3P0ZA

Crystal structure of 2-c-methyl-d-erythritol 2,4-cyclodiphosphate synthase from burkholderia pseudomallei with cytidine and fol955, 4-(1h-imidazol)-1-yl)phenol
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
158
structure length
158
Chain Sequence
b'MDFRIGQGYDVHQLVPGRPLIIGGVTIPYERGLLGHSDADVLLHAITDALFGAAALGDIGRHFSDTDPRFKGADSRALLRECASRVAQAGFAIRNVDSTIIAQAPKLAPHIDAMRANIAADLDLPLDRVNVKAKTNEKLGYLGRGEGIEAQAAALVVR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase
publication title Leveraging structure determination with fragment screening for infectious disease drug targets: MECP synthase from Burkholderia pseudomallei.
pubmed doi rcsb
source organism Burkholderia pseudomallei
molecule tags Lyase
total genus 50
structure length 158
sequence length 158
chains with identical sequence B, C
ec nomenclature ec 4.6.1.12: 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase.
pdb deposition date 2010-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02542 YgbB YgbB family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.50 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase 3p0zA00
3Q8HA 1H48A 1U43A 3ESJA 4C81A 3F6MA 1W57A 3EORA 2UZHA 3F0FA 3B6NA 3F0GA 3P10A 3GHZA 1IV3A 3FPIA 1KNJA 2PMPA 4C82A 1VHAA 3K2XA 3ERNA 3IKFA 1U3PA 1W55A 3KE1A 4C8GA 3FBAA 1H47A 1JN1A 1T0AA 3JVHA 3ELCA 3QHDA 1KNKA 5B8FA 2AMTA 3IKEA 3P0ZA 1IV1A 3IEQA 4C8EA 1IV4A 3MBMA 1GX1A 1VH8A 3F0DA 2GZLA 3RE3A 3IEWA 1U40A 3T80A 1U3LA 3F0EA 1IV2A 3K14A 1JY8A 4C8IA 1YQNA
chains in the Genus database with same CATH superfamily
3Q8HA 3CPWF 1U43A 1W5EA 4I55B 1TVKB 3VO8A 2UYNB 4B62A 4NQ3A 1KNJA 5JQGA 3J81M 4HNAA 1VQ6F 1YI2F 3NVKE 2KG4A 3S0WA 2ZOVA 3KIZA 5HY1A 1SA0B 3SIVA 1W59A 3JAKA 3HKEB 1KQSF 1RQ2A 5G4VC 3V7EA 3E20B 5HP7A 5IJ0B 4DXDA 1TUBA 1JFFB 1U40A 2F9ZC 2RHOA 3F0EA 1XRGA 5JCOA 2CSLA 3HKDB 3N2KB 1VQ7F 2VAMA 2VGMA 1Q81H 2RB9A 3CG6A 3EORA 1ODEA 3VCZA 5MN5A 3RYIA 2LBTA 1VQNF 3RYFA 4EB6B 5ITZA 3JAWA 4RHAA 3ELCA 2Q1YA 3JASA 5EWRA 5CB4A 4DRXA 4EI8A 5JVDA 4O4IA 2VAPA 4B45A 1U3LA 3CYPB 4C8IA 1QVFF 5GINC 4ZHWA 5LA6B 3S06A 2AIZP 3I7TA 2CWJA 3ZP7A 4TZZA 4O2BB 1W41A 2KTUA 1YJ9F 1X7OA 5IYZA 1YHQF 4YJ3A 2LBWA 1CLIA 2IAFA 2I6DA 2HX0A 3O85A 5LXTA 3CCJF 1Q7YH 3MQWA 1XHOA 2BTUA 1CK2A 2AMTA 3U0OA 3MCQA 1IV1A 4ZOLA 2Z1UA 2BO1A 4BVRA 4TV8A 1VQ4F 5KMGB 2Z1FA 1T0KB 4O4LA 3HKCA 2R751 1VK3A 1YQNA 2QI2A 4R40B 3JAMM 2MQEA 1VQLF 1X7PA 4NUTA 3V7QA 3C9SA 5EYPA 4LNUA 3S03A 5FNVB 4C4WC 1YIJF 4BVTA 5GANK 1FNKA 4WBNA 1W5AA 2ZF8A 3F0GA 4BT5A 2QEXF 3JATB 3CCUF 1M1KH 5JH7B 1W55A 3J80M 5LYJA 3WJPA 5HWEA 2IG8A 3LWVC 1K73H 2L26A 5B8FA 2B33A 1FSZA 2UYJA 3CC4F 3UT5A 4ZHQA 1Z5VA 3HKBA 3T80A 1UFYA 1IV2A 1QD9A 4BT4A 1ZWZA 5EAZA 3JARB 3RA5A 5HY4A 3V4DA 4B5CA 3WPXA 3KHNA 2PMPA 3WGMA 1IPAA 3BYQA 4BT2A 5HP8A 4KWEA 5JQGB 4YJ2A 2I6RA 3JVHA 1NJIH 3RYCA 3JALA 2EWCA 3TD3A 5MN6A 1YGYA 1NQ3A 3TD4A 3HJWC 5IJ9A 3HAXD 3N2GB 4F6RB 5J2UB 3CCVF 1ONIA 2QTPA 3WJRA 1VQOF 3M1XA 2HRUA 5CA0B 3P4EA 5KX5B 4X1IB 4G4ZA 3VYTC 1IV3A 5LP6B 4O2AB 1H7MA 1VQKF 3CCQF 4X1YA 4O4JB 5EZYA 4ZHYB 4TV9B 1DBFA 2GZLA 2BTQB 2HP3A 3DDNA 5GAPK 3K14A 5BMVB 3C9UA 3VTIC 4TUYA 1OFUA 4IIJA 2HQSC 4BW0B 3RYHB 3M84A 5EIBC 2HP0B 1S72F 4X20B 3S02A 5J2TB 3VOBA 4ZHVA 4I4TA 3CCSF 3HTNA 3OBWA 4ZI7A 1VQ9F 1QVGF 1H47A 5EB0A 4B46A 1T0AA 2V9YA 4X3MA 2H8EA 5CA1A 4U3JB 3CCMF 1GX1A 4I55A 1M90H 1TVKA 2YYEA 1OAPA 4X1KB 3NK6A 1VQMF 2UYNA 2Z1EA 4C81A 1RQ7A 5C8YB 5LP6C 3NMUC 1KD1H 1SA0A 1YJNF 3WGNA 5GONB 4O4HA 2HS0A 4C82A 3CMEF 2VGNA 3KE1A 1FNJA 1VQPF 2Z01A 4G4VA 5IJ0A 3CYQA 3QTYA 1J7HA 1JFFA 3LWQC 3E22B 2OTJF 3ZOPA 2W8BC 3F0DA 3HKDA 3N2KA 4IHJB 4PWTA 2LCAA 1COMA 3MDOA 3RA6A 1Q8RA 1K9MH 3ESJA 4I50B 4EI7A 1X52A 2UZHA 4G88A 2UYPA 3CD6F 3VOAA 4EB6A 4G4XA 5AVMA 1E7KA 2OTMA 4U39A 2R6R1 3CC7F 3D00A 3FBAA 3GYQA 3VYUC 5HXUA 3IKEA 3SIUA 2JNBA 2Z1TA 2PHNA 5LA6A 4FFBB 3IEWA 4O2BA 1FFXB 3GTZA 2DT4A 2FGYA 1JJ2F 1DT9A 3K0TA 5LOVB 3OW2F 3E1YA 4BT6A 2OZBA 4NWOB 2H6LA 3K2XA 5KMGA 3IR9A 1RA4A 4HNAB 3P0ZA 5EO3A 3PAFA 1W581 3JAKB 1KC8H 3FD5A 4G4YA 5FNVA 3G71F 3LWOC 1TUBB 1RLGA 3JATA 1W3EX 2CW4A 3F6MA 2ZODA 3TD5A 5JH7A 5FJ4C 3NK7A 3M4SA 3S0HA 3CCLF 1VQ5F 3ON1A 4BY9D 2CZWA 1VHAA 2DYYA 4G4WA 5GIPC 3LFOA 2ZVYA 3ZP4A 2CVLA 3I56F 2HVYD 5DCVA 3N4ZA 3RYIB 2FC3A 3RYFB 2HS3A 5ITZB 3VI6A 2YXZA 1W5BA 3JAWB 1W5FA 3CXCF 3JARA 3JASB 5CB4B 4DRXB 3WXMB 1GO0A 1CN7A 3CPQA 3K12A 2HS4A 5FLXM 4XCQA 2BTOA 5JVDB 2IQQA 4O4IB 3B6NA 3P10A 3LWPC 4EI9A 3KJKA 1QAHA 1W2BF 1Z5WA 3R0PA 3C9RA 4C8GA 2KTVA 3VYSC 2H8CA 5IYZB 2ZVZA 4O4HB 1SDSA 4YJ3B 2RHLA 2GLZA 3N2GA 3LYBA 1VQVA 4F6RA 5J2UA 3G4SF 5EB1B 5LXTB 2VXYA 4LCKA 1GO1A 2LBXA 1VH8A 3ZO8A 4BT7A 1W40A 4ZOLB 5CA0A 5KX5A 2P6YA 4X1IA 4TV8B 4ZK7A 4BT3A 3OBYA 5LP6A 3CC2F 4O2AA 2QA4F 4O4LB 5JCOC 3CB2A 1W57A 1GZ0A 3HKCB 2WALA 4BVQA 3GHZA 2CHSA 5EYPB 4LNUB 4O4JA 4RQOA 3HKEA 1VQ8F 4WBNB 1XBIA 4TV9A 3CCRF 5BMVA 5HY2A 3MBMA 5LYJB 3RE3A 5EIBD 2NMUA 3D01A 5IT9M 2VAWA 3RYHA 3UT5B 4ZHQB 5G4UC 1H48A 2HP0A 3HKBB 4X20A 3WGJA 5J2TA 3CMAF 3F0FA 3DC2A 3FFMA 3C9TA 1Q86H 3PLAC 2ZAUA 3WGLA 3NVIB 1YITF 3FD6A 4U3JA 3OONA 3AGKA 3I55F 1KNKA 1PF5A 3MCAB 2UYKA 4X1KA 4C8EA 1X25A 3IMPA 4YJ2B 3I3FA 3CCEF 3RYCB 2OHWA 3JALB 3J7AR 2KGWA 5C8YA 3LMEA 3WJQA 2HRYA 5IJ9B 3LDTA 3VIUA 3HWUA 5GONA 3C8LA 5HXZA 3G6EF 3N4YA 1Q82H 3QUWA 5A2QM 1YJWF 3E22A 3VMFB 1NMUB 1JN1A 1QU9A 3LWRC 4IHJA 4X3LA 2K1SA 3V3TA 4X1YB 1PXWA 3L7QA 4I50A 2N48A 5HY0A 1W42A 1SZQA 5EZYB 1JY8A 3D54A 4E6EA 1R1MA 2GVIA 2RHHA 4BVSA 1XV2A 5GIOC 3FPIA 1UI9A 4TUYB 2CHTA 4IIJB 3ERNA 3IKFA 1U3PA 1K8AH 3WPWA 2Q1XA 3QHDA 4FFBA 4M8IA 3IEQA 1FFXA 4I4TB 1IV4A 4ZI7B 2AIFA 1N8RH 3JCMM 3S0YA 5CA1B 2G9IA 1JD1A 5LOVA 1RLUA 2ALEA 3WGKA 5MN4A 2OTLF 3KJJA 2RHJA 4ERHA
chains in the Genus database with same CATH topology
3Q8HA 1H48A 1U43A 3ESJA 4C81A 3F6MA 1W57A 3EORA 2UZHA 3F0FA 3B6NA 3F0GA 3P10A 3GHZA 1IV3A 3FPIA 1KNJA 2PMPA 4C82A 1VHAA 3K2XA 3ERNA 3IKFA 1U3PA 1W55A 3KE1A 4C8GA 3FBAA 1H47A 1JN1A 1T0AA 3JVHA 3ELCA 3QHDA 1KNKA 5B8FA 2AMTA 3IKEA 3P0ZA 1IV1A 3IEQA 4C8EA 1IV4A 3MBMA 1GX1A 1VH8A 3F0DA 2GZLA 3RE3A 3IEWA 1U40A 3T80A 1U3LA 3F0EA 1IV2A 3K14A 1JY8A 4C8IA 1YQNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3Q8H A;  1H48 A;  1U43 A;  3ESJ A;  4C81 A;  3F6M A;  1W57 A;  3EOR A;  2UZH A;  3F0F A;  3B6N A;  3F0G A;  3P10 A;  3GHZ A;  1IV3 A;  3FPI A;  1KNJ A;  2PMP A;  4C82 A;  1VHA A;  3K2X A;  3ERN A;  3IKF A;  1U3P A;  1W55 A;  3KE1 A;  4C8G A;  3FBA A;  1H47 A;  1JN1 A;  1T0A A;  3JVH A;  3ELC A;  3QHD A;  1KNK A;  5B8F A;  2AMT A;  3IKE A;  3P0Z A;  1IV1 A;  3IEQ A;  4C8E A;  1IV4 A;  3MBM A;  1GX1 A;  1VH8 A;  3F0D A;  2GZL A;  3RE3 A;  3IEW A;  1U40 A;  3T80 A;  1U3L A;  3F0E A;  1IV2 A;  3K14 A;  1JY8 A;  4C8I A;  1YQN A; 
#chains in the Genus database with same CATH topology
 3Q8H A;  3CPW F;  1U43 A;  1W5E A;  4I55 B;  1TVK B;  3VO8 A;  2UYN B;  4B62 A;  4NQ3 A;  1KNJ A;  5JQG A;  3J81 M;  4HNA A;  1VQ6 F;  1YI2 F;  3NVK E;  2KG4 A;  3S0W A;  2ZOV A;  3KIZ A;  5HY1 A;  1SA0 B;  3SIV A;  1W59 A;  3JAK A;  3HKE B;  1KQS F;  1RQ2 A;  5G4V C;  3V7E A;  3E20 B;  5HP7 A;  5IJ0 B;  4DXD A;  1TUB A;  1JFF B;  1U40 A;  2F9Z C;  2RHO A;  3F0E A;  1XRG A;  5JCO A;  2CSL A;  3HKD B;  3N2K B;  1VQ7 F;  2VAM A;  2VGM A;  1Q81 H;  2RB9 A;  3CG6 A;  3EOR A;  1ODE A;  3VCZ A;  5MN5 A;  3RYI A;  2LBT A;  1VQN F;  3RYF A;  4EB6 B;  5ITZ A;  3JAW A;  4RHA A;  3ELC A;  2Q1Y A;  3JAS A;  5EWR A;  5CB4 A;  4DRX A;  4EI8 A;  5JVD A;  4O4I A;  2VAP A;  4B45 A;  1U3L A;  3CYP B;  4C8I A;  1QVF F;  5GIN C;  4ZHW A;  5LA6 B;  3S06 A;  2AIZ P;  3I7T A;  2CWJ A;  3ZP7 A;  4TZZ A;  4O2B B;  1W41 A;  2KTU A;  1YJ9 F;  1X7O A;  5IYZ A;  1YHQ F;  4YJ3 A;  2LBW A;  1CLI A;  2IAF A;  2I6D A;  2HX0 A;  3O85 A;  5LXT A;  3CCJ F;  1Q7Y H;  3MQW A;  1XHO A;  2BTU A;  1CK2 A;  2AMT A;  3U0O A;  3MCQ A;  1IV1 A;  4ZOL A;  2Z1U A;  2BO1 A;  4BVR A;  4TV8 A;  1VQ4 F;  5KMG B;  2Z1F A;  1T0K B;  4O4L A;  3HKC A;  2R75 1;  1VK3 A;  1YQN A;  2QI2 A;  4R40 B;  3JAM M;  2MQE A;  1VQL F;  1X7P A;  4NUT A;  3V7Q A;  3C9S A;  5EYP A;  4LNU A;  3S03 A;  5FNV B;  4C4W C;  1YIJ F;  4BVT A;  5GAN K;  1FNK A;  4WBN A;  1W5A A;  2ZF8 A;  3F0G A;  4BT5 A;  2QEX F;  3JAT B;  3CCU F;  1M1K H;  5JH7 B;  1W55 A;  3J80 M;  5LYJ A;  3WJP A;  5HWE A;  2IG8 A;  3LWV C;  1K73 H;  2L26 A;  5B8F A;  2B33 A;  1FSZ A;  2UYJ A;  3CC4 F;  3UT5 A;  4ZHQ A;  1Z5V A;  3HKB A;  3T80 A;  1UFY A;  1IV2 A;  1QD9 A;  4BT4 A;  1ZWZ A;  5EAZ A;  3JAR B;  3RA5 A;  5HY4 A;  3V4D A;  4B5C A;  3WPX A;  3KHN A;  2PMP A;  3WGM A;  1IPA A;  3BYQ A;  4BT2 A;  5HP8 A;  4KWE A;  5JQG B;  4YJ2 A;  2I6R A;  3JVH A;  1NJI H;  3RYC A;  3JAL A;  2EWC A;  3TD3 A;  5MN6 A;  1YGY A;  1NQ3 A;  3TD4 A;  3HJW C;  5IJ9 A;  3HAX D;  3N2G B;  4F6R B;  5J2U B;  3CCV F;  1ONI A;  2QTP A;  3WJR A;  1VQO F;  3M1X A;  2HRU A;  5CA0 B;  3P4E A;  5KX5 B;  4X1I B;  4G4Z A;  3VYT C;  1IV3 A;  5LP6 B;  4O2A B;  1H7M A;  1VQK F;  3CCQ F;  4X1Y A;  4O4J B;  5EZY A;  4ZHY B;  4TV9 B;  1DBF A;  2GZL A;  2BTQ B;  2HP3 A;  3DDN A;  5GAP K;  3K14 A;  5BMV B;  3C9U A;  3VTI C;  4TUY A;  1OFU A;  4IIJ A;  2HQS C;  4BW0 B;  3RYH B;  3M84 A;  5EIB C;  2HP0 B;  1S72 F;  4X20 B;  3S02 A;  5J2T B;  3VOB A;  4ZHV A;  4I4T A;  3CCS F;  3HTN A;  3OBW A;  4ZI7 A;  1VQ9 F;  1QVG F;  1H47 A;  5EB0 A;  4B46 A;  1T0A A;  2V9Y A;  4X3M A;  2H8E A;  5CA1 A;  4U3J B;  3CCM F;  1GX1 A;  4I55 A;  1M90 H;  1TVK A;  2YYE A;  1OAP A;  4X1K B;  3NK6 A;  1VQM F;  2UYN A;  2Z1E A;  4C81 A;  1RQ7 A;  5C8Y B;  5LP6 C;  3NMU C;  1KD1 H;  1SA0 A;  1YJN F;  3WGN A;  5GON B;  4O4H A;  2HS0 A;  4C82 A;  3CME F;  2VGN A;  3KE1 A;  1FNJ A;  1VQP F;  2Z01 A;  4G4V A;  5IJ0 A;  3CYQ A;  3QTY A;  1J7H A;  1JFF A;  3LWQ C;  3E22 B;  2OTJ F;  3ZOP A;  2W8B C;  3F0D A;  3HKD A;  3N2K A;  4IHJ B;  4PWT A;  2LCA A;  1COM A;  3MDO A;  3RA6 A;  1Q8R A;  1K9M H;  3ESJ A;  4I50 B;  4EI7 A;  1X52 A;  2UZH A;  4G88 A;  2UYP A;  3CD6 F;  3VOA A;  4EB6 A;  4G4X A;  5AVM A;  1E7K A;  2OTM A;  4U39 A;  2R6R 1;  3CC7 F;  3D00 A;  3FBA A;  3GYQ A;  3VYU C;  5HXU A;  3IKE A;  3SIU A;  2JNB A;  2Z1T A;  2PHN A;  5LA6 A;  4FFB B;  3IEW A;  4O2B A;  1FFX B;  3GTZ A;  2DT4 A;  2FGY A;  1JJ2 F;  1DT9 A;  3K0T A;  5LOV B;  3OW2 F;  3E1Y A;  4BT6 A;  2OZB A;  4NWO B;  2H6L A;  3K2X A;  5KMG A;  3IR9 A;  1RA4 A;  4HNA B;  3P0Z A;  5EO3 A;  3PAF A;  1W58 1;  3JAK B;  1KC8 H;  3FD5 A;  4G4Y A;  5FNV A;  3G71 F;  3LWO C;  1TUB B;  1RLG A;  3JAT A;  1W3E X;  2CW4 A;  3F6M A;  2ZOD A;  3TD5 A;  5JH7 A;  5FJ4 C;  3NK7 A;  3M4S A;  3S0H A;  3CCL F;  1VQ5 F;  3ON1 A;  4BY9 D;  2CZW A;  1VHA A;  2DYY A;  4G4W A;  5GIP C;  3LFO A;  2ZVY A;  3ZP4 A;  2CVL A;  3I56 F;  2HVY D;  5DCV A;  3N4Z A;  3RYI B;  2FC3 A;  3RYF B;  2HS3 A;  5ITZ B;  3VI6 A;  2YXZ A;  1W5B A;  3JAW B;  1W5F A;  3CXC F;  3JAR A;  3JAS B;  5CB4 B;  4DRX B;  3WXM B;  1GO0 A;  1CN7 A;  3CPQ A;  3K12 A;  2HS4 A;  5FLX M;  4XCQ A;  2BTO A;  5JVD B;  2IQQ A;  4O4I B;  3B6N A;  3P10 A;  3LWP C;  4EI9 A;  3KJK A;  1QAH A;  1W2B F;  1Z5W A;  3R0P A;  3C9R A;  4C8G A;  2KTV A;  3VYS C;  2H8C A;  5IYZ B;  2ZVZ A;  4O4H B;  1SDS A;  4YJ3 B;  2RHL A;  2GLZ A;  3N2G A;  3LYB A;  1VQV A;  4F6R A;  5J2U A;  3G4S F;  5EB1 B;  5LXT B;  2VXY A;  4LCK A;  1GO1 A;  2LBX A;  1VH8 A;  3ZO8 A;  4BT7 A;  1W40 A;  4ZOL B;  5CA0 A;  5KX5 A;  2P6Y A;  4X1I A;  4TV8 B;  4ZK7 A;  4BT3 A;  3OBY A;  5LP6 A;  3CC2 F;  4O2A A;  2QA4 F;  4O4L B;  5JCO C;  3CB2 A;  1W57 A;  1GZ0 A;  3HKC B;  2WAL A;  4BVQ A;  3GHZ A;  2CHS A;  5EYP B;  4LNU B;  4O4J A;  4RQO A;  3HKE A;  1VQ8 F;  4WBN B;  1XBI A;  4TV9 A;  3CCR F;  5BMV A;  5HY2 A;  3MBM A;  5LYJ B;  3RE3 A;  5EIB D;  2NMU A;  3D01 A;  5IT9 M;  2VAW A;  3RYH A;  3UT5 B;  4ZHQ B;  5G4U C;  1H48 A;  2HP0 A;  3HKB B;  4X20 A;  3WGJ A;  5J2T A;  3CMA F;  3F0F A;  3DC2 A;  3FFM A;  3C9T A;  1Q86 H;  3PLA C;  2ZAU A;  3WGL A;  3NVI B;  1YIT F;  3FD6 A;  4U3J A;  3OON A;  3AGK A;  3I55 F;  1KNK A;  1PF5 A;  3MCA B;  2UYK A;  4X1K A;  4C8E A;  1X25 A;  3IMP A;  4YJ2 B;  3I3F A;  3CCE F;  3RYC B;  2OHW A;  3JAL B;  3J7A R;  2KGW A;  5C8Y A;  3LME A;  3WJQ A;  2HRY A;  5IJ9 B;  3LDT A;  3VIU A;  3HWU A;  5GON A;  3C8L A;  5HXZ A;  3G6E F;  3N4Y A;  1Q82 H;  3QUW A;  5A2Q M;  1YJW F;  3E22 A;  3VMF B;  1NMU B;  1JN1 A;  1QU9 A;  3LWR C;  4IHJ A;  4X3L A;  2K1S A;  3V3T A;  4X1Y B;  1PXW A;  3L7Q A;  4I50 A;  2N48 A;  5HY0 A;  1W42 A;  1SZQ A;  5EZY B;  1JY8 A;  3D54 A;  4E6E A;  1R1M A;  2GVI A;  2RHH A;  4BVS A;  1XV2 A;  5GIO C;  3FPI A;  1UI9 A;  4TUY B;  2CHT A;  4IIJ B;  3ERN A;  3IKF A;  1U3P A;  1K8A H;  3WPW A;  2Q1X A;  3QHD A;  4FFB A;  4M8I A;  3IEQ A;  1FFX A;  4I4T B;  1IV4 A;  4ZI7 B;  2AIF A;  1N8R H;  3JCM M;  3S0Y A;  5CA1 B;  2G9I A;  1JD1 A;  5LOV A;  1RLU A;  2ALE A;  3WGK A;  5MN4 A;  2OTL F;  3KJJ A;  2RHJ A;  4ERH A; 
#chains in the Genus database with same CATH homology
 3Q8H A;  1H48 A;  1U43 A;  3ESJ A;  4C81 A;  3F6M A;  1W57 A;  3EOR A;  2UZH A;  3F0F A;  3B6N A;  3F0G A;  3P10 A;  3GHZ A;  1IV3 A;  3FPI A;  1KNJ A;  2PMP A;  4C82 A;  1VHA A;  3K2X A;  3ERN A;  3IKF A;  1U3P A;  1W55 A;  3KE1 A;  4C8G A;  3FBA A;  1H47 A;  1JN1 A;  1T0A A;  3JVH A;  3ELC A;  3QHD A;  1KNK A;  5B8F A;  2AMT A;  3IKE A;  3P0Z A;  1IV1 A;  3IEQ A;  4C8E A;  1IV4 A;  3MBM A;  1GX1 A;  1VH8 A;  3F0D A;  2GZL A;  3RE3 A;  3IEW A;  1U40 A;  3T80 A;  1U3L A;  3F0E A;  1IV2 A;  3K14 A;  1JY8 A;  4C8I A;  1YQN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...