3P0PA

Human tankyrase 2 - catalytic parp domain in complex with an inhibitor
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
210
structure length
206
Chain Sequence
GTILIDLSPDDKEFQSVEEEMQSTVREHRDGGHAGGIFNRYNILKIQKVCNKKLWERYTHRRKEVSEENHNHANERMLFHGSPFVNAIIHKGFDERHAYIGGMFGAGIYFAENSSKSNQYVYGIGGGTGCPVHKDRSCYICHRQLLFCRVTLGKSFLQFSAHSPPGHHSVTGRPSVNGLALAEYVIYRGEQAYPEYLITYQIMRPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Family-wide chemical profiling and structural analysis of PARP and tankyrase inhibitors
pubmed doi rcsb
molecule keywords Tankyrase-2
molecule tags Transferase/transferase inhibitor
source organism Homo sapiens
total genus 63
structure length 206
sequence length 210
chains with identical sequence C
ec nomenclature ec 2.4.2.30: NAD(+) ADP-ribosyltransferase.
pdb deposition date 2010-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00644 PARP Poly(ADP-ribose) polymerase catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.228.10 Alpha Beta Alpha-Beta Complex Phosphoenolpyruvate Carboxykinase; domain 3 Phosphoenolpyruvate Carboxykinase; domain 3 3p0pA00
4UVZA 4L34A 4BUIA 4L2GA 3KCZA 4UFYA 4BUYA 4UVPA 4L0BA 2RF5A 4OPXC 4PNRA 4BUXA 4BUVA 1A26A 5AL3A 4BJBA 4UXBA 4TKIA 4TK0A 4W5SA 4BU8A 4AVUA 4LI7A 5ADSA 4L7PA 5AL1A 4PNSA 2PQFA 4DVIA 3C4HA 3GEYA 4BFPA 4L2KA 4L7UA 4F1QA 4L31A 4HLKA 5LX6A 4HHYA 3U9YA 4PNLA 4TJYA 4TORA 4L6SA 3L3LA 4BU6A 4UUHA 4UI4A 5AL4A 1UK0A 4BUWA 4TKGA 5C5QA 4HLFA 3L3MA 4W5IA 4TK5A 5AL5A 4ZZYA 4N4TA 4J22A 4RV6A 3HKVA 4J3MA 4PY4A 3P0NA 4UI7A 4L09A 4BUUA 4HLHA 4HLMA 4GV0A 4L7NA 4L0SA 3KR7A 4ZZXA 2PAWA 4BU7A 5AL2A 4UVOA 4LI8A 3GOYA 4PNQA 4UVUA 4UVYA 4TJUA 4UW1A 4OQBC 4UVTA 3P0QA 4UFUA 5AKWA 2RCWA 4BJCA 3GJWA 4L10A 3PAXA 3UA9A 4K4FA 4UVSA 4HL5A 3CE0A 3MHJA 4UX4A 1UK1A 4U6AA 3MHKA 4KRSA 4UVLA 5LYHA 4AVWA 4DQYC 4IUEA 4MT9A 4PNMA 4UVNA 4UNDA 3UH2A 2PAXA 4J3LA 4L7OA 2RD6A 4ZZZA 4GV4A 4PNNA 4N4VA 4HLGA 3KJDA 4BUDA 4GV2A 4XHUA 4I9IA 1GS0A 4L7LA 5ADQA 4LI6A 4BUEA 3SE2A 4HKIA 4PNTA 4X52A 4L32A 4KZUA 4L6ZA 4W6EA 4L0TA 4OQAC 5LXPA 4F0EA 4TOSA 3GN7A 4HYFA 3SMIA 4MSKA 5A00A 3W51A 3BLJA 4L7RA 4UVVA 4GV7A 4UVXA 5AKUA 5AEHA 3KR8A 1EFYA 4PJTA 4PMLA 4L0IA 4UVWA 4UI3A 5FPGA 3C49A 4KZLA 4M7BA 4R5WA 5ETYA 4BJ9A 4F1LA 5ADTA 4L70A 4BU9A 3FHBA 4J21A 4TVJA 5ECEA 4HHZA 4BU5A 3U9HA 4BU3A 4BUSA 1PAXA 4OA7A 4TJWA 4N3RA 4PAXA 5EBTA 4PJVA 4HMHA 4K4EA 4HKKA 5ADRA 4UI8A 3UDDA 4BUFA 4UHGA 4KZQA 3UH4A 1WOKA 4J1ZA 4TKFA 3SMJA 4BUAA 4UI6A 4HKNA 4MSGA 4L33A 4R6EA 5C5PA 5C5RA 3P0PA 4UI5A 4BUTA 5FPFA 2X5YA 4BS4A 5DCZA 4L2FA 4L0VA
chains in the Genus database with same CATH superfamily
4UVZA 4L34A 4BUIA 4L2GA 3KCZA 4UFYA 4BUYA 4UVPA 4L0BA 2RF5A 4OPXC 4PNRA 4BUXA 4BUVA 1A26A 5AL3A 4BJBA 3DT4A 4TKIA 4UXBA 4TK0A 4W5SA 4BU8A 1K3CA 4AVUA 4LI7A 4WOUA 5ADSA 4WPVA 4L7PA 5AL1A 2QZYA 2PQFA 4PNSA 4DVIA 3C4HA 3GEYA 2QEYA 4BFPA 4L2KA 4L7UA 4F1QA 4L31A 2QEWA 4HLKA 5LX6A 4HHYA 3U9YA 4PNLA 4TJYA 4TORA 4L6SA 3L3LA 1OS1A 1M51A 4BU6A 4UUHA 4UI4A 5AL4A 4GMWA 1UK0A 4BUWA 4TKGA 5C5QA 5ADTA 1II2A 5FH2A 4GNOA 4HLFA 5FH3A 3L3MA 4W5IA 4TK5A 5AL5A 1YGGA 4RCGA 1KHBA 4N4TA 4ZZYA 4J22A 4RV6A 3HKVA 4J3MA 2QF2A 4PY4A 3P0NA 4UI7A 2RK8A 2RKEA 4L09A 4OX2A 4WIUA 4WPTA 4BUUA 4HLHA 4HLMA 4GV0A 4L7NA 4L0SA 1AQ2A 1KHFA 3KR7A 4ZZXA 2PAWA 4BU7A 4GNLA 2GMVA 1KHEA 5AL2A 4UVOA 4LI8A 3GOYA 4PNQA 2PY7X 4UVUA 4UVYA 5FH1A 2FAHA 4TJUA 3DT2A 4GMMA 4UW1A 4YW8A 2RK7A 5I67A 1XKVA 4OQBC 4UVTA 3P0QA 4UFUA 5AKWA 2RCWA 4YWDA 4BJCA 3GJWA 4L10A 3PAXA 3UA9A 4K4FA 4UVSA 4HL5A 3CE0A 3MHJA 4UX4A 1UK1A 4U6AA 1OENA 2RKAA 3MHKA 4KRSA 4UVLA 4GNMA 5LYHA 4AVWA 4DQYC 4IUEA 4MT9A 1K3DA 4PNMA 4WL8A 3MOFA 1YVYA 2FAFA 4UNDA 3DT7A 4UVNA 5DCZA 2PAXA 3UH2A 3DTBA 1KHGA 4J3LA 1J3BA 2RD6A 4L7OA 2RKDA 2ZCIA 4GMUA 4GV4A 4ZZZA 4PNNA 4GMZA 4HLGA 4N4VA 3KJDA 5FH4A 4WPUA 4BUDA 1AYLA 4GV2A 4XHUA 4I9IA 1GS0A 4L7LA 5ADQA 5FH5A 4LI6A 4BUEA 3SE2A 4HKIA 4PNTA 5EBTA 4X52A 4L32A 4KZUA 4L6ZA 4W6EA 4R43A 4L0TA 4OQAC 2PC9A 5LXPA 4F0EA 4TOSA 3MOHA 4YWBA 3GN7A 4GNQA 4HYFA 3SMIA 4MSKA 5FH0A 5A00A 3W51A 3BLJA 1YLHA 2OLQA 1YTMA 4L7RA 4GV7A 4UVVA 4UVXA 2QF1A 5AKUA 5AEHA 3KR8A 1EFYA 4PJTA 4PMLA 4L0IA 4UVWA 4UI3A 4WIEA 3C49A 4KZLA 4M7BA 4R5WA 5ETYA 5FPGA 4BJ9A 4F1LA 4L70A 4BU9A 3FHBA 4J21A 4TVJA 5ECEA 4HHZA 4BU5A 3U9HA 4BU3A 4BUSA 2PXZX 1PAXA 4OA7A 4GNPA 4N3RA 4PAXA 4TJWA 4PJVA 3MOEA 4HMHA 4HKKA 4K4EA 4UI8A 3UDDA 5ADRA 4BUFA 4UHGA 4KZQA 1NHXA 3UH4A 1WOKA 4J1ZA 4TKFA 3SMJA 4BUAA 4UI6A 4HKNA 4MSGA 4L33A 4R6EA 5C5PA 5C5RA 3P0PA 4UI5A 4YW9A 4BUTA 5FPFA 2X5YA 4BS4A 2OLRA 4L2FA 4L0VA
chains in the Genus database with same CATH topology
4UVZA 4L34A 4BUIA 4L2GA 3KCZA 4UFYA 4BUYA 4UVPA 4L0BA 2RF5A 4OPXC 4PNRA 4BUXA 4BUVA 1A26A 5AL3A 4BJBA 3DT4A 4TKIA 4UXBA 4TK0A 4W5SA 4BU8A 1K3CA 4AVUA 4LI7A 4WOUA 5ADSA 4WPVA 4L7PA 5AL1A 2QZYA 2PQFA 4PNSA 4DVIA 3C4HA 3GEYA 2QEYA 4BFPA 4L2KA 4L7UA 4F1QA 4L31A 2QEWA 4HLKA 5LX6A 4HHYA 3U9YA 4PNLA 4TJYA 4TORA 4L6SA 3L3LA 1OS1A 1M51A 4BU6A 4UUHA 4UI4A 5AL4A 4GMWA 1UK0A 4BUWA 4TKGA 5C5QA 5ADTA 1II2A 5FH2A 4GNOA 4HLFA 5FH3A 3L3MA 4W5IA 4TK5A 5AL5A 1YGGA 4RCGA 1KHBA 4N4TA 4ZZYA 4J22A 4RV6A 3HKVA 4J3MA 2QF2A 4PY4A 3P0NA 4UI7A 2RK8A 2RKEA 4L09A 4OX2A 4WIUA 4WPTA 4BUUA 4HLHA 4HLMA 4GV0A 4L7NA 4L0SA 1AQ2A 1KHFA 3KR7A 4ZZXA 2PAWA 4BU7A 4GNLA 2GMVA 1KHEA 5AL2A 4UVOA 4LI8A 3GOYA 4PNQA 2PY7X 4UVUA 4UVYA 5FH1A 2FAHA 4TJUA 3DT2A 4GMMA 4UW1A 4YW8A 2RK7A 5I67A 1XKVA 4OQBC 4UVTA 3P0QA 4UFUA 5AKWA 2RCWA 4YWDA 4BJCA 3GJWA 4L10A 3PAXA 3UA9A 4K4FA 4UVSA 4HL5A 3CE0A 3MHJA 4UX4A 1UK1A 4U6AA 1OENA 2RKAA 3MHKA 4KRSA 4UVLA 4GNMA 5LYHA 4AVWA 4DQYC 4IUEA 4MT9A 1K3DA 4PNMA 4WL8A 3MOFA 1YVYA 2FAFA 4UNDA 3DT7A 4UVNA 5DCZA 2PAXA 3UH2A 3DTBA 1KHGA 4J3LA 1J3BA 2RD6A 4L7OA 2RKDA 2ZCIA 4GMUA 4GV4A 4ZZZA 4PNNA 4GMZA 4HLGA 4N4VA 3KJDA 5FH4A 4WPUA 4BUDA 1AYLA 4GV2A 4XHUA 4I9IA 1GS0A 4L7LA 5ADQA 5FH5A 4LI6A 4BUEA 3SE2A 4HKIA 4PNTA 5EBTA 4X52A 4L32A 4KZUA 4L6ZA 4W6EA 4R43A 4L0TA 4OQAC 2PC9A 5LXPA 4F0EA 4TOSA 3MOHA 4YWBA 3GN7A 4GNQA 4HYFA 3SMIA 4MSKA 5FH0A 5A00A 3W51A 3BLJA 1YLHA 2OLQA 1YTMA 4L7RA 4GV7A 4UVVA 4UVXA 2QF1A 5AKUA 5AEHA 3KR8A 1EFYA 4PJTA 4PMLA 4L0IA 4UVWA 4UI3A 4WIEA 3C49A 4KZLA 4M7BA 4R5WA 5ETYA 5FPGA 4BJ9A 4F1LA 4L70A 4BU9A 3FHBA 4J21A 4TVJA 5ECEA 4HHZA 4BU5A 3U9HA 4BU3A 4BUSA 2PXZX 1PAXA 4OA7A 4GNPA 4N3RA 4PAXA 4TJWA 4PJVA 3MOEA 4HMHA 4HKKA 4K4EA 4UI8A 3UDDA 5ADRA 4BUFA 4UHGA 4KZQA 1NHXA 3UH4A 1WOKA 4J1ZA 4TKFA 3SMJA 4BUAA 4UI6A 4HKNA 4MSGA 4L33A 4R6EA 5C5PA 5C5RA 3P0PA 4UI5A 4YW9A 4BUTA 5FPFA 2X5YA 4BS4A 2OLRA 4L2FA 4L0VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4UVZ A;  4L34 A;  4BUI A;  4L2G A;  3KCZ A;  4UFY A;  4BUY A;  4UVP A;  4L0B A;  2RF5 A;  4OPX C;  4PNR A;  4BUX A;  4BUV A;  1A26 A;  5AL3 A;  4BJB A;  4UXB A;  4TKI A;  4TK0 A;  4W5S A;  4BU8 A;  4AVU A;  4LI7 A;  5ADS A;  4L7P A;  5AL1 A;  4PNS A;  2PQF A;  4DVI A;  3C4H A;  3GEY A;  4BFP A;  4L2K A;  4L7U A;  4F1Q A;  4L31 A;  4HLK A;  5LX6 A;  4HHY A;  3U9Y A;  4PNL A;  4TJY A;  4TOR A;  4L6S A;  3L3L A;  4BU6 A;  4UUH A;  4UI4 A;  5AL4 A;  1UK0 A;  4BUW A;  4TKG A;  5C5Q A;  4HLF A;  3L3M A;  4W5I A;  4TK5 A;  5AL5 A;  4ZZY A;  4N4T A;  4J22 A;  4RV6 A;  3HKV A;  4J3M A;  4PY4 A;  3P0N A;  4UI7 A;  4L09 A;  4BUU A;  4HLH A;  4HLM A;  4GV0 A;  4L7N A;  4L0S A;  3KR7 A;  4ZZX A;  2PAW A;  4BU7 A;  5AL2 A;  4UVO A;  4LI8 A;  3GOY A;  4PNQ A;  4UVU A;  4UVY A;  4TJU A;  4UW1 A;  4OQB C;  4UVT A;  3P0Q A;  4UFU A;  5AKW A;  2RCW A;  4BJC A;  3GJW A;  4L10 A;  3PAX A;  3UA9 A;  4K4F A;  4UVS A;  4HL5 A;  3CE0 A;  3MHJ A;  4UX4 A;  1UK1 A;  4U6A A;  3MHK A;  4KRS A;  4UVL A;  5LYH A;  4AVW A;  4DQY C;  4IUE A;  4MT9 A;  4PNM A;  4UVN A;  4UND A;  3UH2 A;  2PAX A;  4J3L A;  4L7O A;  2RD6 A;  4ZZZ A;  4GV4 A;  4PNN A;  4N4V A;  4HLG A;  3KJD A;  4BUD A;  4GV2 A;  4XHU A;  4I9I A;  1GS0 A;  4L7L A;  5ADQ A;  4LI6 A;  4BUE A;  3SE2 A;  4HKI A;  4PNT A;  4X52 A;  4L32 A;  4KZU A;  4L6Z A;  4W6E A;  4L0T A;  4OQA C;  5LXP A;  4F0E A;  4TOS A;  3GN7 A;  4HYF A;  3SMI A;  4MSK A;  5A00 A;  3W51 A;  3BLJ A;  4L7R A;  4UVV A;  4GV7 A;  4UVX A;  5AKU A;  5AEH A;  3KR8 A;  1EFY A;  4PJT A;  4PML A;  4L0I A;  4UVW A;  4UI3 A;  5FPG A;  3C49 A;  4KZL A;  4M7B A;  4R5W A;  5ETY A;  4BJ9 A;  4F1L A;  5ADT A;  4L70 A;  4BU9 A;  3FHB A;  4J21 A;  4TVJ A;  5ECE A;  4HHZ A;  4BU5 A;  3U9H A;  4BU3 A;  4BUS A;  1PAX A;  4OA7 A;  4TJW A;  4N3R A;  4PAX A;  5EBT A;  4PJV A;  4HMH A;  4K4E A;  4HKK A;  5ADR A;  4UI8 A;  3UDD A;  4BUF A;  4UHG A;  4KZQ A;  3UH4 A;  1WOK A;  4J1Z A;  4TKF A;  3SMJ A;  4BUA A;  4UI6 A;  4HKN A;  4MSG A;  4L33 A;  4R6E A;  5C5P A;  5C5R A;  3P0P A;  4UI5 A;  4BUT A;  5FPF A;  2X5Y A;  4BS4 A;  5DCZ A;  4L2F A;  4L0V A; 
#chains in the Genus database with same CATH topology
 4UVZ A;  4L34 A;  4BUI A;  4L2G A;  3KCZ A;  4UFY A;  4BUY A;  4UVP A;  4L0B A;  2RF5 A;  4OPX C;  4PNR A;  4BUX A;  4BUV A;  1A26 A;  5AL3 A;  4BJB A;  3DT4 A;  4TKI A;  4UXB A;  4TK0 A;  4W5S A;  4BU8 A;  1K3C A;  4AVU A;  4LI7 A;  4WOU A;  5ADS A;  4WPV A;  4L7P A;  5AL1 A;  2QZY A;  2PQF A;  4PNS A;  4DVI A;  3C4H A;  3GEY A;  2QEY A;  4BFP A;  4L2K A;  4L7U A;  4F1Q A;  4L31 A;  2QEW A;  4HLK A;  5LX6 A;  4HHY A;  3U9Y A;  4PNL A;  4TJY A;  4TOR A;  4L6S A;  3L3L A;  1OS1 A;  1M51 A;  4BU6 A;  4UUH A;  4UI4 A;  5AL4 A;  4GMW A;  1UK0 A;  4BUW A;  4TKG A;  5C5Q A;  5ADT A;  1II2 A;  5FH2 A;  4GNO A;  4HLF A;  5FH3 A;  3L3M A;  4W5I A;  4TK5 A;  5AL5 A;  1YGG A;  4RCG A;  1KHB A;  4N4T A;  4ZZY A;  4J22 A;  4RV6 A;  3HKV A;  4J3M A;  2QF2 A;  4PY4 A;  3P0N A;  4UI7 A;  2RK8 A;  2RKE A;  4L09 A;  4OX2 A;  4WIU A;  4WPT A;  4BUU A;  4HLH A;  4HLM A;  4GV0 A;  4L7N A;  4L0S A;  1AQ2 A;  1KHF A;  3KR7 A;  4ZZX A;  2PAW A;  4BU7 A;  4GNL A;  2GMV A;  1KHE A;  5AL2 A;  4UVO A;  4LI8 A;  3GOY A;  4PNQ A;  2PY7 X;  4UVU A;  4UVY A;  5FH1 A;  2FAH A;  4TJU A;  3DT2 A;  4GMM A;  4UW1 A;  4YW8 A;  2RK7 A;  5I67 A;  1XKV A;  4OQB C;  4UVT A;  3P0Q A;  4UFU A;  5AKW A;  2RCW A;  4YWD A;  4BJC A;  3GJW A;  4L10 A;  3PAX A;  3UA9 A;  4K4F A;  4UVS A;  4HL5 A;  3CE0 A;  3MHJ A;  4UX4 A;  1UK1 A;  4U6A A;  1OEN A;  2RKA A;  3MHK A;  4KRS A;  4UVL A;  4GNM A;  5LYH A;  4AVW A;  4DQY C;  4IUE A;  4MT9 A;  1K3D A;  4PNM A;  4WL8 A;  3MOF A;  1YVY A;  2FAF A;  4UND A;  3DT7 A;  4UVN A;  5DCZ A;  2PAX A;  3UH2 A;  3DTB A;  1KHG A;  4J3L A;  1J3B A;  2RD6 A;  4L7O A;  2RKD A;  2ZCI A;  4GMU A;  4GV4 A;  4ZZZ A;  4PNN A;  4GMZ A;  4HLG A;  4N4V A;  3KJD A;  5FH4 A;  4WPU A;  4BUD A;  1AYL A;  4GV2 A;  4XHU A;  4I9I A;  1GS0 A;  4L7L A;  5ADQ A;  5FH5 A;  4LI6 A;  4BUE A;  3SE2 A;  4HKI A;  4PNT A;  5EBT A;  4X52 A;  4L32 A;  4KZU A;  4L6Z A;  4W6E A;  4R43 A;  4L0T A;  4OQA C;  2PC9 A;  5LXP A;  4F0E A;  4TOS A;  3MOH A;  4YWB A;  3GN7 A;  4GNQ A;  4HYF A;  3SMI A;  4MSK A;  5FH0 A;  5A00 A;  3W51 A;  3BLJ A;  1YLH A;  2OLQ A;  1YTM A;  4L7R A;  4GV7 A;  4UVV A;  4UVX A;  2QF1 A;  5AKU A;  5AEH A;  3KR8 A;  1EFY A;  4PJT A;  4PML A;  4L0I A;  4UVW A;  4UI3 A;  4WIE A;  3C49 A;  4KZL A;  4M7B A;  4R5W A;  5ETY A;  5FPG A;  4BJ9 A;  4F1L A;  4L70 A;  4BU9 A;  3FHB A;  4J21 A;  4TVJ A;  5ECE A;  4HHZ A;  4BU5 A;  3U9H A;  4BU3 A;  4BUS A;  2PXZ X;  1PAX A;  4OA7 A;  4GNP A;  4N3R A;  4PAX A;  4TJW A;  4PJV A;  3MOE A;  4HMH A;  4HKK A;  4K4E A;  4UI8 A;  3UDD A;  5ADR A;  4BUF A;  4UHG A;  4KZQ A;  1NHX A;  3UH4 A;  1WOK A;  4J1Z A;  4TKF A;  3SMJ A;  4BUA A;  4UI6 A;  4HKN A;  4MSG A;  4L33 A;  4R6E A;  5C5P A;  5C5R A;  3P0P A;  4UI5 A;  4YW9 A;  4BUT A;  5FPF A;  2X5Y A;  4BS4 A;  2OLR A;  4L2F A;  4L0V A; 
#chains in the Genus database with same CATH homology
 4UVZ A;  4L34 A;  4BUI A;  4L2G A;  3KCZ A;  4UFY A;  4BUY A;  4UVP A;  4L0B A;  2RF5 A;  4OPX C;  4PNR A;  4BUX A;  4BUV A;  1A26 A;  5AL3 A;  4BJB A;  3DT4 A;  4TKI A;  4UXB A;  4TK0 A;  4W5S A;  4BU8 A;  1K3C A;  4AVU A;  4LI7 A;  4WOU A;  5ADS A;  4WPV A;  4L7P A;  5AL1 A;  2QZY A;  2PQF A;  4PNS A;  4DVI A;  3C4H A;  3GEY A;  2QEY A;  4BFP A;  4L2K A;  4L7U A;  4F1Q A;  4L31 A;  2QEW A;  4HLK A;  5LX6 A;  4HHY A;  3U9Y A;  4PNL A;  4TJY A;  4TOR A;  4L6S A;  3L3L A;  1OS1 A;  1M51 A;  4BU6 A;  4UUH A;  4UI4 A;  5AL4 A;  4GMW A;  1UK0 A;  4BUW A;  4TKG A;  5C5Q A;  5ADT A;  1II2 A;  5FH2 A;  4GNO A;  4HLF A;  5FH3 A;  3L3M A;  4W5I A;  4TK5 A;  5AL5 A;  1YGG A;  4RCG A;  1KHB A;  4N4T A;  4ZZY A;  4J22 A;  4RV6 A;  3HKV A;  4J3M A;  2QF2 A;  4PY4 A;  3P0N A;  4UI7 A;  2RK8 A;  2RKE A;  4L09 A;  4OX2 A;  4WIU A;  4WPT A;  4BUU A;  4HLH A;  4HLM A;  4GV0 A;  4L7N A;  4L0S A;  1AQ2 A;  1KHF A;  3KR7 A;  4ZZX A;  2PAW A;  4BU7 A;  4GNL A;  2GMV A;  1KHE A;  5AL2 A;  4UVO A;  4LI8 A;  3GOY A;  4PNQ A;  2PY7 X;  4UVU A;  4UVY A;  5FH1 A;  2FAH A;  4TJU A;  3DT2 A;  4GMM A;  4UW1 A;  4YW8 A;  2RK7 A;  5I67 A;  1XKV A;  4OQB C;  4UVT A;  3P0Q A;  4UFU A;  5AKW A;  2RCW A;  4YWD A;  4BJC A;  3GJW A;  4L10 A;  3PAX A;  3UA9 A;  4K4F A;  4UVS A;  4HL5 A;  3CE0 A;  3MHJ A;  4UX4 A;  1UK1 A;  4U6A A;  1OEN A;  2RKA A;  3MHK A;  4KRS A;  4UVL A;  4GNM A;  5LYH A;  4AVW A;  4DQY C;  4IUE A;  4MT9 A;  1K3D A;  4PNM A;  4WL8 A;  3MOF A;  1YVY A;  2FAF A;  4UND A;  3DT7 A;  4UVN A;  5DCZ A;  2PAX A;  3UH2 A;  3DTB A;  1KHG A;  4J3L A;  1J3B A;  2RD6 A;  4L7O A;  2RKD A;  2ZCI A;  4GMU A;  4GV4 A;  4ZZZ A;  4PNN A;  4GMZ A;  4HLG A;  4N4V A;  3KJD A;  5FH4 A;  4WPU A;  4BUD A;  1AYL A;  4GV2 A;  4XHU A;  4I9I A;  1GS0 A;  4L7L A;  5ADQ A;  5FH5 A;  4LI6 A;  4BUE A;  3SE2 A;  4HKI A;  4PNT A;  5EBT A;  4X52 A;  4L32 A;  4KZU A;  4L6Z A;  4W6E A;  4R43 A;  4L0T A;  4OQA C;  2PC9 A;  5LXP A;  4F0E A;  4TOS A;  3MOH A;  4YWB A;  3GN7 A;  4GNQ A;  4HYF A;  3SMI A;  4MSK A;  5FH0 A;  5A00 A;  3W51 A;  3BLJ A;  1YLH A;  2OLQ A;  1YTM A;  4L7R A;  4GV7 A;  4UVV A;  4UVX A;  2QF1 A;  5AKU A;  5AEH A;  3KR8 A;  1EFY A;  4PJT A;  4PML A;  4L0I A;  4UVW A;  4UI3 A;  4WIE A;  3C49 A;  4KZL A;  4M7B A;  4R5W A;  5ETY A;  5FPG A;  4BJ9 A;  4F1L A;  4L70 A;  4BU9 A;  3FHB A;  4J21 A;  4TVJ A;  5ECE A;  4HHZ A;  4BU5 A;  3U9H A;  4BU3 A;  4BUS A;  2PXZ X;  1PAX A;  4OA7 A;  4GNP A;  4N3R A;  4PAX A;  4TJW A;  4PJV A;  3MOE A;  4HMH A;  4HKK A;  4K4E A;  4UI8 A;  3UDD A;  5ADR A;  4BUF A;  4UHG A;  4KZQ A;  1NHX A;  3UH4 A;  1WOK A;  4J1Z A;  4TKF A;  3SMJ A;  4BUA A;  4UI6 A;  4HKN A;  4MSG A;  4L33 A;  4R6E A;  5C5P A;  5C5R A;  3P0P A;  4UI5 A;  4YW9 A;  4BUT A;  5FPF A;  2X5Y A;  4BS4 A;  2OLR A;  4L2F A;  4L0V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...