3P0ZA

Crystal structure of 2-c-methyl-d-erythritol 2,4-cyclodiphosphate synthase from burkholderia pseudomallei with cytidine and fol955, 4-(1h-imidazol)-1-yl)phenol
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
158
structure length
158
Chain Sequence
MDFRIGQGYDVHQLVPGRPLIIGGVTIPYERGLLGHSDADVLLHAITDALFGAAALGDIGRHFSDTDPRFKGADSRALLRECASRVAQAGFAIRNVDSTIIAQAPKLAPHIDAMRANIAADLDLPLDRVNVKAKTNEKLGYLGRGEGIEAQAAALVVR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase
publication title Leveraging structure determination with fragment screening for infectious disease drug targets: MECP synthase from Burkholderia pseudomallei.
pubmed doi rcsb
source organism Burkholderia pseudomallei
molecule tags Lyase
total genus 50
structure length 158
sequence length 158
chains with identical sequence B, C
ec nomenclature ec 4.6.1.12: 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase.
pdb deposition date 2010-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02542 YgbB YgbB family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.50 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase 3p0zA00
3F0DA 4C81A 1JY8A 3FBAA 1IV2A 1U3LA 1U43A 2AMTA 3IEQA 3T80A 3MBMA 3F6MA 1W55A 1U40A 3FPIA 1T0AA 1KNKA 3IKFA 3KE1A 1IV1A 3ELCA 3IKEA 2GZLA 3RE3A 2PMPA 1IV4A 1YQNA 1KNJA 3P0ZA 1W57A 1H47A 3F0GA 1VH8A 3P10A 3Q8HA 3K14A 4C8GA 1IV3A 2UZHA 5B8FA 3JVHA 1H48A 1GX1A 4C8EA 3EORA 3ERNA 1U3PA 3F0FA 4C8IA 3ESJA 3B6NA 3K2XA 3GHZA 3QHDA 1VHAA 3F0EA 3IEWA 1JN1A 4C82A
chains in the Genus database with same CATH superfamily
3N2GB 1JY8A 4I50A 3RA6A 2HP0B 1TUBB 5MN4A 1W581 2HP0A 2KTVA 4B62A 3JASB 5HXZA 1K9MH 3QTYA 5LA6A 4ZI7A 1FSZA 3SIUA 2UYJA 4I4TA 2K1SA 3JALB 3JAMM 1X7PA 5HY1A 5MN6A 3CCMF 1RLGA 3V3TA 5CA0B 1W59A 3B6NA 2IG8A 3E22B 3N2KB 5IJ0B 1PF5A 3ON1A 3CC7F 1FFXB 1ONIA 4ZHQB 2CWJA 1GO1A 3WPWA 3OBWA 3GTZA 1FFXA 5JH7A 2ZF8A 5CA1A 2P6YA 3S03A 4I55A 3DDNA 3HKEB 2Q1XA 2UZHA 1YI2F 3D00A 1T0KB 1R1MA 4G4WA 5FLXM 5IJ9A 2RHHA 5EB0A 3WJRA 3V7EA 1W41A 5LYJA 5A2QM 5HP7A 1VQVA 2LBTA 3TD5A 3RYFA 3SIVA 5GONB 3KE1A 1CLIA 1CN7A 3I3FA 1VK3A 5LOVB 4R40B 5JQGB 4O4LA 5ITZA 1H47A 5EAZA 1M90H 2QI2A 5DCVA 3HKBA 5C8YA 1QVGF 2HRYA 4TZZA 2BTQB 1RLUA 3CCJF 3JCMM 2F9ZC 3WGLA 3M1XA 2CVLA 1YJNF 2LBWA 3CC4F 5HY4A 1W5FA 3G4SF 1ZWZA 5EB1B 1UFYA 1VQOF 3JAKA 3JATB 1DT9A 1YHQF 2Z1TA 3CCUF 2W8BC 1ODEA 4F6RA 3R0PA 2AIFA 2YXZA 4TV8B 1YQNA 4BT7A 1XBIA 2L26A 3MCQA 3K14A 3RYCB 4DRXB 5KMGA 3P4EA 5B8FA 3HKDB 1W5AA 2Z01A 4BT6A 2VGMA 2HRUA 3VYTC 3N4YA 5KX5B 5HY2A 5GIOC 5IYZA 3WJQA 3LMEA 3MQWA 2MQEA 3NVKE 3LDTA 4YJ2A 3CMEF 5FNVB 3UT5B 1TVKB 2UYKA 3L7QA 4FFBB 3CCQF 1YIJF 4NWOB 2HP3A 2HS4A 3RE3A 3LFOA 4TUYB 3P0ZA 3CXCF 4TUYA 4NUTA 3C8LA 4X3MA 5J2UA 1VHAA 1FNKA 4I50B 1XHOA 3CCEF 3D54A 4ZHVA 1QD9A 2DT4A 2JNBA 4G88A 4U3JA 1K73H 3ELCA 2R751 3IKEA 2RHLA 4IHJA 1H7MA 4O2AB 1S72F 5LA6B 4ZI7B 4LNUA 1VQNF 3KJKA 3NK6A 4I4TB 3F0GA 5HY0A 2H8CA 3OW2F 2LBXA 1IPAA 1VQ8F 4O2AA 3E1YA 5BMVA 3CYQA 4IIJA 5AVMA 3WGMA 3IR9A 5LXTA 5LP6B 3VI6A 2AIZP 3VOBA 1Q81H 2YYEA 4M8IA 2PHNA 5LP6A 1PXWA 4BVTA 3F0DA 1XV2A 4C81A 5HWEA 1W2BF 3FD6A 2AMTA 2IAFA 2RHJA 3M4SA 1X7OA 4ERHA 5LP6C 5EWRA 3IKFA 3S0HA 1OFUA 4BY9D 5JH7B 5CA1B 4I55B 3VMFB 1W5EA 3M84A 2VGNA 4EI8A 1VQ5F 4G4XA 5IJ9B 1XRGA 3I56F 2B33A 2ZOVA 5CB4B 1VQMF 3J80M 2DYYA 3K0TA 5LYJB 2KG4A 2UYPA 5CB4A 5EO3A 3DC2A 3RYFB 3C9TA 3NMUC 4EB6A 3FPIA 4G4ZA 1T0AA 4X1YA 3G71F 2CHTA 5J2TA 1IV1A 1E7KA 4O4LB 5ITZB 1KC8H 5HXUA 1W42A 2OTMA 3HKBB 3ZO8A 5C8YB 1W57A 3BYQA 1VH8A 1VQ4F 3CPWF 1QVFF 2CZWA 2HS3A 1NJIH 5EZYA 1M1KH 1OAPA 3EORA 1VQLF 4C8IA 3ESJA 3K2XA 3J7AR 5EIBD 4O4HA 3CMAF 4ZOLA 2ALEA 3OBYA 4BT2A 2VAPA 2HQSC 2HS0A 3JAKB 2N48A 1W55A 2LCAA 1X52A 3LYBA 4F6RB 4X3LA 3OONA 3KHNA 2CW4A 3RYHB 3WJPA 1JD1A 3P10A 5KMGB 3RYHA 3C9RA 3CB2A 3ZP4A 1H48A 3CCVF 1SZQA 2Z1FA 5IYZB 5G4VC 3MDOA 2R6R1 3PLAC 3ZP7A 1KQSF 4YJ2B 2I6DA 3N4ZA 5EYPB 2EWCA 2UYNB 3S0WA 3S02A 5GANK 3KIZA 3FBAA 1U43A 3HJWC 2NMUA 5EIBC 5EYPA 5HP8A 3VYSC 2UYNA 1W5BA 3NK7A 3JAWA 2VAWA 5GAPK 4NQ3A 2KTUA 3CYPB 4X1IA 5G4UC 5J2UB 5MN5A 1J7HA 3F0FA 3V7QA 4TV9A 1NQ3A 1Q7YH 4C4WC 4ZHWA 4HNAA 1SA0A 3K12A 3MCAB 5GINC 4O4JB 4U3JB 3HKCA 4WBNA 1U40A 3WGKA 4O4JA 4IHJB 4LNUB 1W3EX 3V4DA 4B5CA 3CCRF 3LWQC 5BMVB 2QEXF 2QA4F 4IIJB 5LXTB 3HAXD 3JVHA 1N8RH 3C9SA 2OTJF 2HVYD 4EI9A 3F0EA 4O2BA 2I6RA 4KWEA 2Q1YA 2Z1EA 5JCOA 3S06A 3IEQA 3TD3A 3IMPA 1JJ2F 4U39A 3N2GA 2QTPA 4BVRA 1KNKA 4ZK7A 4YJ3B 5JCOC 1TUBA 1RQ7A 2PMPA 4YJ3A 3LWOC 3Q8HA 5JVDB 5FJ4C 2VXYA 5GIPC 2RB9A 3JASA 4ZHYB 1YJWF 4BT4A 2ZODA 3CD6F 1VQKF 5JVDA 2V9YA 1K8AH 3JALA 2ZAUA 1RA4A 1CK2A 2KGWA 3WGJA 4EB6B 3GYQA 1RQ2A 3FFMA 1COMA 4X1YB 5CA0A 4BVSA 1YGYA 2H6LA 4G4VA 5J2TB 3F6MA 4BVQA 1YITF 3E22A 3VCZA 3N2KA 5IJ0A 3WGNA 3CCSF 2IQQA 3VO8A 1KD1H 1VQ7F 4ZHQA 3WPXA 3LWRC 1IV4A 3RA5A 1FNJA 1Z5WA 5EZYB 4DXDA 1IV3A 2OZBA 1Z5VA 1Q86H 4XCQA 4O4HB 3HKEA 3KJJA 1GZ0A 2BO1A 4ZOLB 2CSLA 3I7TA 3U0OA 4O4IB 2FGYA 3GHZA 3QHDA 4E6EA 1QAHA 4O4IA 4BT3A 3CPQA 2OHWA 2GLZA 3VOAA 2OTLF 3QUWA 3D01A 5GONA 3I55F 3JARB 5LOVA 5JQGA 3NVIB 3JARA 1Q82H 3J81M 3ZOPA 1NMUB 4C8EA 3G6EF 3ERNA 3VYUC 4X20B 3CC2F 2FC3A 1UI9A 2Z1UA 1JFFB 4X1KB 3E20B 4X20A 4C82A 3PAFA 3T80A 4G4YA 3S0YA 1U3LA 2ZVYA 1JFFA 4X1KA 3JAWB 4BT5A 3HTNA 1Q8RA 1DBFA 4EI7A 1VQ6F 4B45A 1VQPF 3JATA 4X1IB 4B46A 1KNJA 3CG6A 4TV8A 4C8GA 2VAMA 4TV9B 3WXMB 3RYCA 4DRXA 1GX1A 4PWTA 1U3PA 4HNAB 1SA0B 3HKDA 5IT9M 3HKCB 1GO0A 4WBNB 1X25A 1VQ9F 5KX5A 3VIUA 2HX0A 2H8EA 3C9UA 1IV2A 3TD4A 2BTUA 3MBMA 1YJ9F 3LWPC 5FNVA 3AGKA 3UT5A 1SDSA 2GVIA 2GZLA 1TVKA 2BTOA 2ZVZA 3O85A 4FFBA 4LCKA 4RHAA 2RHOA 1W40A 4RQOA 2WALA 4BW0B 4O2BB 1QU9A 3RYIB 2G9IA 3HWUA 3CCLF 3RYIA 3FD5A 3VTIC 3IEWA 2CHSA 1JN1A 3LWVC
chains in the Genus database with same CATH topology
3F0DA 4C81A 1JY8A 3FBAA 1IV2A 1U3LA 1U43A 2AMTA 3IEQA 3T80A 3MBMA 3F6MA 1W55A 1U40A 3FPIA 1T0AA 1KNKA 3IKFA 3KE1A 1IV1A 3ELCA 3IKEA 2GZLA 3RE3A 2PMPA 1IV4A 1YQNA 1KNJA 3P0ZA 1W57A 1H47A 3F0GA 1VH8A 3P10A 3Q8HA 3K14A 4C8GA 1IV3A 2UZHA 5B8FA 3JVHA 1H48A 1GX1A 4C8EA 3EORA 3ERNA 1U3PA 3F0FA 4C8IA 3ESJA 3B6NA 3K2XA 3GHZA 3QHDA 1VHAA 3F0EA 3IEWA 1JN1A 4C82A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3F0D A;  4C81 A;  1JY8 A;  3FBA A;  1IV2 A;  1U3L A;  1U43 A;  2AMT A;  3IEQ A;  3T80 A;  3MBM A;  3F6M A;  1W55 A;  1U40 A;  3FPI A;  1T0A A;  1KNK A;  3IKF A;  3KE1 A;  1IV1 A;  3ELC A;  3IKE A;  2GZL A;  3RE3 A;  2PMP A;  1IV4 A;  1YQN A;  1KNJ A;  3P0Z A;  1W57 A;  1H47 A;  3F0G A;  1VH8 A;  3P10 A;  3Q8H A;  3K14 A;  4C8G A;  1IV3 A;  2UZH A;  5B8F A;  3JVH A;  1H48 A;  1GX1 A;  4C8E A;  3EOR A;  3ERN A;  1U3P A;  3F0F A;  4C8I A;  3ESJ A;  3B6N A;  3K2X A;  3GHZ A;  3QHD A;  1VHA A;  3F0E A;  3IEW A;  1JN1 A;  4C82 A; 
#chains in the Genus database with same CATH topology
 3N2G B;  1JY8 A;  4I50 A;  3RA6 A;  2HP0 B;  1TUB B;  5MN4 A;  1W58 1;  2HP0 A;  2KTV A;  4B62 A;  3JAS B;  5HXZ A;  1K9M H;  3QTY A;  5LA6 A;  4ZI7 A;  1FSZ A;  3SIU A;  2UYJ A;  4I4T A;  2K1S A;  3JAL B;  3JAM M;  1X7P A;  5HY1 A;  5MN6 A;  3CCM F;  1RLG A;  3V3T A;  5CA0 B;  1W59 A;  3B6N A;  2IG8 A;  3E22 B;  3N2K B;  5IJ0 B;  1PF5 A;  3ON1 A;  3CC7 F;  1FFX B;  1ONI A;  4ZHQ B;  2CWJ A;  1GO1 A;  3WPW A;  3OBW A;  3GTZ A;  1FFX A;  5JH7 A;  2ZF8 A;  5CA1 A;  2P6Y A;  3S03 A;  4I55 A;  3DDN A;  3HKE B;  2Q1X A;  2UZH A;  1YI2 F;  3D00 A;  1T0K B;  1R1M A;  4G4W A;  5FLX M;  5IJ9 A;  2RHH A;  5EB0 A;  3WJR A;  3V7E A;  1W41 A;  5LYJ A;  5A2Q M;  5HP7 A;  1VQV A;  2LBT A;  3TD5 A;  3RYF A;  3SIV A;  5GON B;  3KE1 A;  1CLI A;  1CN7 A;  3I3F A;  1VK3 A;  5LOV B;  4R40 B;  5JQG B;  4O4L A;  5ITZ A;  1H47 A;  5EAZ A;  1M90 H;  2QI2 A;  5DCV A;  3HKB A;  5C8Y A;  1QVG F;  2HRY A;  4TZZ A;  2BTQ B;  1RLU A;  3CCJ F;  3JCM M;  2F9Z C;  3WGL A;  3M1X A;  2CVL A;  1YJN F;  2LBW A;  3CC4 F;  5HY4 A;  1W5F A;  3G4S F;  1ZWZ A;  5EB1 B;  1UFY A;  1VQO F;  3JAK A;  3JAT B;  1DT9 A;  1YHQ F;  2Z1T A;  3CCU F;  2W8B C;  1ODE A;  4F6R A;  3R0P A;  2AIF A;  2YXZ A;  4TV8 B;  1YQN A;  4BT7 A;  1XBI A;  2L26 A;  3MCQ A;  3K14 A;  3RYC B;  4DRX B;  5KMG A;  3P4E A;  5B8F A;  3HKD B;  1W5A A;  2Z01 A;  4BT6 A;  2VGM A;  2HRU A;  3VYT C;  3N4Y A;  5KX5 B;  5HY2 A;  5GIO C;  5IYZ A;  3WJQ A;  3LME A;  3MQW A;  2MQE A;  3NVK E;  3LDT A;  4YJ2 A;  3CME F;  5FNV B;  3UT5 B;  1TVK B;  2UYK A;  3L7Q A;  4FFB B;  3CCQ F;  1YIJ F;  4NWO B;  2HP3 A;  2HS4 A;  3RE3 A;  3LFO A;  4TUY B;  3P0Z A;  3CXC F;  4TUY A;  4NUT A;  3C8L A;  4X3M A;  5J2U A;  1VHA A;  1FNK A;  4I50 B;  1XHO A;  3CCE F;  3D54 A;  4ZHV A;  1QD9 A;  2DT4 A;  2JNB A;  4G88 A;  4U3J A;  1K73 H;  3ELC A;  2R75 1;  3IKE A;  2RHL A;  4IHJ A;  1H7M A;  4O2A B;  1S72 F;  5LA6 B;  4ZI7 B;  4LNU A;  1VQN F;  3KJK A;  3NK6 A;  4I4T B;  3F0G A;  5HY0 A;  2H8C A;  3OW2 F;  2LBX A;  1IPA A;  1VQ8 F;  4O2A A;  3E1Y A;  5BMV A;  3CYQ A;  4IIJ A;  5AVM A;  3WGM A;  3IR9 A;  5LXT A;  5LP6 B;  3VI6 A;  2AIZ P;  3VOB A;  1Q81 H;  2YYE A;  4M8I A;  2PHN A;  5LP6 A;  1PXW A;  4BVT A;  3F0D A;  1XV2 A;  4C81 A;  5HWE A;  1W2B F;  3FD6 A;  2AMT A;  2IAF A;  2RHJ A;  3M4S A;  1X7O A;  4ERH A;  5LP6 C;  5EWR A;  3IKF A;  3S0H A;  1OFU A;  4BY9 D;  5JH7 B;  5CA1 B;  4I55 B;  3VMF B;  1W5E A;  3M84 A;  2VGN A;  4EI8 A;  1VQ5 F;  4G4X A;  5IJ9 B;  1XRG A;  3I56 F;  2B33 A;  2ZOV A;  5CB4 B;  1VQM F;  3J80 M;  2DYY A;  3K0T A;  5LYJ B;  2KG4 A;  2UYP A;  5CB4 A;  5EO3 A;  3DC2 A;  3RYF B;  3C9T A;  3NMU C;  4EB6 A;  3FPI A;  4G4Z A;  1T0A A;  4X1Y A;  3G71 F;  2CHT A;  5J2T A;  1IV1 A;  1E7K A;  4O4L B;  5ITZ B;  1KC8 H;  5HXU A;  1W42 A;  2OTM A;  3HKB B;  3ZO8 A;  5C8Y B;  1W57 A;  3BYQ A;  1VH8 A;  1VQ4 F;  3CPW F;  1QVF F;  2CZW A;  2HS3 A;  1NJI H;  5EZY A;  1M1K H;  1OAP A;  3EOR A;  1VQL F;  4C8I A;  3ESJ A;  3K2X A;  3J7A R;  5EIB D;  4O4H A;  3CMA F;  4ZOL A;  2ALE A;  3OBY A;  4BT2 A;  2VAP A;  2HQS C;  2HS0 A;  3JAK B;  2N48 A;  1W55 A;  2LCA A;  1X52 A;  3LYB A;  4F6R B;  4X3L A;  3OON A;  3KHN A;  2CW4 A;  3RYH B;  3WJP A;  1JD1 A;  3P10 A;  5KMG B;  3RYH A;  3C9R A;  3CB2 A;  3ZP4 A;  1H48 A;  3CCV F;  1SZQ A;  2Z1F A;  5IYZ B;  5G4V C;  3MDO A;  2R6R 1;  3PLA C;  3ZP7 A;  1KQS F;  4YJ2 B;  2I6D A;  3N4Z A;  5EYP B;  2EWC A;  2UYN B;  3S0W A;  3S02 A;  5GAN K;  3KIZ A;  3FBA A;  1U43 A;  3HJW C;  2NMU A;  5EIB C;  5EYP A;  5HP8 A;  3VYS C;  2UYN A;  1W5B A;  3NK7 A;  3JAW A;  2VAW A;  5GAP K;  4NQ3 A;  2KTU A;  3CYP B;  4X1I A;  5G4U C;  5J2U B;  5MN5 A;  1J7H A;  3F0F A;  3V7Q A;  4TV9 A;  1NQ3 A;  1Q7Y H;  4C4W C;  4ZHW A;  4HNA A;  1SA0 A;  3K12 A;  3MCA B;  5GIN C;  4O4J B;  4U3J B;  3HKC A;  4WBN A;  1U40 A;  3WGK A;  4O4J A;  4IHJ B;  4LNU B;  1W3E X;  3V4D A;  4B5C A;  3CCR F;  3LWQ C;  5BMV B;  2QEX F;  2QA4 F;  4IIJ B;  5LXT B;  3HAX D;  3JVH A;  1N8R H;  3C9S A;  2OTJ F;  2HVY D;  4EI9 A;  3F0E A;  4O2B A;  2I6R A;  4KWE A;  2Q1Y A;  2Z1E A;  5JCO A;  3S06 A;  3IEQ A;  3TD3 A;  3IMP A;  1JJ2 F;  4U39 A;  3N2G A;  2QTP A;  4BVR A;  1KNK A;  4ZK7 A;  4YJ3 B;  5JCO C;  1TUB A;  1RQ7 A;  2PMP A;  4YJ3 A;  3LWO C;  3Q8H A;  5JVD B;  5FJ4 C;  2VXY A;  5GIP C;  2RB9 A;  3JAS A;  4ZHY B;  1YJW F;  4BT4 A;  2ZOD A;  3CD6 F;  1VQK F;  5JVD A;  2V9Y A;  1K8A H;  3JAL A;  2ZAU A;  1RA4 A;  1CK2 A;  2KGW A;  3WGJ A;  4EB6 B;  3GYQ A;  1RQ2 A;  3FFM A;  1COM A;  4X1Y B;  5CA0 A;  4BVS A;  1YGY A;  2H6L A;  4G4V A;  5J2T B;  3F6M A;  4BVQ A;  1YIT F;  3E22 A;  3VCZ A;  3N2K A;  5IJ0 A;  3WGN A;  3CCS F;  2IQQ A;  3VO8 A;  1KD1 H;  1VQ7 F;  4ZHQ A;  3WPX A;  3LWR C;  1IV4 A;  3RA5 A;  1FNJ A;  1Z5W A;  5EZY B;  4DXD A;  1IV3 A;  2OZB A;  1Z5V A;  1Q86 H;  4XCQ A;  4O4H B;  3HKE A;  3KJJ A;  1GZ0 A;  2BO1 A;  4ZOL B;  2CSL A;  3I7T A;  3U0O A;  4O4I B;  2FGY A;  3GHZ A;  3QHD A;  4E6E A;  1QAH A;  4O4I A;  4BT3 A;  3CPQ A;  2OHW A;  2GLZ A;  3VOA A;  2OTL F;  3QUW A;  3D01 A;  5GON A;  3I55 F;  3JAR B;  5LOV A;  5JQG A;  3NVI B;  3JAR A;  1Q82 H;  3J81 M;  3ZOP A;  1NMU B;  4C8E A;  3G6E F;  3ERN A;  3VYU C;  4X20 B;  3CC2 F;  2FC3 A;  1UI9 A;  2Z1U A;  1JFF B;  4X1K B;  3E20 B;  4X20 A;  4C82 A;  3PAF A;  3T80 A;  4G4Y A;  3S0Y A;  1U3L A;  2ZVY A;  1JFF A;  4X1K A;  3JAW B;  4BT5 A;  3HTN A;  1Q8R A;  1DBF A;  4EI7 A;  1VQ6 F;  4B45 A;  1VQP F;  3JAT A;  4X1I B;  4B46 A;  1KNJ A;  3CG6 A;  4TV8 A;  4C8G A;  2VAM A;  4TV9 B;  3WXM B;  3RYC A;  4DRX A;  1GX1 A;  4PWT A;  1U3P A;  4HNA B;  1SA0 B;  3HKD A;  5IT9 M;  3HKC B;  1GO0 A;  4WBN B;  1X25 A;  1VQ9 F;  5KX5 A;  3VIU A;  2HX0 A;  2H8E A;  3C9U A;  1IV2 A;  3TD4 A;  2BTU A;  3MBM A;  1YJ9 F;  3LWP C;  5FNV A;  3AGK A;  3UT5 A;  1SDS A;  2GVI A;  2GZL A;  1TVK A;  2BTO A;  2ZVZ A;  3O85 A;  4FFB A;  4LCK A;  4RHA A;  2RHO A;  1W40 A;  4RQO A;  2WAL A;  4BW0 B;  4O2B B;  1QU9 A;  3RYI B;  2G9I A;  3HWU A;  3CCL F;  3RYI A;  3FD5 A;  3VTI C;  3IEW A;  2CHS A;  1JN1 A;  3LWV C; 
#chains in the Genus database with same CATH homology
 3F0D A;  4C81 A;  1JY8 A;  3FBA A;  1IV2 A;  1U3L A;  1U43 A;  2AMT A;  3IEQ A;  3T80 A;  3MBM A;  3F6M A;  1W55 A;  1U40 A;  3FPI A;  1T0A A;  1KNK A;  3IKF A;  3KE1 A;  1IV1 A;  3ELC A;  3IKE A;  2GZL A;  3RE3 A;  2PMP A;  1IV4 A;  1YQN A;  1KNJ A;  3P0Z A;  1W57 A;  1H47 A;  3F0G A;  1VH8 A;  3P10 A;  3Q8H A;  3K14 A;  4C8G A;  1IV3 A;  2UZH A;  5B8F A;  3JVH A;  1H48 A;  1GX1 A;  4C8E A;  3EOR A;  3ERN A;  1U3P A;  3F0F A;  4C8I A;  3ESJ A;  3B6N A;  3K2X A;  3GHZ A;  3QHD A;  1VHA A;  3F0E A;  3IEW A;  1JN1 A;  4C82 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...