3P09A

Crystal structure of beta-lactamase from francisella tularensis
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
268
structure length
264
Chain Sequence
QLDDSFKNLENKYDGKIGIYTLNTNIKYNESYHFPICSVFKFLLVGAILDYDMHNQGFLDKKIPINQDDIGKLGYAPITAKNVGKTLTISQLNYAAILSDSPASNILVRELGGLQNLNKFIKKLGDNDTIITADEPEINYTQPHSNINKTTPKAITKDIYKLAFGNILDKKHKDIFIKYLQDNNTGANRIAFSMPKDWIIGDKTGTCGQYAATNDVAIIWPKNQQPIALGILYTNPNDKNAPSNEEIIQQAAKLIANDLTNTYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Beta-Lactamase from Francisella tularensis
rcsb
molecule keywords Beta-lactamase
source organism Francisella tularensis subsp. tularensis
molecule tags Hydrolase
total genus 92
structure length 264
sequence length 268
chains with identical sequence B
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2010-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 3p09A00
4OP5A 3WS2A 1CEGA 2UWXA 3IF6B 1YMXA 4S2NC 5CHMA 1W8YA 2V2FF 3MKFA 1BZAA 4MBKA 4OQIA 5AQAA 3SOIA 1FSYA 1L0EA 2ZC7A 3AGDA 2FFFB 4N1XA 5TR7A 5F82A 2A49A 1FCNA 3UN7A 3Q7ZA 3EQUA 4QJGA 4LV3A 4K0WA 3FWLA 4BLMA 2EFUA 2HP5A 4GB7A 5TFQA 2RL3A 1EROA 2DCFA 4HEFA 4R3BA 5FAQA 3VP0A 3I7JA 3NBLA 3IHAA 3VOYA 2G2UA 2IWBA 1CI9A 2OLUA 5DTSA 5HX9A 3WRZA 1E4DA 1GCEA 5CHUA 3HBRA 3IF5A 1XP4A 4JF4A 4MNRA 5E2EA 2VGJA 4E3OA 2BG1A 3N8SA 4M3KA 5CRFA 5L2FA 1IELA 3S22A 3HLEA 4WZ4A 5TGFA 1VM1A 1I5QA 1ONGA 2OLVA 3PBRA 1NZOA 4S2PA 1DJBA 2Y2MA 1PW8A 3G30A 3MXSA 4QB8A 1KVLA 1KGFA 2R9WA 1K4EA 2FFYA 2WGVA 3A3IA 4OH0A 4Q8IA 3P98A 4LV1A 2XR0A 1MWRA 1W8QA 3BEBA 3HUMA 4X6TA 5A92A 1Q2QA 1LHYA 3WS0A 4X68A 4LV2A 3UDFA 1NJ4A 1HVBA 4MBHA 4R3JA 5M1AA 2VGKA 3M2KA 3PBSA 3Q7VA 4DDSA 1HTZA 1PWDA 2EX9A 4DF6A 1KGEA 1RP5A 5HAPA 4R23A 3TSGA 2EXBA 3C4PA 3Q7VB 2WGWB 1DJCA 1KDWA 3IXGA 3VP1A 1AXBA 1MBLA 1QMEA 2HDQA 1QMFA 4XUZA 1O7EA 1XX2A 1CI8A 2ZQCA 3OZHA 4RYEA 1L0GA 4Y0TA 3WS1A 4S2MA 4DXBA 3PBTA 4U0TA 1XA7A 1TEMA 3MXRA 1KE4A 2ZC6B 1W79A 1JTDA 5EVLA 3UE1A 3V3RA 3ISGA 1KGGA 3MKEA 4QY6A 1IYOA 3IF6C 4JKTA 4OONA 1KVMA 4DDYA 5KZHA 2JE5A 3HUNA 3MZFA 5F1GA 1H8YA 3ZGAB 4BJPA 4DE1A 4JXGA 3N7WA 3QNCA 3OCLA 5FQJA 1ONHA 1JVJA 4MBFA 4EBLA 2XD5A 1MPLA 3FKWA 1JWZA 2Y2PA 1ESIA 1FOFA 1RGZA 1ZC2A 3GRJA 4S2LA 4KG5A 3VFFA 2XF3A 3SS3A 5G18A 2IWDA 1RCJA 2GDNA 2Y2QA 1MKIA 3CZDA 3O86A 4KQRA 3VFHA 4S2OA 5DF9A 2ZJ9A 1PZOA 4R1GA 1E3UA 3AGEA 2P9VB 4KZ9A 5M19A 3ITAA 1IYQA 1K55A 1K6RA 4HBUA 4K0XA 3UPPA 4PMAA 2PU4A 1YLTA 3IXBA 4O7DA 1BTLA 5GHXA 4C75A 3LY4A 2X71A 3CJMA 4IEDA 4GKUA 1KDSA 2ZD8A 2HP9A 2ZQDA 1C3BA 1SDEA 2EXAA 2R9XA 4GNUA 1K6SA 2V20A 4ZJ1A 4BENA 1ES5A 1XKZA 2I72A 3VOZA 1J9MA 2Z2LB 3PTEA 4Y7PA 2WKEA 4LCMA 4QHCA 5EVIC 2Y2GA 3CG5A 3OCNA 3Q82A 5FATA 1SKFA 4UA7A 5E2GA 4OQ0A 3RXXA 4DXCA 4PM9A 5CHJA 1XGIA 5CTMA 1GHIA 1HZOA 4Z9QA 3UPNA 5DTKA 2XK1A 1FQGA 3O88A 4P85A 2XEPA 2H10A 3IWQA 5E2FA 4ZBEA 3NDEA 2HDSA 3PBQA 2XLNA 3LEZA 1XPBA 2Y2KA 3BFDA 3HUOA 3IH9A 4DE3A 4C3QA 2HDRA 4WZ5C 5FSRA 3IH8A 3IXHA 4GZBA 3UE3A 1SDNA 2Y91A 1LLBA 1JWVA 1MY8A 4UA6A 2EX2A 1IYPA 4QY5A 4C6YA 1K25A 3RJUA 2Z2MB 2G2WA 3BFEA 3BLMA 4XUXA 4RA7A 1JTGA 2WKIA 1PZPA 5A90A 1BSGA 4IVKA 3ZVTA 3NCKA 4EQIA 2Y2LA 4NK3A 3EQVA 4Y0UA 4A5RA 4MLLA 4WBGA 4E3IA 2ZMAA 3GTCA 4ZDXA 4GN2A 3V5MA 1NRFA 1GA0A 1TVFA 3PAEA 5KSCA 3C7UA 3S1YA 2IWCA 3VP4A 4OVDA 2Y2JA 1M40A 1NXYA 2HDUA 1G68A 1LL9A 1Z6FA 5FQQA 4KQOA 5GHYA 3ZNYA 1RGYA 4KZAA 2J9PA 3B3XA 3LY3A 4WMCA 5FAPA 4B4XA 4E6WA 2WZZA 4OOYA 1PWGA 3TG9A 1ZKJA 4U0XA 1BLCA 3G35A 4Y0OA 4B88A 3A3EA 5CERA 2ZM0A 4E6XA 4EBNA 5AQ7A 5FI6A 3NIAA 5FI7A 1NYYA 4OP8A 5JYPA 4PM8A 4X69A 4D2OA 3SS4A 3SH8A 4S2NA 5E43A 4BD0A 1ERQA 2Y4AA 4HESA 5HARA 1VQQA 1W5DA 3NC8A 5EECA 1KE0A 1ES2A 3OPHA 5EVIA 2XDMA 3BECA 2BLSA 1W7FA 4KZ6A 3GVBA 2XFSA 5CXWA 5I94A 3WS4A 4KQQA 3TOIA 4DE0A 4E3MA 1IKGA 1YM1A 2ZC3B 4GD8A 1MWTA 1DJAA 3FV7A 2JCHA 1NYMA 4GDBA 1G6AA 1I2SA 4PM6A 2WAEA 3HLWA 3ZG8B 4UAAA 3IT9A 4KZBA 5DF7A 2J8YA 1K54C 2ZM8A 5KSHA 4ZJ3A 3UY6A 2WAFA 3HL9A 4L0LA 2XH9A 3HVFA 2PBYA 3RXWA 2EX8A 2V1ZA 4OPQA 1BLSA 3MZDA 2OSUA 1PIOA 3ZG7B 2HP6A 4F94A 1XA1A 5FASA 3NY4A 2H5SA 3CMZA 3ZVWA 3W4QA 3MZEA 1FSWA 1ERMA 3G34A 5E2HA 2Y2OA 3S4XA 5EE8A 4IBRA 3IXDA 4HBTA 5HAQA 4R4RA 2QZ6A 5FQ9A 1E3UD 3D4FA 2Q9NA 4OPYA 5U47A 3G31A 5J8XA 3PAGA 1WYBA 3PBNA 3G2ZA 4RX2A 2ZQ8A 4OQGA 4JXSA 1ES3A 4KG6A 2EFXA 1K56A 1YMSA 5A93A 1ZG6A 1N9BA 1FCOA 2J7VA 3Q81A 1YLJA 4KENB 4S2JA 3FKVA 3Q1FA 3NDGA 2CC1A 4BD1A 3WRTA 1BUEA 3ZHHA 3ZNTA 5FA7A 4EV4A 3M2JA 1L2SA 5A91A 3HLGA 2PU2A 3DWKA 2C6WB 4K91A 1GA9A 5FQMA 3PBOA 4U3TA 2WADA 3HREA 3DW0A 3UPOA 5EPHA 4N1HA 2P74A 1Y54A 4UHUA 3IF6A 3SS5A 1IKIA 4BL2A 3E2KA 2EX6A 3BRMA 4LCLA 1LL5A 1K38A 5EOEA 3AGFA 2WGIA 2HPBA 2WKHA 3LO7A 1IYSA 4XXRA 4R4SA 1MWSA 3W4OA 4OLGA 3P09A 1N4OA 5HW3A 3UO9A 3C7VA 3NI9A 4FD8A 4OOLA 3V3SA 5BOHA 1LI9A 1ESUA 4N9LA 1YLPA 3OPRA 3BFFA 3SH7A 4BQMA 4QU3A 3VMAA 3WS5A 3IWOA 2WYXA 2X02A 1PW1A 3IHBA 4X55A 1I2WA 3VSKA 5CGWA 4GD6A 4P6BA 3O3VA 1XGJA 1XXMA 4ID4A 5F83A 2Y2NA 4DRTA 2B5RA 1BT5A 4WEJA 3W4PA 5GHZA 3Q07A 4WM9A 2Q9MA 1SCWA 5GLDA 3GSGA 3HLCA 4KZ8A 5FQKA 1E25A 4WMCD 5M18A 4RX3A 4LENA 5FDHA 3N6IA 1CEFA 3BLSA 2ZQ7A 4KZ5A 4PPRA 4WEKA 2WZXA 3IWIA 5DVAA 4ZTKA 4H8RA 5AQBA 3HLFA 2X01A 1HD8A 3GV9A 4JXVA 1BLHA 3MFDA 4JPMA 4E3NA 1GHPA 1BULA 3BFGA 4UA9A 3DTMA 4LV0A 4R0QA 3GMWA 1MXOA 4OQHA 2J9OA 4CPKA 5AQ9A 5IHVA 3BM6A 3V50A 5EVID 4JLFA 1KE3A 4JBFA 4KG2A 3UE0A 3VSLA 4B4ZA 1H5XA 1S6RA 2XQZA 5EVIB 4S2KA 1LI0A 2XD1A 5GLBA 1K55C 1S0WA 4FSFA 2A3UA 4FCFA 1FCMA 1OMEA 4QD4A 4EWFA 4P0MA 1K4FA 2WUQA 3N4IA 2WGWA 3FYZA 2Y2HA 4OKPA 3A3JA 3OPLA 1EWZA 1H8ZA 1IEMA 1K57C 3A3DA 5D3OA 5HFOA 4WZ5A 4GOGA 3DWZA 2Y55A 5DF8A 1NY0A 1SHVA 2ZQ9A 1DY6A 1PI4A 3A3FA 3LCEA 1FR1A 2WK0A 5GL9A 4BL3A 3FZCA 5CEBA 4JXWA 2ZQAA 2C5WB 4IBXA 4OPRA 2RCXA 4YFMA 5CGXA 4JF5A 4OOMA 1L0DA 1NZUA 2JBFA 1WE4A 4EBPA 2XFTA 5HL1A 3ZG0A 3C5AA 3M6BA 3IQAA 2JC7A 4IVIA 4S2IA 5CEDA 5FQIA 2DRWA 4X53A 1L0FA 3O87A 2QMIA 5GLAA 4E3KA 1GHMA 4WELA 4OPZA 5JYOA 4KZ4A 1PI5A 4N9KA 3ZFZA 4FH4A 4E3JA 1Q2PA 1WYCA 3VP2A 1ALQA 3ZG5A 3WWXA 1ES4A 1YLYA 4N92A 4YINA 3N8RA 2H0YA 3E2LA 2H0TA 5CECA 3HLDA 1CK3A 1YQSA 2ZLYA 1YT4A 2QPNA 1PYYA 4X56A 3OPPA 4CJNA 3G2YA 4PM7A 5CGSA 4PM5A 1TDLA 3GQZA 3QHYA 3G32A 4DKIA 1BLPA 1EI5A 1U60A 4DE2A 1ZG4A 1K56D 2ZC5B 3GR2A 1YLWA 3BFCA 2DNSA 4ZJ2A 2ZM2A 4KZ7A 5CTNA 2P9VA 2ZC4B 1MWUA 3G4PA 5HAIA 4MEZA 4WYYA 1O07A 3MBZA 5F1FA 1FR6A 2Y2IA 3SH9A 2Y59A 3ITBA 3JYIA 4JF6A 3UNWA 3N8LA 3UDXA 5KMWA 1JWPA 3UDIA 4KZ3A 3VP3A 3ZCZA 5DTTA 3BYDA 3M6HA 4P87A 3W8KA 3ZG9B 1YLZA 1TDGA 5EUAA 5FI2A 3HLBA 3OC2A 4EUZA 1M6KA 4RVAA 1K57A 5EOOA 4FH2A 2E8IA 2XGNA 4GDNA 3C4OA 4OLDA 4E3LA 5FAOA 3V39A 1PWCA 3QNBA 4ZAMA 2OV5A 3ZDJA 4NETA 1K54A 5GLCA
chains in the Genus database with same CATH superfamily
4OP5A 3IF6B 4S2NC 2O0YA 2QWSA 4HJ4A 2V2FF 1Y4OA 1BZAA 3SOIA 1L0EA 2FFFB 2QKPA 5TR7A 2A49A 1FCNA 3EEAA 4LV3A 4K0WA 3V67A 4BLMA 3T1SA 1EROA 4YOFA 4HEFA 5DKLA 3VP0A 3I7JA 4UEYA 5DTSA 3HBRA 3CI6A 3F1NB 1XP4A 4JF4A 5E2EA 3LFVA 3S7PA 2ACGA 3LI8A 2VV6A 3F1OA 2VGLM 3H9WA 4WZ4A 2OLVA 1I5QA 1ONGA 1DJBA 2VGLS 1PW8A 2XSSA 1KGFA 1K4EA 3BEBA 1MWRA 4X6TA 5A92A 4EW7A 3T4SA 1HVBA 3H82B 3M2KA 3BJNA 1YPRA 2EXBA 3VP1A 1MZUA 4GS9A 4Y0TA 4DXBA 3PBTA 3P01A 1XA7A 1TEMA 2YKHA 2KOIA 3V3RA 3MKEA 3T1RA 4QY6A 3KSFA 3MZFA 4R6LA 4DE1A 1VETB 2G7UA 2Y79A 4EBLA 4CLCB 1FOFA 4S2LA 1W63M 2XF3A 5FDSA 4EXOA 1RCJA 2GDNA 4Y3IA 3DTKA 2Y2QA 1MKIA 3CZDA 3MMHA 3O86A 4S2OA 5DF9A 4H6JA 5IT5A 5AVEA 3ITAA 1IYQA 1ODVA 2QHKA 2W1TA 1K6RA 4K0XA 3UPPA 5FEGA 1OT6A 4PMAA 1YLTA 3IXBA 1BTLA 4C75A 4XT2B 3LY4A 3CJMA 3IX3A 3D72A 3MQ0A 1KDSA 1C3BA 4ZJ1A 1XKZA 4ARZB 1OTEA 3PTEA 4QHCA 1TS0A 3Q82A 4UA7A 4DXCA 2PYPA 3VV4A 1XGIA 5CTMA 2XK1A 1FQGA 3O88A 2XEPA 1FIKA 3SW1A 3LEZA 3BFDA 2Y2KA 4DE3A 5FSRA 3BY8A 1OTIA 3PXPA 4UA6A 1IYPA 4QY5A 4C6YA 3BFEA 3BLMA 3T4QA 4RA7A 1JTGA 1MKMA 5A90A 4IVKA 2PRFA 2Y2LA 4NK3A 4Y0UA 4WBGA 2ZMAA 5DJUA 3MXQA 3U4LP 4OVDA 1M40A 2HJEA 1RGYA 4B4XA 3B3XA 4OOYA 2R78A 4U0XA 4B88A 2ZM0A 4E6XA 4ETZA 1NYYA 4R38A 2OWHA 5JYPA 4JGPA 1ERQA 4IHQA 4BD0A 4I39A 2P04A 1G6OA 2BLSA 4KZ6A 4Y5FA 5I94A 2ZL1B 5AJGA 2W1RA 1YM1A 1DJAA 2WAEA 4GLQA 4FOFA 4L0LA 1XJ4A 4LPZA 2XH9A 3GDIA 3RXWA 2PD8A 3K3DA 2V1ZA 4LFUA 1BLSA 4BWIA 5FASA 2VZWA 4EQ1A 2V1AA 2Y2OA 2CMNA 4I3JA 4HBTA 3FC7A 5TBMB 4OPYA 1LSWA 3PAGA 1V9ZA 1WYBA 4HI4A 2ZQ8A 2VA0A 2EFXA 1ZHHB 5A93A 1ZG6A 3ZHHA 3ZNTA 3OBFA 4EV4A 3M2JA 1L2SA 2PR5A 3CHWP 3HLGA 2PU2A 4K91A 3T4KA 3PBOA 4X1LA 5EPHA 4N1HA 2P74A 1Y54A 4WF0A 3IF6A 3SS5A 4Y13A 4KUKA 2ZOIA 5EOEA 3AGFA 1P9WA 5HW3A 2E8JA 4N9LA 2W27A 3OPRA 2V0WA 3VMAA 3WS5A 5FEFA 1S4RA 3L7HA 1PW1A 1I2WA 3LEQA 4EESA 3O3VA 1XGJA 3QP2A 2JKTI 3IS2B 4ID4A 1S1ZA 3F1NA 1SCWA 3NECA 1N9NA 1V9YA 5FQKA 4Q0IA 5FDHA 4KZ5A 4PPRA 2WZXA 4NXEA 5AQBA 3GV9A 4JPMA 1OTAA 1BULA 3BFGA 3DTMA 3LR0A 4LV0A 4O8GA 2OAQ1 3VE3A 4P6ZS 1DP6A 3QP1A 5AQ9A 5EVID 4JLFA 3H82A 1S67L 4B4ZA 1H5XA 1S6RA 4S2KA 2XD1A 4QD4A 1OMEA 1K4FA 3N4IA 3FYZA 5K5BA 1EWZA 1IEMA 4WZ5A 4CLCE 3DWZA 3CUEC 2Y55A 4GW9A 2ZQ9A 3DTEA 3FG8A 5CEBA 3FZCA 4YFMA 2BASA 3E4QA 4JF5A 4OOMA 5HL1A 3M6BA 4IVIA 1L0FA 2QMIA 4HOIA 4N9KA 4BBVA 4FH4A 1WYCA 2Q0OA 1ALQA 3WWXA 4CLCA 5L07A 3S7NA 1TD5A 1YQSA 1YT4A 1PYYA 4CJNA 3EOIA 3G32A 1PRQA 4DE2A 1K56D 2DNSA 1LT0A 4KZ7A 1WA9A 3TJZC 4WYYA 3LGOA 3ITBA 4JF6A 3N8LA 3UDXA 1JWPA 2OOLA 4XT2A 3M6HA 4RVAA 4FH2A 3UB8A 2XGNA 4GDNA 1D1JA 3C4OA 2KX6A 1TS8A 3IBJA 4MN7A 2OV5A 5GLCA 3WS2A 1CEGA 2HZ5A 2Y8HA 3S7QA 5AQAA 2ZC7A 3BQAA 3H7WB 4N1XA 5F82A 3EQUA 3FWLA 4Y2FA 5TFQA 4GB7A 1STZA 2QJ7A 3TE8A 5L10A 1MC0A 2G2UA 2IWBA 1CI9A 2WKQA 1GCEA 5CHUA 1G5UA 4K08A 2VGJA 2BG1A 3HLEA 5TGFA 4S2PA 3UB9A 2FFYA 3A3IA 1IFQA 2VK3A 3P98A 2VV8A 2XR0A 3WS0A 4X68A 4LV2A 2W0NA 3UMEA 3CITA 5M1AA 4JGQA 3RTYA 1HTZA 3QP5A 4GJ4A 1RP5A 3TSGA 3C4PA 2JKRM 3Q7VB 1QMEA 3TRCA 1CI8A 2ZQCA 3OZHA 3LICA 3TW8A 1L0GA 1S4SA 3T4JA 3E0YA 3UE1A 3ISGA 1T1CA 1IYOA 4LRZE 1KVMA 5KZHA 5F6AA 3LR4A 4BJPA 3SZTA 1TS7A 3QNCA 5FQJA 3D3OA 2Y2PA 1ZC2A 1RGZA 3GRJA 4GHIB 5TBMA 2Z6DA 1PZOA 3AGEA 3LIFA 1J3WA 4GCZA 2X71A 4IEDA 3KSIA 4GKUA 3W2ZA 1YKDA 2EXAA 2V20A 3VOZA 3UB5P 4Y7PA 2VLGA 4LCMA 3EGDC 5EVIC 2Y2GA 3CG5A 3OCNA 4D60A 4M4XA 5E2GA 3RXXA 4PM9A 2W3DA 3UPNA 5DTKA 3FPWA 3NJAA 4O01A 1YSPA 3C30A 4ZBEA 3RFBA 3IH9A 5HDDA 5MC7A 2HDRA 3IH8A 1MY8A 1JWVA 2GX5A 1K25A 4LRYC 1OT9A 3DAVA 1PZPA 1BSGA 2LB9A 3EQVA 2J3TC 3HJIA 3IS2A 4MLLA 4A5RA 1TVFA 1NRFA 1GA0A 5KSCA 3C7UA 3VP4A 1NXYA 2HDUA 5DFYA 5HSQA 5GHYA 2JKGA 5FAPA 3LY3A 4E6WA 4Y0OA 3A3EA 5CERA 5FI6A 5FI7A 4L9EA 4PM8A 4X69A 4D2OA 3SS4A 5E43A 3RH8B 4HESA 5HARA 2HGVA 3NC8A 1KE0A 1ES2A 3QP6A 2XDMA 3GVBA 4KUOA 1ZTUA 4GDBA 4I3IA 4YNRA 3HLWA 1K54C 1GSVA 3LR3A 4OPQA 1PFLA 1XA1A 5E2HA 4MDZA 5EE8A 4EETB 3IXDA 1F9IA 3FPVA 1E3UD 3D4FA 5J8XA 1XJ2A 2XA7M 4RX2A 2XA7S 4OQGA 3ULFA 4JXSA 1ES3A 4KG6A 4L9GA 4ZRRA 3Q81A 4KENB 3FKVA 4BD1A 4ETXA 3E4OA 4G3WA 1GA9A 1NLZA 4IUHA 4BBUA 2WKPA 3LIBA 2ZMFA 2P08A 1LL5A 5HPFA 4HHDA 1IOUA 2WKHA 2ZOHA 1IYSA 4XXRA 4R4SA 1P9RA 3H7WA 3P09A 1N4OA 4OLGA 3UB6A 4F3LB 4G3KA 1TS6A 3C7VA 4OOLA 3V3SA 3D9YA 1LI9A 2DMWA 1K0KA 2X02A 3OLOA 4NXFA 2ZBBA 1VEUB 1P97A 2GJ3A 1XXMA 2B5RA 1BT5A 4WEJA 3C2WA 1NRJA 5DKKA 4B9OA 4KZ8A 4WMCD 5M18A 3N6IA 1FILA 3UE6A 4B93A 2ZQ7A 2VKSA 4WEKA 1H3QA 1SZVA 4E3NA 3B33A 1GHPA 4R0QA 4LGWA 3GMWA 4OQHA 2J9OA 4Z1WA 5IHVA 3CWFA 1KE3A 1TF1A 2JKFA 4KG2A 2XQZA 5EVIB 3GECA 1LI0A 4FSFA 1FCMA 2WUQA 3OPLA 1H8ZA 3MJQA 4II7A 1NY0A 3A3FA 3O5YA 4BL3A 2QJ5A 4JXWA 1VB6A 2ZQAA 3MR0A 4OPRA 1NLYA 5CGXA 4EBPA 1T18A 3C5AA 4Y15A 2DRWA 4X53A 3UB7A 4E3KA 1GHMA 4WELA 4OPZA 3ZFZA 3K2NA 1GSWA 3ZG5A 1ES4A 3E2LA 2H0TA 3QP8A 4GHIA 2LB5A 4X56A 3OPPA 2I9VA 3G2YA 1Z09A 4PM7A 5CGSA 1TDLA 3GQZA 1BLPA 1EI5A 2HV1A 3T50A 2ZC5B 3GR2A 3R4KA 4X1MA 5CTNA 3DBAA 1MWUA 5F1FA 1FR6A 2JHEA 2Y2IA 3UNWA 4Q0JA 3UDIA 4KZ3A 5DTTA 3NOPC 4P87A 3ZG9B 2W3EA 4QWOA 5FI2A 3HLBA 3S7OA 4E04A 4X25A 2E8IA 5FAOA 4NETA 1EW0A 3K3CA 2UWXA 5CHMA 1YMXA 4MBKA 3LYXA 4IUKA 2QYBA 3UN7A 3Q7ZA 2EFUA 2HP5A 2O99A 2KDKA 2DCFA 5FAQA 5HDSA 3NBLA 3VOYA 4LRXC 5DJTA 1YAXA 5HX9A 1E4DA 1SKOB 3IF5A 4MNRA 3BY9A 4E3OA 3IX8A 3N8SA 4M3KA 5CRFA 5L2FA 4IJGA 3EGXC 5HWTA 3PYPA 3S22A 1VM1A 3PBRA 2Y2MA 3G30A 4QB8A 2R9WA 2WGVA 4OH0A 4Q8IA 4LV1A 3HUMA 1LHYA 5IS1A 3UDFA 4MBHA 1T19A 4R3JA 2M7VA 3NULA 2VGKA 3PBSA 4DDSA 4ME4A 2EX9A 5HPIA 4DF6A 1KGEA 2Z6CA 5HAPA 3A0VA 2WGWB 1MBLA 2HDQA 1QMFA 4HP4A 1O7EA 1XX2A 4RYEA 2K7SA 3WS1A 4S2MA 4MN5A 4U0TA 2J3TD 3MXRA 4RQ9A 4GS9B 1W79A 2AVXA 5EVLA 1KGGA 3IF6C 4JKTA 1VETA 2A24B 1H8YA 3A0SA 3N7WA 3OCLA 1MPLA 2JN7A 4KG5A 3T1QB 3MQOA 1VHMA 5F5YA 4KQRA 2JKRI 4NG2A 3JPUA 1A0KA 3KYZA 1LSVA 2P9VB 3EWKA 4KZ9A 5M19A 2INWA 1K55A 4HBUA 4HJ3A 5GHXA 4ARZA 2ZD8A 4GNUA 1K6SA 4BENA 1ES5A 2I72A 2Z2LB 2VEAA 2WKEA 5HL6A 1D7EA 5FATA 1SKFA 4OQ0A 4AFIA 1N9LA 4R3AA 5CHJA 1F98A 2D02A 4P85A 4F3LA 3IWQA 5E2FA 3PBQA 2V0UA 3HUOA 4WZ5C 3IXHA 2Y91A 5G4ZA 1LLBA 3NOTC 1H0MA 1YSQA 3IBRA 2WKIA 1VEUA 3CPTB 5HDCA 4E3IA 4ZDXA 2W3FA 4GN2A 3V5MA 3KO6A 3S1YA 2Y2JA 1G68A 1LL9A 2P7JA 5FQQA 1NWZA 1UWPX 3ZNYA 2WZZA 1PWGA 3TG9A 2D01A 3G35A 4CLCC 1AWIA 3MFXA 2VX8A 4EBNA 5AQ7A 3NIAA 4S2NA 2Y4AA 3LIAA 1VQQA 3CLOA 2ZL1A 5EVIA 3OPHA 3BECA 4O0PA 4HH2A 4MMNA 5CXWA 1LL8A 3WS4A 1OTBA 3T4LA 4KQQA 4DE0A 4E3MA 2K31A 2PD7A 2ZC3B 5C5KA 3ZYTA 5EVEA 4KZBA 2J8YA 5KSHA 3HL9A 3HVFA 5L09A 4UQIM 4DN0A 4F94A 1G28A 4UQIS 3NY4A 5J7EA 3CMZA 3ZVWA 3MZEA 1FSWA 3S4XA 3T4OA 4IBRA 4NKPA 3KSHA 2J80A 4Q0HA 3IX4A 3PBNA 4DMZA 3G2ZA 1K56A 1YMSA 2WKRA 4WLAA 1FCOA 2J7VA 3Q1FA 3NDGA 3WRTA 1BUEA 1HLUP 4PHTA 1CQAA 3OOVA 2PAVP 3VE4A 3F1PB 5FQMA 5LBRA 3HREA 2PR6A 4UHUA 3E2KA 4HQAA 2EX6A 1MWSA 3W4OA 3UO9A 3NI9A 1YLPA 3BFFA 4QU3A 1JNUA 3IWOA 2WYXA 3IHBA 5CGWA 4P6BA 1SKOA 5F83A 1BYWA 1CF0A 1T1AA 3W4PA 4BBTA 2Q9MA 5GLDA 3GSGA 1E25A 4LENA 4R70A 1CEFA 3BLSA 1OJGA 3IWIA 4H8RA 1HD8A 5I5LA 2FZ0A 4UA9A 4CQHA 4CPKA 3V50A 3BM6A 4HIAA 4JBFA 4HY8A 2OAP1 5J4EA 4EWFA 2A3UA 4FCFA 5L8MA 4P0MA 2WGWA 4OKPA 2Y2HA 3LIDA 3A3DA 1K57C 5HWVA 5D3OA 4GOGA 5DF8A 1SHVA 1DY6A 1FR1A 2WK0A 5GL9A 4IBXA 2C5WB 1L3LA 3JVVA 1L0DA 1NZUA 2JBFA 1WE4A 3IQAA 4S2IA 3O87A 4I5SA 3ICYA 5TJJA 2A24A 2M1CA 5F69A 4KZ4A 3JVUA 4E3JA 1Q2PA 3VP2A 1YLYA 1N9OA 3N8RA 5CECA 1OTDA 1CK3A 3MSHA 3HLDA 2ZLYA 2QPNA 2GNXA 4PM5A 4DKIA 1U60A 5KIZA 3BFCA 4ZJ2A 2PHYA 2P9VA 5HAIA 2EA9A 4MEZA 2PDRA 5IU1A 2Y59A 5EM1A 3VP3A 3VOLA 3BYDA 2PT7A 4MCWA 3W8KA 1TDGA 5HWWA 3OC2A 1M6KA 3KYQA 2H28A 1ACFA 4OLDA 4E3LA 3V39A 3QNBA 4ZAMA 3ZDJA 1W8YA 4LLOB 3MKFA 4OQIA 3B47A 4EEUA 1FSYA 3AGDA 3A0RA 3E4PA 2EWVA 1DP8A 4QJGA 2RL3A 4R3BA 3IHAA 2HF6A 5AVFA 5J3WA 3LI9A 3CPTA 1XJ6A 2OLUA 3WRZA 3LR5A 1IELA 5EFWA 3BW6A 1KOUA 1NZOA 3MXSA 2B18A 1KVLA 1OPXA 2V8CA 1W8QA 1Q2QA 4EU0A 1NJ4A 3R7WB 3NOUC 2MJ6A 3Q7VA 1PWDA 2W3HA 2OWJA 4R23A 1P0ZA 3HCYA 4HNBA 1UGUA 1DJCA 1KDWA 2V1BA 3IXGA 1AXBA 4XUZA 5FL3A 3NHQA 3BQ8A 1KE4A 2ZC6B 1JTDA 5A8BA 4NXBA 1XFQA 4OONA 4DDYA 2GZAA 2JE5A 3HUNA 5F1GA 4YWZA 3LUQA 2UV0E 3ZGAB 2V8FA 4JXGA 4CLCD 4EUVA 2XROA 1ONHA 1JVJA 2KLIA 4MBFA 2XD5A 2M7UA 3FKWA 1JWZA 1ESIA 3VFFA 3SS3A 5G18A 2IWDA 4I38A 3VFHA 3KX0X 2ZJ9A 4R1GA 1E3UA 2V9AA 3QP4A 2PU4A 4O7DA 4JGRA 1Y28A 3CUEA 2L1MA 2HP9A 2ZQDA 1SDEA 2R9XA 3F1PA 4HP9A 1J9MA 4NXGA 2O9BA 4WN5A 4MN6A 4QPRA 1GHIA 3PHYA 1HZOA 4Z9QA 1OJ5A 2H10A 3NDEA 2XRNA 2HDSA 4PKYG 2XLNA 1XPBA 3UMDA 4C3QA 4GZBA 3UE3A 1SDNA 5DFXA 2EX2A 3RJUA 2Z2MB 2G2WA 4XUXA 2VJWA 3ZVTA 3NCKA 4EQIA 2K2NA 3GTCA 3PAEA 3B42A 2IWCA 2B02A 2IA2A 1Z6FA 1DRMA 4KQOA 3F1OB 4KZAA 2J9PA 4WMCA 4KQDA 3HJKA 1ZKJA 1BLCA 2NUPC 3G6OA 4OP8A 5EV0A 4G3VA 3SH8A 2HJ9C 4P6ZM 1W5DA 5EECA 1W7FA 2XFSA 4JGOA 3TOIA 1IKGA 4GD8A 2YKFA 1MWTA 2EWWA 3FV7A 2JCHA 1NYMA 1G6AA 2L4RA 2FH5A 2VV7A 1I2SA 4PM6A 3KSGA 3ZG8B 4UAAA 3IT9A 5DF7A 1F2KA 5EM0A 2L0WA 2ZM8A 5CX7A 1DP9A 4WUJA 1S66L 4ZJ3A 2WAFA 3UY6A 2PBYA 2EX8A 3MZDA 2OSUA 1PIOA 3ZG7B 2HP6A 3MF0A 2H5SA 3W4QA 1ERMA 3G34A 2BTFP 5HAQA 4R4RA 2QZ6A 5FQ9A 2Q9NA 5U47A 3G31A 5F68A 4HH3A 4H6JB 4L9FA 3DTIA 2W1TB 2A2LA 1N9BA 1YLJA 4S2JA 1S1YA 2JKTM 2CC1A 1XFNA 5FA7A 3E98A 5A91A 1XJ3A 3DWKA 4FUWA 3C8CA 2C6WB 4HJ6A 4DJ2A 4U3TA 2WADA 3DW0A 3BWLA 2PYRA 3UPOA 3MQQA 1IKIA 4BL2A 4LCLA 3BRMA 4WL9A 1K38A 2WGIA 2J3WA 2HPBA 3LO7A 3ZQ5A 3P7NA 1H8MA 1T1BA 3KYEA 4FD8A 5BOHA 1W63Q 1ESUA 4EEPA 3SH7A 4BQMA 1PNEA 4X55A 3VSKA 2ZMVA 1X0OA 4GD6A 2Y2NA 4DRTA 5GHZA 3Q07A 4WM9A 3HLCA 4RX3A 5G4YA 5DVAA 4ZTKA 1UWNX 2X01A 3HLFA 4JXVA 5HD3A 1BLHA 3MFDA 1MXOA 3R7WA 1CJFA 3LIEA 4NEED 4PAUA 3UE0A 3VSLA 2NUTC 5GLBA 1K55C 1S0WA 4ESPA 4Y17A 2PBDP 3A3JA 5HFOA 1PI4A 3LCEA 2RCXA 1LSXA 4EERA 2XFTA 3ZG0A 3L9KA 5HD5A 2JC7A 5CEDA 5FQIA 1GSXA 4PKYA 4I3AA 4FTXA 3EEHA 5GLAA 5JYOA 1PI5A 2O9CA 2W3GA 5HZHA 3MS6A 1F5MA 4N92A 4YINA 3U2AA 2H0YA 1D06A 2B95A 4DJ3A 3QHYA 1ZG4A 1YLWA 2ZM2A 2ZC4B 3G4PA 3PR6A 1O07A 3MBZA 3C38A 3SH9A 4BMWA 3JYIA 5KMWA 3ZCZA 1YLZA 5EUAA 4EUZA 2O9AA 3T12B 3T4TA 3T1XA 1K57A 5EOOA 3CAXA 1PWCA 1K54A
chains in the Genus database with same CATH topology
4OP5A 3WS2A 1CEGA 2UWXA 3IF6B 1YMXA 4S2NC 5CHMA 1W8YA 2V2FF 3MKFA 1BZAA 4MBKA 4OQIA 5AQAA 3SOIA 1FSYA 1L0EA 2ZC7A 3AGDA 2FFFB 4N1XA 5TR7A 5F82A 2A49A 1FCNA 3UN7A 3Q7ZA 3EQUA 4QJGA 4LV3A 4K0WA 3FWLA 4BLMA 2EFUA 2HP5A 4GB7A 5TFQA 2RL3A 1EROA 2DCFA 4HEFA 4R3BA 5FAQA 3VP0A 3I7JA 3NBLA 3IHAA 3VOYA 2G2UA 2IWBA 1CI9A 2OLUA 5DTSA 5HX9A 3WRZA 1E4DA 1GCEA 5CHUA 3HBRA 3IF5A 1XP4A 4JF4A 4MNRA 5E2EA 2VGJA 4E3OA 2BG1A 3N8SA 4M3KA 5CRFA 5L2FA 1IELA 3S22A 3HLEA 4WZ4A 5TGFA 1VM1A 1I5QA 1ONGA 2OLVA 3PBRA 1NZOA 4S2PA 1DJBA 2Y2MA 1PW8A 3G30A 3MXSA 4QB8A 1KVLA 1KGFA 2R9WA 1K4EA 2FFYA 2WGVA 3A3IA 4OH0A 4Q8IA 3P98A 4LV1A 2XR0A 1MWRA 1W8QA 3BEBA 3HUMA 4X6TA 5A92A 1Q2QA 1LHYA 3WS0A 4X68A 4LV2A 3UDFA 1NJ4A 1HVBA 4MBHA 4R3JA 5M1AA 2VGKA 3M2KA 3PBSA 3Q7VA 4DDSA 1HTZA 1PWDA 2EX9A 4DF6A 1KGEA 1RP5A 5HAPA 4R23A 3TSGA 2EXBA 3C4PA 3Q7VB 2WGWB 1DJCA 1KDWA 3IXGA 3VP1A 1AXBA 1MBLA 1QMEA 2HDQA 1QMFA 4XUZA 1O7EA 1XX2A 1CI8A 2ZQCA 3OZHA 4RYEA 1L0GA 4Y0TA 3WS1A 4S2MA 4DXBA 3PBTA 4U0TA 1XA7A 1TEMA 3MXRA 1KE4A 2ZC6B 1W79A 1JTDA 5EVLA 3UE1A 3V3RA 3ISGA 1KGGA 3MKEA 4QY6A 1IYOA 3IF6C 4JKTA 4OONA 1KVMA 4DDYA 5KZHA 2JE5A 3HUNA 3MZFA 5F1GA 1H8YA 3ZGAB 4BJPA 4DE1A 4JXGA 3N7WA 3QNCA 3OCLA 5FQJA 1ONHA 1JVJA 4MBFA 4EBLA 2XD5A 1MPLA 3FKWA 1JWZA 2Y2PA 1ESIA 1FOFA 1RGZA 1ZC2A 3GRJA 4S2LA 4KG5A 3VFFA 2XF3A 3SS3A 5G18A 2IWDA 1RCJA 2GDNA 2Y2QA 1MKIA 3CZDA 3O86A 4KQRA 3VFHA 4S2OA 5DF9A 2ZJ9A 1PZOA 4R1GA 1E3UA 3AGEA 2P9VB 4KZ9A 5M19A 3ITAA 1IYQA 1K55A 1K6RA 4HBUA 4K0XA 3UPPA 4PMAA 2PU4A 1YLTA 3IXBA 4O7DA 1BTLA 5GHXA 4C75A 3LY4A 2X71A 3CJMA 4IEDA 4GKUA 1KDSA 2ZD8A 2HP9A 2ZQDA 1C3BA 1SDEA 2EXAA 2R9XA 4GNUA 1K6SA 2V20A 4ZJ1A 4BENA 1ES5A 1XKZA 2I72A 3VOZA 1J9MA 2Z2LB 3PTEA 4Y7PA 2WKEA 4LCMA 4QHCA 5EVIC 2Y2GA 3CG5A 3OCNA 3Q82A 5FATA 1SKFA 4UA7A 5E2GA 4OQ0A 3RXXA 4DXCA 4PM9A 5CHJA 1XGIA 5CTMA 1GHIA 1HZOA 4Z9QA 3UPNA 5DTKA 2XK1A 1FQGA 3O88A 4P85A 2XEPA 2H10A 3IWQA 5E2FA 4ZBEA 3NDEA 2HDSA 3PBQA 2XLNA 3LEZA 1XPBA 2Y2KA 3BFDA 3HUOA 3IH9A 4DE3A 4C3QA 2HDRA 4WZ5C 5FSRA 3IH8A 3IXHA 4GZBA 3UE3A 1SDNA 2Y91A 1LLBA 1JWVA 1MY8A 4UA6A 2EX2A 1IYPA 4QY5A 4C6YA 1K25A 3RJUA 2Z2MB 2G2WA 3BFEA 3BLMA 4XUXA 4RA7A 1JTGA 2WKIA 1PZPA 5A90A 1BSGA 4IVKA 3ZVTA 3NCKA 4EQIA 2Y2LA 4NK3A 3EQVA 4Y0UA 4A5RA 4MLLA 4WBGA 4E3IA 2ZMAA 3GTCA 4ZDXA 4GN2A 3V5MA 1NRFA 1GA0A 1TVFA 3PAEA 5KSCA 3C7UA 3S1YA 2IWCA 3VP4A 4OVDA 2Y2JA 1M40A 1NXYA 2HDUA 1G68A 1LL9A 1Z6FA 5FQQA 4KQOA 5GHYA 3ZNYA 1RGYA 4KZAA 2J9PA 3B3XA 3LY3A 4WMCA 5FAPA 4B4XA 4E6WA 2WZZA 4OOYA 1PWGA 3TG9A 1ZKJA 4U0XA 1BLCA 3G35A 4Y0OA 4B88A 3A3EA 5CERA 2ZM0A 4E6XA 4EBNA 5AQ7A 5FI6A 3NIAA 5FI7A 1NYYA 4OP8A 5JYPA 4PM8A 4X69A 4D2OA 3SS4A 3SH8A 4S2NA 5E43A 4BD0A 1ERQA 2Y4AA 4HESA 5HARA 1VQQA 1W5DA 3NC8A 5EECA 1KE0A 1ES2A 3OPHA 5EVIA 2XDMA 3BECA 2BLSA 1W7FA 4KZ6A 3GVBA 2XFSA 5CXWA 5I94A 3WS4A 4KQQA 3TOIA 4DE0A 4E3MA 1IKGA 1YM1A 2ZC3B 4GD8A 1MWTA 1DJAA 3FV7A 2JCHA 1NYMA 4GDBA 1G6AA 1I2SA 4PM6A 2WAEA 3HLWA 3ZG8B 4UAAA 3IT9A 4KZBA 5DF7A 2J8YA 1K54C 2ZM8A 5KSHA 4ZJ3A 3UY6A 2WAFA 3HL9A 4L0LA 2XH9A 3HVFA 2PBYA 3RXWA 2EX8A 2V1ZA 4OPQA 1BLSA 3MZDA 2OSUA 1PIOA 3ZG7B 2HP6A 4F94A 1XA1A 5FASA 3NY4A 2H5SA 3CMZA 3ZVWA 3W4QA 3MZEA 1FSWA 1ERMA 3G34A 5E2HA 2Y2OA 3S4XA 5EE8A 4IBRA 3IXDA 4HBTA 5HAQA 4R4RA 2QZ6A 5FQ9A 1E3UD 3D4FA 2Q9NA 4OPYA 5U47A 3G31A 5J8XA 3PAGA 1WYBA 3PBNA 3G2ZA 4RX2A 2ZQ8A 4OQGA 4JXSA 1ES3A 4KG6A 2EFXA 1K56A 1YMSA 5A93A 1ZG6A 1N9BA 1FCOA 2J7VA 3Q81A 1YLJA 4KENB 4S2JA 3FKVA 3Q1FA 3NDGA 2CC1A 4BD1A 3WRTA 1BUEA 3ZHHA 3ZNTA 5FA7A 4EV4A 3M2JA 1L2SA 5A91A 3HLGA 2PU2A 3DWKA 2C6WB 4K91A 1GA9A 5FQMA 3PBOA 4U3TA 2WADA 3HREA 3DW0A 3UPOA 5EPHA 4N1HA 2P74A 1Y54A 4UHUA 3IF6A 3SS5A 1IKIA 4BL2A 3E2KA 2EX6A 3BRMA 4LCLA 1LL5A 1K38A 5EOEA 3AGFA 2WGIA 2HPBA 2WKHA 3LO7A 1IYSA 4XXRA 4R4SA 1MWSA 3W4OA 4OLGA 3P09A 1N4OA 5HW3A 3UO9A 3C7VA 3NI9A 4FD8A 4OOLA 3V3SA 5BOHA 1LI9A 1ESUA 4N9LA 1YLPA 3OPRA 3BFFA 3SH7A 4BQMA 4QU3A 3VMAA 3WS5A 3IWOA 2WYXA 2X02A 1PW1A 3IHBA 4X55A 1I2WA 3VSKA 5CGWA 4GD6A 4P6BA 3O3VA 1XGJA 1XXMA 4ID4A 5F83A 2Y2NA 4DRTA 2B5RA 1BT5A 4WEJA 3W4PA 5GHZA 3Q07A 4WM9A 2Q9MA 1SCWA 5GLDA 3GSGA 3HLCA 4KZ8A 5FQKA 1E25A 4WMCD 5M18A 4RX3A 4LENA 5FDHA 3N6IA 1CEFA 3BLSA 2ZQ7A 4KZ5A 4PPRA 4WEKA 2WZXA 3IWIA 5DVAA 4ZTKA 4H8RA 5AQBA 3HLFA 2X01A 1HD8A 3GV9A 4JXVA 1BLHA 3MFDA 4JPMA 4E3NA 1GHPA 1BULA 3BFGA 4UA9A 3DTMA 4LV0A 4R0QA 3GMWA 1MXOA 4OQHA 2J9OA 4CPKA 5AQ9A 5IHVA 3BM6A 3V50A 5EVID 4JLFA 1KE3A 4JBFA 4KG2A 3UE0A 3VSLA 4B4ZA 1H5XA 1S6RA 2XQZA 5EVIB 4S2KA 1LI0A 2XD1A 5GLBA 1K55C 1S0WA 4FSFA 2A3UA 4FCFA 1FCMA 1OMEA 4QD4A 4EWFA 4P0MA 1K4FA 2WUQA 3N4IA 2WGWA 3FYZA 2Y2HA 4OKPA 3A3JA 3OPLA 1EWZA 1H8ZA 1IEMA 1K57C 3A3DA 5D3OA 5HFOA 4WZ5A 4GOGA 3DWZA 2Y55A 5DF8A 1NY0A 1SHVA 2ZQ9A 1DY6A 1PI4A 3A3FA 3LCEA 1FR1A 2WK0A 5GL9A 4BL3A 3FZCA 5CEBA 4JXWA 2ZQAA 2C5WB 4IBXA 4OPRA 2RCXA 4YFMA 5CGXA 4JF5A 4OOMA 1L0DA 1NZUA 2JBFA 1WE4A 4EBPA 2XFTA 5HL1A 3ZG0A 3C5AA 3M6BA 3IQAA 2JC7A 4IVIA 4S2IA 5CEDA 5FQIA 2DRWA 4X53A 1L0FA 3O87A 2QMIA 5GLAA 4E3KA 1GHMA 4WELA 4OPZA 5JYOA 4KZ4A 1PI5A 4N9KA 3ZFZA 4FH4A 4E3JA 1Q2PA 1WYCA 3VP2A 1ALQA 3ZG5A 3WWXA 1ES4A 1YLYA 4N92A 4YINA 3N8RA 2H0YA 3E2LA 2H0TA 5CECA 3HLDA 1CK3A 1YQSA 2ZLYA 1YT4A 2QPNA 1PYYA 4X56A 3OPPA 4CJNA 3G2YA 4PM7A 5CGSA 4PM5A 1TDLA 3GQZA 3QHYA 3G32A 4DKIA 1BLPA 1EI5A 1U60A 4DE2A 1ZG4A 1K56D 2ZC5B 3GR2A 1YLWA 3BFCA 2DNSA 4ZJ2A 2ZM2A 4KZ7A 5CTNA 2P9VA 2ZC4B 1MWUA 3G4PA 5HAIA 4MEZA 4WYYA 1O07A 3MBZA 5F1FA 1FR6A 2Y2IA 3SH9A 2Y59A 3ITBA 3JYIA 4JF6A 3UNWA 3N8LA 3UDXA 5KMWA 1JWPA 3UDIA 4KZ3A 3VP3A 3ZCZA 5DTTA 3BYDA 3M6HA 4P87A 3W8KA 3ZG9B 1YLZA 1TDGA 5EUAA 5FI2A 3HLBA 3OC2A 4EUZA 1M6KA 4RVAA 1K57A 5EOOA 4FH2A 2E8IA 2XGNA 4GDNA 3C4OA 4OLDA 4E3LA 5FAOA 3V39A 1PWCA 3QNBA 4ZAMA 2OV5A 3ZDJA 4NETA 1K54A 5GLCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OP5 A;  3WS2 A;  1CEG A;  2UWX A;  3IF6 B;  1YMX A;  4S2N C;  5CHM A;  1W8Y A;  2V2F F;  3MKF A;  1BZA A;  4MBK A;  4OQI A;  5AQA A;  3SOI A;  1FSY A;  1L0E A;  2ZC7 A;  3AGD A;  2FFF B;  4N1X A;  5TR7 A;  5F82 A;  2A49 A;  1FCN A;  3UN7 A;  3Q7Z A;  3EQU A;  4QJG A;  4LV3 A;  4K0W A;  3FWL A;  4BLM A;  2EFU A;  2HP5 A;  4GB7 A;  5TFQ A;  2RL3 A;  1ERO A;  2DCF A;  4HEF A;  4R3B A;  5FAQ A;  3VP0 A;  3I7J A;  3NBL A;  3IHA A;  3VOY A;  2G2U A;  2IWB A;  1CI9 A;  2OLU A;  5DTS A;  5HX9 A;  3WRZ A;  1E4D A;  1GCE A;  5CHU A;  3HBR A;  3IF5 A;  1XP4 A;  4JF4 A;  4MNR A;  5E2E A;  2VGJ A;  4E3O A;  2BG1 A;  3N8S A;  4M3K A;  5CRF A;  5L2F A;  1IEL A;  3S22 A;  3HLE A;  4WZ4 A;  5TGF A;  1VM1 A;  1I5Q A;  1ONG A;  2OLV A;  3PBR A;  1NZO A;  4S2P A;  1DJB A;  2Y2M A;  1PW8 A;  3G30 A;  3MXS A;  4QB8 A;  1KVL A;  1KGF A;  2R9W A;  1K4E A;  2FFY A;  2WGV A;  3A3I A;  4OH0 A;  4Q8I A;  3P98 A;  4LV1 A;  2XR0 A;  1MWR A;  1W8Q A;  3BEB A;  3HUM A;  4X6T A;  5A92 A;  1Q2Q A;  1LHY A;  3WS0 A;  4X68 A;  4LV2 A;  3UDF A;  1NJ4 A;  1HVB A;  4MBH A;  4R3J A;  5M1A A;  2VGK A;  3M2K A;  3PBS A;  3Q7V A;  4DDS A;  1HTZ A;  1PWD A;  2EX9 A;  4DF6 A;  1KGE A;  1RP5 A;  5HAP A;  4R23 A;  3TSG A;  2EXB A;  3C4P A;  3Q7V B;  2WGW B;  1DJC A;  1KDW A;  3IXG A;  3VP1 A;  1AXB A;  1MBL A;  1QME A;  2HDQ A;  1QMF A;  4XUZ A;  1O7E A;  1XX2 A;  1CI8 A;  2ZQC A;  3OZH A;  4RYE A;  1L0G A;  4Y0T A;  3WS1 A;  4S2M A;  4DXB A;  3PBT A;  4U0T A;  1XA7 A;  1TEM A;  3MXR A;  1KE4 A;  2ZC6 B;  1W79 A;  1JTD A;  5EVL A;  3UE1 A;  3V3R A;  3ISG A;  1KGG A;  3MKE A;  4QY6 A;  1IYO A;  3IF6 C;  4JKT A;  4OON A;  1KVM A;  4DDY A;  5KZH A;  2JE5 A;  3HUN A;  3MZF A;  5F1G A;  1H8Y A;  3ZGA B;  4BJP A;  4DE1 A;  4JXG A;  3N7W A;  3QNC A;  3OCL A;  5FQJ A;  1ONH A;  1JVJ A;  4MBF A;  4EBL A;  2XD5 A;  1MPL A;  3FKW A;  1JWZ A;  2Y2P A;  1ESI A;  1FOF A;  1RGZ A;  1ZC2 A;  3GRJ A;  4S2L A;  4KG5 A;  3VFF A;  2XF3 A;  3SS3 A;  5G18 A;  2IWD A;  1RCJ A;  2GDN A;  2Y2Q A;  1MKI A;  3CZD A;  3O86 A;  4KQR A;  3VFH A;  4S2O A;  5DF9 A;  2ZJ9 A;  1PZO A;  4R1G A;  1E3U A;  3AGE A;  2P9V B;  4KZ9 A;  5M19 A;  3ITA A;  1IYQ A;  1K55 A;  1K6R A;  4HBU A;  4K0X A;  3UPP A;  4PMA A;  2PU4 A;  1YLT A;  3IXB A;  4O7D A;  1BTL A;  5GHX A;  4C75 A;  3LY4 A;  2X71 A;  3CJM A;  4IED A;  4GKU A;  1KDS A;  2ZD8 A;  2HP9 A;  2ZQD A;  1C3B A;  1SDE A;  2EXA A;  2R9X A;  4GNU A;  1K6S A;  2V20 A;  4ZJ1 A;  4BEN A;  1ES5 A;  1XKZ A;  2I72 A;  3VOZ A;  1J9M A;  2Z2L B;  3PTE A;  4Y7P A;  2WKE A;  4LCM A;  4QHC A;  5EVI C;  2Y2G A;  3CG5 A;  3OCN A;  3Q82 A;  5FAT A;  1SKF A;  4UA7 A;  5E2G A;  4OQ0 A;  3RXX A;  4DXC A;  4PM9 A;  5CHJ A;  1XGI A;  5CTM A;  1GHI A;  1HZO A;  4Z9Q A;  3UPN A;  5DTK A;  2XK1 A;  1FQG A;  3O88 A;  4P85 A;  2XEP A;  2H10 A;  3IWQ A;  5E2F A;  4ZBE A;  3NDE A;  2HDS A;  3PBQ A;  2XLN A;  3LEZ A;  1XPB A;  2Y2K A;  3BFD A;  3HUO A;  3IH9 A;  4DE3 A;  4C3Q A;  2HDR A;  4WZ5 C;  5FSR A;  3IH8 A;  3IXH A;  4GZB A;  3UE3 A;  1SDN A;  2Y91 A;  1LLB A;  1JWV A;  1MY8 A;  4UA6 A;  2EX2 A;  1IYP A;  4QY5 A;  4C6Y A;  1K25 A;  3RJU A;  2Z2M B;  2G2W A;  3BFE A;  3BLM A;  4XUX A;  4RA7 A;  1JTG A;  2WKI A;  1PZP A;  5A90 A;  1BSG A;  4IVK A;  3ZVT A;  3NCK A;  4EQI A;  2Y2L A;  4NK3 A;  3EQV A;  4Y0U A;  4A5R A;  4MLL A;  4WBG A;  4E3I A;  2ZMA A;  3GTC A;  4ZDX A;  4GN2 A;  3V5M A;  1NRF A;  1GA0 A;  1TVF A;  3PAE A;  5KSC A;  3C7U A;  3S1Y A;  2IWC A;  3VP4 A;  4OVD A;  2Y2J A;  1M40 A;  1NXY A;  2HDU A;  1G68 A;  1LL9 A;  1Z6F A;  5FQQ A;  4KQO A;  5GHY A;  3ZNY A;  1RGY A;  4KZA A;  2J9P A;  3B3X A;  3LY3 A;  4WMC A;  5FAP A;  4B4X A;  4E6W A;  2WZZ A;  4OOY A;  1PWG A;  3TG9 A;  1ZKJ A;  4U0X A;  1BLC A;  3G35 A;  4Y0O A;  4B88 A;  3A3E A;  5CER A;  2ZM0 A;  4E6X A;  4EBN A;  5AQ7 A;  5FI6 A;  3NIA A;  5FI7 A;  1NYY A;  4OP8 A;  5JYP A;  4PM8 A;  4X69 A;  4D2O A;  3SS4 A;  3SH8 A;  4S2N A;  5E43 A;  4BD0 A;  1ERQ A;  2Y4A A;  4HES A;  5HAR A;  1VQQ A;  1W5D A;  3NC8 A;  5EEC A;  1KE0 A;  1ES2 A;  3OPH A;  5EVI A;  2XDM A;  3BEC A;  2BLS A;  1W7F A;  4KZ6 A;  3GVB A;  2XFS A;  5CXW A;  5I94 A;  3WS4 A;  4KQQ A;  3TOI A;  4DE0 A;  4E3M A;  1IKG A;  1YM1 A;  2ZC3 B;  4GD8 A;  1MWT A;  1DJA A;  3FV7 A;  2JCH A;  1NYM A;  4GDB A;  1G6A A;  1I2S A;  4PM6 A;  2WAE A;  3HLW A;  3ZG8 B;  4UAA A;  3IT9 A;  4KZB A;  5DF7 A;  2J8Y A;  1K54 C;  2ZM8 A;  5KSH A;  4ZJ3 A;  3UY6 A;  2WAF A;  3HL9 A;  4L0L A;  2XH9 A;  3HVF A;  2PBY A;  3RXW A;  2EX8 A;  2V1Z A;  4OPQ A;  1BLS A;  3MZD A;  2OSU A;  1PIO A;  3ZG7 B;  2HP6 A;  4F94 A;  1XA1 A;  5FAS A;  3NY4 A;  2H5S A;  3CMZ A;  3ZVW A;  3W4Q A;  3MZE A;  1FSW A;  1ERM A;  3G34 A;  5E2H A;  2Y2O A;  3S4X A;  5EE8 A;  4IBR A;  3IXD A;  4HBT A;  5HAQ A;  4R4R A;  2QZ6 A;  5FQ9 A;  1E3U D;  3D4F A;  2Q9N A;  4OPY A;  5U47 A;  3G31 A;  5J8X A;  3PAG A;  1WYB A;  3PBN A;  3G2Z A;  4RX2 A;  2ZQ8 A;  4OQG A;  4JXS A;  1ES3 A;  4KG6 A;  2EFX A;  1K56 A;  1YMS A;  5A93 A;  1ZG6 A;  1N9B A;  1FCO A;  2J7V A;  3Q81 A;  1YLJ A;  4KEN B;  4S2J A;  3FKV A;  3Q1F A;  3NDG A;  2CC1 A;  4BD1 A;  3WRT A;  1BUE A;  3ZHH A;  3ZNT A;  5FA7 A;  4EV4 A;  3M2J A;  1L2S A;  5A91 A;  3HLG A;  2PU2 A;  3DWK A;  2C6W B;  4K91 A;  1GA9 A;  5FQM A;  3PBO A;  4U3T A;  2WAD A;  3HRE A;  3DW0 A;  3UPO A;  5EPH A;  4N1H A;  2P74 A;  1Y54 A;  4UHU A;  3IF6 A;  3SS5 A;  1IKI A;  4BL2 A;  3E2K A;  2EX6 A;  3BRM A;  4LCL A;  1LL5 A;  1K38 A;  5EOE A;  3AGF A;  2WGI A;  2HPB A;  2WKH A;  3LO7 A;  1IYS A;  4XXR A;  4R4S A;  1MWS A;  3W4O A;  4OLG A;  3P09 A;  1N4O A;  5HW3 A;  3UO9 A;  3C7V A;  3NI9 A;  4FD8 A;  4OOL A;  3V3S A;  5BOH A;  1LI9 A;  1ESU A;  4N9L A;  1YLP A;  3OPR A;  3BFF A;  3SH7 A;  4BQM A;  4QU3 A;  3VMA A;  3WS5 A;  3IWO A;  2WYX A;  2X02 A;  1PW1 A;  3IHB A;  4X55 A;  1I2W A;  3VSK A;  5CGW A;  4GD6 A;  4P6B A;  3O3V A;  1XGJ A;  1XXM A;  4ID4 A;  5F83 A;  2Y2N A;  4DRT A;  2B5R A;  1BT5 A;  4WEJ A;  3W4P A;  5GHZ A;  3Q07 A;  4WM9 A;  2Q9M A;  1SCW A;  5GLD A;  3GSG A;  3HLC A;  4KZ8 A;  5FQK A;  1E25 A;  4WMC D;  5M18 A;  4RX3 A;  4LEN A;  5FDH A;  3N6I A;  1CEF A;  3BLS A;  2ZQ7 A;  4KZ5 A;  4PPR A;  4WEK A;  2WZX A;  3IWI A;  5DVA A;  4ZTK A;  4H8R A;  5AQB A;  3HLF A;  2X01 A;  1HD8 A;  3GV9 A;  4JXV A;  1BLH A;  3MFD A;  4JPM A;  4E3N A;  1GHP A;  1BUL A;  3BFG A;  4UA9 A;  3DTM A;  4LV0 A;  4R0Q A;  3GMW A;  1MXO A;  4OQH A;  2J9O A;  4CPK A;  5AQ9 A;  5IHV A;  3BM6 A;  3V50 A;  5EVI D;  4JLF A;  1KE3 A;  4JBF A;  4KG2 A;  3UE0 A;  3VSL A;  4B4Z A;  1H5X A;  1S6R A;  2XQZ A;  5EVI B;  4S2K A;  1LI0 A;  2XD1 A;  5GLB A;  1K55 C;  1S0W A;  4FSF A;  2A3U A;  4FCF A;  1FCM A;  1OME A;  4QD4 A;  4EWF A;  4P0M A;  1K4F A;  2WUQ A;  3N4I A;  2WGW A;  3FYZ A;  2Y2H A;  4OKP A;  3A3J A;  3OPL A;  1EWZ A;  1H8Z A;  1IEM A;  1K57 C;  3A3D A;  5D3O A;  5HFO A;  4WZ5 A;  4GOG A;  3DWZ A;  2Y55 A;  5DF8 A;  1NY0 A;  1SHV A;  2ZQ9 A;  1DY6 A;  1PI4 A;  3A3F A;  3LCE A;  1FR1 A;  2WK0 A;  5GL9 A;  4BL3 A;  3FZC A;  5CEB A;  4JXW A;  2ZQA A;  2C5W B;  4IBX A;  4OPR A;  2RCX A;  4YFM A;  5CGX A;  4JF5 A;  4OOM A;  1L0D A;  1NZU A;  2JBF A;  1WE4 A;  4EBP A;  2XFT A;  5HL1 A;  3ZG0 A;  3C5A A;  3M6B A;  3IQA A;  2JC7 A;  4IVI A;  4S2I A;  5CED A;  5FQI A;  2DRW A;  4X53 A;  1L0F A;  3O87 A;  2QMI A;  5GLA A;  4E3K A;  1GHM A;  4WEL A;  4OPZ A;  5JYO A;  4KZ4 A;  1PI5 A;  4N9K A;  3ZFZ A;  4FH4 A;  4E3J A;  1Q2P A;  1WYC A;  3VP2 A;  1ALQ A;  3ZG5 A;  3WWX A;  1ES4 A;  1YLY A;  4N92 A;  4YIN A;  3N8R A;  2H0Y A;  3E2L A;  2H0T A;  5CEC A;  3HLD A;  1CK3 A;  1YQS A;  2ZLY A;  1YT4 A;  2QPN A;  1PYY A;  4X56 A;  3OPP A;  4CJN A;  3G2Y A;  4PM7 A;  5CGS A;  4PM5 A;  1TDL A;  3GQZ A;  3QHY A;  3G32 A;  4DKI A;  1BLP A;  1EI5 A;  1U60 A;  4DE2 A;  1ZG4 A;  1K56 D;  2ZC5 B;  3GR2 A;  1YLW A;  3BFC A;  2DNS A;  4ZJ2 A;  2ZM2 A;  4KZ7 A;  5CTN A;  2P9V A;  2ZC4 B;  1MWU A;  3G4P A;  5HAI A;  4MEZ A;  4WYY A;  1O07 A;  3MBZ A;  5F1F A;  1FR6 A;  2Y2I A;  3SH9 A;  2Y59 A;  3ITB A;  3JYI A;  4JF6 A;  3UNW A;  3N8L A;  3UDX A;  5KMW A;  1JWP A;  3UDI A;  4KZ3 A;  3VP3 A;  3ZCZ A;  5DTT A;  3BYD A;  3M6H A;  4P87 A;  3W8K A;  3ZG9 B;  1YLZ A;  1TDG A;  5EUA A;  5FI2 A;  3HLB A;  3OC2 A;  4EUZ A;  1M6K A;  4RVA A;  1K57 A;  5EOO A;  4FH2 A;  2E8I A;  2XGN A;  4GDN A;  3C4O A;  4OLD A;  4E3L A;  5FAO A;  3V39 A;  1PWC A;  3QNB A;  4ZAM A;  2OV5 A;  3ZDJ A;  4NET A;  1K54 A;  5GLC A; 
#chains in the Genus database with same CATH topology
 4OP5 A;  3IF6 B;  4S2N C;  2O0Y A;  2QWS A;  4HJ4 A;  2V2F F;  1Y4O A;  1BZA A;  3SOI A;  1L0E A;  2FFF B;  2QKP A;  5TR7 A;  2A49 A;  1FCN A;  3EEA A;  4LV3 A;  4K0W A;  3V67 A;  4BLM A;  3T1S A;  1ERO A;  4YOF A;  4HEF A;  5DKL A;  3VP0 A;  3I7J A;  4UEY A;  5DTS A;  3HBR A;  3CI6 A;  3F1N B;  1XP4 A;  4JF4 A;  5E2E A;  3LFV A;  3S7P A;  2ACG A;  3LI8 A;  2VV6 A;  3F1O A;  2VGL M;  3H9W A;  4WZ4 A;  2OLV A;  1I5Q A;  1ONG A;  1DJB A;  2VGL S;  1PW8 A;  2XSS A;  1KGF A;  1K4E A;  3BEB A;  1MWR A;  4X6T A;  5A92 A;  4EW7 A;  3T4S A;  1HVB A;  3H82 B;  3M2K A;  3BJN A;  1YPR A;  2EXB A;  3VP1 A;  1MZU A;  4GS9 A;  4Y0T A;  4DXB A;  3PBT A;  3P01 A;  1XA7 A;  1TEM A;  2YKH A;  2KOI A;  3V3R A;  3MKE A;  3T1R A;  4QY6 A;  3KSF A;  3MZF A;  4R6L A;  4DE1 A;  1VET B;  2G7U A;  2Y79 A;  4EBL A;  4CLC B;  1FOF A;  4S2L A;  1W63 M;  2XF3 A;  5FDS A;  4EXO A;  1RCJ A;  2GDN A;  4Y3I A;  3DTK A;  2Y2Q A;  1MKI A;  3CZD A;  3MMH A;  3O86 A;  4S2O A;  5DF9 A;  4H6J A;  5IT5 A;  5AVE A;  3ITA A;  1IYQ A;  1ODV A;  2QHK A;  2W1T A;  1K6R A;  4K0X A;  3UPP A;  5FEG A;  1OT6 A;  4PMA A;  1YLT A;  3IXB A;  1BTL A;  4C75 A;  4XT2 B;  3LY4 A;  3CJM A;  3IX3 A;  3D72 A;  3MQ0 A;  1KDS A;  1C3B A;  4ZJ1 A;  1XKZ A;  4ARZ B;  1OTE A;  3PTE A;  4QHC A;  1TS0 A;  3Q82 A;  4UA7 A;  4DXC A;  2PYP A;  3VV4 A;  1XGI A;  5CTM A;  2XK1 A;  1FQG A;  3O88 A;  2XEP A;  1FIK A;  3SW1 A;  3LEZ A;  3BFD A;  2Y2K A;  4DE3 A;  5FSR A;  3BY8 A;  1OTI A;  3PXP A;  4UA6 A;  1IYP A;  4QY5 A;  4C6Y A;  3BFE A;  3BLM A;  3T4Q A;  4RA7 A;  1JTG A;  1MKM A;  5A90 A;  4IVK A;  2PRF A;  2Y2L A;  4NK3 A;  4Y0U A;  4WBG A;  2ZMA A;  5DJU A;  3MXQ A;  3U4L P;  4OVD A;  1M40 A;  2HJE A;  1RGY A;  4B4X A;  3B3X A;  4OOY A;  2R78 A;  4U0X A;  4B88 A;  2ZM0 A;  4E6X A;  4ETZ A;  1NYY A;  4R38 A;  2OWH A;  5JYP A;  4JGP A;  1ERQ A;  4IHQ A;  4BD0 A;  4I39 A;  2P04 A;  1G6O A;  2BLS A;  4KZ6 A;  4Y5F A;  5I94 A;  2ZL1 B;  5AJG A;  2W1R A;  1YM1 A;  1DJA A;  2WAE A;  4GLQ A;  4FOF A;  4L0L A;  1XJ4 A;  4LPZ A;  2XH9 A;  3GDI A;  3RXW A;  2PD8 A;  3K3D A;  2V1Z A;  4LFU A;  1BLS A;  4BWI A;  5FAS A;  2VZW A;  4EQ1 A;  2V1A A;  2Y2O A;  2CMN A;  4I3J A;  4HBT A;  3FC7 A;  5TBM B;  4OPY A;  1LSW A;  3PAG A;  1V9Z A;  1WYB A;  4HI4 A;  2ZQ8 A;  2VA0 A;  2EFX A;  1ZHH B;  5A93 A;  1ZG6 A;  3ZHH A;  3ZNT A;  3OBF A;  4EV4 A;  3M2J A;  1L2S A;  2PR5 A;  3CHW P;  3HLG A;  2PU2 A;  4K91 A;  3T4K A;  3PBO A;  4X1L A;  5EPH A;  4N1H A;  2P74 A;  1Y54 A;  4WF0 A;  3IF6 A;  3SS5 A;  4Y13 A;  4KUK A;  2ZOI A;  5EOE A;  3AGF A;  1P9W A;  5HW3 A;  2E8J A;  4N9L A;  2W27 A;  3OPR A;  2V0W A;  3VMA A;  3WS5 A;  5FEF A;  1S4R A;  3L7H A;  1PW1 A;  1I2W A;  3LEQ A;  4EES A;  3O3V A;  1XGJ A;  3QP2 A;  2JKT I;  3IS2 B;  4ID4 A;  1S1Z A;  3F1N A;  1SCW A;  3NEC A;  1N9N A;  1V9Y A;  5FQK A;  4Q0I A;  5FDH A;  4KZ5 A;  4PPR A;  2WZX A;  4NXE A;  5AQB A;  3GV9 A;  4JPM A;  1OTA A;  1BUL A;  3BFG A;  3DTM A;  3LR0 A;  4LV0 A;  4O8G A;  2OAQ 1;  3VE3 A;  4P6Z S;  1DP6 A;  3QP1 A;  5AQ9 A;  5EVI D;  4JLF A;  3H82 A;  1S67 L;  4B4Z A;  1H5X A;  1S6R A;  4S2K A;  2XD1 A;  4QD4 A;  1OME A;  1K4F A;  3N4I A;  3FYZ A;  5K5B A;  1EWZ A;  1IEM A;  4WZ5 A;  4CLC E;  3DWZ A;  3CUE C;  2Y55 A;  4GW9 A;  2ZQ9 A;  3DTE A;  3FG8 A;  5CEB A;  3FZC A;  4YFM A;  2BAS A;  3E4Q A;  4JF5 A;  4OOM A;  5HL1 A;  3M6B A;  4IVI A;  1L0F A;  2QMI A;  4HOI A;  4N9K A;  4BBV A;  4FH4 A;  1WYC A;  2Q0O A;  1ALQ A;  3WWX A;  4CLC A;  5L07 A;  3S7N A;  1TD5 A;  1YQS A;  1YT4 A;  1PYY A;  4CJN A;  3EOI A;  3G32 A;  1PRQ A;  4DE2 A;  1K56 D;  2DNS A;  1LT0 A;  4KZ7 A;  1WA9 A;  3TJZ C;  4WYY A;  3LGO A;  3ITB A;  4JF6 A;  3N8L A;  3UDX A;  1JWP A;  2OOL A;  4XT2 A;  3M6H A;  4RVA A;  4FH2 A;  3UB8 A;  2XGN A;  4GDN A;  1D1J A;  3C4O A;  2KX6 A;  1TS8 A;  3IBJ A;  4MN7 A;  2OV5 A;  5GLC A;  3WS2 A;  1CEG A;  2HZ5 A;  2Y8H A;  3S7Q A;  5AQA A;  2ZC7 A;  3BQA A;  3H7W B;  4N1X A;  5F82 A;  3EQU A;  3FWL A;  4Y2F A;  5TFQ A;  4GB7 A;  1STZ A;  2QJ7 A;  3TE8 A;  5L10 A;  1MC0 A;  2G2U A;  2IWB A;  1CI9 A;  2WKQ A;  1GCE A;  5CHU A;  1G5U A;  4K08 A;  2VGJ A;  2BG1 A;  3HLE A;  5TGF A;  4S2P A;  3UB9 A;  2FFY A;  3A3I A;  1IFQ A;  2VK3 A;  3P98 A;  2VV8 A;  2XR0 A;  3WS0 A;  4X68 A;  4LV2 A;  2W0N A;  3UME A;  3CIT A;  5M1A A;  4JGQ A;  3RTY A;  1HTZ A;  3QP5 A;  4GJ4 A;  1RP5 A;  3TSG A;  3C4P A;  2JKR M;  3Q7V B;  1QME A;  3TRC A;  1CI8 A;  2ZQC A;  3OZH A;  3LIC A;  3TW8 A;  1L0G A;  1S4S A;  3T4J A;  3E0Y A;  3UE1 A;  3ISG A;  1T1C A;  1IYO A;  4LRZ E;  1KVM A;  5KZH A;  5F6A A;  3LR4 A;  4BJP A;  3SZT A;  1TS7 A;  3QNC A;  5FQJ A;  3D3O A;  2Y2P A;  1ZC2 A;  1RGZ A;  3GRJ A;  4GHI B;  5TBM A;  2Z6D A;  1PZO A;  3AGE A;  3LIF A;  1J3W A;  4GCZ A;  2X71 A;  4IED A;  3KSI A;  4GKU A;  3W2Z A;  1YKD A;  2EXA A;  2V20 A;  3VOZ A;  3UB5 P;  4Y7P A;  2VLG A;  4LCM A;  3EGD C;  5EVI C;  2Y2G A;  3CG5 A;  3OCN A;  4D60 A;  4M4X A;  5E2G A;  3RXX A;  4PM9 A;  2W3D A;  3UPN A;  5DTK A;  3FPW A;  3NJA A;  4O01 A;  1YSP A;  3C30 A;  4ZBE A;  3RFB A;  3IH9 A;  5HDD A;  5MC7 A;  2HDR A;  3IH8 A;  1MY8 A;  1JWV A;  2GX5 A;  1K25 A;  4LRY C;  1OT9 A;  3DAV A;  1PZP A;  1BSG A;  2LB9 A;  3EQV A;  2J3T C;  3HJI A;  3IS2 A;  4MLL A;  4A5R A;  1TVF A;  1NRF A;  1GA0 A;  5KSC A;  3C7U A;  3VP4 A;  1NXY A;  2HDU A;  5DFY A;  5HSQ A;  5GHY A;  2JKG A;  5FAP A;  3LY3 A;  4E6W A;  4Y0O A;  3A3E A;  5CER A;  5FI6 A;  5FI7 A;  4L9E A;  4PM8 A;  4X69 A;  4D2O A;  3SS4 A;  5E43 A;  3RH8 B;  4HES A;  5HAR A;  2HGV A;  3NC8 A;  1KE0 A;  1ES2 A;  3QP6 A;  2XDM A;  3GVB A;  4KUO A;  1ZTU A;  4GDB A;  4I3I A;  4YNR A;  3HLW A;  1K54 C;  1GSV A;  3LR3 A;  4OPQ A;  1PFL A;  1XA1 A;  5E2H A;  4MDZ A;  5EE8 A;  4EET B;  3IXD A;  1F9I A;  3FPV A;  1E3U D;  3D4F A;  5J8X A;  1XJ2 A;  2XA7 M;  4RX2 A;  2XA7 S;  4OQG A;  3ULF A;  4JXS A;  1ES3 A;  4KG6 A;  4L9G A;  4ZRR A;  3Q81 A;  4KEN B;  3FKV A;  4BD1 A;  4ETX A;  3E4O A;  4G3W A;  1GA9 A;  1NLZ A;  4IUH A;  4BBU A;  2WKP A;  3LIB A;  2ZMF A;  2P08 A;  1LL5 A;  5HPF A;  4HHD A;  1IOU A;  2WKH A;  2ZOH A;  1IYS A;  4XXR A;  4R4S A;  1P9R A;  3H7W A;  3P09 A;  1N4O A;  4OLG A;  3UB6 A;  4F3L B;  4G3K A;  1TS6 A;  3C7V A;  4OOL A;  3V3S A;  3D9Y A;  1LI9 A;  2DMW A;  1K0K A;  2X02 A;  3OLO A;  4NXF A;  2ZBB A;  1VEU B;  1P97 A;  2GJ3 A;  1XXM A;  2B5R A;  1BT5 A;  4WEJ A;  3C2W A;  1NRJ A;  5DKK A;  4B9O A;  4KZ8 A;  4WMC D;  5M18 A;  3N6I A;  1FIL A;  3UE6 A;  4B93 A;  2ZQ7 A;  2VKS A;  4WEK A;  1H3Q A;  1SZV A;  4E3N A;  3B33 A;  1GHP A;  4R0Q A;  4LGW A;  3GMW A;  4OQH A;  2J9O A;  4Z1W A;  5IHV A;  3CWF A;  1KE3 A;  1TF1 A;  2JKF A;  4KG2 A;  2XQZ A;  5EVI B;  3GEC A;  1LI0 A;  4FSF A;  1FCM A;  2WUQ A;  3OPL A;  1H8Z A;  3MJQ A;  4II7 A;  1NY0 A;  3A3F A;  3O5Y A;  4BL3 A;  2QJ5 A;  4JXW A;  1VB6 A;  2ZQA A;  3MR0 A;  4OPR A;  1NLY A;  5CGX A;  4EBP A;  1T18 A;  3C5A A;  4Y15 A;  2DRW A;  4X53 A;  3UB7 A;  4E3K A;  1GHM A;  4WEL A;  4OPZ A;  3ZFZ A;  3K2N A;  1GSW A;  3ZG5 A;  1ES4 A;  3E2L A;  2H0T A;  3QP8 A;  4GHI A;  2LB5 A;  4X56 A;  3OPP A;  2I9V A;  3G2Y A;  1Z09 A;  4PM7 A;  5CGS A;  1TDL A;  3GQZ A;  1BLP A;  1EI5 A;  2HV1 A;  3T50 A;  2ZC5 B;  3GR2 A;  3R4K A;  4X1M A;  5CTN A;  3DBA A;  1MWU A;  5F1F A;  1FR6 A;  2JHE A;  2Y2I A;  3UNW A;  4Q0J A;  3UDI A;  4KZ3 A;  5DTT A;  3NOP C;  4P87 A;  3ZG9 B;  2W3E A;  4QWO A;  5FI2 A;  3HLB A;  3S7O A;  4E04 A;  4X25 A;  2E8I A;  5FAO A;  4NET A;  1EW0 A;  3K3C A;  2UWX A;  5CHM A;  1YMX A;  4MBK A;  3LYX A;  4IUK A;  2QYB A;  3UN7 A;  3Q7Z A;  2EFU A;  2HP5 A;  2O99 A;  2KDK A;  2DCF A;  5FAQ A;  5HDS A;  3NBL A;  3VOY A;  4LRX C;  5DJT A;  1YAX A;  5HX9 A;  1E4D A;  1SKO B;  3IF5 A;  4MNR A;  3BY9 A;  4E3O A;  3IX8 A;  3N8S A;  4M3K A;  5CRF A;  5L2F A;  4IJG A;  3EGX C;  5HWT A;  3PYP A;  3S22 A;  1VM1 A;  3PBR A;  2Y2M A;  3G30 A;  4QB8 A;  2R9W A;  2WGV A;  4OH0 A;  4Q8I A;  4LV1 A;  3HUM A;  1LHY A;  5IS1 A;  3UDF A;  4MBH A;  1T19 A;  4R3J A;  2M7V A;  3NUL A;  2VGK A;  3PBS A;  4DDS A;  4ME4 A;  2EX9 A;  5HPI A;  4DF6 A;  1KGE A;  2Z6C A;  5HAP A;  3A0V A;  2WGW B;  1MBL A;  2HDQ A;  1QMF A;  4HP4 A;  1O7E A;  1XX2 A;  4RYE A;  2K7S A;  3WS1 A;  4S2M A;  4MN5 A;  4U0T A;  2J3T D;  3MXR A;  4RQ9 A;  4GS9 B;  1W79 A;  2AVX A;  5EVL A;  1KGG A;  3IF6 C;  4JKT A;  1VET A;  2A24 B;  1H8Y A;  3A0S A;  3N7W A;  3OCL A;  1MPL A;  2JN7 A;  4KG5 A;  3T1Q B;  3MQO A;  1VHM A;  5F5Y A;  4KQR A;  2JKR I;  4NG2 A;  3JPU A;  1A0K A;  3KYZ A;  1LSV A;  2P9V B;  3EWK A;  4KZ9 A;  5M19 A;  2INW A;  1K55 A;  4HBU A;  4HJ3 A;  5GHX A;  4ARZ A;  2ZD8 A;  4GNU A;  1K6S A;  4BEN A;  1ES5 A;  2I72 A;  2Z2L B;  2VEA A;  2WKE A;  5HL6 A;  1D7E A;  5FAT A;  1SKF A;  4OQ0 A;  4AFI A;  1N9L A;  4R3A A;  5CHJ A;  1F98 A;  2D02 A;  4P85 A;  4F3L A;  3IWQ A;  5E2F A;  3PBQ A;  2V0U A;  3HUO A;  4WZ5 C;  3IXH A;  2Y91 A;  5G4Z A;  1LLB A;  3NOT C;  1H0M A;  1YSQ A;  3IBR A;  2WKI A;  1VEU A;  3CPT B;  5HDC A;  4E3I A;  4ZDX A;  2W3F A;  4GN2 A;  3V5M A;  3KO6 A;  3S1Y A;  2Y2J A;  1G68 A;  1LL9 A;  2P7J A;  5FQQ A;  1NWZ A;  1UWP X;  3ZNY A;  2WZZ A;  1PWG A;  3TG9 A;  2D01 A;  3G35 A;  4CLC C;  1AWI A;  3MFX A;  2VX8 A;  4EBN A;  5AQ7 A;  3NIA A;  4S2N A;  2Y4A A;  3LIA A;  1VQQ A;  3CLO A;  2ZL1 A;  5EVI A;  3OPH A;  3BEC A;  4O0P A;  4HH2 A;  4MMN A;  5CXW A;  1LL8 A;  3WS4 A;  1OTB A;  3T4L A;  4KQQ A;  4DE0 A;  4E3M A;  2K31 A;  2PD7 A;  2ZC3 B;  5C5K A;  3ZYT A;  5EVE A;  4KZB A;  2J8Y A;  5KSH A;  3HL9 A;  3HVF A;  5L09 A;  4UQI M;  4DN0 A;  4F94 A;  1G28 A;  4UQI S;  3NY4 A;  5J7E A;  3CMZ A;  3ZVW A;  3MZE A;  1FSW A;  3S4X A;  3T4O A;  4IBR A;  4NKP A;  3KSH A;  2J80 A;  4Q0H A;  3IX4 A;  3PBN A;  4DMZ A;  3G2Z A;  1K56 A;  1YMS A;  2WKR A;  4WLA A;  1FCO A;  2J7V A;  3Q1F A;  3NDG A;  3WRT A;  1BUE A;  1HLU P;  4PHT A;  1CQA A;  3OOV A;  2PAV P;  3VE4 A;  3F1P B;  5FQM A;  5LBR A;  3HRE A;  2PR6 A;  4UHU A;  3E2K A;  4HQA A;  2EX6 A;  1MWS A;  3W4O A;  3UO9 A;  3NI9 A;  1YLP A;  3BFF A;  4QU3 A;  1JNU A;  3IWO A;  2WYX A;  3IHB A;  5CGW A;  4P6B A;  1SKO A;  5F83 A;  1BYW A;  1CF0 A;  1T1A A;  3W4P A;  4BBT A;  2Q9M A;  5GLD A;  3GSG A;  1E25 A;  4LEN A;  4R70 A;  1CEF A;  3BLS A;  1OJG A;  3IWI A;  4H8R A;  1HD8 A;  5I5L A;  2FZ0 A;  4UA9 A;  4CQH A;  4CPK A;  3V50 A;  3BM6 A;  4HIA A;  4JBF A;  4HY8 A;  2OAP 1;  5J4E A;  4EWF A;  2A3U A;  4FCF A;  5L8M A;  4P0M A;  2WGW A;  4OKP A;  2Y2H A;  3LID A;  3A3D A;  1K57 C;  5HWV A;  5D3O A;  4GOG A;  5DF8 A;  1SHV A;  1DY6 A;  1FR1 A;  2WK0 A;  5GL9 A;  4IBX A;  2C5W B;  1L3L A;  3JVV A;  1L0D A;  1NZU A;  2JBF A;  1WE4 A;  3IQA A;  4S2I A;  3O87 A;  4I5S A;  3ICY A;  5TJJ A;  2A24 A;  2M1C A;  5F69 A;  4KZ4 A;  3JVU A;  4E3J A;  1Q2P A;  3VP2 A;  1YLY A;  1N9O A;  3N8R A;  5CEC A;  1OTD A;  1CK3 A;  3MSH A;  3HLD A;  2ZLY A;  2QPN A;  2GNX A;  4PM5 A;  4DKI A;  1U60 A;  5KIZ A;  3BFC A;  4ZJ2 A;  2PHY A;  2P9V A;  5HAI A;  2EA9 A;  4MEZ A;  2PDR A;  5IU1 A;  2Y59 A;  5EM1 A;  3VP3 A;  3VOL A;  3BYD A;  2PT7 A;  4MCW A;  3W8K A;  1TDG A;  5HWW A;  3OC2 A;  1M6K A;  3KYQ A;  2H28 A;  1ACF A;  4OLD A;  4E3L A;  3V39 A;  3QNB A;  4ZAM A;  3ZDJ A;  1W8Y A;  4LLO B;  3MKF A;  4OQI A;  3B47 A;  4EEU A;  1FSY A;  3AGD A;  3A0R A;  3E4P A;  2EWV A;  1DP8 A;  4QJG A;  2RL3 A;  4R3B A;  3IHA A;  2HF6 A;  5AVF A;  5J3W A;  3LI9 A;  3CPT A;  1XJ6 A;  2OLU A;  3WRZ A;  3LR5 A;  1IEL A;  5EFW A;  3BW6 A;  1KOU A;  1NZO A;  3MXS A;  2B18 A;  1KVL A;  1OPX A;  2V8C A;  1W8Q A;  1Q2Q A;  4EU0 A;  1NJ4 A;  3R7W B;  3NOU C;  2MJ6 A;  3Q7V A;  1PWD A;  2W3H A;  2OWJ A;  4R23 A;  1P0Z A;  3HCY A;  4HNB A;  1UGU A;  1DJC A;  1KDW A;  2V1B A;  3IXG A;  1AXB A;  4XUZ A;  5FL3 A;  3NHQ A;  3BQ8 A;  1KE4 A;  2ZC6 B;  1JTD A;  5A8B A;  4NXB A;  1XFQ A;  4OON A;  4DDY A;  2GZA A;  2JE5 A;  3HUN A;  5F1G A;  4YWZ A;  3LUQ A;  2UV0 E;  3ZGA B;  2V8F A;  4JXG A;  4CLC D;  4EUV A;  2XRO A;  1ONH A;  1JVJ A;  2KLI A;  4MBF A;  2XD5 A;  2M7U A;  3FKW A;  1JWZ A;  1ESI A;  3VFF A;  3SS3 A;  5G18 A;  2IWD A;  4I38 A;  3VFH A;  3KX0 X;  2ZJ9 A;  4R1G A;  1E3U A;  2V9A A;  3QP4 A;  2PU4 A;  4O7D A;  4JGR A;  1Y28 A;  3CUE A;  2L1M A;  2HP9 A;  2ZQD A;  1SDE A;  2R9X A;  3F1P A;  4HP9 A;  1J9M A;  4NXG A;  2O9B A;  4WN5 A;  4MN6 A;  4QPR A;  1GHI A;  3PHY A;  1HZO A;  4Z9Q A;  1OJ5 A;  2H10 A;  3NDE A;  2XRN A;  2HDS A;  4PKY G;  2XLN A;  1XPB A;  3UMD A;  4C3Q A;  4GZB A;  3UE3 A;  1SDN A;  5DFX A;  2EX2 A;  3RJU A;  2Z2M B;  2G2W A;  4XUX A;  2VJW A;  3ZVT A;  3NCK A;  4EQI A;  2K2N A;  3GTC A;  3PAE A;  3B42 A;  2IWC A;  2B02 A;  2IA2 A;  1Z6F A;  1DRM A;  4KQO A;  3F1O B;  4KZA A;  2J9P A;  4WMC A;  4KQD A;  3HJK A;  1ZKJ A;  1BLC A;  2NUP C;  3G6O A;  4OP8 A;  5EV0 A;  4G3V A;  3SH8 A;  2HJ9 C;  4P6Z M;  1W5D A;  5EEC A;  1W7F A;  2XFS A;  4JGO A;  3TOI A;  1IKG A;  4GD8 A;  2YKF A;  1MWT A;  2EWW A;  3FV7 A;  2JCH A;  1NYM A;  1G6A A;  2L4R A;  2FH5 A;  2VV7 A;  1I2S A;  4PM6 A;  3KSG A;  3ZG8 B;  4UAA A;  3IT9 A;  5DF7 A;  1F2K A;  5EM0 A;  2L0W A;  2ZM8 A;  5CX7 A;  1DP9 A;  4WUJ A;  1S66 L;  4ZJ3 A;  2WAF A;  3UY6 A;  2PBY A;  2EX8 A;  3MZD A;  2OSU A;  1PIO A;  3ZG7 B;  2HP6 A;  3MF0 A;  2H5S A;  3W4Q A;  1ERM A;  3G34 A;  2BTF P;  5HAQ A;  4R4R A;  2QZ6 A;  5FQ9 A;  2Q9N A;  5U47 A;  3G31 A;  5F68 A;  4HH3 A;  4H6J B;  4L9F A;  3DTI A;  2W1T B;  2A2L A;  1N9B A;  1YLJ A;  4S2J A;  1S1Y A;  2JKT M;  2CC1 A;  1XFN A;  5FA7 A;  3E98 A;  5A91 A;  1XJ3 A;  3DWK A;  4FUW A;  3C8C A;  2C6W B;  4HJ6 A;  4DJ2 A;  4U3T A;  2WAD A;  3DW0 A;  3BWL A;  2PYR A;  3UPO A;  3MQQ A;  1IKI A;  4BL2 A;  4LCL A;  3BRM A;  4WL9 A;  1K38 A;  2WGI A;  2J3W A;  2HPB A;  3LO7 A;  3ZQ5 A;  3P7N A;  1H8M A;  1T1B A;  3KYE A;  4FD8 A;  5BOH A;  1W63 Q;  1ESU A;  4EEP A;  3SH7 A;  4BQM A;  1PNE A;  4X55 A;  3VSK A;  2ZMV A;  1X0O A;  4GD6 A;  2Y2N A;  4DRT A;  5GHZ A;  3Q07 A;  4WM9 A;  3HLC A;  4RX3 A;  5G4Y A;  5DVA A;  4ZTK A;  1UWN X;  2X01 A;  3HLF A;  4JXV A;  5HD3 A;  1BLH A;  3MFD A;  1MXO A;  3R7W A;  1CJF A;  3LIE A;  4NEE D;  4PAU A;  3UE0 A;  3VSL A;  2NUT C;  5GLB A;  1K55 C;  1S0W A;  4ESP A;  4Y17 A;  2PBD P;  3A3J A;  5HFO A;  1PI4 A;  3LCE A;  2RCX A;  1LSX A;  4EER A;  2XFT A;  3ZG0 A;  3L9K A;  5HD5 A;  2JC7 A;  5CED A;  5FQI A;  1GSX A;  4PKY A;  4I3A A;  4FTX A;  3EEH A;  5GLA A;  5JYO A;  1PI5 A;  2O9C A;  2W3G A;  5HZH A;  3MS6 A;  1F5M A;  4N92 A;  4YIN A;  3U2A A;  2H0Y A;  1D06 A;  2B95 A;  4DJ3 A;  3QHY A;  1ZG4 A;  1YLW A;  2ZM2 A;  2ZC4 B;  3G4P A;  3PR6 A;  1O07 A;  3MBZ A;  3C38 A;  3SH9 A;  4BMW A;  3JYI A;  5KMW A;  3ZCZ A;  1YLZ A;  5EUA A;  4EUZ A;  2O9A A;  3T12 B;  3T4T A;  3T1X A;  1K57 A;  5EOO A;  3CAX A;  1PWC A;  1K54 A; 
#chains in the Genus database with same CATH homology
 4OP5 A;  3WS2 A;  1CEG A;  2UWX A;  3IF6 B;  1YMX A;  4S2N C;  5CHM A;  1W8Y A;  2V2F F;  3MKF A;  1BZA A;  4MBK A;  4OQI A;  5AQA A;  3SOI A;  1FSY A;  1L0E A;  2ZC7 A;  3AGD A;  2FFF B;  4N1X A;  5TR7 A;  5F82 A;  2A49 A;  1FCN A;  3UN7 A;  3Q7Z A;  3EQU A;  4QJG A;  4LV3 A;  4K0W A;  3FWL A;  4BLM A;  2EFU A;  2HP5 A;  4GB7 A;  5TFQ A;  2RL3 A;  1ERO A;  2DCF A;  4HEF A;  4R3B A;  5FAQ A;  3VP0 A;  3I7J A;  3NBL A;  3IHA A;  3VOY A;  2G2U A;  2IWB A;  1CI9 A;  2OLU A;  5DTS A;  5HX9 A;  3WRZ A;  1E4D A;  1GCE A;  5CHU A;  3HBR A;  3IF5 A;  1XP4 A;  4JF4 A;  4MNR A;  5E2E A;  2VGJ A;  4E3O A;  2BG1 A;  3N8S A;  4M3K A;  5CRF A;  5L2F A;  1IEL A;  3S22 A;  3HLE A;  4WZ4 A;  5TGF A;  1VM1 A;  1I5Q A;  1ONG A;  2OLV A;  3PBR A;  1NZO A;  4S2P A;  1DJB A;  2Y2M A;  1PW8 A;  3G30 A;  3MXS A;  4QB8 A;  1KVL A;  1KGF A;  2R9W A;  1K4E A;  2FFY A;  2WGV A;  3A3I A;  4OH0 A;  4Q8I A;  3P98 A;  4LV1 A;  2XR0 A;  1MWR A;  1W8Q A;  3BEB A;  3HUM A;  4X6T A;  5A92 A;  1Q2Q A;  1LHY A;  3WS0 A;  4X68 A;  4LV2 A;  3UDF A;  1NJ4 A;  1HVB A;  4MBH A;  4R3J A;  5M1A A;  2VGK A;  3M2K A;  3PBS A;  3Q7V A;  4DDS A;  1HTZ A;  1PWD A;  2EX9 A;  4DF6 A;  1KGE A;  1RP5 A;  5HAP A;  4R23 A;  3TSG A;  2EXB A;  3C4P A;  3Q7V B;  2WGW B;  1DJC A;  1KDW A;  3IXG A;  3VP1 A;  1AXB A;  1MBL A;  1QME A;  2HDQ A;  1QMF A;  4XUZ A;  1O7E A;  1XX2 A;  1CI8 A;  2ZQC A;  3OZH A;  4RYE A;  1L0G A;  4Y0T A;  3WS1 A;  4S2M A;  4DXB A;  3PBT A;  4U0T A;  1XA7 A;  1TEM A;  3MXR A;  1KE4 A;  2ZC6 B;  1W79 A;  1JTD A;  5EVL A;  3UE1 A;  3V3R A;  3ISG A;  1KGG A;  3MKE A;  4QY6 A;  1IYO A;  3IF6 C;  4JKT A;  4OON A;  1KVM A;  4DDY A;  5KZH A;  2JE5 A;  3HUN A;  3MZF A;  5F1G A;  1H8Y A;  3ZGA B;  4BJP A;  4DE1 A;  4JXG A;  3N7W A;  3QNC A;  3OCL A;  5FQJ A;  1ONH A;  1JVJ A;  4MBF A;  4EBL A;  2XD5 A;  1MPL A;  3FKW A;  1JWZ A;  2Y2P A;  1ESI A;  1FOF A;  1RGZ A;  1ZC2 A;  3GRJ A;  4S2L A;  4KG5 A;  3VFF A;  2XF3 A;  3SS3 A;  5G18 A;  2IWD A;  1RCJ A;  2GDN A;  2Y2Q A;  1MKI A;  3CZD A;  3O86 A;  4KQR A;  3VFH A;  4S2O A;  5DF9 A;  2ZJ9 A;  1PZO A;  4R1G A;  1E3U A;  3AGE A;  2P9V B;  4KZ9 A;  5M19 A;  3ITA A;  1IYQ A;  1K55 A;  1K6R A;  4HBU A;  4K0X A;  3UPP A;  4PMA A;  2PU4 A;  1YLT A;  3IXB A;  4O7D A;  1BTL A;  5GHX A;  4C75 A;  3LY4 A;  2X71 A;  3CJM A;  4IED A;  4GKU A;  1KDS A;  2ZD8 A;  2HP9 A;  2ZQD A;  1C3B A;  1SDE A;  2EXA A;  2R9X A;  4GNU A;  1K6S A;  2V20 A;  4ZJ1 A;  4BEN A;  1ES5 A;  1XKZ A;  2I72 A;  3VOZ A;  1J9M A;  2Z2L B;  3PTE A;  4Y7P A;  2WKE A;  4LCM A;  4QHC A;  5EVI C;  2Y2G A;  3CG5 A;  3OCN A;  3Q82 A;  5FAT A;  1SKF A;  4UA7 A;  5E2G A;  4OQ0 A;  3RXX A;  4DXC A;  4PM9 A;  5CHJ A;  1XGI A;  5CTM A;  1GHI A;  1HZO A;  4Z9Q A;  3UPN A;  5DTK A;  2XK1 A;  1FQG A;  3O88 A;  4P85 A;  2XEP A;  2H10 A;  3IWQ A;  5E2F A;  4ZBE A;  3NDE A;  2HDS A;  3PBQ A;  2XLN A;  3LEZ A;  1XPB A;  2Y2K A;  3BFD A;  3HUO A;  3IH9 A;  4DE3 A;  4C3Q A;  2HDR A;  4WZ5 C;  5FSR A;  3IH8 A;  3IXH A;  4GZB A;  3UE3 A;  1SDN A;  2Y91 A;  1LLB A;  1JWV A;  1MY8 A;  4UA6 A;  2EX2 A;  1IYP A;  4QY5 A;  4C6Y A;  1K25 A;  3RJU A;  2Z2M B;  2G2W A;  3BFE A;  3BLM A;  4XUX A;  4RA7 A;  1JTG A;  2WKI A;  1PZP A;  5A90 A;  1BSG A;  4IVK A;  3ZVT A;  3NCK A;  4EQI A;  2Y2L A;  4NK3 A;  3EQV A;  4Y0U A;  4A5R A;  4MLL A;  4WBG A;  4E3I A;  2ZMA A;  3GTC A;  4ZDX A;  4GN2 A;  3V5M A;  1NRF A;  1GA0 A;  1TVF A;  3PAE A;  5KSC A;  3C7U A;  3S1Y A;  2IWC A;  3VP4 A;  4OVD A;  2Y2J A;  1M40 A;  1NXY A;  2HDU A;  1G68 A;  1LL9 A;  1Z6F A;  5FQQ A;  4KQO A;  5GHY A;  3ZNY A;  1RGY A;  4KZA A;  2J9P A;  3B3X A;  3LY3 A;  4WMC A;  5FAP A;  4B4X A;  4E6W A;  2WZZ A;  4OOY A;  1PWG A;  3TG9 A;  1ZKJ A;  4U0X A;  1BLC A;  3G35 A;  4Y0O A;  4B88 A;  3A3E A;  5CER A;  2ZM0 A;  4E6X A;  4EBN A;  5AQ7 A;  5FI6 A;  3NIA A;  5FI7 A;  1NYY A;  4OP8 A;  5JYP A;  4PM8 A;  4X69 A;  4D2O A;  3SS4 A;  3SH8 A;  4S2N A;  5E43 A;  4BD0 A;  1ERQ A;  2Y4A A;  4HES A;  5HAR A;  1VQQ A;  1W5D A;  3NC8 A;  5EEC A;  1KE0 A;  1ES2 A;  3OPH A;  5EVI A;  2XDM A;  3BEC A;  2BLS A;  1W7F A;  4KZ6 A;  3GVB A;  2XFS A;  5CXW A;  5I94 A;  3WS4 A;  4KQQ A;  3TOI A;  4DE0 A;  4E3M A;  1IKG A;  1YM1 A;  2ZC3 B;  4GD8 A;  1MWT A;  1DJA A;  3FV7 A;  2JCH A;  1NYM A;  4GDB A;  1G6A A;  1I2S A;  4PM6 A;  2WAE A;  3HLW A;  3ZG8 B;  4UAA A;  3IT9 A;  4KZB A;  5DF7 A;  2J8Y A;  1K54 C;  2ZM8 A;  5KSH A;  4ZJ3 A;  3UY6 A;  2WAF A;  3HL9 A;  4L0L A;  2XH9 A;  3HVF A;  2PBY A;  3RXW A;  2EX8 A;  2V1Z A;  4OPQ A;  1BLS A;  3MZD A;  2OSU A;  1PIO A;  3ZG7 B;  2HP6 A;  4F94 A;  1XA1 A;  5FAS A;  3NY4 A;  2H5S A;  3CMZ A;  3ZVW A;  3W4Q A;  3MZE A;  1FSW A;  1ERM A;  3G34 A;  5E2H A;  2Y2O A;  3S4X A;  5EE8 A;  4IBR A;  3IXD A;  4HBT A;  5HAQ A;  4R4R A;  2QZ6 A;  5FQ9 A;  1E3U D;  3D4F A;  2Q9N A;  4OPY A;  5U47 A;  3G31 A;  5J8X A;  3PAG A;  1WYB A;  3PBN A;  3G2Z A;  4RX2 A;  2ZQ8 A;  4OQG A;  4JXS A;  1ES3 A;  4KG6 A;  2EFX A;  1K56 A;  1YMS A;  5A93 A;  1ZG6 A;  1N9B A;  1FCO A;  2J7V A;  3Q81 A;  1YLJ A;  4KEN B;  4S2J A;  3FKV A;  3Q1F A;  3NDG A;  2CC1 A;  4BD1 A;  3WRT A;  1BUE A;  3ZHH A;  3ZNT A;  5FA7 A;  4EV4 A;  3M2J A;  1L2S A;  5A91 A;  3HLG A;  2PU2 A;  3DWK A;  2C6W B;  4K91 A;  1GA9 A;  5FQM A;  3PBO A;  4U3T A;  2WAD A;  3HRE A;  3DW0 A;  3UPO A;  5EPH A;  4N1H A;  2P74 A;  1Y54 A;  4UHU A;  3IF6 A;  3SS5 A;  1IKI A;  4BL2 A;  3E2K A;  2EX6 A;  3BRM A;  4LCL A;  1LL5 A;  1K38 A;  5EOE A;  3AGF A;  2WGI A;  2HPB A;  2WKH A;  3LO7 A;  1IYS A;  4XXR A;  4R4S A;  1MWS A;  3W4O A;  4OLG A;  3P09 A;  1N4O A;  5HW3 A;  3UO9 A;  3C7V A;  3NI9 A;  4FD8 A;  4OOL A;  3V3S A;  5BOH A;  1LI9 A;  1ESU A;  4N9L A;  1YLP A;  3OPR A;  3BFF A;  3SH7 A;  4BQM A;  4QU3 A;  3VMA A;  3WS5 A;  3IWO A;  2WYX A;  2X02 A;  1PW1 A;  3IHB A;  4X55 A;  1I2W A;  3VSK A;  5CGW A;  4GD6 A;  4P6B A;  3O3V A;  1XGJ A;  1XXM A;  4ID4 A;  5F83 A;  2Y2N A;  4DRT A;  2B5R A;  1BT5 A;  4WEJ A;  3W4P A;  5GHZ A;  3Q07 A;  4WM9 A;  2Q9M A;  1SCW A;  5GLD A;  3GSG A;  3HLC A;  4KZ8 A;  5FQK A;  1E25 A;  4WMC D;  5M18 A;  4RX3 A;  4LEN A;  5FDH A;  3N6I A;  1CEF A;  3BLS A;  2ZQ7 A;  4KZ5 A;  4PPR A;  4WEK A;  2WZX A;  3IWI A;  5DVA A;  4ZTK A;  4H8R A;  5AQB A;  3HLF A;  2X01 A;  1HD8 A;  3GV9 A;  4JXV A;  1BLH A;  3MFD A;  4JPM A;  4E3N A;  1GHP A;  1BUL A;  3BFG A;  4UA9 A;  3DTM A;  4LV0 A;  4R0Q A;  3GMW A;  1MXO A;  4OQH A;  2J9O A;  4CPK A;  5AQ9 A;  5IHV A;  3BM6 A;  3V50 A;  5EVI D;  4JLF A;  1KE3 A;  4JBF A;  4KG2 A;  3UE0 A;  3VSL A;  4B4Z A;  1H5X A;  1S6R A;  2XQZ A;  5EVI B;  4S2K A;  1LI0 A;  2XD1 A;  5GLB A;  1K55 C;  1S0W A;  4FSF A;  2A3U A;  4FCF A;  1FCM A;  1OME A;  4QD4 A;  4EWF A;  4P0M A;  1K4F A;  2WUQ A;  3N4I A;  2WGW A;  3FYZ A;  2Y2H A;  4OKP A;  3A3J A;  3OPL A;  1EWZ A;  1H8Z A;  1IEM A;  1K57 C;  3A3D A;  5D3O A;  5HFO A;  4WZ5 A;  4GOG A;  3DWZ A;  2Y55 A;  5DF8 A;  1NY0 A;  1SHV A;  2ZQ9 A;  1DY6 A;  1PI4 A;  3A3F A;  3LCE A;  1FR1 A;  2WK0 A;  5GL9 A;  4BL3 A;  3FZC A;  5CEB A;  4JXW A;  2ZQA A;  2C5W B;  4IBX A;  4OPR A;  2RCX A;  4YFM A;  5CGX A;  4JF5 A;  4OOM A;  1L0D A;  1NZU A;  2JBF A;  1WE4 A;  4EBP A;  2XFT A;  5HL1 A;  3ZG0 A;  3C5A A;  3M6B A;  3IQA A;  2JC7 A;  4IVI A;  4S2I A;  5CED A;  5FQI A;  2DRW A;  4X53 A;  1L0F A;  3O87 A;  2QMI A;  5GLA A;  4E3K A;  1GHM A;  4WEL A;  4OPZ A;  5JYO A;  4KZ4 A;  1PI5 A;  4N9K A;  3ZFZ A;  4FH4 A;  4E3J A;  1Q2P A;  1WYC A;  3VP2 A;  1ALQ A;  3ZG5 A;  3WWX A;  1ES4 A;  1YLY A;  4N92 A;  4YIN A;  3N8R A;  2H0Y A;  3E2L A;  2H0T A;  5CEC A;  3HLD A;  1CK3 A;  1YQS A;  2ZLY A;  1YT4 A;  2QPN A;  1PYY A;  4X56 A;  3OPP A;  4CJN A;  3G2Y A;  4PM7 A;  5CGS A;  4PM5 A;  1TDL A;  3GQZ A;  3QHY A;  3G32 A;  4DKI A;  1BLP A;  1EI5 A;  1U60 A;  4DE2 A;  1ZG4 A;  1K56 D;  2ZC5 B;  3GR2 A;  1YLW A;  3BFC A;  2DNS A;  4ZJ2 A;  2ZM2 A;  4KZ7 A;  5CTN A;  2P9V A;  2ZC4 B;  1MWU A;  3G4P A;  5HAI A;  4MEZ A;  4WYY A;  1O07 A;  3MBZ A;  5F1F A;  1FR6 A;  2Y2I A;  3SH9 A;  2Y59 A;  3ITB A;  3JYI A;  4JF6 A;  3UNW A;  3N8L A;  3UDX A;  5KMW A;  1JWP A;  3UDI A;  4KZ3 A;  3VP3 A;  3ZCZ A;  5DTT A;  3BYD A;  3M6H A;  4P87 A;  3W8K A;  3ZG9 B;  1YLZ A;  1TDG A;  5EUA A;  5FI2 A;  3HLB A;  3OC2 A;  4EUZ A;  1M6K A;  4RVA A;  1K57 A;  5EOO A;  4FH2 A;  2E8I A;  2XGN A;  4GDN A;  3C4O A;  4OLD A;  4E3L A;  5FAO A;  3V39 A;  1PWC A;  3QNB A;  4ZAM A;  2OV5 A;  3ZDJ A;  4NET A;  1K54 A;  5GLC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...