2EFX A;  4K0W A;  1ES4 A;  3Q1F A;  5DTT A;  5DTS A;  2HP5 A;  2JCH A;  5G18 A;  4DRT A;  5TGF A;  5JYO A;  2CC1 A;  5FAP A;  1SDE A;  2BG1 A;  3PBQ A;  2R9X A;  1KVL A;  4U0X A;  1PIO A;  3HLG A;  4WZ5 A;  4PM7 A;  5GHY A;  4KZB A;  5GLD A;  3SH9 A;  1PW8 A;  3ZDJ A;  4OLD A;  4OLG A;  1BLP A;  1MPL A;  3BLS A;  2Y2P A;  3NI9 A;  1QME A;  1YMS A;  2Q9M A;  4GOG A;  5EVI D;  4DE1 A;  1TEM A;  4UHU A;  1JWP A;  4BLM A;  1XA1 A;  3OZH A;  2EXA A;  1XXM A;  2JC7 A;  3NBL A;  3UPP A;  2JBF A;  1NY0 A;  3LO7 A;  2Y2K A;  1ESI A;  4IVK A;  4LCM A;  3W4Q A;  5FAT A;  3LY3 A;  1PYY A;  2Y91 A;  4X69 A;  4E3J A;  5FQI A;  5GLB A;  4CPK A;  1K57 C;  1ONG A;  3O86 A;  4PM6 A;  3FYZ A;  1CI8 A;  2RL3 A;  3Q82 A;  2ZC7 A;  5E2F A;  5AQA A;  4JXS A;  1KE0 A;  1OME A;  4LV0 A;  3PBS A;  4QHC A;  5A93 A;  3Q7Z A;  4S2O A;  5DVA A;  1E3U D;  2P9V A;  4GKU A;  4OOM A;  3G2Z A;  3UPO A;  1HD8 A;  3ZG9 B;  2P9V B;  2Y2Q A;  4S2N A;  2ZLY A;  4PPR A;  5DF9 A;  2WKH A;  2WKE A;  3S22 A;  4K91 A;  3N4I A;  4QU3 A;  4KQR A;  5L2F A;  4R4R A;  1K6R A;  3PTE A;  1IKG A;  2ZM8 A;  1N9B A;  1IYP A;  1KGG A;  2H0T A;  3C4P A;  3NCK A;  4WYY A;  3ZCZ A;  2WZZ A;  3IXG A;  1CI9 A;  1ZG6 A;  4MLL A;  3EQU A;  5FA7 A;  1KVM A;  1WYB A;  3ZGA B; 
#chains in the Genus database with same CATH topology
 1PI4 A;  1L0F A;  5F1F A;  1ES5 A;  1VEU B;  4HNB A;  4DE0 A;  2VK3 A;  4M4X A;  3T4L A;  1H0M A;  1XA7 A;  4R3B A;  4N9K A;  1T1B A;  2XSS A;  1JNU A;  2XFT A;  1F98 A;  2PBY A;  4B4Z A;  3IWO A;  3MXS A;  2QHK A;  1DJC A;  1UWP X;  2HJ9 C;  2K7S A;  3KSI A;  4ZAM A;  4HY8 A;  4S2L A;  4KQD A;  4PMA A;  3CZD A;  1ZC2 A;  4NET A;  3KYZ A;  1DP6 A;  2J7V A;  4R0Q A;  3V39 A;  1VM1 A;  1HTZ A;  1GCE A;  2XH9 A;  1YSQ A;  4WMC A;  4EET B;  4ZBE A;  2G2U A;  2V1Z A;  4DF6 A;  2I72 A;  3A3D A;  1TD5 A;  4PKY A;  1FCN A;  3WS5 A;  4EUZ A;  4KZ6 A;  1E25 A;  3OPP A;  5EVI B;  4B9O A;  2M7V A;  5CXW A;  5AQ7 A;  1LSX A;  5MC7 A;  4GNU A;  1CK3 A;  4MCW A;  1ES2 A;  4KZA A;  4R6L A;  5C5K A;  1M40 A;  3GSG A;  3UE1 A;  1S67 L;  2W1R A;  3V67 A;  1NZU A;  4UQI S;  1X0O A;  3PR6 A;  4OH0 A;  4OP8 A;  3UDX A;  2OLU A;  2WYX A;  3F1N B;  5CTN A;  2G2W A;  2V20 A;  3U4L P;  4X53 A;  3IS2 B;  4PM9 A;  5DJU A;  3G31 A;  3OCL A;  5TBM A;  4LFU A;  3MZD A;  3NOP C;  2Z2L B;  1EWZ A;  2MJ6 A;  4L9G A;  3VFF A;  2X71 A;  2QJ5 A;  1YT4 A;  3NOU C;  2VLG A;  5CEB A;  1K54 C;  5KSC A;  2WZX A;  4UAA A;  5HDS A;  2QJ7 A;  2ZOH A;  4LRZ E;  1T1C A;  2ZMA A;  3WS4 A;  4CQH A;  2JKT I;  4PHT A;  4E3M A;  3VSL A;  4E3L A;  3GV9 A;  4YWZ A;  3UB6 A;  5BOH A;  3SZT A;  1KVM A;  2EX8 A;  1XP4 A;  3KSF A;  1PWD A;  3UPN A;  4Z1W A;  1S6R A;  4FH2 A;  3NC8 A;  2ZC3 B;  3PXP A;  1BLC A;  2PYR A;  4JLF A;  1F5M A;  3SOI A;  1W7F A;  2J3W A;  2H5S A;  3OPL A;  1I2W A;  3LIC A;  4HES A;  4KG6 A;  3CHW P;  2WGW A;  3VP3 A;  2E8I A;  4KZ9 A;  5CRF A;  1VET B;  4Y13 A;  4E6W A;  3UB7 A;  2VGK A;  2OWH A;  4YOF A;  3T4Q A;  5M1A A;  2A49 A;  2V9A A;  2Y2H A;  4KQO A;  3UO9 A;  3P98 A;  4OOL A;  3RXW A;  2VKS A;  5G4Y A;  3VOY A;  4S2I A;  2QWS A;  1W63 M;  3IH8 A;  3GRJ A;  5FI7 A;  4MEZ A;  3QP6 A;  1ERO A;  3I7J A;  2Z6D A;  4XT2 A;  4EBP A;  1KE3 A;  1L0D A;  3BFG A;  5CEC A;  4S2N C;  4KZ4 A;  1NYY A;  2C6W B;  4Y15 A;  4P87 A;  4FUW A;  5E2E A;  1NWZ A;  3TG9 A;  4X55 A;  1GSW A;  4MBH A;  1E3U A;  1OT9 A;  3HUO A;  1P0Z A;  3VP2 A;  4HH2 A;  5EM1 A;  5A8B A;  4JXG A;  4UQI M;  1BSG A;  5KZH A;  4WEJ A;  5DF8 A;  3UY6 A;  3CMZ A;  4HBU A;  1S0W A;  3R7W B;  1RP5 A;  1L0E A;  5GHX A;  5TR7 A;  4Q8I A;  4KG2 A;  1FCM A;  3LEZ A;  1YSP A;  3C8C A;  4HJ3 A;  2VV8 A;  1K4F A;  1MXO A;  2J80 A;  3EQV A;  4LV3 A;  4U3T A;  3MKF A;  4I3I A;  4ZTK A;  5FAQ A;  1WE4 A;  2GX5 A;  4HJ4 A;  1XPB A;  2HV1 A;  1BTL A;  4UA7 A;  1H5X A;  3M2J A;  1O07 A;  3OBF A;  3W4O A;  1NLZ A;  4Y2F A;  3WS1 A;  1PZP A;  2DNS A;  4XUZ A;  3GTC A;  1IEL A;  1XGI A;  4RYE A;  3DTE A;  1Z6F A;  3ZG8 B;  5L8M A;  4FOF A;  3V3R A;  4JXV A;  1FR6 A;  1KDS A;  2B95 A;  3PBO A;  1H8M A;  3NDE A;  4OKP A;  2HPB A;  4E3K A;  2WKP A;  3WRZ A;  4EXO A;  4KZ8 A;  3FG8 A;  4UEY A;  1OTB A;  3MJQ A;  3NDG A;  3SH7 A;  2X02 A;  3KYE A;  3BY9 A;  3DW0 A;  2UV0 E;  2XQZ A;  4S2P A;  2OAP 1;  1CF0 A;  3C7U A;  3N8L A;  1IYQ A;  3CIT A;  1T18 A;  3WS0 A;  3SS5 A;  2Y8H A;  5CX7 A;  3KO6 A;  1KOU A;  1YLP A;  1K55 C;  2JCH A;  4DRT A;  5JYO A;  1SDE A;  4F3L B;  4WZ5 A;  1PW8 A;  3ZDJ A;  3BLS A;  4GOG A;  1TEM A;  4BLM A;  2EXA A;  2JBF A;  2VEA A;  4LCM A;  1OTA A;  1MKM A;  3O86 A;  4K08 A;  4JXS A;  1KE0 A;  1OME A;  4LV0 A;  1N9N A;  5DVA A;  2PD8 A;  1HD8 A;  1T1A A;  4MDZ A;  3T4J A;  4HI4 A;  5DF9 A;  3S22 A;  4K91 A;  3N4I A;  2ZMV A;  2QKP A;  4R4R A;  4Q0I A;  3MQQ A;  1ZG6 A;  4MLL A;  1JTG A;  4ZJ2 A;  3QHY A;  3FPV A;  3H9W A;  4R4S A;  5FQK A;  4U0T A;  2JKF A;  2ZL1 A;  3C4O A;  2OWJ A;  2HZ5 A;  5FQQ A;  4YIN A;  4DN0 A;  1LI9 A;  4C75 A;  2XK1 A;  4ID4 A;  4I38 A;  1MY8 A;  5AJG A;  3CUE C;  3IF6 C;  3GEC A;  3LR3 A;  1OTI A;  1GHP A;  2HF6 A;  3E4P A;  5HWT A;  3BQA A;  2PR6 A;  3A3E A;  1SHV A;  3IHB A;  4GCZ A;  4G3W A;  3Q7V A;  2VV6 A;  5TFQ A;  3S7Q A;  4FTX A;  4GHI A;  4WM9 A;  5L07 A;  2VJW A;  4OQI A;  2P7J A;  3CI6 A;  4MNR A;  1YLZ A;  3TOI A;  5EPH A;  1GHI A;  1D1J A;  1Y28 A;  2RCX A;  1XJ3 A;  3VP0 A;  4Z9Q A;  2AVX A;  1PI5 A;  3UN7 A;  4ZJ3 A;  3MKE A;  3N8R A;  4OPY A;  1MWR A;  3E98 A;  5HX9 A;  1BYW A;  1LL5 A;  2Y2N A;  3AGD A;  3BLM A;  1TS6 A;  2JKR M;  3UB8 A;  5HSQ A;  4S2J A;  2EXB A;  3TJZ C;  3DTK A;  2B5R A;  2L0W A;  2HDR A;  3BW6 A;  1RCJ A;  4UA9 A;  4YNR A;  4MMN A;  5L10 A;  2ZM2 A;  4CLC C;  1YLY A;  4HHD A;  2JHE A;  4DDY A;  2DRW A;  4DDS A;  1C3B A;  1W8Q A;  4XUX A;  1MWU A;  2EFU A;  3ZQ5 A;  5EM0 A;  5TBM B;  3H82 A;  5CGS A;  4G3K A;  3TSG A;  3HLD A;  3C30 A;  1K0K A;  3Q07 A;  2QPN A;  2XFS A;  2WAE A;  3HJK A;  1ONH A;  3MFX A;  2WAD A;  1VB6 A;  1TVF A;  3MXQ A;  4Y0O A;  1FR1 A;  1LLB A;  4KQQ A;  1YLW A;  4NKP A;  4B93 A;  4O7D A;  1K57 A;  2IWB A;  4K0X A;  4OOY A;  4LGW A;  4LRY C;  3M6H A;  3NIA A;  2Z2M B;  2VGL S;  4EBN A;  1Y54 A;  5I94 A;  3K2N A;  4BD0 A;  1FCO A;  4WEK A;  2D02 A;  2C5W B;  2BLS A;  2QMI A;  5HWW A;  3EWK A;  3ZVT A;  2WGW B;  3F1O A;  1OTE A;  5LBR A;  2WKQ A;  4KZ7 A;  2OSU A;  2ZC4 B;  3BEB A;  4OPZ A;  5HAI A;  1IYS A;  2W27 A;  5M18 A;  2NUT C;  1OT6 A;  5HD5 A;  2EWW A;  4GD8 A;  2V8C A;  3ZHH A;  3ITA A;  1BLS A;  3PAG A;  3S1Y A;  3HLF A;  5GLA A;  2WKR A;  3ZVW A;  1HVB A;  3G35 A;  2Y59 A;  4P6B A;  1IYO A;  4XT2 B;  4B88 A;  3BYD A;  3BFE A;  4ZJ1 A;  5FQJ A;  3E2K A;  3VE4 A;  1ODV A;  5CTM A;  4IBX A;  2WGI A;  2VA0 A;  1KDW A;  4IHQ A;  2V1B A;  5F83 A;  2GJ3 A;  3W2Z A;  2YKF A;  2FFF B;  2J9O A;  3VSK A;  1YPR A;  2PR5 A;  4ZDX A;  4N9L A;  4GDB A;  2Y2M A;  4YFM A;  4P6Z S;  4ESP A;  4MBF A;  2L4R A;  4NXE A;  1L0G A;  3B3X A;  3TRC A;  4EQ1 A;  4BQM A;  4EQI A;  1H8Y A;  3VFH A;  3FKW A;  4QY6 A;  5HAR A;  3K3D A;  3MXR A;  4OVD A;  2R9W A;  3T12 B;  4ME4 A;  4X56 A;  2Y2G A;  3TE8 A;  3NJA A;  3AGF A;  4JF5 A;  4I5S A;  1OJ5 A;  1DJB A;  3T1X A;  1S4S A;  5EVI C;  4O8G A;  2YKH A;  5HL1 A;  2M1C A;  4BD1 A;  3IWI A;  1W79 A;  3IX3 A;  3A3J A;  4QD4 A;  1KGE A;  3WRT A;  4OQ0 A;  3MZE A;  4MBK A;  4EV4 A;  3UE3 A;  3OCN A;  1DP9 A;  4EBL A;  2A2L A;  1M6K A;  4NEE D;  2VGL M;  1K54 A;  3A3I A;  4C6Y A;  5IU1 A;  5FL3 A;  3RXX A;  3BWL A;  1L2S A;  3IXH A;  2XF3 A;  5HL6 A;  1RGZ A;  5KIZ A;  4BEN A;  2VZW A;  4WL9 A;  3E0Y A;  3D72 A;  3CPT A;  1NRJ A;  3ZNT A;  1HZO A;  3RJU A;  3S4X A;  1W63 Q;  1TS7 A;  1AWI A;  4E6X A;  4OPR A;  5FAS A;  3GDI A;  3Q1F A;  4NG2 A;  1MC0 A;  5G18 A;  1G6O A;  4WF0 A;  5FAP A;  2BG1 A;  3PBQ A;  4EES A;  3SH9 A;  3LIB A;  5HZH A;  1S4R A;  2KOI A;  3EEH A;  4OLD A;  2Q9M A;  4DE1 A;  5DKL A;  1JWP A;  3IX8 A;  3OZH A;  3NBL A;  1MZU A;  3LO7 A;  3LIF A;  3NUL A;  4DJ3 A;  4D60 A;  1ESI A;  4ETX A;  3W4Q A;  3LY3 A;  4E3J A;  1ONG A;  1CI8 A;  2RL3 A;  2B02 A;  3MQ0 A;  5EFW A;  4S2O A;  3T1S A;  2FH5 A;  3S7O A;  4HH3 A;  2ZMF A;  4GKU A;  1G28 A;  3LR4 A;  4OOM A;  3G2Z A;  3UPO A;  4S2N A;  3S7N A;  3LEQ A;  3UME A;  2P08 A;  4QU3 A;  1F2K A;  5DKK A;  1IYP A;  2H0T A;  4EEU A;  3F1P A;  3JVU A;  2ZOI A;  3T4K A;  5AVE A;  2WKI A;  1FIL A;  3EOI A;  4LPZ A;  4RQ9 A;  3U2A A;  5DF7 A;  3DWK A;  2ZL1 B;  2ACG A;  3W4P A;  2A3U A;  2EX2 A;  3PYP A;  3FPW A;  1ZHH B;  4FH4 A;  1LL9 A;  3IXB A;  5EVL A;  2O9A A;  2HDS A;  1JWZ A;  2ZQD A;  4BL2 A;  2W0N A;  3G34 A;  3SW1 A;  1JTD A;  4GD6 A;  4QY5 A;  1E4D A;  3ICY A;  4E3N A;  3JPU A;  2H0Y A;  4RA7 A;  4WUJ A;  3LIE A;  3FKV A;  5AVF A;  3VP4 A;  1W5D A;  4JGQ A;  1PWG A;  3UE0 A;  2A24 A;  4IED A;  4CLC D;  1XGJ A;  1LHY A;  2Y2J A;  3Q7V B;  5EVE A;  2X01 A;  1TF1 A;  1LI0 A;  3ZNY A;  3QNC A;  1QMF A;  1L3L A;  5GHZ A;  4IUH A;  2XEP A;  3B33 A;  4GHI B;  2WUQ A;  3LR5 A;  1Q2Q A;  1XFN A;  2XRN A;  1CEF A;  4JKT A;  3DWZ A;  3SS3 A;  5TJJ A;  3HLW A;  1LL8 A;  3CJM A;  5J4E A;  4DJ2 A;  3LYX A;  5K5B A;  3KX0 X;  1TDG A;  3HBR A;  1FSY A;  2W3H A;  4Y5F A;  2FZ0 A;  3HJI A;  3TW8 A;  4L9F A;  1VHM A;  3H7W A;  3G6O A;  4JGR A;  4FD8 A;  4LV2 A;  4RX3 A;  3E2L A;  4DE2 A;  2UWX A;  3PAE A;  3KSH A;  3IXD A;  2XD1 A;  2Y79 A;  3P7N A;  2Y4A A;  4AFI A;  3BM6 A;  1DJA A;  3HL9 A;  2Q9N A;  3L7H A;  3N6I A;  1YM1 A;  5IS1 A;  4WEL A;  3QP4 A;  5F82 A;  3IBR A;  1K55 A;  3H82 B;  4MN7 A;  4ARZ A;  4X1L A;  4DMZ A;  1FSW A;  4PAU A;  3HLB A;  3VMA A;  1KGF A;  4Q0H A;  3FC7 A;  5EE8 A;  2Y2I A;  1DRM A;  1MWT A;  5HPI A;  3BJN A;  1XKZ A;  2QYB A;  3A3F A;  2V1A A;  1MBL A;  3OPH A;  2W1T A;  3Q81 A;  4R1G A;  1Q2P A;  3G30 A;  3CLO A;  1KE4 A;  4GDN A;  1V9Z A;  2HP6 A;  1P9W A;  2H10 A;  2J3T C;  1K4E A;  1IOU A;  3NHQ A;  5D3O A;  4PM8 A;  4RVA A;  5FAO A;  1Z09 A;  2PYP A;  1EI5 A;  5HPF A;  5DTK A;  2V0W A;  4LV1 A;  1NLY A;  3LFV A;  4H6J A;  1PW1 A;  1N4O A;  3AGE A;  2LB5 A;  4LEN A;  2V2F F;  3BFC A;  1ERM A;  3DTI A;  1I2S A;  3F1O B;  3EGX C;  3UE6 A;  3ITB A;  1SKO A;  1ACF A;  5IHV A;  3VOZ A;  2HDQ A;  3LY4 A;  5F69 A;  3IH9 A;  3HRE A;  2EWV A;  1GA9 A;  4P0M A;  4JBF A;  1O7E A;  3LGO A;  4LCL A;  2P74 A;  1Y4O A;  1GA0 A;  4M3K A;  3O3V A;  4HIA A;  3GR2 A;  2HJE A;  3EGD C;  4NK3 A;  4CLC E;  5A91 A;  5HD3 A;  1NRF A;  4D2O A;  5I5L A;  3BFD A;  5KSH A;  4HQA A;  4LLO B;  3CUE A;  4JGO A;  3LI9 A;  3L9K A;  2ZM0 A;  1K56 D;  1WYC A;  3IF6 A;  4E3O A;  2IA2 A;  4WLA A;  3T1Q B;  5DFY A;  4GZB A;  2WAF A;  3DBA A;  3OC2 A;  2E8J A;  3ZG0 A;  5U47 A;  3IQA A;  4L9E A;  3NOT C;  2M7U A;  3UDI A;  3B42 A;  2DMW A;  2PT7 A;  5HDD A;  3VV4 A;  3LR0 A;  1STZ A;  3UB5 P;  2ZBB A;  3HUM A;  3K3C A;  1LSW A;  2ZC6 B;  2D01 A;  4P85 A;  3A0S A;  5E2H A;  4KUK A;  3E4Q A;  1N9L A;  4X25 A;  4R23 A;  4N92 A;  4GS9 A;  4C3Q A;  5F1G A;  3IWQ A;  3ZG7 B;  4II7 A;  5FI6 A;  5FQ9 A;  2VX8 A;  1N9O A;  4H8R A;  3BQ8 A;  2H28 A;  3WS2 A;  3RFB A;  3BRM A;  4DE3 A;  4HBT A;  1WA9 A;  2Z6C A;  4O01 A;  1PNE A;  4JPM A;  4PM5 A;  3LID A;  4KG5 A;  1H3Q A;  2PU4 A;  3T4S A;  5J3W A;  3CWF A;  3FZC A;  5FDH A;  1TDL A;  2JKT M;  4GN2 A;  4CLC A;  1SZV A;  1SDN A;  2DCF A;  3V50 A;  4PKY G;  1ZG4 A;  5FDS A;  1D7E A;  3OOV A;  4I39 A;  3HLC A;  1VQQ A;  3D9Y A;  5J8X A;  2XLN A;  2Y2O A;  3VP1 A;  1UWN X;  2V8F A;  1G6A A;  1JWV A;  3N7W A;  3NEC A;  2J8Y A;  3RH8 B;  3FWL A;  4QJG A;  4E04 A;  5HDC A;  4Y7P A;  4MN5 A;  1W8Y A;  2ZQ8 A;  4OQH A;  4BJP A;  2I9V A;  4Y3I A;  1ZTU A;  1YLT A;  4RX2 A;  2XD5 A;  3C7V A;  3PBN A;  3IF5 A;  2JKR I;  1PFL A;  4OON A;  3OPR A;  3CPT B;  4FCF A;  3ZYT A;  5DTT A;  5DTS A;  1P97 A;  2HP5 A;  5TGF A;  2CC1 A;  4U0X A;  5GHY A;  4PM7 A;  1BLP A;  2PD7 A;  1QME A;  1YMS A;  1HLU P;  1YKD A;  4BMW A;  1NY0 A;  2Y2K A;  1J3W A;  5DJT A;  5FAT A;  5GLB A;  4CPK A;  4PM6 A;  4EUV A;  3FYZ A;  2ZC7 A;  3EEA A;  5AQA A;  5A93 A;  3PBS A;  3ULF A;  3Q7Z A;  2P9V A;  3ZG9 B;  5FEF A;  2Y2Q A;  2ZLY A;  2W3F A;  2WKH A;  5L2F A;  1K6R A;  3PTE A;  1IKG A;  2ZM8 A;  3C4P A;  1KGG A;  3ZCZ A;  3NCK A;  4WYY A;  2WZZ A;  4KUO A;  1UGU A;  5FA7 A;  2PAV P;  1WYB A;  3ZGA B;  1VEU A;  3F1P B;  4A5R A;  5J7E A;  4CJN A;  1BT5 A;  3GMW A;  1GHM A;  4I3A A;  2OAQ 1;  3O87 A;  2GNX A;  3DTM A;  2L1M A;  3HCY A;  3MZF A;  3MMH A;  4IUK A;  3M2K A;  1AXB A;  1XJ2 A;  4E3I A;  5A92 A;  3M6B A;  2EX9 A;  1S66 L;  1BZA A;  5FI2 A;  4BBV A;  1DY6 A;  5CHU A;  5F6A A;  2OLV A;  1IFQ A;  3KSG A;  4DXB A;  4R3A A;  2PDR A;  2VGJ A;  4XXR A;  2BTF P;  2GZA A;  5GLC A;  4JF4 A;  4FSF A;  3LCE A;  3LUQ A;  1D06 A;  4JXW A;  1BUL A;  2HGV A;  2O99 A;  3LI8 A;  4BBT A;  2OOL A;  4O0P A;  4N1H A;  1K56 A;  3UMD A;  1IEM A;  3ZG5 A;  4EER A;  3CAX A;  1J9M A;  2A24 B;  2HP9 A;  4R38 A;  3UDF A;  3DAV A;  3A0R A;  2FFY A;  4F94 A;  2O9C A;  4N1X A;  5EVI A;  2PBD P;  5CER A;  3SS4 A;  3P09 A;  4Y0U A;  5EOO A;  4UA6 A;  5DFX A;  3A0V A;  4ZRR A;  1JVJ A;  2JKG A;  2K2N A;  5EOE A;  1PZO A;  4NXF A;  1ERQ A;  3IBJ A;  2NUP C;  3QNB A;  1FQG A;  5KMW A;  1DP8 A;  2XRO A;  3WWX A;  3F1N A;  3T4O A;  1IKI A;  3H7W B;  2GDN A;  4JF6 A;  3HLE A;  5FQM A;  3C5A A;  2JE5 A;  3IS2 A;  2Y55 A;  4P6Z M;  1XJ6 A;  2W3E A;  1BUE A;  2J3T D;  1NXY A;  1GSV A;  3O88 A;  3NY4 A;  2OV5 A;  1H8Z A;  3T1R A;  4S2K A;  3QP5 A;  1GSX A;  4HP9 A;  3BEC A;  3UNW A;  4X68 A;  1S1Z A;  4IVI A;  2XA7 S;  3V5M A;  2WGV A;  4R70 A;  2WK0 A;  3PHY A;  2ZQC A;  3UB9 A;  2CMN A;  4MN6 A;  5F5Y A;  1PRQ A;  4S2M A;  4X1M A;  5AQB A;  3QP1 A;  4ARZ B;  4NXG A;  2ZQA A;  1A0K A;  1FOF A;  3MQO A;  5HFO A;  3N8S A;  5CGW A;  2W3G A;  2W1T B;  4L0L A;  4X6T A;  5GL9 A;  3SH8 A;  3W8K A;  2PRF A;  1T19 A;  2ZJ9 A;  4OP5 A;  4WZ5 C;  3D4F A;  5CHJ A;  4ETZ A;  1VET A;  2ZQ9 A;  2ZC5 B;  4DKI A;  4LRX C;  4KZ3 A;  2XDM A;  5M19 A;  3IHA A;  4B4X A;  1EW0 A;  4H6J B;  1G5U A;  3OLO A;  5EV0 A;  2BAS A;  3C38 A;  1NYM A;  4IJG A;  2V0U A;  3MBZ A;  2ZD8 A;  2O0Y A;  5F68 A;  1SKO B;  1MWS A;  5CGX A;  1OPX A;  1OJG A;  4G3V A;  1I5Q A;  4GJ4 A;  5JYP A;  4Y0T A;  1K6S A;  3VE3 A;  2QZ6 A;  3BFF A;  2EA9 A;  1LT0 A;  1ZKJ A;  4R3J A;  4WN5 A;  4QPR A;  4GB7 A;  3ZFZ A;  5CHM A;  2G7U A;  1YQS A;  1NJ4 A;  5CED A;  1ES3 A;  4WMC D;  5L09 A;  1FIK A;  2KLI A;  4HEF A;  2K31 A;  3QP2 A;  2KX6 A;  3CG5 A;  3IF6 B;  2INW A;  1U60 A;  1V9Y A;  5EUA A;  1BLH A;  5HWV A;  2JN7 A;  1SKF A;  5A90 A;  3GQZ A;  3R7W A;  4EW7 A;  3FV7 A;  2HDU A;  3IX4 A;  1S1Y A;  3MS6 A;  3PBR A;  2IWD A;  2KDK A;  3HUN A;  3ISG A;  4WZ4 A;  1PWC A;  1K38 A;  2P04 A;  4OPQ A;  1MKI A;  5HAP A;  4GS9 B;  1YLJ A;  3HVF A;  1K25 A;  2XA7 M;  4IBR A;  4Y17 A;  3KYQ A;  4KEN B;  3BY8 A;  2PU2 A;  1CEG A;  4QB8 A;  1YMX A;  3G2Y A;  3R4K A;  1LSV A;  4BL3 A;  1XX2 A;  1CJF A;  1TS8 A;  3G4P A;  1F9I A;  5HW3 A;  1CQA A;  4NXB A;  3G32 A;  4EEP A;  3MFD A;  3MSH A;  4EU0 A;  3QP8 A;  3O5Y A;  4DXC A;  3D3O A;  5FEG A;  3T4T A;  2R78 A;  3V3S A;  4CLC B;  4HOI A;  2XR0 A;  5EEC A;  2Q0O A;  4JGP A;  2Y2L A;  1RGY A;  1NZO A;  1SCW A;  4I3J A;  3E4O A;  1ALQ A;  1G68 A;  1XFQ A;  2J9P A;  4HP4 A;  2IWC A;  5IT5 A;  1TS0 A;  4EWF A;  3PBT A;  4BBU A;  3RTY A;  1P9R A;  3P01 A;  4OQG A;  3B47 A;  4KZ5 A;  5G4Z A;  2LB9 A;  5E43 A;  2ZQ7 A;  4WBG A;  4QWO A;  5AQ9 A;  1XJ4 A;  5E2G A;  5HAQ A;  2XGN A;  3IT9 A;  3VOL A;  5FSR A;  2EX6 A;  2O9B A;  1ESU A;  4GW9 A;  1YAX A;  3GVB A;  2EFX A;  4K0W A;  1ES4 A;  4F3L A;  4GLQ A;  2R9X A;  1KVL A;  5GLD A;  1PIO A;  3HLG A;  4KZB A;  3MF0 A;  4Q0J A;  4OLG A;  1MPL A;  2Y2P A;  3MR0 A;  3S7P A;  3NI9 A;  5EVI D;  4UHU A;  1XA1 A;  1XXM A;  2JC7 A;  3UPP A;  4IVK A;  2B18 A;  1PYY A;  2Y91 A;  4X69 A;  5FQI A;  1K57 C;  3Q82 A;  4HJ6 A;  5E2F A;  4QHC A;  3T50 A;  1E3U D;  3JVV A;  3C2W A;  1OTD A;  2P9V B;  2PHY A;  3LIA A;  4PPR A;  2W3D A;  2WKE A;  4KQR A;  4BWI A;  1N9B A;  2VV7 A;  3IXG A;  1CI9 A;  3EQU A;  3JYI A; 
#chains in the Genus database with same CATH homology
 1JTG A;  4ZJ2 A;  4A5R A;  1PI4 A;  1L0F A;  4S2N C;  4CJN A;  1BT5 A;  3GMW A;  1GHM A;  3QHY A;  2WKI A;  5F1F A;  4R4S A;  5FQK A;  3O87 A;  3DTM A;  1ES5 A;  4U0T A;  3MZF A;  3C4O A;  4DE0 A;  3M2K A;  1AXB A;  5FQQ A;  5DF7 A;  1XA7 A;  4R3B A;  3DWK A;  4N9K A;  4YIN A;  1LI9 A;  4C75 A;  4E3I A;  2XK1 A;  3W4P A;  4ID4 A;  2A3U A;  2XFT A;  2EX2 A;  2PBY A;  4B4Z A;  3M6B A;  5A92 A;  1MY8 A;  2EX9 A;  1BZA A;  5FI2 A;  4FH4 A;  3IWO A;  3MXS A;  1LL9 A;  3IXB A;  5EVL A;  1DJC A;  1DY6 A;  2HDS A;  1JWZ A;  2ZQD A;  5CHU A;  3IF6 C;  2OLV A;  4ZAM A;  4BL2 A;  3G34 A;  1JTD A;  4GD6 A;  1GHP A;  4QY5 A;  4S2L A;  4DXB A;  1E4D A;  4PMA A;  3CZD A;  4E3N A;  2VGJ A;  4XXR A;  2H0Y A;  4RA7 A;  5GLC A;  3FKV A;  4FSF A;  4JF4 A;  3LCE A;  3VP4 A;  1W5D A;  1ZC2 A;  1SHV A;  3A3E A;  3IHB A;  4NET A;  2J7V A;  4JXW A;  4R0Q A;  1BUL A;  3V39 A;  1PWG A;  1VM1 A;  3Q7V A;  3UE0 A;  1HTZ A;  4IED A;  4N1H A;  1XGJ A;  5TFQ A;  1GCE A;  2XH9 A;  1K56 A;  1LHY A;  1IEM A;  2Y2J A;  3ZG5 A;  3Q7V B;  4WMC A;  1J9M A;  2HP9 A;  2X01 A;  3UDF A;  4ZBE A;  1LI0 A;  2G2U A;  2V1Z A;  3ZNY A;  3QNC A;  1QMF A;  4WM9 A;  5GHZ A;  4DF6 A;  2FFY A;  4F94 A;  2I72 A;  3A3D A;  2XEP A;  4OQI A;  4N1X A;  5EVI A;  4MNR A;  1YLZ A;  3TOI A;  1FCN A;  5EPH A;  5CER A;  3WS5 A;  4EUZ A;  4KZ6 A;  2WUQ A;  1E25 A;  1GHI A;  1Q2Q A;  3SS4 A;  3P09 A;  3OPP A;  1CEF A;  4Y0U A;  2RCX A;  4JKT A;  5EVI B;  5EOO A;  3VP0 A;  4Z9Q A;  4UA6 A;  5CXW A;  5AQ7 A;  1PI5 A;  3DWZ A;  3UN7 A;  4ZJ3 A;  3MKE A;  3SS3 A;  3N8R A;  3HLW A;  1JVJ A;  4OPY A;  3CJM A;  1MWR A;  4GNU A;  1CK3 A;  5HX9 A;  1ES2 A;  1LL5 A;  4KZA A;  1TDG A;  3HBR A;  1M40 A;  1FSY A;  3GSG A;  2Y2N A;  5EOE A;  1PZO A;  3AGD A;  1ERQ A;  3UE1 A;  3BLM A;  3QNB A;  4FD8 A;  1FQG A;  5KMW A;  1NZU A;  4LV2 A;  3WWX A;  4RX3 A;  3E2L A;  1IKI A;  4OH0 A;  4OP8 A;  4S2J A;  3UDX A;  4DE2 A;  2EXB A;  2OLU A;  2GDN A;  2UWX A;  4JF6 A;  2B5R A;  2WYX A;  3HLE A;  3C5A A;  3PAE A;  5FQM A;  5CTN A;  2HDR A;  2JE5 A;  3IXD A;  2XD1 A;  2Y55 A;  2G2W A;  1RCJ A;  4UA9 A;  2Y4A A;  2V20 A;  2ZM2 A;  1YLY A;  4DDY A;  1BUE A;  2DRW A;  1NXY A;  4X53 A;  3O88 A;  4PM9 A;  4DDS A;  3NY4 A;  3BM6 A;  3G31 A;  3OCL A;  1C3B A;  1H8Z A;  1DJA A;  3HL9 A;  2OV5 A;  4S2K A;  2Q9N A;  3MZD A;  1W8Q A;  4XUX A;  2Z2L B;  1EWZ A;  1MWU A;  3N6I A;  2EFU A;  3BEC A;  1YM1 A;  3UNW A;  4WEL A;  3VFF A;  4X68 A;  2X71 A;  1YT4 A;  4IVI A;  5CEB A;  5F82 A;  5CGS A;  1K54 C;  3V5M A;  5KSC A;  2WGV A;  2WZX A;  4UAA A;  1K55 A;  2WK0 A;  3TSG A;  2ZQC A;  3HLD A;  1FSW A;  3Q07 A;  2QPN A;  3HLB A;  4S2M A;  2XFS A;  3VMA A;  2WAE A;  5AQB A;  1KGF A;  2ZMA A;  3WS4 A;  5EE8 A;  1ONH A;  2ZQA A;  2WAD A;  4E3M A;  3VSL A;  4E3L A;  2Y2I A;  3GV9 A;  1TVF A;  4Y0O A;  1MWT A;  1FR1 A;  1LLB A;  1XKZ A;  1FOF A;  5BOH A;  4KQQ A;  1YLW A;  3A3F A;  1MBL A;  2EX8 A;  1XP4 A;  3OPH A;  5HFO A;  1PWD A;  3N8S A;  5CGW A;  3Q81 A;  4R1G A;  3UPN A;  1Q2P A;  3G30 A;  1KE4 A;  4GDN A;  4O7D A;  1K57 A;  2IWB A;  1S6R A;  4K0X A;  2HP6 A;  4FH2 A;  3NC8 A;  2ZC3 B;  4OOY A;  4L0L A;  4X6T A;  2H10 A;  1K4E A;  5GL9 A;  5D3O A;  3SH8 A;  3W8K A;  1BLC A;  4PM8 A;  4JLF A;  4RVA A;  2ZJ9 A;  5FAO A;  4OP5 A;  1W7F A;  4WZ5 C;  3SOI A;  3D4F A;  2H5S A;  3OPL A;  3M6H A;  3NIA A;  1EI5 A;  2Z2M B;  1I2W A;  4HES A;  5CHJ A;  4EBN A;  1Y54 A;  2ZQ9 A;  5DTK A;  4KG6 A;  5I94 A;  3VP3 A;  2WGW A;  2ZC5 B;  4LV1 A;  2E8I A;  4BD0 A;  4DKI A;  1FCO A;  4KZ3 A;  2XDM A;  4KZ9 A;  4WEK A;  3IHA A;  5M19 A;  5CRF A;  2C5W B;  1PW1 A;  2BLS A;  2QMI A;  1N4O A;  3AGE A;  3ZVT A;  4E6W A;  2VGK A;  2WGW B;  4LEN A;  4B4X A;  2V2F F;  3BFC A;  1ERM A;  4KZ7 A;  5M1A A;  2A49 A;  1I2S A;  2OSU A;  2Y2H A;  2ZC4 B;  3BEB A;  4KQO A;  3UO9 A;  4OPZ A;  3P98 A;  3ITB A;  4OOL A;  3RXW A;  1NYM A;  5HAI A;  1IYS A;  5M18 A;  3VOY A;  4S2I A;  5IHV A;  3MBZ A;  3VOZ A;  2ZD8 A;  2HDQ A;  3IH8 A;  3GRJ A;  4GD8 A;  1MWS A;  5CGX A;  3LY4 A;  3ZHH A;  5FI7 A;  4MEZ A;  1I5Q A;  3IH9 A;  3HRE A;  1GA9 A;  1ERO A;  3I7J A;  3JYI A;  4P0M A;  3ITA A;  1BLS A;  1O7E A;  3PAG A;  4JBF A;  3S1Y A;  1KE3 A;  1L0D A;  4EBP A;  3BFG A;  5JYP A;  4Y0T A;  4LCL A;  2P74 A;  3HLF A;  5GLA A;  5CEC A;  1K6S A;  3ZVW A;  1GA0 A;  1HVB A;  3G35 A;  2QZ6 A;  2Y59 A;  3O3V A;  4KZ4 A;  1NYY A;  1IYO A;  3BFF A;  3GR2 A;  3BYD A;  4M3K A;  4P6B A;  4B88 A;  3BFE A;  4ZJ1 A;  2C6W B;  5FQJ A;  1ZKJ A;  4NK3 A;  3E2K A;  4P87 A;  5A91 A;  4R3J A;  5E2E A;  1NRF A;  4D2O A;  3BFD A;  5KSH A;  4GB7 A;  3ZFZ A;  5CHM A;  5CTM A;  4IBX A;  1YQS A;  2WGI A;  1NJ4 A;  3TG9 A;  5CED A;  2ZM0 A;  1K56 D;  1KDW A;  1WYC A;  4MBH A;  3IF6 A;  1ES3 A;  4X55 A;  4WMC D;  4E3O A;  1E3U A;  5F83 A;  3HUO A;  4HEF A;  4GZB A;  2WAF A;  3CG5 A;  3IF6 B;  3OC2 A;  1U60 A;  3VP2 A;  3ZG0 A;  5U47 A;  3IQA A;  2FFF B;  3UDI A;  2J9O A;  5EUA A;  3VSK A;  1BLH A;  4JXG A;  1BSG A;  4ZDX A;  5KZH A;  1SKF A;  5A90 A;  3GQZ A;  4WEJ A;  5DF8 A;  4N9L A;  3FV7 A;  2HDU A;  4GDB A;  3UY6 A;  2Y2M A;  3CMZ A;  4HBU A;  3HUM A;  1S0W A;  4YFM A;  2ZC6 B;  4MBF A;  3PBR A;  1RP5 A;  2IWD A;  1L0E A;  4P85 A;  3HUN A;  5E2H A;  3ISG A;  5GHX A;  4WZ4 A;  5TR7 A;  4Q8I A;  1L0G A;  3B3X A;  1PWC A;  4KG2 A;  1K38 A;  1FCM A;  4R23 A;  3LEZ A;  4BQM A;  4EQI A;  4N92 A;  4C3Q A;  1H8Y A;  3VFH A;  1K4F A;  5F1G A;  1MXO A;  3EQV A;  3IWQ A;  4LV3 A;  4OPQ A;  3ZG7 B;  3FKW A;  1MKI A;  4U3T A;  4QY6 A;  5HAP A;  5HAR A;  1YLJ A;  3HVF A;  1K25 A;  3MKF A;  4IBR A;  3MXR A;  5FI6 A;  4KEN B;  5FQ9 A;  4OVD A;  4ZTK A;  2PU2 A;  1CEG A;  2R9W A;  1YMX A;  1WE4 A;  3G2Y A;  4QB8 A;  5FAQ A;  1XPB A;  4H8R A;  1BTL A;  4UA7 A;  3WS2 A;  4X56 A;  1H5X A;  2Y2G A;  3M2J A;  1O07 A;  3BRM A;  4DE3 A;  4HBT A;  3AGF A;  3W4O A;  4BL3 A;  4JF5 A;  1XX2 A;  4JPM A;  4PM5 A;  3WS1 A;  4KG5 A;  1PZP A;  2PU4 A;  1DJB A;  3G4P A;  2DNS A;  5HW3 A;  4XUZ A;  5EVI C;  3GTC A;  1IEL A;  1XGI A;  3FZC A;  3G32 A;  3MFD A;  5HL1 A;  4RYE A;  4BD1 A;  5FDH A;  1Z6F A;  4DXC A;  3ZG8 B;  1TDL A;  3IWI A;  1W79 A;  3V3R A;  4GN2 A;  3A3J A;  4QD4 A;  4JXV A;  1KGE A;  1FR6 A;  1SDN A;  3WRT A;  1KDS A;  3V3S A;  4OQ0 A;  2DCF A;  3V50 A;  2XR0 A;  3MZE A;  3PBO A;  5EEC A;  1ZG4 A;  4MBK A;  4EV4 A;  3NDE A;  4OKP A;  3UE3 A;  2Y2L A;  1RGY A;  3OCN A;  2HPB A;  1SCW A;  1NZO A;  3HLC A;  4E3K A;  4EBL A;  1VQQ A;  1M6K A;  3WRZ A;  1ALQ A;  1G68 A;  4KZ8 A;  2XLN A;  5J8X A;  2J9P A;  1K54 A;  2IWC A;  2Y2O A;  3A3I A;  3VP1 A;  1G6A A;  1JWV A;  3N7W A;  4EWF A;  3PBT A;  2J8Y A;  3NDG A;  3FWL A;  3SH7 A;  4QJG A;  4C6Y A;  2X02 A;  4Y7P A;  4OQG A;  4KZ5 A;  3DW0 A;  1W8Y A;  2ZQ8 A;  2XQZ A;  3RXX A;  4S2P A;  5E43 A;  2ZQ7 A;  1L2S A;  4WBG A;  5AQ9 A;  3C7U A;  5E2G A;  4OQH A;  4BJP A;  3IXH A;  5HAQ A;  3N8L A;  2XF3 A;  1IYQ A;  1RGZ A;  2XGN A;  4BEN A;  1YLT A;  3IT9 A;  4RX2 A;  2XD5 A;  3WS0 A;  3SS5 A;  3C7V A;  3PBN A;  3IF5 A;  5FSR A;  3ZNT A;  1HZO A;  3RJU A;  3S4X A;  4OON A;  2EX6 A;  1ESU A;  3OPR A;  3GVB A;  1YLP A;  4E6X A;  4FCF A;  4OPR A;  5FAS A;  1K55 C;  2EFX A;  4K0W A;  1ES4 A;  3Q1F A;  5DTT A;  5DTS A;  2HP5 A;  2JCH A;  5G18 A;  4DRT A;  5TGF A;  5JYO A;  2CC1 A;  5FAP A;  1SDE A;  2BG1 A;  3PBQ A;  2R9X A;  1KVL A;  4U0X A;  1PIO A;  3HLG A;  4WZ5 A;  4PM7 A;  5GHY A;  4KZB A;  5GLD A;  3SH9 A;  1PW8 A;  3ZDJ A;  4OLD A;  4OLG A;  1BLP A;  1MPL A;  3BLS A;  2Y2P A;  3NI9 A;  1QME A;  1YMS A;  2Q9M A;  4GOG A;  5EVI D;  4DE1 A;  1TEM A;  4UHU A;  1JWP A;  4BLM A;  1XA1 A;  3OZH A;  2EXA A;  1XXM A;  2JC7 A;  3NBL A;  3UPP A;  2JBF A;  1NY0 A;  3LO7 A;  2Y2K A;  1ESI A;  4IVK A;  4LCM A;  3W4Q A;  5FAT A;  3LY3 A;  1PYY A;  2Y91 A;  4X69 A;  4E3J A;  5FQI A;  5GLB A;  4CPK A;  1K57 C;  1ONG A;  3O86 A;  4PM6 A;  3FYZ A;  1CI8 A;  2RL3 A;  3Q82 A;  2ZC7 A;  5E2F A;  5AQA A;  4JXS A;  1KE0 A;  1OME A;  4LV0 A;  3PBS A;  4QHC A;  5A93 A;  3Q7Z A;  4S2O A;  5DVA A;  1E3U D;  2P9V A;  4GKU A;  4OOM A;  3G2Z A;  3UPO A;  1HD8 A;  3ZG9 B;  2P9V B;  2Y2Q A;  4S2N A;  2ZLY A;  4PPR A;  5DF9 A;  2WKH A;  2WKE A;  3S22 A;  4K91 A;  3N4I A;  4QU3 A;  4KQR A;  5L2F A;  4R4R A;  1K6R A;  3PTE A;  1IKG A;  2ZM8 A;  1N9B A;  1IYP A;  1KGG A;  2H0T A;  3C4P A;  3NCK A;  4WYY A;  3ZCZ A;  2WZZ A;  3IXG A;  1CI9 A;  1ZG6 A;  4MLL A;  3EQU A;  5FA7 A;  1KVM A;  1WYB A;  3ZGA B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...